>gi|26553568|ref|NP_757502.1| 30S ribosomal protein S6 [Mycoplasma penetrans HF-2] >gi|32171557|sp|Q8EWT7|RS6_MYCPE 30S ribosomal protein S6 >gi|26453574|dbj|BAC43906.1| ribosomal protein S6 [Mycoplasma penetrans HF-2] (145 aa)
Score = 604, Expect = 2.2e-61, Identities = 145/145 (100%), Positives = 145/145 (100%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRIKEQVLAEQEKIRKERDNTPVKLTDV 145
           MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRIKEQVLAEQEKIRKERDNTPVKLTDV
  S:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRIKEQVLAEQEKIRKERDNTPVKLTDV 145
>gi|13358118|ref|NP_078392.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167971291|ref|ZP_02553568.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168281887|ref|ZP_02689554.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308036|ref|ZP_02690711.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762224|ref|YP_001752638.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|189045593|sp|B1AJJ4|RS6_UREP2 30S ribosomal protein S6 >gi|13959537|sp|Q9PPT6|RS6_UREPA 30S ribosomal protein S6 >gi|11357046|pir||C82875 ribosomal protein S6 UU554 [imported] - Ureaplasma urealyticum >gi|6899560|gb|AAF30967.1|AE002154_3 ribosomal protein S6 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827801|gb|ACA33063.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902615|gb|EDT48904.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675944|gb|EDT87849.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701168|gb|EDU19450.1| 30S ribosomal protein S6 [Ureaplasma parvum serovar 6 str. ATCC 27818] (160 aa)
Score = 253, Expect = 1.2e-20, Identities = 65/134 (48%), Positives = 90/134 (67%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRIKEQVLAEQEKIRKE 134
           M KYEIMLVV G +++ +A  VAN+LK+ LK +   +    G++ LAY INK    Y Y++NF   D + I EFRR+ ++ K VLRH+IINLEKDYGYKA  N KK+ R++ RAE Y R KE+  AE+  + ++
  S:     1 MAKYEIMLVVRGDLDQEQANKVANELKATLKNTEVKENNYDGVQQLAYEINKLKTAYRYVYNFETTDVSLINEFRRLAIINKNVLRHIIINLEKDYGYKATVNTKKVQRNEKRAEVYARQKEE--AERRAVERQ 132
>gi|167940729|ref|ZP_02527804.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 8] >gi|167958956|ref|ZP_02546028.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167973252|ref|ZP_02555529.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167974088|ref|ZP_02556365.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|167975516|ref|ZP_02557793.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|167988274|ref|ZP_02569945.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|168337926|ref|ZP_02694541.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 10] >gi|168362595|ref|ZP_02695774.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|168808138|ref|ZP_02829197.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 2] >gi|195867987|ref|ZP_03079983.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903342|gb|EDT49631.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184208983|gb|EDU06026.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019152|gb|EDU57192.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998246|gb|EDU67343.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659855|gb|EDX53235.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660321|gb|EDX53582.1| 30S ribosomal protein S6 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (160 aa)
Score = 251, Expect = 2.1e-20, Identities = 62/121 (51%), Positives = 82/121 (67%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRIK 121
           M KYEIMLVV G +++ +A  VAN+LK+ LK +   +    G++ LAY INK    Y Y++NF   D + I EFRR+ ++ K VLRH+IINLEKDYGYKA  N KK+ R++ RAE Y R K
  S:     1 MAKYEIMLVVRGDLDQEQANKVANELKATLKNTEVKENNYEGVQQLAYEINKLKTAYRYVYNFETTDVSLINEFRRLAIINKNVLRHIIINLEKDYGYKATVNAKKVQRNEKRAEVYVRQK 121
>gi|12044942|ref|NP_072752.1| 30S ribosomal protein S6 [Mycoplasma genitalium G37] >gi|1351004|sp|P47336|RS6_MYCGE 30S ribosomal protein S6 >gi|3844677|gb|AAC71308.1| ribosomal protein S6 [Mycoplasma genitalium G37] >gi|166078987|gb|ABY79605.1| ribosomal protein S6 [synthetic Mycoplasma genitalium JCVI-1.0] (208 aa)
Score = 207, Expect = 2.4e-15, Identities = 48/117 (41%), Positives = 74/117 (63%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRI 120
           Y I+L+VDG++   +A  V    + +L+K+T+ K E +GLK+LAYPI K+   +YY ++F+ E   + +EF+R   + K+++R LIIN EKDYGY    NPKK   S  +  +Y  I
  S:     3 YNIILLVDGTLSLEQANQVEQKHQKLLEKATEFKSEYLGLKELAYPIKKQLSAHYYRWSFHGESNCT-KEFKRAANINKQIIRELIINREKDYGYLGSVNPKKQQLSLQKLTKYNEI 118
>gi|66880321|ref|ZP_00405303.1| COG0360: Ribosomal protein S6 [Mycoplasma genitalium G-37] (157 aa)
Score = 204, Expect = 4.9e-15, Identities = 48/117 (41%), Positives = 74/117 (63%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRI 120
           Y I+L+VDG++   +A  V    + +L+K+T+ K E +GLK+LAYPI K+   +YY ++F+ E   + +EF+R   + K+++R LIIN EKDYGY    NPKK   S  +  +Y  I
  S:     3 YNIILLVDGTLSLEQANQVEQKHQKLLEKATEFKSEYLGLKELAYPIKKQLSAHYYRWSFHGESNCT-KEFKRAANINKQIIRELIINREKDYGYLGSVNPKKQQLSLQKLTKYNEI 118
>gi|31544819|ref|NP_853397.1| 30S ribosomal protein S6 [Mycoplasma gallisepticum R] >gi|61215679|sp|Q7NAM1|RS6_MYCGA 30S ribosomal protein S6 >gi|31541665|gb|AAP56965.1| RpsF [Mycoplasma gallisepticum R] (191 aa)
Score = 197, Expect = 3.9e-14, Identities = 49/124 (39%), Positives = 80/124 (64%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRIKEQV 124
           M KYEIML+V G + +++A AV ++LK++  K T++  E +G K L YPI K+   +Y+   F   D  S+ E++R+  ++ +VLR LI+N EK++GY+A  N KK+  ++ +  RY  I +QV
  S:     1 MAKYEIMLMVSGQLNQNQAQAVNDELKAVFGK-TEITEEYLGQKTLEYPIKKEVTAHYFNL-FLTSDGKSVHEYKRLASIRTDVLRILILNTEKEFGYRASQNAKKVALAKQKQARYNDIMKQV 122
>gi|13507967|ref|NP_109916.1| 30S ribosomal protein S6 [Mycoplasma pneumoniae M129] >gi|2500412|sp|P75543|RS6_MYCPN 30S ribosomal protein S6 >gi|1674305|gb|AAB96251.1| ribosomal protein S6 [Mycoplasma pneumoniae M129] (215 aa)
Score = 191, Expect = 1.6e-13, Identities = 48/118 (40%), Positives = 71/118 (60%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRI 120
           +Y I+L+VDGS+   +A  V    +  L     L+ E +GLK+LAYPI K+   +YY + F + D  S ++F+R   + K+VLR LIINLE++YGY A  NPKK   +  +  +Y  I
  S:     2 QYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYLGLKELAYPIKKQLSAHYYRWKF-SGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKKQQLALQKRAKYDEI 118
>gi|171853616|emb|CAM11487.1| 30S ribosomal protein S6 [Candidatus Phytoplasma australiense] (93 aa)
Score = 140, Expect = 1.4e-07, Identities = 36/90 (40%), Positives = 59/90 (65%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYEIM ++  +++ ++   + + L+S+  K  ST L+ +++GLKDLAYPIN   +GYYY F     D  ++ EF R+  + +EV+R +II
  S:     1 MKKYEIMYILRPNLDNNEVKKINDHLESVFSKKPSTILEKKEIGLKDLAYPINNHKKGYYYWF-ITQTDNEAVLEFNRIVKITEEVIRFIII 91
>gi|160944122|ref|ZP_02091352.1| hypothetical protein FAEPRAM212_01624 [Faecalibacterium prausnitzii M21/2] >gi|158444798|gb|EDP21802.1| hypothetical protein FAEPRAM212_01624 [Faecalibacterium prausnitzii M21/2] (94 aa)
Score = 129, Expect = 2.8e-06, Identities = 32/94 (34%), Positives = 55/94 (58%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYE ML+   +++E  + A+    KS+++ +  +  +++ G + LAYPIN +  G Y + NF +E P+   E  RV  + + V+R LII  E+
  S:     1 MAKYETMLITSAALDEEASAALVGKFKSLIEANGTIDSIDEWGKRRLAYPINDEEEGVYTVINFTSE-PSFPAELDRVYKITEGVMRSLIIAHEE 94
>gi|193216924|ref|YP_002000166.1| ribosomal protein S6 [Mycoplasma arthritidis 158L3-1] >gi|193002247|gb|ACF07462.1| ribosomal protein S6 [Mycoplasma arthritidis 158L3-1] (160 aa)
Score = 128, Expect = 3.9e-06, Identities = 48/123 (39%), Positives = 67/123 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRIKEQ 123
           M  YEIM++ +    +S    V+  L S+LKKS D K+EK+   +LAYPI+K +R  YYL      DP  + E  R   + K +LR LIINL+ + G K    P+K+ R   RA+   R   Q
  S:     1 MSNYEIMILAN---PDSTLEQVSELLFSVLKKS-DTKIEKLERSELAYPIHKLTRATYYLVTV-KSDPQLMAELTRKLNIAKFILRSLIINLDSEKGLK----PRKVKRFIPRAKNNDRSANQ 114
>gi|110003928|emb|CAK98268.1| putative 30s ribosomal protein s6 [Spiroplasma citri] (149 aa)
Score = 126, Expect = 5.4e-06, Identities = 47/130 (36%), Positives = 74/130 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLE--KMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKT----------NPKKIVRSQFRAERYKRIKEQVLAEQEK 130
           M KYEIM +++   E +    + + L  IL+ +     E  K G+KDL YPI KK++GYY +    N    +I EF R++ ++++VLR L+IN EK+ GY   T           P +  +   R   YKR +++   E+ K
  S:     1 MRKYEIMYILNP--EATNLDELESKLHQILEANGGKIEEHGKWGIKDLVYPIKKKTKGYYGVL-IVNTTSVNIDEFVRISHIEQDVLRILVINTEKEKGYIQSTVYAKTEVKNDKPDRDRKPGNRKPDYKRHEQRSEGEETK 139
>gi|15675658|ref|NP_269832.1| 30S ribosomal protein S6 [Streptococcus pyogenes M1 GAS] >gi|19746764|ref|NP_607900.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS8232] >gi|21911118|ref|NP_665386.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS315] >gi|28895197|ref|NP_801547.1| 30S ribosomal protein S6 [Streptococcus pyogenes SSI-1] >gi|50914913|ref|YP_060885.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS10394] >gi|71904204|ref|YP_281007.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS6180] >gi|71911368|ref|YP_282918.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS5005] >gi|94989190|ref|YP_597291.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS9429] >gi|94991131|ref|YP_599231.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS10270] >gi|94993077|ref|YP_601176.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS2096] >gi|139473171|ref|YP_001127886.1| 30S ribosomal protein S6 [Streptococcus pyogenes str. Manfredo] >gi|166227389|sp|Q1JA29|RS6_STRPB 30S ribosomal protein S6 >gi|166227390|sp|Q1JK76|RS6_STRPC 30S ribosomal protein S6 >gi|166227391|sp|Q1JF72|RS6_STRPD 30S ribosomal protein S6 >gi|166227392|sp|A2RCR4|RS6_STRPG 30S ribosomal protein S6 >gi|54039535|sp|P66600|RS6_STRP3 30S ribosomal protein S6 >gi|54039536|sp|P66601|RS6_STRP8 30S ribosomal protein S6 >gi|54041978|sp|P66599|RS6_STRP1 30S ribosomal protein S6 >gi|61216147|sp|Q5XA61|RS6_STRP6 30S ribosomal protein S6 >gi|91207794|sp|Q48RK8|RS6_STRPM 30S ribosomal protein S6 >gi|13622870|gb|AAK34553.1| 30S ribosomal protein S6 [Streptococcus pyogenes M1 GAS] >gi|19748995|gb|AAL98399.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS8232] >gi|21905328|gb|AAM80189.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS315] >gi|28810443|dbj|BAC63380.1| 30S ribosomal protein S6 [Streptococcus pyogenes SSI-1] >gi|50903987|gb|AAT87702.1| SSU ribosomal protein S6P [Streptococcus pyogenes MGAS10394] >gi|71803299|gb|AAX72652.1| SSU ribosomal protein S6P [Streptococcus pyogenes MGAS6180] >gi|71854150|gb|AAZ52173.1| SSU ribosomal protein S6P [Streptococcus pyogenes MGAS5005] >gi|94542698|gb|ABF32747.1| SSU ribosomal protein S6P [Streptococcus pyogenes MGAS9429] >gi|94544639|gb|ABF34687.1| SSU ribosomal protein S6P [Streptococcus pyogenes MGAS10270] >gi|94546585|gb|ABF36632.1| SSU ribosomal protein S6P [Streptococcus pyogenes MGAS2096] >gi|134271417|emb|CAM29637.1| 30S ribosomal protein S6 [Streptococcus pyogenes str. Manfredo] (96 aa)
Score = 124, Expect = 1.1e-05, Identities = 31/93 (33%), Positives = 53/93 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYEI+ ++  +IEE    A+     SIL    +T ++ +    + LAY IN    G Y++ N    D A++ EF R++ +  ++LRH+I+ L+
  S:     1 MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEINDFREGLYHIVNLEATDAAALNEFDRLSKINGDILRHMIVKLD 95
>gi|118444568|ref|YP_876989.1| 30S ribosomal protein S6 [Clostridium novyi NT] >gi|166226824|sp|A0PX87|RS6_CLONN 30S ribosomal protein S6 >gi|118135024|gb|ABK62068.1| ribosomal protein S6 [Clostridium novyi NT] (95 aa)
Score = 124, Expect = 1.1e-05, Identities = 31/94 (32%), Positives = 53/94 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE + +++ S++E    A     K +++K   +   +++ G + LAYPINK + GYY L NF   +P   +E  RV  +   V+R +++N EK
  S:     1 MRNYETLFILNPSLDEEATKAAIEKFKGVIEKEGGVVENVDEWGRRKLAYPINKVNEGYYTLINF-KANPELPRELERVFRITDGVMRFMVVNPEK 95
>gi|134301137|ref|YP_001114633.1| 30S ribosomal protein S6 [Desulfotomaculum reducens MI-1] >gi|189045464|sp|A4J9Q5|RS6_DESRM 30S ribosomal protein S6 >gi|134053837|gb|ABO51808.1| SSU ribosomal protein S6P [Desulfotomaculum reducens MI-1] (95 aa)
Score = 123, Expect = 1.2e-05, Identities = 36/90 (40%), Positives = 52/90 (57%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YE+M ++   +EE K TA+    KS++  K +   KL+K G + LAY INK   G Y L  F  E PA+  E  RV  +  +++RH+II
  S:     1 MRNYEVMYIIKPEVEEEKVTALMEKFKSVVEEKGAEVTKLDKWGKRRLAYEINKIKEGIYVLMQFKAE-PAASAELDRVMKINDDIVRHMII 91
>gi|91207900|sp|Q5PBN1|RS6_ANAMM 30S ribosomal protein S6 (109 aa)
Score = 122, Expect = 1.9e-05, Identities = 30/94 (31%), Positives = 53/94 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE   +    + + +   ++  L ++L K  +  +K E  GL D AY I K ++G+Y +  +   +PA++ EFRR   L ++VLR L + ++K
  S:     1 MPIYEFAFIAQQGLTQYELEGLSKGLSALLVKIGAELVKYEYWGLLDFAYSIAKNNKGHYCMM-YIRAEPAAMDEFRRRVRLNEDVLRFLCLKVDK 95
>gi|168187293|ref|ZP_02621928.1| ribosomal protein S6 [Clostridium botulinum C str. Eklund] >gi|169294825|gb|EDS76958.1| ribosomal protein S6 [Clostridium botulinum C str. Eklund] (95 aa)
Score = 121, Expect = 2.2e-05, Identities = 30/94 (31%), Positives = 53/94 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE + +++ S++E    A     K ++++   +   +++ G + LAYPINK + GYY L NF   +P   +E  RV  +   V+R +++N EK
  S:     1 MRNYETLFILNPSLDEEATKAAIEKFKGVIEREGGVVENVDEWGRRKLAYPINKINEGYYTLINF-KANPELPRELERVFRITDGVMRFMVVNPEK 95
>gi|162447063|ref|YP_001620195.1| small subunit ribosomal protein S6 [Acholeplasma laidlawii PG-8A] >gi|189045451|sp|A9NEN9|RS6_ACHLI 30S ribosomal protein S6 >gi|161985170|gb|ABX80819.1| small subunit ribosomal protein S6 [Acholeplasma laidlawii PG-8A] (95 aa)
Score = 121, Expect = 2.4e-05, Identities = 29/88 (32%), Positives = 55/88 (62%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHL 88
           M KYE+M + +  ++  K   +  +L +++  +  + L L+++GLKDLAY INK  +G YY++      P +I E++RV  + + V+R++
  S:     1 MRKYELMYIANPQLDPEKLKGLVANLSNVITSNGGSVLSLKEIGLKDLAYEINKHRKG-YYVWMLVEASPEAIAEYKRVVNITESVIRNI 89
>gi|195977487|ref|YP_002122731.1| 30S ribosomal protein S6 RpsF [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974192|gb|ACG61718.1| 30S ribosomal protein S6 RpsF [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (96 aa)
Score = 120, Expect = 2.8e-05, Identities = 30/93 (32%), Positives = 52/93 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYEI+ ++  +IEE    A+     SIL    +T ++ +    + LAY IN    G Y++ N    D  ++ EF R++ +  ++LRH+I+ L+
  S:     1 MAKYEILYIIRPNIEEEAKNALVARFDSILTNNGATIVESKDWEKRRLAYEINDFREGLYHIVNLEATDAVALNEFDRLSKINGDILRHMIVKLD 95
>gi|56416479|ref|YP_153553.1| 30S ribosomal protein S6 [Anaplasma marginale str. St. Maries] >gi|56387711|gb|AAV86298.1| 30S ribosomal protein S6 [Anaplasma marginale str. St. Maries] (127 aa)
Score = 119, Expect = 3.8e-05, Identities = 29/94 (30%), Positives = 53/94 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           +P YE   +    + + +   ++  L ++L K  +  +K E  GL D AY I K ++G+Y +  +   +PA++ EFRR   L ++VLR L + ++K
  S:    19 VPIYEFAFIAQQGLTQYELEGLSKGLSALLVKIGAELVKYEYWGLLDFAYSIAKNNKGHYCMM-YIRAEPAAMDEFRRRVRLNEDVLRFLCLKVDK 113
>gi|54020446|ref|YP_115819.1| 30S ribosomal protein S6 [Mycoplasma hyopneumoniae 232] >gi|81378667|sp|Q600Z6|RS6_MYCH2 30S ribosomal protein S6 >gi|53987619|gb|AAV27820.1| 30s ribosomal protein S6 [Mycoplasma hyopneumoniae 232] (241 aa)
Score = 118, Expect = 4.5e-05, Identities = 35/101 (34%), Positives = 57/101 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAK 101
           MPKYEIM ++D    +++   + N LK++   ++  KL K+   +LAYPI K     Y+L +  N     I+EF R   + +E+ R+LI+NL+ + G   K
  S:     1 MPKYEIMTILD---PKAEMAIIDNLLKTVFGDNSTEKLRKLETTNLAYPIRKSKIAQYFLVDL-NAPTNLIEEFVRRANITREIWRYLIVNLDSEKGLNKK 97
>gi|192809478|ref|ZP_03038153.1| ribosomal protein S6 [Geobacillus sp. Y412MC10] >gi|192802149|gb|EDV78654.1| ribosomal protein S6 [Geobacillus sp. Y412MC10] (94 aa)
Score = 118, Expect = 5.6e-05, Identities = 32/91 (35%), Positives = 48/91 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIIN 91
           M KYE+M ++   IE+    A  +  + I+    ++ K + MG + LAY I K   G Y L NF N  P  + E  R+  +  EV+R+LI N
  S:     1 MRKYEVMYIIRPDIEQEAVQAAVDKFQGIISNGGEITKHDVMGKRRLAYEIKKFRDGVYVLVNF-NATPEVVAELERLMKISDEVIRYLITN 91
>gi|22537853|ref|NP_688704.1| 30S ribosomal protein S6 [Streptococcus agalactiae 2603V/R] >gi|25011798|ref|NP_736193.1| 30S ribosomal protein S6 [Streptococcus agalactiae NEM316] >gi|76788641|ref|YP_330323.1| 30S ribosomal protein S6 [Streptococcus agalactiae A909] >gi|76798958|ref|ZP_00781159.1| ribosomal protein S6 [Streptococcus agalactiae 18RS21] >gi|77406980|ref|ZP_00783996.1| ribosomal protein S6 [Streptococcus agalactiae H36B] >gi|77412640|ref|ZP_00788916.1| ribosomal protein S6 [Streptococcus agalactiae CJB111] >gi|77413667|ref|ZP_00789851.1| ribosomal protein S6 [Streptococcus agalactiae 515] >gi|54039534|sp|P66598|RS6_STRA5 30S ribosomal protein S6 >gi|54041977|sp|P66597|RS6_STRA3 30S ribosomal protein S6 >gi|91207793|sp|Q3JZI0|RS6_STRA1 30S ribosomal protein S6 >gi|22534748|gb|AAN00577.1|AE014269_21 ribosomal protein S6 [Streptococcus agalactiae 2603V/R] >gi|24413339|emb|CAD47418.1| 30S ribosomal protein S6 [Streptococcus agalactiae NEM316] >gi|76563698|gb|ABA46282.1| ribosomal protein S6 [Streptococcus agalactiae A909] >gi|76585679|gb|EAO62236.1| ribosomal protein S6 [Streptococcus agalactiae 18RS21] >gi|77160267|gb|EAO71394.1| ribosomal protein S6 [Streptococcus agalactiae 515] >gi|77161312|gb|EAO72347.1| ribosomal protein S6 [Streptococcus agalactiae CJB111] >gi|77174404|gb|EAO77257.1| ribosomal protein S6 [Streptococcus agalactiae H36B] (95 aa)
Score = 118, Expect = 5.6e-05, Identities = 29/93 (31%), Positives = 53/93 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYEI+ ++  +IEE    A+     SIL    +T ++ +    + LAY I   + G Y++ N   ED  ++ EF R++ +  ++LRH+I+ ++
  S:     1 MAKYEILYIIRPNIEEEAKNALVARFDSILSDNGATVVESKDWEKRRLAYEIQDFTEGLYHIVNVEAEDAVALNEFDRLSKINGDILRHMIVKVD 95
>gi|169351668|ref|ZP_02868606.1| hypothetical protein CLOSPI_02449 [Clostridium spiroforme DSM 1552] >gi|169291890|gb|EDS74023.1| hypothetical protein CLOSPI_02449 [Clostridium spiroforme DSM 1552] (93 aa)
Score = 117, Expect = 6.4e-05, Identities = 31/90 (34%), Positives = 50/90 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYEIM +V   +EE     +  + K+IL  +  T   +++ GL+DLAY I    +GYY + +      A + EF R++ +   +LRHL +
  S:     1 MNKYEIMFIVKPDVEEEARNTLIENFKNILTANGGTVDNVDEWGLRDLAYEIQDFKKGYYVVVD-TTCTAADVAEFERLSNINSSMLRHLTL 91
>gi|72080634|ref|YP_287692.1| 30S ribosomal protein S6 [Mycoplasma hyopneumoniae 7448] >gi|91207920|sp|Q4A870|RS6_MYCH7 30S ribosomal protein S6 >gi|71913758|gb|AAZ53669.1| 30S ribosomal protein S6 [Mycoplasma hyopneumoniae 7448] (241 aa)
Score = 117, Expect = 6.5e-05, Identities = 35/101 (34%), Positives = 56/101 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAK 101
           MPKYEIM ++D    +++   + N LK++   ++  KL K+   +LAYPI K     Y+L    N     I+EF R   + +E+ R+LI+NL+ + G   K
  S:     1 MPKYEIMTILD---PKAEMAIIDNLLKTVFGDNSTEKLRKLETTNLAYPIRKSKIAQYFLVEL-NAPTNLIEEFVRRANITREIWRYLIVNLDSEKGLNKK 97
>gi|167755262|ref|ZP_02427389.1| hypothetical protein CLORAM_00767 [Clostridium ramosum DSM 1402] >gi|167705312|gb|EDS19891.1| hypothetical protein CLORAM_00767 [Clostridium ramosum DSM 1402] (93 aa)
Score = 117, Expect = 7.1e-05, Identities = 31/90 (34%), Positives = 49/90 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYEIM +V   +E+    A+    K IL  +  T   +++ GL+DLAY I    +GYY + +      A + EF R++ +   +LRHL +
  S:     1 MNKYEIMFIVKPDVEDDARNALIESFKGILTANGGTVDNVDEWGLRDLAYEIKDYKKGYYVVVD-ATCTAADVAEFERLSNINASMLRHLTL 91
>gi|125717304|ref|YP_001034437.1| 30S ribosomal protein S6 [Streptococcus sanguinis SK36] >gi|166227394|sp|A3CL32|RS6_STRSV 30S ribosomal protein S6 >gi|125497221|gb|ABN43887.1| 30S ribosomal protein S6, putative [Streptococcus sanguinis SK36] (96 aa)
Score = 116, Expect = 7.9e-05, Identities = 30/93 (32%), Positives = 53/93 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYEI+ ++  +IEE    A+     SIL    +T ++ +    + LAY I     G Y++ N    D A+++EF R++ +  ++LRH+I+ L+
  S:     1 MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIQDFREGLYHIVNVEANDDAALKEFDRLSKINADILRHMIVKLD 95
>gi|73667309|ref|YP_303325.1| 30S ribosomal protein S6 [Ehrlichia canis str. Jake] >gi|91207915|sp|Q3YRC8|RS6_EHRCJ 30S ribosomal protein S6 >gi|72394450|gb|AAZ68727.1| SSU ribosomal protein S6P [Ehrlichia canis str. Jake] (109 aa)
Score = 116, Expect = 8.8e-05, Identities = 31/94 (32%), Positives = 51/94 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE   +    + + +   +   L S+L K+    LK E  GL D AY I+K ++G+Y +  +    P+S+ EF+R   L ++VLR L +  +K
  S:     1 MPLYEFTFIAQQGLTQYELEGLVKGLSSLLTKNGAELLKYEYWGLLDFAYTIDKMNKGHYCMI-YIKATPSSMDEFKRKVRLNEDVLRFLCLKKDK 95
>gi|171779260|ref|ZP_02920231.1| hypothetical protein STRINF_01108 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282316|gb|EDT47743.1| hypothetical protein STRINF_01108 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (96 aa)
Score = 116, Expect = 9.1e-05, Identities = 30/93 (32%), Positives = 52/93 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYEI+ ++  +IEE    A+     SIL    +T ++ +    + LAY I     G Y++ N   ED  ++ EF R++ +  ++LRH+I+ L+
  S:     1 MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIKDFREGLYHVVNVEAEDAVALNEFDRLSKINGDILRHMIVKLD 95
>gi|160892969|ref|ZP_02073757.1| hypothetical protein CLOL250_00506 [Clostridium sp. L2-50] >gi|156865052|gb|EDO58483.1| hypothetical protein CLOL250_00506 [Clostridium sp. L2-50] (96 aa)
Score = 115, Expect = 1.1e-04, Identities = 35/95 (36%), Positives = 51/95 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKD 95
           M KYE+ LVV+  I+E   TA    +K+ ++K+  T   +E  GLK LAY I K    YYY   F  E     Q    V +++  VLR+L + L+ +
  S:     1 MNKYELTLVVNAKIDEDARTAAVEKVKAYIEKANATITNVEDCGLKKLAYEIQKMGEAYYYFIQFDAEADVPAQLEANVRIMEP-VLRYLCVRLDAE 96
>gi|163815609|ref|ZP_02206982.1| hypothetical protein COPEUT_01784 [Coprococcus eutactus ATCC 27759] >gi|158449246|gb|EDP26241.1| hypothetical protein COPEUT_01784 [Coprococcus eutactus ATCC 27759] (96 aa)
Score = 115, Expect = 1.1e-04, Identities = 36/95 (37%), Positives = 54/95 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNED--PASIQEFRRVTLLKKEVLRHLIINLEKD 95
           M KYE+ LVV   I+E   TAV + +KS ++K  +T   + + GLK LAY I K    YYY   F  +   PA ++   R+    + VLR+L + L+ +
  S:     1 MNKYELTLVVSAKIDEEARTAVVDKVKSYIEKANATITDVNECGLKKLAYEIQKMGEAYYYFIQFDADADVPAQLEANIRIM---ESVLRYLCVRLDAE 96
>gi|68171813|ref|ZP_00545151.1| Ribosomal protein S6 [Ehrlichia chaffeensis str. Sapulpa] >gi|88658444|ref|YP_507129.1| 30S ribosomal protein S6 [Ehrlichia chaffeensis str. Arkansas] >gi|123493682|sp|Q2GHF4|RS6_EHRCR 30S ribosomal protein S6 >gi|67998762|gb|EAM85476.1| Ribosomal protein S6 [Ehrlichia chaffeensis str. Sapulpa] >gi|88599901|gb|ABD45370.1| ribosomal protein S6 [Ehrlichia chaffeensis str. Arkansas] (109 aa)
Score = 115, Expect = 1.2e-04, Identities = 30/94 (31%), Positives = 51/94 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE   +    + + +   +   L S+L K+    LK E  GL D AY I+K ++G+Y +  +    P+S+ EF+R   L +++LR L +  +K
  S:     1 MPLYEFTFIAQQGLTQYELEGLVKGLSSLLTKNGAELLKYEYWGLLDFAYTIDKMNKGHYCMI-YIKATPSSMDEFKRKVRLNEDILRFLCLKKDK 95
>gi|171325306|ref|ZP_02913812.1| ribosomal protein S6 [Geobacillus sp. WCH70] >gi|171088730|gb|EDT35075.1| ribosomal protein S6 [Geobacillus sp. WCH70] (95 aa)
Score = 115, Expect = 1.2e-04, Identities = 30/94 (31%), Positives = 55/94 (58%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYEIM ++  ++++    AV +   +ILK++      +   G + LAY I K   G+Y + N  +E P ++QEF R+  +  +++RH+++  EK
  S:     1 MRKYEIMYIIRPNLDDEARQAVVDRFNNILKENGAEITNVTDWGKRRLAYEIKKYRDGHYMILNVVSE-PKAVQEFDRLARISDDIIRHIVVKEEK 95
>gi|23100934|ref|NP_694401.1| 30S ribosomal protein S6 [Oceanobacillus iheyensis HTE831] >gi|32171554|sp|Q8EKV4|RS6_OCEIH 30S ribosomal protein S6 >gi|22779169|dbj|BAC15435.1| 30S ribosomal protein S6 [Oceanobacillus iheyensis HTE831] (95 aa)
Score = 114, Expect = 1.3e-04, Identities = 34/94 (36%), Positives = 51/94 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYEIM ++   IEE   TA+     +IL  +     K+++ G + LAY IN    GYY + NF   + A I EF R+     +++RH+ I  E+
  S:     1 MRKYEIMYIIRPDIEEEAQTALIERFNTILTDNGAEIDKVDEKGKRRLAYEINDYRDGYYVIINFRGSEEA-INEFDRLAKFNDDIIRHMAIKDEQ 95
>gi|24380220|ref|NP_722175.1| 30S ribosomal protein S6 [Streptococcus mutans UA159] >gi|32171545|sp|Q8DSD7|RS6_STRMU 30S ribosomal protein S6 >gi|24378227|gb|AAN59481.1|AE015012_10 30S ribosomal protein S6 [Streptococcus mutans UA159] (96 aa)
Score = 114, Expect = 1.3e-04, Identities = 28/93 (30%), Positives = 52/93 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYEI+ ++  +IEE    A+     ++L    +T ++ +    + LAY I     G Y++ N   ED  ++ EF R++ +  ++LRH+I+ L+
  S:     1 MAKYEILYIIRPNIEEEAKNALVARFDAVLTDNGATIVESKDWEKRRLAYEIQDFREGLYHVINVETEDAHALNEFDRLSKINNDILRHMIVKLD 95
>gi|15901385|ref|NP_345989.1| 30S ribosomal protein S6 [Streptococcus pneumoniae TIGR4] >gi|15903439|ref|NP_358989.1| 30S ribosomal protein S6 [Streptococcus pneumoniae R6] >gi|111658384|ref|ZP_01409071.1| hypothetical protein SpneT_02000463 [Streptococcus pneumoniae TIGR4] >gi|116516740|ref|YP_816830.1| 30S ribosomal protein S6 [Streptococcus pneumoniae D39] >gi|148984889|ref|ZP_01818142.1| 30S ribosomal protein S6 [Streptococcus pneumoniae SP3-BS71] >gi|148992569|ref|ZP_01822237.1| 30S ribosomal protein S6 [Streptococcus pneumoniae SP9-BS68] >gi|148997395|ref|ZP_01825000.1| 30S ribosomal protein S6 [Streptococcus pneumoniae SP11-BS70] >gi|149003237|ref|ZP_01828133.1| 30S ribosomal protein S6 [Streptococcus pneumoniae SP14-BS69] >gi|149007546|ref|ZP_01831181.1| 30S ribosomal protein S6 [Streptococcus pneumoniae SP18-BS74] >gi|149011779|ref|ZP_01832975.1| 30S ribosomal protein S6 [Streptococcus pneumoniae SP19-BS75] >gi|149021815|ref|ZP_01835822.1| 30S ribosomal protein S6 [Streptococcus pneumoniae SP23-BS72] >gi|168488797|ref|ZP_02712996.1| ribosomal protein S6 [Streptococcus pneumoniae SP195] >gi|168491567|ref|ZP_02715710.1| ribosomal protein S6 [Streptococcus pneumoniae CDC0288-04] >gi|168493442|ref|ZP_02717585.1| ribosomal protein S6 [Streptococcus pneumoniae CDC3059-06] >gi|168575263|ref|ZP_02721226.1| ribosomal protein S6 [Streptococcus pneumoniae MLV-016] >gi|169833108|ref|YP_001694946.1| ribosomal protein S6 [Streptococcus pneumoniae Hungary19A-6] >gi|182684497|ref|YP_001836244.1| 30S ribosomal protein S6 [Streptococcus pneumoniae CGSP14] >gi|122278324|sp|Q04JK8|RS6_STRP2 30S ribosomal protein S6 >gi|54039537|sp|P66603|RS6_STRR6 30S ribosomal protein S6 >gi|54041979|sp|P66602|RS6_STRPN 30S ribosomal protein S6 >gi|14973031|gb|AAK75629.1| ribosomal protein S6 [Streptococcus pneumoniae TIGR4] >gi|15459047|gb|AAL00200.1| 30S Ribosomal protein S6 (S6) [Streptococcus pneumoniae R6] >gi|116077316|gb|ABJ55036.1| ribosomal protein S6 [Streptococcus pneumoniae D39] >gi|147756450|gb|EDK63491.1| 30S ribosomal protein S6 [Streptococcus pneumoniae SP11-BS70] >gi|147758697|gb|EDK65694.1| 30S ribosomal protein S6 [Streptococcus pneumoniae SP14-BS69] >gi|147760905|gb|EDK67875.1| 30S ribosomal protein S6 [Streptococcus pneumoniae SP18-BS74] >gi|147764210|gb|EDK71142.1| 30S ribosomal protein S6 [Streptococcus pneumoniae SP19-BS75] >gi|147922911|gb|EDK74027.1| 30S ribosomal protein S6 [Streptococcus pneumoniae SP3-BS71] >gi|147928586|gb|EDK79600.1| 30S ribosomal protein S6 [Streptococcus pneumoniae SP9-BS68] >gi|147930051|gb|EDK81038.1| 30S ribosomal protein S6 [Streptococcus pneumoniae SP23-BS72] >gi|168995610|gb|ACA36222.1| ribosomal protein S6 [Streptococcus pneumoniae Hungary19A-6] >gi|182629831|gb|ACB90779.1| 30S ribosomal protein S6 [Streptococcus pneumoniae CGSP14] >gi|183572796|gb|EDT93324.1| ribosomal protein S6 [Streptococcus pneumoniae SP195] >gi|183574214|gb|EDT94742.1| ribosomal protein S6 [Streptococcus pneumoniae CDC0288-04] >gi|183576305|gb|EDT96833.1| ribosomal protein S6 [Streptococcus pneumoniae CDC3059-06] >gi|183578693|gb|EDT99221.1| ribosomal protein S6 [Streptococcus pneumoniae MLV-016] (96 aa)
Score = 114, Expect = 1.4e-04, Identities = 29/93 (31%), Positives = 53/93 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYEI+ ++  +IEE    A+     SIL    +T ++ +    + LAY I     G Y++ N    D A+++EF R++ +  ++LRH+I+ ++
  S:     1 MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVNVEANDDAALKEFDRLSKINADILRHMIVKID 95
>gi|160916103|ref|ZP_02078310.1| hypothetical protein EUBDOL_02130 [Eubacterium dolichum DSM 3991] >gi|158431827|gb|EDP10116.1| hypothetical protein EUBDOL_02130 [Eubacterium dolichum DSM 3991] (97 aa)
Score = 114, Expect = 1.5e-04, Identities = 28/95 (29%), Positives = 54/95 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILK--KSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKD 95
           M KYEIM +V+ S++E+ +  V + L  I+   + T   ++  G+K+ AY I   ++G+Y + N    +   I EF R+  +   V+R++++  E +
  S:     1 MKKYEIMYIVNASLDEAASQKVMDSLHKIITDHEGTIDNVDDWGVKEFAYEIKHMNKGHYVVINV-TANNEGIHEFERLARINPNVVRYMVVKTEAE 96
>gi|148988587|ref|ZP_01820020.1| 30S ribosomal protein S6 [Streptococcus pneumoniae SP6-BS73] >gi|147925788|gb|EDK76863.1| 30S ribosomal protein S6 [Streptococcus pneumoniae SP6-BS73] (96 aa)
Score = 114, Expect = 1.6e-04, Identities = 29/93 (31%), Positives = 53/93 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYEI+ ++  +IEE    A+     SIL    +T ++ +    + LAY I     G Y++ N    D A+++EF R++ +  ++LRH+I+ ++
  S:     1 MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVNVKANDDAALKEFDRLSKINADILRHMIVKID 95
>gi|196249875|ref|ZP_03148571.1| ribosomal protein S6 [Geobacillus sp. G11MC16] >gi|196210751|gb|EDY05514.1| ribosomal protein S6 [Geobacillus sp. G11MC16] (95 aa)
Score = 113, Expect = 1.8e-04, Identities = 30/94 (31%), Positives = 54/94 (57%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYEIM ++  ++++    AV     ++LK+  +    +   G + LAY I K   GYY + N   E P ++QEF R+  + ++++RH+++  EK
  S:     1 MRKYEIMYIIRPNMDDEARQAVVERFNNVLKEKGAEITNVTDWGKRRLAYEIEKYRDGYYMILNVMAE-PQAVQEFDRLARISEDIIRHIVVKEEK 95
>gi|124520274|ref|ZP_01695457.1| ribosomal protein S6 [Bacillus coagulans 36D1] >gi|124497764|gb|EAY45317.1| ribosomal protein S6 [Bacillus coagulans 36D1] (95 aa)
Score = 113, Expect = 1.9e-04, Identities = 28/94 (29%), Positives = 56/94 (59%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYEIM ++  +IE+    A+     ++L  + +  ++ ++ G + LAY I     GYY++ N  N +P ++QEF R+  +  +++RH+++  E+
  S:     1 MRKYEIMYIIRPNIEDEAKKALVERFDNVLNNQGAEIIESKEWGKRRLAYEIQDFRDGYYHIINV-NAEPVAVQEFDRLAKINGDIIRHIVVREEE 95
>gi|67921027|ref|ZP_00514546.1| Ribosomal protein S6 [Crocosphaera watsonii WH 8501] >gi|67857144|gb|EAM52384.1| Ribosomal protein S6 [Crocosphaera watsonii WH 8501] (111 aa)
Score = 113, Expect = 2.1e-04, Identities = 31/90 (34%), Positives = 48/90 (53%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           YE++ ++   + E +     N  K  L    +T+L+++  G + LAYPI KK  G Y  FN Y  D   I    R+  L +EV+R+L I L+
  S:     5 YEMIFILRPDLSEDQVNQALNSYKEFLTTNNATNLEVKIWGKRRLAYPIQKKVDGIYVQFN-YEADGTQIAPLERMMRLGEEVMRYLTIRLD 95
>gi|20809110|ref|NP_624281.1| 30S ribosomal protein S6 [Thermoanaerobacter tengcongensis MB4] >gi|24212292|sp|Q8R6M1|RS6_THETN 30S ribosomal protein S6 >gi|20517788|gb|AAM25885.1| Ribosomal protein S6 [Thermoanaerobacter tengcongensis MB4] (95 aa)
Score = 113, Expect = 2.1e-04, Identities = 33/90 (36%), Positives = 47/90 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YE M V+   + E +   +    K+++  +       ++ G + LAYPI KKS GYY L NF N  P   +E  RV  +   VLR+LII
  S:     1 MRSYETMYVLSPDLNEEERKGLIERFKNLIVERGGEITNFDEWGKRKLAYPIQKKSEGYYVLMNF-NSSPDVSRELERVYRITDGVLRYLII 91
>gi|161611280|ref|YP_140168.2| 30S ribosomal protein S6 [Streptococcus thermophilus LMG 18311] >gi|161936363|ref|YP_142087.2| 30S ribosomal protein S6 [Streptococcus thermophilus CNRZ1066] >gi|91207795|sp|Q5LY48|RS6_STRT1 30S ribosomal protein S6 >gi|91207796|sp|Q5M2Q3|RS6_STRT2 30S ribosomal protein S6 (96 aa)
Score = 113, Expect = 2.1e-04, Identities = 29/93 (31%), Positives = 51/93 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYEI+ ++  +IEE    A+     SIL    +T ++ +    + LAY I     G Y++ N    D  ++ EF R++ +  ++LRH+I+ L+
  S:     1 MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIQDFREGLYHVVNVEANDATALNEFDRLSKINGDILRHMIVKLD 95
>gi|116628446|ref|YP_821065.1| 30S ribosomal protein S6 [Streptococcus thermophilus LMD-9] >gi|122266959|sp|Q03IV3|RS6_STRTD 30S ribosomal protein S6 >gi|116101723|gb|ABJ66869.1| SSU ribosomal protein S6P [Streptococcus thermophilus LMD-9] (96 aa)
Score = 112, Expect = 2.2e-04, Identities = 29/93 (31%), Positives = 51/93 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYEI+ ++  +IEE    A+     SIL    +T ++ +    + LAY I     G Y++ N    D  ++ EF R++ +  ++LRH+I+ L+
  S:     1 MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIQDFREGIYHVVNVEANDATALNEFDRLSKINGDILRHMIVKLD 95
>gi|75763192|ref|ZP_00742957.1| SSU ribosomal protein S6P [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74489324|gb|EAO52775.1| SSU ribosomal protein S6P [Bacillus thuringiensis serovar israelensis ATCC 35646] (113 aa)
Score = 112, Expect = 2.2e-04, Identities = 28/94 (29%), Positives = 51/94 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYEIM ++   +EE    A+      +L  +    +  ++ G + LAY IN    G+Y + N  N +  +I EF R+  + +++LRH+++  E+
  S:    18 MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNV-NSNAEAINEFDRLAKINEDILRHIVVKEEE 112
>gi|157149860|ref|YP_001451147.1| 30S ribosomal protein S6 [Streptococcus gordonii str. Challis substr. CH1] >gi|189045592|sp|A8AZD7|RS6_STRGC 30S ribosomal protein S6 >gi|157074654|gb|ABV09337.1| ribosomal protein S6 [Streptococcus gordonii str. Challis substr. CH1] (96 aa)
Score = 112, Expect = 2.3e-04, Identities = 29/93 (31%), Positives = 52/93 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYEI+ ++  +IEE    A+     SIL    +T ++ +    + LAY I     G Y++ N    D  +++EF R++ +  ++LRH+I+ L+
  S:     1 MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIQDFREGLYHIVNVEANDDVALKEFDRLSKINADILRHMIVKLD 95
>gi|73663682|ref|YP_302463.1| 30S ribosomal protein S6 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|82581625|sp|Q49UQ0|RS6_STAS1 30S ribosomal protein S6 >gi|72496197|dbj|BAE19518.1| 30S ribosomal protein S6 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (101 aa)
Score = 112, Expect = 2.3e-04, Identities = 31/95 (32%), Positives = 50/95 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKD 95
           M  YE+M ++  +IEE    AV      IL    S  L+ +  G + LAY IN  S GYY +      D  +  EF+R+  +  +V+R+++I  ++D
  S:     1 MRTYEVMYIIRPNIEEDAKKAVVERFNGILASHGSEVLEAKDWGKRRLAYEINDFSEGYYNIVRIQTADNEATDEFQRLAKISDDVIRYIVIREDED 97
>gi|158319094|ref|YP_001511601.1| ribosomal protein S6 [Alkaliphilus oremlandii OhILAs] >gi|167011242|sp|A8MED4|RS6_ALKOO 30S ribosomal protein S6 >gi|158139293|gb|ABW17605.1| ribosomal protein S6 [Alkaliphilus oremlandii OhILAs] (94 aa)
Score = 112, Expect = 2.4e-04, Identities = 32/94 (34%), Positives = 54/94 (57%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLK-LEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYE++ ++  ++EE K   + +  + I++    ++ +++ G + LAY INK + GYY L NF        +E  R   +  EV+RH+II LEK
  S:     1 MNKYELVYILKSNVEEEKRNQLLDKFRGIIEADGTIENVDEWGNRRLAYEINKINEGYYTLVNFSAAADVP-KELDRNLKIADEVIRHMIIRLEK 94
>gi|50364895|ref|YP_053320.1| 30S ribosomal protein S6 [Mesoplasma florum L1] >gi|81391993|sp|Q6F237|RS6_MESFL 30S ribosomal protein S6 >gi|50363451|gb|AAT75436.1| 30S ribosomal protein S6 [Mesoplasma florum L1] (290 aa)
Score = 112, Expect = 2.4e-04, Identities = 35/114 (30%), Positives = 61/114 (53%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAER 116
           KYE M ++D   ++  A + +  ++ I K    ++   +GL + AY IN K +G+Y++         +I+EF R+  ++K V+R LIIN E + GY+      K   ++F  ER
  S:     4 KYEAMFILDQDTQDVNALS-SRMIEIISKDGKVIEKNDLGLIEFAYKINHKKKGHYFVV-IVEATAEAIKEFERIANIEKNVVRTLIINTENEQGYEQSVQLSKTDMTKFEEER 115
>gi|89100932|ref|ZP_01173779.1| ribosomal protein S6 (BS9) [Bacillus sp. NRRL B-14911] >gi|89084341|gb|EAR63495.1| ribosomal protein S6 (BS9) [Bacillus sp. NRRL B-14911] (95 aa)
Score = 112, Expect = 2.4e-04, Identities = 33/94 (35%), Positives = 52/94 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKM--GLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYEIM V+  +IE+    A+     SIL  +     E    G + LAY IN    GYY L +  N + A++ EF R+  + ++++RH+++  EK
  S:     1 MRKYEIMYVIRPNIEDEAKKALVERFNSILTDNGAELTESKDWGKRRLAYEINDFRDGYYQLIHL-NAEAAAVDEFTRLAKISEDIIRHMVVKDEK 95
>gi|65317455|ref|ZP_00390414.1| COG0360: Ribosomal protein S6 [Bacillus anthracis str. A2012] >gi|118480502|ref|YP_897653.1| 30S ribosomal protein S6 [Bacillus thuringiensis str. Al Hakam] >gi|118419727|gb|ABK88146.1| SSU ribosomal protein S6P [Bacillus thuringiensis str. Al Hakam] (113 aa)
Score = 112, Expect = 2.6e-04, Identities = 28/94 (29%), Positives = 51/94 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYEIM ++   +EE    A+      +L  +    +  ++ G + LAY IN    G+Y + N  N +  +I EF R+  + +++LRH+++  E+
  S:    18 MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNV-NANAEAINEFDRLAKINEDILRHIVVKEEE 112
>gi|94263202|ref|ZP_01287019.1| Ribosomal protein S6 [delta proteobacterium MLMS-1] >gi|94270366|ref|ZP_01291724.1| Ribosomal protein S6 [delta proteobacterium MLMS-1] >gi|93450832|gb|EAT01865.1| Ribosomal protein S6 [delta proteobacterium MLMS-1] >gi|93456420|gb|EAT06540.1| Ribosomal protein S6 [delta proteobacterium MLMS-1] (126 aa)
Score = 112, Expect = 2.8e-04, Identities = 30/95 (31%), Positives = 56/95 (58%)
  Q:     1 MPKYE-IMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKD 95
           M KYE +++V  G+  E++ TAV++   +++ +       +   GLK LAYP+ K+++G+Y L   Y  +P  I+E  R+  +   +L+ L + L+ D
  S:     1 MRKYESVIIVRPGAAAEAEITAVSDKYAAVISEYQGEVASVNHWGLKRLAYPVKKENQGFYLLLR-YLCNPDGIKEMERLLRIDDRILKFLTVRLDDD 97
>gi|71894543|ref|YP_278651.1| 30S ribosomal protein S6 [Mycoplasma synoviae 53] (163 aa)
Score = 112, Expect = 2.8e-04, Identities = 41/134 (30%), Positives = 68/134 (50%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRIKEQVLAEQEKIRKERD 136
           KYEIM++V     ++ A+ V + LKS+       K EK+   +LAY INK     Y+L N   E   +I EF R++ + KE+ RHL++NL+ + G        +     FR +R    +     ++E  +K ++
  S:     4 KYEIMVLVG---PKTSASTVESFLKSVFHDDFK-KAEKLERTELAYEINKTKHAQYFLVNLETER-KNIAEFIRLSNINKEIWRHLVVNLDTEKGLNKVFKTHRKFGHDFRDQRSHHGQAGEFRKREPQQKSKE 132
>gi|71893643|ref|YP_279089.1| 30S ribosomal protein S6 [Mycoplasma hyopneumoniae J] >gi|91207921|sp|Q4AA43|RS6_MYCHJ 30S ribosomal protein S6 >gi|71851770|gb|AAZ44378.1| 30S ribosomal protein S6 [Mycoplasma hyopneumoniae J] (241 aa)
Score = 112, Expect = 2.8e-04, Identities = 34/101 (33%), Positives = 56/101 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAK 101
           MPKYEIM ++D    +++   + N LK++   ++  KL K+   +LAY I K     Y+L +  N     I+EF R   + +E+ R+LI+NL+ + G   K
  S:     1 MPKYEIMTILD---PKAEMAIIDNLLKTVFGDNSTEKLRKLETTNLAYSIRKSKIAQYFLVDL-NAPTNLIEEFVRRANITREIWRYLIVNLDSEKGLNKK 97
>gi|81427623|ref|YP_394620.1| 30S ribosomal protein S6 [Lactobacillus sakei subsp. sakei 23K] >gi|91207917|sp|Q38ZR8|RS6_LACSS 30S ribosomal protein S6 >gi|78609262|emb|CAI54309.1| 30S Ribosomal protein S6 [Lactobacillus sakei subsp. sakei 23K] (98 aa)
Score = 111, Expect = 3.2e-04, Identities = 30/91 (32%), Positives = 50/91 (54%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKD-----LAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           KYE+  ++  +++E   TA+ N    ILK   D   E +  KD     LAY IN +  G Y++ N   ++  ++ EF R+  +   +LRH+I+  E
  S:     5 KYEVTYIISTTLDEESKTALVNRFDGILK---DNGAEVVDSKDWSKRRLAYEINNQHEGIYHIVNVLADNDEALNEFDRLAKIDGAILRHMIVKRE 97
>gi|145218997|ref|YP_001129706.1| 30S ribosomal protein S6 [Prosthecochloris vibrioformis DSM 265] >gi|189045487|sp|A4SCJ5|RS6_PROVI 30S ribosomal protein S6 >gi|145205161|gb|ABP36204.1| SSU ribosomal protein S6P [Prosthecochloris vibrioformis DSM 265] (133 aa)
Score = 111, Expect = 3.3e-04, Identities = 35/89 (39%), Positives = 52/89 (58%)
  Q:     4 YEIMLVVDGSIE-ESKATAVANDLKSILKKSTDLK-LEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           YE  +++DG ++ E  A A+A   K I +K   +K +  +G +  AYPINKK+ GYY    F  + P  I E  RV   +  +LR+LII+L
  S:     7 YECTVIIDGGLQDEPIAEAMAMVQKVITEKGGSIKSVLDIGRRKTAYPINKKTIGYYAHIEFTADTPV-IAEIERVLRYEDVLLRYLIIHL 96
>gi|138897056|ref|YP_001127509.1| ribosomal protein S6 (BS9) [Geobacillus thermodenitrificans NG80-2] >gi|134268569|gb|ABO68764.1| Ribosomal protein S6 (BS9) [Geobacillus thermodenitrificans NG80-2] (98 aa)
Score = 111, Expect = 3.4e-04, Identities = 29/92 (31%), Positives = 53/92 (57%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           KYEIM ++  ++++    AV     ++LK+  +    +   G + LAY I K   GYY + N   E P ++QEF R+  + ++++RH+++  EK
  S:     6 KYEIMYIIRPNMDDEARQAVVERFNNVLKEKGAEITNVTDWGKRRLAYEIEKYRDGYYMILNVMAE-PQAVQEFDRLARISEDIIRHIVVKEEK 98
>gi|4220414|gb|AAD12413.1| Homology to ribosomal protein S6 X04022 [Mycoplasma genitalium] (75 aa)
Score = 111, Expect = 3.5e-04, Identities = 24/56 (42%), Positives = 38/56 (67%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYY 59
           Y I+L+VDG++   +A  V    + +L+K+T+ K E +GLK+LAYPI K+   +YY
  S:    20 YNIILLVDGTLSLEQANQVEQKHQKLLEKATEFKSEYLGLKELAYPIKKQLSAHYY 75
>gi|95930452|ref|ZP_01313188.1| ribosomal protein S6 [Desulfuromonas acetoxidans DSM 684] >gi|95133492|gb|EAT15155.1| ribosomal protein S6 [Desulfuromonas acetoxidans DSM 684] (121 aa)
Score = 111, Expect = 3.5e-04, Identities = 34/93 (36%), Positives = 51/93 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE +L+V+  I   + TAV    K +L  + +  LK+++ G K LAYP+ K  +G Y L NF N +   I+EF R   L   V++   + LE
  S:     1 MRTYETVLIVNPQIVGDEYTAVIEKFKGVLTDQNAEILKVDEWGTKRLAYPVKKCEQGTYVLINF-NAENVVIKEFERRMRLDDAVIKFQTLILE 94
>gi|88607094|ref|YP_504775.1| 30S ribosomal protein S6 [Anaplasma phagocytophilum HZ] >gi|123495753|sp|Q2GLH6|RS6_ANAPZ 30S ribosomal protein S6 >gi|88598157|gb|ABD43627.1| ribosomal protein S6 [Anaplasma phagocytophilum HZ] (109 aa)
Score = 111, Expect = 3.5e-04, Identities = 28/94 (29%), Positives = 52/94 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE   +    + + +   ++  L ++L K  +  +K E  GL D  Y I K ++G+Y +  +   +PA++ EF+R   L ++VLR L + ++K
  S:     1 MPFYEFAFIAQQGLTQYELEGLSKGLTALLVKMGAELVKYEYWGLLDFVYSIAKNNKGHYCMM-YIRAEPAAMDEFKRKVKLNEDVLRFLCLKVDK 95
>gi|152977673|ref|YP_001377190.1| 30S ribosomal protein S6 [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189045454|sp|A7GVN7|RS6_BACCN 30S ribosomal protein S6 >gi|152026425|gb|ABS24195.1| ribosomal protein S6 [Bacillus cereus subsp. cytotoxis NVH 391-98] (95 aa)
Score = 111, Expect = 3.7e-04, Identities = 27/94 (28%), Positives = 55/94 (58%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYEIM ++  ++EE    A+     ++L  +    +  ++ G + LAY IN    G+Y + N  N +P +++EF R+  + ++++RH+++  E+
  S:     1 MKKYEIMYIIRPNMEEEAQKALVERFANVLTNNGAEIINTKEWGKRRLAYEINDLRDGFYMILNV-NSNPEAVKEFDRLAKINEDIIRHIVVKEEE 95
>gi|169187393|ref|ZP_02847552.1| ribosomal protein S6 [Paenibacillus sp. JDR-2] >gi|169005402|gb|EDS52254.1| ribosomal protein S6 [Paenibacillus sp. JDR-2] (94 aa)
Score = 110, Expect = 3.8e-04, Identities = 29/90 (32%), Positives = 48/90 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYE+M ++   +E+    A+ +    I+    ++ K + +G + LAY INK   GYY L +F N     + E  R+  +  EV+R LI+
  S:     1 MRKYEVMYIIRPDVEQENVQAIVDKFSGIINNGGEVTKQDVIGKRRLAYEINKIRDGYYVLVHF-NATTEVVNELDRIMKITDEVIRSLIV 90
>gi|57239414|ref|YP_180550.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Welgevonden] >gi|58579386|ref|YP_197598.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Welgevonden] >gi|58617441|ref|YP_196640.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Gardel] >gi|75356738|sp|Q5FG27|RS6_EHRRG 30S ribosomal protein S6 >gi|81352829|sp|Q5HAJ4|RS6_EHRRW 30S ribosomal protein S6 >gi|57161493|emb|CAH58419.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Welgevonden] >gi|58417053|emb|CAI28166.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Gardel] >gi|58418012|emb|CAI27216.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Welgevonden] (109 aa)
Score = 110, Expect = 3.9e-04, Identities = 30/94 (31%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE   +    + + +   +   L S+L K+    LK E  GL D AY I+K ++G+Y +  +      S+ EF+R   L ++VLR L +  +K
  S:     1 MPLYEFTFIAQQGLTQYELEGLVKGLSSLLTKNGAELLKYEYWGLLDFAYAIDKMNKGHYCMM-YIRSSSTSMDEFKRKVRLNEDVLRFLCLKRDK 95
>gi|148543250|ref|YP_001270620.1| SSU ribosomal protein S6P [Lactobacillus reuteri F275] >gi|184152662|ref|YP_001841003.1| 30S ribosomal protein S6 [Lactobacillus reuteri F275] >gi|194467409|ref|ZP_03073396.1| ribosomal protein S6 [Lactobacillus reuteri 100-23] >gi|189045474|sp|A5VHF9|RS6_LACRF 30S ribosomal protein S6 >gi|148530284|gb|ABQ82283.1| SSU ribosomal protein S6P [Lactobacillus reuteri F275] >gi|183224006|dbj|BAG24523.1| 30S ribosomal protein S6 [Lactobacillus reuteri F275] >gi|194454445|gb|EDX43342.1| ribosomal protein S6 [Lactobacillus reuteri 100-23] (98 aa)
Score = 110, Expect = 4.0e-04, Identities = 27/91 (29%), Positives = 47/91 (51%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           KYEI  ++   IEES  + + +    IL    +T    +    +  AYPI K + G Y++ N   +   ++ EF R+     ++LRH+I+ L+
  S:     5 KYEITYIIRPDIEESAKSELVDRFDKILADNGATIADSKDWSTRRFAYPIAKYTEGTYHVVNLTTDSDQALNEFDRLAKFSDDILRHMIVKLD 97
>gi|148377542|ref|YP_001256418.1| 30S ribosomal protein S6 [Mycoplasma agalactiae PG2] >gi|148291588|emb|CAL58974.1| 30S ribosomal protein S6 [Mycoplasma agalactiae PG2] (145 aa)
Score = 110, Expect = 4.0e-04, Identities = 33/99 (33%), Positives = 56/99 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYK 99
           M KYEIML++D +I+ + A  +   ++S+  K    K+ K+    LAYPINK S+  Y ++    +    I EF R   + K + R ++INL+ + G++
  S:     1 MNKYEIMLIIDPAIDMAMANEI---VESVFDKKNINKVVKLENSTLAYPINKSSKAQYVVYTLEAKSEL-IAEFTRRANIAKFIWRQMVINLDTEKGFQ 95
>gi|16802092|ref|NP_463577.1| 30S ribosomal protein S6 [Listeria monocytogenes EGD-e] >gi|46906275|ref|YP_012664.1| 30S ribosomal protein S6 [Listeria monocytogenes str. 4b F2365] >gi|47092169|ref|ZP_00229961.1| ribosomal protein S6 [Listeria monocytogenes str. 4b H7858] >gi|47095112|ref|ZP_00232724.1| ribosomal protein S6 [Listeria monocytogenes str. 1/2a F6854] >gi|153164869|ref|ZP_01926044.1| ribosomal protein S6 [Listeria monocytogenes FSL N1-017] >gi|153176212|ref|ZP_01931471.1| ribosomal protein S6 [Listeria monocytogenes FSL N3-165] >gi|153181076|ref|ZP_01934043.1| ribosomal protein S6 [Listeria monocytogenes F6900] >gi|153184403|ref|ZP_01935162.1| ribosomal protein S6 [Listeria monocytogenes J0161] >gi|153192687|ref|ZP_01939647.1| ribosomal protein S6 [Listeria monocytogenes J2818] >gi|153198010|ref|ZP_01942180.1| ribosomal protein S6 [Listeria monocytogenes 10403S] >gi|153200432|ref|ZP_01942594.1| ribosomal protein S6 [Listeria monocytogenes HPB2262] >gi|167015969|ref|ZP_02278502.1| 30S ribosomal protein S6 [Listeria monocytogenes FSL J1-194] >gi|167052252|ref|ZP_02278650.1| 30S ribosomal protein S6 [Listeria monocytogenes FSL F2-515] >gi|167211119|ref|ZP_02281426.1| 30S ribosomal protein S6 [Listeria monocytogenes LO28] >gi|167215495|ref|ZP_02285802.1| 30S ribosomal protein S6 [Listeria monocytogenes FSL R2-503] >gi|167216355|ref|ZP_02285991.1| 30S ribosomal protein S6 [Listeria monocytogenes FSL J1-175] >gi|167342420|ref|ZP_02288350.1| 30S ribosomal protein S6 [Listeria monocytogenes FSL J1-208] >gi|167452780|ref|ZP_02319003.1| 30S ribosomal protein S6 [Listeria monocytogenes FSL J2-064] >gi|168267079|ref|ZP_02689044.1| 30S ribosomal protein S6 [Listeria monocytogenes FSL J2-071] >gi|24212308|sp|Q8YAR9|RS6_LISMO 30S ribosomal protein S6 >gi|61215608|sp|Q725C0|RS6_LISMF 30S ribosomal protein S6 >gi|16409403|emb|CAC98259.1| ribosomal protein S6 [Listeria monocytogenes] >gi|46879539|gb|AAT02841.1| ribosomal protein S6 [Listeria monocytogenes str. 4b F2365] >gi|47016457|gb|EAL07378.1| ribosomal protein S6 [Listeria monocytogenes str. 1/2a F6854] >gi|47019371|gb|EAL10112.1| ribosomal protein S6 [Listeria monocytogenes str. 4b H7858] >gi|126942906|gb|EBA20640.1| ribosomal protein S6 [Listeria monocytogenes J0161] >gi|127632346|gb|EBA22028.1| ribosomal protein S6 [Listeria monocytogenes 10403S] >gi|127763724|gb|EBA24558.1| ribosomal protein S6 [Listeria monocytogenes J2818] >gi|133728569|gb|EBA30267.1| ribosomal protein S6 [Listeria monocytogenes FSL N1-017] >gi|133728925|gb|EBA30623.1| ribosomal protein S6 [Listeria monocytogenes FSL N3-165] >gi|133731594|gb|EBA33292.1| ribosomal protein S6 [Listeria monocytogenes F6900] >gi|133736710|gb|EBA38408.1| ribosomal protein S6 [Listeria monocytogenes HPB2262] (97 aa)
Score = 110, Expect = 4.2e-04, Identities = 30/91 (32%), Positives = 50/91 (54%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLE--KMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           KYEIM ++  +IEE +  AV      IL ++    +E  + G + LAY IN    G+Y++     +   SI EF R+  +  +++RH++I  E
  S:     4 KYEIMYIIRPNIEEDEKKAVVERFDGILTENGAEIIESKEWGKRRLAYEINDYRDGFYHIVKLNADKADSINEFDRLAKISDDIIRHMVIKEE 96
>gi|114328878|ref|YP_746035.1| SSU ribosomal protein S6P [Granulibacter bethesdensis CGDNIH1] >gi|122326173|sp|Q0BPZ0|RS6_GRABC 30S ribosomal protein S6 >gi|114317052|gb|ABI63112.1| SSU ribosomal protein S6P [Granulibacter bethesdensis CGDNIH1] (154 aa)
Score = 110, Expect = 4.5e-04, Identities = 31/94 (32%), Positives = 52/94 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE +L+    + + +  +VA+ + S+++       K E  GL+ LAY I K  +G+Y L    +  PA+I E  R   L ++VLR + I +E+
  S:     1 MPLYESVLIARNDVTQQQVESVADHVASLIEAEGGAIKKREYWGLRTLAYRIKKNRKGHYMLLGL-DAKPATITEVERQLRLNEDVLRFMTIRVEE 95
>gi|56422017|ref|YP_149335.1| 30S ribosomal protein S6 (BS9) [Geobacillus kaustophilus HTA426] >gi|61215358|sp|Q5KU69|RS6_GEOKA 30S ribosomal protein S6 >gi|56381859|dbj|BAD77767.1| 30S ribosomal protein S6 (BS9) [Geobacillus kaustophilus HTA426] (95 aa)
Score = 110, Expect = 4.9e-04, Identities = 28/94 (29%), Positives = 55/94 (58%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYEIM ++  ++++    A+     ++LK++      +   G + LAY I K   GYY + N  +E P ++QEF R+  + ++++RH+++  E+
  S:     1 MRKYEIMYIIRPNMDDEARQALVERFNNVLKENGAEITNVTDWGKRRLAYEIQKYRDGYYMIVNVVSE-PKAVQEFDRLARISEDIIRHIVVKEEE 95
>gi|16799116|ref|NP_469384.1| 30S ribosomal protein S6 [Listeria innocua Clip11262] >gi|116871457|ref|YP_848238.1| 30S ribosomal protein S6 [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123463367|sp|A0AEM1|RS6_LISW6 30S ribosomal protein S6 >gi|24212317|sp|Q92FR6|RS6_LISIN 30S ribosomal protein S6 >gi|16412458|emb|CAC95270.1| ribosomal protein S6 [Listeria innocua] >gi|116740335|emb|CAK19453.1| rpsF [Listeria welshimeri serovar 6b str. SLCC5334] (97 aa)
Score = 109, Expect = 5.1e-04, Identities = 30/91 (32%), Positives = 50/91 (54%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLE--KMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           KYEIM ++  +IEE +  AV      IL ++    +E  + G + LAY IN    G+Y++     +   SI EF R+  +  +++RH++I  E
  S:     4 KYEIMYIIRPNIEEDEKKAVVERFDGILTENGAEIIESKEWGKRRLAYEINDYRDGFYHIVKLNADKADSINEFDRLAKISDDIVRHMVIKEE 96
>gi|47568673|ref|ZP_00239370.1| ribosomal protein S6 [Bacillus cereus G9241] >gi|47554661|gb|EAL13015.1| ribosomal protein S6 [Bacillus cereus G9241] (96 aa)
Score = 109, Expect = 5.2e-04, Identities = 29/94 (30%), Positives = 51/94 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYEIM ++   +EE    A+      +L  +    +  ++ G + LAY IN    G+Y + N  N +  +I EF R+  + +++LRH+I+  E+
  S:     1 MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNV-NSNAEAINEFDRLAKINEDILRHIIVKEEE 95
>gi|55737711|gb|AAV61353.1| 30S ribosomal protein S6 [Streptococcus thermophilus LMG 18311] >gi|55739631|gb|AAV63272.1| 30S ribosomal protein S6 [Streptococcus thermophilus CNRZ1066] (112 aa)
Score = 109, Expect = 5.3e-04, Identities = 29/93 (31%), Positives = 51/93 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYEI+ ++  +IEE    A+     SIL    +T ++ +    + LAY I     G Y++ N    D  ++ EF R++ +  ++LRH+I+ L+
  S:    17 MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIQDFREGLYHVVNVEANDATALNEFDRLSKINGDILRHMIVKLD 111
>gi|148265698|ref|YP_001232404.1| 30S ribosomal protein S6 [Geobacter uraniireducens Rf4] >gi|189045470|sp|A5G7R3|RS6_GEOUR 30S ribosomal protein S6 >gi|146399198|gb|ABQ27831.1| SSU ribosomal protein S6P [Geobacter uraniireducens Rf4] (128 aa)
Score = 109, Expect = 5.7e-04, Identities = 33/100 (33%), Positives = 52/100 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILK--KSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKA 100
           M  YE + +V   + E +   ++  ++ ++   K    +LE  G + LAYPINK +RG YY   F + D A I E  R   L  +V+R+  + LEK+    A
  S:     1 MRMYETIFIVQPDLGEEEMKGISTKVQDVIASMKGDFKRLEDWGPRKLAYPINKFARGRYYYLRF-DGDSALIAELERRLRLDDKVIRYQSVKLEKEVALAA 101
>gi|78188077|ref|YP_378415.1| 30S ribosomal protein S6 [Chlorobium chlorochromatii CaD3] >gi|91207907|sp|Q3ANR5|RS6_CHLCH 30S ribosomal protein S6 >gi|78170276|gb|ABB27372.1| SSU ribosomal protein S6P [Chlorobium chlorochromatii CaD3] (132 aa)
Score = 109, Expect = 5.8e-04, Identities = 31/89 (34%), Positives = 47/89 (52%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           YE   ++DG +++    A    ++ ++  K  T   +  +G +  AYPI KKS GYY    F    P  I E  RV   ++E+LR+LII L
  S:     7 YECTAIIDGGLQDEAVAATLAMVQRVITEKGGTINSVLDLGRRKTAYPIKKKSMGYYVHIEFNAAAPV-IAEIERVLRYEEELLRYLIIQL 96
>gi|153956492|ref|YP_001397257.1| 30S ribosomal protein S6 [Clostridium kluyveri DSM 555] >gi|189045461|sp|A5N440|RS6_CLOK5 30S ribosomal protein S6 >gi|146349350|gb|EDK35886.1| RpsF [Clostridium kluyveri DSM 555] (95 aa)
Score = 108, Expect = 7.1e-04, Identities = 31/94 (32%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYE + ++  S++E    A     K +++    +   ++  G + LAY I K + GYY L  F N DP   +E  RV  +   V+RH+I+  EK
  S:     1 MGKYETIFILHPSLDEEGYKANVEKFKGVIENGGGVIENVDIWGKRKLAYEIKKVNEGYYTLITF-NADPTLPKELDRVFRITDTVVRHIIVKDEK 95
>gi|148260512|ref|YP_001234639.1| ribosomal protein S6 [Acidiphilium cryptum JF-5] >gi|166226792|sp|A5FYN8|RS6_ACICJ 30S ribosomal protein S6 >gi|146402193|gb|ABQ30720.1| SSU ribosomal protein S6P [Acidiphilium cryptum JF-5] (158 aa)
Score = 108, Expect = 7.2e-04, Identities = 29/93 (31%), Positives = 52/93 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           MP YE +L+    I + +   +A+ + + ++  +    K E  GL++LAY I K  +G+Y L    + +PA+I E  R   L ++VLR + + +E
  S:     1 MPLYECVLIARSEITQQQVDTIADAVTAQVESESGAVKKREYWGLRNLAYRIKKNRKGHYVLLGL-DAEPATISEMERQLGLNEDVLRFMTVRVE 94
>gi|194398723|ref|YP_002038173.1| 30S ribosomal protein S6 [Streptococcus pneumoniae G54] >gi|194358390|gb|ACF56838.1| 30S ribosomal protein S6 [Streptococcus pneumoniae G54] (96 aa)
Score = 108, Expect = 7.5e-04, Identities = 28/93 (30%), Positives = 52/93 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYEI+ ++  +IEE    A+     SIL    +T ++ +    + LAY I     G Y++      D A+++EF R++ +  ++LRH+I+ ++
  S:     1 MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVXVEANDDAALKEFDRLSKINADILRHMIVKID 95
>gi|168143823|ref|ZP_02587052.1| 30S ribosomal protein S6 [Bacillus cereus G9842] (96 aa)
Score = 108, Expect = 7.5e-04, Identities = 28/94 (29%), Positives = 51/94 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYEIM ++   +EE    A+      +L  +    +  ++ G + LAY IN    G+Y + N  N +  +I EF R+  + +++LRH+++  E+
  S:     1 MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNV-NSNAEAINEFDRLAKINEDILRHIVVKEEE 95
>gi|163943154|ref|YP_001648038.1| 30S ribosomal protein S6 [Bacillus weihenstephanensis KBAB4] >gi|163865351|gb|ABY46410.1| ribosomal protein S6 [Bacillus weihenstephanensis KBAB4] (96 aa)
Score = 108, Expect = 7.9e-04, Identities = 28/94 (29%), Positives = 51/94 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYEIM ++   +EE    A+      +L  +    +  ++ G + LAY IN    G+Y + N  N +  +I EF R+  + +++LRH+++  E+
  S:     1 MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNV-NSNSEAINEFDRLAKINEDILRHIVVKEEE 95
>gi|30265492|ref|NP_847869.1| 30S ribosomal protein S6 [Bacillus anthracis str. Ames] >gi|47531060|ref|YP_022409.1| 30S ribosomal protein S6 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49188311|ref|YP_031564.1| 30S ribosomal protein S6 [Bacillus anthracis str. Sterne] >gi|49481194|ref|YP_039464.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52145282|ref|YP_086739.1| 30S ribosomal protein S6 [Bacillus cereus E33L] >gi|165873021|ref|ZP_02217642.1| ribosomal protein S6 [Bacillus anthracis str. A0488] >gi|166982572|ref|ZP_02254004.1| 30S ribosomal protein S6 [Bacillus cereus AH187] >gi|166997085|ref|ZP_02263544.1| 30S ribosomal protein S6 [Bacillus cereus AH820] >gi|167635107|ref|ZP_02393424.1| ribosomal protein S6 [Bacillus anthracis str. A0442] >gi|167641752|ref|ZP_02399995.1| ribosomal protein S6 [Bacillus anthracis str. A0193] >gi|168160949|ref|ZP_02596182.1| 30S ribosomal protein S6 [Bacillus cereus H3081.97] >gi|170689457|ref|ZP_02880647.1| ribosomal protein S6 [Bacillus anthracis str. A0465] >gi|170707585|ref|ZP_02898038.1| ribosomal protein S6 [Bacillus anthracis str. A0389] >gi|177655277|ref|ZP_02936831.1| ribosomal protein S6 [Bacillus anthracis str. A0174] >gi|190569298|ref|ZP_03022192.1| ribosomal protein S6 [Bacillus anthracis Tsiankovskii-I] >gi|196036113|ref|ZP_03103513.1| ribosomal protein S6 [Bacillus cereus W] >gi|196041953|ref|ZP_03109240.1| ribosomal protein S6 [Bacillus cereus NVH0597-99] >gi|196045561|ref|ZP_03112792.1| ribosomal protein S6 [Bacillus cereus 03BB108] >gi|61215455|sp|Q630C8|RS6_BACCZ 30S ribosomal protein S6 >gi|61215550|sp|Q6HAG2|RS6_BACHK 30S ribosomal protein S6 >gi|61215741|sp|Q81JI2|RS6_BACAN 30S ribosomal protein S6 >gi|30260170|gb|AAP29355.1| ribosomal protein S6 [Bacillus anthracis str. Ames] >gi|47506208|gb|AAT34884.1| ribosomal protein S6 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49182238|gb|AAT57614.1| ribosomal protein S6 [Bacillus anthracis str. Sterne] >gi|49332750|gb|AAT63396.1| ribosomal protein S6 (30S ribosomal protein S6) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51978751|gb|AAU20301.1| ribosomal protein S6 (30S ribosomal protein S6) [Bacillus cereus E33L] >gi|164711233|gb|EDR16789.1| ribosomal protein S6 [Bacillus anthracis str. A0488] >gi|167510306|gb|EDR85709.1| ribosomal protein S6 [Bacillus anthracis str. A0193] >gi|167529581|gb|EDR92331.1| ribosomal protein S6 [Bacillus anthracis str. A0442] >gi|170127581|gb|EDS96455.1| ribosomal protein S6 [Bacillus anthracis str. A0389] >gi|170666559|gb|EDT17332.1| ribosomal protein S6 [Bacillus anthracis str. A0465] >gi|172080204|gb|EDT65296.1| ribosomal protein S6 [Bacillus anthracis str. A0174] >gi|190559605|gb|EDV13596.1| ribosomal protein S6 [Bacillus anthracis Tsiankovskii-I] >gi|195991280|gb|EDX55248.1| ribosomal protein S6 [Bacillus cereus W] >gi|196023768|gb|EDX62444.1| ribosomal protein S6 [Bacillus cereus 03BB108] >gi|196027208|gb|EDX65828.1| ribosomal protein S6 [Bacillus cereus NVH0597-99] (96 aa)
Score = 107, Expect = 8.7e-04, Identities = 28/94 (29%), Positives = 51/94 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYEIM ++   +EE    A+      +L  +    +  ++ G + LAY IN    G+Y + N  N +  +I EF R+  + +++LRH+++  E+
  S:     1 MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNV-NANAEAINEFDRLAKINEDILRHIVVKEEE 95
>gi|139439451|ref|ZP_01772892.1| Hypothetical protein COLAER_01912 [Collinsella aerofaciens ATCC 25986] >gi|133775230|gb|EBA39050.1| Hypothetical protein COLAER_01912 [Collinsella aerofaciens ATCC 25986] (97 aa)
Score = 107, Expect = 9.1e-04, Identities = 29/90 (32%), Positives = 47/90 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YE++  VD S++     AV   + + + +       +++ G + LAY IN  + G Y L NF+  DP  I E  RV  +   V+RH+I+
  S:     1 MKAYELLFFVDPSLDPETRLAVMKRIDTTIAEGAGKVDSVDEWGKRKLAYEINDLTDGDYTLINFH-ADPTQIAELDRVLRITDAVVRHMIV 91
>gi|126654886|ref|ZP_01726420.1| 30S ribosomal protein S6 [Cyanothece sp. CCY0110] >gi|126623621|gb|EAZ94325.1| 30S ribosomal protein S6 [Cyanothece sp. CCY0110] (126 aa)
Score = 107, Expect = 9.2e-04, Identities = 30/91 (32%), Positives = 49/91 (53%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           +YE++ ++   + E +        +  L +  +TDL+ +  G + LAYPI KK  G Y  FN Y  D + I    R+  L ++VLR+L I L+
  S:     4 QYEMIFILRPDLSEEQVNQAVTKYQEFLTENNATDLQTKIWGKRRLAYPIQKKVDGIYVQFN-YQADGSQIAPLERMMRLGEDVLRYLTIKLD 95
>gi|16081143|ref|NP_391971.1| 30S ribosomal protein S6 [Bacillus subtilis subsp. subtilis str. 168] >gi|585949|sp|P21468|RS6_BACSU 30S ribosomal protein S6 (BS9) >gi|467375|dbj|BAA05221.1| ribosomal protein S6 [Bacillus subtilis] >gi|2636638|emb|CAB16128.1| ribosomal protein S6 (BS9) [Bacillus subtilis subsp. subtilis str. 168] (95 aa)
Score = 107, Expect = 9.5e-04, Identities = 32/94 (34%), Positives = 52/94 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKD-----LAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYE+M ++  +I+E    AV     ++L   T    E  G KD     LAY IN    G+Y + N    D A++QEF R+  +  +++RH+++  E+
  S:     1 MRKYEVMYIIRPNIDEESKKAVIERFNNVL---TSNGAEITGTKDWGKRRLAYEINDFRDGFYQIVNV-QSDAAAVQEFDRLAKISDDIIRHIVVKEEE 95
>gi|90960997|ref|YP_534913.1| 30S ribosomal protein S6 [Lactobacillus salivarius UCC118] >gi|90820191|gb|ABD98830.1| SSU ribosomal protein S6P [Lactobacillus salivarius UCC118] (96 aa)
Score = 107, Expect = 1.0e-03, Identities = 28/93 (30%), Positives = 48/93 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YEI  ++  +I+E+  TA+     +ILK   +  +  +    +  AY I   S G Y++ N   E+  +I EF R+  +   +LRH+I+  E
  S:     1 MTNYEITYIISPAIDEAAKTALVERFDNILKNDGAEIVDSKDWSKRRFAYEIGGFSEGIYHIVNIKAENADAINEFDRLAKINDGILRHMIVKRE 95
>gi|50843665|ref|YP_056892.1| 30S ribosomal protein S6 [Propionibacterium acnes KPA171202] >gi|61216184|sp|Q6A5M9|RS6_PROAC 30S ribosomal protein S6 >gi|50841267|gb|AAT83934.1| 30S ribosomal protein S6 [Propionibacterium acnes KPA171202] (96 aa)
Score = 107, Expect = 1.0e-03, Identities = 30/93 (32%), Positives = 55/93 (59%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYE+M+++D ++EE +  ++      ++  +K T   ++  G + LAY I KKS G Y + N   E PA+IQE  R+  + ++++R  ++  E
  S:     1 MRKYEVMIIIDPTVEERQVDSLMEKYLKVITDEKGTVDNVDVWGKRRLAYDIQKKSEGIYVVVNATCE-PATIQELDRLLAIDEKIMRTKVMRPE 94
>gi|150019894|ref|YP_001312148.1| 30S ribosomal protein S6 [Clostridium beijerinckii NCIMB 8052] >gi|189045460|sp|A6M3L2|RS6_CLOB8 30S ribosomal protein S6 >gi|149906359|gb|ABR37192.1| ribosomal protein S6 [Clostridium beijerinckii NCIMB 8052] (95 aa)
Score = 107, Expect = 1.0e-03, Identities = 29/91 (31%), Positives = 49/91 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIIN 91
           M KYE + +++ S +E    A     K +++    T   ++  G + LAY I+K S G+Y L NF   +P   +E  R+  +   V+RH+I+N
  S:     1 MRKYETIFILNPSFDEETVKANIEKFKGVIENGGGTVENVDFWGKRKLAYEISKVSEGFYTLVNF-TANPELPRELDRIFRITDGVIRHIIVN 92
>gi|116493583|ref|YP_805317.1| ribosomal protein S6 [Lactobacillus casei ATCC 334] >gi|191636833|ref|YP_001985999.1| 30S ribosomal protein S6 [Lactobacillus casei] >gi|122264954|sp|Q03D47|RS6_LACC3 30S ribosomal protein S6 >gi|116103733|gb|ABJ68875.1| SSU ribosomal protein S6P [Lactobacillus casei ATCC 334] >gi|190711135|emb|CAQ65141.1| 30S ribosomal protein S6 [Lactobacillus casei BL23] (98 aa)
Score = 107, Expect = 1.0e-03, Identities = 27/91 (29%), Positives = 51/91 (56%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           KYE+  ++   ++++  T +     +ILK+  +  +  +    + LAY INK + G Y++ N   ED  +I EF R+  +  ++LRH+I+  E
  S:     5 KYEVTYIIRPDLDDAAKTELVERFDNILKENGANIIDSKDWQKRKLAYEINKYNEGLYHIVNLSAEDDKAINEFDRLGKINNDILRHMIVKRE 97
>gi|78224040|ref|YP_385787.1| 30S ribosomal protein S6 [Geobacter metallireducens GS-15] >gi|91207916|sp|Q39RR2|RS6_GEOMG 30S ribosomal protein S6 >gi|78195295|gb|ABB33062.1| SSU ribosomal protein S6P [Geobacter metallireducens GS-15] (118 aa)
Score = 107, Expect = 1.1e-03, Identities = 35/93 (37%), Positives = 51/93 (54%)
  Q:     3 KYEIMLVVD---GSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKD 95
           KYE +++V    G  E     A   D+ + +K     +LE  G++ LAYPINK +RG YY   F + D A I E  R   L  +VLR+  + +EK+
  S:     4 KYETVVIVQPDLGDDELKGLNAKVTDIIATMKGDLH-RLEDWGVRKLAYPINKSARGRYYYVRF-DGDAALIAELERRLRLDDKVLRYQSVKIEKE 97
>gi|15896955|ref|NP_350304.1| 30S ribosomal protein S6 [Clostridium acetobutylicum ATCC 824] >gi|24212323|sp|Q97CX2|RS6_CLOAB 30S ribosomal protein S6 >gi|15026830|gb|AAK81644.1|AE007867_11 Ribosomal protein S6 [Clostridium acetobutylicum ATCC 824] (95 aa)
Score = 107, Expect = 1.1e-03, Identities = 31/94 (32%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYE + +++ S++E          KS++         ++  G + LAY I+K + G Y L NF   D    +E  RV  +   ++RHLII+LEK
  S:     1 MNKYETLFILNPSLDEEGINTNVEKFKSVITNGGGEVENVDLWGKRKLAYEIDKVNEGIYVLVNF-QSDAQLPKELDRVFRISDSIIRHLIISLEK 95
>gi|15616612|ref|NP_244918.1| 30S ribosomal protein S6 [Bacillus halodurans C-125] >gi|11134348|sp|Q9K5N8|RS6_BACHD 30S ribosomal protein S6 >gi|10176675|dbj|BAB07769.1| 30S ribosomal protein S6 [Bacillus halodurans C-125] (95 aa)
Score = 106, Expect = 1.1e-03, Identities = 34/94 (36%), Positives = 51/94 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYEIM ++  ++EE+    +      +L  + +   K+E+MG + LAY INK   GYY L N    D  +I EF R+  +   V+R LI   E+
  S:     1 MRKYEIMYIIAPNLEEAANKEIIERFNGVLTNQGAEIEKVEEMGKRRLAYEINKFREGYYVLLNV-KADADAIAEFNRLIKINDNVIRVLITKDEE 95
>gi|154498401|ref|ZP_02036779.1| hypothetical protein BACCAP_02390 [Bacteroides capillosus ATCC 29799] >gi|150272469|gb|EDM99654.1| hypothetical protein BACCAP_02390 [Bacteroides capillosus ATCC 29799] (98 aa)
Score = 106, Expect = 1.2e-03, Identities = 27/87 (31%), Positives = 49/87 (56%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           YE + ++D  + E    A+    K++++ +  L ++++ G + LAYPIN K+ GYY L  F +  P+   E  R+  +   V+R LI+
  S:     8 YEAVYILDADLGEEATAALVAKFKTLVESNGTLTEVDEWGKRRLAYPINDKNDGYYVLMTFTSA-PSFPLELDRIFRITDGVVRSLIV 94
>gi|152992024|ref|YP_001357745.1| 30S ribosomal protein S6 [Sulfurovum sp. NBC37-1] >gi|166227395|sp|A6Q7C9|RS6_SULNB 30S ribosomal protein S6 >gi|151423885|dbj|BAF71388.1| 30S ribosomal protein S6 [Sulfurovum sp. NBC37-1] (127 aa)
Score = 106, Expect = 1.2e-03, Identities = 31/95 (32%), Positives = 51/95 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKD 95
           M  YE + VV  ++ E +  A    +K +L K  +  L  + MG++ LAYP+ K  RGYY +  FY  +  +I E  R   + +EV++ L +   K+
  S:     1 MNCYETLFVVKPTLTEEETAAEIAKIKDVLAKVDAELLATDDMGMRKLAYPVQKNDRGYYTVL-FYKANGEAIAEIERNLKINEEVIKFLTVKYVKN 96
>gi|116513139|ref|YP_812046.1| 30S ribosomal protein S6 [Lactococcus lactis subsp. cremoris SK11] >gi|125625231|ref|YP_001033714.1| 30S ribosomal protein S6 [Lactococcus lactis subsp. cremoris MG1363] >gi|123025089|sp|Q02VT9|RS6_LACLS 30S ribosomal protein S6 >gi|166226975|sp|A2RNZ4|RS6_LACLM 30S ribosomal protein S6 >gi|116108793|gb|ABJ73933.1| SSU ribosomal protein S6P [Lactococcus lactis subsp. cremoris SK11] >gi|124494039|emb|CAL99039.1| 30S ribosomal protein S6 [Lactococcus lactis subsp. cremoris MG1363] (97 aa)
Score = 106, Expect = 1.2e-03, Identities = 30/93 (32%), Positives = 52/93 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGL--KDLAYPINKKSRGYYYLFNFYNEDPA-SIQEFRRVTLLKKEVLRHLIINLE 93
           M KYEI+ ++  +I+E   TA+     +IL ++    LE      + LAY IN    G Y++  F  E  + ++ EF R+  +  ++LRH+I+ +E
  S:     1 MTKYEILYIIRPNIDEEAKTALVERFDAILTENGAANLESKDWEKRKLAYEINDFREGIYHIATFEAETTSEALSEFDRLAKINLDILRHMIVKVE 96
>gi|116513235|ref|YP_812141.1| 30S ribosomal protein S6 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116092550|gb|ABJ57703.1| SSU ribosomal protein S6P [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (97 aa)
Score = 106, Expect = 1.2e-03, Identities = 27/92 (29%), Positives = 48/92 (52%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKM--GLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           KYEI  ++   +++    A+ +    ++  +    +E    G +  AY I K   G YY+  F  ED A++ EF R++ +   VLR +I+ L+K
  S:     4 KYEITYIIKPDVDDEAKKAIIDKYTKVIADNGGEMVEAKDWGKRRFAYEIEKYREGSYYIMTFTAEDAAAVNEFARLSKIDDSVLRSMIVKLDK 97
>gi|146321680|ref|YP_001201391.1| 30S ribosomal protein S6 [Streptococcus suis 98HAH33] >gi|166227393|sp|A4W3Q2|RS6_STRS2 30S ribosomal protein S6 >gi|145692486|gb|ABP92991.1| Ribosomal protein S6 [Streptococcus suis 98HAH33] (96 aa)
Score = 106, Expect = 1.2e-03, Identities = 28/93 (30%), Positives = 50/93 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGL--KDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYEI+ ++  +IEE    A+     SIL  +    +E      + LAY I     G Y++ N    +  +++EF R++ +  ++LRH+I+ L+
  S:     1 MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATIVESKAWEKRRLAYEIKDFREGLYHIVNVEANNDEALKEFDRLSKINGDILRHMIVKLD 95
>gi|83589001|ref|YP_429010.1| 30S ribosomal protein S6 [Moorella thermoacetica ATCC 39073] >gi|91207918|sp|Q2RM72|RS6_MOOTA 30S ribosomal protein S6 >gi|83571915|gb|ABC18467.1| SSU ribosomal protein S6P [Moorella thermoacetica ATCC 39073] (98 aa)
Score = 106, Expect = 1.3e-03, Identities = 30/95 (31%), Positives = 48/95 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKD 95
           M  YE++ V+   +E    TAV      ++        ++++ G K +AY + K   GYY L  F    PA  QE  RV  +  +V+R+LI  LE++
  S:     1 MRNYEVVFVIRPDLEAEATTAVVEKFTQLITDQGGQVTRVDQWGKKRMAYEVRKYREGYYVLVEFKGT-PAVAQELERVLKISDDVIRYLITRLEEE 96
>gi|121535341|ref|ZP_01667153.1| ribosomal protein S6 [Thermosinus carboxydivorans Nor1] >gi|121306033|gb|EAX46963.1| ribosomal protein S6 [Thermosinus carboxydivorans Nor1] (94 aa)
Score = 106, Expect = 1.3e-03, Identities = 26/90 (28%), Positives = 54/90 (60%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYE++ +V   ++E    AV    ++++K +     K+++ G + LAYP+   + GYY +  +++ +P ++ E  RV  +  E+LRH+++
  S:     1 MRKYEVIFIVK-PLDEEATNAVIAKFENLIKNNGGNVEKIDRWGKRRLAYPVKDFTEGYYCVI-YFDAEPKAVFELERVMKITDEILRHMVV 90
>gi|170016527|ref|YP_001727446.1| ribosomal protein S6 [Leuconostoc citreum KM20] >gi|169803384|gb|ACA82002.1| Ribosomal protein S6 [Leuconostoc citreum KM20] (98 aa)
Score = 105, Expect = 1.5e-03, Identities = 27/87 (31%), Positives = 43/87 (49%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           YE+  +V   +E     A+      IL    +T  K      +  AY I     G Y++ NF  ED A+I EF R+  + +++LRH+I+
  S:     5 YEMTYIVRPDMEADAKKALVERFDGILTNNGATITKSADWATRRFAYEIAGYREGVYHVINFTAEDDAAINEFDRLAKISQDILRHMIV 93
>gi|157694462|ref|YP_001488924.1| 30S ribosomal protein S6 [Bacillus pumilus SAFR-032] >gi|194016480|ref|ZP_03055094.1| ribosomal protein S6 [Bacillus pumilus ATCC 7061] >gi|167011243|sp|A8FJE7|RS6_BACP2 30S ribosomal protein S6 >gi|157683220|gb|ABV64364.1| ribosomal protein S6 [Bacillus pumilus SAFR-032] >gi|194011953|gb|EDW21521.1| ribosomal protein S6 [Bacillus pumilus ATCC 7061] (95 aa)
Score = 105, Expect = 1.6e-03, Identities = 30/93 (32%), Positives = 51/93 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKD-----LAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYE+M ++  ++++    AV     ++L   T    E  G KD     LAY IN    G+Y + N    D A++QEF R+  +  +++RH+++  E
  S:     1 MRKYEVMYIIRPTVDDEAKKAVIERFNNVL---TSNGAEITGTKDWGKRRLAYEINDFREGFYQIVNV-QSDAAAVQEFDRLAKISDDIIRHIVVKEE 94
>gi|34558168|ref|NP_907983.1| 30S ribosomal protein S6 [Wolinella succinogenes DSM 1740] >gi|61216265|sp|Q7MQZ8|RS6_WOLSU 30S ribosomal protein S6 >gi|34483887|emb|CAE10883.1| HYPOTHETICAL PROTEIN-Ribosomal protein S6 [Wolinella succinogenes] (137 aa)
Score = 105, Expect = 1.6e-03, Identities = 28/93 (30%), Positives = 53/93 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLK-SILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE M +V  ++   +     N  K +I+K   ++   + MG+++LAY INK  RGYY++  ++   P+ + E  R+  + +++LR ++I  E
  S:     1 MRHYETMFIVKPTLTPEEIVEKINFYKEAIIKNGGEICATQDMGMRNLAYEINKNKRGYYFVV-YFKSAPSLVIELERLYRINEDILRFIVIKYE 94
>gi|84701455|ref|ZP_01016030.1| ribosomal protein S6 [Parvularcula bermudensis HTCC2503] >gi|84690701|gb|EAQ16541.1| ribosomal protein S6 [Parvularcula bermudensis HTCC2503] (110 aa)
Score = 105, Expect = 1.8e-03, Identities = 29/94 (30%), Positives = 55/94 (58%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE + V    I  ++  A+ ++L++I++++     K E  GL++L Y INK  +G+Y L N  +    +I E  R   +K+++LR + + +E+
  S:     1 MPLYEHVFVARQDISPAQVEALTDELQTIIRENGGEIRKSEYWGLRNLQYKINKNRKGHYSLMNI-DSPSEAIVELERQMRIKEDILRFMTLKVEE 95
>gi|167646474|ref|YP_001684137.1| ribosomal protein S6 [Caulobacter sp. K31] >gi|189045459|sp|B0SWL1|RS6_CAUSK 30S ribosomal protein S6 >gi|167348904|gb|ABZ71639.1| ribosomal protein S6 [Caulobacter sp. K31] (126 aa)
Score = 104, Expect = 2.0e-03, Identities = 35/122 (28%), Positives = 66/122 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRIKE 122
           M  YE +++    I   +A A+   LK++L+++     K+E  GL++L Y I K  +G+Y L    +   A+++E  R  L+ ++VLR + I +E+      + +P    R + R ER +R ++
  S:     1 MAFYEHVVIARQDISPQQAEALNEQLKALLEENGGHIAKIEYWGLRNLTYRIKKNRKGHYSLLAI-DAPAAAVKEMERQLLINEDVLRFMTIRVEE---LDLELSPVLARRDRERGERSERPRD 120
>gi|116490136|ref|YP_809664.1| ribosomal protein S6 [Oenococcus oeni PSU-1] >gi|118587502|ref|ZP_01544927.1| 30S ribosomal protein S6 [Oenococcus oeni ATCC BAA-1163] >gi|122277673|sp|Q04HQ7|RS6_OENOB 30S ribosomal protein S6 >gi|116090861|gb|ABJ56015.1| Ribosomal protein S6 [Oenococcus oeni PSU-1] >gi|118432152|gb|EAV38893.1| 30S ribosomal protein S6 [Oenococcus oeni ATCC BAA-1163] (146 aa)
Score = 104, Expect = 2.0e-03, Identities = 29/94 (30%), Positives = 50/94 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLI--INLEK 94
           M  YE+  +V   +++    A+     SIL  +     K E    +  AY IN   +G Y++  F +ED  ++ EF R+  +  ++LRH+I  ++LEK
  S:     1 MANYELTYIVRPDLDKDAKAALVTRFDSILSDNGAKIDKSEDWDTRRFAYEINNYRQGTYHIVTFSSEDEKAVNEFDRLAKISGDILRHMIVAVDLEK 98
>gi|29374668|ref|NP_813820.1| 30S ribosomal protein S6 [Enterococcus faecalis V583] >gi|61215751|sp|Q839Z0|RS6_ENTFA 30S ribosomal protein S6 >gi|29342126|gb|AAO79892.1| ribosomal protein S6 [Enterococcus faecalis V583] (100 aa)
Score = 104, Expect = 2.1e-03, Identities = 29/91 (31%), Positives = 51/91 (56%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGL--KDLAYPINKKSRGYYYLFNFYNEDPA-SIQEFRRVTLLKKEVLRHLIINLE 93
           KYEIM ++  +I+E   TA+     +ILK +    +E      + LAY +N    G Y++ N  +   A +I EF R+  +  +++RH+I+ +E
  S:     6 KYEIMYIIRPNIDEEAKTALVERFDTILKDNGAEVIESKDWEKRRLAYEMNGFREGIYHIVNVTSPSTAGAINEFDRLAKINDDIIRHMIVKVE 99
>gi|84517317|ref|ZP_01004671.1| ribosomal protein S6 [Loktanella vestfoldensis SKA53] >gi|84508797|gb|EAQ05260.1| ribosomal protein S6 [Loktanella vestfoldensis SKA53] (133 aa)
Score = 104, Expect = 2.1e-03, Identities = 31/93 (33%), Positives = 51/93 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           MP YE +++    +  ++A A+     +IL  +    L+ E  G+K +AY INK  +G+Y L       PA IQE  R+  L ++V+R L I ++
  S:     1 MPLYEHVMIARQDLSNTQAEALIEHFGTILADNGGKLLENEYWGVKTMAYKINKNRKGHYALLRTDAPAPA-IQEMERLMRLNEDVMRVLTIKVD 94
>gi|194246578|ref|YP_002004217.1| 30S ribosomal protein S6 [Candidatus Phytoplasma mali] >gi|193806935|emb|CAP18367.1| 30S ribosomal protein S6 [Candidatus Phytoplasma mali] (94 aa)
Score = 104, Expect = 2.2e-03, Identities = 30/93 (32%), Positives = 54/93 (58%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYEI+ ++  +I + +       +  I   + +  ++ +++GLKDLAY I+K  +GYY    F N  P  I+EF RV  + ++++R ++I  E
  S:     1 MKKYEILYIMRPNIGDEEIKKNVETINKIFYNNENKIIQSKELGLKDLAYCIDKHYKGYYVSM-FLNAMPQMIEEFNRVVKINEDIIRSIVIKEE 94
>gi|13476510|ref|NP_108080.1| 30S ribosomal protein S6 [Mesorhizobium loti MAFF303099] >gi|24212327|sp|Q984T8|RS6_RHILO 30S ribosomal protein S6 >gi|14027271|dbj|BAB54225.1| 30S ribosomal protein S6 [Mesorhizobium loti MAFF303099] (166 aa)
Score = 104, Expect = 2.2e-03, Identities = 28/93 (30%), Positives = 47/93 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE + +    + + +  A+    K ++  +     ++E  GLK L Y +NK  + YY L +  N  PA++ E  R   L ++VLR L I +E
  S:     1 MALYEHVFLARQDLSQQQVDALVEQYKGVISANGGSVGRVENWGLKSLTYRVNKNRKAYYTLMDL-NCPPAALNEMERQMGLSEDVLRFLTIKVE 94
>gi|172037638|ref|YP_001804139.1| 30s ribosomal protein S6 [Cyanothece sp. ATCC 51142] >gi|171699092|gb|ACB52073.1| 30s ribosomal protein S6 [Cyanothece sp. ATCC 51142] (119 aa)
Score = 104, Expect = 2.3e-03, Identities = 28/90 (31%), Positives = 48/90 (53%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           YE++ ++   + E +        +  L +  +TDL+ +  G + LAYPI KK  G Y  FN Y  D + +    R+  L ++V+R+L I L+
  S:     5 YEMIFILRPDLSEEQVNQAVAKYQEFLTENNATDLQTKIWGKRRLAYPIQKKVDGIYVQFN-YQADGSQVAPLERMMRLGEDVMRYLTIKLD 95
>gi|168183706|ref|ZP_02618370.1| ribosomal protein S6 [Clostridium botulinum Bf] >gi|182673234|gb|EDT85195.1| ribosomal protein S6 [Clostridium botulinum Bf] (94 aa)
Score = 104, Expect = 2.4e-03, Identities = 31/93 (33%), Positives = 50/93 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYE + +++ +++E    A     KS+++ +  T   ++  G + LAY + K S GYY L NF   D    +E  RV  +   V+RH+II  E
  S:     1 MRKYETVFILNPALDEEGYKANVEKFKSVIENAGGTVDNVDLWGKRKLAYEVKKVSEGYYTLMNF-TADTELPKELDRVFRITDTVIRHMIITQE 94
>gi|15829082|ref|NP_326442.1| 30S ribosomal protein S6 [Mycoplasma pulmonis UAB CTIP] >gi|24212329|sp|Q98PV8|RS6_MYCPU 30S ribosomal protein S6 >gi|14090026|emb|CAC13784.1| 30S RIBOSOMAL PROTEIN S6 [Mycoplasma pulmonis] (150 aa)
Score = 103, Expect = 2.5e-03, Identities = 45/141 (31%), Positives = 65/141 (46%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRIKEQVLAEQEKIRKERDNTPVK 141
           M KYEI++++D +    KA ++   LKS  K   + K EK+    LAY INK     Y L    ++    I EF R   + K   RH+IINL  + G      PKK  +  F A ++ R  E      E+ R+    +  K
  S:     1 MNKYEIVIMLDPAENIEKAQSL---LKSTFKSGVE-KFEKLEFTKLAYEINKSKVAQYVLAIVNSQGKEEINEFVRKANITKTFWRHMIINLTSEKGINKPAKPKKTFKKTFVARKFSRDDESKTHSTEEPRRANTKSTYK 137
>gi|28376981|ref|NP_783873.1| 30S ribosomal protein S6 [Lactobacillus plantarum WCFS1] >gi|32171524|sp|Q890K2|RS6_LACPL 30S ribosomal protein S6 >gi|28269812|emb|CAD62709.1| ribosomal protein S6 [Lactobacillus plantarum WCFS1] (99 aa)
Score = 103, Expect = 2.8e-03, Identities = 30/91 (32%), Positives = 50/91 (54%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKD-----LAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           KYEI  +V   I+++  TA+ +    IL   TD   + +  KD      AY I   + G Y++ N    D A++ EF R++ +  ++LRH+I+  E
  S:     6 KYEITYIVRPDIDDAAKTALVDRFDKIL---TDNGAQVIDSKDWSKRRFAYEIGGFNEGTYHIVNLTATDDAALNEFDRLSKINDDILRHMIVKRE 98
>gi|18311624|ref|NP_563558.1| 30S ribosomal protein S6 [Clostridium perfringens str. 13] >gi|169343464|ref|ZP_02864464.1| ribosomal protein S6 [Clostridium perfringens C str. JGS1495] >gi|170764006|ref|ZP_02900189.1| ribosomal protein S6 [Clostridium perfringens B str. ATCC 3626] >gi|170764180|ref|ZP_02900237.1| ribosomal protein S6 [Clostridium perfringens E str. JGS1987] >gi|170764288|ref|ZP_02900252.1| ribosomal protein S6 [Clostridium perfringens CPE str. F4969] >gi|182420538|ref|ZP_02951674.1| ribosomal protein S6 [Clostridium perfringens NCTC 8239] >gi|182626414|ref|ZP_02954167.1| ribosomal protein S6 [Clostridium perfringens D str. JGS1721] >gi|18146308|dbj|BAB82348.1| 30S ribosomal protein S6 [Clostridium perfringens str. 13] >gi|169298416|gb|EDS80505.1| ribosomal protein S6 [Clostridium perfringens C str. JGS1495] >gi|170660921|gb|EDT13604.1| ribosomal protein S6 [Clostridium perfringens E str. JGS1987] >gi|170710436|gb|EDT22618.1| ribosomal protein S6 [Clostridium perfringens B str. ATCC 3626] >gi|170713733|gb|EDT25915.1| ribosomal protein S6 [Clostridium perfringens CPE str. F4969] >gi|177908288|gb|EDT70841.1| ribosomal protein S6 [Clostridium perfringens D str. JGS1721] >gi|182379946|gb|EDT77425.1| ribosomal protein S6 [Clostridium perfringens NCTC 8239] (96 aa)
Score = 103, Expect = 2.8e-03, Identities = 30/94 (31%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYE + V   S++E    A+    K +++    T   ++  G + LAY I K + GYY L NF   +P   +E  RV  +   ++RH+I+  E+
  S:     2 MRKYETIFVAHPSLDEEAVKALIEKFKGVIENGNGTVDNVDFWGKRKLAYEIAKVNEGYYTLINF-TANPELPKELDRVFGITDGIIRHIIVKEEQ 96
>gi|161485955|ref|NP_739430.2| 30S ribosomal protein S6 [Corynebacterium efficiens YS-314] >gi|32171562|sp|Q8FLP8|RS6_COREF 30S ribosomal protein S6 (95 aa)
Score = 103, Expect = 3.0e-03, Identities = 31/94 (32%), Positives = 52/94 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M +YE+M+++D S +E       +    +++K     +K++  G + LAYPINKK  G Y + +   E  A++ E  RV  L   VLR  ++ L+K
  S:     1 MRQYELMIILDPSQDERTVAPSLDKFLEVVRKDKGDVVKVDVWGKRRLAYPINKKEEGIYAVIDLKCES-ATVLELDRVLNLNDGVLRTKVLRLDK 95
>gi|184154483|ref|YP_001842823.1| 30S ribosomal protein S6 [Lactobacillus fermentum IFO 3956] >gi|183225827|dbj|BAG26343.1| 30S ribosomal protein S6 [Lactobacillus fermentum IFO 3956] (97 aa)
Score = 103, Expect = 3.0e-03, Identities = 27/88 (30%), Positives = 44/88 (50%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           KYEI  ++   IEES  + +      IL    +T +       +  AY I K + G Y++ N   +  AS+ EF R+     ++LRH+I+
  S:     5 KYEITYIIRPDIEESAKSELVARFDKILADNGATVVDSADWDTRRFAYQIGKYTEGTYHIVNVTADSDASLNEFDRLAKFSDDILRHMIV 94
>gi|170761522|ref|YP_001788970.1| ribosomal protein S6 [Clostridium botulinum A3 str. Loch Maree] >gi|169408511|gb|ACA56922.1| ribosomal protein S6 [Clostridium botulinum A3 str. Loch Maree] (94 aa)
Score = 103, Expect = 3.0e-03, Identities = 31/93 (33%), Positives = 49/93 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYE + +++ +++E    A     K +++ S  T   ++  G + LAY + K S GYY L NF   D    +E  RV  +   V+RH+II  E
  S:     1 MRKYETVFILNPALDEEGYKANVEKFKGVIENSGGTVDNVDLWGKRKLAYEVKKVSEGYYTLMNF-TADTELPKELDRVFRITDTVIRHMIITQE 94
>gi|110799639|ref|YP_697332.1| 30S ribosomal protein S6 [Clostridium perfringens ATCC 13124] >gi|110802528|ref|YP_699891.1| 30S ribosomal protein S6 [Clostridium perfringens SM101] >gi|122958624|sp|Q0TM08|RS6_CLOP1 30S ribosomal protein S6 >gi|123145831|sp|Q0SPR6|RS6_CLOPS 30S ribosomal protein S6 >gi|24212304|sp|Q8XH43|RS6_CLOPE 30S ribosomal protein S6 >gi|110674286|gb|ABG83273.1| ribosomal protein S6 [Clostridium perfringens ATCC 13124] >gi|110683029|gb|ABG86399.1| ribosomal protein S6 [Clostridium perfringens SM101] (95 aa)
Score = 103, Expect = 3.0e-03, Identities = 30/94 (31%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYE + V   S++E    A+    K +++    T   ++  G + LAY I K + GYY L NF   +P   +E  RV  +   ++RH+I+  E+
  S:     1 MRKYETIFVAHPSLDEEAVKALIEKFKGVIENGNGTVDNVDFWGKRKLAYEIAKVNEGYYTLINF-TANPELPKELDRVFGITDGIIRHIIVKEEQ 95
>gi|149194316|ref|ZP_01871413.1| 30S ribosomal protein S6 [Caminibacter mediatlanticus TB-2] >gi|149135491|gb|EDM23970.1| 30S ribosomal protein S6 [Caminibacter mediatlanticus TB-2] (111 aa)
Score = 103, Expect = 3.1e-03, Identities = 26/90 (28%), Positives = 53/90 (58%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILK--KSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           YE M++V  ++ + +  A+ +++K ++   K   + ++ +G+++LAYPI K  RG+YY+  +Y     ++ E  R     +EVLR + +  E
  S:     6 YETMVIVKPTLTDEEKEAIIDNIKKVISDFKGEVVAVDNIGVRELAYPIEKFERGHYYII-YYKAPAEAVIELERQLRYNEEVLRFMTVKYE 96
>gi|77919595|ref|YP_357410.1| 30S ribosomal protein S6 [Pelobacter carbinolicus DSM 2380] >gi|91207926|sp|Q3A317|RS6_PELCD 30S ribosomal protein S6 >gi|77545678|gb|ABA89240.1| SSU ribosomal protein S6P [Pelobacter carbinolicus DSM 2380] (115 aa)
Score = 103, Expect = 3.1e-03, Identities = 30/96 (31%), Positives = 50/96 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILK--KSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDY 96
           M  YE +++V       +  AV    K +L    +  LK+++ G++ LAYP+ K+ RG Y L   +  DP  I E+ R   L + V++   + LEK +
  S:     1 MRTYENIMIVHPDKVADEYNAVVEKFKGVLTDLNANLLKVDEWGVRKLAYPVKKQGRGSYVL-TVFEADPTIIDEYERRLRLDEAVIKFQTVLLEKGF 97
>gi|148887425|sp|Q4A5N1|RS6_MYCS5 30S ribosomal protein S6 >gi|144575157|gb|AAZ43940.2| 30S ribosomal protein S6 [Mycoplasma synoviae 53] (156 aa)
Score = 102, Expect = 3.3e-03, Identities = 35/121 (28%), Positives = 60/121 (49%)
  Q:    16 ESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRIKEQVLAEQEKIRKERD 136
           ++ A+ V + LKS+       K EK+   +LAY INK     Y+L N   E   +I EF R++ + KE+ RHL++NL+ + G        +     FR +R    +     ++E  +K ++
  S:     7 KTSASTVESFLKSVFHDDFK-KAEKLERTELAYEINKTKHAQYFLVNLETER-KNIAEFIRLSNINKEIWRHLVVNLDTEKGLNKVFKTHRKFGHDFRDQRSHHGQAGEFRKREPQQKSKE 125
>gi|169824838|ref|YP_001692449.1| 30S ribosomal protein S6 [Finegoldia magna ATCC 29328] >gi|167831643|dbj|BAG08559.1| 30S ribosomal protein S6 [Finegoldia magna ATCC 29328] (95 aa)
Score = 102, Expect = 3.6e-03, Identities = 26/94 (27%), Positives = 54/94 (57%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLK-LEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYE++L+    + E     V + ++ ++ ++  L+ +   G + LAY IN    GYYY+ NF + DP  ++E  R   L  +++R++++ +++
  S:     1 MNKYELVLIFKPELSEEDRNTVFSRIQQVIDENGKLEEVHDWGKRKLAYEINYIKEGYYYIVNF-DLDPQFVKEIERRCRLFDQIIRYMVVRVDE 94
>gi|193214372|ref|YP_001995571.1| ribosomal protein S6 [Chloroherpeton thalassium ATCC 35110] >gi|193087849|gb|ACF13124.1| ribosomal protein S6 [Chloroherpeton thalassium ATCC 35110] (133 aa)
Score = 102, Expect = 3.7e-03, Identities = 33/91 (36%), Positives = 49/91 (53%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLE-----KMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           YE  +VVDG ++ES   A    +  ++   T L  E      +G K+LAYPI K + GYY    F   D  +++E  R   L + ++R L I L+K
  S:     5 YETTIVVDGGLDESVIAATVEKVTGLI---TSLGCEVKTVLDVGRKNLAYPIGKATIGYYVHIEF-ESDGTALKELERQYRLNESIIRFLTIILDK 96
>gi|104773264|ref|YP_618244.1| 30S ribosomal protein S6 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103422345|emb|CAI96853.1| 30S ribosomal protein S6 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (97 aa)
Score = 102, Expect = 3.8e-03, Identities = 26/92 (28%), Positives = 47/92 (51%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKM--GLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           KYEI  ++   +++    A+ +    ++  +    +E    G +  AY I K   G YY+  F  ED A++ EF R++ +   VLR + + L+K
  S:     4 KYEITYIIKPDVDDEAKKAIIDKYTKVIADNGGEMVEAKDWGKRRFAYEIEKYREGSYYIMTFTAEDAAAVNEFARLSKIDDSVLRSMTVKLDK 97
>gi|24212294|sp|Q8RIE3|RS6_FUSNN 30S ribosomal protein S6 (94 aa)
Score = 102, Expect = 3.8e-03, Identities = 29/90 (32%), Positives = 50/90 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYEIM +++ ++ E     + N + ++L    +T  K EK G + LAYPI+KK  G+Y L  F   D   + E      + + V+R++++
  S:     1 MRKYEIMYIINPTVLEEGREELVNQVNALLTSNGATIAKTEKWGERKLAYPIDKKKSGFYVLTTF-EIDGTKLAEVESKLNIMESVMRYIVV 91
>gi|162149103|ref|YP_001603564.1| 30S ribosomal protein S6 [Gluconacetobacter diazotrophicus PAl 5] >gi|187598781|ref|ZP_02985030.1| ribosomal protein S6 [Gluconacetobacter diazotrophicus PAl 5] >gi|189045471|sp|A9H1N0|RS6_GLUDA 30S ribosomal protein S6 >gi|161787680|emb|CAP57276.1| 30S ribosomal protein S6 [Gluconacetobacter diazotrophicus PAl 5] >gi|187489181|gb|EDU27133.1| ribosomal protein S6 [Gluconacetobacter diazotrophicus PAl 5] (161 aa)
Score = 102, Expect = 4.0e-03, Identities = 28/94 (29%), Positives = 51/94 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE + +    + + +  AVA+ + ++L+       K E  GL+ LAY I K  +G+Y L    +  P +I+E  R   L ++V+R L + +++
  S:     1 MPLYETVFIARNDVSQQQVEAVADGIAALLETDGGAVKKREYWGLRSLAYRIKKNRKGHYMLLGL-DAKPETIKEIERQLGLNEDVMRVLTLRVDE 95
>gi|167747440|ref|ZP_02419567.1| hypothetical protein ANACAC_02160 [Anaerostipes caccae DSM 14662] >gi|167652802|gb|EDR96931.1| hypothetical protein ANACAC_02160 [Anaerostipes caccae DSM 14662] (113 aa)
Score = 101, Expect = 4.1e-03, Identities = 33/90 (36%), Positives = 51/90 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNF--YNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYE+ LVV+  IE+     V    K+++ ++      +++ G K LAY I K   GYYY   F    E PA ++E  R+T   + VLR+L++
  S:    19 MSKYELALVVNAKIEDEARAEVVEKAKAMITEAGAEITNVDEWGKKRLAYEIQKMKEGYYYFIQFDAETEVPAVLEEKLRIT---ENVLRYLVV 109
>gi|30023498|ref|NP_835129.1| 30S ribosomal protein S6 [Bacillus cereus ATCC 14579] >gi|42784670|ref|NP_981917.1| 30S ribosomal protein S6 [Bacillus cereus ATCC 10987] >gi|167937972|ref|ZP_02525047.1| 30S ribosomal protein S6 [Bacillus cereus AH1134] >gi|168137549|ref|ZP_02580778.1| 30S ribosomal protein S6 [Bacillus cereus B4264] >gi|61215625|sp|Q72WV3|RS6_BACC1 30S ribosomal protein S6 >gi|61215739|sp|Q814G5|RS6_BACCR 30S ribosomal protein S6 >gi|29899059|gb|AAP12330.1| SSU ribosomal protein S6P [Bacillus cereus ATCC 14579] >gi|42740602|gb|AAS44525.1| ribosomal protein S6 [Bacillus cereus ATCC 10987] (96 aa)
Score = 101, Expect = 4.3e-03, Identities = 27/94 (28%), Positives = 50/94 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYEIM ++   +EE    A+      +L  +    +  ++ G + LAY IN    G+Y + N    +  +I EF R+  + +++LRH+++  E+
  S:     1 MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNV-KSNAEAINEFDRLAKINEDILRHIVVKEEE 95
>gi|154688195|ref|YP_001423356.1| 30S ribosomal protein S6 [Bacillus amyloliquefaciens FZB42] >gi|166226800|sp|A7ZAU9|RS6_BACA2 30S ribosomal protein S6 >gi|154354046|gb|ABS76125.1| RpsF [Bacillus amyloliquefaciens FZB42] (95 aa)
Score = 101, Expect = 4.4e-03, Identities = 31/94 (32%), Positives = 52/94 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKD-----LAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYE+M ++  +I+E    AV     ++L   T    E  G KD     LAY IN    G+Y + N  +E  A++ EF R+  +  +++RH+++  E+
  S:     1 MKKYEVMYIIRPNIDEESKKAVIERFNNVL---TSNGAEITGTKDWGKRRLAYEINDFRDGFYQILNVQSE-AAAVAEFDRLAKISDDIIRHIVVKEEE 95
>gi|78777857|ref|YP_394172.1| 30S ribosomal protein S6 [Sulfurimonas denitrificans DSM 1251] >gi|91207800|sp|Q30PZ4|RS6_THIDN 30S ribosomal protein S6 >gi|78498397|gb|ABB44937.1| SSU ribosomal protein S6P [Sulfurimonas denitrificans DSM 1251] (137 aa)
Score = 101, Expect = 4.5e-03, Identities = 26/95 (27%), Positives = 54/95 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKD 95
           M  YE +++V  ++   +  A  + ++ I+  +       + MG++ LAYP+ K  RGY+++  +Y+ DP++I E  R   + +E+LR + I  + +
  S:     1 MRNYENLVIVKPTLTAEEIQANISAIEEIITSNGGEIAARDAMGMRKLAYPLGKNERGYFHVI-YYSVDPSAISEIERRFRINEELLRFVTIKYDTN 96
>gi|32476151|ref|NP_869145.1| ribosomal protein S6 [Rhodopirellula baltica SH 1] >gi|61216280|sp|Q7UKV1|RS6_RHOBA 30S ribosomal protein S6 >gi|32446695|emb|CAD76531.1| probable ribosomal protein S6 [Rhodopirellula baltica SH 1] (140 aa)
Score = 101, Expect = 4.5e-03, Identities = 27/90 (30%), Positives = 51/90 (56%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKKST-DLKLEKMGL-KDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           YE + ++D +        VA  L+ ++ ++  ++++ +M + + LAYPI+K  +G YYL  F  E P ++ +  R   L + V+R L I L+
  S:     7 YETLFILDSNHYARDPGGVAKQLEELIAENGGEVQVSRMWMEQKLAYPIDKHQKGTYYLIYFSMEGP-NLTQLARAFALAEPVIRELTIKLD 97
>gi|146296357|ref|YP_001180128.1| ribosomal protein S6 [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409933|gb|ABP66937.1| SSU ribosomal protein S6P [Caldicellulosiruptor saccharolyticus DSM 8903] (124 aa)
Score = 101, Expect = 4.5e-03, Identities = 28/92 (30%), Positives = 51/92 (55%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           KYE + ++  ++++     +    K+++  +  L  +E+ G + LAY I+K + GYY L  F ++ P   +E  RV  +   V+R LI+ LEK
  S:    33 KYETVFIISPTLDDEARANLIEKFKNLISSNGQLLTVEEWGKRRLAYKIDKHAEGYYVLMQFISK-PEFPRELERVYRITDGVIRFLIVKLEK 124
>gi|27469290|ref|NP_765927.1| 30S ribosomal protein S6 [Staphylococcus epidermidis ATCC 12228] >gi|57865983|ref|YP_187644.1| 30S ribosomal protein S6 [Staphylococcus epidermidis RP62A] >gi|32171535|sp|Q8CQP4|RS6_STAES 30S ribosomal protein S6 >gi|73919119|sp|Q5HRZ5|RS6_STAEQ 30S ribosomal protein S6 >gi|27316840|gb|AAO06015.1|AE016752_48 30S ribosomal protein S6 [Staphylococcus epidermidis ATCC 12228] >gi|57636641|gb|AAW53429.1| ribosomal protein S6 [Staphylococcus epidermidis RP62A] (98 aa)
Score = 101, Expect = 4.6e-03, Identities = 29/95 (30%), Positives = 49/95 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKM--GLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKD 95
           M  YEIM +V  +IEE    A+      IL       LE+   G + LAY IN    G+Y +     ++  S  EF+R+  +  +++R+++I  ++D
  S:     1 MRTYEIMYIVRPNIEEDAKKALVERFNGILASEGSEVLEEKDWGKRRLAYEINDFKEGFYNIVRIKTDNNKSTDEFQRLAKINDDIIRYIVIREDQD 97
>gi|83311202|ref|YP_421466.1| ribosomal protein S6 [Magnetospirillum magneticum AMB-1] >gi|123542046|sp|Q2W5G8|RS6_MAGMM 30S ribosomal protein S6 >gi|82946043|dbj|BAE50907.1| Ribosomal protein S6 [Magnetospirillum magneticum AMB-1] (144 aa)
Score = 101, Expect = 4.7e-03, Identities = 31/119 (26%), Positives = 62/119 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKR 119
           M  YE + +    I   +   +  +L +I+ +   +  K E  GL+++AY + K  +G+Y L N  +   A+++E  R   + ++VLR L I +E     + +  P  +++S+ R +R +R
  S:     1 MSLYECVFIARQDISTPQVETLTEELSNIITQGGGSVSKKEYWGLRNIAYRVKKNRKGHYVLLNI-DAPSAAVKEMERQMSINEDVLRTLTIRVE-----ELEEGPSAMMQSKSRDDRPRR 115
>gi|170751791|ref|YP_001758051.1| ribosomal protein S6 [Methylobacterium radiotolerans JCM 2831] >gi|170658313|gb|ACB27368.1| ribosomal protein S6 [Methylobacterium radiotolerans JCM 2831] (154 aa)
Score = 101, Expect = 4.8e-03, Identities = 27/94 (28%), Positives = 51/94 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE +L+    +   +   + +  K +++++     K+E  G+K LAY I K  + ++ L N  +  PA+I E  R   + ++VLR + I +E+
  S:     1 MPLYEHVLLARQDVTSQQVETMIDTYKGVIEQNGGRLEKIEMWGVKSLAYRIKKNRKAHFALLNI-DAPPAAIAEMERQMQISEDVLRFMTIRVEE 95
>gi|15674173|ref|NP_268348.1| 30S ribosomal protein S6 [Lactococcus lactis subsp. lactis Il1403] >gi|13959507|sp|Q9CDM8|RS6_LACLA 30S ribosomal protein S6 >gi|12725255|gb|AAK06289.1|AE006448_7 30S ribosomal protein S6 [Lactococcus lactis subsp. lactis Il1403] (97 aa)
Score = 101, Expect = 4.8e-03, Identities = 29/93 (31%), Positives = 49/93 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGL--KDLAYPINKKSRGYYYLFNFYNEDPA-SIQEFRRVTLLKKEVLRHLIINLE 93
           M KYEI+ ++  +I+E    A+      IL  +    LE      + LAY IN    G Y++  F  E  + ++ EF R+  +  ++LRH+I+ +E
  S:     1 MTKYEILYIIRPNIDEEAKAALVERFDGILTDNGAANLESKDWEKRKLAYEINDFREGIYHIATFEAETTSEALSEFDRLAKINLDILRHMIVKVE 96
>gi|19704978|ref|NP_602473.1| SSU ribosomal protein S6P [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19712882|gb|AAL93772.1| SSU ribosomal protein S6P [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (105 aa)
Score = 101, Expect = 4.9e-03, Identities = 29/90 (32%), Positives = 50/90 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYEIM +++ ++ E     + N + ++L    +T  K EK G + LAYPI+KK  G+Y L  F   D   + E      + + V+R++++
  S:    12 MRKYEIMYIINPTVLEEGREELVNQVNALLTSNGATIAKTEKWGERKLAYPIDKKKSGFYVLTTF-EIDGTKLAEVESKLNIMESVMRYIVV 102
>gi|187777388|ref|ZP_02993861.1| hypothetical protein CLOSPO_00944 [Clostridium sporogenes ATCC 15579] >gi|187774316|gb|EDU38118.1| hypothetical protein CLOSPO_00944 [Clostridium sporogenes ATCC 15579] (94 aa)
Score = 101, Expect = 5.0e-03, Identities = 30/93 (32%), Positives = 49/93 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYE + +++ +++E    A     K +++ +  T   ++  G + LAY + K S GYY L NF   D    +E  RV  +   V+RH+II  E
  S:     1 MRKYETVFILNPALDEEGYKANVEKFKGVIENAGGTVDNVDLWGKRKLAYEVKKVSEGYYTLMNF-TADTELPKELDRVFRITDSVIRHMIITQE 94
>gi|126701291|ref|YP_001090188.1| 30S ribosomal protein S6 [Clostridium difficile 630] >gi|145952500|ref|ZP_01801510.1| hypothetical protein CdifQ_04004251 [Clostridium difficile QCD-32g58] >gi|168695979|ref|ZP_02728256.1| 30S ribosomal protein S6 [Clostridium difficile QCD-37x79] >gi|168714873|ref|ZP_02747150.1| 30S ribosomal protein S6 [Clostridium difficile QCD-63q42] >gi|168724956|ref|ZP_02757233.1| 30S ribosomal protein S6 [Clostridium difficile QCD-76w55] >gi|168732192|ref|ZP_02764469.1| 30S ribosomal protein S6 [Clostridium difficile QCD-97b34] >gi|196124287|ref|ZP_03116036.1| 30S ribosomal protein S6 [Clostridium difficile ATCC 43255] >gi|196160203|ref|ZP_03120764.1| 30S ribosomal protein S6 [Clostridium difficile CIP 107932] >gi|196163201|ref|ZP_03123732.1| 30S ribosomal protein S6 [Clostridium difficile QCD-23m63] >gi|123066511|sp|Q181R5|RS6_CLOD6 30S ribosomal protein S6 >gi|115252728|emb|CAJ70572.1| 30S ribosomal protein S6 [Clostridium difficile 630] (92 aa)
Score = 101, Expect = 5.0e-03, Identities = 29/90 (32%), Positives = 50/90 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YE++ VV  + +E    A+ N +K ++    ++ K++  G K LAYPI K + G+Y L NF +      +E  R   + + V+RH+I+
  S:     1 MRNYELVYVVKPNSDEEVREAILNKVKEVVATDGEIVKVDTWGTKKLAYPIAKFTEGFYVLVNFKSAVDVP-KEIDRNLKINENVIRHMIV 90
>gi|148323619|gb|EDK88869.1| ribosomal protein S6 [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (94 aa)
Score = 101, Expect = 5.2e-03, Identities = 29/90 (32%), Positives = 50/90 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYEIM +++ ++ E     + N + ++L    +T  K EK G + LAYPI+KK  G+Y L  F   D   + E      + + V+R++++
  S:     1 MRKYEIMYIINPTVLEEGREELINQVNALLTSNGATIAKTEKWGERKLAYPIDKKKSGFYVLTTF-EIDGTKLAEVESKLNIMESVMRYIVV 91
>gi|148381565|ref|YP_001256106.1| ribosomal protein S6 [Clostridium botulinum A str. ATCC 3502] >gi|153934321|ref|YP_001385942.1| 30S ribosomal protein S6 [Clostridium botulinum A str. ATCC 19397] >gi|153934983|ref|YP_001389349.1| 30S ribosomal protein S6 [Clostridium botulinum A str. Hall] >gi|166226821|sp|A7FZH1|RS6_CLOB1 30S ribosomal protein S6 >gi|166226822|sp|A5I801|RS6_CLOBH 30S ribosomal protein S6 >gi|148291049|emb|CAL85186.1| 30S ribosomal protein S6 [Clostridium botulinum A str. ATCC 3502] >gi|152930365|gb|ABS35865.1| ribosomal protein S6 [Clostridium botulinum A str. ATCC 19397] >gi|152930897|gb|ABS36396.1| ribosomal protein S6 [Clostridium botulinum A str. Hall] (94 aa)
Score = 100, Expect = 5.6e-03, Identities = 30/93 (32%), Positives = 49/93 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYE + +++ +++E    A     K +++ +  T   ++  G + LAY + K S GYY L NF   D    +E  RV  +   V+RH+II  E
  S:     1 MRKYETVFILNPTLDEEGYKANVEKFKGVIENAGGTVDNVDLWGKRKLAYEVKKVSEGYYTLMNF-TADTELPKELDRVFRITDTVIRHMIITQE 94
>gi|153941470|ref|YP_001392984.1| 30S ribosomal protein S6 [Clostridium botulinum F str. Langeland] >gi|168181095|ref|ZP_02615759.1| ribosomal protein S6 [Clostridium botulinum NCTC 2916] >gi|170755574|ref|YP_001783263.1| ribosomal protein S6 [Clostridium botulinum B1 str. Okra] >gi|166226823|sp|A7GJM4|RS6_CLOBL 30S ribosomal protein S6 >gi|152937366|gb|ABS42864.1| ribosomal protein S6 [Clostridium botulinum F str. Langeland] >gi|169120786|gb|ACA44622.1| ribosomal protein S6 [Clostridium botulinum B1 str. Okra] >gi|182668139|gb|EDT80118.1| ribosomal protein S6 [Clostridium botulinum NCTC 2916] (94 aa)
Score = 100, Expect = 5.7e-03, Identities = 30/93 (32%), Positives = 49/93 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYE + +++ +++E    A     K +++ +  T   ++  G + LAY + K S GYY L NF   D    +E  RV  +   V+RH+II  E
  S:     1 MRKYETVFILNPALDEEGYKANVEKFKGVIENAGGTVDNVDLWGKRKLAYEVKKVSEGYYTLMNF-TADTELPKELDRVFRITDTVIRHMIITQE 94
>gi|167038654|ref|YP_001666232.1| 30S ribosomal protein S6 [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167041004|ref|YP_001663989.1| 30S ribosomal protein S6 [Thermoanaerobacter sp. X514] >gi|166855244|gb|ABY93653.1| ribosomal protein S6 [Thermoanaerobacter sp. X514] >gi|166857488|gb|ABY95896.1| ribosomal protein S6 [Thermoanaerobacter pseudethanolicus ATCC 33223] (95 aa)
Score = 100, Expect = 5.9e-03, Identities = 31/94 (32%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE M ++   + E +   +    K+++ ++       ++ G + LAY I+KK  GYY L NF N D    QE  RV  +   VLR+LII  ++
  S:     1 MRSYETMYILSPDLSEEERKGLIERFKNLIIENGGEITNFDEWGKRKLAYLIDKKPEGYYVLMNF-NSDSKVSQELERVYKITDGVLRYLIIRTDE 95
>gi|83319327|ref|YP_424022.1| 30S ribosomal protein S6 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|91207919|sp|Q2ST91|RS6_MYCCT 30S ribosomal protein S6 >gi|83283213|gb|ABC01145.1| 30S ribosomal protein S6 [Mycoplasma capricolum subsp. capricolum ATCC 27343] (137 aa)
Score = 100, Expect = 5.9e-03, Identities = 36/134 (26%), Positives = 68/134 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD-LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERY--KRIKEQVLAEQEKIRKE 134
           + KYE+M ++D  ++++K   +   L  IL +    L+   +GL D  Y IN K +G+Y++         +I+EF R+  + K V+R L++N +    Y+      K   ++F  E+   K  ++  +  +E   KE
  S:     2 IKKYEVMYILDQDLKDTKE--LVAKLDGILSEGGQILESNDLGLLDFTYEINHKKKGFYHIV-IVQATTQAIKEFERIAKIDKNVVRTLVLNTQNIQNYEQSVVLSKTDMTKFEEEQREKKNFRKPFIKREEAATKE 135
>gi|163736680|ref|ZP_02144099.1| 30S ribosomal protein S6 [Phaeobacter gallaeciensis BS107] >gi|163742693|ref|ZP_02150078.1| ribosomal protein S6 [Phaeobacter gallaeciensis 2.10] >gi|161383948|gb|EDQ08332.1| ribosomal protein S6 [Phaeobacter gallaeciensis 2.10] >gi|161390550|gb|EDQ14900.1| 30S ribosomal protein S6 [Phaeobacter gallaeciensis BS107] (117 aa)
Score = 100, Expect = 6.1e-03, Identities = 27/93 (29%), Positives = 49/93 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           MP YE +++    +  S+A  +     ++L  +  + +  E  G+K +AY INK  +G+Y      +   A+IQE  R+  L  +V+R L I ++
  S:     1 MPLYEHVMIARQDLSNSQAEGLIEHFGAVLSDNGGSLVDSEYWGVKTMAYKINKNRKGHYSFLK-TDASAAAIQEMERLMRLHDDVMRVLTIKVD 94
>gi|110598898|ref|ZP_01387147.1| ribosomal protein S6 [Chlorobium ferrooxidans DSM 13031] >gi|110339489|gb|EAT58015.1| ribosomal protein S6 [Chlorobium ferrooxidans DSM 13031] (133 aa)
Score = 100, Expect = 6.1e-03, Identities = 27/89 (30%), Positives = 50/89 (56%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           YE  +++DG +++   TA    ++ ++  K  +   + ++G +  AYPI K++ GYY    F    P  I E  +V   ++++LR+LII L
  S:     7 YECTVIIDGGLQDEAITAAMELVQRVITEKGGSISGVLEIGRRKTAYPIKKRTIGYYAHIEFTGA-PGVIAEIEKVLRYEEDLLRYLIIQL 96
>gi|108803691|ref|YP_643628.1| SSU ribosomal protein S6P [Rubrobacter xylanophilus DSM 9941] >gi|108764934|gb|ABG03816.1| ribosomal protein S6 [Rubrobacter xylanophilus DSM 9941] (147 aa)
Score = 100, Expect = 6.3e-03, Identities = 24/93 (25%), Positives = 52/93 (55%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKKSTDLKL---EKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDY 96
           YE+ML++   ++E +  +  +  +++++++    +      G + LAY I+ +S  YY +  F   D  ++ E +R+  +  +VLRH+I+ L   Y
  S:    38 YEVMLIIIPELDEEQVQSTVSRFRTVIERTGGEVVGEPNHWGKRKLAYEIDHRSDAYYVVMEFTAGD-RTLVELKRILRVSDDVLRHMIVKLPPGY 132
>gi|34763884|ref|ZP_00144788.1| SSU ribosomal protein S6P [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886347|gb|EAA23618.1| SSU ribosomal protein S6P [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (105 aa)
Score = 100, Expect = 6.4e-03, Identities = 29/90 (32%), Positives = 50/90 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYEIM +++ ++ E     + N + ++L    +T  K EK G + LAYPI+KK  G+Y L  F   D   + E      + + V+R++++
  S:    12 MRKYEIMYIINPTVLEEGREELINQVNALLTSNGATIAKTEKWGERKLAYPIDKKKSGFYVLTTF-EIDGTKLAEVESKLNIMESVMRYIVV 102
>gi|125974672|ref|YP_001038582.1| SSU ribosomal protein S6P [Clostridium thermocellum ATCC 27405] >gi|196252198|ref|ZP_03150859.1| ribosomal protein S6 [Clostridium thermocellum DSM 4150] >gi|125714897|gb|ABN53389.1| SSU ribosomal protein S6P [Clostridium thermocellum ATCC 27405] >gi|196198331|gb|EDX93167.1| ribosomal protein S6 [Clostridium thermocellum DSM 4150] (95 aa)
Score = 100, Expect = 6.5e-03, Identities = 26/92 (28%), Positives = 51/92 (55%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDLK-LEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           KYE + +++  + E +  A+   +K  ++ S  L+ +++ G + LAYPI+  + GYY L NF   D    +E  R+  +   +++ +I+  EK
  S:     4 KYETIFIINPELSEEETKALVEKIKGTIEASAQLESIDEWGKRKLAYPIDHFNEGYYVLANF-TADSNFPRELERIFRITDGIIKDIIVKREK 95
>gi|23494664|dbj|BAC19630.1| putative 30S ribosomal protein S6 [Corynebacterium efficiens YS-314] (99 aa)
Score = 100, Expect = 6.6e-03, Identities = 30/92 (32%), Positives = 51/92 (55%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           +YE+M+++D S +E       +    +++K     +K++  G + LAYPINKK  G Y + +   E  A++ E  RV  L   VLR  ++ L+K
  S:     7 QYELMIILDPSQDERTVAPSLDKFLEVVRKDKGDVVKVDVWGKRRLAYPINKKEEGIYAVIDLKCES-ATVLELDRVLNLNDGVLRTKVLRLDK 99
>gi|150387885|ref|YP_001317934.1| ribosomal protein S6 [Alkaliphilus metalliredigens QYMF] >gi|167011241|sp|A6TJA7|RS6_ALKMQ 30S ribosomal protein S6 >gi|149947747|gb|ABR46275.1| ribosomal protein S6 [Alkaliphilus metalliredigens QYMF] (94 aa)
Score = 100, Expect = 6.8e-03, Identities = 28/94 (29%), Positives = 54/94 (57%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLK-LEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYE+  ++    +E K   +A   K I++    ++ +++ G + LAY I+K++ GYY L NF +      +E  R   + ++V+RH+II +++
  S:     1 MNKYELTYILKSETDEEKRNQLAEKFKGIIEADGAVENVDEWGNRKLAYEIDKRNEGYYVLVNFASSIDVP-KELDRNLKIAEQVIRHMIIRIQE 94
>gi|118726030|ref|ZP_01574663.1| ribosomal protein S6 [Clostridium cellulolyticum H10] >gi|118664586|gb|EAV71215.1| ribosomal protein S6 [Clostridium cellulolyticum H10] (94 aa)
Score = 99, Expect = 7.1e-03, Identities = 26/90 (28%), Positives = 51/90 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLK-LEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           +  YE + +++  + E    A+    K++L+ S  L+ +++ G + LAY I+ K+ GYY L NF +  P    E  R+  + + +L+++II
  S:     2 LKNYETIFIINSEVGEENTKALVEKFKTMLETSAQLESMDEWGKRKLAYEIDDKTEGYYVLANF-SSSPDFPAELERMYKITEGILKYIII 91
>gi|170077069|ref|YP_001733707.1| ribosomal protein S6 [Synechococcus sp. PCC 7002] >gi|169884738|gb|ACA98451.1| ribosomal protein S6 [Synechococcus sp. PCC 7002] (115 aa)
Score = 99, Expect = 7.2e-03, Identities = 28/92 (30%), Positives = 52/92 (56%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKD 95
           YE+M ++   + E +   V++  K++L+ S  +DL+++  G + LAYPI   + G Y   N Y  D + I+   R   L + V+R+L + L+ +
  S:     5 YEMMYILRPDLSEEQVQEVSSKYKTMLQDSGASDLQVQVRGKRHLAYPIQNFNDGIYIQVN-YKADGSQIKAVERDMRLGEMVIRYLTMKLDAE 97
>gi|161611250|ref|NP_950261.2| 30S ribosomal protein S6 [Onion yellows phytoplasma OY-M] >gi|61216244|sp|Q6YRK5|RS6_ONYPE 30S ribosomal protein S6 (95 aa)
Score = 99, Expect = 7.2e-03, Identities = 27/90 (30%), Positives = 52/90 (57%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEK--MGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYEIM ++  +++      + + L+++  ++ +  LE+  +GLKDLAY I+   +GYY        D  ++ EF R+  + +E++R + I
  S:     1 MKKYEIMYILRPNLDSKDVKKINDTLQNVFLQAPNQILEQNEIGLKDLAYLIDNHKKGYYNWL-MVKADNDAVLEFNRIVKITEEIIRFIFI 91
>gi|15612232|ref|NP_223885.1| 30S ribosomal protein S6 [Helicobacter pylori J99] >gi|7388226|sp|Q9ZJY1|RS6_HELPJ 30S ribosomal protein S6 >gi|4155764|gb|AAD06741.1| 30S RIBOSOMAL PROTEIN S6 [Helicobacter pylori J99] (142 aa)
Score = 99, Expect = 7.3e-03, Identities = 28/93 (30%), Positives = 51/93 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEK--MGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE M ++  ++ E +  +     + ++ K   +      MG+++LAY I K  RGYYY+  ++  DP+ I E  R+  + ++VLR ++I  E
  S:     1 MRHYETMFILKPTLVEEEIKSKIEFYREVITKHHGVIETSLDMGMRNLAYEIKKHKRGYYYV-AYFKADPSMILELERLYRINEDVLRFIVIKYE 94
>gi|163790925|ref|ZP_02185348.1| ribosomal protein S6 [Carnobacterium sp. AT7] >gi|159873767|gb|EDP67848.1| ribosomal protein S6 [Carnobacterium sp. AT7] (99 aa)
Score = 99, Expect = 7.4e-03, Identities = 28/91 (30%), Positives = 47/91 (51%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKM--GLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           KYEI+ ++  +IEE++ TA+     +ILK +     E      +  AY I     G Y++      D  +I EF R++ +  ++LRH+ I  E
  S:     6 KYEILYIIRPNIEEAEKTALVERFDTILKDNGAEITESKDWSKRRFAYEIKDFHEGIYHIVKLTANDAVAINEFDRLSKISPDILRHMTIREE 98
>gi|42560587|ref|NP_975038.1| 30S ribosomal protein S6 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|61215588|sp|Q6MUK4|RS6_MYCMS 30S ribosomal protein S6 >gi|42492083|emb|CAE76680.1| 30S ribosomal protein S6 [Mycoplasma mycoides subsp. mycoides SC str. PG1] (137 aa)
Score = 99, Expect = 8.6e-03, Identities = 32/119 (26%), Positives = 65/119 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD-LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKR 119
           + KYE+M ++D  ++++K   + + L +IL ++   L+   +GL D  Y IN K +G+Y++         +I+EF R+  + K V+R L++N E    Y+      K   +++  E+ ++
  S:     2 IKKYEVMYILDQDVKDTKE--LVSKLDAILAENGKILESNDLGLLDFTYEINHKKKGFYHVV-IVEATTQAIKEFERIAKIDKNVVRTLVLNTENIQNYEQSVVLSKTDMTKYEEEQREK 118
>gi|108563614|ref|YP_627930.1| 30S ribosomal protein S6 [Helicobacter pylori HPAG1] >gi|123073733|sp|Q1CS16|RS6_HELPH 30S ribosomal protein S6 >gi|107837387|gb|ABF85256.1| ribosomal protein S6 [Helicobacter pylori HPAG1] (142 aa)
Score = 99, Expect = 8.6e-03, Identities = 28/93 (30%), Positives = 51/93 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEK--MGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE M ++  ++ E +  +     K ++ K   +      MG+++LAY I K  RGYYY+  ++  +P+ I E  R+  + ++VLR ++I  E
  S:     1 MRHYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYYYV-AYFKAEPSMILELERLYRINEDVLRFIVIKYE 94
>gi|89897782|ref|YP_521269.1| 30S ribosomal protein S6 [Desulfitobacterium hafniense Y51] >gi|109647904|ref|ZP_01371807.1| ribosomal protein S6 [Desulfitobacterium hafniense DCB-2] >gi|122480435|sp|Q24MB7|RS6_DESHY 30S ribosomal protein S6 >gi|89337230|dbj|BAE86825.1| 30S ribosomal protein S6 [Desulfitobacterium hafniense Y51] >gi|109640994|gb|EAT50549.1| ribosomal protein S6 [Desulfitobacterium hafniense DCB-2] (95 aa)
Score = 99, Expect = 8.6e-03, Identities = 26/93 (27%), Positives = 47/93 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE++ V+   +++    A  + L  ++  +   D+ ++K G + LAY +N    G+Y L NF N +  + QE  R+  +   V+R L    E
  S:     1 MKAYEVLYVIRPDLDDEAVAATVDKLSEVVTNNGGADVAIDKWGKRRLAYEVNDYREGFYILMNF-NGEARTAQEVERIMKISDAVVRFLTTKKE 94
>gi|16125915|ref|NP_420479.1| ribosomal protein S6 [Caulobacter crescentus CB15] >gi|24212335|sp|Q9A7Q1|RS6_CAUCR 30S ribosomal protein S6 >gi|13423077|gb|AAK23647.1| ribosomal protein S6 [Caulobacter crescentus CB15] (126 aa)
Score = 99, Expect = 8.7e-03, Identities = 29/94 (30%), Positives = 53/94 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE +++    I   +A A+   LK++++++     K+E  GL++L Y I K  +G+Y L       PA ++E  R  L+ ++VLR + I +E+
  S:     1 MAFYEHVVIARQDISPQQAEALNEQLKALIEENGGHIAKIEYWGLRNLTYRIKKNRKGHYSLLAIDAPAPA-VKEMERQLLINEDVLRFMTIRVEE 95
>gi|15645860|ref|NP_208038.1| 30S ribosomal protein S6 [Helicobacter pylori 26695] >gi|2500411|sp|P56013|RS6_HELPY 30S ribosomal protein S6 >gi|2314412|gb|AAD08292.1| ribosomal protein S6 (rps6) [Helicobacter pylori 26695] (142 aa)
Score = 99, Expect = 8.8e-03, Identities = 28/93 (30%), Positives = 51/93 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEK--MGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE M ++  ++ E +  +     K ++ K   +      MG+++LAY I K  RGYYY+  ++  +P+ I E  R+  + ++VLR ++I  E
  S:     1 MRHYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYYYV-AYFKAEPSMIVELERLYRINEDVLRFIVIKYE 94
>gi|114800162|ref|YP_760858.1| ribosomal protein S6 [Hyphomonas neptunium ATCC 15444] >gi|123323137|sp|Q0C085|RS6_HYPNA 30S ribosomal protein S6 >gi|114740336|gb|ABI78461.1| ribosomal protein S6 [Hyphomonas neptunium ATCC 15444] (112 aa)
Score = 98, Expect = 9.5e-03, Identities = 29/93 (31%), Positives = 54/93 (58%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPA-SIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE +++    I  ++  +   ++ + LK+  +T  K E  GL+ LAYPI K+ +G+Y L N   + PA +I E  R   + ++V+R++ + +E
  S:     1 MALYEHVVITRPDISPAQVESFIEEMTTFLKEKGATVGKTEYWGLRSLAYPIKKQRKGHYSLINI--DGPADAIHELERRQRIAEDVMRYMTVRVE 94
>gi|116750609|ref|YP_847296.1| ribosomal protein S6 [Syntrophobacter fumaroxidans MPOB] >gi|166227396|sp|A0LN59|RS6_SYNFM 30S ribosomal protein S6 >gi|116699673|gb|ABK18861.1| SSU ribosomal protein S6P [Syntrophobacter fumaroxidans MPOB] (147 aa)
Score = 98, Expect = 9.7e-03, Identities = 30/96 (31%), Positives = 47/96 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDY 96
           M KYE   ++D  + +    AV   +KS++  +    +     G K LAYP+ K+SRG Y L   Y  D   + E  R   L + VL+ + + L+  Y
  S:     1 MRKYETFFIIDPDLPDEVTAAVDEKIKSVVGANGGDVVSYVPWGKKKLAYPVKKRSRGLYVLME-YAGDSRLVAELERNMRLDERVLKFITVKLDDRY 97
>gi|188528036|ref|YP_001910723.1| 30S ribosomal protein S6 [Helicobacter pylori Shi470] >gi|188144276|gb|ACD48693.1| 30S ribosomal protein S6 [Helicobacter pylori Shi470] (142 aa)
Score = 98, Expect = 9.8e-03, Identities = 28/93 (30%), Positives = 51/93 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEK--MGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE M ++  ++ E +  +     K ++ K   +      MG+++LAY I K  RGYYY+  ++  +P+ I E  R+  + ++VLR ++I  E
  S:     1 MRHYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYYYV-AYFKANPSMILELERLYRINEDVLRFIVIKYE 94
>gi|167925660|ref|ZP_02512751.1| 30S ribosomal protein S6 [Mycoplasma mycoides subsp. mycoides LC str. GM12] (137 aa)
Score = 98, Expect = 9.9e-03, Identities = 32/119 (26%), Positives = 64/119 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD-LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKR 119
           + KYE+M ++D  ++++K   +   L +IL ++   L+   +GL D  Y IN K +G+Y++         +I+EF R+  + K V+R L++N E    Y+      K   +++  E+ ++
  S:     2 IKKYEVMYILDQDVKDTKE--LVTKLDAILAENGKILESNDLGLLDFTYEINHKKKGFYHVV-IVEATTQAIKEFERIAKIDKNVVRTLVLNTENIQNYEQSVVLSKTDMTKYEEEQREK 118
>gi|189345696|ref|YP_001942225.1| ribosomal protein S6 [Chlorobium limicola DSM 245] >gi|189339843|gb|ACD89246.1| ribosomal protein S6 [Chlorobium limicola DSM 245] (133 aa)
Score = 98, Expect = 1.0e-02, Identities = 27/89 (30%), Positives = 50/89 (56%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           YE  +++DG +++    A    ++ ++  K  +   + ++G +  AYPINKK+ GYY    F    P  I    +V   ++++LR+LII+L
  S:     7 YECTVIIDGGLQDEAIAAAMEMVQKVITEKGGSISSVLEVGRRKTAYPINKKTIGYYAHIEFTAAAPV-IGAIEKVLRYEEDLLRYLIIHL 96
>gi|19554176|ref|NP_602178.1| 30S ribosomal protein S6 [Corynebacterium glutamicum ATCC 13032] >gi|62391830|ref|YP_227232.1| 30S ribosomal protein S6 [Corynebacterium glutamicum ATCC 13032] >gi|24212283|sp|Q8NLF9|RS6_CORGL 30S ribosomal protein S6 >gi|21325756|dbj|BAC00377.1| Ribosomal protein S6 [Corynebacterium glutamicum ATCC 13032] >gi|41222977|emb|CAF18922.1| RIBOSOMAL PROTEIN S6 [Corynebacterium glutamicum ATCC 13032] (95 aa)
Score = 98, Expect = 1.0e-02, Identities = 30/94 (31%), Positives = 52/94 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M +YE+M+++D S +E       +    +++K     +K++  G + LAYPI+KK  G Y + +   E  A++ E  RV  L   VLR  ++ L+K
  S:     1 MRQYELMIILDPSQDERTVAPSLDKFLEVVRKDKGDVVKVDVWGKRRLAYPIDKKEEGVYAVVDLKCES-ATVLELDRVLNLNDGVLRTKVLRLDK 95
>gi|154482842|ref|ZP_02025290.1| hypothetical protein EUBVEN_00538 [Eubacterium ventriosum ATCC 27560] >gi|149736270|gb|EDM52156.1| hypothetical protein EUBVEN_00538 [Eubacterium ventriosum ATCC 27560] (96 aa)
Score = 98, Expect = 1.1e-02, Identities = 28/93 (30%), Positives = 49/93 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYE+ +VV   +++   TA    +K++++K   T  K+E+ G K LAY I K S  +YY  +   E+     E      + + V+R + + +E
  S:     1 MNKYELTVVVSAKLDDEGRTAEVEKVKALIEKFGGTITKIEEAGKKKLAYEIQKMSEAFYYFIDIDTENTDFPSELESQLRIMENVIRFMTVAVE 95
>gi|126735965|ref|ZP_01751709.1| ribosomal protein S6 [Roseobacter sp. CCS2] >gi|126714522|gb|EBA11389.1| ribosomal protein S6 [Roseobacter sp. CCS2] (117 aa)
Score = 98, Expect = 1.1e-02, Identities = 28/93 (30%), Positives = 50/93 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           MP YE +++    +  ++A ++     ++L  +    L+ E  G+K +AY INK  +G+Y         PA IQE  R+  L ++V+R L I ++
  S:     1 MPLYEHVMIARQDLSNTQAESLIEHFGTVLADNGGKLLENEYWGVKTMAYKINKNRKGHYAFMRTDAPAPA-IQEMERLMRLHEDVMRVLTIKVD 94
>gi|86357078|ref|YP_468970.1| 30S ribosomal protein S6 [Rhizobium etli CFN 42] >gi|123512430|sp|Q2KA93|RS6_RHIEC 30S ribosomal protein S6 >gi|86281180|gb|ABC90243.1| 30S ribosomal protein S6 [Rhizobium etli CFN 42] (152 aa)
Score = 98, Expect = 1.1e-02, Identities = 32/119 (26%), Positives = 59/119 (49%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKR 119
           M  YE + +    I   +  A+    K +++ +     ++E  GLK L Y I K  + +Y L +  +  PA+IQE  R   + ++VLR++ I +EK      +  P  +++ + R +R  R
  S:     1 MALYEHVFLARQDISAQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHYALMDI-DAPPAAIQEMERQMRISEDVLRYMTIAVEKH-----EEGPSAMLQKRDRDDRGPR 115
>gi|83591754|ref|YP_425506.1| SSU ribosomal protein S6P [Rhodospirillum rubrum ATCC 11170] >gi|91207786|sp|Q2RXC6|RS6_RHORT 30S ribosomal protein S6 >gi|83574668|gb|ABC21219.1| SSU ribosomal protein S6P [Rhodospirillum rubrum ATCC 11170] (160 aa)
Score = 98, Expect = 1.1e-02, Identities = 27/94 (28%), Positives = 50/94 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE +L+    I  ++   + +++ +IL +   +  K E  GL+ L + I K  +G+Y L N     PA + E  R   L ++V+RH+ + +E+
  S:     1 MALYECVLIARQDISNAQVDTMGDEVSAILSEGGGSVSKREYWGLRTLNFRIKKNRKGHYLLLNIDAPAPA-VHELDRRLRLNEDVIRHMTVKVEE 95
>gi|56552121|ref|YP_162960.1| 30S ribosomal protein S6 [Zymomonas mobilis subsp. mobilis ZM4] >gi|61216127|sp|Q5NN61|RS6_ZYMMO 30S ribosomal protein S6 >gi|56543695|gb|AAV89849.1| ribosomal protein S6 [Zymomonas mobilis subsp. mobilis ZM4] (124 aa)
Score = 98, Expect = 1.1e-02, Identities = 27/93 (29%), Positives = 53/93 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPA-SIQEFRRVTLLKKEVLRHLIINLE 93
           MP YE + +    + +++   +A    SI+++ +   +K E  GL++LAY I K  + YY +     + PA +IQE  R   L ++V+R++ + ++
  S:     1 MPLYEHVFLARQDLAQTQVDGLAATATSIIEEKSGKVVKTEIWGLRNLAYRIQKNRKAYYIMLEI--DAPADAIQELERQMALNEDVIRYMTVRVD 94
>gi|62425122|ref|ZP_00380259.1| COG0360: Ribosomal protein S6 [Brevibacterium linens BL2] (96 aa)
Score = 98, Expect = 1.1e-02, Identities = 29/90 (32%), Positives = 48/90 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YE+ML++D   +E       + L  ++  +  T   ++  G +  AY I KKS G+Y + +F+ E PA+ +E  R   L + VLR  I+
  S:     1 MRHYELMLILDNETDERTLADTVDKLMKVVPAENGTVDNVDIWGRRRFAYDIQKKSEGFYVVVDFHAE-PATTKELDRQLGLNESVLRTKIL 91
>gi|58038781|ref|YP_190745.1| SSU ribosomal protein S6P [Gluconobacter oxydans 621H] >gi|81352549|sp|Q5FU57|RS6_GLUOX 30S ribosomal protein S6 >gi|58001195|gb|AAW60089.1| SSU ribosomal protein S6P [Gluconobacter oxydans 621H] (160 aa)
Score = 98, Expect = 1.2e-02, Identities = 27/94 (28%), Positives = 53/94 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE +L+    + +++   +   ++++LK +  +  K E  GL+ LAY I K  +G+Y L    +  P +++E  R   L ++VLR L + +++
  S:     1 MPLYESVLIARNDVSQAQVETLVETIETLLKDNGGSIQKREFWGLRSLAYRIKKNRKGHYVLLGL-DCTPDTLRELERQLGLNEDVLRVLTLRVDE 95
>gi|184201985|ref|YP_001856192.1| 30S ribosomal protein S6 [Kocuria rhizophila DC2201] >gi|183582215|dbj|BAG30686.1| 30S ribosomal protein S6 [Kocuria rhizophila DC2201] (101 aa)
Score = 97, Expect = 1.2e-02, Identities = 33/94 (35%), Positives = 50/94 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M +YE+M++++  +EE            ++ K   T  KL+  G + LAY I KKS G Y + NF  E P + +E  RV  L + V+R  II  E+
  S:     1 MREYELMVILNPEVEERAVEPTLKKFLEVVTKENGTVDKLDIWGRRRLAYEIQKKSEGIYAVVNFTAE-PQTAKELDRVLSLNEAVMRTKIIRPEE 95
>gi|109946866|ref|YP_664094.1| 30S ribosomal protein S6 [Helicobacter acinonychis str. Sheeba] >gi|123362772|sp|Q17Z31|RS6_HELAH 30S ribosomal protein S6 >gi|109714087|emb|CAJ99095.1| 30S ribosomal protein S6 [Helicobacter acinonychis str. Sheeba] (142 aa)
Score = 97, Expect = 1.2e-02, Identities = 27/93 (29%), Positives = 51/93 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEK--MGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE M ++  ++ E +  +     K ++ K   +      MG+++LAY I K  RGYYY+  ++  +P+ I E  R+  + ++VLR ++I  +
  S:     1 MRHYETMFILKPTLVEEEIKSKIEFYKEVITKHNGVIETSLDMGMRNLAYEIKKHKRGYYYVM-YFKAEPSMILELERLYRINEDVLRFIVIKYD 94
>gi|153810613|ref|ZP_01963281.1| hypothetical protein RUMOBE_00994 [Ruminococcus obeum ATCC 29174] >gi|149833792|gb|EDM88873.1| hypothetical protein RUMOBE_00994 [Ruminococcus obeum ATCC 29174] (95 aa)
Score = 97, Expect = 1.3e-02, Identities = 31/90 (34%), Positives = 44/90 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYE+ LVV   +E+    AV    KS + +      ++E+ G K LAY I K   G+YY   F   D     E  R   +   VLR+L++
  S:     1 MNKYELALVVSAKVEDEVRDAVVEKAKSYIARYNGNVTEVEEWGKKKLAYEIQKMHEGFYYFIQF-EADAQCPAEVERHVRIMDNVLRYLVV 91
>gi|194335286|ref|YP_002017080.1| ribosomal protein S6 [Pelodictyon phaeoclathratiforme BU-1] >gi|194307763|gb|ACF42463.1| ribosomal protein S6 [Pelodictyon phaeoclathratiforme BU-1] (134 aa)
Score = 97, Expect = 1.3e-02, Identities = 31/89 (34%), Positives = 53/89 (59%)
  Q:     4 YEIMLVVDGSIE-ESKATAVANDLKSILKKSTDLK-LEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           YE  L++DG ++ E+ A A+A   + I +K   +  + ++G +  AYPI KK+ GYY    F     + I E  +V   ++++LR+LII+L
  S:     7 YECTLIIDGGLQDEAIAAAMALVQRVITEKGGSISSVLEIGRRKTAYPIKKKTIGYYAHIEF-TAATSVIAEVEKVIRYEEDLLRYLIIHL 96
>gi|86138736|ref|ZP_01057308.1| ribosomal protein S6 [Roseobacter sp. MED193] >gi|85824383|gb|EAQ44586.1| ribosomal protein S6 [Roseobacter sp. MED193] (117 aa)
Score = 97, Expect = 1.3e-02, Identities = 27/94 (28%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE +++    +  S+A  +     ++L  +    +  E  G+K +AY INK  +G+Y      +   A+IQE  R+  L  +V+R L I +++
  S:     1 MPLYEHVMIARQDLSNSQAEGLVEHFGAVLADNEGKLVDSEYWGVKTMAYKINKNRKGHYAFLR-TDAPAAAIQEMERLMRLHDDVMRVLTIKVDE 95
>gi|147679227|ref|YP_001213442.1| 30S ribosomal protein S6 [Pelotomaculum thermopropionicum SI] >gi|189045485|sp|A5CY52|RS6_PELTS 30S ribosomal protein S6 >gi|146275324|dbj|BAF61073.1| ribosomal protein S6 [Pelotomaculum thermopropionicum SI] (95 aa)
Score = 97, Expect = 1.3e-02, Identities = 28/90 (31%), Positives = 48/90 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYE++ ++   +EE K   V    K++++      +K++K G + LAY +     G+Y +    N +P    E  RV  +  EVLRH+I+
  S:     1 MRKYEVIFILRPDLEEEKNAEVIEKFKNLIESHGGEIIKIDKWGKRRLAYEVKDFREGFYIVIQI-NAEPKLAAELDRVFKITDEVLRHMIV 91
>gi|39721604|dbj|BAD04094.1| ribosomal protein S6 [Onion yellows phytoplasma OY-M] (112 aa)
Score = 97, Expect = 1.4e-02, Identities = 27/90 (30%), Positives = 52/90 (57%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEK--MGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYEIM ++  +++      + + L+++  ++ +  LE+  +GLKDLAY I+   +GYY        D  ++ EF R+  + +E++R + I
  S:    18 MKKYEIMYILRPNLDSKDVKKINDTLQNVFLQAPNQILEQNEIGLKDLAYLIDNHKKGYYNWL-MVKADNDAVLEFNRIVKITEEIIRFIFI 108
>gi|134103771|ref|YP_001109432.1| 30S ribosomal protein S6 [Saccharopolyspora erythraea NRRL 2338] >gi|166227379|sp|A4FR32|RS6_SACEN 30S ribosomal protein S6 >gi|133916394|emb|CAM06507.1| 30S ribosomal protein S6 [Saccharopolyspora erythraea NRRL 2338] (118 aa)
Score = 97, Expect = 1.4e-02, Identities = 30/86 (34%), Positives = 52/86 (60%)
  Q:     1 MPKYEIMLVVDGSIEE-SKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLR 86
           M  YE+M+++D S++E + A ++ N L  I      + K++  G + LAY I+K++ G Y + +  N +PAS++E  R   L + VLR
  S:     1 MRHYELMVILDPSLDERTVAPSLENFLNVIRNDGGSVEKVDVWGRRRLAYEIDKQAEGIYVVLDL-NSEPASVKELDRQLNLNETVLR 87
>gi|52082636|ref|YP_081427.1| 30S ribosomal protein S6 [Bacillus licheniformis ATCC 14580] >gi|52788035|ref|YP_093864.1| 30S ribosomal protein S6 [Bacillus licheniformis ATCC 14580] >gi|81690793|sp|Q65CP3|RS6_BACLD 30S ribosomal protein S6 >gi|52005847|gb|AAU25789.1| ribosomal protein S6 (BS9) [Bacillus licheniformis ATCC 14580] >gi|52350537|gb|AAU43171.1| RpsF [Bacillus licheniformis DSM 13] (95 aa)
Score = 97, Expect = 1.5e-02, Identities = 27/94 (28%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYEIM ++   ++E    AV     +IL  +     + +  G + LAY IN    G+Y + N       ++QEF R+  +  +++RH+++  E+
  S:     1 MRKYEIMYIIRPDVDEESKKAVVERFNNILTTNGAEITETKDWGKRRLAYEINDFRDGFYQILNV-QAGAEAVQEFDRLAKISDDIIRHIVVKEEE 95
>gi|70727627|ref|YP_254543.1| 30S ribosomal protein S6 [Staphylococcus haemolyticus JCSC1435] >gi|82581624|sp|Q4L340|RS6_STAHJ 30S ribosomal protein S6 >gi|68448353|dbj|BAE05937.1| 30S ribosomal protein S6 [Staphylococcus haemolyticus JCSC1435] (98 aa)
Score = 97, Expect = 1.5e-02, Identities = 29/95 (30%), Positives = 48/95 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKM--GLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKD 95
           M  YEIM VV  +IEE    AV      IL       LE+   G + LAY I     G+Y +     ++  +  EF+R+  +  +++R+++I  ++D
  S:     1 MRTYEIMYVVRPNIEEDAKKAVVERFNGILASEGSEVLEEKDWGKRRLAYEIEDFKEGFYNIVRIKTDNNRATDEFQRLAKISDDIIRYIVIREDQD 97
>gi|182437467|ref|YP_001825186.1| putative 30S ribosomal protein S6 [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178465983|dbj|BAG20503.1| putative 30S ribosomal protein S6 [Streptomyces griseus subsp. griseus NBRC 13350] (96 aa)
Score = 97, Expect = 1.5e-02, Identities = 31/93 (33%), Positives = 53/93 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKM---GLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE+M+++D  +EE   + +  +  S++++  D K+EK+   G + LAY I KK  G Y + +   E PA ++E  R   L + VLR  ++  E
  S:     1 MRHYEVMVILDPDLEERAVSPLIENFLSVVREG-DGKVEKVDTWGRRRLAYEIKKKPEGIYSVIDLQAE-PAVVKELDRQMNLNESVLRTKVLRPE 94
>gi|159040549|ref|YP_001539802.1| ribosomal protein S6 [Salinispora arenicola CNS-205] >gi|189045490|sp|A8LXG3|RS6_SALAI 30S ribosomal protein S6 >gi|157919384|gb|ABW00812.1| ribosomal protein S6 [Salinispora arenicola CNS-205] (96 aa)
Score = 97, Expect = 1.6e-02, Identities = 29/93 (31%), Positives = 50/93 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YEIM+++D S+EE       +   ++++ +  +  K +  G + LAY I+KK+ G Y + +     PA++ E  R   L + VLR  +I  E
  S:     1 MRHYEIMVILDSSLEERTVAPSLDTYLNVIRTAGGSVEKTDVWGRRRLAYEIDKKTEGIYAVIDL-QATPAAVAELERQLRLNESVLRTKVIRPE 94
>gi|99080886|ref|YP_613040.1| 30S ribosomal protein S6 [Silicibacter sp. TM1040] >gi|123252445|sp|Q1GHT8|RS6_SILST 30S ribosomal protein S6 >gi|99037166|gb|ABF63778.1| SSU ribosomal protein S6P [Silicibacter sp. TM1040] (117 aa)
Score = 96, Expect = 1.6e-02, Identities = 28/94 (29%), Positives = 51/94 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPAS-IQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE +++    +  S+A  +     ++L  +    +  E  G+K +AY INK  +G+Y      ++ P+S +QE  R+  L  +V+R L I +E+
  S:     1 MPLYEHVMIARQDLSNSQAEGLIEHFGAVLSDNGGKLVDQEYWGVKTMAYKINKNRKGHYAFLR--SDAPSSAVQEMERLMRLHDDVMRVLTIKVEE 95
>gi|118579196|ref|YP_900446.1| 30S ribosomal protein S6 [Pelobacter propionicus DSM 2379] >gi|166227361|sp|A1AM18|RS6_PELPD 30S ribosomal protein S6 >gi|118501906|gb|ABK98388.1| SSU ribosomal protein S6P [Pelobacter propionicus DSM 2379] (129 aa)
Score = 96, Expect = 1.6e-02, Identities = 31/92 (33%), Positives = 50/92 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILK--KSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           M KYE + ++   + E     VA+ ++ ++   K    +LE  G++ LAYPINK +RG  YL+  Y+     I E  R   L ++VLR   +N+
  S:     1 MRKYETIYILQPDLSEDDIKVVADKVQDVITSYKGDFQRLEDWGIRKLAYPINKCARG-RYLYLRYDGGREMIAELERRLRLDEKVLRFQSVNI 93
>gi|193211784|ref|YP_001997737.1| ribosomal protein S6 [Chlorobaculum parvum NCIB 8327] >gi|193085261|gb|ACF10537.1| ribosomal protein S6 [Chlorobaculum parvum NCIB 8327] (131 aa)
Score = 96, Expect = 1.7e-02, Identities = 27/92 (29%), Positives = 49/92 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           + +YE  +++DG +++    A    +K  +     +   + ++G + +AY I K S GYY    F +  P++I E  RV   ++ +LR LII L
  S:     4 LKQYECTVIIDGGLQDDAIAAAMELVKKTITDQGSVINNVLEVGRRKMAYLIGKSSVGYYAHIEF-DAAPSAIAEIERVFRYEENILRFLIIQL 96
>gi|163842735|ref|YP_001627139.1| 30S ribosomal protein S6 [Brucella suis ATCC 23445] >gi|189045457|sp|B0CKD9|RS6_BRUSI 30S ribosomal protein S6 >gi|163673458|gb|ABY37569.1| ribosomal protein S6 [Brucella suis ATCC 23445] (148 aa)
Score = 96, Expect = 1.7e-02, Identities = 28/94 (29%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE +L+    I + +  A+    K +L+ +     K+E  GL+ L Y I K  + YY L N  +   A++ E  R   + ++VLR L + +E+
  S:     1 MALYEHVLLARQDISQQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYYTLVNI-DAPAAAVAEMERQMRINEDVLRFLTVRVEE 95
>gi|56697142|ref|YP_167505.1| 30S ribosomal protein S6 [Silicibacter pomeroyi DSS-3] >gi|81349630|sp|Q5LR50|RS6_SILPO 30S ribosomal protein S6 >gi|56678879|gb|AAV95545.1| ribosomal protein S6 [Silicibacter pomeroyi DSS-3] (117 aa)
Score = 96, Expect = 1.7e-02, Identities = 27/94 (28%), Positives = 51/94 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPAS-IQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE +++    +  ++A  +     ++L  +  + +  E  G+K +AY INK  +G+Y       + PAS +QE  R+  L  +V+R L I +++
  S:     1 MPLYEHVMIARQDLSNTQAEGLIEHFGAVLSDNGGSLVDHEYWGVKTMAYKINKNRKGHYAFLR--TDAPASAVQEMERLMRLHDDVMRVLTIKVDE 95
>gi|116491825|ref|YP_803560.1| SSU ribosomal protein S6P [Pediococcus pentosaceus ATCC 25745] >gi|116101975|gb|ABJ67118.1| SSU ribosomal protein S6P [Pediococcus pentosaceus ATCC 25745] (94 aa)
Score = 96, Expect = 1.9e-02, Identities = 28/90 (31%), Positives = 49/90 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKD-----LAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YEI  ++  +++++  TA+ +    IL   TD   E +  KD     LAY I   + G Y++ N    D  ++ EF R++ +   +LRH+I+
  S:     1 MKNYEITYIIAPNLDDAAKTALVDRFDKIL---TDNGAEIVDSKDWSKRRLAYEIGGFNDGIYHIVNVKASDDEALNEFDRLSKIADGILRHMIV 92
>gi|196478429|gb|ACG77957.1| ribosomal protein S6 [Phenylobacterium zucineum HLK1] (222 aa)
Score = 96, Expect = 1.9e-02, Identities = 26/94 (27%), Positives = 56/94 (59%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPA-SIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE +++    I   +A A+ + LK+++++   +  K+E  GL++L Y I K  +G+Y L     + PA +++E  R   + ++VLR++ + +++
  S:   103 MALYEHVVISRQDISPQQAEALNDQLKALIEQGGGSVAKIEYWGLRNLTYRIKKNRKGHYSLLAI--DAPADAVKEMERQLSINEDVLRYMTVRVDE 197
>gi|145597065|ref|YP_001161362.1| ribosomal protein S6 [Salinispora tropica CNB-440] >gi|189045493|sp|A4XDG8|RS6_SALTO 30S ribosomal protein S6 >gi|145306402|gb|ABP56984.1| SSU ribosomal protein S6P [Salinispora tropica CNB-440] (96 aa)
Score = 96, Expect = 1.9e-02, Identities = 29/93 (31%), Positives = 50/93 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YEIM+++D S+EE       +   ++++ +  +  K +  G + LAY I+KK+ G Y + +     PA++ E  R   L + VLR  +I  E
  S:     1 MRHYEIMVILDSSLEERTVAPSLDTYLNVIRTAGGSVEKTDVWGRRRLAYEIDKKTEGIYAVIDL-QATPAAVAELDRQLRLNESVLRTKVIRPE 94
>gi|126739373|ref|ZP_01755066.1| ribosomal protein S6 [Roseobacter sp. SK209-2-6] >gi|126719473|gb|EBA16182.1| ribosomal protein S6 [Roseobacter sp. SK209-2-6] (117 aa)
Score = 96, Expect = 1.9e-02, Identities = 26/94 (27%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE +++    +  S+A  +     ++L  +    +  E  G+K +AY INK  +G+Y      +   A++QE  R+  L  +V+R L I +++
  S:     1 MPLYEHVMIARQDLSNSQAEGLIEHFGAVLADNEGKLVDSEYWGVKTMAYKINKNRKGHYSFLR-TDASAAAVQEMERLMRLHDDVMRVLTIKVDE 95
>gi|191163072|ref|ZP_03024949.1| ribosomal protein S6 [Geobacter sp. M21] >gi|190995855|gb|EDV71306.1| ribosomal protein S6 [Geobacter sp. M21] (134 aa)
Score = 96, Expect = 2.0e-02, Identities = 29/92 (31%), Positives = 49/92 (53%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILK-KSTDLK-LEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKD 95
           YE + +V   + + +  A++  ++ ++   + D K LE  G + LAYPINK  RG Y+   F + D   I E  R   L  +V+R+  + LE +
  S:     5 YETIYIVQPDLGDEEIKALSTKVQDVVAGMNGDFKRLEDWGTRKLAYPINKNPRGRYFYLRF-DGDSGLIAELERRLRLDDKVIRYQSVKLETE 97
>gi|23501356|ref|NP_697483.1| 30S ribosomal protein S6 [Brucella suis 1330] >gi|161618426|ref|YP_001592313.1| 30S ribosomal protein S6 [Brucella canis ATCC 23365] >gi|189045456|sp|A9M8X8|RS6_BRUC2 30S ribosomal protein S6 >gi|32171565|sp|Q8G274|RS6_BRUSU 30S ribosomal protein S6 >gi|23347249|gb|AAN29398.1| ribosomal protein S6 [Brucella suis 1330] >gi|161335237|gb|ABX61542.1| ribosomal protein S6 [Brucella canis ATCC 23365] (148 aa)
Score = 95, Expect = 2.1e-02, Identities = 28/94 (29%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE +L+    I + +  A+    K +L+ +     K+E  GL+ L Y I K  + YY L N  +   A++ E  R   + ++VLR L + +E+
  S:     1 MALYEHVLLARQDISQQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYYTLVNI-DAPAAAVAEMERQMRINEDVLRFLTVRVEE 95
>gi|7388214|sp|O68126|RS6_RHOCA 30S ribosomal protein S6 >gi|3128364|gb|AAC16216.1| potential 30S ribosomal protein S6 [Rhodobacter capsulatus] (144 aa)
Score = 95, Expect = 2.1e-02, Identities = 26/93 (27%), Positives = 48/93 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           MP YE +L+    +  ++A  +     +++  +    L  E  G+K +AY INK  +G+Y      +   A++QE  R+  L  +V+R L I ++
  S:     1 MPLYEHVLIARQDLSNAQAEGLIEHFSTVIGDNGGKVLGTEYWGVKTMAYKINKNRKGHYGFLR-TDAPSAAVQEMERLARLHDDVMRVLTIKVD 94
>gi|15923355|ref|NP_370889.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus Mu50] >gi|15926066|ref|NP_373599.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus N315] >gi|21282070|ref|NP_645158.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus MW2] >gi|49482595|ref|YP_039819.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49485245|ref|YP_042466.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus MSSA476] >gi|82750077|ref|YP_415818.1| 30S ribosomal protein S6 [Staphylococcus aureus RF122] >gi|87161421|ref|YP_493080.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus USA300] >gi|88194147|ref|YP_498937.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148266852|ref|YP_001245795.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus JH9] >gi|150392898|ref|YP_001315573.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus JH1] >gi|151220569|ref|YP_001331391.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156978693|ref|YP_001440952.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus Mu3] >gi|161353537|ref|YP_185328.2| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus COL] >gi|161508637|ref|YP_001574296.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168729155|ref|ZP_02761432.1| ribosomal protein S6 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|82581623|sp|Q5HIS9|RS6_STAAC 30S ribosomal protein S6 >gi|122540227|sp|Q2G113|RS6_STAA8 30S ribosomal protein S6 >gi|123487277|sp|Q2FJP8|RS6_STAA3 30S ribosomal protein S6 >gi|166227388|sp|A7WY58|RS6_STAA1 30S ribosomal protein S6 >gi|189045588|sp|A6TYL8|RS6_STAA2 30S ribosomal protein S6 >gi|189045589|sp|A5IPU6|RS6_STAA9 30S ribosomal protein S6 >gi|189045590|sp|A6QE47|RS6_STAAE 30S ribosomal protein S6 >gi|189045591|sp|A8YZJ1|RS6_STAAT 30S ribosomal protein S6 >gi|54039533|sp|P66596|RS6_STAAW 30S ribosomal protein S6 >gi|54039565|sp|P99142|RS6_STAAN 30S ribosomal protein S6 >gi|54041976|sp|P66595|RS6_STAAM 30S ribosomal protein S6 >gi|56749399|sp|Q6GCA7|RS6_STAAS 30S ribosomal protein S6 >gi|56749428|sp|Q6GJV3|RS6_STAAR 30S ribosomal protein S6 >gi|91207792|sp|Q2YVJ2|RS6_STAAB 30S ribosomal protein S6 >gi|13700279|dbj|BAB41577.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus N315] >gi|14246133|dbj|BAB56527.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus Mu50] >gi|21203506|dbj|BAB94206.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus MW2] >gi|49240724|emb|CAG39385.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49243688|emb|CAG42112.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus MSSA476] >gi|82655608|emb|CAI80004.1| 30S ribosomal protein S6 [Staphylococcus aureus RF122] >gi|87127395|gb|ABD21909.1| ribosomal protein S6 [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201705|gb|ABD29515.1| ribosomal protein S6 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147739921|gb|ABQ48219.1| SSU ribosomal protein S6P [Staphylococcus aureus subsp. aureus JH9] >gi|149945350|gb|ABR51286.1| ribosomal protein S6 [Staphylococcus aureus subsp. aureus JH1] >gi|150373369|dbj|BAF66629.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156720828|dbj|BAF77245.1| 30S ribosomal protein S6 [Staphylococcus aureus subsp. aureus Mu3] >gi|160367446|gb|ABX28417.1| ribosomal protein S6 [Staphylococcus aureus subsp. aureus USA300_TCH1516] (98 aa)
Score = 95, Expect = 2.1e-02, Identities = 26/95 (27%), Positives = 52/95 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKD 95
           M  YE+M +V  +IEE    A+      IL  + +  L+ +  G + LAY IN    G+Y +    +++  +  EF+R+  +  +++R+++I  ++D
  S:     1 MRTYEVMYIVRPNIEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFYNIVRVKSDNNKATDEFQRLAKISDDIIRYMVIREDED 97
>gi|182416762|ref|ZP_02948159.1| ribosomal protein S6 [Clostridium butyricum 5521] >gi|182379419|gb|EDT76914.1| ribosomal protein S6 [Clostridium butyricum 5521] (95 aa)
Score = 95, Expect = 2.1e-02, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFY--NEDPASIQEFRRVTLLKKEVLRHLIIN 91
           M KYE + +++ S +E    A     K +++    T   ++  G + LAY I K + GYY L NF    E P   +E  R+  +   V+RH+I+N
  S:     1 MRKYETIFILNPSFDEETVKANIEKFKGVIENGGGTVENVDFWGKRKLAYEIAKVNEGYYTLVNFTAGTELP---RELDRIFRITDGVIRHIIVN 92
>gi|62289440|ref|YP_221233.1| 30S ribosomal protein S6 [Brucella abortus bv. 1 str. 9-941] >gi|82699366|ref|YP_413940.1| 30S ribosomal protein S6 [Brucella melitensis biovar Abortus 2308] >gi|189023690|ref|YP_001934458.1| Ribosomal protein S6 [Brucella abortus S19] >gi|75497231|sp|Q57ER2|RS6_BRUAB 30S ribosomal protein S6 >gi|91207903|sp|Q2YMG9|RS6_BRUA2 30S ribosomal protein S6 >gi|62195572|gb|AAX73872.1| RpsF, ribosomal protein S6 [Brucella abortus biovar 1 str. 9-941] >gi|82615467|emb|CAJ10436.1| Ribosomal protein S6 [Brucella melitensis biovar Abortus 2308] >gi|189019262|gb|ACD71984.1| Ribosomal protein S6 [Brucella abortus S19] (148 aa)
Score = 95, Expect = 2.2e-02, Identities = 28/94 (29%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE +L+    I + +  A+    K +L+ +     K+E  GL+ L Y I K  + YY L N  +   A++ E  R   + ++VLR L + +E+
  S:     1 MALYEHVLLARQDISQQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYYTLVNI-DAPAAAVAEMERQMRINEDVLRFLTVRVEE 95
>gi|161598671|ref|NP_940593.2| 30S ribosomal protein S6 [Corynebacterium diphtheriae NCTC 13129] >gi|61215593|sp|Q6NEI3|RS6_CORDI 30S ribosomal protein S6 (95 aa)
Score = 95, Expect = 2.3e-02, Identities = 31/94 (32%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE+M+++D S +E       +    I++K   T  K++  G + LAYPI KK  G Y + N   E  A++ E  RV  L   V+R  ++  +K
  S:     1 MRHYEVMIILDPSQDERTVAPSLDKFLEIVRKENGTVEKVDIWGKRRLAYPIAKKEEGIYAVVNLTCES-ATVLELDRVLNLNDSVMRTKVLRGDK 95
>gi|15640393|ref|NP_230020.1| 30S ribosomal protein S6 [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121590972|ref|ZP_01678292.1| ribosomal protein S6 [Vibrio cholerae 2740-80] >gi|121730195|ref|ZP_01682585.1| ribosomal protein S6 [Vibrio cholerae V52] >gi|147675449|ref|YP_001218635.1| 30S ribosomal protein S6 [Vibrio cholerae O395] >gi|153216649|ref|ZP_01950556.1| ribosomal protein S6 [Vibrio cholerae 1587] >gi|153225586|ref|ZP_01954790.1| ribosomal protein S6 [Vibrio cholerae MAK 757] >gi|153820255|ref|ZP_01972922.1| ribosomal protein S6 [Vibrio cholerae NCTC 8457] >gi|153827636|ref|ZP_01980303.1| ribosomal protein S6 [Vibrio cholerae MZO-2] >gi|153830466|ref|ZP_01983133.1| ribosomal protein S6 [Vibrio cholerae 623-39] >gi|194531361|ref|YP_002066820.1| ribosomal protein S6 [Vibrio cholerae MO10] >gi|189045594|sp|A5F3K3|RS6_VIBC3 30S ribosomal protein S6 >gi|13959535|sp|Q9KUZ2|RS6_VIBCH 30S ribosomal protein S6 >gi|9654783|gb|AAF93539.1| ribosomal protein S6 [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121547198|gb|EAX57325.1| ribosomal protein S6 [Vibrio cholerae 2740-80] >gi|121628053|gb|EAX60598.1| ribosomal protein S6 [Vibrio cholerae V52] >gi|124114160|gb|EAY32980.1| ribosomal protein S6 [Vibrio cholerae 1587] >gi|124117275|gb|EAY36018.1| ribosomal protein S6 [Vibrio cholerae MAK 757] >gi|125617289|gb|EAZ45862.1| ribosomal protein S6 [Vibrio cholerae MO10] >gi|126509206|gb|EAZ71800.1| ribosomal protein S6 [Vibrio cholerae NCTC 8457] >gi|146317332|gb|ABQ21871.1| ribosomal protein S6 [Vibrio cholerae O395] >gi|148874068|gb|EDL72203.1| ribosomal protein S6 [Vibrio cholerae 623-39] >gi|149737886|gb|EDM52791.1| ribosomal protein S6 [Vibrio cholerae MZO-2] >gi|150423625|gb|EDN15567.1| ribosomal protein S6 [Vibrio cholerae AM-19226] (122 aa)
Score = 95, Expect = 2.3e-02, Identities = 39/129 (30%), Positives = 60/129 (46%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRIKEQVLAEQE 129
           M  YEI+ +V     E  A  +     SI +    + +LE  G + LAYPINK  + +Y L N    D A + E          VLR++I+  +      A T P  ++++  R ER KR + +  A+ E
  S:     1 MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHYVLMNV-EADQAVVDELETAFRFNDAVLRNMIMRTK-----AAITEPSIMLKA--REERVKRDEMKFDADVE 122
>gi|46579369|ref|YP_010177.1| 30S ribosomal protein S6 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120603073|ref|YP_967473.1| 30S ribosomal protein S6 [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166226826|sp|A1VF30|RS6_DESVV 30S ribosomal protein S6 >gi|61215612|sp|Q72DH3|RS6_DESVH 30S ribosomal protein S6 >gi|46448783|gb|AAS95436.1| ribosomal protein S6 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120563302|gb|ABM29046.1| SSU ribosomal protein S6P [Desulfovibrio vulgaris subsp. vulgaris DP4] (101 aa)
Score = 95, Expect = 2.4e-02, Identities = 22/92 (23%), Positives = 47/92 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           M K+E +L++   +      A+   L  ++++   + +  +  G++DLAYP+ K+ RGYY     Y    A++ E  R+  +   + + + + L
  S:     1 MRKFETLLLLSPELAADAREALLTTLSGVVEREQGSMITADHWGMRDLAYPVRKQMRGYYVRLE-YTAPGATVAELERIIRISDGIFKFVTVKL 93
>gi|145296972|ref|YP_001139793.1| 30S ribosomal protein S6 [Corynebacterium glutamicum R] >gi|140846892|dbj|BAF55891.1| hypothetical protein [Corynebacterium glutamicum R] (98 aa)
Score = 95, Expect = 2.4e-02, Identities = 29/92 (31%), Positives = 51/92 (55%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           +YE+M+++D S +E       +    +++K     +K++  G + LAYPI+KK  G Y + +   E  A++ E  RV  L   VLR  ++ L+K
  S:     6 QYELMIILDPSQDERTVAPSLDKFLEVVRKDKGDVVKVDVWGKRRLAYPIDKKEEGVYAVVDLKCES-ATVLELDRVLNLNDGVLRTKVLRLDK 98
>gi|159044729|ref|YP_001533523.1| 30S ribosomal protein S6 [Dinoroseobacter shibae DFL 12] >gi|189045465|sp|A8LQQ5|RS6_DINSH 30S ribosomal protein S6 >gi|157912489|gb|ABV93922.1| ribosomal protein S6 [Dinoroseobacter shibae DFL 12] (117 aa)
Score = 95, Expect = 2.5e-02, Identities = 27/94 (28%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE + +    +  ++A ++     S+L  +    +  E  GLK +AY INK  +G+Y         PA +QE  R+  L  +V+R + I +++
  S:     1 MPLYEHVFISRQDLSNAQAESLVEHFGSVLADNGGKVVDSEYWGLKTMAYKINKNRKGHYAFLKTDAPAPA-VQEMERLMRLHDDVMRVMTIKVDE 95
>gi|84503440|ref|ZP_01001500.1| Ribosomal protein S6 [Oceanicola batsensis HTCC2597] >gi|84388227|gb|EAQ01179.1| Ribosomal protein S6 [Oceanicola batsensis HTCC2597] (118 aa)
Score = 95, Expect = 2.5e-02, Identities = 27/94 (28%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE + +    +  ++A  +     ++L  +    ++ E  G+K +AY INK  +G+Y         PA +QE  R+  L  +V+R L I +E+
  S:     1 MPLYEHVFIARQDLSNAQAEGLIEHFGTVLSDNGGKLVEQEYWGVKTMAYKINKNRKGHYAFLKSDAPAPA-VQEMERLMRLHDDVMRVLTIRVEE 95
>gi|116628690|ref|YP_813862.1| 30S ribosomal protein S6 [Lactobacillus gasseri ATCC 33323] >gi|122274312|sp|Q047E8|RS6_LACGA 30S ribosomal protein S6 >gi|116094272|gb|ABJ59424.1| SSU ribosomal protein S6P [Lactobacillus gasseri ATCC 33323] (98 aa)
Score = 95, Expect = 2.5e-02, Identities = 24/92 (26%), Positives = 48/92 (52%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           KYE+  ++   I+E    A+ +    ++    + +L+ +  G +  AY I K   G Y++  F  E+   + EF R++ +  +VLR + + L+K
  S:     5 KYEVTYIIKPDIDEDSKKALIDRFDKVVTDNGAEELESKDWGKRRFAYEIEKYREGTYHIMTFVAENSEPVDEFGRLSRIDNQVLRSMTVKLDK 98
>gi|85057283|ref|YP_456199.1| 30S ribosomal protein S6 [Aster yellows witches'-broom phytoplasma AYWB] >gi|123518528|sp|Q2NKC3|RS6_AYWBP 30S ribosomal protein S6 >gi|84789388|gb|ABC65120.1| SSU ribosomal protein S6P [Aster yellows witches'-broom phytoplasma AYWB] (95 aa)
Score = 95, Expect = 2.6e-02, Identities = 26/90 (28%), Positives = 52/90 (57%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEK--MGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYEIM ++  +++      + + L+++  ++ +  LE+  +GLKDL Y I+   +GYY        D  ++ EF R+  + +E++R ++I
  S:     1 MKKYEIMYILRPNLDNKYVKKINDTLQNVFLQAPNQILEQKEIGLKDLTYFIDNHKKGYYNWL-MVKADNDAVLEFNRIVKITEEIIRFIVI 91
>gi|156448850|ref|ZP_02055234.1| ribosomal protein S6 [Methylobacterium chloromethanicum CM4] >gi|163853341|ref|YP_001641384.1| ribosomal protein S6 [Methylobacterium extorquens PA1] >gi|156192366|gb|EDO24551.1| ribosomal protein S6 [Methylobacterium chloromethanicum CM4] >gi|163664946|gb|ABY32313.1| ribosomal protein S6 [Methylobacterium extorquens PA1] (151 aa)
Score = 94, Expect = 2.7e-02, Identities = 25/94 (26%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE + +    +   +   +    K +++    T  K+E  G+K LAY I K  + ++ L N  +  PA++ E  R   + ++VLR + + +E+
  S:     1 MPLYEHVFLARQDVTAQQVETMVETYKGVIETGGGTIEKIESWGVKSLAYRIKKNRKAHFTLLNI-SAPPAAVAEMERQMQISEDVLRFMTVRVEQ 95
>gi|145618654|ref|ZP_01774711.1| ribosomal protein S6 [Geobacter bemidjiensis Bem] >gi|144945032|gb|EDJ80100.1| ribosomal protein S6 [Geobacter bemidjiensis Bem] >gi|197088497|gb|ACH39768.1| ribosomal protein S6 [Geobacter bemidjiensis Bem] (134 aa)
Score = 94, Expect = 2.8e-02, Identities = 28/92 (30%), Positives = 49/92 (53%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKK-STDLK-LEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKD 95
           YE + +V   + + +  A++  ++ ++   + D K +E  G + LAYPINK  RG Y+   F + D   I E  R   L  +V+R+  + LE +
  S:     5 YETIYIVQPDLGDEEIKALSTKVQDVIASMNGDFKRVEDWGTRKLAYPINKNPRGRYFYLRF-DGDSGLIAELERRLRLDDKVIRYQSVKLETE 97
>gi|152990908|ref|YP_001356630.1| 30S ribosomal protein S6 [Nitratiruptor sp. SB155-2] >gi|166227355|sp|A6Q464|RS6_NITSB 30S ribosomal protein S6 >gi|151422769|dbj|BAF70273.1| 30S ribosomal protein S6 [Nitratiruptor sp. SB155-2] (128 aa)
Score = 94, Expect = 3.0e-02, Identities = 25/93 (26%), Positives = 52/93 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE + V+  ++ + ++ A    +K +++ +    +  E +G++ LAYPI K  RG+YY+  ++     ++ E  R+  + ++V+R L I  E
  S:     1 MRHYETLFVLKPTLTDEESKAKFEFIKEVIQNNGGEIVATEDLGVRKLAYPIQKFERGHYYII-YFTAPSHTVLELERIYRITEDVIRFLTIKYE 94
>gi|119962193|ref|YP_949832.1| ribosomal protein S6 [Arthrobacter aurescens TC1] >gi|166226797|sp|A1RC70|RS6_ARTAT 30S ribosomal protein S6 >gi|119949052|gb|ABM07963.1| ribosomal protein S6 [Arthrobacter aurescens TC1] (101 aa)
Score = 94, Expect = 3.0e-02, Identities = 30/93 (32%), Positives = 48/93 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE+M+++D  +EE    +      +++     T  K++  G + LAY I KKS G Y + NF    PA+ +E  R   L + ++R  II  E
  S:     1 MRPYELMVIIDPEVEERTVESSLQKFLNVITTDGGTIEKVDIWGRRRLAYDIKKKSEGIYAVVNF-TAAPATAKELDRQLSLNETIMRTKIIRPE 94
>gi|119718881|ref|YP_925846.1| SSU ribosomal protein S6P [Nocardioides sp. JS614] >gi|166227356|sp|A1SQS4|RS6_NOCSJ 30S ribosomal protein S6 >gi|119539542|gb|ABL84159.1| SSU ribosomal protein S6P [Nocardioides sp. JS614] (96 aa)
Score = 94, Expect = 3.1e-02, Identities = 25/86 (29%), Positives = 48/86 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLR 86
           M  YE+M+++D S+EE       +   ++++K   T   ++  G + LAY + K + G Y +    N +PA+++EF R   L + ++R
  S:     1 MRAYEVMVILDPSLEERTVEPSLDKYLNVIRKDGGTVESVDVWGRRRLAYEVKKNAEGIYAVIKL-NAEPATVKEFDRQLTLNESIIR 87
>gi|167629779|ref|YP_001680278.1| 30S ribosomal protein S6 [Heliobacterium modesticaldum Ice1] >gi|167592519|gb|ABZ84267.1| 30S ribosomal protein s6 [Heliobacterium modesticaldum Ice1] (96 aa)
Score = 94, Expect = 3.1e-02, Identities = 26/90 (28%), Positives = 50/90 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M +YE +++V  ++EE     V +   +++ +     +K++K G + L Y + K    +Y+L NF  E PA  QE  RV  +  +++R L++
  S:     1 MREYEAVVLVRPNLEEEALQGVIDKFVNLVPQQGGEVVKVDKWGKRRLQYEVKKFKEAFYFLLNFKGE-PAVAQELERVMKISDDIIRFLVV 91
>gi|194343685|gb|EDX24651.1| 30S ribosomal protein S6 [Streptomyces sp. Mg1] (96 aa)
Score = 94, Expect = 3.1e-02, Identities = 28/93 (30%), Positives = 50/93 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE+M+++D  +EE   + +  +  S++++      K++  G + LAY I KK  G Y + +   E PA ++E  R   L + VLR  ++  E
  S:     1 MRHYEVMVILDPDLEERAVSPLIENFLSVVREGNGKVEKVDTWGRRRLAYEIKKKPEGIYSVIDLQAE-PAVVKELDRQMNLNESVLRTKVLRPE 94
>gi|58336361|ref|YP_192946.1| 30S ribosomal protein S6 [Lactobacillus acidophilus NCFM] >gi|75358243|sp|Q5FN09|RS6_LACAC 30S ribosomal protein S6 >gi|58253678|gb|AAV41915.1| 30S ribosomal protein S6 [Lactobacillus acidophilus NCFM] (98 aa)
Score = 94, Expect = 3.1e-02, Identities = 22/92 (23%), Positives = 49/92 (53%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           KYE+  ++   I+E    A+  +   ++  +  T ++ +  G +  AY I+K   G Y++  F  ++  ++ EF R++ +   +LR + + L+K
  S:     5 KYEVTYIIKPDIDEDNKKALVENYDKVIADNGGTMVESKDWGKRRFAYEIDKYREGTYHIMTFTADNADAVNEFSRLSKIDNAILRSMTVKLDK 98
>gi|119358280|ref|YP_912924.1| 30S ribosomal protein S6 [Chlorobium phaeobacteroides DSM 266] >gi|166226819|sp|A1BJC3|RS6_CHLPD 30S ribosomal protein S6 >gi|119355629|gb|ABL66500.1| SSU ribosomal protein S6P [Chlorobium phaeobacteroides DSM 266] (133 aa)
Score = 94, Expect = 3.2e-02, Identities = 26/89 (29%), Positives = 50/89 (56%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           YE  +++DG +++    A    ++ ++  K  +   + ++G +  AYPINKK+ GYY    F     + I E  +V   ++ ++R+LII+L
  S:     7 YECTVIIDGGLQDEVIAAAMEMVQKVIADKGGSISSVLEVGRRKTAYPINKKTIGYYAHIEF-TAGTSVIAEIEKVLRYEEALMRYLIIHL 96
>gi|42518091|ref|NP_964021.1| 30S ribosomal protein S6 [Lactobacillus johnsonii NCC 533] >gi|61215656|sp|Q74M28|RS6_LACJO 30S ribosomal protein S6 >gi|41582375|gb|AAS07987.1| 30S ribosomal protein S7 [Lactobacillus johnsonii NCC 533] (98 aa)
Score = 94, Expect = 3.4e-02, Identities = 23/92 (25%), Positives = 48/92 (52%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           KYE+  ++   I+E    A+ +    ++    + +L+ +  G +  AY I K   G Y++  F  E+   + EF R++ +  ++LR + + L+K
  S:     5 KYEVTYIIKPDIDEDSKKALIDRFDKVVTDNGAEELESKDWGKRRFAYEIEKYREGTYHIMTFVAENSEPVDEFGRLSRIDNQILRSMTVKLDK 98
>gi|160881892|ref|YP_001560860.1| ribosomal protein S6 [Clostridium phytofermentans ISDg] >gi|160430558|gb|ABX44121.1| ribosomal protein S6 [Clostridium phytofermentans ISDg] (95 aa)
Score = 94, Expect = 3.4e-02, Identities = 29/90 (32%), Positives = 44/90 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYE+ LVV+  IE+    A    +K ++ +       ++  G K LAY I K   GYYY   F + D  +  E  +   + + V+R L I
  S:     1 MNKYELALVVNAKIEDEAKNATVEAVKELITRFGGNITNVDDWGKKRLAYEIQKMKEGYYYFIKF-DGDSTTPSEVEQRIRIMENVIRFLCI 91
>gi|149182310|ref|ZP_01860789.1| ribosomal protein S6 (BS9) [Bacillus sp. SG-1] >gi|148850002|gb|EDL64173.1| ribosomal protein S6 (BS9) [Bacillus sp. SG-1] (95 aa)
Score = 94, Expect = 3.5e-02, Identities = 27/94 (28%), Positives = 52/94 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLE--KMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYE+M ++  ++++    AV +   ++L  +    +E  + G + LAY IN    GYY L    + + A + EF R+  +  +++RH++I  E+
  S:     1 MRKYEVMYIIRPNVDDETKKAVVDRFDNVLTSNGAEIVESKEWGKRRLAYEINDFRDGYYQLVKIQSNNEA-VSEFDRLAKISDDIIRHIVIKEEE 95
>gi|114569763|ref|YP_756443.1| SSU ribosomal protein S6P [Maricaulis maris MCS10] >gi|122316233|sp|Q0AQD2|RS6_MARMM 30S ribosomal protein S6 >gi|114340225|gb|ABI65505.1| SSU ribosomal protein S6P [Maricaulis maris MCS10] (117 aa)
Score = 93, Expect = 3.5e-02, Identities = 26/93 (27%), Positives = 53/93 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE + +V   +  ++  ++  + K+++  K     K+E  GL++L+Y INK  +G+Y L +  + +   I E  R+  L ++V+RH+ + +E
  S:     1 MALYEHIFIVRPDVSPAQMESLLEETKALIEEKGGKTGKIEYWGLRNLSYRINKSRKGHYGLIDI-DAEADVINELERLQRLSEDVIRHMTLRVE 94
>gi|114332339|ref|YP_748561.1| 30S ribosomal protein S6 [Nitrosomonas eutropha C91] >gi|122313013|sp|Q0ADI6|RS6_NITEC 30S ribosomal protein S6 >gi|114309353|gb|ABI60596.1| SSU ribosomal protein S6P [Nitrosomonas eutropha C91] (144 aa)
Score = 93, Expect = 3.6e-02, Identities = 27/92 (29%), Positives = 42/92 (45%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           M  YEI+ +V     E  +  +      I ++S  + +LE  G + L YPI K  + +Y L N    D  S+ E          +LRHL+I +
  S:     1 MRHYEIIFIVHPDQSEQVSAMIERYSNMITERSGGIHRLEDWGRRQLTYPIQKLHKAHYILMNI-ECDQESLNELEHSFKFNDAILRHLVIRM 92
>gi|21674944|ref|NP_663009.1| 30S ribosomal protein S6 [Chlorobium tepidum TLS] >gi|25009197|sp|Q8KAM1|RS6_CHLTE 30S ribosomal protein S6 >gi|21648174|gb|AAM73351.1| ribosomal protein S6 [Chlorobium tepidum TLS] (131 aa)
Score = 93, Expect = 3.6e-02, Identities = 28/92 (30%), Positives = 49/92 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           + +YE  +++DG +++    AV   +K  +     +   + ++G + +AY I K S GYY    F +  P+ I E  RV   ++ +LR LII L
  S:     4 LKQYECTVIIDGGLQDDAIAAVMELVKKTVTDKGGVINNVLEVGRRKMAYLIRKTSIGYYAHIEF-DAVPSVIAEIERVFRYEEAILRFLIIQL 96
>gi|188583607|ref|YP_001927052.1| ribosomal protein S6 [Methylobacterium populi BJ001] >gi|179347105|gb|ACB82517.1| ribosomal protein S6 [Methylobacterium populi BJ001] (151 aa)
Score = 93, Expect = 3.7e-02, Identities = 25/94 (26%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE + +    +   +   +    K +++    T  K+E  G+K LAY I K  + ++ L N  +  PA++ E  R   + ++VLR + + +E+
  S:     1 MPLYEHVFLARQDVTAQQVETMVETYKGVIETGGGTIEKIESWGVKSLAYRIKKNRKAHFTLLNI-SAPPAALAEMERQMQISEDVLRFMTVRVEQ 95
>gi|91204545|emb|CAJ70773.1| similar to 30S ribosomal subunit protein S6 [Candidatus Kuenenia stuttgartiensis] (137 aa)
Score = 93, Expect = 3.8e-02, Identities = 32/90 (35%), Positives = 45/90 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YE + ++D     S    V   +  IL K+    LK EK G K LAY I    RG Y L +F N +  SI + +R   L + ++R LI+
  S:     1 MRLYEGLFLIDNVPANSDWDGVVKSIHDILAKNGAEILKTEKWGEKKLAYKIKSHKRGTYLLIHF-NAENTSITQMKRDFQLSEFLIRSLIL 91
>gi|88854482|ref|ZP_01129149.1| 30S ribosomal protein S6 [marine actinobacterium PHSC20C1] >gi|88816290|gb|EAR26145.1| 30S ribosomal protein S6 [marine actinobacterium PHSC20C1] (162 aa)
Score = 93, Expect = 3.8e-02, Identities = 30/98 (30%), Positives = 51/98 (52%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKK---STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKA 100
           +YE+M+++D  I+E       +   ++++    S D  ++  G + LAY INKK+ G Y + NF  E  AS  E  R   L + V+R  ++  E  +   A
  S:     4 QYELMVILDPEIDERTVAPSLDKFLNVIRNDGGSID-NIDIWGRRRLAYEINKKTEGIYAVVNFTAES-ASTDELDRQLKLSEAVMRTKVLRAEAGFAQVA 102
>gi|118411090|ref|YP_874485.1| 30S ribosomal protein S6 [Phaeodactylum tricornutum] >gi|125987757|sp|A0T0L0|RR6_PHATR Chloroplast 30S ribosomal protein S6 >gi|116739837|gb|ABK20708.1| 30S ribosomal protein S6 [Phaeodactylum tricornutum] (98 aa)
Score = 93, Expect = 3.8e-02, Identities = 32/89 (35%), Positives = 47/89 (52%)
  Q:     3 KYEIMLVVDGSIEESK-ATAVANDLKSILKKST-DLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIIN 91
           KYEIM+++     +S+  T V N  K++ K S  D+ +   G  +LAYPI  K +G Y   NF +  P  I  F +   +   VLR L+ N
  S:     6 KYEIMILLTEEFNDSELKTWVFNYAKNLRKFSVCDISVISRGKHNLAYPIETKMKGNYIQLNF-SSMPKYITNFSKTLKMDSNVLRFLVFN 95
>gi|187934196|ref|YP_001887721.1| ribosomal protein S6 [Clostridium botulinum B str. Eklund 17B] >gi|188589519|ref|YP_001922704.1| ribosomal protein S6 [Clostridium botulinum E3 str. Alaska E43] >gi|187722349|gb|ACD23570.1| ribosomal protein S6 [Clostridium botulinum B str. Eklund 17B] >gi|188499800|gb|ACD52936.1| ribosomal protein S6 [Clostridium botulinum E3 str. Alaska E43] (96 aa)
Score = 93, Expect = 4.0e-02, Identities = 29/93 (31%), Positives = 46/93 (49%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYE + +   S +E          K +++    T   ++  G + LAY I+K S GYY L +F N  P   +E  RV  +   ++RH+I+  E
  S:     2 MRKYETIFIQHPSFDEETVKTNIEKFKGVIENGGGTIENVDFWGKRKLAYEISKVSDGYYTLVSF-NAGPELPKELDRVFRITDGIIRHIIVKEE 95
>gi|153007914|ref|YP_001369129.1| 30S ribosomal protein S6 [Ochrobactrum anthropi ATCC 49188] >gi|166227357|sp|A6WWE6|RS6_OCHA4 30S ribosomal protein S6 >gi|151559802|gb|ABS13300.1| ribosomal protein S6 [Ochrobactrum anthropi ATCC 49188] (151 aa)
Score = 93, Expect = 4.0e-02, Identities = 28/94 (29%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE +L+    I + +  A+    K +L+ +     K+E  GL+ L Y I K  + YY L N  +   A++ E  R   + ++VLR L + +E+
  S:     1 MALYEHVLLARQDISQQQVDALVEQYKGVLEANGGKVGKVESWGLRPLTYRIKKNRKAYYTLVNI-DAPAAAVAEMERQMRINEDVLRFLTVRVEE 95
>gi|167754092|ref|ZP_02426219.1| hypothetical protein ALIPUT_02380 [Alistipes putredinis DSM 17216] >gi|167658717|gb|EDS02847.1| hypothetical protein ALIPUT_02380 [Alistipes putredinis DSM 17216] (114 aa)
Score = 93, Expect = 4.1e-02, Identities = 22/66 (33%), Positives = 38/66 (57%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNE 66
           M  YE + +V   + +++   VA+  + ++ ++    +  E  GLK LAYPI KK+ G+Y+L  F  E
  S:     1 MNNYETVFIVTPVLSDAQVKEVADKFQGVITENGGQIVNSEAWGLKKLAYPIQKKTTGFYFLIEFTGE 68
>gi|186898668|ref|ZP_02971632.1| ribosomal protein S6 [Cyanothece sp. PCC 7424] >gi|186693945|gb|EDU18557.1| ribosomal protein S6 [Cyanothece sp. PCC 7424] (176 aa)
Score = 93, Expect = 4.1e-02, Identities = 28/92 (30%), Positives = 48/92 (52%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKD 95
           YE++ ++   + E +     N  +  L   ++ +++++  G + LAYPI K   G+Y   N Y  D   I    R+  L  EV+R+L I L+KD
  S:     5 YEMVYILRPDLLEEQVQQEINRYRDFLTENEAQEVQIKYWGKRRLAYPIKKLQDGFYVQMN-YQGDGKQIAPLERMMRLSDEVIRYLTIKLDKD 97
>gi|83949660|ref|ZP_00958393.1| ribosomal protein S6 [Roseovarius nubinhibens ISM] >gi|83837559|gb|EAP76855.1| ribosomal protein S6 [Roseovarius nubinhibens ISM] (118 aa)
Score = 93, Expect = 4.2e-02, Identities = 25/94 (26%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE + +    +  ++A  +     ++L  +    ++ E  G+K +AY INK  +G+Y      +   A++QE  R+  L  +V+R L I +++
  S:     1 MPLYEHVFISRQDLSNTQAEGLVEHFGTVLSDNGGKVVESEYWGVKTMAYKINKNRKGHYAFLK-SDAPAAAVQEMERLMRLHDDVMRVLTIKVDE 95
>gi|144899045|emb|CAM75909.1| 30S ribosomal protein S6 [Magnetospirillum gryphiswaldense MSR-1] (144 aa)
Score = 93, Expect = 4.4e-02, Identities = 24/94 (25%), Positives = 51/94 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE +++    +   +   + +++  +L +   T  K E  GL+++AY + K  + +Y L N  +   A+++E  R   L ++VLR L + +++
  S:     1 MPFYECVILARQEVSAPQVETLIDEMAGVLAQGGGTVAKKEFWGLRNIAYRVKKNRKAHYVLLNL-DSPSAAVKEMERQMSLNEDVLRVLTVRVDE 95
>gi|148559735|ref|YP_001258474.1| 30S ribosomal protein S6 [Brucella ovis ATCC 25840] >gi|148370992|gb|ABQ60971.1| 30S ribosomal protein S6 [Brucella ovis ATCC 25840] (156 aa)
Score = 93, Expect = 4.5e-02, Identities = 28/94 (29%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE +L+    I + +  A+    K +L+ +     K+E  GL+ L Y I K  + YY L N  +   A++ E  R   + ++VLR L + +E+
  S:     9 MALYEHVLLARQDISQQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYYTLVNI-DAPAAAVAEMERQMRINEDVLRFLTVRVEE 103
>gi|38201090|emb|CAE50814.1| 30S ribosomal protein S6 [Corynebacterium diphtheriae] (98 aa)
Score = 93, Expect = 4.5e-02, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           YE+M+++D S +E       +    I++K   T  K++  G + LAYPI KK  G Y + N   E  A++ E  RV  L   V+R  ++  +K
  S:     7 YEVMIILDPSQDERTVAPSLDKFLEIVRKENGTVEKVDIWGKRRLAYPIAKKEEGIYAVVNLTCES-ATVLELDRVLNLNDSVMRTKVLRGDK 98
>gi|85374299|ref|YP_458361.1| 30S ribosomal protein S6 [Erythrobacter litoralis HTCC2594] >gi|84787382|gb|ABC63564.1| ribosomal protein S6 [Erythrobacter litoralis HTCC2594] (126 aa)
Score = 92, Expect = 4.7e-02, Identities = 33/123 (26%), Positives = 65/123 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPAS-IQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRIKEQ 123
           M  YE + +    + +S+  A+A     I++K+     K E  GLK+LAY I++  + ++ + N   E P S + E  R T + ++V+R++ I +E+      +  P  ++R   R  + +R +E+
  S:     6 MALYEHIFLARQDLSQSQVDALAATATDIIEKNDGKVTKTETWGLKNLAYKIDRNRKAHFVMLNI--EGPGSVVAELERQTRINEDVIRYMTIRVEEH-----EEGPSVMMRKNDRDNKKRRDREE 124
>gi|119897009|ref|YP_932222.1| 30S ribosomal protein S6 [Azoarcus sp. BH72] >gi|166226799|sp|A1K3D0|RS6_AZOSB 30S ribosomal protein S6 >gi|119669422|emb|CAL93335.1| RpsF protein [Azoarcus sp. BH72] (127 aa)
Score = 92, Expect = 4.8e-02, Identities = 34/111 (30%), Positives = 53/111 (47%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQ 111
           M  YEI+ +V     E +  A+ +  KSI+  +     +LE  G + LAYPI K  + +Y L N    D  ++ E          VLRHL I ++     KA T P  +++ +
  S:     1 MRHYEIVFIVHPDQSE-QVPAMIDRYKSIVTARNGQIHRLEDWGRRQLAYPIQKVHKAHYVLMNI-ECDGEALGELEHAFKFNDAVLRHLTIKMK-----KAVTTPSPMMKEE 106
>gi|51894455|ref|YP_077146.1| 30S ribosomal protein S6 [Symbiobacterium thermophilum IAM 14863] >gi|61216175|sp|Q67J48|RS6_SYMTH 30S ribosomal protein S6 >gi|51858144|dbj|BAD42302.1| 30S ribosomal protein S6 [Symbiobacterium thermophilum IAM 14863] (95 aa)
Score = 92, Expect = 4.8e-02, Identities = 27/90 (30%), Positives = 48/90 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYE+M++    ++E+   A+++ +  ++  +  T    +    + LAY I     G+Y +FNF  E P +  E  RV  +  EV+R LI+
  S:     1 MRKYEMMVIARPDLDEAGLQALSDKIAELITSNGGTVESQDAWKKQRLAYEIKHLREGFYSVFNFTGE-PRTANELNRVLKITDEVVRFLIV 91
>gi|153808731|ref|ZP_01961399.1| hypothetical protein BACCAC_03030 [Bacteroides caccae ATCC 43185] >gi|149128557|gb|EDM19775.1| hypothetical protein BACCAC_03030 [Bacteroides caccae ATCC 43185] (114 aa)
Score = 92, Expect = 4.8e-02, Identities = 30/94 (31%), Positives = 46/94 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M +YE + ++   + + +        K IL+   +  +  E  GLK LAYPI KKS G+Y L  F N DP  I +        + V+R L   ++K
  S:     1 MNQYETVFILTPVLSDVQMKEAVEKFKGILQAEGAEIINEENWGLKKLAYPIQKKSTGFYQLIEF-NADPTVIDKLEVNFRRDERVIRFLTFKMDK 95
>gi|145221468|ref|YP_001132146.1| 30S ribosomal protein S6 [Mycobacterium gilvum PYR-GCK] >gi|145213954|gb|ABP43358.1| SSU ribosomal protein S6P [Mycobacterium gilvum PYR-GCK] (96 aa)
Score = 92, Expect = 4.8e-02, Identities = 30/94 (31%), Positives = 51/94 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK---STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YEIM+++D +++E           ++++K   S D K++  G + LAY I K + G Y + +   E PA++ E  R   L + VLR  ++  EK
  S:     1 MRPYEIMVILDPTLDERTVAPSLETFLNVIRKDGGSVD-KVDIWGRRRLAYEIAKHAEGIYAIIDVKAE-PATVSELDRQLNLNESVLRTKVMRTEK 95
>gi|116619043|ref|YP_819414.1| ribosomal protein S6 [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097890|gb|ABJ63041.1| Ribosomal protein S6 [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (98 aa)
Score = 92, Expect = 4.8e-02, Identities = 22/70 (31%), Positives = 37/70 (52%)
  Q:    21 AVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           A+  D  + ++KS D    +      AY I     G Y++ NF  ED  +I EF R+  + +++LRH+I+
  S:    29 AILTDNGATIQKSADWATRR-----FAYEIAGYREGTYHIINFTAEDDKAINEFDRLAKISQDILRHMIV 93
>gi|85859720|ref|YP_461922.1| SSU ribosomal protein S6P [Syntrophus aciditrophicus SB] >gi|85722811|gb|ABC77754.1| SSU ribosomal protein S6P [Syntrophus aciditrophicus SB] (173 aa)
Score = 92, Expect = 4.9e-02, Identities = 23/88 (26%), Positives = 49/88 (55%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           +YE +++   ++ E   T +     SI+  +K T +K+++ G++ LAY I K++RG Y +++F       + E  R   +   VL+++ +
  S:    23 RYETVVIAQANLPEDDMTGLIERYNSIIADRKGTVVKIDRWGVRKLAYDIRKQTRGAYVIYDFAGTSDV-VAELERNLKIDDNVLKYMTV 111
>gi|154247047|ref|YP_001418005.1| ribosomal protein S6 [Xanthobacter autotrophicus Py2] >gi|154161132|gb|ABS68348.1| ribosomal protein S6 [Xanthobacter autotrophicus Py2] (152 aa)
Score = 92, Expect = 5.0e-02, Identities = 27/94 (28%), Positives = 47/94 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE + +    +   +   +    K +++ +     K E  G+K L Y INK  + ++ L N  N   A+IQE  R   + ++VLR L + +E+
  S:     1 MPLYEHVFLARQDVTAQQVEELTTRFKGVIEANGGSVGKTEYWGVKSLTYRINKNRKAHFTLLNI-NAPAAAIQELERQQRIDEDVLRILTLRVEE 95
>gi|167462795|ref|ZP_02327884.1| 30S ribosomal protein S6 [Paenibacillus larvae subsp. larvae BRL-230010] (70 aa)
Score = 92, Expect = 5.0e-02, Identities = 23/55 (41%), Positives = 33/55 (60%)
  Q:    37 KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIIN 91
           K + MG + LAY I K   G+Y L NF  E P  ++E  RV  +  E++R+LI+N
  S:    14 KHDVMGKRRLAYEIKKFRDGHYVLVNFTAE-PEVVKELDRVMKISDEIIRYLIVN 67
>gi|114762811|ref|ZP_01442243.1| ribosomal protein S6 [Roseovarius sp. HTCC2601] >gi|114544421|gb|EAU47428.1| ribosomal protein S6 [Roseovarius sp. HTCC2601] (118 aa)
Score = 92, Expect = 5.0e-02, Identities = 26/94 (27%), Positives = 50/94 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPAS-IQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE + +    +  ++A  +     ++L  +    ++ E  G+K +AY INK  +G+Y       + PA+ +QE  R+  L  +V+R L I +++
  S:     1 MPLYEHVFIARQDLSNAQAEGLVEHFGTVLSDNGGKVVESEYWGVKTMAYKINKNRKGHYAFLK--TDAPATAVQEMERLMRLHDDVMRVLTIKVDE 95
>gi|15794430|ref|NP_284252.1| 30S ribosomal protein S6 [Neisseria meningitidis Z2491] >gi|121635034|ref|YP_975279.1| 30S ribosomal protein S6 [Neisseria meningitidis FAM18] >gi|161870198|ref|YP_001599368.1| 30S ribosomal protein S6 [Neisseria meningitidis 053442] >gi|166227354|sp|A1KUF0|RS6_NEIMF 30S ribosomal protein S6 >gi|189045476|sp|A9LZQ3|RS6_NEIM0 30S ribosomal protein S6 >gi|13959509|sp|Q9JU24|RS6_NEIMA 30S ribosomal protein S6 >gi|120866740|emb|CAM10493.1| 30S ribosomal protein S6 [Neisseria meningitidis FAM18] >gi|121052351|emb|CAM08683.1| 30S ribosomal protein S6 [Neisseria meningitidis Z2491] >gi|161595751|gb|ABX73411.1| 30S ribosomal protein S6 [Neisseria meningitidis 053442] (122 aa)
Score = 92, Expect = 5.3e-02, Identities = 29/90 (32%), Positives = 44/90 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YEI+ +V     E +  A+    K+++ ++     +LE  G + LAYPINK  + +Y L N     P  ++E          VLRHL I
  S:     1 MRHYEIVFIVHPDQSE-QVPAMVERYKTMIAEANGKIHRLEDWGRRQLAYPINKIHKAHYVLMNI-ETTPEVVEELETAFRFNDAVLRHLTI 90
>gi|29347573|ref|NP_811076.1| 30S ribosomal protein S6 [Bacteroides thetaiotaomicron VPI-5482] >gi|32171532|sp|Q8A5S5|RS6_BACTN 30S ribosomal protein S6 >gi|29339474|gb|AAO77270.1| 30S ribosomal protein S6 [Bacteroides thetaiotaomicron VPI-5482] (114 aa)
Score = 92, Expect = 5.3e-02, Identities = 30/94 (31%), Positives = 46/94 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M +YE + ++   + + +        K IL+   +  +  E  GLK LAYPI KKS G+Y L  F N DP  I +        + V+R L   ++K
  S:     1 MNQYETVFILTPVLSDVQMKEAVEKFKGILQAEGAEIINEENWGLKKLAYPIQKKSTGFYQLVEF-NADPTVIDKLELNFRRDERVIRFLTFKMDK 95
>gi|160931688|ref|ZP_02079082.1| hypothetical protein CLOLEP_00519 [Clostridium leptum DSM 753] >gi|156869333|gb|EDO62705.1| hypothetical protein CLOLEP_00519 [Clostridium leptum DSM 753] (98 aa)
Score = 92, Expect = 5.4e-02, Identities = 28/90 (31%), Positives = 48/90 (53%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKKSTDLK-LEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           YE +LV+   + +    A+    K +++ +  L+ +++ G + LAY INK++  YY L+NF   D     E  R+  +   +LR LII  E
  S:     8 YETVLVISLKLGDEGVAAMVQKFKDLIEANATLESVDEWGKRRLAYLINKEAEAYYVLYNF-KSDAEFPAELDRIYKITDGILRSLIIKKE 97
>gi|152968282|ref|YP_001364066.1| ribosomal protein S6 [Kineococcus radiotolerans SRS30216] >gi|151362799|gb|ABS05802.1| ribosomal protein S6 [Kineococcus radiotolerans SRS30216] (98 aa)
Score = 92, Expect = 5.5e-02, Identities = 28/91 (30%), Positives = 48/91 (52%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           +YE+M+++D  +EE       +   +++++      K++  G + LAY I KKS G Y +    N +PA  QE  R   L + VLR  ++  E
  S:     5 QYELMVILDAELEERTVAPSLDRFLNVVRQGGGEVGKVDIWGRRRLAYDIKKKSEGIYAVIEL-NTEPAVAQELDRQLNLNEGVLRTKLLRAE 96
>gi|94986796|ref|YP_594729.1| 30S ribosomal protein S6 [Lawsonia intracellularis PHE/MN1-00] >gi|166226976|sp|Q1MRG8|RS6_LAWIP 30S ribosomal protein S6 >gi|94731045|emb|CAJ54408.1| ribosomal protein S6 [Lawsonia intracellularis PHE/MN1-00] (105 aa)
Score = 92, Expect = 5.6e-02, Identities = 22/66 (33%), Positives = 33/66 (50%)
  Q:    29 ILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           I K      +   G++DLAYP+ K  RGYY L   Y   P  I+E  R+  +   + + + I LE+
  S:    30 IEKNKGQFTVNHWGMRDLAYPVQKHMRGYYVLLE-YTTYPNIIEELERIIRITNGIFKFMTIKLEE 94
>gi|146277395|ref|YP_001167554.1| 30S ribosomal protein S6 [Rhodobacter sphaeroides ATCC 17025] >gi|166227374|sp|A4WS85|RS6_RHOS5 30S ribosomal protein S6 >gi|145555636|gb|ABP70249.1| SSU ribosomal protein S6P [Rhodobacter sphaeroides ATCC 17025] (132 aa)
Score = 92, Expect = 5.7e-02, Identities = 26/94 (27%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE + +    +  ++A  +     ++L  +    +  E  G+K +AY INK  +G+Y      +   A++QE  R+  L  +V+R L I ++K
  S:     1 MPLYEHVFISRQDLSNAQAEGLIEHFSTVLADNGGKVVDREYWGVKTMAYKINKNRKGHYAFLK-SDAPSAAVQEMERLMRLHDDVMRVLTIKVDK 95
>gi|161579540|ref|YP_114470.2| 30S ribosomal protein S6 [Methylococcus capsulatus str. Bath] >gi|61215443|sp|Q606H8|RS6_METCA 30S ribosomal protein S6 (136 aa)
Score = 92, Expect = 5.7e-02, Identities = 35/115 (30%), Positives = 54/115 (46%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAE 115
           M  YEI+ +V    +  +  A+    +SI++ +     +LE  G + LAYPI K  + +Y L N    D A+++E          VLR L I  +     +A T P  + RS   AE
  S:     1 MRHYEIVFMVHPD-QSGQVPAMIERYRSIIEGAAGRIHRLEDWGRRQLAYPIAKLHKAHYVLMNI-ECDQATLEELESGFRFNDAVLRSLTIRRD-----EAVTEPSALARSGSDAE 110
>gi|29345794|ref|NP_809297.1| hypothetical protein BT_0384 [Bacteroides thetaiotaomicron VPI-5482] >gi|29337687|gb|AAO75491.1| hypothetical protein BT_0384 [Bacteroides thetaiotaomicron VPI-5482] (377 aa)
Score = 92, Expect = 5.9e-02, Identities = 26/61 (42%), Positives = 37/61 (60%)
  Q:    43 LKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTL----LKKEVLRHLIINLEKDYGYKAKTN 103
           LK + + I K    YY+LFNF  ED   +     +TL    LK+ V R++II +E+ YGY A T+
  S:    83 LKKMDFLIKKIIFTYYFLFNFSAEDTLVLYHSVELTLLVAKLKRLVKRNVIIEVEEIYGYSAVTD 147
>gi|157736502|ref|YP_001489185.1| 30S ribosomal protein S6 [Arcobacter butzleri RM4018] >gi|157698356|gb|ABV66516.1| 30S ribosomal protein S6 [Arcobacter butzleri RM4018] (118 aa)
Score = 91, Expect = 6.1e-02, Identities = 24/90 (26%), Positives = 51/90 (56%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           YE M ++  ++ E +  A  + +K++++K+       + +G+++LAY I K  RGYYY+  ++  +P+ I E  R     + ++R + I  +
  S:     7 YETMFILKPTLTEEETVAQIDGIKALIEKNGGEISSTDNVGIRELAYEIEKCKRGYYYVI-YFKGNPSGIAEIERNYRNNENLIRFIFIKYD 97
>gi|163797516|ref|ZP_02191467.1| Ribosomal protein S6 [alpha proteobacterium BAL199] >gi|159177265|gb|EDP61824.1| Ribosomal protein S6 [alpha proteobacterium BAL199] (158 aa)
Score = 91, Expect = 6.3e-02, Identities = 21/57 (36%), Positives = 35/57 (61%)
  Q:    37 KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           K E  GL+ LAY I K  +G+Y LFN  +   A++ E  R+  L +++LR+L + ++
  S:    39 KREYWGLRSLAYRIKKNRKGHYVLFNL-DAPAAAVSEMERLMRLNEDILRYLTVKVD 94
>gi|167730536|emb|CAO81448.1| 30S ribosomal protein S6 [Candidatus Cloacamonas acidaminovorans] (95 aa)
Score = 91, Expect = 6.4e-02, Identities = 21/87 (24%), Positives = 54/87 (62%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           YE+M+++  ++   +A A+ + L +++ ++    +K++  G + LAYPI K   GYY++ +++  D   I++ + +  + + ++R+L +
  S:     5 YELMVILVPTLSADEANAINDSLMALVTENGGEIIKIDPWGKRMLAYPIKKFREGYYFV-DYFRVDSLVIKKLKALFNINENIIRYLFV 92
>gi|56965864|ref|YP_177598.1| 30S ribosomal protein S6 [Bacillus clausii KSM-K16] >gi|61215393|sp|Q5WAH3|RS6_BACSK 30S ribosomal protein S6 >gi|56912110|dbj|BAD66638.1| 30S ribosomal protein S6 [Bacillus clausii KSM-K16] (95 aa)
Score = 91, Expect = 6.5e-02, Identities = 30/94 (31%), Positives = 50/94 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYEIM ++  ++EES    +      +L  +    LK++++G K LAY IN    G+Y L +    +  +I EF R+  +   V+R L+   E+
  S:     1 MRKYEIMYIIAPNLEESANKEIIERYNKVLTDNGAEILKVDEIGKKRLAYEINDFKDGFYVLLSV-QANTEAINEFNRLIKINDNVIRVLVTKDEQ 95
>gi|163803109|ref|ZP_02196993.1| 30S ribosomal protein S6 [Vibrio campbellii AND4] >gi|159173101|gb|EDP57933.1| 30S ribosomal protein S6 [Vibrio campbellii AND4] (126 aa)
Score = 91, Expect = 6.6e-02, Identities = 30/90 (33%), Positives = 42/90 (46%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YEI+ +V     E  A  +     SI +    + +LE  G + LAYPINK  + +Y L N    D A I E          VLR++I+
  S:     1 MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHYVLMNV-EADQAVIDELETAFRFNDAVLRNMIM 90
>gi|29830832|ref|NP_825466.1| 30S ribosomal protein S6 [Streptomyces avermitilis MA-4680] >gi|61216299|sp|Q82FG4|RS6_STRAW 30S ribosomal protein S6 >gi|29607945|dbj|BAC72001.1| putative ribosomal protein S6 [Streptomyces avermitilis MA-4680] (96 aa)
Score = 91, Expect = 6.7e-02, Identities = 27/93 (29%), Positives = 50/93 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE+M+++D  +EE   + +  +  S++++      K++  G + L+Y I KK  G Y + +   E PA ++E  R   L + VLR  ++  E
  S:     1 MRHYEVMVILDPDLEERAVSPLIENFLSVVREGNGKVEKVDTWGRRRLSYEIKKKPEGIYSVIDLQAE-PAVVKELDRQMNLNESVLRTKVLRPE 94
>gi|149203936|ref|ZP_01880904.1| ribosomal protein S6 [Roseovarius sp. TM1035] >gi|149142378|gb|EDM30423.1| ribosomal protein S6 [Roseovarius sp. TM1035] (141 aa)
Score = 91, Expect = 6.7e-02, Identities = 26/93 (27%), Positives = 53/93 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPAS-IQEFRRVTLLKKEVLRHLIINLE 93
           MP YE +++    +  ++A  +     ++L ++  T ++ E  G+K +AY INK  +G+Y      ++ P+S +QE  R+  L  +V+R L + ++
  S:     1 MPLYEHVMIARQDLSSAQAEGLIEHFGAVLTENGGTLVEHEYWGVKTMAYKINKNRKGHYAFLK--SDAPSSAVQEMERLMRLHDDVMRVLTVKVD 94
>gi|172059040|ref|YP_001815500.1| ribosomal protein S6 [Exiguobacterium sibiricum 255-15] >gi|171991561|gb|ACB62483.1| ribosomal protein S6 [Exiguobacterium sibiricum 255-15] (95 aa)
Score = 91, Expect = 6.8e-02, Identities = 28/94 (29%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYE++ ++   ++E    A+      +L  +  T  K  +MG +  AY IN    G+Y L N   E PA+ +E  R+  +  +++R +I   EK
  S:     1 MRKYEVLYIIRPEVDEEARKALVERFNKVLTDNGGTVEKTTEMGKRRFAYEINDMREGFYVLLNVTAE-PAATKELDRLMKISDDIVRLMITKDEK 95
>gi|163746684|ref|ZP_02154041.1| 30S ribosomal protein S6 [Oceanibulbus indolifex HEL-45] >gi|161379798|gb|EDQ04210.1| 30S ribosomal protein S6 [Oceanibulbus indolifex HEL-45] (117 aa)
Score = 91, Expect = 7.0e-02, Identities = 29/94 (30%), Positives = 53/94 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKL---EKMGLKDLAYPINKKSRGYYYLFNFYNEDPAS-IQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE +++    +  ++A  +     ++L  + D KL   E  G+K +AY INK  +G+Y      ++ PA+ +QE  R+  L  +V+R L I +++
  S:     1 MPLYEHVMIARQDLSNTQAEGLIEHFGTVLADN-DGKLVDSEYWGVKTMAYKINKNRKGHYAFLR--SDAPATAVQEMERLMRLHDDVMRVLTIKVDE 95
>gi|83943161|ref|ZP_00955621.1| ribosomal protein S6 [Sulfitobacter sp. EE-36] >gi|83954296|ref|ZP_00963016.1| ribosomal protein S6 [Sulfitobacter sp. NAS-14.1] >gi|83841333|gb|EAP80503.1| ribosomal protein S6 [Sulfitobacter sp. NAS-14.1] >gi|83846169|gb|EAP84046.1| ribosomal protein S6 [Sulfitobacter sp. EE-36] (120 aa)
Score = 91, Expect = 7.0e-02, Identities = 29/94 (30%), Positives = 53/94 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKL---EKMGLKDLAYPINKKSRGYYYLFNFYNEDPAS-IQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE +++    +  ++A  +     ++L  + D KL   E  G+K +AY INK  +G+Y      ++ PA+ +QE  R+  L  +V+R L I +++
  S:     1 MPLYEHVMIARQDLSNTQAEGLIEHFGTVLADN-DGKLVDSEYWGVKTMAYKINKNRKGHYAFLR--SDAPATAVQEMERLMRLHDDVMRVLTIKVDE 95
>gi|158319029|ref|YP_001511537.1| 30S ribosomal protein S6 [Frankia sp. EAN1pec] >gi|158114434|gb|ABW16631.1| ribosomal protein S6 [Frankia sp. EAN1pec] (108 aa)
Score = 91, Expect = 7.3e-02, Identities = 26/92 (28%), Positives = 51/92 (55%)
  Q:     1 MPK-YEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           MP+ YE+M+++D  +EE       +   +++++   +  K++  G + L+Y I K   G Y + + + E PA + E  R  +L + V+R  +I L
  S:     1 MPRHYELMVILDSELEERTVAPSLDQYLNVVRQGGGVVEKVDVWGRRRLSYEIAKSFEGIYAVIDLHTE-PAVVAELDRQLVLNESVIRTKVIRL 94
>gi|94995010|ref|YP_603108.1| SSU ribosomal protein S6P [Streptococcus pyogenes MGAS10750] >gi|94548518|gb|ABF38564.1| SSU ribosomal protein S6P [Streptococcus pyogenes MGAS10750] (84 aa)
Score = 91, Expect = 7.4e-02, Identities = 26/76 (34%), Positives = 40/76 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRR 76
           M KYEI+ ++  +IEE    A+     SIL    +T ++ +    + LAY IN    G Y++ N    D A++ EF R
  S:     1 MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEINDFREGLYHIVNLEATDAAALNEFDR 78
>gi|15677189|ref|NP_274342.1| 30S ribosomal protein S6 [Neisseria meningitidis MC58] >gi|13959510|sp|Q9JZ29|RS6_NEIMB 30S ribosomal protein S6 >gi|7226565|gb|AAF41698.1| 30S ribosomal protein S6 [Neisseria meningitidis MC58] (122 aa)
Score = 91, Expect = 7.4e-02, Identities = 28/90 (31%), Positives = 44/90 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YEI+ +V     E +  A+    K+++ ++     +LE  G + LAYPINK  + +Y L N     P  ++E          +LRHL I
  S:     1 MRHYEIVFIVHPDQSE-QVPAMVERYKTMIAEANGKIHRLEDWGRRQLAYPINKIHKAHYVLMNI-ETTPEVVEELETAFRFNDAILRHLTI 90
>gi|89068232|ref|ZP_01155642.1| Ribosomal protein S6 [Oceanicola granulosus HTCC2516] >gi|89046149|gb|EAR52207.1| Ribosomal protein S6 [Oceanicola granulosus HTCC2516] (118 aa)
Score = 91, Expect = 7.4e-02, Identities = 26/94 (27%), Positives = 46/94 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE + +    +  ++A  +      +L  +    +  E  G+K +AY INK  +G+Y         PA +QE  R+  L  +V+R L I +++
  S:     1 MPLYEHVFIARQDLSNAQAEGLIEHFSQVLADNDGKVVDTEYWGVKTMAYKINKNRKGHYAFLKTDAPAPA-VQEMERLMRLHDDVMRVLTIRVDE 95
>gi|161506641|ref|YP_001576589.1| 30S ribosomal protein S6 [Lactobacillus helveticus DPC 4571] >gi|189045473|sp|A8YW47|RS6_LACH4 30S ribosomal protein S6 >gi|160347630|gb|ABX26304.1| 30S ribosomal protein S6 [Lactobacillus helveticus DPC 4571] (98 aa)
Score = 91, Expect = 7.5e-02, Identities = 21/92 (22%), Positives = 49/92 (53%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           KYE+  ++   ++E    A+  +   ++  +  T ++ +  G +  AY I+K   G Y++  F  ++  ++ EF R++ +   +LR + + L+K
  S:     5 KYEVTYIIKPDVDEESKKALVENYDKVIADNGGTMVESKDWGKRRFAYEIDKYREGTYHIMTFTADNADAVNEFGRLSKIDNMILRSMTVKLDK 98
>gi|160885185|ref|ZP_02066188.1| hypothetical protein BACOVA_03183 [Bacteroides ovatus ATCC 8483] >gi|156109535|gb|EDO11280.1| hypothetical protein BACOVA_03183 [Bacteroides ovatus ATCC 8483] (114 aa)
Score = 91, Expect = 7.7e-02, Identities = 29/94 (30%), Positives = 46/94 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M +YE + ++   + + +        K +L+   +  +  E  GLK LAYPI KKS G+Y L  F N DP  I +        + V+R L   ++K
  S:     1 MNQYETVFILTPVLSDVQMKEAVEKFKGVLQAEGAEIINEENWGLKKLAYPIQKKSTGFYQLIEF-NADPTVIDKLEINFRRDERVIRFLTFKMDK 95
>gi|86133512|ref|ZP_01052094.1| 30S ribosomal protein S6 [Tenacibaculum sp. MED152] >gi|85820375|gb|EAQ41522.1| 30S ribosomal protein S6 [Polaribacter dokdonensis MED152] (113 aa)
Score = 91, Expect = 7.7e-02, Identities = 32/94 (34%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFY---NEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE + +++  + +++           L  K +  +  E  GLK LAYPI KK  G+Y+LF F     E  A   EFRR       V+R+L + L+K
  S:     1 MNHYETVFILNPVLSDTQIKETVQKFNDYLVSKGAEMISKEDWGLKKLAYPIQKKKSGFYHLFEFKIAGEEITAFELEFRR----DDSVMRYLTVRLDK 95
>gi|188997590|ref|YP_001931841.1| ribosomal protein S6 [Sulfurihydrogenibium sp. YO3AOP1] >gi|188932657|gb|ACD67287.1| ribosomal protein S6 [Sulfurihydrogenibium sp. YO3AOP1] (104 aa)
Score = 90, Expect = 7.8e-02, Identities = 28/93 (30%), Positives = 54/93 (58%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNED---PASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE++ V+  ++ E +       +K +++++       E  G ++LAYPINK + GYY+L NF   +   PA+++   R+    ++V+R L + L+
  S:     1 MRHYELVFVLKPTLSEEEIKTRVQAIKDLIQQNQGEIYNEENWGRRNLAYPINKFNSGYYFLINFKTGNSNLPATLEYNLRIN---EDVIRFLNMKLK 95
>gi|47459062|ref|YP_015924.1| 30S ribosomal protein S6 [Mycoplasma mobile 163K] >gi|47458391|gb|AAT27713.1| 30S ribosomal protein s6 [Mycoplasma mobile 163K] (154 aa)
Score = 90, Expect = 7.9e-02, Identities = 34/117 (29%), Positives = 59/117 (50%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKR 119
           KYEI+++ D   E+S      N +   ++K      E++   +LAY +N  S  +Y+L N   + P  I EF R   + K + R ++INL+ +     K + KK  + +  A+R +R
  S:     4 KYEILIMTDPKEEKSVIEKFTNQIFKKIEK-----FEQLERTELAYKVNHSSTAHYFLVNVEAKGP-EITEFNRRANISKTIWRTMVINLDTEKYLSKKASEKKFTK-KITADRPRR 113
>gi|32266035|ref|NP_860067.1| 30S ribosomal protein S6 [Helicobacter hepaticus ATCC 51449] >gi|61215713|sp|Q7VIR8|RS6_HELHP 30S ribosomal protein S6 >gi|32262084|gb|AAP77133.1| ribosomal protein S6 [Helicobacter hepaticus ATCC 51449] (137 aa)
Score = 90, Expect = 8.1e-02, Identities = 29/93 (31%), Positives = 53/93 (56%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEK---MGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE M ++  ++ E +  A  +  K ++ K+   ++E    MG+++LAY I K  RGYY++  ++   P+ I E  R   + +E+LR ++I  E
  S:     1 MKFYETMFILKPTLVEVEIKARLDFFKEVIIKNGG-EIETCLDMGMRNLAYEIKKNKRGYYFVI-YFKAQPSLILELERNYRINEEILRFIVIKYE 94
>gi|21222313|ref|NP_628092.1| 30S ribosomal protein S6 [Streptomyces coelicolor A3(2)] >gi|7388220|sp|Q9X8U2|RS6_STRCO 30S ribosomal protein S6 >gi|4808402|emb|CAB42734.1| putative 30S ribosomal protein S6 [Streptomyces coelicolor A3(2)] (96 aa)
Score = 90, Expect = 8.1e-02, Identities = 27/93 (29%), Positives = 49/93 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE+M+++D  +EE   + +  +  S+++       K++  G + L+Y I KK  G Y + +   E PA ++E  R   L + VLR  ++  E
  S:     1 MRHYEVMVILDPDLEERSVSPLIENFLSVVRDGGGKVEKVDTWGRRRLSYEIKKKPEGIYSVIDLQAE-PAVVKELDRQMNLNESVLRTKVLRPE 94
>gi|169198563|ref|ZP_02857872.1| ribosomal protein S6 [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169087692|gb|EDS67407.1| ribosomal protein S6 [Rhizobium leguminosarum bv. trifolii WSM2304] (155 aa)
Score = 90, Expect = 8.4e-02, Identities = 26/94 (27%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE + +    I   +  A+    K +++ +     ++E  GLK L Y I K  + +Y L +  +   A++QE  R   + ++VLR++ I +EK
  S:     1 MALYEHVFLARQDISAQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHYALMDI-DAPAAAVQEMERQMRISEDVLRYMTIAVEK 95
>gi|116251321|ref|YP_767159.1| 30S ribosomal protein S6 [Rhizobium leguminosarum bv. viciae 3841] >gi|167358798|ref|ZP_02293448.1| ribosomal protein S6 [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|166227372|sp|Q1MJ10|RS6_RHIL3 30S ribosomal protein S6 >gi|115255969|emb|CAK07050.1| putative 30S ribosomal protein S6 [Rhizobium leguminosarum bv. viciae 3841] >gi|167074309|gb|EDR78135.1| ribosomal protein S6 [Rhizobium leguminosarum bv. trifolii WSM1325] (155 aa)
Score = 90, Expect = 8.4e-02, Identities = 26/94 (27%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE + +    I   +  A+    K +++ +     ++E  GLK L Y I K  + +Y L +  +   A++QE  R   + ++VLR++ I +EK
  S:     1 MALYEHVFLARQDISAQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHYALMDI-DAPAAAVQEMERQMRISEDVLRYMTIAVEK 95
>gi|15828450|ref|NP_302713.1| 30S ribosomal protein S6 [Mycobacterium leprae TN] >gi|1173272|sp|P46389|RS6_MYCLE 30S ribosomal protein S6 >gi|886305|gb|AAB53121.1| 30S ribosomal protein S6 >gi|2959412|emb|CAA17954.1| 30s ribosomal protein s6 [Mycobacterium leprae] >gi|13093880|emb|CAC32217.1| 30S ribosomal protein S6 [Mycobacterium leprae] (96 aa)
Score = 90, Expect = 8.7e-02, Identities = 26/94 (27%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YEIM+++D +++E           ++++K      K++  G + LAY I+K + G Y + +     PA++ E  R   L + VLR  ++  +K
  S:     1 MRPYEIMVILDPTLDECTVGPSLETFLNVVRKDGGAIDKVDIWGRRRLAYEISKHAEGIYVVIDL-KAAPATVSELDRQLSLNESVLRTKVMRTDK 95
>gi|163731327|ref|ZP_02138774.1| 30S ribosomal protein S6 [Roseobacter litoralis Och 149] >gi|161394781|gb|EDQ19103.1| 30S ribosomal protein S6 [Roseobacter litoralis Och 149] (117 aa)
Score = 90, Expect = 8.8e-02, Identities = 25/94 (26%), Positives = 47/94 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE +++    +  ++A  +     ++L  +    +  E  G+K +AY INK  +G+Y         PA + E  R+  L  +V+R L I +++
  S:     1 MPLYEHVMIARQDLSNTQAEGLIEHFGTVLSDNGGALVDHEYWGVKTMAYKINKNRKGHYAFLRSDAPAPA-VHEMERLMRLHDDVMRVLTIKVDE 95
>gi|85707089|ref|ZP_01038177.1| ribosomal protein S6 [Roseovarius sp. 217] >gi|85668375|gb|EAQ23248.1| ribosomal protein S6 [Roseovarius sp. 217] (150 aa)
Score = 90, Expect = 8.8e-02, Identities = 27/93 (29%), Positives = 51/93 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPAS-IQEFRRVTLLKKEVLRHLIINLE 93
           MP YE +++    +  ++A  +     ++L  +  T ++ E  G+K +AY INK  +G+Y       + P+S +QE  R+  L  +V+R L I ++
  S:     1 MPLYEHVMIARQDLSSAQAEGLIEHFGAVLTDNGGTLVEHEYWGVKTMAYKINKNRKGHYAFLK--TDAPSSAVQEMERLMRLHDDVMRVLTIKVD 94
>gi|120406964|ref|YP_956793.1| 30S ribosomal protein S6 [Mycobacterium vanbaalenii PYR-1] >gi|119959782|gb|ABM16787.1| SSU ribosomal protein S6P [Mycobacterium vanbaalenii PYR-1] (96 aa)
Score = 90, Expect = 8.9e-02, Identities = 28/94 (29%), Positives = 50/94 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YEIM+++D +++E           ++++K   T  K++  G + LAY I K + G Y + +   E PA++ E  R   L + VLR  ++  +K
  S:     1 MRPYEIMVILDPTLDERTVAPSLETFLNVIRKDGGTVDKVDIWGRRRLAYEIAKHAEGIYAIVDVKAE-PATVSELDRQLNLNESVLRTKVMRTDK 95
>gi|190891122|ref|YP_001977664.1| 30S ribosomal protein S6 [Rhizobium etli CIAT 652] >gi|190696401|gb|ACE90486.1| 30S ribosomal protein S6 [Rhizobium etli CIAT 652] (152 aa)
Score = 90, Expect = 8.9e-02, Identities = 31/119 (26%), Positives = 58/119 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKR 119
           M  YE + +    I   +  A+    K +++ +     ++E  GLK L Y I K  + +Y L +  +   A+IQE  R   + ++VLR++ I +EK      +  P  +++ + R +R  R
  S:     1 MALYEHVFLARQDISAQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHYALMDI-DAPAAAIQEMERQMRISEDVLRYMTIAVEKH-----EEGPSAMLQKRDRDDRGPR 115
>gi|167773046|ref|ZP_02445099.1| hypothetical protein ANACOL_04435 [Anaerotruncus colihominis DSM 17241] >gi|167664979|gb|EDS09109.1| hypothetical protein ANACOL_04435 [Anaerotruncus colihominis DSM 17241] (117 aa)
Score = 90, Expect = 8.9e-02, Identities = 25/92 (27%), Positives = 48/92 (52%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKD 95
           YE ++V+     E     +     +++  + ++ K++  G + LAYP+N ++ GYY + NF ++ P    E  R+  +   VLR LI+  E +
  S:     8 YETVMVLSMKNGEEGVNTLVEKFNTLIADNAEITKVDTWGQRALAYPMNDETVGYYVVINFTSK-PDFPAELDRIYKITDGVLRSLIVAKEPE 99
>gi|59801012|ref|YP_207724.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae FA 1090] >gi|3122818|sp|O07813|RS6_NEIGO 30S ribosomal protein S6 >gi|75432531|sp|Q5F925|RS6_NEIG1 30S ribosomal protein S6 >gi|2196757|gb|AAB61228.1| ribosomal protein S6 [Neisseria gonorrhoeae] >gi|59717907|gb|AAW89312.1| putative 30S ribosomal protein S6 [Neisseria gonorrhoeae FA 1090] (122 aa)
Score = 90, Expect = 9.1e-02, Identities = 29/90 (32%), Positives = 43/90 (47%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YEI+ +V     E +  A+    K+++ ++     +LE  G + LAYPINK  + +Y L N     P  + E          VLRHL I
  S:     1 MRHYEIVFIVHPDQSE-QVPAMVERYKTMITEANGKIHRLEDWGRRQLAYPINKIHKAHYVLMNI-ETTPEVVGELETAFRFNDAVLRHLTI 90
>gi|23008095|ref|ZP_00049682.1| COG0360: Ribosomal protein S6 [Magnetospirillum magnetotacticum MS-1] (96 aa)
Score = 90, Expect = 9.1e-02, Identities = 32/90 (35%), Positives = 50/90 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK---STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M +YE+M+++D  IEE       +   S++K    S D K++  G + LAY INKKS G Y + +F +    + +E  R   L + VLR  I+
  S:     1 MRQYELMIILDPEIEERTVAPSLDKYLSVIKTDGGSVD-KVDIWGRRRLAYDINKKSEGIYAVVDFTSTSDTA-KELDRQLGLNEVVLRTKIL 91
>gi|149913882|ref|ZP_01902414.1| 30S ribosomal protein S6 [Roseobacter sp. AzwK-3b] >gi|149812166|gb|EDM71997.1| 30S ribosomal protein S6 [Roseobacter sp. AzwK-3b] (126 aa)
Score = 90, Expect = 9.2e-02, Identities = 25/94 (26%), Positives = 47/94 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE + +    +  ++A  +     ++L  +    +  E  G+K +AY INK  +G+Y         PA +QE  R+  L  +V+R + I +++
  S:    10 MPLYEHVFIARQDLSNAQAEGLIEHFGTVLSDNGGKIVDSEYWGVKTMAYKINKNRKGHYSFLRTDAPAPA-VQEMERLMRLHDDVMRVMTIKVDE 104
>gi|150025894|ref|YP_001296720.1| 30S ribosomal protein S6 [Flavobacterium psychrophilum JIP02/86] >gi|166226830|sp|A6H0P3|RS6_FLAPJ 30S ribosomal protein S6 >gi|149772435|emb|CAL43917.1| 30S ribosomal protein S6 [Flavobacterium psychrophilum JIP02/86] (113 aa)
Score = 90, Expect = 9.5e-02, Identities = 30/94 (31%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASI---QEFRRVTLLKKEVLRHLIINLEK 94
           M  YE + +++  + E++     +  +  L  K +T +  E  GLK +AY I  K  G+Y+LF F       I    EFRR     + V+R L ++L+K
  S:     1 MNHYETVFILNPVLSETQVKETVSKFEDYLTSKGATMVSKEDWGLKKMAYEIQNKKSGFYHLFEFTVPGEVLIGFETEFRR----DERVMRFLTVSLDK 95
>gi|126661840|ref|ZP_01732839.1| 30S ribosomal subunit protein S6 [Flavobacteria bacterium BAL38] >gi|126625219|gb|EAZ95908.1| 30S ribosomal subunit protein S6 [Flavobacteria bacterium BAL38] (113 aa)
Score = 90, Expect = 9.5e-02, Identities = 33/94 (35%), Positives = 50/94 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASI-----QEFRRVTLLKKEVLRHLIINLEK 94
           M  YE + +++  + E +     +  +  L  K S  +  E  GLK LAY I  K  G+Y+LF F  + PA I      EFRR     + V+R L ++L+K
  S:     1 MNHYETVFILNPVLSEQQVKETVSKFEDFLTSKGSEMVSKEDWGLKKLAYEIQHKKSGFYHLFEF--KAPAEIIIAFETEFRR----DERVMRFLTVSLDK 95
>gi|17987763|ref|NP_540397.1| 30S ribosomal protein S6 [Brucella melitensis 16M] >gi|24212309|sp|Q8YFP0|RS6_BRUME 30S ribosomal protein S6 >gi|17983485|gb|AAL52661.1| SSU ribosomal protein S6P [Brucella melitensis 16M] (148 aa)
Score = 90, Expect = 9.5e-02, Identities = 27/94 (28%), Positives = 47/94 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE +L+    I + +  A+    K +L+ +     K+E  GL+ L Y I K  + YY L N  +   A++ E  R   + ++VL  L + +E+
  S:     1 MALYEHVLLARQDISQQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYYTLVNI-DAPAAAVAEMERQMRINEDVLSFLTVRVEE 95
>gi|187603424|ref|ZP_02989636.1| ribosomal protein S6 [Exiguobacterium sp. AT1b] >gi|187484199|gb|EDU22191.1| ribosomal protein S6 [Exiguobacterium sp. AT1b] (95 aa)
Score = 90, Expect = 9.7e-02, Identities = 28/94 (29%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M KYE++ ++  S++E    A+     +++ ++  T  K   MG +  AY INK   G+Y L N   E P +I E  R+  +  +V+R +    E+
  S:     1 MRKYELLYIIRPSVDEEAKKALIERFNNVITENGGTVEKTTDMGKRRFAYEINKMREGHYVLLNIVAE-PKAILETERLMKISDDVVRQMTTKDER 95
>gi|177672344|ref|ZP_02945149.1| ribosomal protein S6 [Micrococcus luteus NCTC 2665] >gi|172071010|gb|EDT57058.1| ribosomal protein S6 [Micrococcus luteus NCTC 2665] (101 aa)
Score = 90, Expect = 1.0e-01, Identities = 33/94 (35%), Positives = 51/94 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-----KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE+M+++D  ++E     V   LK  L+  T+       ++  G +  AY I KKS   Y + NF +E PA+ QE  R+  L + +LR  II  E+
  S:     1 MRAYELMVLIDPEVDER---TVEPTLKKYLEVVTNAGGTVDNIDVWGRRKTAYEIQKKSEAIYVVVNFQSE-PAATQELDRLLNLNETILRTKIIRPEE 95
>gi|78042831|ref|YP_358907.1| 30S ribosomal protein S6 [Carboxydothermus hydrogenoformans Z-2901] >gi|91207906|sp|Q3AG27|RS6_CARHZ 30S ribosomal protein S6 >gi|77994946|gb|ABB13845.1| ribosomal protein S6 [Carboxydothermus hydrogenoformans Z-2901] (96 aa)
Score = 90, Expect = 1.0e-01, Identities = 24/92 (26%), Positives = 49/92 (53%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           +YE+M ++   ++  K  ++    K ++++      K+++ G +  AY I K   GYY + NF      + QE  R+  +  +V+RH++I  +K
  S:     4 QYEVMYILHPELDAEKTESIIERFKGMIEQEGGEVTKIDRWGKRRFAYEIKKLREGYYVVMNF-KAKAETAQELDRLLRISDDVVRHIVIREDK 96
>gi|126725406|ref|ZP_01741248.1| ribosomal protein S6 [Rhodobacterales bacterium HTCC2150] >gi|126704610|gb|EBA03701.1| ribosomal protein S6 [Rhodobacterales bacterium HTCC2150] (118 aa)
Score = 89, Expect = 1.0e-01, Identities = 27/93 (29%), Positives = 49/93 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPAS-IQEFRRVTLLKKEVLRHLIINLE 93
           MP YE + +    +  ++A  +     ++L  +    ++ E  G+K +AY INK  +G+Y       + PA+ IQE  R+  L  +V+R L I ++
  S:     1 MPLYEHVFISRQDLSNTQAEGLIEHFTAVLADNGGKVVENEYWGIKTMAYKINKNRKGHYAFLK--TDAPATAIQEMERLMRLHDDVMRILTIKVD 94
>gi|91204937|ref|YP_537292.1| 30S ribosomal protein S6 [Rickettsia bellii RML369-C] >gi|122426077|sp|Q1RKB1|RS6_RICBR 30S ribosomal protein S6 >gi|91068481|gb|ABE04203.1| 30S ribosomal protein S6 [Rickettsia bellii RML369-C] (120 aa)
Score = 89, Expect = 1.1e-01, Identities = 27/88 (30%), Positives = 43/88 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHL 88
           M  YE + +V   +  +    + +D   I+K +    +K E  GL+ LAY I    +G+YYL    +  PA  QE  R   L + ++R L
  S:     1 MSFYESVFIVRQDVSLNDIDKIVDDFSKIIKDNNGAIVKKEYWGLRALAYKIGNHKKGHYYLLGL-DTTPAVKQELERKMKLNENIIRFL 89
>gi|84684849|ref|ZP_01012749.1| Ribosomal protein S6 [Rhodobacterales bacterium HTCC2654] >gi|84667184|gb|EAQ13654.1| Ribosomal protein S6 [Rhodobacterales bacterium HTCC2654] (121 aa)
Score = 89, Expect = 1.1e-01, Identities = 24/93 (25%), Positives = 47/93 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           MP YE +++    +  ++A  +     ++L  +    +  E  G+K +AY INK  +G+Y      +    ++QE  R+  L  +V+R L I ++
  S:     1 MPLYEHVMIARQDLSNAQAEGLVEHFSTVLSDNGGKVVDSEYWGVKTMAYKINKNRKGHYAFLK-TDAPSTAVQEMERLMRLHDDVMRVLTIKVD 94
>gi|90419489|ref|ZP_01227399.1| ribosomal protein S6 [Aurantimonas sp. SI85-9A1] >gi|90336426|gb|EAS50167.1| ribosomal protein S6 [Aurantimonas sp. SI85-9A1] (146 aa)
Score = 89, Expect = 1.1e-01, Identities = 27/94 (28%), Positives = 47/94 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE + +    I   +   +   L+ IL+ +     K+E  GLK L + I K  + YY L N  +   A++QE  R     +++LR++ I +E+
  S:     1 MALYEHVFLARQDISNQQVEQLVEQLRGILETNGGKIGKVENWGLKTLTFRIKKNRKAYYTLMNI-DAPSAAVQEMERQMRFNEDILRYMTIRVEE 95
>gi|41406165|ref|NP_959001.1| 30S ribosomal protein S6 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118465214|ref|YP_879374.1| 30S ribosomal protein S6 [Mycobacterium avium 104] >gi|61215645|sp|Q744V6|RS6_MYCPA 30S ribosomal protein S6 >gi|41394513|gb|AAS02384.1| RpsF [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118166501|gb|ABK67398.1| ribosomal protein S6 [Mycobacterium avium 104] (96 aa)
Score = 89, Expect = 1.1e-01, Identities = 27/94 (28%), Positives = 50/94 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YEIM+++D +++E           ++++K   +  K++  G + LAY I K + G Y + +   E PA++ E  R   L + VLR  ++  +K
  S:     1 MRPYEIMVILDPTLDERTVAPSLETFLNVVRKDGGSVEKVDIWGRRRLAYEIAKHAEGIYVVIDLKAE-PATVSELDRQLSLNESVLRTKVMRTDK 95
>gi|148653437|ref|YP_001280530.1| 30S ribosomal protein S6 [Psychrobacter sp. PRwf-1] >gi|189045489|sp|A5WFY9|RS6_PSYWF 30S ribosomal protein S6 >gi|148572521|gb|ABQ94580.1| SSU ribosomal protein S6P [Psychrobacter sp. PRwf-1] (134 aa)
Score = 89, Expect = 1.1e-01, Identities = 30/110 (27%), Positives = 54/110 (49%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRS 110
           M  YE++L+V     +     V   +K +   +  + +LE  G + LAYPINK  + +Y LFN    D A+++E   +      ++R L++  +      A T P ++ +S
  S:     1 MRHYEVVLIVHPDQSDQVVGMVERYIKLVQDNNGMVHRLEDWGRRQLAYPINKIHKAHYVLFNI-ECDGATLEELEELFRYNDAIIRSLVVRRD-----DAITEPSQLAKS 105
>gi|169631972|ref|YP_001705621.1| 30S ribosomal protein S6 [Mycobacterium abscessus] >gi|169243939|emb|CAM64967.1| 30S ribosomal protein S6 [Mycobacterium abscessus] (96 aa)
Score = 89, Expect = 1.1e-01, Identities = 26/86 (30%), Positives = 46/86 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLR 86
           M +YEIM+++D +++E       +   ++++    T  K+E  G + LAY I K + G Y + +     PA++ E  R   L + VLR
  S:     1 MRQYEIMVILDPTLDERTVAPSLDTFLNVVRGDGGTVSKVEVWGKRRLAYEIAKHTEGIYAVIDVVAA-PATVSELDRQLGLNESVLR 87
>gi|164686460|ref|ZP_02210488.1| hypothetical protein CLOBAR_00025 [Clostridium bartlettii DSM 16795] >gi|164604471|gb|EDQ97936.1| hypothetical protein CLOBAR_00025 [Clostridium bartlettii DSM 16795] (92 aa)
Score = 89, Expect = 1.1e-01, Identities = 29/90 (32%), Positives = 52/90 (57%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYN--EDPASIQEFRRVTLLKKEVLRHLII 90
           M  YE++ VV  + ++    +V N +K ++  + ++ K++  G K LAY I K + G+Y L NF +  E P   +E  R   + + V+RH+I+
  S:     1 MKNYELVYVVKPNSDDETKESVLNKIKDVISSNGEVEKVDTWGNKKLAYQIAKFTEGFYVLVNFKSGVEVP---KELDRNLKINENVIRHMIV 90
>gi|157827735|ref|YP_001496799.1| 30S ribosomal protein S6 [Rickettsia bellii OSU 85-389] >gi|166227375|sp|A8GY12|RS6_RICB8 30S ribosomal protein S6 >gi|157803039|gb|ABV79762.1| 30S ribosomal protein S6 [Rickettsia bellii OSU 85-389] (120 aa)
Score = 89, Expect = 1.1e-01, Identities = 27/88 (30%), Positives = 43/88 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHL 88
           M  YE + +V   +  +    + +D   I+K +    +K E  GL+ LAY I    +G+YYL    +  PA  QE  R   L + ++R L
  S:     1 MSFYESVFIVRQDVSLNDIDKIVDDFTKIIKDNNGAIVKKEYWGLRALAYKIGNHKKGHYYLLGL-DTTPAVKQELERKMKLNENIIRFL 89
>gi|163764984|ref|ZP_02172033.1| IstB domain protein ATP-binding protein [Bacillus selenitireducens MLS10] >gi|160354522|gb|EDP81186.1| IstB domain protein ATP-binding protein [Bacillus selenitireducens MLS10] (95 aa)
Score = 89, Expect = 1.2e-01, Identities = 27/90 (30%), Positives = 46/90 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M KYEIM +V   +EE           +IL  +     + ++MG + LAY I   + G+Y L    N +  ++ EF R++ +   +LR +I+
  S:     1 MRKYEIMYIVRPDLEEQAVKETVERFNTILTNNGAELTETKEMGKRRLAYEIEDFTDGFYVLIQL-NANKDALDEFNRLSSINDNILRSIIV 91
>gi|154503454|ref|ZP_02040514.1| hypothetical protein RUMGNA_01278 [Ruminococcus gnavus ATCC 29149] >gi|153795554|gb|EDN77974.1| hypothetical protein RUMGNA_01278 [Ruminococcus gnavus ATCC 29149] (136 aa)
Score = 89, Expect = 1.2e-01, Identities = 27/93 (29%), Positives = 45/93 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYE+ +VV   IE+    AV   +K ++ +       +++ G +  AY I K   G+YY  +F   D +   E  +   +   VLR+L +  E
  S:    42 MNKYELAVVVSAKIEDDARAAVIEKVKEMITRFGGNVTDVDEWGKRRFAYEIQKMKEGFYYFVHF-ESDASVPGEIEQRIRIMDNVLRYLCVRQE 135
>gi|163725806|ref|ZP_02133325.1| ribosomal protein S6 [Desulfatibacillum alkenivorans AK-01] >gi|161400833|gb|EDQ25082.1| ribosomal protein S6 [Desulfatibacillum alkenivorans AK-01] (185 aa)
Score = 89, Expect = 1.2e-01, Identities = 25/95 (26%), Positives = 47/95 (49%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLK--LEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKD 95
           M +YE + + D  + E     +   ++ ++ +        ++ G + LAY + KK RGYY L +F  E  + I E  R+  +   +L+ L I  E++
  S:     1 MRRYETIFISDPDLPEDNRATLFEKMQGLIAEHDGYIAFFDEWGARKLAYEVKKKKRGYYVLMDFCAEG-SLIAEMERIMRIDDRILKFLTIQTEEE 96
>gi|154253798|ref|YP_001414622.1| ribosomal protein S6 [Parvibaculum lavamentivorans DS-1] >gi|189045484|sp|A7HYI2|RS6_PARL1 30S ribosomal protein S6 >gi|154157748|gb|ABS64965.1| ribosomal protein S6 [Parvibaculum lavamentivorans DS-1] (155 aa)
Score = 89, Expect = 1.2e-01, Identities = 27/110 (24%), Positives = 56/110 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRS 110
           M  YE + +    + + +  A+     +I+K+      K E  GL++LA+ + K  +G+Y L N  +   A++ E  R   + ++VLR + + +E+      +T P  +++S
  S:     1 MALYEHIFIARQDVSQQQVEALTEQFSNIIKEQGGQVGKTEYWGLRNLAFKVKKNRKGHYTLVNI-DAPHAAVAEMERQMGISEDVLRFITVRVEEH-----ETEPSAMMQS 106
>gi|28899514|ref|NP_799119.1| 30S ribosomal protein S6 [Vibrio parahaemolyticus RIMD 2210633] >gi|91227277|ref|ZP_01261702.1| 30S ribosomal protein S6 [Vibrio alginolyticus 12G01] >gi|31340374|sp|Q87L72|RS6_VIBPA 30S ribosomal protein S6 >gi|28807750|dbj|BAC61003.1| ribosomal protein S6 [Vibrio parahaemolyticus RIMD 2210633] >gi|91188671|gb|EAS74960.1| 30S ribosomal protein S6 [Vibrio alginolyticus 12G01] (129 aa)
Score = 89, Expect = 1.2e-01, Identities = 30/90 (33%), Positives = 42/90 (46%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YEI+ +V     E  A  +     SI +    + +LE  G + LAYPINK  + +Y L N    D A I E          VLR++I+
  S:     1 MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHYVLMNV-EADQAVIDELETAFRFNDAVLRNMIM 90
>gi|110680235|ref|YP_683242.1| 30S ribosomal protein S6 [Roseobacter denitrificans OCh 114] >gi|123065437|sp|Q164N7|RS6_ROSDO 30S ribosomal protein S6 >gi|109456351|gb|ABG32556.1| ribosomal protein S6 [Roseobacter denitrificans OCh 114] (117 aa)
Score = 89, Expect = 1.3e-01, Identities = 25/94 (26%), Positives = 47/94 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE +++    +  ++A  +     ++L  +    +  E  G+K +AY INK  +G+Y         PA + E  R+  L  +V+R L I +++
  S:     1 MPLYEHVMIARQDLSNTQAEGLIEHFGTVLSDNGGKLVDHEYWGVKTMAYKINKNRKGHYAFLRSDAPAPA-VHEMERLMRLHDDVMRVLTIKVDE 95
>gi|169184426|ref|ZP_02844723.1| ribosomal protein S6 [Thauera sp. MZ1T] >gi|169008611|gb|EDS55417.1| ribosomal protein S6 [Thauera sp. MZ1T] (128 aa)
Score = 89, Expect = 1.3e-01, Identities = 33/111 (29%), Positives = 52/111 (46%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQ 111
           M  YEI+ +V     E +  A+    KSI+  +     +LE  G + +AYPI K  + +Y L N    D  ++ E          VLRHL I ++     KA T P  +++ +
  S:     1 MRHYEIVFIVHPDQSE-QVPAMVERYKSIVTTRNGQIHRLEDWGRRQMAYPIQKVHKAHYVLMNI-ECDGETLAELEHSFKFNDAVLRHLTIKMK-----KAVTTPSPMMKEE 106
>gi|78356457|ref|YP_387906.1| 30S ribosomal protein S6 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|91207914|sp|Q312D5|RS6_DESDG 30S ribosomal protein S6 >gi|78218862|gb|ABB38211.1| SSU ribosomal protein S6P [Desulfovibrio desulfuricans G20] (101 aa)
Score = 89, Expect = 1.3e-01, Identities = 23/91 (25%), Positives = 42/91 (46%)
  Q:     2 PKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           P+ +++ V+ G IE  + + +A D                G++DLAYP+ K  RGYY    +    P S+ E  R+  +   + + + + L
  S:    18 PREDLLAVLTGVIEREQGSVLAVD--------------HWGMRDLAYPVRKHMRGYYVRLEYAVAGP-SVAELERIIRITDGIYKFVTVKL 93
>gi|126728810|ref|ZP_01744625.1| Ribosomal protein S6 [Sagittula stellata E-37] >gi|126710740|gb|EBA09791.1| Ribosomal protein S6 [Sagittula stellata E-37] (120 aa)
Score = 89, Expect = 1.3e-01, Identities = 26/93 (27%), Positives = 50/93 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPAS-IQEFRRVTLLKKEVLRHLIINLE 93
           MP YE + +    +  ++A  +     ++LK +    ++ E  G+K +A+ INK  +G+Y       + P+S +QE  R+  L  +V+R L I ++
  S:     1 MPLYEHVFISRQDLSNAQAEGLVEHFSTVLKDNGGNVIESEYWGVKTMAFKINKNRKGHYAYLR--TDAPSSAVQEMERLMRLHDDVMRVLTIKVD 94
>gi|53715146|ref|YP_101138.1| 30S ribosomal protein S6 [Bacteroides fragilis YCH46] >gi|60683082|ref|YP_213226.1| 30S ribosomal protein S6 [Bacteroides fragilis NCTC 9343] >gi|61215472|sp|Q64PH7|RS6_BACFR 30S ribosomal protein S6 >gi|81313864|sp|Q5L9B5|RS6_BACFN 30S ribosomal protein S6 >gi|52218011|dbj|BAD50604.1| 30S ribosomal protein S6 [Bacteroides fragilis YCH46] >gi|60494516|emb|CAH09313.1| putative 30S ribosomal protein S6 [Bacteroides fragilis NCTC 9343] (114 aa)
Score = 88, Expect = 1.4e-01, Identities = 29/94 (30%), Positives = 46/94 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M +YE + ++   + + +        K IL+   +  +  E  GLK LAYPI KKS G+Y L  F N +P  I +        + V+R L   ++K
  S:     1 MNQYETVFILTPVLSDVQMKEAVEKFKGILQAEGAEIINEENWGLKKLAYPIQKKSTGFYQLIEF-NAEPTVIDKLELNFRRDERVIRFLTFRMDK 95
>gi|78186004|ref|YP_374047.1| 30S ribosomal protein S6 [Pelodictyon luteolum DSM 273] >gi|91207927|sp|Q3B6M7|RS6_PELLD 30S ribosomal protein S6 >gi|78165906|gb|ABB23004.1| SSU ribosomal protein S6P [Pelodictyon luteolum DSM 273] (133 aa)
Score = 88, Expect = 1.4e-01, Identities = 26/89 (29%), Positives = 47/89 (52%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           YE  +++DG +++    A    ++ ++  K  +   +  +G +  AYPI KK+ G Y    F    P  I E  RV   ++ +LR+LI++L
  S:     7 YECTVIIDGGLQDEAIAAAMEMVQKVITEKGGSISSVLDIGRRKTAYPIKKKTIGSYAHIEFTAATPV-IAEIERVLRYEEVLLRYLIVHL 96
>gi|39995771|ref|NP_951722.1| 30S ribosomal protein S6 [Geobacter sulfurreducens PCA] >gi|61215651|sp|Q74FE4|RS6_GEOSL 30S ribosomal protein S6 >gi|39982535|gb|AAR33995.1| ribosomal protein S6 [Geobacter sulfurreducens PCA] (117 aa)
Score = 88, Expect = 1.4e-01, Identities = 27/69 (39%), Positives = 39/69 (56%)
  Q:    24 NDLKSILKKSTDL---------KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           ++LK +  K TD+         +LE  G++ LAYP+ K  RG YY   F  + P  I E  R   L  +VLR+  + L
  S:    18 DELKGLTAKVTDIIGSFKGVLHRLEDWGVRKLAYPVKKSVRGRYYYVRFDGDAPL-IAELERRLRLDDKVLRYQSVKL 94
>gi|54027546|ref|YP_121788.1| 30S ribosomal protein S6 [Nocardia farcinica IFM 10152] >gi|61215419|sp|Q5YN17|RS6_NOCFA 30S ribosomal protein S6 >gi|54019054|dbj|BAD60424.1| putative ribosomal protein S6 [Nocardia farcinica IFM 10152] (95 aa)
Score = 88, Expect = 1.4e-01, Identities = 26/94 (27%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE+M+++D S++E        ++  ++K       K++  G + LAY I K++ G Y + +     PA++ E  R   L + VLR  ++  +K
  S:     1 MRHYEVMVILDPSLDERTVGPSLENMLGVVKTEGGKIDKVDIWGRRRLAYEIRKQAEGIYAVIDL-TASPATVNELDRQLGLNESVLRTKVLRHDK 95
>gi|19114340|ref|NP_593428.1| mitochondrial ribosomal protein subunit Mrp17 [Schizosaccharomyces pombe] >gi|74625918|sp|Q9UT82|RT06_SCHPO Mitochondrial 37S ribosomal protein MRP17 >gi|5706509|emb|CAB52271.1| mitochondrial ribosomal protein subunit Mrp17 [Schizosaccharomyces pombe] (109 aa)
Score = 88, Expect = 1.4e-01, Identities = 23/59 (38%), Positives = 37/59 (62%)
  Q:    32 KSTDLKLEKMGLKDLAYPINK----KSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           K   + +E MGLK+LA PI K     S G+++   FY+ +P    E +R+  L+  VLR++I+
  S:    38 KGVVVDVESMGLKELAKPIKKLNQSYSFGHWWSMTFYS-NPTVQSEIQRILRLEPSVLRYMIV 99
>gi|58584757|ref|YP_198330.1| ribosomal protein S6 [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|75497804|sp|Q5GSD6|RS6_WOLTR 30S ribosomal protein S6 >gi|58419073|gb|AAW71088.1| Ribosomal protein S6 [Wolbachia endosymbiont strain TRS of Brugia malayi] (260 aa)
Score = 88, Expect = 1.5e-01, Identities = 27/96 (28%), Positives = 48/96 (50%)
  Q:    12 GSIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKI 107
           G  E +++      L   ++ S  +K E  GL D AYPINK   G+Y +    +     + EF R   L + ++RHL ++++K +  K+    K++
  S:   161 GMAEPNQSNKTLEMLLDNIEASGLIKYEYWGLLDFAYPINKMKSGHYCIMCI-SSTSNIMDEFVRRIKLNENIIRHLSVHVDKFFEGKSHMMNKQV 255
>gi|88806419|ref|ZP_01121936.1| 30S ribosomal protein S6 [Robiginitalea biformata HTCC2501] >gi|88783251|gb|EAR14423.1| 30S ribosomal protein S6 [Robiginitalea biformata HTCC2501] (112 aa)
Score = 88, Expect = 1.5e-01, Identities = 29/94 (30%), Positives = 50/94 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASI-----QEFRRVTLLKKEVLRHLIINLEK 94
           M  YE + +++  + +++        ++ L K  +  +  E  GLK LAYPI  K  G+Y+LF F    P  +     QEF+R     + ++R L + L+K
  S:     1 MNHYETVFILNPVLSDTQIEETVKKFENFLTKNGAKMVSKEDWGLKKLAYPIQHKKSGFYHLFEF--TAPGEVIGPYEQEFKR----DERIMRFLTVKLDK 95
>gi|69933099|ref|ZP_00628301.1| Ribosomal protein S6 [Paracoccus denitrificans PD1222] >gi|119383642|ref|YP_914698.1| 30S ribosomal protein S6 [Paracoccus denitrificans PD1222] >gi|166227360|sp|A1B0F8|RS6_PARDP 30S ribosomal protein S6 >gi|119373409|gb|ABL69002.1| SSU ribosomal protein S6P [Paracoccus denitrificans PD1222] (131 aa)
Score = 88, Expect = 1.5e-01, Identities = 24/94 (25%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE +L+    +  ++A  +     +++  +    +  E  G++ LAY INK  +G+Y      +   A++QE  R+  L  +V+R L + +++
  S:     1 MPLYEHVLIARQDLSNAQAEGLIEHFSTVIADNGGKVVDNEYWGVRTLAYKINKNRKGHYAYLR-SDAPSAAVQEMERLARLHDDVMRVLTVRVDE 95
>gi|21672805|ref|NP_660872.1| 30S ribosomal protein S6 [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|25009193|sp|Q8K918|RS6_BUCAP 30S ribosomal protein S6 >gi|21623455|gb|AAM68083.1| 30S ribosomal protein S6 [Buchnera aphidicola str. Sg (Schizaphis graminum)] (113 aa)
Score = 88, Expect = 1.6e-01, Identities = 28/94 (29%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YEI+ ++     E K + +    K I+  ++ +  +LE  G + LAYPINK  + +Y L N     P +I            V+R++II+++K
  S:     1 MRHYEIIFMIHPDYSE-KVSVIIEKYKKIIHHNSGIIHRLEDWGRRQLAYPINKLHKAHYILLNI-ETFPKTISLLETDFRFNNAVIRNIIISVKK 94
>gi|57242165|ref|ZP_00370105.1| 30S ribosomal protein S6 Cj1070 [Campylobacter upsaliensis RM3195] >gi|57017357|gb|EAL54138.1| 30S ribosomal protein S6 Cj1070 [Campylobacter upsaliensis RM3195] (125 aa)
Score = 88, Expect = 1.6e-01, Identities = 29/93 (31%), Positives = 49/93 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE++ ++  ++ E + +A    +K IL K+      +  MG + LAY I K  RG Y++  ++      I E  RV  + +EV+R LI+  E
  S:     1 MKHYEVLFILKPTLTEEEVSAKLEFVKEILSKNGAEIQTVVPMGTRKLAYKIKKYERGTYFVI-YFKAPTNLIAELERVLRITEEVIRFLIVKYE 94
>gi|42527185|ref|NP_972283.1| 30S ribosomal protein S6 [Treponema denticola ATCC 35405] >gi|61216252|sp|Q73M32|RS6_TREDE 30S ribosomal protein S6 >gi|41817609|gb|AAS12194.1| ribosomal protein S6 [Treponema denticola ATCC 35405] (93 aa)
Score = 88, Expect = 1.6e-01, Identities = 35/93 (37%), Positives = 49/93 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK-STDLKLEK-MGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE+M V    +EE       + L SIL      +K E+  G +DLAY I KK++G Y LFN    DPA + E  +   L  ++L +L + LE
  S:     1 MRNYELMTVF--PVEEDLYKPGIDALHSILADFGVQIKSEEPFGDRDLAYEIKKKTKGRYVLFNI-EADPAKMIELDKRFKLITQMLTYLFVRLE 92
>gi|113477336|ref|YP_723397.1| 30S ribosomal protein S6 [Trichodesmium erythraeum IMS101] >gi|123351920|sp|Q10XV0|RS6_TRIEI 30S ribosomal protein S6 >gi|110168384|gb|ABG52924.1| SSU ribosomal protein S6P [Trichodesmium erythraeum IMS101] (117 aa)
Score = 88, Expect = 1.6e-01, Identities = 29/90 (32%), Positives = 44/90 (48%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           YE M ++   + E K        KS+L++  + D+K++  G   LAY IN +  G Y   N Y   P  I    R   L +EV+R+L +  E
  S:     6 YETMYILRPDMTEEKVEQAITKYKSMLEEQGAYDIKIQHRGKLRLAYEINNQREGIYIQMN-YQGPPTQIAILERAMRLSEEVIRYLTVKQE 96
>gi|189499148|ref|YP_001958618.1| ribosomal protein S6 [Chlorobium phaeobacteroides BS1] >gi|189494589|gb|ACE03137.1| ribosomal protein S6 [Chlorobium phaeobacteroides BS1] (134 aa)
Score = 88, Expect = 1.7e-01, Identities = 23/89 (25%), Positives = 52/89 (58%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKKST-DLK-LEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           YE  ++++G +E+    A  +++++++ K+  D++ + ++G + +AYPI K++ G Y    F  E P+ +          + +LR LI++L
  S:     7 YECTVIINGGLEDDAIAATMDEVRNVIAKNGGDIENVLEVGRRTMAYPIGKQTIGSYAHIEFRGE-PSGLAAIETAFRYNENILRFLIVHL 96
>gi|166030695|ref|ZP_02233524.1| hypothetical protein DORFOR_00369 [Dorea formicigenerans ATCC 27755] >gi|166029487|gb|EDR48244.1| hypothetical protein DORFOR_00369 [Dorea formicigenerans ATCC 27755] (139 aa)
Score = 88, Expect = 1.7e-01, Identities = 29/93 (31%), Positives = 49/93 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNED--PASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYE+ +VV   IE+ +   V   +K+++++       +++ G K LAY I K    YYY  +F  E   P  I++  R+      V+R+L +  E
  S:    45 MNKYELAVVVSAKIEDDERAQVIEKVKALVERFGGKISDVDESGKKRLAYEIQKMKEAYYYFIHFDAEADVPGEIEQRIRIM---DNVIRYLCVRQE 138
>gi|196196188|gb|EDX91147.1| ribosomal protein S6 [Alcanivorax sp. DG881] (113 aa)
Score = 87, Expect = 1.8e-01, Identities = 27/90 (30%), Positives = 45/90 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILK--KSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YE++ +V     E + +A+     +I+   K T  ++E  G + LAYPINK  + +Y + N    D  ++ E          V+RHL+I
  S:     1 MRHYEVVFLVHPDQSE-QVSAMVERYSAIVTDGKGTIHRVEDWGRRQLAYPINKIHKAHYVMLNI-ECDGETLGELENTFRFNDAVIRHLVI 90
>gi|110835052|ref|YP_693911.1| 30S ribosomal protein S6 [Alcanivorax borkumensis SK2] >gi|123345339|sp|Q0VMF9|RS6_ALCBS 30S ribosomal protein S6 >gi|110648163|emb|CAL17639.1| 30S ribosomal protein S6 [Alcanivorax borkumensis SK2] (113 aa)
Score = 87, Expect = 1.8e-01, Identities = 27/90 (30%), Positives = 45/90 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILK--KSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YE++ +V     E + +A+     +I+   K T  ++E  G + LAYPINK  + +Y + N    D  ++ E          V+RHL+I
  S:     1 MRHYEVVFLVHPDQSE-QVSAMVERYSAIVTDGKGTIHRVEDWGRRQLAYPINKIHKAHYVMLNI-ECDGETLGELENTFRFNDAVIRHLVI 90
>gi|163755339|ref|ZP_02162459.1| 30S ribosomal protein S6 [Kordia algicida OT-1] >gi|161324759|gb|EDP96088.1| 30S ribosomal protein S6 [Kordia algicida OT-1] (112 aa)
Score = 87, Expect = 1.8e-01, Identities = 29/94 (30%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASI-----QEFRRVTLLKKEVLRHLIINLEK 94
           M  YE + +++  + E++        +  +  +    +  E  GLK LAYPI  K  G+Y+LF F  + P  I      EFRR     + ++R+L + L+K
  S:     1 MNHYETVFILNPVLSETQIKETVAKFEDFIVSRGGKMISKENWGLKKLAYPIQHKKSGFYHLFEF--QAPGEIINQYELEFRR----DERIMRYLTVRLDK 95
>gi|189463979|ref|ZP_03012764.1| hypothetical protein BACINT_00314 [Bacteroides intestinalis DSM 17393] >gi|189438552|gb|EDV07537.1| hypothetical protein BACINT_00314 [Bacteroides intestinalis DSM 17393] (114 aa)
Score = 87, Expect = 2.0e-01, Identities = 30/94 (31%), Positives = 45/94 (47%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M +YE + ++   + + +        K IL  + +  +  E  GLK LAYPI KKS G+Y L  F N DP  I +        + V+R L    +K
  S:     1 MNQYETVFILTPVLSDVQMKEAVEKFKGILTAEGAEIVNEENWGLKKLAYPIQKKSTGFYQLIEF-NADPTVIDKLELNFRRDERVIRFLTFKQDK 95
>gi|167760813|ref|ZP_02432940.1| hypothetical protein CLOSCI_03198 [Clostridium scindens ATCC 35704] >gi|167661700|gb|EDS05830.1| hypothetical protein CLOSCI_03198 [Clostridium scindens ATCC 35704] (95 aa)
Score = 87, Expect = 2.0e-01, Identities = 28/93 (30%), Positives = 50/93 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYE+ +VV   IE+ +   V   +K+++++       +++ G K LAY I K    YYY  +F +E     +  +R+ ++   VLR+L +  E
  S:     1 MNKYELAVVVSAKIEDDERAQVIEKVKALVERFGGKISDVDEWGKKRLAYEIQKMKEAYYYFIHFESESDVPGEIEQRIRIMDN-VLRYLCVRQE 94
>gi|89054113|ref|YP_509564.1| 30S ribosomal protein S6 [Jannaschia sp. CCS1] >gi|122498966|sp|Q28RX3|RS6_JANSC 30S ribosomal protein S6 >gi|88863662|gb|ABD54539.1| SSU ribosomal protein S6P [Jannaschia sp. CCS1] (117 aa)
Score = 87, Expect = 2.0e-01, Identities = 27/93 (29%), Positives = 50/93 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPAS--IQEFRRVTLLKKEVLRHLIINLE 93
           M  YE +++    +  ++A A+     ++L  +  T +  E  G+K +AY INK  +G+Y   ++   D  S  +QE  R+  L  +V+R L I ++
  S:     1 MALYEHVMIARQDLSNAQAEALNEHFGAVLADNGGTVVDTEYWGVKTMAYKINKNRKGHY---SYLRTDAPSDAVQEMERLMRLHDDVMRVLTIKVD 94
>gi|27364781|ref|NP_760309.1| 30S ribosomal protein S6 [Vibrio vulnificus CMCP6] >gi|161486597|ref|NP_935777.2| 30S ribosomal protein S6 [Vibrio vulnificus YJ016] >gi|61216263|sp|Q7MH88|RS6_VIBVY 30S ribosomal protein S6 >gi|31340389|sp|Q8DCL6|RS6_VIBVU 30S ribosomal protein S6 >gi|27360926|gb|AAO09836.1|AE016801_155 Ribosomal protein S6 [Vibrio vulnificus CMCP6] (123 aa)
Score = 87, Expect = 2.0e-01, Identities = 30/90 (33%), Positives = 42/90 (46%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YEI+ +V     E  A  +     SI +    + +LE  G + LAYPINK  + +Y L N    D A I E          VLR++I+
  S:     1 MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHYVLMNV-EADQAVIDELETAFRYNDAVLRNMIM 90
>gi|158425932|ref|YP_001527224.1| ribosomal protein S6 [Azorhizobium caulinodans ORS 571] >gi|189045453|sp|A8HVF1|RS6_AZOC5 30S ribosomal protein S6 >gi|158332821|dbj|BAF90306.1| ribosomal protein S6 [Azorhizobium caulinodans ORS 571] (150 aa)
Score = 87, Expect = 2.0e-01, Identities = 27/94 (28%), Positives = 50/94 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE + +V   +   +   +A   K +++ +  T  K+E  G+K L Y I K  + ++ LFN  +   A++QE  R   + ++VLR L I +++
  S:     1 MSLYEHVFLVRQDVTAQQVEELAARFKGVIEANGGTVSKVEAWGVKSLTYRIKKNRKAHFTLFNI-DAPAAAVQEMERQMGIDEDVLRFLTIRVDE 95
>gi|117929340|ref|YP_873891.1| SSU ribosomal protein S6P [Acidothermus cellulolyticus 11B] >gi|166226791|sp|A0LWU5|RS6_ACIC1 30S ribosomal protein S6 >gi|117649803|gb|ABK53905.1| SSU ribosomal protein S6P [Acidothermus cellulolyticus 11B] (96 aa)
Score = 87, Expect = 2.0e-01, Identities = 26/86 (30%), Positives = 47/86 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLR 86
           M  YE+M+++D  +EE       +   +++++   T  K++  G + LAY I KKS G Y + +    +P +++E  R   L + VLR
  S:     1 MRHYELMVLLDPDVEERSVEPSLDQFLNVVRQDGGTVQKIDVWGRRRLAYEIRKKSEGIYAVIDLI-ANPQTVKELDRQLNLNENVLR 87
>gi|57237952|ref|YP_179201.1| 30S ribosomal protein S6 [Campylobacter jejuni RM1221] >gi|86150512|ref|ZP_01068737.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|148926027|ref|ZP_01809713.1| 30S ribosomal protein S6 [Campylobacter jejuni subsp. jejuni CG8486] >gi|73621847|sp|Q5HU34|RS6_CAMJR 30S ribosomal protein S6 >gi|4376254|emb|CAA76675.1| ribosomal protein S6 [Campylobacter jejuni] >gi|57166756|gb|AAW35535.1| ribosomal protein S6 [Campylobacter jejuni RM1221] >gi|85839107|gb|EAQ56371.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|145845506|gb|EDK22598.1| 30S ribosomal protein S6 [Campylobacter jejuni subsp. jejuni CG8486] (125 aa)
Score = 87, Expect = 2.0e-01, Identities = 28/93 (30%), Positives = 49/93 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE++ ++  ++ E +  A    +K +L K++     +  MG + LAY I K  RG Y++  ++      I E  RV  + +EV+R LI+  E
  S:     1 MKHYEVLFILKPTLTEEEVNAKLEFVKEVLTKNSAEIETVVPMGTRKLAYKIKKYERGTYFVI-YFKAPTNLIAELERVLRITEEVIRFLIVKYE 94
>gi|72163494|ref|YP_291151.1| 30S ribosomal protein S6 [Thermobifida fusca YX] >gi|91207797|sp|Q47K94|RS6_THEFY 30S ribosomal protein S6 >gi|71917226|gb|AAZ57128.1| SSU ribosomal protein S6P [Thermobifida fusca YX] (96 aa)
Score = 87, Expect = 2.1e-01, Identities = 25/93 (26%), Positives = 48/93 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M +YE+M+++D +++E           S+++    +  K++  G + LAY I K S G Y + +     P+++ E  R   L + VLR  ++  E
  S:     1 MRRYEVMIILDPTLDERTVAPSLEQFLSVVRNEGGSVEKVDVWGKRRLAYDIGKNSEGIYAVIDL-TAKPSTVHELDRQLNLTEAVLRTKVLRPE 94
>gi|116332688|ref|YP_794215.1| 30S ribosomal protein S6 [Lactobacillus brevis ATCC 367] >gi|122270616|sp|Q03UD8|RS6_LACBA 30S ribosomal protein S6 >gi|116098035|gb|ABJ63184.1| SSU ribosomal protein S6P [Lactobacillus brevis ATCC 367] (98 aa)
Score = 87, Expect = 2.2e-01, Identities = 27/91 (29%), Positives = 44/91 (48%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGLKD-----LAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           KYEI  ++   ++++  TA+      IL   TD   E +  KD      AY I   + G Y++      D   + EF R+  +   +LRH+I+  E
  S:     5 KYEITYIIRPDLDDAAKTALVERFDKIL---TDNGAELINSKDWSKRRFAYEIGGFNEGIYHVITLNATDDKGLNEFDRLAKINDSILRHMIVKRE 97
>gi|163857369|ref|YP_001631667.1| 30S ribosomal protein S6 [Bordetella petrii DSM 12804] >gi|163261097|emb|CAP43399.1| 30S ribosomal protein S6 [Bordetella petrii] (125 aa)
Score = 87, Expect = 2.2e-01, Identities = 29/94 (30%), Positives = 43/94 (45%)
  Q:    37 KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRIKEQVLAEQEK 130
           +LE  G + LAYPI K  + +Y   N      A++ E          VLRHL+I  +     KA+T+P  +++S  R E  K   E     Q +
  S:    38 RLEDWGRRQLAYPIQKLVKAHYVCMNI-ECGQATLDELEHSFRYNDAVLRHLVIKTK-----KAQTSPSIMMKSVEREEARKASTEASAPAQAQ 125
>gi|69246712|ref|ZP_00604080.1| Ribosomal protein S6 [Enterococcus faecium DO] >gi|68195126|gb|EAN09585.1| Ribosomal protein S6 [Enterococcus faecium DO] (99 aa)
Score = 86, Expect = 2.3e-01, Identities = 26/91 (28%), Positives = 48/91 (52%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKMGL--KDLAYPINKKSRGYYYLFNFYNEDPA-SIQEFRRVTLLKKEVLRHLIINLE 93
           KYEIM ++  +I+E   TA+     +ILK +    +E      +  AY +N    G Y++    +   A ++ EF R+  +  +++RH+I+  E
  S:     5 KYEIMYIIRPNIDEEAKTALIERFDAILKDNGAEVIESKDWEKRRFAYEMNGYREGIYHIVKVSSPSSANAVNEFDRLAKINDDIIRHMIVKEE 98
>gi|118615983|ref|YP_904315.1| 30S ribosomal protein S6 [Mycobacterium ulcerans Agy99] >gi|183980107|ref|YP_001848398.1| 30S ribosomal protein S6 RpsF [Mycobacterium marinum M] >gi|118568093|gb|ABL02844.1| 30S ribosomal protein S6 RpsF [Mycobacterium ulcerans Agy99] >gi|183173433|gb|ACC38543.1| 30S ribosomal protein S6 RpsF [Mycobacterium marinum M] (96 aa)
Score = 86, Expect = 2.3e-01, Identities = 27/94 (28%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YEIM+++D +++E           ++++K   T  K++  G + LAY I K + G Y + +     PA++ E  R   L + VLR  ++  +K
  S:     1 MRPYEIMVILDPTLDERTVAPSLETFLNVIRKDGGTVDKVDIWGRRRLAYEIAKHAEGIYAVIDV-KAAPATVSELDRQLSLNESVLRTKVMRADK 95
>gi|153816339|ref|ZP_01969007.1| hypothetical protein RUMTOR_02591 [Ruminococcus torques ATCC 27756] >gi|145846300|gb|EDK23218.1| hypothetical protein RUMTOR_02591 [Ruminococcus torques ATCC 27756] (95 aa)
Score = 86, Expect = 2.4e-01, Identities = 25/93 (26%), Positives = 48/93 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYE+ +VV   +E+     V   +K+++ +       +++ G +  AY I K + G+YY  +F  E     +  +R+ ++   VLR+L +  E
  S:     1 MNKYELAVVVSAKLEDEARANVIEKVKALITRFGGNVTDVDEWGKRRFAYEIQKMTEGFYYFVHFEAESTVPGEVEQRIRIMDN-VLRYLCVKQE 94
>gi|108802329|ref|YP_642526.1| 30S ribosomal protein S6 [Mycobacterium sp. MCS] >gi|119871482|ref|YP_941434.1| 30S ribosomal protein S6 [Mycobacterium sp. KMS] >gi|126438309|ref|YP_001074000.1| 30S ribosomal protein S6 [Mycobacterium sp. JLS] >gi|108772748|gb|ABG11470.1| SSU ribosomal protein S6P [Mycobacterium sp. MCS] >gi|119697571|gb|ABL94644.1| SSU ribosomal protein S6P [Mycobacterium sp. KMS] >gi|126238109|gb|ABO01510.1| SSU ribosomal protein S6P [Mycobacterium sp. JLS] (96 aa)
Score = 86, Expect = 2.4e-01, Identities = 28/94 (29%), Positives = 50/94 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK---STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YEIM+++D +++E           ++++K   S D K++  G + LAY I K + G Y + +     PA++ E  R   L + VLR  ++  +K
  S:     1 MRPYEIMVILDPTLDERTVAPSLETFLNVIRKDGGSVD-KVDIWGRRRLAYEIAKHAEGIYAVIDV-KAAPATVTELDRQLSLNESVLRTKVMRTDK 95
>gi|196183916|gb|EDX78892.1| ribosomal protein S6, putative [Brevundimonas sp. BAL3] (147 aa)
Score = 86, Expect = 2.5e-01, Identities = 25/94 (26%), Positives = 50/94 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE  ++    I   +A A+ + +K ++ +   +  K+E  GL++L Y + K  + +Y L    +  PA++ E  R   + ++VLR L + +E+
  S:    20 MALYEHTVMTRQDISAQQAEALNDTIKDLIVQGGGSVAKIEYWGLRNLTYRVKKNRKAHYSLLAV-DAPPAAMAEVERQLGINEDVLRWLTVRVEE 114
>gi|91783363|ref|YP_558569.1| 30S ribosomal protein S6 [Burkholderia xenovorans LB400] >gi|170692292|ref|ZP_02883455.1| ribosomal protein S6 [Burkholderia graminis C4D1M] >gi|187923776|ref|YP_001895418.1| ribosomal protein S6 [Burkholderia phytofirmans PsJN] >gi|122970480|sp|Q13ZH2|RS6_BURXL 30S ribosomal protein S6 >gi|91687317|gb|ABE30517.1| SSU ribosomal protein S6P [Burkholderia xenovorans LB400] >gi|170142722|gb|EDT10887.1| ribosomal protein S6 [Burkholderia graminis C4D1M] >gi|187714970|gb|ACD16194.1| ribosomal protein S6 [Burkholderia phytofirmans PsJN] (124 aa)
Score = 86, Expect = 2.5e-01, Identities = 32/123 (26%), Positives = 52/123 (42%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRIKEQ 123
           M  YEI+ +V     E     +     +I      + ++E  G + LAY I K ++ +Y   N    D  ++ E          VLRHLI+ ++     KA+T P  +++   R E  K    Q
  S:     1 MRHYEIVFIVHPDQSEQVPAMIERYKSTITSHGGQIHRIEDWGRRQLAYMIEKLAKAHYVCMNI-ECDQTTLDELEHAFKFNDAVLRHLIVKMK-----KAETGPSPMMKEVQREEAKKSAATQ 118
>gi|22298822|ref|NP_682069.1| 30S ribosomal protein S6 [Thermosynechococcus elongatus BP-1] >gi|32171538|sp|Q8DJE6|RS6_SYNEL 30S ribosomal protein S6 >gi|22295003|dbj|BAC08831.1| 30S ribosomal protein S6 [Thermosynechococcus elongatus BP-1] (114 aa)
Score = 86, Expect = 2.5e-01, Identities = 25/89 (28%), Positives = 43/89 (48%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           YE + ++   + E +     +  ++ L++  +T LK++  G +  AYPI K   GYY L   Y     +I    R   L + +LR + I L
  S:     6 YETLYIIRPDVGEEQLEQTISQFRTFLEEQGATKLKVQNRGKRRFAYPIKKLREGYYILMT-YTAPGTAIAPLERAMRLNENILRFMTIVL 95
>gi|37199919|dbj|BAC95748.1| ribosomal protein S6 [Vibrio vulnificus YJ016] (134 aa)
Score = 86, Expect = 2.6e-01, Identities = 30/90 (33%), Positives = 42/90 (46%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YEI+ +V     E  A  +     SI +    + +LE  G + LAYPINK  + +Y L N    D A I E          VLR++I+
  S:    12 MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHYVLMNV-EADQAVIDELETAFRYNDAVLRNMIM 101
>gi|116626135|ref|YP_828291.1| SSU ribosomal protein S6P [Solibacter usitatus Ellin6076] >gi|122251817|sp|Q01QR4|RS6_SOLUE 30S ribosomal protein S6 >gi|116229297|gb|ABJ88006.1| SSU ribosomal protein S6P [Solibacter usitatus Ellin6076] (153 aa)
Score = 86, Expect = 2.6e-01, Identities = 26/91 (28%), Positives = 47/91 (51%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           YE + +V     + +  A    L++ L  +  T  K++K G + LAY ++K   G Y LF F +E P  ++E  R   +   VL+ L + +++
  S:     5 YEELFIVKPDASDEEVDAFVETLRTQLTAAGATVDKIDKWGKRRLAYRVDKYREGTYVLFQFTSE-PTGVKELERRLRVSDIVLKFLTVRIDE 96
>gi|167766037|ref|ZP_02438090.1| hypothetical protein CLOSS21_00530 [Clostridium sp. SS2/1] >gi|167712117|gb|EDS22696.1| hypothetical protein CLOSS21_00530 [Clostridium sp. SS2/1] (94 aa)
Score = 86, Expect = 2.6e-01, Identities = 21/64 (32%), Positives = 35/64 (54%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNE 66
           KYE+ LV+   IE+ +  A+   +++++  +      +++ G K LAY I K   GYYY   F  E
  S:     2 KYELALVLSAKIEDEERAAMVEKVQAMITTAGAAITNVDEWGKKQLAYEIQKMKEGYYYFIQFEGE 67
>gi|84497233|ref|ZP_00996055.1| 30S ribosomal protein S6 [Janibacter sp. HTCC2649] >gi|84382121|gb|EAP98003.1| 30S ribosomal protein S6 [Janibacter sp. HTCC2649] (95 aa)
Score = 86, Expect = 2.8e-01, Identities = 24/86 (27%), Positives = 48/86 (55%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLR 86
           M +YE+M+++D  +++       +   +++ K   T   ++  G + LAY I KK+ G Y + +F +E PA+ +E  R   L + ++R
  S:     1 MRQYELMVILDPELDDRTVQPSLDKFLTVITKDGGTVDNVDIWGRRRLAYEIKKKAEGIYAIVDFTSE-PATAKELDRQLGLNESIMR 87
>gi|119471284|ref|ZP_01613787.1| 30S ribosomal protein S6 [Alteromonadales bacterium TW-7] >gi|119445750|gb|EAW27033.1| 30S ribosomal protein S6 [Alteromonadales bacterium TW-7] (113 aa)
Score = 86, Expect = 2.9e-01, Identities = 31/90 (34%), Positives = 42/90 (46%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPAS-IQEFRRVTLLKKEVLRHLII 90
           M  YEI+ +V     E  A  +     SI +    + +LE  G + LAYPINK  + +Y L N   E P   I E          VLR+L+I
  S:     1 MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGSIHRLEDWGRRQLAYPINKLHKAHYVLMNV--EAPTEVISELETTFRYNDAVLRNLVI 90
>gi|33566505|emb|CAE37761.1| 30s ribosomal protein s6 [Bordetella parapertussis] >gi|33568499|emb|CAE32411.1| 30s ribosomal protein s6 [Bordetella bronchiseptica RB50] (157 aa)
Score = 85, Expect = 3.0e-01, Identities = 27/94 (28%), Positives = 45/94 (47%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE++ +V     E +  A+    ++++  +  T  +LE  G + LAYPI K  + +Y   N      A++ E          VLRHL+I  +K
  S:    32 MRHYEVVFIVHPDQSE-QVPAMVERYQALVTGQSGTVHRLEDWGRRQLAYPIQKLVKAHYVCMNI-ECGQATLDELEHSFRYNDAVLRHLVIKTKK 125
>gi|88803225|ref|ZP_01118751.1| 30S ribosomal protein S6 [Polaribacter irgensii 23-P] >gi|88780791|gb|EAR11970.1| 30S ribosomal protein S6 [Polaribacter irgensii 23-P] (113 aa)
Score = 85, Expect = 3.0e-01, Identities = 32/107 (29%), Positives = 52/107 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFY---NEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKI 107
           M  YE + +++  + +++           L  + +  +  E  GLK LAYPI KK  G+Y+L  +     E  A   EFRR       V+R+L I L+K     AK   +++
  S:     1 MNHYETVFILNPVLSDTQIKETVQKFNDYLVSRGAEMISKEDWGLKKLAYPIQKKKSGFYHLLEYKVAGEEISAFELEFRR----DDSVMRYLSIRLDKHAAAWAKIRTERV 108
>gi|157165390|ref|YP_001467164.1| 30S ribosomal protein S6 [Campylobacter concisus 13826] >gi|166226813|sp|A7ZEF6|RS6_CAMC1 30S ribosomal protein S6 >gi|112801440|gb|EAT98784.1| ribosomal protein S6 [Campylobacter concisus 13826] (139 aa)
Score = 85, Expect = 3.1e-01, Identities = 32/128 (25%), Positives = 64/128 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAE----------RYKRIKEQVLAEQ 128
           M  YE++ ++  ++ E +  A  + +K ++ K+      + +MG + LAY I K  RG Y++  +Y   PA + E  R   + ++++R L +  E      A     K ++   + E          R +++ EQ   E+
  S:     1 MKHYELLFILKPTLTEEEVKAKVDFVKEVITKNGGEIATVIEMGTRKLAYTIKKYERGTYFVI-YYKAPPALLAELTRNVRITEDIIRFLSVKYENKREIAAWERLCKGIKQTIKKEPREPRAPREPRVEKVDEQTFTEE 139
>gi|74001414|ref|XP_852396.1| PREDICTED: similar to Mitochondrial 28S ribosomal protein S6 (S6mt) (MRP-S6) [Canis familiaris] (124 aa)
Score = 85, Expect = 3.1e-01, Identities = 29/87 (33%), Positives = 51/87 (58%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLK-LEKMGLKDLAYPIN----KKSRGYYYLFNFYNEDPA--SIQEF--RRVTLLKKEVLRH 87
           MP+YE+ L++        A A+   L++++ +   ++ LE +G + L Y I+    +  RG Y+L +FY    A  SI E   R V +++  V+RH
  S:     1 MPRYELALILKAMQRPETAAALKRTLEALMDRGAIVRHLENLGDRALPYRISAHNQRHVRGGYFLVDFYAPATAVESIMEHLSRDVDVIRPNVIRH 96
>gi|53757419|gb|AAU91710.1| ribosomal protein S6 [Methylococcus capsulatus str. Bath] (128 aa)
Score = 85, Expect = 3.2e-01, Identities = 27/79 (34%), Positives = 37/79 (46%)
  Q:    37 KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAE 115
           +LE  G + LAYPI K  + +Y L N    D A+++E          VLR L I  +     +A T P  + RS   AE
  S:    30 RLEDWGRRQLAYPIAKLHKAHYVLMNI-ECDQATLEELESGFRFNDAVLRSLTIRRD-----EAVTEPSALARSGSDAE 102
>gi|168335181|ref|ZP_02693286.1| ribosomal protein S6 [Epulopiscium sp. 'N.t. morphotype B'] (58 aa)
Score = 85, Expect = 3.2e-01, Identities = 23/58 (39%), Positives = 35/58 (60%)
  Q:    37 KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           K++  G K LAY I+KK  G+YY   F N +P +  E      + + VLR+LI++LE+
  S:     1 KVDDWGKKKLAYEIDKKKEGFYYFIEF-NAEPDAPAEIESRLRITEAVLRYLIVSLEE 57
>gi|86151148|ref|ZP_01069364.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni 260.94] >gi|86152790|ref|ZP_01070995.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|121612432|ref|YP_001000748.1| 30S ribosomal protein S6 [Campylobacter jejuni subsp. jejuni 81-176] >gi|153951510|ref|YP_001397814.1| 30S ribosomal protein S6 [Campylobacter jejuni subsp. doylei 269.97] >gi|157415331|ref|YP_001482587.1| 30S ribosomal protein S6 [Campylobacter jejuni subsp. jejuni 81116] >gi|167005668|ref|ZP_02271426.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni 81-176] >gi|166226817|sp|A7H2T4|RS6_CAMJD 30S ribosomal protein S6 >gi|166226818|sp|A1W057|RS6_CAMJJ 30S ribosomal protein S6 >gi|189045458|sp|A8FMC3|RS6_CAMJ8 30S ribosomal protein S6 >gi|85842318|gb|EAQ59564.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni 260.94] >gi|85843675|gb|EAQ60885.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87249295|gb|EAQ72256.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni 81-176] >gi|152938956|gb|ABS43697.1| ribosomal protein S6 [Campylobacter jejuni subsp. doylei 269.97] >gi|157386295|gb|ABV52610.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni 81116] (125 aa)
Score = 85, Expect = 3.3e-01, Identities = 28/93 (30%), Positives = 48/93 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE++ ++  ++ E +  A    +K +L K+      +  MG + LAY I K  RG Y++  ++      I E  RV  + +EV+R LI+  E
  S:     1 MKHYEVLFILKPTLTEEEVNAKLEFVKEVLTKNGAEIETVVPMGTRKLAYKIKKYERGTYFVI-YFKAPTNLIAELERVLRITEEVIRFLIVKYE 94
>gi|119474661|ref|ZP_01615014.1| 30S ribosomal protein S6 [marine gamma proteobacterium HTCC2143] >gi|119450864|gb|EAW32097.1| 30S ribosomal protein S6 [marine gamma proteobacterium HTCC2143] (145 aa)
Score = 85, Expect = 3.4e-01, Identities = 34/119 (28%), Positives = 54/119 (45%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKR 119
           M  YEI+ +V     E     V    ++I K    + +LE  G + LAYPINK  + +Y L N    D  +I E          VLR+L+I +++    ++     +    + RA R +R
  S:     1 MRHYEIIFLVHPDQSEQVPGMVERYTQAIEKNGGKIHRLEDWGRRHLAYPINKIHKAHYTLMNV-EADQEAIDELTTNFRYNDAVLRNLVIKMDESVTAESPIMKAEKESRERRASRPER 119
>gi|59712919|ref|YP_205695.1| 30S ribosomal protein S6 [Vibrio fischeri ES114] >gi|163730245|ref|ZP_02137720.1| 30S ribosomal protein S6 [Vibrio fischeri MJ11] >gi|75353318|sp|Q5E2D9|RS6_VIBF1 30S ribosomal protein S6 >gi|59481020|gb|AAW86807.1| 30S ribosomal subunit protein S6 [Vibrio fischeri ES114] >gi|161396397|gb|EDQ20691.1| 30S ribosomal protein S6 [Vibrio fischeri MJ11] (126 aa)
Score = 85, Expect = 3.4e-01, Identities = 29/90 (32%), Positives = 43/90 (47%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YEI+ +V     E  A  +     SI +    + +LE  G + +AYPINK  + +Y L N  +E  A I E          VLR++I+
  S:     1 MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGTIHRLEDWGRRQMAYPINKLHKAHYVLMNVESEQ-AVIDELETAFRYNDAVLRNMIM 90
>gi|186475676|ref|YP_001857146.1| ribosomal protein S6 [Burkholderia phymatum STM815] >gi|184192135|gb|ACC70100.1| ribosomal protein S6 [Burkholderia phymatum STM815] (124 aa)
Score = 85, Expect = 3.5e-01, Identities = 29/109 (26%), Positives = 49/109 (44%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVR 109
           M  YEI+ +V     E     +     +I      + ++E  G + LAY I K ++ +Y   N    D A++ E          VLRHLI+ ++     KA+T P  +++
  S:     1 MRHYEIVFIVHPDQSEQVPAMIERYKTTITSHGGQIHRIEDWGRRQLAYMIEKLAKAHYVCMNI-ECDQATLDELEHAFKFNDAVLRHLIVKMK-----KAETGPSPMMK 104
>gi|163842245|ref|YP_001626650.1| SSU ribosomal protein S6P [Renibacterium salmoninarum ATCC 33209] >gi|162955721|gb|ABY25236.1| SSU ribosomal protein S6P [Renibacterium salmoninarum ATCC 33209] (95 aa)
Score = 85, Expect = 3.6e-01, Identities = 29/87 (33%), Positives = 44/87 (50%)
  Q:     7 MLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M+++D  +EE           +++     T  K++  G + LAY I KKS G Y + NF  E PA+ +E  R   L + +LR  II  E
  S:     1 MVIIDPEVEERTVEPTLQKFLNVITTDGGTVDKVDIWGRRRLAYDIKKKSEGIYAVVNFTAE-PATAKELDRQLGLNETILRTKIIRPE 88
>gi|189462619|ref|ZP_03011404.1| hypothetical protein BACCOP_03311 [Bacteroides coprocola DSM 17136] >gi|189430780|gb|EDU99764.1| hypothetical protein BACCOP_03311 [Bacteroides coprocola DSM 17136] (115 aa)
Score = 85, Expect = 3.6e-01, Identities = 29/94 (30%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M +YE + ++   + + +        K+IL +  +  +  E  GLK LAYPI KKS G+Y L  F  E P+ I++        + V+R L   ++K
  S:     1 MNQYETVFILTPVLSDVQMKEAVEKFKAILTQEGAEIINEENWGLKKLAYPIQKKSTGFYQLIEFKAE-PSVIEKLEVNYRRDERVIRFLTFKMDK 95
>gi|196241369|ref|ZP_03140132.1| ribosomal protein S6 [Cyanothece sp. PCC 7425] >gi|196214429|gb|EDY09085.1| ribosomal protein S6 [Cyanothece sp. PCC 7425] (106 aa)
Score = 85, Expect = 3.7e-01, Identities = 26/87 (29%), Positives = 42/87 (48%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           YE M ++   + E     V N  +S+L+   + D++ +  G + LAY I K   G Y   N+    P  +   +R   L  EV+R+L I
  S:     5 YETMYIIRPDLGEETVDQVINQYQSLLRDQGAEDVQTQHRGKRRLAYEIRKFREGIYVQMNYKAAGPL-VANLQRAMRLSDEVIRYLTI 92
>gi|118588141|ref|ZP_01545551.1| 30S ribosomal protein S6 [Stappia aggregata IAM 12614] >gi|118439763|gb|EAV46394.1| 30S ribosomal protein S6 [Stappia aggregata IAM 12614] (148 aa)
Score = 85, Expect = 3.7e-01, Identities = 25/94 (26%), Positives = 47/94 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE + +    +   +   +    K +++ +  T  K+E  GL+ LAY I K  + +Y L N  N   A++ E  R   L +++LR +   +++
  S:     1 MPLYEHVFLARQDVSAQQVEQLVEQYKGLIEGAGGTVGKVENWGLRSLAYRIKKNRKAHYTLMNI-NAPHAAVAEMERQMGLSEDILRFMTFKVDE 95
>gi|103487384|ref|YP_616945.1| 30S ribosomal protein S6 [Sphingopyxis alaskensis RB2256] >gi|122984936|sp|Q1GRW0|RS6_SPHAL 30S ribosomal protein S6 >gi|98977461|gb|ABF53612.1| SSU ribosomal protein S6P [Sphingopyxis alaskensis RB2256] (122 aa)
Score = 85, Expect = 3.7e-01, Identities = 25/94 (26%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILK--KSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE + +    + +++  A+A  +  ++   K    K E  GLK LAY I K  +G+Y + +      A I E  R   + ++++R + I +++
  S:     1 MPFYEHVFIARQDLSQAQVDALAETVTGVIGEYKGQVHKTETWGLKQLAYKIQKNRKGHYVMLSAEVSGEA-IAEIERQAAINEDIIRWMTIKVDE 95
>gi|57240362|ref|ZP_00368311.1| ribosomal protein S6 [Campylobacter lari RM2100] >gi|57018703|gb|EAL55476.1| ribosomal protein S6 [Campylobacter lari RM2100] (124 aa)
Score = 85, Expect = 3.7e-01, Identities = 28/93 (30%), Positives = 49/93 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE++ ++  ++ E + +A    +K +L K+      +  MG + LAY I K  RG Y++  ++      I E  RV  + +EV+R LI+  E
  S:     1 MRHYEVLFILKPTLTEEEVSAKLEFVKEVLTKNGAEIESVVPMGTRKLAYKIKKYERGTYFVI-YFKAPTNLIAELERVLRITEEVIRFLIVKYE 94
>gi|167836329|ref|ZP_02463212.1| 30S ribosomal protein S6 [Burkholderia thailandensis MSMB43] (124 aa)
Score = 85, Expect = 3.7e-01, Identities = 29/109 (26%), Positives = 49/109 (44%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVR 109
           M  YEI+ +V     E     +     +I      + ++E  G + LAY I K ++ +Y   N    D A++ E          VLRHLI+ ++     KA+T P  +++
  S:     1 MRHYEIVFIVHPDQSEQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNI-ECDQATLDELEHAFKFNDAVLRHLIVKMK-----KAETGPSPMMK 104
>gi|17232294|ref|NP_488842.1| 30S ribosomal protein S6 [Nostoc sp. PCC 7120] >gi|24212311|sp|Q8YMX2|RS6_ANASP 30S ribosomal protein S6 >gi|17133939|dbj|BAB76501.1| 30S ribosomal protein S6 [Nostoc sp. PCC 7120] (108 aa)
Score = 85, Expect = 3.8e-01, Identities = 26/90 (28%), Positives = 49/90 (54%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           YE + ++   + + +        +++L++  +TDL+++  G + LAY I K+  G+Y  FN YN    +I    R   L +EV+R+L +  E
  S:     5 YETLYILRPDLTDEQVELAIAKYQNLLQEQGATDLEVQNRGKRRLAYEIKKQRDGFYVQFN-YNAPGKAIAILERAMRLSEEVIRYLTVKQE 95
>gi|163868015|ref|YP_001609219.1| 30S ribosomal protein S6 [Bartonella tribocorum CIP 105476] >gi|189045455|sp|A9IRU5|RS6_BART1 30S ribosomal protein S6 >gi|161017666|emb|CAK01224.1| 30S ribosomal protein S6 [Bartonella tribocorum CIP 105476] (135 aa)
Score = 84, Expect = 4.2e-01, Identities = 21/58 (36%), Positives = 34/58 (58%)
  Q:    37 KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           ++E  GL+ LAY I K  + YY L N  +   A+I E  R   + +++LR++ I +EK
  S:    39 RVENWGLRPLAYRIRKNRKAYYVLVNI-DAPAAAIAEMERQMRINEDILRYMTIRVEK 95
>gi|167750473|ref|ZP_02422600.1| hypothetical protein EUBSIR_01449 [Eubacterium siraeum DSM 15702] >gi|167656624|gb|EDS00754.1| hypothetical protein EUBSIR_01449 [Eubacterium siraeum DSM 15702] (97 aa)
Score = 84, Expect = 4.3e-01, Identities = 26/87 (29%), Positives = 46/87 (52%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKK-STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLI 89
           KYE ++V      E    A+      ++K+  T + +++ G + LAY IN ++ GYY +++F +  P    EF R+  +   VLR L+
  S:     7 KYEAVVVFSLKNGEDAVKALVAKFSDLIKEHGTLVDVDEWGARKLAYEINYETDGYYVVYSF-DCKPDFPMEFERIINITDGVLRSLV 93
>gi|49475326|ref|YP_033367.1| 30S ribosomal protein S6 [Bartonella henselae str. Houston-1] >gi|61215539|sp|Q6G446|RS6_BARHE 30S ribosomal protein S6 >gi|49238132|emb|CAF27340.1| 30S ribosomal protein s6 [Bartonella henselae str. Houston-1] (135 aa)
Score = 84, Expect = 4.3e-01, Identities = 27/94 (28%), Positives = 46/94 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE M +    I   +   + N  K +++       ++E  GL+ LAY I K  + YY L N  +    +I E  R   + +++LR++ I +EK
  S:     1 MALYEHMFLARQDIAPQQVDELLNIYKGVIETYGGKVGRVENWGLRPLAYRIRKNRKAYYVLVNI-DAPATAIAEVERQMRINEDILRYMTIRVEK 95
>gi|77463710|ref|YP_353214.1| 30S ribosomal protein S6 [Rhodobacter sphaeroides 2.4.1] >gi|91207787|sp|Q3J1M1|RS6_RHOS4 30S ribosomal protein S6 >gi|77388128|gb|ABA79313.1| SSU ribosomal protein S6P [Rhodobacter sphaeroides 2.4.1] (132 aa)
Score = 84, Expect = 4.3e-01, Identities = 25/94 (26%), Positives = 47/94 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE + +    +  ++A  +     ++L  +    +  E  G+K +AY INK  +G+Y      +   A++QE  R+  L  +V+R L I ++K
  S:     1 MSLYEHVFIARQDLSNAQAEGLIEHFSTVLADNGGKVVDREYWGVKTMAYKINKNRKGHYAFLK-SDAPSAAVQEMERLMRLHDDVMRVLTIKVDK 95
>gi|126462539|ref|YP_001043653.1| 30S ribosomal protein S6 [Rhodobacter sphaeroides ATCC 17029] >gi|166227373|sp|A3PKL5|RS6_RHOS1 30S ribosomal protein S6 >gi|126104203|gb|ABN76881.1| SSU ribosomal protein S6P [Rhodobacter sphaeroides ATCC 17029] (135 aa)
Score = 84, Expect = 4.3e-01, Identities = 25/94 (26%), Positives = 47/94 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE + +    +  ++A  +     ++L  +    +  E  G+K +AY INK  +G+Y      +   A++QE  R+  L  +V+R L I ++K
  S:     1 MSLYEHVFIARQDLSNAQAEGLIEHFSTVLADNGGKVVDREYWGVKTMAYKINKNRKGHYAFLK-SDAPSAAVQEMERLMRLHDDVMRVLTIKVDK 95
>gi|86130270|ref|ZP_01048870.1| 30S ribosomal protein S6 [Cellulophaga sp. MED134] >gi|85818945|gb|EAQ40104.1| 30S ribosomal protein S6 [Dokdonia donghaensis MED134] (113 aa)
Score = 84, Expect = 4.7e-01, Identities = 25/94 (26%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE + +++  + + +        + +LK+  +  +  E  GLK LAYPI  K  G+Y+L  F   D  +I ++       + V+R+L + ++K
  S:     1 MNHYETVFILNPVLSDDQIKETVKKYEGLLKEKGAKMISKEDWGLKKLAYPIQNKKSGFYHLLEF-TVDGQAINDYELAFRRDERVMRYLTVAMDK 95
>gi|153803834|ref|ZP_01958420.1| ribosomal protein S6 [Vibrio cholerae MZO-3] >gi|124120632|gb|EAY39375.1| ribosomal protein S6 [Vibrio cholerae MZO-3] (108 aa)
Score = 84, Expect = 4.8e-01, Identities = 30/93 (32%), Positives = 46/93 (49%)
  Q:    37 KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRIKEQVLAEQE 129
           +LE  G + LAYPINK  + +Y L N    D A + E          VLR++I+  +      A T P  ++++  R ER KR + +  A+ E
  S:    24 RLEDWGRRQLAYPINKLHKAHYVLMNV-EADQAVVDELETAFRFNDAVLRNMIMRTK-----AAITEPSIMLKA--REERVKRDEMKFDADVE 108
>gi|13620887|dbj|BAB40996.1| mitochondrial ribosomal protein S6 [Mus musculus] (163 aa)
Score = 84, Expect = 4.8e-01, Identities = 26/87 (29%), Positives = 52/87 (59%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLK-LEKMGLKDLAYPIN----KKSRGYYYLFNFYNEDPA--SIQEF--RRVTLLKKEVLRH 87
           MP+YE+ L++        A A+   ++S++ +   ++ LE +G + L Y I+    + SRG Y+L +FY    A  +I E   R + +++  +++H
  S:    39 MPRYELALILKAMRRPETAAALKRTIESLMDRGAIVRNLESLGERALPYRISSHSQQHSRGGYFLVDFYAPTSAVENILEHLARDIDVVRPNIVKH 134
>gi|15607195|ref|NP_214567.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis H37Rv] >gi|15839430|ref|NP_334467.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis CDC1551] >gi|31791230|ref|NP_853723.1| 30S ribosomal protein S6 [Mycobacterium bovis AF2122/97] >gi|121635963|ref|YP_976186.1| 30S ribosomal protein S6 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148659813|ref|YP_001281336.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis H37Ra] >gi|148821243|ref|YP_001285997.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis F11] >gi|167970579|ref|ZP_02552856.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis H37Ra] >gi|166227352|sp|A1KEM1|RS6_MYCBP 30S ribosomal protein S6 >gi|166227353|sp|A5TYC4|RS6_MYCTA 30S ribosomal protein S6 >gi|54039531|sp|P66592|RS6_MYCBO 30S ribosomal protein S6 >gi|54041974|sp|P66591|RS6_MYCTU 30S ribosomal protein S6 >gi|1568592|emb|CAB02531.1| PROBABLE 30S RIBOSOMAL PROTEIN S6 RPSF [Mycobacterium tuberculosis H37Rv] >gi|13879102|gb|AAK44281.1| ribosomal protein S6 [Mycobacterium tuberculosis CDC1551] >gi|31616815|emb|CAD92916.1| PROBABLE 30S RIBOSOMAL PROTEIN S6 RPSF [Mycobacterium bovis AF2122/97] >gi|121491610|emb|CAL70068.1| Probable 30s ribosomal protein s6 rpsF [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|134152023|gb|EBA44068.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis str. Haarlem] >gi|148503965|gb|ABQ71774.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis H37Ra] >gi|148719770|gb|ABR04395.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis F11] (96 aa)
Score = 84, Expect = 4.9e-01, Identities = 28/94 (29%), Positives = 50/94 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLKLEKM---GLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YEIM+++D +++E           ++++K    K+EK+   G + LAY I K + G Y + +     PA++ E  R   L + VLR  ++  +K
  S:     1 MRPYEIMVILDPTLDERTVAPSLETFLNVVRKDGG-KVEKVDIWGKRRLAYEIAKHAEGIYVVIDV-KAAPATVSELDRQLSLNESVLRTKVMRTDK 95
>gi|160890913|ref|ZP_02071916.1| hypothetical protein BACUNI_03358 [Bacteroides uniformis ATCC 8492] >gi|167764866|ref|ZP_02436987.1| hypothetical protein BACSTE_03258 [Bacteroides stercoris ATCC 43183] >gi|156859912|gb|EDO53343.1| hypothetical protein BACUNI_03358 [Bacteroides uniformis ATCC 8492] >gi|167697535|gb|EDS14114.1| hypothetical protein BACSTE_03258 [Bacteroides stercoris ATCC 43183] (114 aa)
Score = 83, Expect = 5.1e-01, Identities = 29/94 (30%), Positives = 46/94 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M +YE + ++   + + +        K IL  + +  +  E  GLK LAYPI KKS G+Y L  F N +P  I++        + V+R L    +K
  S:     1 MNQYETVFILTPVLSDVQMKEAVEKFKGILTAEGAEIVNEENWGLKKLAYPIQKKSTGFYQLIEF-NAEPTVIEKLEINFRRDERVIRFLTFKQDK 95
>gi|89211326|ref|ZP_01189696.1| Ribosomal protein S6 [Halothermothrix orenii H 168] >gi|89159068|gb|EAR78746.1| Ribosomal protein S6 [Halothermothrix orenii H 168] (95 aa)
Score = 83, Expect = 5.1e-01, Identities = 28/94 (29%), Positives = 47/94 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE   ++   +EE     + + +K I+  +     ++++ G ++LAY I   + GYY L  F  E   +I E  R   L   VLR+L+I  +K
  S:     1 MRAYETTFIIKPDLEEEARNNILDRVKEIIDTNGGKVNEVDEWGDRNLAYEIKNYNTGYYTLIKFEGE-AETIDEMERYFNLTDSVLRYLVIREDK 95
>gi|153855509|ref|ZP_01996628.1| hypothetical protein DORLON_02642 [Dorea longicatena DSM 13814] >gi|149752031|gb|EDM61962.1| hypothetical protein DORLON_02642 [Dorea longicatena DSM 13814] (95 aa)
Score = 83, Expect = 5.2e-01, Identities = 25/77 (32%), Positives = 44/77 (57%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYN--EDPASIQEFRRV 77
           M KYE+ +VV   IE+ +   V   +K+++++       +++ G K LAY I K    YYY  +F +  E P+ I++  R+
  S:     1 MNKYELAVVVSAKIEDDERAQVIEKVKALVERFGGQISDVDEWGKKRLAYEIQKMKEAYYYFIHFESDAETPSEIEQRIRI 81
>gi|15792395|ref|NP_282218.1| 30S ribosomal protein S6 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|9297123|sp|Q9ZAH3|RS6_CAMJE 30S ribosomal protein S6 >gi|112360390|emb|CAL35187.1| 30S ribosomal protein S6 [Campylobacter jejuni subsp. jejuni NCTC 11168] (125 aa)
Score = 83, Expect = 5.2e-01, Identities = 27/93 (29%), Positives = 48/93 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE++ ++  ++ E +       +K +L K++     +  MG + LAY I K  RG Y++  ++      I E  RV  + +EV+R LI+  E
  S:     1 MKHYEVLFILKPTLTEEEVNTKLEFVKEVLTKNSAEIETVVPMGTRKLAYKIKKYERGTYFVI-YFKAPTNLIAELERVLRITEEVIRFLIVKYE 94
>gi|186685611|ref|YP_001868807.1| ribosomal protein S6 [Nostoc punctiforme PCC 73102] >gi|186468063|gb|ACC83864.1| ribosomal protein S6 [Nostoc punctiforme PCC 73102] (116 aa)
Score = 83, Expect = 5.2e-01, Identities = 25/87 (28%), Positives = 44/87 (50%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           YE M ++   + + +A       +++L+   + D++++  G + LAY I K   G Y   N Y     +I  F R   L +EV+R+L I
  S:     5 YETMYILRPDLGDEQAEQAITKYQNLLRDQGAEDIQIQNRGKRRLAYEIKKHRDGIYIQLN-YTAPATAIAPFERAMRLSEEVIRYLTI 92
>gi|68537161|ref|YP_251866.1| 30S ribosomal protein S6 [Corynebacterium jeikeium K411] >gi|91207910|sp|Q4JSF9|RS6_CORJK 30S ribosomal protein S6 >gi|68264760|emb|CAI38248.1| 30S ribosomal protein S6 [Corynebacterium jeikeium K411] (95 aa)
Score = 83, Expect = 5.3e-01, Identities = 26/86 (30%), Positives = 46/86 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLR 86
           M +YE+M+++D S +E       +    I++K      K++  G + L YPINKK  G Y + +   E  A++ E  R+  +  ++LR
  S:     1 MRQYEMMIIIDPSQDERTVAPSLDKYLDIVRKENGSVEKVDIWGKRRLEYPINKKDEGIYVVLDLKCES-ATVLEIDRLLNINDQILR 87
>gi|88810598|ref|ZP_01125855.1| Ribosomal protein S6 [Nitrococcus mobilis Nb-231] >gi|88792228|gb|EAR23338.1| Ribosomal protein S6 [Nitrococcus mobilis Nb-231] (141 aa)
Score = 83, Expect = 5.3e-01, Identities = 32/123 (26%), Positives = 65/123 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQ--FRAERYKRIKEQ 123
           M  YE++ +V    +  + +A+    +S+++ +     +LE  G + LAYPI K  + +Y L N     P +++E   +      V+RH++++ +     +A T+P  + +SQ   R  R +R+ +Q
  S:     1 MRHYEVVFLVHPD-QSDQVSAMIERYRSLIEGNGGQIHRLEDWGRRQLAYPIKKLIKAHYILMNVECR-PENMEELVSMFRFNDAVIRHMVLSRQ-----EAITDPSPLAKSQDEERGARGERLDKQ 120
>gi|88596295|ref|ZP_01099532.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni 84-25] >gi|88191136|gb|EAQ95108.1| ribosomal protein S6 [Campylobacter jejuni subsp. jejuni 84-25] (125 aa)
Score = 83, Expect = 5.3e-01, Identities = 28/93 (30%), Positives = 48/93 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE++ ++  ++ E +  A    +K +L K+      +  MG + LAY I K  RG Y++  ++      I E  RV  + +EV+R LI+  E
  S:     1 MKHYEVLFILKPTLTEEEVNAKLEFVKEVLIKNGAEIETVVPMGTRKLAYKIKKYERGTYFVI-YFKAPTNLIAELERVLRITEEVIRFLIVKYE 94
>gi|30248222|ref|NP_840292.1| 30S ribosomal protein S6 [Nitrosomonas europaea ATCC 19718] >gi|61215748|sp|Q82XQ6|RS6_NITEU 30S ribosomal protein S6 >gi|30180107|emb|CAD84109.1| Ribosomal protein S6 [Nitrosomonas europaea ATCC 19718] (146 aa)
Score = 83, Expect = 5.5e-01, Identities = 26/92 (28%), Positives = 40/92 (43%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           M  YEI+ +V     E  +         +  +S  + +LE  G + L YPI K  + +Y L N    D  S+ E          +LRHL+I +
  S:     1 MRHYEIVFIVHPDQSEQVSAMTERYSNIVTGRSGKIHRLEDWGRRQLTYPIQKLHKAHYVLMNI-ECDQESLNELEHSFKFNDAILRHLVIRM 92
>gi|166363872|ref|YP_001656145.1| 30S ribosomal protein S6 [Microcystis aeruginosa NIES-843] >gi|166086245|dbj|BAG00953.1| 30S ribosomal protein S6 [Microcystis aeruginosa NIES-843] (129 aa)
Score = 83, Expect = 5.6e-01, Identities = 23/72 (31%), Positives = 36/72 (50%)
  Q:    33 STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNP 104
           +TD++++  G K LAYPI K + G Y   N Y      +    R   L  EV+R+L + L++     A  +P
  S:    36 ATDIQVKVWGKKRLAYPIKKLNDGVYVQMN-YQASGKQVAPMERAMRLSDEVIRYLTLKLDRVVAPPADLSP 106
>gi|189425663|ref|YP_001952840.1| ribosomal protein S6 [Geobacter lovleyi SZ] >gi|189421922|gb|ACD96320.1| ribosomal protein S6 [Geobacter lovleyi SZ] (122 aa)
Score = 83, Expect = 5.6e-01, Identities = 27/92 (29%), Positives = 46/92 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILK--KSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINL 92
           M KYE + ++   + E    +V + ++ ++   K    +L+  G + LAY I K  RG YY   F +     + E  R   L ++VLR L +N+
  S:     1 MRKYETIFILQPDLAEDDVKSVTDKVQDVVASLKGDFHRLDDWGTRKLAYAIRKFPRGRYYYLRF-DGGAQLVAELERRLRLDEKVLRFLSVNI 93
>gi|149191591|ref|ZP_01869836.1| 30S ribosomal protein S6 [Vibrio shilonii AK1] >gi|148834549|gb|EDL51541.1| 30S ribosomal protein S6 [Vibrio shilonii AK1] (126 aa)
Score = 83, Expect = 5.8e-01, Identities = 30/90 (33%), Positives = 42/90 (46%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS-TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YEI+ +V     E  A  +     SI + + T  +LE  G + LAYPINK  + +Y L N      A I E          VLR++I+
  S:     1 MRHYEIVFMVHPDQSEQVAGMIERYTGSITEANGTVHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEA-IDELETAFRFNDAVLRNMIM 90
>gi|153824152|ref|ZP_01976819.1| ribosomal protein S6 [Vibrio cholerae B33] >gi|126518329|gb|EAZ75552.1| ribosomal protein S6 [Vibrio cholerae B33] (102 aa)
Score = 83, Expect = 5.9e-01, Identities = 30/93 (32%), Positives = 46/93 (49%)
  Q:    37 KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQFRAERYKRIKEQVLAEQE 129
           +LE  G + LAYPINK  + +Y L N    D A + E          VLR++I+  +      A T P  ++++  R ER KR + +  A+ E
  S:    18 RLEDWGRRQLAYPINKLHKAHYVLMNV-EADQAVVDELETAFRFNDAVLRNMIMRTK-----AAITEPSIMLKA--REERVKRDEMKFDADVE 102
>gi|194098900|ref|YP_002001965.1| ribosomal protein S6 [Neisseria gonorrhoeae NCCP11945] >gi|193934190|gb|ACF30014.1| ribosomal protein S6 [Neisseria gonorrhoeae NCCP11945] (102 aa)
Score = 83, Expect = 6.1e-01, Identities = 21/54 (38%), Positives = 26/54 (48%)
  Q:    37 KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           +LE  G + LAYPINK  + +Y L N     P  + E          VLRHL I
  S:    18 RLEDWGRRQLAYPINKIHKAHYVLMNI-ETTPEVVGELETAFRFNDAVLRHLTI 70
>gi|74318123|ref|YP_315863.1| 30S ribosomal protein S6 [Thiobacillus denitrificans ATCC 25259] >gi|91207799|sp|Q3SH31|RS6_THIDA 30S ribosomal protein S6 >gi|74057618|gb|AAZ98058.1| ribosomal protein S6 [Thiobacillus denitrificans ATCC 25259] (127 aa)
Score = 83, Expect = 6.2e-01, Identities = 26/90 (28%), Positives = 41/90 (45%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YEI+ +V     E     +     +I  +  ++ +LE  G + +AYPI K  + +Y L N    D  +++E          VLRHL I
  S:     1 MRHYEIVFIVHPDQSEQVPAMIERYRANIAARGGNVHRLEDWGRRQMAYPIQKVHKAHYVLMNI-ECDQETLEELEHGFKFNDAVLRHLTI 90
>gi|75908293|ref|YP_322589.1| 30S ribosomal protein S6 [Anabaena variabilis ATCC 29413] >gi|91207901|sp|Q3MBE2|RS6_ANAVT 30S ribosomal protein S6 >gi|75702018|gb|ABA21694.1| SSU ribosomal protein S6P [Anabaena variabilis ATCC 29413] (108 aa)
Score = 83, Expect = 6.4e-01, Identities = 25/90 (27%), Positives = 49/90 (54%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           YE + ++   + + +        +++L++  +TD++++  G + LAY I K+  G+Y  FN YN    +I    R   L +EV+R+L +  E
  S:     5 YETLYILRPDLTDEQVELAIAKYQNLLQEQGATDIEVQNRGKRRLAYEIKKQRDGFYVQFN-YNAPGKAIAILERAMRLSEEVIRYLTVKQE 95
>gi|169176786|ref|ZP_02838493.1| ribosomal protein S6 [Arthrobacter chlorophenolicus A6] >gi|169015141|gb|EDS61662.1| ribosomal protein S6 [Arthrobacter chlorophenolicus A6] (101 aa)
Score = 83, Expect = 6.5e-01, Identities = 28/94 (29%), Positives = 46/94 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE+M+++D  +EE           +++     T  K++  G + LAY I KKS G Y + NF    P + +E  R   L + ++R  I   E+
  S:     1 MRPYELMVIIDPEVEERTVEPSLQKFLNVITNDGGTIEKVDIWGRRRLAYDIKKKSEGIYAVVNF-TAKPETAKELDRQLSLNETIMRTKITRPEE 95
>gi|148274147|ref|YP_001223708.1| 30S ribosomal protein S6 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|170783387|ref|YP_001711721.1| 30S ribosomal protein S6 [Clavibacter michiganensis subsp. sepedonicus] >gi|147832077|emb|CAN03050.1| 30S ribosomal protein S6 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|169157957|emb|CAQ03167.1| 30S ribosomal protein S6 [Clavibacter michiganensis subsp. sepedonicus] (154 aa)
Score = 83, Expect = 6.5e-01, Identities = 26/92 (28%), Positives = 48/92 (52%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           +YE+M+++D  I+E       +   ++++ S  T   ++  G + LAY INKK+ G Y +        A+ QE  R   L + V+R  ++  E+
  S:     4 QYELMVILDPEIDERTVAPSLDKFLNVIRTSGGTVDNVDVWGRRRLAYEINKKNEGIYAVVQLTATSEAT-QELDRQLGLSEAVMRTKVLRAEE 96
>gi|57167954|ref|ZP_00367093.1| 30S ribosomal protein S6 Cj1070 [Campylobacter coli RM2228] >gi|57020328|gb|EAL56997.1| 30S ribosomal protein S6 Cj1070 [Campylobacter coli RM2228] (125 aa)
Score = 83, Expect = 6.5e-01, Identities = 27/93 (29%), Positives = 48/93 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE++ ++  ++ E +  A    +K +L K+      +  MG + LAY I K  RG Y++  ++      I E  R+  + +EV+R LI+  E
  S:     1 MKHYEVLFILKPTLTEEEVNAKLEFVKEVLVKNGAEIETVVPMGTRKLAYKIKKYERGTYFVI-YFKAPTNLIAELERILRITEEVIRFLIVKYE 94
>gi|111020421|ref|YP_703393.1| 30S ribosomal protein S6 [Rhodococcus sp. RHA1] >gi|123340395|sp|Q0SB51|RS6_RHOSR 30S ribosomal protein S6 >gi|110819951|gb|ABG95235.1| 30S ribosomal protein S6 [Rhodococcus sp. RHA1] (95 aa)
Score = 83, Expect = 6.5e-01, Identities = 26/94 (27%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE+M+++D S++E       +   +++++      K++  G + LAY I K S G Y + +  +  PA++ E  R   L + VLR  ++   K
  S:     1 MRHYELMVILDPSLDERTVAPSLDTFLNVVRQDGGKIDKVDVWGKRRLAYEILKHSEGIYAVIDI-SATPATVAELDRQLGLNESVLRTKVLRHNK 95
>gi|94966962|ref|NP_001035674.1| mitochondrial ribosomal protein S6 [Bos taurus] >gi|108935892|sp|P82931|RT06_BOVIN Mitochondrial 28S ribosomal protein S6 (S6mt) (MRP-S6) >gi|73586927|gb|AAI02979.1| Mitochondrial ribosomal protein S6 [Bos taurus] (124 aa)
Score = 82, Expect = 6.8e-01, Identities = 26/87 (29%), Positives = 52/87 (59%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDLK-LEKMGLKDLAYPIN----KKSRGYYYLFNFY--NEDPASIQEF--RRVTLLKKEVLRH 87
           MP+YE+ L++        A A+   L++++ +   ++ LE +G + L Y ++    + +RG Y+L +FY      ASI E   R + +++  V++H
  S:     1 MPRYELALILKAMQRPETAAALKRTLEALMDRGAVVRSLENLGERTLPYKMSAHSQRHTRGGYFLVDFYAPTTTVASIMEHLSRDIDVIRPNVVKH 96
>gi|49474088|ref|YP_032130.1| 30S ribosomal protein S6 [Bartonella quintana str. Toulouse] >gi|61215537|sp|Q6G060|RS6_BARQU 30S ribosomal protein S6 >gi|49239592|emb|CAF25949.1| 30s ribosomal protein s6 [Bartonella quintana str. Toulouse] (136 aa)
Score = 82, Expect = 6.8e-01, Identities = 21/58 (36%), Positives = 35/58 (60%)
  Q:    37 KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPAS-IQEFRRVTLLKKEVLRHLIINLEK 94
           ++E  GL+ LAY I K  + YY L N   + PA+ I E  R   + +++LR++ + +EK
  S:    39 RVENWGLRPLAYRIRKNRKAYYVLINI--DAPATAIAEVERQMHINEDILRYMTVRVEK 95
>gi|114704792|ref|ZP_01437700.1| 30S ribosomal protein S6 [Fulvimarina pelagi HTCC2506] >gi|114539577|gb|EAU42697.1| 30S ribosomal protein S6 [Fulvimarina pelagi HTCC2506] (155 aa)
Score = 82, Expect = 7.1e-01, Identities = 24/94 (25%), Positives = 48/94 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE + +    +  ++   +  +L+ IL+       K+E  GLK LAY ++K  + +Y L N  +   A++ E  R     +++LR + I +++
  S:     7 MALYEHVFLARQDVSNNQVEQLVENLRGILESGGGKVGKVENWGLKTLAYRMDKNRKAHYTLMNI-DAPSAAVHEMERQMRFNEDILRFMTIRVDE 101
>gi|15639057|ref|NP_218503.1| 30S ribosomal protein S6 [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025297|ref|YP_001933069.1| ribosomal protein S6 [Treponema pallidum subsp. pallidum SS14] >gi|6094191|sp|O83102|RS6_TREPA 30S ribosomal protein S6 >gi|3322321|gb|AAC65058.1| ribosomal protein S6 (rpsF) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189017872|gb|ACD70490.1| ribosomal protein S6 [Treponema pallidum subsp. pallidum SS14] (93 aa)
Score = 82, Expect = 7.2e-01, Identities = 26/93 (27%), Positives = 51/93 (54%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M  YE+M V   S  E      +  ++++L+++  +  + + +G ++LAYP+ K+ RG Y LF    E P  ++E      L+ ++L HL + ++
  S:     1 MRTYELMAVF--SAHEDLFLQGSTAVRALLQENDAVIAREDHIGERELAYPLKKQKRGRYLLFIVQCE-PGKVRELDHKLRLRHDLLTHLFVRVD 92
>gi|83816197|ref|YP_445489.1| 30S ribosomal protein S6 [Salinibacter ruber DSM 13855] >gi|83757591|gb|ABC45704.1| 30S ribosomal protein S6 [Salinibacter ruber DSM 13855] (202 aa)
Score = 82, Expect = 7.3e-01, Identities = 22/91 (24%), Positives = 51/91 (56%)
  Q:     3 KYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPAS-IQEFRRVTLLKKEVLRHLIINLE 93
           +YE+  V+ G +++++   +   +  +++ +    L++++ G + LAY I++K  GYY   N Y + P   +    R   +  +VLR+L + ++
  S:    81 QYELTYVISGVVKQNQVDDIVRKVNHLIESNDGDVLEVDEWGNQRLAYEIDRKRSGYY--VNMYFQAPGELVPRLERELDINDDVLRYLTLRMD 172
>gi|114768973|ref|ZP_01446599.1| Ribosomal protein S6 [alpha proteobacterium HTCC2255] >gi|114549890|gb|EAU52771.1| Ribosomal protein S6 [alpha proteobacterium HTCC2255] (119 aa)
Score = 82, Expect = 7.3e-01, Identities = 25/94 (26%), Positives = 50/94 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPAS-IQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE + +    +  ++A  +     ++L  +    +  E  GLK +AY INK  +G+Y      ++ P+S +QE  R+  L ++V+R + I +++
  S:     1 MALYEHVFISRQDLSNAQAEGLIEHFSAVLSDNDGKVIDQEYWGLKTMAYKINKNRKGHYAFLK--SDAPSSAVQEMERLMRLHEDVMRVMTIRVDE 95
>gi|116672662|ref|YP_833595.1| SSU ribosomal protein S6P [Arthrobacter sp. FB24] >gi|166226798|sp|A0K2H5|RS6_ARTS2 30S ribosomal protein S6 >gi|116612771|gb|ABK05495.1| SSU ribosomal protein S6P [Arthrobacter sp. FB24] (101 aa)
Score = 82, Expect = 7.4e-01, Identities = 28/94 (29%), Positives = 46/94 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M  YE+M+++D  +EE           +++     T  K++  G + LAY I KKS G Y + NF    P + +E  R   L + ++R  I   E+
  S:     1 MRPYELMVIIDPEVEERTVEPSLQKFLNVITNDGGTIEKVDIWGRRRLAYEIKKKSEGIYAVVNF-TAKPDTAKELDRQLSLNETIMRTKITRPEE 95
>gi|150002621|ref|YP_001297365.1| 30S ribosomal protein S6 [Bacteroides vulgatus ATCC 8482] >gi|166226801|sp|A6KWD7|RS6_BACV8 30S ribosomal protein S6 >gi|149931045|gb|ABR37743.1| 30S ribosomal protein S6 [Bacteroides vulgatus ATCC 8482] (114 aa)
Score = 82, Expect = 7.8e-01, Identities = 29/94 (30%), Positives = 46/94 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M +YE + ++   + + +        K IL  + +  +  E  GLK LAYPI KKS G+Y L  F  E P  I++        + V+R L   ++K
  S:     1 MNQYETVFILTPVLSDVQMKEAVEKFKGILTAEGAEIINEENWGLKKLAYPIQKKSTGFYQLIEFKAE-PQVIEKLEINFRRDERVIRFLTFKMDK 95
>gi|157803226|ref|YP_001491775.1| 30S ribosomal protein S6 [Rickettsia canadensis str. McKiel] >gi|166227376|sp|A8EXA7|RS6_RICCK 30S ribosomal protein S6 >gi|157784489|gb|ABV72990.1| 30S ribosomal protein S6 [Rickettsia canadensis str. McKiel] (121 aa)
Score = 82, Expect = 7.9e-01, Identities = 26/90 (28%), Positives = 43/90 (47%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKS--TDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M  YE + ++   I  +    + +D   I+K +  T +K E  GL+ LAY I    +G+YY     +  P   +E  R   L + ++R L I
  S:     1 MSFYESVFIIRQDISLNDIDKIVDDFAKIIKDNNGTIIKKEYWGLRTLAYKIGSNKKGHYYFLGL-DITPNVKEEIERKMKLNENIIRFLTI 91
>gi|172041664|ref|YP_001801378.1| 30S ribosomal protein S6 [Corynebacterium urealyticum DSM 7109] >gi|171852968|emb|CAQ05944.1| 30S ribosomal protein S6 [Corynebacterium urealyticum DSM 7109] (95 aa)
Score = 82, Expect = 8.2e-01, Identities = 28/94 (29%), Positives = 49/94 (52%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILK--KSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           M +YE+M++VD S +E       +   +I++  K +  K++  G +   YPI KK  G Y + +   E   +++E  RV  L   VLR  ++  +K
  S:     1 MRQYEVMIIVDPSQDERTVAPSLDKYLNIVREEKGSVDKVDVWGKRRFEYPIQKKEEGVYIVLDLTCESD-TVRELDRVLNLNDNVLRTKVLRKDK 95
>gi|160940067|ref|ZP_02087412.1| hypothetical protein CLOBOL_04956 [Clostridium bolteae ATCC BAA-613] >gi|158436647|gb|EDP14414.1| hypothetical protein CLOBOL_04956 [Clostridium bolteae ATCC BAA-613] (95 aa)
Score = 82, Expect = 8.4e-01, Identities = 26/93 (27%), Positives = 44/93 (47%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLE 93
           M KYE+ +V++  +E+ +  A    +K  + +   T   +++ G K LAY I K    YYY   F   D     E      + + V+R+L +  E
  S:     1 MNKYELTVVLNVKLEDEQRAAAIEKVKGYITRFGGTVTNVDEWGKKRLAYEIQKMHEAYYYFIQF-ESDSVCPNEVEAHIRIMEPVIRYLCVKAE 94
>gi|126647680|ref|ZP_01720185.1| 30S ribosomal protein S6 [Algoriphagus sp. PR1] >gi|126576356|gb|EAZ80634.1| 30S ribosomal protein S6 [Algoriphagus sp. PR1] (123 aa)
Score = 82, Expect = 8.5e-01, Identities = 27/91 (29%), Positives = 48/91 (52%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           YE + ++   + + +     +   ++LK+  +  + +E  GLK +AY I+KK+ G+Y L  F   DP  I +F       ++V+R L   LEK
  S:     6 YETVFILTPVLSDVQMKDTVDKFVNLLKEEGADVINVENWGLKKMAYTIDKKTTGFYVLVEF-KADPTVISKFELEFRRDEKVMRFLTTVLEK 97
>gi|194563187|ref|YP_002098210.1| Ribosomal protein S6 [Burkholderia dolosa AUO158] >gi|124894811|gb|EAY68691.1| Ribosomal protein S6 [Burkholderia dolosa AUO158] (133 aa)
Score = 81, Expect = 8.7e-01, Identities = 28/109 (25%), Positives = 48/109 (44%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVR 109
           M  YEI+ +V     E     +     +I      + ++E  G + LAY I K ++ +Y   N    D  ++ E          VLRHLI+ ++     KA+T P  +++
  S:    10 MRHYEIVFIVHPDQSEQVPAMIERYKTTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNI-ECDQTTLDELEHAFKFNDAVLRHLIVKMK-----KAETGPSPMMK 113
>gi|71906855|ref|YP_284442.1| 30S ribosomal protein S6 [Dechloromonas aromatica RCB] >gi|91207911|sp|Q47GQ9|RS6_DECAR 30S ribosomal protein S6 >gi|71846476|gb|AAZ45972.1| SSU ribosomal protein S6P [Dechloromonas aromatica RCB] (127 aa)
Score = 81, Expect = 8.7e-01, Identities = 30/111 (27%), Positives = 46/111 (41%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVRSQ 111
           M  YEI  +V     E     V      +  K   + +LE  G + LAYPI K  + +Y L N    D  ++ E          VLRHL + ++      A T P  +++ +
  S:     1 MRHYEICFIVHPDQSEQVPGMVERYRAIVTAKGGSIHRLEDWGRRQLAYPIQKIHKAHYVLMNI-ECDGDTLNELEHSFKFNDAVLRHLTVKMK-----AAVTTPSPMMKEE 106
>gi|169832353|ref|YP_001718335.1| ribosomal protein S6 [Candidatus Desulforudis audaxviator MP104C] >gi|169639197|gb|ACA60703.1| ribosomal protein S6 [Candidatus Desulforudis audaxviator MP104C] (94 aa)
Score = 81, Expect = 8.9e-01, Identities = 26/90 (28%), Positives = 46/90 (51%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLII 90
           M +YE+M ++   +E+ ++T +      I+  +     +L + G + LAY I     G+Y +     E  A+ QE  RV  +   +LRH+II
  S:     1 MRQYEVMYILKPDLEDEESTQLIEKFSKIITDRDGEITELNRWGKRRLAYEIKDYREGHYVVMKCRAEHAAA-QELDRVFRITDGLLRHMII 91
>gi|87199437|ref|YP_496694.1| 30S ribosomal protein S6 [Novosphingobium aromaticivorans DSM 12444] >gi|123489788|sp|Q2G8G3|RS6_NOVAD 30S ribosomal protein S6 >gi|87135118|gb|ABD25860.1| SSU ribosomal protein S6P [Novosphingobium aromaticivorans DSM 12444] (120 aa)
Score = 81, Expect = 8.9e-01, Identities = 25/94 (26%), Positives = 50/94 (53%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTD--LKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEK 94
           MP YE + +    + +++  A+A     I++ +     K E  GL+ LAY I K  + ++ L N      A+I E  R T + ++V+R++ + +++
  S:     1 MPLYEHVFLARQDLSQAQVDALAAAATEIVESNEGKVTKTETWGLRSLAYKIQKNRKAHFVLLNI-EASGATIAELERQTQINEDVIRYMTVRVDE 95
>gi|177664942|ref|ZP_02940743.1| ribosomal protein S6 [Cyanothece sp. PCC 8801] >gi|172076053|gb|EDT61466.1| ribosomal protein S6 [Cyanothece sp. PCC 8801] (124 aa)
Score = 81, Expect = 8.9e-01, Identities = 26/105 (24%), Positives = 50/105 (47%)
  Q:     4 YEIMLVVDGSIEESKATAVANDLKSILKKST--DLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIV 108
           YE++ ++  S+ E +     N  +  L +    DL+++  G + LAYPI +   G Y   N+  E    +    R   L +EV+R++ + +E        + P+ +V
  S:     5 YEMIYILRPSLSEEQVNQEVNKYRDFLNEYNVKDLQVKIWGKRRLAYPIKRFIDGIYVQMNYQGEG-NQVAPLERAMRLSEEVIRYMTLKVETAVSETPASVPEVLV 110
>gi|91214892|ref|ZP_01251865.1| 30S ribosomal protein S6 [Psychroflexus torquis ATCC 700755] >gi|91187319|gb|EAS73689.1| 30S ribosomal protein S6 [Psychroflexus torquis ATCC 700755] (112 aa)
Score = 81, Expect = 9.1e-01, Identities = 28/107 (26%), Positives = 52/107 (48%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSIL--KKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKI 107
           M  YE + +++  + E +        +  L  + +  +  E  GLK LAYPI  K  G+Y++F +    P +I+    +    + ++R+L + L+K     AK   K+I
  S:     1 MNHYETVFILNPVLSEDQIKETVKKYEDFLVSEGAKMVNKEDWGLKKLAYPIQHKKSGFYHMFEYEVVGP-TIEPLEVMFRRDERMMRYLTVKLDKHAIDWAKERVKRI 108
>gi|194559000|ref|YP_002094026.1| Ribosomal protein S6 [Burkholderia cenocepacia PC184] >gi|124872791|gb|EAY64507.1| Ribosomal protein S6 [Burkholderia cenocepacia PC184] (133 aa)
Score = 81, Expect = 9.7e-01, Identities = 28/109 (25%), Positives = 48/109 (44%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKKSTDL-KLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKIVR 109
           M  YEI+ +V     E     +     +I      + ++E  G + LAY I K ++ +Y   N    D  ++ E          VLRHLI+ ++     KA+T P  +++
  S:    10 MRHYEIVFIVHPDQSEQVPAMIERYKTTITTHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNI-ECDQTTLDELEHAFKFNDAVLRHLIVKMK-----KAETGPSPMMK 113
>gi|94502359|ref|ZP_01308825.1| 30S ribosomal protein S6 [Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata)] >gi|161833771|ref|YP_001597967.1| 30S ribosomal subunit protein S6 [Candidatus Sulcia muelleri GWSS] >gi|94451084|gb|EAT14043.1| 30S ribosomal protein S6 [Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata)] >gi|152206261|gb|ABS30571.1| 30S ribosomal subunit protein S6 [Candidatus Sulcia muelleri GWSS] (108 aa)
Score = 81, Expect = 9.8e-01, Identities = 30/105 (28%), Positives = 55/105 (52%)
  Q:     3 KYEIMLVVDG--SIEESKATAVANDLKSILKKSTDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASIQEFRRVTLLKKEVLRHLIINLEKDYGYKAKTNPKKI 107
           KYE +L++    S E+ K T +      I+ K+  +  E  G+K LAYPI KK  G+Y++F +Y+ +P  I          ++++R L + +  +     K++ K +
  S:     2 KYETVLIITPVLSSEKIKLTTLEYINYLIINKANLMFEEHWGVKKLAYPIKKKKYGFYHIF-YYSANPKLIYNLDFKLNRDEKIIRFLTVKIGNEAFSYYKSSKKDV 107
>gi|88711929|ref|ZP_01106016.1| 30S ribosomal protein S6 [Flavobacteriales bacterium HTCC2170] >gi|88709335|gb|EAR01568.1| 30S ribosomal protein S6 [Flavobacteriales bacterium HTCC2170] (112 aa)
Score = 81, Expect = 9.9e-01, Identities = 31/94 (32%), Positives = 47/94 (50%)
  Q:     1 MPKYEIMLVVDGSIEESKATAVANDLKSILKK--STDLKLEKMGLKDLAYPINKKSRGYYYLFNFYNEDPASI-----QEFRRVTLLKKEVLRHLIINLEK 94
           M  YE + +++  + + +        +  L K  +  +  E  GLK LAY I  K  G+Y+LF F    P  I     QEFRR     + V+R L + L+K
  S:     1 MNNYETVFILNPVLSDVQIEETVKKFEDFLIKNGAKMVAKENWGLKKLAYAIQNKKSGFYHLFEFTG--PGEIITPYEQEFRR----DERVMRFLTVKLDK 95