>gi|26553569|ref|NP_757503.1| single-strand DNA binding protein [Mycoplasma penetrans HF-2] >gi|37999433|sp|Q8EWT6|SSB_MYCPE Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|26453575|dbj|BAC43907.1| single-strand DNA binding protein [Mycoplasma penetrans HF-2] (189 aa)
Score = 797, Expect = 1.4e-83, Identities = 189/189 (100%), Positives = 189/189 (100%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFALNDDEDPDQVVSLDWLDEFKE 189
           MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFALNDDEDPDQVVSLDWLDEFKE
  S:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFALNDDEDPDQVVSLDWLDEFKE 189
>gi|56965863|ref|YP_177597.1| single-strand DNA-binding protein SSB [Bacillus clausii KSM-K16] >gi|56912109|dbj|BAD66637.1| single-strand DNA-binding protein SSB [Bacillus clausii KSM-K16] (161 aa)
Score = 199, Expect = 2.9e-14, Identities = 47/138 (34%), Positives = 77/138 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDD 138
           +N+V +VGRL +DP+   T NG+  +  ++A     S+   + E  F  CV W+  A  + ++L KG L  +DG++  RSY + EG+ V+V EIV ES++ L  +NS N +S  +  ++     N     Q+  S S   D+
  S:     2 LNRVVLVGRLTRDPELRFTPNGVAVANFTLAVNRPFSNQQGEREADFINCVVWRKPAENVANFLKKGSLAGVDGRVQTRSYDNNEGRRVFVTEIVAESVQFLEPRNSQNQSSGNNPGFDQYGAGNQGSGNQTGGSRSNGYDN 143
>gi|16801465|ref|NP_471733.1| hypothetical protein lin2402 [Listeria innocua Clip11262] >gi|37999745|sp|Q928X8|SSB3_LISIN Single-stranded DNA-binding protein 3 (SSB 3) (Helix-destabilizing protein 3) >gi|16414925|emb|CAC97629.1| lin2402 [Listeria innocua] (160 aa)
Score = 196, Expect = 8.2e-14, Identities = 49/144 (34%), Positives = 79/144 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFA 144
           MN+V +VGRL +DP+   T  G+  +  ++A +    +   + E  F  CV W+  A  + ++L KG L  +DG++  R+Y   +GK VYV EIV ES++ L SK +    S+ + N + TN  N+N +       S+  D F +  A
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRPFKNGQGEQEADFIQCVVWRKPAENVANFLKKGSLAGVDGRVQTRNYEGNDGKRVYVTEIVAESVQFLESKQNGAGGSTSNNNQSETNYSNDNKTSSYRADRSQNGDSFANEGA 149
>gi|89897781|ref|YP_521268.1| hypothetical protein DSY5035 [Desulfitobacterium hafniense Y51] >gi|109647905|ref|ZP_01371808.1| single-strand binding protein [Desulfitobacterium hafniense DCB-2] >gi|89337229|dbj|BAE86824.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109640995|gb|EAT50550.1| single-strand binding protein [Desulfitobacterium hafniense DCB-2] (137 aa)
Score = 194, Expect = 1.1e-13, Identities = 39/107 (36%), Positives = 67/107 (62%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAA 107
           +N+V ++GRL +DP+   T NG+  +  S+A   N+     + E  F PCV ++  A    +YL KG L A+DG+L  R+Y +++G+  +V E+V E+++ LS K+  N+ 
  S:     2 LNRVVLIGRLTKDPELRYTPNGVAVASFSLAVDRNFKNANGEREADFIPCVVYRQLAELCANYLAKGKLAAVDGRLQVRTYDAQDGQRRWVYEVVAENVRFLSPKDGGNSG 112
>gi|166992782|ref|ZP_02259242.1| single-strand DNA-binding protein [Bacillus cereus AH820] (112 aa)
Score = 194, Expect = 1.3e-13, Identities = 36/101 (35%), Positives = 63/101 (62%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+V ++GRL +DP+ + T+ G+  +R+ +A +    ++  + +  F  CV W+ +A  +  Y  KG LV I G++  R+Y   +GK +Y+ E+VIESI  L  +
  S:     2 MNRVVLIGRLTKDPELYYTKQGVAYARVYVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCTKGSLVGITGRIHTRNYEDDQGKRIYITEVVIESITFLERR 106
>gi|196046035|ref|ZP_03113263.1| single-stranded DNA-binding protein [Bacillus cereus 03BB108] >gi|196023090|gb|EDX61769.1| single-stranded DNA-binding protein [Bacillus cereus 03BB108] (112 aa)
Score = 194, Expect = 1.4e-13, Identities = 35/101 (34%), Positives = 63/101 (62%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+V ++GRL ++P+ + T+ G+  +R+ +A +    ++  + +  F  CV W+ +A  +  Y  KG LV I G++  R+Y   +GK +Y+ E+VIESI  L  +
  S:     2 MNRVVLIGRLTKEPELYYTKQGVAYARVCVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIHTRNYEDDQGKRIYITEVVIESITFLERR 106
>gi|169825431|ref|YP_001695606.1| single-stranded DNA-binding protein (SSB) (helix-destabilizing protein) [Lysinibacillus sphaericus C3-41] >gi|168994708|gb|ACA42247.1| Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) [Lysinibacillus sphaericus C3-41] (199 aa)
Score = 193, Expect = 1.5e-13, Identities = 44/125 (35%), Positives = 72/125 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYS 125
           +N+V +VGRL +DP+   T NGI  +R +IA     S+   + E  F  CVAW+  A  + +Y+ KG+L+ ++G++   SY  ++GK VY  ++V +S++ L  +N N  A    +N       NN  S
  S:     2 INRVVLVGRLTKDPELRYTPNGIASTRFTIAVNRTFSNQQGEREADFISCVAWRKQAENLANYMRKGNLIGVEGRIQTGSYEGQDGKRVYTTDVVADSVQFLEPRNGNGGAPPAPQNNGGQTYGNNQPS 130
>gi|42781293|ref|NP_978540.1| single-strand DNA-binding protein [Bacillus cereus ATCC 10987] >gi|42737215|gb|AAS41148.1| single-stranded DNA-binding protein [Bacillus cereus ATCC 10987] (111 aa)
Score = 193, Expect = 1.6e-13, Identities = 35/101 (34%), Positives = 63/101 (62%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+V ++GRL ++P+ + T+ G+  +R+ +A +    ++  + +  F  CV W+ +A  +  Y  KG LV I G++  R+Y   +GK +Y+ E+VIESI  L  +
  S:     2 MNRVVLIGRLTKEPELYYTKQGVAYARVCVAVNRGFRNSLGEQQVDFINCVVWRRSAENVTEYCTKGSLVGITGRIHTRNYEDNQGKRIYITEVVIESITFLERR 106
>gi|56421726|ref|YP_149044.1| single-strand DNA-binding protein [Geobacillus kaustophilus HTA426] >gi|56381568|dbj|BAD77476.1| single-strand DNA-binding protein [Geobacillus kaustophilus HTA426] (119 aa)
Score = 193, Expect = 1.7e-13, Identities = 39/100 (39%), Positives = 61/100 (61%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE----TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSS 100
           +N+V +VGRL +DP+   T  G   + +++A + N+   E      F PCV W+ TA    +Y  KG +VA+ G++  R Y  K+G+ VYV E+V ES++ L S
  S:     6 INQVVLVGRLTKDPELRYTAEGAAVATVTLAVARNFRNAEGGIDADFVPCVLWRKTAEHTANYCRKGSMVAVTGRIQTRRYDKKDGQRVYVTEVVAESVQFLHS 109
>gi|30262185|ref|NP_844562.1| single-strand DNA-binding protein [Bacillus anthracis str. Ames] >gi|47527461|ref|YP_018810.1| single-strand DNA-binding protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49185024|ref|YP_028276.1| single-strand DNA-binding protein [Bacillus anthracis str. Sterne] >gi|52143270|ref|YP_083559.1| single-strand DNA-binding protein [Bacillus cereus E33L] >gi|167632979|ref|ZP_02391305.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0442] >gi|170686388|ref|ZP_02877609.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0465] >gi|170708420|ref|ZP_02898863.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0389] >gi|177650938|ref|ZP_02933835.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0174] >gi|190567927|ref|ZP_03020838.1| single-stranded DNA-binding protein [Bacillus anthracis Tsiankovskii-I] >gi|196039620|ref|ZP_03106924.1| single-stranded DNA-binding protein [Bacillus cereus NVH0597-99] >gi|30256811|gb|AAP26048.1| single-stranded DNA-binding protein [Bacillus anthracis str. Ames] >gi|47502609|gb|AAT31285.1| single-stranded DNA-binding protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49178951|gb|AAT54327.1| single-stranded DNA-binding protein [Bacillus anthracis str. Sterne] >gi|51976739|gb|AAU18289.1| single-stranded DNA-binding protein [Bacillus cereus E33L] >gi|167531791|gb|EDR94456.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0442] >gi|170126659|gb|EDS95543.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0389] >gi|170669464|gb|EDT20206.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0465] >gi|172083399|gb|EDT68460.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0174] >gi|190560982|gb|EDV14956.1| single-stranded DNA-binding protein [Bacillus anthracis Tsiankovskii-I] >gi|196029323|gb|EDX67926.1| single-stranded DNA-binding protein [Bacillus cereus NVH0597-99] (112 aa)
Score = 193, Expect = 1.8e-13, Identities = 35/101 (34%), Positives = 63/101 (62%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+V ++GRL ++P+ + T+ G+  +R+ +A +    ++  + +  F  CV W+ +A  +  Y  KG LV I G++  R+Y   +GK +Y+ E+VIESI  L  +
  S:     2 MNRVVLIGRLTKEPELYYTKQGVAYARVCVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCTKGSLVGITGRIHTRNYEDDQGKRIYITEVVIESITFLERR 106
>gi|153168328|ref|ZP_01928250.1| single strand binding protein [Listeria monocytogenes FSL N1-017] >gi|133726359|gb|EBA28057.1| single strand binding protein [Listeria monocytogenes FSL N1-017] (160 aa)
Score = 192, Expect = 1.9e-13, Identities = 49/144 (34%), Positives = 79/144 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFA 144
           MN+V +VGRL +DP    T  G+  +  ++A     ++   + E  F  CV W+  A  + ++L KG +  +DG++  R+Y  K+GK VYV EIV ES++ L SK +    S+ + N + TN  N+N +       S+  D F +  A
  S:     2 MNRVVLVGRLTKDPDLRYTPAGVAVATFTLAVNRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEDKDGKRVYVTEIVAESVQFLESKQNGAGGSTSNNNQSETNYSNDNKTSSYRADRSQNGDSFANEGA 149
>gi|171920641|ref|ZP_02931881.1| single-strand binding protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185179096|ref|ZP_02964827.1| single-strand binding protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024030|ref|ZP_02996788.1| single-strand binding protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039211|ref|ZP_02998020.1| single-strand binding protein [Ureaplasma urealyticum serovar 8] >gi|188518377|ref|ZP_03003883.1| single-strand binding protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524268|ref|ZP_03004312.1| single-strand binding protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530629|ref|ZP_03004977.1| single-strand binding protein [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568878|ref|ZP_03005594.1| single-strand binding protein [Ureaplasma urealyticum serovar 2] >gi|188592694|ref|ZP_03005984.1| single-strand binding protein [Ureaplasma urealyticum serovar 10] >gi|195867997|ref|ZP_03079993.1| single-strand binding protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903369|gb|EDT49658.1| single-strand binding protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184208990|gb|EDU06033.1| single-strand binding protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019059|gb|EDU57099.1| single-strand binding protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998177|gb|EDU67274.1| single-strand binding protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659723|gb|EDX53103.1| single-strand binding protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660331|gb|EDX53592.1| single-strand binding protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (168 aa)
Score = 191, Expect = 3.0e-13, Identities = 58/172 (33%), Positives = 94/172 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQS-NMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFALNDD 172
           MNKV ++G L +DP+     +G   +  ++A +DN       F  CVAW + ANF+ +YL KGD +AI+G+++ RSYV   GKT YV E+  + ++ LS +N N    + D N +  N      +  S N   + + +  ++NF   TS++N   KN+++E        L+DD
  S:     1 MNKVILIGNLVRDPEARQIPSGRLVTNFTVAVNDNIPNANANFIRCVAWNNQANFLTTYLKKGDAIAIEGRIVSRSYVDNNGKTNYVTEVYADQVQSLSRRNQN----ANDHNNDKVNVDTMMGAYASINTDAAFSSNQPQTNFQSTTSNSN---KNDDEEDEITSWINLDDD 166
>gi|49477535|ref|YP_036314.1| single-strand DNA-binding protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49329091|gb|AAT59737.1| single-stranded DNA-binding protein [Bacillus thuringiensis serovar konkukian str. 97-27] (112 aa)
Score = 189, Expect = 4.9e-13, Identities = 34/101 (33%), Positives = 62/101 (61%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+  ++GRL ++P+ + T+ G+  +R+ +A +    ++  + +  F  CV W+ +A  +  Y  KG LV I G++  R+Y   +GK +Y+ E+VIESI  L  +
  S:     2 MNRAVLIGRLTKEPELYYTKQGVAYARVCVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIHTRNYEDDQGKRIYITEVVIESITFLERR 106
>gi|167213509|ref|ZP_02283816.1| hypothetical protein LmonoFSL_00040 [Listeria monocytogenes FSL R2-503] (160 aa)
Score = 189, Expect = 5.0e-13, Identities = 48/139 (34%), Positives = 75/139 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDF 139
           MN+V +VGRL +DP    T  G+  +  ++A     ++   + E  F  CV W+  A  + ++L KG +  +DG++  R+Y   +GK VYV EIV ES++ L  K +    S+ + N N  N  NNN +     S S+  D F
  S:     2 MNRVMLVGRLTKDPDLRYTPAGVAVATFTLAVNRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEGNDGKRVYVTEIVAESVQFLEPKQNAVEGSTPNNNQNEANYSNNNKNGSYRASSSQKKDSF 144
>gi|89894943|ref|YP_518430.1| hypothetical protein DSY2197 [Desulfitobacterium hafniense Y51] >gi|89334391|dbj|BAE83986.1| hypothetical protein [Desulfitobacterium hafniense Y51] (129 aa)
Score = 189, Expect = 5.1e-13, Identities = 40/101 (39%), Positives = 67/101 (66%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIA---SSDNWN-KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+V ++GRL +DP+   T +G+  +  ++A   S  N N + ET F PCV ++  A   ++YL KG L A+DG+L  R+Y +++G+  +V E+V E+++ LS K
  S:     1 MNRVVLIGRLTKDPELRYTPSGVAVASFTLAVDRSFKNANGERETDFIPCVVYRQLAELCSNYLDKGKLAAVDGRLQVRTYDAQDGQRRWVYEVVAENVRFLSPK 105
>gi|167212944|ref|ZP_02283251.1| hypothetical protein LmonL_20722 [Listeria monocytogenes LO28] (160 aa)
Score = 187, Expect = 7.8e-13, Identities = 48/139 (34%), Positives = 75/139 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDF 139
           MN+V +VGRL +DP    T  G   +  ++A +    +   + E  F  CV W+  A  + ++L KG L  +DG++  R+Y   +GK VYV EIV ES++ L  KN++   S+ + N N  N  NN+ +       S+  D F
  S:     2 MNRVILVGRLTKDPDLRYTPAGAAVATFTLAVNRPFKNGQGEQEADFIQCVVWRKPAENVANFLKKGSLAGVDGRVQTRNYEGNDGKRVYVTEIVAESVQFLEPKNNHVEGSTSNNNQNGANYSNNSKTTPYRADSSQNKDSF 144
>gi|138896746|ref|YP_001127199.1| single-strand binding protein [Geobacillus thermodenitrificans NG80-2] >gi|196249441|ref|ZP_03148139.1| single-strand binding protein [Geobacillus sp. G11MC16] >gi|134268259|gb|ABO68454.1| Single-strand binding protein [Geobacillus thermodenitrificans NG80-2] >gi|196211198|gb|EDY05959.1| single-strand binding protein [Geobacillus sp. G11MC16] (115 aa)
Score = 187, Expect = 8.6e-13, Identities = 38/100 (38%), Positives = 60/100 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE----TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSS 100
           +N+V +VGRL +DP+   T  G   + + +A + N+   E      F PCV W+ TA     Y  KG +VA+ G++  R Y +K+G+ VYV E+V +S++ L S
  S:     2 INQVVLVGRLTKDPELRYTAEGTAVTTVILAVARNFRNAEGGIDADFVPCVLWRKTAEHTAHYCQKGSMVAVTGRIQTRRYENKDGQRVYVTEVVADSVQFLHS 105
>gi|65317454|ref|ZP_00390413.1| COG0629: Single-stranded DNA-binding protein [Bacillus anthracis str. A2012] >gi|118480501|ref|YP_897652.1| single-strand DNA-binding protein [Bacillus thuringiensis str. Al Hakam] >gi|167641755|ref|ZP_02399998.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0193] >gi|170689467|ref|ZP_02880657.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0465] >gi|170707600|ref|ZP_02898053.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0389] >gi|118419726|gb|ABK88145.1| single-stranded DNA-binding protein [Bacillus thuringiensis str. Al Hakam] >gi|167510309|gb|EDR85712.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0193] >gi|170127596|gb|EDS96470.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0389] >gi|170666569|gb|EDT17342.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0465] (176 aa)
Score = 187, Expect = 8.6e-13, Identities = 55/175 (31%), Positives = 87/175 (49%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFA-------LNDDEDP 175
           MN+V +VGRL +DP    T NG+  +  ++A     ++   + E  F  CV W+  A  + +YL KG L  +DG+L  R+Y  ++GK VYV E++ ES++ L  +N          N  P+     N S                 F Q ++S N  ++     T  DDPF+       ++DD+ P
  S:     5 MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRG-SFNQQPSGAGFGNQSSNP--------------FGQSSNSGNQGNQGNSGFTKNDDPFSNVGQPIDISDDDLP 175
>gi|152977672|ref|YP_001377189.1| single-strand DNA-binding protein [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152026424|gb|ABS24194.1| single-strand binding protein [Bacillus cereus subsp. cytotoxis NVH 391-98] (164 aa)
Score = 186, Expect = 9.4e-13, Identities = 50/145 (34%), Positives = 79/145 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPT-----NTKNNNYSQQSNMSVSEAMDDFESNFAQ 145
           MN+V +VGRL +DP    T NG+  +  ++A     ++   + E  F  CV W+  A  + +YL KG L  +DG+L  R+Y  ++G+ VYV E++ ES++ L  +NS         N  P+     N  +N + Q  N   ++  D F SN  Q
  S:     2 MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFTNQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYEGQDGRRVYVTEVLAESVQFLEPRNSGGEQRG-SFNQQPSGAGFGNQGSNPFGQSGNSGFTKNDDPF-SNVGQ 153
>gi|13358117|ref|NP_078391.1| single-strand binding protein [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170761966|ref|YP_001752637.1| single-strand binding protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920309|ref|ZP_02931656.1| single-strand binding protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508675|ref|ZP_02958168.1| single-strand binding protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701773|ref|ZP_02971453.1| single-strand binding protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|37999466|sp|Q9PPT7|SSB_UREPA Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|11357053|pir||B82875 single-strand binding protein UU553 [imported] - Ureaplasma urealyticum >gi|6899559|gb|AAF30966.1|AE002154_2 single-strand binding protein [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827543|gb|ACA32805.1| single-strand binding protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902724|gb|EDT49013.1| single-strand binding protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182676146|gb|EDT88051.1| single-strand binding protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701048|gb|EDU19330.1| single-strand binding protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (166 aa)
Score = 186, Expect = 9.6e-13, Identities = 53/160 (33%), Positives = 90/160 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKN---SNNAASSID---KNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKE 160
           MNKV ++G L +DP+     +G   +  +IA +DN       F  CVAW + ANF+ +YL KGD +AI+G+++ RSYV   GKT YV E+  + ++ LS +N   S+N   ++D   ++Y   NT     S +   ++S    +   N  ++   T+  + +++ E
  S:     1 MNKVILIGNLVRDPEARQIPSGRLVTNFTIAVNDNTPNANANFIRCVAWNNQANFLTTYLKKGDAIAIEGRIVSRSYVDNNGKTNYVTEVYADQVQSLSRRNQSPSDNNKVNVDTMMESYTGINTDAAFSSNKPQTTLSSTTSNLNKNNDEEDEITSWINLDDDLE 166
>gi|160915231|ref|ZP_02077444.1| hypothetical protein EUBDOL_01239 [Eubacterium dolichum DSM 3991] >gi|158433030|gb|EDP11319.1| hypothetical protein EUBDOL_01239 [Eubacterium dolichum DSM 3991] (158 aa)
Score = 186, Expect = 1.0e-12, Identities = 47/142 (33%), Positives = 83/142 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKN-YNPTNTKNNNYSQQSNMSVSEAMDDFESN 142
           +N+V +VGR+ +DP    T +GI+    ++A +    K    +  F  C AWQ  A+ ++ Y  KG L+ ++G++  RSY  + GK VYV E+V++S++ L  K+S +A +++  N Y P N+    Y   +  + S + +DF S+
  S:     2 INRVVLVGRITKDPVLRKTTSGISVVAFTLAVNRRIKKEGQPDADFINCQAWQGVADVLHKYTKKGSLIGVEGRIQTRSYDDRSGKRVYVTEVVVDSVQFLEPKDSASANANVSTNTYVPQNSYEPTYEPGAGTTPSYS-NDFASS 146
>gi|153168365|ref|ZP_01928273.1| hypothetical protein LMHG_02807 [Listeria monocytogenes FSL N1-017] >gi|133726352|gb|EBA28050.1| hypothetical protein LMHG_02807 [Listeria monocytogenes FSL N1-017] (159 aa)
Score = 185, Expect = 1.2e-12, Identities = 46/141 (32%), Positives = 76/141 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFES 141
           MN+V +VGRL +DP    T  G+  +  ++A     ++   + E  F  CV W+  A  + ++L KG +  +DG++  R+Y   +GK V+V E+V ES++ L  KN+N   ++ +   N  N  NNN +       S+  D F S
  S:     1 MNRVVLVGRLTKDPDLRYTPAGVAVATFTLAVNRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEDNDGKRVFVTEVVAESVQFLEPKNNNVEGATSNNYQNKANYSNNNQTSSYRADTSQKSDSFAS 145
>gi|49188310|ref|YP_031563.1| single-strand DNA-binding protein [Bacillus anthracis str. Sterne] >gi|49480470|ref|YP_039463.1| single-strand DNA-binding protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|167635123|ref|ZP_02393440.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0442] >gi|177655279|ref|ZP_02936833.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0174] >gi|49182237|gb|AAT57613.1| single-stranded DNA-binding protein [Bacillus anthracis str. Sterne] >gi|49332026|gb|AAT62672.1| single-stranded DNA-binding protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|167529597|gb|EDR92347.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0442] >gi|172080206|gb|EDT65298.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0174] (173 aa)
Score = 185, Expect = 1.4e-12, Identities = 55/175 (31%), Positives = 87/175 (49%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFA-------LNDDEDP 175
           MN+V +VGRL +DP    T NG+  +  ++A     ++   + E  F  CV W+  A  + +YL KG L  +DG+L  R+Y  ++GK VYV E++ ES++ L  +N          N  P+     N S                 F Q ++S N  ++     T  DDPF+       ++DD+ P
  S:     2 MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRG-SFNQQPSGAGFGNQSSNP--------------FGQSSNSGNQGNQGNSGFTKNDDPFSNVGQPIDISDDDLP 172
>gi|153203713|ref|ZP_01944709.1| hypothetical protein LMSG_02931 [Listeria monocytogenes HPB2262] >gi|133734597|gb|EBA36295.1| hypothetical protein LMSG_02931 [Listeria monocytogenes HPB2262] (159 aa)
Score = 185, Expect = 1.5e-12, Identities = 51/141 (36%), Positives = 79/141 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNY-NPTNTKNNNYSQQSNMSVSEAMDDFES 141
           MN+V +VGRL +DP+   T  G+  +  ++A +  + N+N   E  F  CV W+  A  + ++L KG L  +DG++  R+Y   +GK V+V E+V ES++ L  +N    A+S   NY N  N  NNN +       S+  D F S
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQNGEREADFIQCVVWRKPAENVANFLKKGSLAGVDGRIQTRNYEDNDGKRVFVTEVVAESVQFLEPRNHAEGATS--NNYQNEANYSNNNKTSSYRADTSQKSDSFAS 145
>gi|172059039|ref|YP_001815499.1| single-strand binding protein [Exiguobacterium sibiricum 255-15] >gi|171991560|gb|ACB62482.1| single-strand binding protein [Exiguobacterium sibiricum 255-15] (175 aa)
Score = 184, Expect = 1.6e-12, Identities = 39/103 (37%), Positives = 62/103 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           +N+V +VGRL +DP+   TQ+GI  +R ++A    +     K E  F  CV W+  A  +  YL KG L  ++G+L   SY  K+G+  Y  E+V +S++ L S+N+
  S:     2 INRVVLVGRLTRDPEMRYTQSGIAVTRFTLACDRPFTGQDGKREADFIDCVVWRKQAENVAQYLKKGSLAGVEGRLQISSYDDKDGQRRYRAEVVADSVRFLESRNA 108
>gi|187603425|ref|ZP_02989637.1| single-strand binding protein [Exiguobacterium sp. AT1b] >gi|187484200|gb|EDU22192.1| single-strand binding protein [Exiguobacterium sp. AT1b] (169 aa)
Score = 184, Expect = 1.6e-12, Identities = 37/104 (35%), Positives = 63/104 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW----NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSN 104
           +N+V +VGRL +DP+   TQ+GI  +R+++A    +     K ET F  CV W+  A  +  YL KG +  +DG+L   SY  ++G+  Y  E+V +S++ L  + ++
  S:     2 INRVVLVGRLTRDPEMRYTQSGIAVTRLTLACDRPFAGQDGKRETDFIDCVVWRKQAENVAQYLKKGSMAGVDGRLQISSYEGQDGQRRYRAEVVADSVRFLEPRGAS 109
>gi|75763191|ref|ZP_00742956.1| Single-strand DNA binding protein [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74489323|gb|EAO52774.1| Single-strand DNA binding protein [Bacillus thuringiensis serovar israelensis ATCC 35646] (176 aa)
Score = 184, Expect = 1.6e-12, Identities = 55/175 (31%), Positives = 86/175 (49%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFA-------LNDDEDP 175
           MN+V +VGRL  DP    T NG+  +  ++A     ++   + E  F  CV W+  A  + +YL KG L  +DG+L  R+Y  ++GK VYV E++ ES++ L  +N          N  P+     N S                 F Q ++S N  ++     T  DDPF+       ++DD+ P
  S:     5 MNRVILVGRLTXDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYDGQDGKRVYVTEVLAESVQFLEPRNGGGEQRG-SFNQQPSGAGFGNQSSNP--------------FGQSSNSGNQGNQGNSGFTKNDDPFSNVGQPIDISDDDLP 175
>gi|30265491|ref|NP_847868.1| single-strand DNA-binding protein [Bacillus anthracis str. Ames] >gi|47531059|ref|YP_022408.1| single-strand DNA-binding protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|47568672|ref|ZP_00239369.1| single-strand DNA binding protein [Bacillus cereus G9241] >gi|52145281|ref|YP_086738.1| single-strand DNA-binding protein [Bacillus cereus E33L] >gi|165873020|ref|ZP_02217641.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0488] >gi|166982573|ref|ZP_02254005.1| single-strand DNA-binding protein [Bacillus cereus AH187] >gi|166997086|ref|ZP_02263545.1| single-strand DNA-binding protein [Bacillus cereus AH820] >gi|168160950|ref|ZP_02596183.1| single-strand DNA-binding protein [Bacillus cereus H3081.97] >gi|190569296|ref|ZP_03022190.1| single-stranded DNA-binding protein [Bacillus anthracis Tsiankovskii-I] >gi|196036124|ref|ZP_03103524.1| single-stranded DNA-binding protein [Bacillus cereus W] >gi|196041929|ref|ZP_03109216.1| single-stranded DNA-binding protein [Bacillus cereus NVH0597-99] >gi|196045533|ref|ZP_03112764.1| single-stranded DNA-binding protein [Bacillus cereus 03BB108] >gi|37999368|sp|Q81JI3|SSB_BACAN Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|30260169|gb|AAP29354.1| single-stranded DNA-binding protein [Bacillus anthracis str. Ames] >gi|47506207|gb|AAT34883.1| single-stranded DNA-binding protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|47554660|gb|EAL13014.1| single-strand DNA binding protein [Bacillus cereus G9241] >gi|51978750|gb|AAU20300.1| single-stranded DNA-binding protein [Bacillus cereus E33L] >gi|164711232|gb|EDR16788.1| single-stranded DNA-binding protein [Bacillus anthracis str. A0488] >gi|190559603|gb|EDV13594.1| single-stranded DNA-binding protein [Bacillus anthracis Tsiankovskii-I] >gi|195991291|gb|EDX55259.1| single-stranded DNA-binding protein [Bacillus cereus W] >gi|196023740|gb|EDX62416.1| single-stranded DNA-binding protein [Bacillus cereus 03BB108] >gi|196027184|gb|EDX65804.1| single-stranded DNA-binding protein [Bacillus cereus NVH0597-99] (172 aa)
Score = 184, Expect = 1.7e-12, Identities = 55/175 (31%), Positives = 87/175 (49%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFA-------LNDDEDP 175
           MN+V +VGRL +DP    T NG+  +  ++A     ++   + E  F  CV W+  A  + +YL KG L  +DG+L  R+Y  ++GK VYV E++ ES++ L  +N          N  P+     N S                 F Q ++S N  ++     T  DDPF+       ++DD+ P
  S:     1 MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRG-SFNQQPSGAGFGNQSSNP--------------FGQSSNSGNQGNQGNSGFTKNDDPFSNVGQPIDISDDDLP 171
>gi|30020289|ref|NP_831920.1| single-strand DNA-binding protein [Bacillus cereus ATCC 14579] >gi|29895839|gb|AAP09121.1| Single-strand DNA binding protein [Bacillus cereus ATCC 14579] (111 aa)
Score = 184, Expect = 1.9e-12, Identities = 35/101 (34%), Positives = 62/101 (61%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+V ++GRL ++P+ + T+ G+  +RI +A +    ++  + +  F  CV W+ +A  +  Y  KG LV I G++   +Y  ++GK +Y  E+VIESI  L  +
  S:     2 MNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIQTSNYDDEQGKRIYRTEVVIESITFLERR 106
>gi|16804347|ref|NP_465832.1| hypothetical protein lmo2308 [Listeria monocytogenes EGD-e] >gi|47096011|ref|ZP_00233613.1| single-strand binding protein subfamily [Listeria monocytogenes str. 1/2a F6854] >gi|167405138|ref|ZP_02309902.1| hypothetical protein LmonocytFSL_19113 [Listeria monocytogenes FSL J2-003] >gi|37999734|sp|Q8Y4X1|SSB2_LISMO Single-stranded DNA-binding protein 2 (SSB 2) (Helix-destabilizing protein 2) >gi|16411778|emb|CAD00386.1| lmo2308 [Listeria monocytogenes] >gi|47015608|gb|EAL06539.1| single-strand binding protein subfamily [Listeria monocytogenes str. 1/2a F6854] (160 aa)
Score = 184, Expect = 1.9e-12, Identities = 48/141 (34%), Positives = 78/141 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFES 141
           MN+V +VGRL +DP    T  G+  +  ++A +  + N+N   E  F  CV W+  A  + ++L KG +  +DG++  R+Y   +GK V+V E+V ES++ L  KN+N   ++ +   N  N  NNN +       S+  D F S
  S:     2 MNRVVLVGRLTKDPDLRYTPAGVAVATFTLAVNRTFTNQNGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEDNDGKRVFVTEVVAESVQFLEPKNNNVEGATSNNYQNKANYSNNNQTSSYRADTSQKSDSFAS 146
>gi|56422016|ref|YP_149334.1| single-strand DNA-binding protein [Geobacillus kaustophilus HTA426] >gi|56381858|dbj|BAD77766.1| single-strand DNA-binding protein [Geobacillus kaustophilus HTA426] (164 aa)
Score = 184, Expect = 1.9e-12, Identities = 39/114 (34%), Positives = 68/114 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNY 114
           +N+V +VGRL +DP+   T +G+  +  ++A     ++   + ET F  CV W+  A  + ++L KG L  +DG+L  RSY ++EG+ VYV E+V +S++ L  K ++    +    Y
  S:     2 INRVILVGRLTRDPELRYTPSGVAVATFTLAVNRPFTNQQGERETDFIQCVVWRRQAENVANFLKKGSLAGVDGRLQTRSYENQEGRRVYVTEVVADSVQFLEPKGTSEQRGATAGGY 119
>gi|138897055|ref|YP_001127508.1| single-strand DNA-binding protein, phage-related protein [Geobacillus thermodenitrificans NG80-2] >gi|134268568|gb|ABO68763.1| Single-strand DNA-binding protein, phage-related protein [Geobacillus thermodenitrificans NG80-2] (164 aa)
Score = 184, Expect = 2.0e-12, Identities = 38/104 (36%), Positives = 65/104 (62%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSN 104
           +N+V +VGRL +DP+   T +G+  +  ++A     ++   + E  F  CV W+  A  + ++L KG L  +DG+L  RSY ++EG+ VYV E+V ++++ L  K SN
  S:     2 INRVILVGRLTRDPELRYTPSGVAVATFTLAVNRPFTNQQGEREADFIQCVVWRRQAENVANFLKKGSLAGVDGRLQTRSYENQEGRRVYVTEVVADNVQFLEPKGSN 109
>gi|163943153|ref|YP_001648037.1| single-strand DNA-binding protein [Bacillus weihenstephanensis KBAB4] >gi|163865350|gb|ABY46409.1| single-strand binding protein [Bacillus weihenstephanensis KBAB4] (173 aa)
Score = 184, Expect = 2.0e-12, Identities = 55/175 (31%), Positives = 87/175 (49%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFA-------LNDDEDP 175
           MN+V +VGRL +DP    T NG+  +  ++A     ++   + E  F  CV W+  A  + +YL KG L  +DG+L  R+Y  ++GK VYV E++ ES++ L  +N          N  P+     N S                 F Q ++S N  ++     T  DDPF+       ++DD+ P
  S:     2 MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYDGQDGKRVYVTEVLAESVQFLEPRNGGGEQRG-SFNQQPSGAGFGNQSSNP--------------FGQSSNSGNQGNQGNSGFTKNDDPFSNVGQPIDISDDDLP 172
>gi|167939397|ref|ZP_02526472.1| single-strand DNA-binding protein [Bacillus cereus AH1134] (169 aa)
Score = 183, Expect = 2.1e-12, Identities = 50/175 (28%), Positives = 89/175 (50%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFALNDDEDP 175
           +N+V +VGRL +DP    T NG+  +  ++A     ++   + E  F  CV W+  A  + +YL KG L  +DG+L  R+Y  ++GK VYV E++ ES++ L  +NS         N  P      ++  +++ S  +  +   S F          +KN++  +   +P  ++DD+ P
  S:     3 LNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLRKGSLAGVDGRLQTRNYEGQDGKRVYVTEVLAESVQFLEPRNSGRGEQRNTSNQQPVGA---SFGNENSSSFRKTGNQGNSGF----------TKNDDPFSNVGNPIDISDDDLP 168
>gi|152975402|ref|YP_001374919.1| single-strand DNA-binding protein [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152024154|gb|ABS21924.1| single-strand binding protein [Bacillus cereus subsp. cytotoxis NVH 391-98] (121 aa)
Score = 183, Expect = 2.1e-12, Identities = 38/101 (37%), Positives = 61/101 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+V +VGRL +DP+ + T+ GI  +RI IA +    ++  + +  +  CV W+ +A  +  Y  KG LV I G++   +Y + +GK +Y  E+VIE I  L  K
  S:    11 MNRVVLVGRLTKDPELYYTKQGIPYARICIAVNRGFRNSLGEQQADYIYCVVWRKSAENVLEYCRKGSLVGITGRIHTSNYENDQGKRIYRTEVVIERITFLERK 115
>gi|114568044|ref|YP_755198.1| single-strand binding protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338979|gb|ABI69827.1| single-strand binding protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (150 aa)
Score = 183, Expect = 2.3e-12, Identities = 40/103 (38%), Positives = 64/103 (62%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESI----KPLSSKNS 103
           +N+V ++GRL +DP+   TQNG   +  ++A    + + ET F P V W   A    +YL+KG LVAI+G++  R+Y ++EG+  +V E+V E +    KP  S+ S
  S:     2 LNRVILIGRLTKDPELRYTQNGTAVATFTLAVDRKYKREETDFIPIVVWAKQAENCANYLNKGSLVAIEGRIQVRTYDNQEGQRRWVTEVVAEDVRFMGKPAGSRGS 108
>gi|167757398|ref|ZP_02429525.1| hypothetical protein CLORAM_02948 [Clostridium ramosum DSM 1402] >gi|167703573|gb|EDS18152.1| hypothetical protein CLORAM_02948 [Clostridium ramosum DSM 1402] (153 aa)
Score = 183, Expect = 2.4e-12, Identities = 45/141 (31%), Positives = 79/141 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFES 141
           +N+V +VGR+ ++P+   TQ G   +  ++A + N+     + +  F  CV W+  A  +  Y  KG LV ++GK+  R+Y  K+GKTV+V+E+  +S++ L ++N N A     K        N+NY    + S S+ M+D  +
  S:     2 INRVVLVGRMTRNPELRRTQQGDAVTSFTLAVNRNFTSGDGQRQADFINCVVWRKPAENVERYCSKGSLVGVEGKIQTRTYDDKDGKTVFVVEVRCDSVQFLDTRNQNEAPMDTQK---VQQMANDNYFHNGSSSPSDFMEDVNT 143
>gi|168143824|ref|ZP_02587053.1| single-strand binding protein [Bacillus cereus G9842] (172 aa)
Score = 183, Expect = 2.4e-12, Identities = 55/175 (31%), Positives = 87/175 (49%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFA-------LNDDEDP 175
           MN+V +VGRL +DP    T NG+  +  ++A     ++   + E  F  CV W+  A  + +YL KG L  +DG+L  R+Y  ++GK VYV E++ ES++ L  +N          N  P+     N S                 F Q ++S N  ++     T  DDPF+       ++DD+ P
  S:     1 MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYDGQDGKRVYVTEVLAESVQFLEPRNGGGEQRG-SFNQQPSGAGFGNQSSNP--------------FGQSSNSGNQGNQGNSGFTKNDDPFSNVGQPIDISDDDLP 171
>gi|75764878|ref|ZP_00744239.1| Single-strand DNA binding protein [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74487633|gb|EAO51488.1| Single-strand DNA binding protein [Bacillus thuringiensis serovar israelensis ATCC 35646] (111 aa)
Score = 182, Expect = 2.7e-12, Identities = 36/101 (35%), Positives = 62/101 (61%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+V ++GRL ++P+ + T+ G+  +RI IA +    ++  + +  F  CV W+ +A  +  Y  KG LV I G++   +Y  ++GK +Y  E+VIESI  L  +
  S:     2 MNRVVLIGRLTKEPELYYTKQGVAYARICIAVNRGFRNSLGEQQVDFINCVVWRKSAENVAEYCKKGSLVGITGRIQTSNYDDEQGKRIYRTEVVIESITFLERR 106
>gi|168138339|ref|ZP_02581568.1| single-strand DNA-binding protein [Bacillus cereus B4264] (111 aa)
Score = 182, Expect = 3.1e-12, Identities = 35/101 (34%), Positives = 63/101 (62%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+V ++GRL ++P+ + T+ G+  +RI +A +    ++  + +  F  CV W+ +A  +  Y  KG LV I G++   +Y +++GK +Y  E+VIESI  L  +
  S:     2 MNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIQTSNYDNEQGKRIYRTEVVIESITFLERR 106
>gi|126651976|ref|ZP_01724168.1| single-strand DNA-binding protein [Bacillus sp. B14905] >gi|169830184|ref|YP_001700342.1| single-stranded DNA-binding protein (SSB) (helix-destabilizing protein) [Lysinibacillus sphaericus C3-41] >gi|126591245|gb|EAZ85354.1| single-strand DNA-binding protein [Bacillus sp. B14905] >gi|168994672|gb|ACA42212.1| Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) [Lysinibacillus sphaericus C3-41] (189 aa)
Score = 182, Expect = 3.3e-12, Identities = 41/123 (33%), Positives = 71/123 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNN 123
           +N+V +VGRL +DP+   T NGI  +R ++A     S+   + E  F  CVAW+  A  + +++ KG L+ ++G++   SY  ++GK VY  ++V +S++ L  +N + A +     Y    T  NN
  S:     2 INRVVLVGRLTKDPELRYTPNGIASTRFTVAVNRAFSNQQGEREADFINCVAWRKQAENLANFMRKGSLIGVEGRIQTGSYEGQDGKRVYTTDVVADSVQFLEPRNGSGAPAP---QYGGGQTYGNN 125
>gi|148377633|ref|YP_001256509.1| single-strand binding protein(helix-destabilizing protein) [Mycoplasma agalactiae PG2] >gi|148291679|emb|CAL59065.1| Single-strand binding protein(Helix-destabilizing protein) [Mycoplasma agalactiae PG2] (184 aa)
Score = 182, Expect = 3.4e-12, Identities = 63/172 (36%), Positives = 102/172 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE--TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNF----AQKTSSTNITSKNE----EKETFKDDPFALNDD 172
           +NKV ++GR++ D +   T +GI+ +R  IA S N++ +   T F P +AW+STA+F+N Y  KG LVAI+G L+  +Y S  G+T Y IE+ I+++  L S++  N   + D +    N K N+    +N + S     FE NF    ++K  +TN  S+ +    E + F +  F  +DD
  S:     3 LNKVILIGRVSSDIRYSKTNSGISFARTRIAISRNYSSDNEVTDFIPVIAWRSTADFLNGYAPKGTLVAIEGALVTSTYESN-GQTNYSIEVRIDNLHLLESRSVRNQRQTNDFSVVQPNFKKNDLGNGNNFAKSNKA--FEQNFNLEGSEKNKNTNKASEAQSAKVEDQPFNNINFNFDDD 181
>gi|15616611|ref|NP_244917.1| single-strand DNA-binding protein (phage-related protein) [Bacillus halodurans C-125] >gi|37999463|sp|Q9K5N9|SSB_BACHD Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|10176674|dbj|BAB07768.1| single-strand DNA-binding protein (phage-related protein) [Bacillus halodurans C-125] (168 aa)
Score = 181, Expect = 4.2e-12, Identities = 43/123 (34%), Positives = 71/123 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNY---NPTNTKNNN 123
           +N+V +VGRL +DP+   T NG+  +  ++A     S+   + E  F  CV W+  A  + +YL KG L  +DG++  RSY + EG+ V+V E++ ES++ L  + S +   S   N+   +P N    N
  S:     2 LNRVVLVGRLTRDPELRYTPNGVAVANFTLAVNRPFSNQQGEREADFINCVVWRKQAENVANYLKKGSLAGVDGRIQTRSYDNNEGRRVFVTEVMAESVQFLEPRGSQSQGGSNVDNFGGGSPNNPMGGN 131
>gi|167935484|ref|ZP_02522559.1| single-strand DNA-binding protein [Bacillus cereus AH1134] >gi|168138958|ref|ZP_02582187.1| single-strand DNA-binding protein [Bacillus cereus G9842] (111 aa)
Score = 181, Expect = 4.2e-12, Identities = 35/101 (34%), Positives = 62/101 (61%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+V ++GRL ++P+ + T+ G+  +RI +A +    ++  + +  F  CV W+ +A  +  Y  KG LV I G++   +Y  ++GK +Y  E+VIESI  L  +
  S:     2 MNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRKSAENVAEYCKKGSLVGITGRIQTSNYDDEQGKRIYRTEVVIESITFLERR 106
>gi|47097485|ref|ZP_00235027.1| single-strand binding protein subfamily [Listeria monocytogenes str. 1/2a F6854] >gi|153186866|ref|ZP_01936957.1| hypothetical protein LMOG_02935 [Listeria monocytogenes J0161] >gi|153192296|ref|ZP_01939316.1| hypothetical protein LMPG_02580 [Listeria monocytogenes J2818] >gi|47014126|gb|EAL05117.1| single-strand binding protein subfamily [Listeria monocytogenes str. 1/2a F6854] >gi|126940907|gb|EBA18816.1| hypothetical protein LMOG_02935 [Listeria monocytogenes J0161] >gi|127764356|gb|EBA24895.1| hypothetical protein LMPG_02580 [Listeria monocytogenes J2818] (160 aa)
Score = 180, Expect = 5.6e-12, Identities = 44/139 (31%), Positives = 75/139 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDF 139
           MN+V +VGRL +DP+   T  G+  +  ++A     ++   + E  F  CV W+  A  + ++L KG +  +DG++  R+Y   +GK V+V E+V ES++ L  KN+N   ++ +   N  N  NNN +        +  D F
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEDSDGKRVFVTEVVAESVQFLDPKNNNVEGTTSNNYQNKANYSNNNKTSSYRADTGQNSDSF 144
>gi|16798847|ref|NP_463525.1| putative SSB protein [Listeria phage A118] >gi|157325471|ref|YP_001468893.1| gp53 [Listeria phage A006] >gi|5823662|emb|CAB53850.1| putative SSB protein [Listeria phage A118] >gi|66733476|gb|AAY53290.1| gp53 [Listeria phage A006] (160 aa)
Score = 180, Expect = 5.8e-12, Identities = 46/141 (32%), Positives = 75/141 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFES 141
           MN+V +VGRL +DP    T  G   +  ++A     ++   + E  F  CV W+  A  + ++L KG +  +DG++  R+Y   +GK V+V E+V ES++ L  KN+N   ++ +   N  N  NNN +       S+  D F S
  S:     2 MNRVVLVGRLTKDPDLRYTPAGAAVATFTLAVNRMFTNQNGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEDNDGKRVFVTEVVAESVQFLEPKNNNVEGATSNNYQNKANYSNNNQTSSYRADTSQKSDSFAS 146
>gi|30023497|ref|NP_835128.1| single-strand DNA-binding protein [Bacillus cereus ATCC 14579] >gi|168137548|ref|ZP_02580777.1| single-strand DNA-binding protein [Bacillus cereus B4264] >gi|37999367|sp|Q814G6|SSB_BACCR Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|29899058|gb|AAP12329.1| Single-strand DNA binding protein [Bacillus cereus ATCC 14579] (170 aa)
Score = 179, Expect = 6.5e-12, Identities = 46/129 (35%), Positives = 72/129 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPT-----NTKNNNYSQQSN 129
           MN+V +VGRL +DP    T NG+  +  ++A     ++   + E  F  CV W+  A  + +YL KG L  +DG+L  R+Y  ++GK VYV E++ ES++ L  +N          N  P+     N  +N + Q SN
  S:     2 MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRG-SFNQQPSGAGFGNQGSNPFGQSSN 138
>gi|163939975|ref|YP_001644859.1| single-strand DNA-binding protein [Bacillus weihenstephanensis KBAB4] >gi|163862172|gb|ABY43231.1| single-strand binding protein [Bacillus weihenstephanensis KBAB4] (112 aa)
Score = 179, Expect = 6.6e-12, Identities = 35/101 (34%), Positives = 62/101 (61%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+V ++GRL ++P+ + T+ G+  +RI +A +    ++  + +  F  CV W+ +A  +  Y  KG LV I G++   +Y  ++GK VY  E++IESI  L  +
  S:     2 MNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVIWRRSAENVTEYCTKGSLVGITGRIHTSNYDDEQGKRVYRTEVLIESITFLERR 106
>gi|196033825|ref|ZP_03101236.1| single-stranded DNA-binding protein [Bacillus cereus W] >gi|195993505|gb|EDX57462.1| single-stranded DNA-binding protein [Bacillus cereus W] (111 aa)
Score = 179, Expect = 6.9e-12, Identities = 36/101 (35%), Positives = 61/101 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+V ++GRL ++P+ + T+ G   +RI IA +    ++  + +  F  CV W+ +A  +  Y  KG LV I G++   +Y  ++GK +Y  E+VIESI  L  +
  S:     2 MNRVVLIGRLTKEPELYYTKQGAAYARICIAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIQTSNYDDEQGKRIYRTEVVIESITFLERR 106
>gi|153180328|ref|ZP_01933448.1| single-strand binding protein subfamily [Listeria monocytogenes F6900] >gi|133732095|gb|EBA33793.1| single-strand binding protein subfamily [Listeria monocytogenes F6900] (151 aa)
Score = 179, Expect = 7.2e-12, Identities = 42/123 (34%), Positives = 71/123 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNN 123
           MN+V +VGRL +DP+   T  G+  +  ++A     ++   + E  F  CV W+  A  + ++L KG +  +DG++  R+Y   +GK V+V E+V ES++ L  KN+N   ++ +   N  N  NNN
  S:    13 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEDSDGKRVFVTEVVAESVQFLDPKNNNVEGTTSNNYQNKANYSNNN 139
>gi|42784669|ref|NP_981916.1| single-strand DNA-binding protein [Bacillus cereus ATCC 10987] >gi|167937973|ref|ZP_02525048.1| single-strand DNA-binding protein [Bacillus cereus AH1134] >gi|42740601|gb|AAS44524.1| single-stranded DNA-binding protein [Bacillus cereus ATCC 10987] (169 aa)
Score = 179, Expect = 7.7e-12, Identities = 46/129 (35%), Positives = 72/129 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPT-----NTKNNNYSQQSN 129
           MN+V +VGRL +DP    T NG+  +  ++A     ++   + E  F  CV W+  A  + +YL KG L  +DG+L  R+Y  ++GK VYV E++ ES++ L  +N          N  P+     N  +N + Q SN
  S:     1 MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRG-SFNQQPSGAGFGNQGSNPFGQSSN 137
>gi|161506642|ref|YP_001576590.1| single-stranded DNA-binding protein [Lactobacillus helveticus DPC 4571] >gi|160347631|gb|ABX26305.1| Single-stranded dna-binding protein [Lactobacillus helveticus DPC 4571] (172 aa)
Score = 178, Expect = 8.4e-12, Identities = 49/175 (28%), Positives = 94/175 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE----TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETF--KDDPFALNDDEDP 175
           +N+V +VGRL +DP+   T +GI+ +  ++A    +  ++      F  CV W+ +A    ++  KG LV IDG++  RSY +K+G+ VYV E+V+++   L S+    A             +N  Y+  +  + + + ++F++N   + ++ N    N  ++ F    DP  ++DD+ P
  S:     2 INRVVLVGRLTRDPELRTTGSGISVATFTLAVDRQFTNSQGERGADFISCVIWRKSAENFCNFTSKGSLVGIDGRIQTRSYDNKDGQRVYVTEVVVDNFALLESRKDREARG-----------QNGGYTPNTGNAGAPSTNNFQNNGGSQNNAQNNNQSNNAQDPFAGSGDPIDISDDDLP 171
>gi|162447064|ref|YP_001620196.1| single-strand DNA-binding protein [Acholeplasma laidlawii PG-8A] >gi|161985171|gb|ABX80820.1| single-strand DNA-binding protein [Acholeplasma laidlawii PG-8A] (148 aa)
Score = 178, Expect = 8.7e-12, Identities = 39/109 (35%), Positives = 75/109 (68%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           +N+V +VGR+ +D    VT +G +    ++A + N+     + E  F  CV W+++A+F+ +Y+ KG+L+A+DG++  R+Y   +G+TVY+ E+V +S++ L S++SN + +S
  S:     2 INRVVLVGRITKDVDHRVTTSGASVVSFTLAVNRNFTSASGEREADFINCVTWRASADFMKNYVKKGNLLAVDGRMQTRNYEDNDGRTVYITEVVADSVQLLESRSSNQSDNS 114
>gi|167015407|ref|ZP_02277940.1| hypothetical protein LmonFS_14436 [Listeria monocytogenes FSL J1-194] (159 aa)
Score = 178, Expect = 9.2e-12, Identities = 50/141 (35%), Positives = 78/141 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNY-NPTNTKNNNYSQQSNMSVSEAMDDFES 141
           MN+V +VGRL +DP+   T  G+  +  ++A +  + N+N   E  F  CV W+  A    ++L KG +  +DG++  R+Y   +GK V+V E+V ES++ L  +N    A+S   NY N  N  NNN +       S+  D F S
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRAFTNQNGEREADFIQCVVWRKPAENAANFLKKGSMAGVDGRIQTRNYEDNDGKRVFVTEVVAESVQFLEPRNHAEGATS--NNYQNKANYSNNNQTSSYRADTSQKSDSFAS 145
>gi|9635695|ref|NP_061608.1| single strand DNA binding protein [Staphylococcus prophage phiPV83] >gi|8918765|dbj|BAA97825.1| single strand DNA binding protein [Staphylococcus prophage phiPV83] (142 aa)
Score = 177, Expect = 1.0e-11, Identities = 44/131 (33%), Positives = 76/131 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMS 131
           +N+  +VGRL +DP+   T NG++ +  +IA +  +     + E  F  CV ++  A  +N YL KG L  +DG+L  RSY +K+G+ V+V E+V +S++ L  KN+N   ++       T T NN +   + ++
  S:     2 LNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNHYLSKGSLAGVDGRLQSRSYENKDGQRVFVTEVVADSVQFLEPKNNNQQQNNNYHQQRQTQTGNNPFDNTTAIT 136
>gi|148747771|ref|YP_001285850.1| putative ssDNA binding protein [Geobacillus virus E2] >gi|113715713|gb|ABI36862.1| putative ssDNA binding protein [Geobacillus virus E2] >gi|156530369|gb|ABU75286.1| single-stranded DNA binding protein [Geobacillus virus E2] (161 aa)
Score = 177, Expect = 1.3e-11, Identities = 56/175 (32%), Positives = 87/175 (49%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFA-----LNDDEDP 175
           MN+V +VGRL +D +   T NG   +  ++A     ++   + E  F   +AW+ TA  + +Y  KG LVA+DG+L  RSY  K+G+ VYV E+V +S++ L    SNN   +        N K     + ++ +  EA+                 S+  E +   DDPF       NDD+ P
  S:     1 MNRVVLVGRLTKDAELRYTPNGTAVASFTLAVNRPFTNQQGEREVDFISVIAWRKTAENVANYTAKGSLVAVDGRLQTRSY-EKDGRRVYVTEVVADSVQFLGRSGSNNEGKA------QGNGKGAGQQKDASKAAREAL-----------------SRPPETDWGNDDPFGGEPIEFNDDDLP 160
>gi|66394900|ref|YP_239778.1| ORF033 [Staphylococcus phage 85] >gi|66395397|ref|YP_239695.1| ORF030 [Staphylococcus phage 53] >gi|148717859|ref|YP_001285331.1| ssb [Staphylococcus phage 80alpha] >gi|62635747|gb|AAX90858.1| ORF030 [Bacteriophage 53] >gi|62635829|gb|AAX90940.1| ORF033 [Bacteriophage 85] >gi|103058645|gb|ABF71588.1| ssb [Staphylococcus phage 80alpha] (142 aa)
Score = 177, Expect = 1.3e-11, Identities = 44/128 (34%), Positives = 75/128 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQS 128
           +N+  +VGRL +DP+   T NG++ +  +IA +  +     + E  F  CV ++  A  +N+YL KG L  +DG+L  RSY +K+G+ V+V E+V +S++ L  KN+N   ++       T T NN +   +
  S:     2 LNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSRSYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTT 133
>gi|73663681|ref|YP_302462.1| single-strand DNA-binding protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72496196|dbj|BAE19517.1| single-strand DNA-binding protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (170 aa)
Score = 177, Expect = 1.3e-11, Identities = 37/104 (35%), Positives = 67/104 (64%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSN 104
           +N+V +VGRL +DP+   T +G++ +  ++A +  +     + E  F  CV ++  A  +N+YL KG L  +DG++  RSY ++EG+ ++V E+V +S++ L  KN N
  S:     2 INRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRKQAENVNNYLFKGSLAGVDGRIQSRSYENQEGRRIFVTEVVCDSVQFLEPKNQN 109
>gi|66396367|ref|YP_240717.1| ORF035 [Staphylococcus phage 88] >gi|62636782|gb|AAX91893.1| ORF035 [Bacteriophage 88] (141 aa)
Score = 176, Expect = 1.4e-11, Identities = 44/129 (34%), Positives = 76/129 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSN 129
           +N+  +VGRL +DP+   T NG++ +  +IA +  +     + E  F  CV ++  A  +N+YL KG L  +DG+L  RSY +K+G+ V+V E+V +S++ L  KN+N   ++       T T NN +   ++
  S:     2 LNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSRSYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNAD 134
>gi|47092406|ref|ZP_00230196.1| single-strand binding protein subfamily [Listeria monocytogenes str. 4b H7858] >gi|47019183|gb|EAL09926.1| single-strand binding protein subfamily [Listeria monocytogenes str. 4b H7858] (159 aa)
Score = 176, Expect = 1.5e-11, Identities = 50/141 (35%), Positives = 78/141 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNY-NPTNTKNNNYSQQSNMSVSEAMDDFES 141
           MN+V +VGRL +DP+   T  G+  +  ++A +  + N+N   E  F  CV W+  A    ++L KG +  +DG++  R+Y   +GK V+V E+V ES++ L  +N    A+S   NY N  N  NNN +       S+  D F S
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQNGEREADFINCVVWRKPAENAANFLKKGSMAGVDGRIQTRNYEDNDGKRVFVTEVVAESVQFLEPRNHAEGATS--NNYQNEANYSNNNKTSSYRADTSQKSDSFAS 145
>gi|166980836|ref|ZP_02252308.1| single-strand DNA-binding protein [Bacillus cereus AH187] (111 aa)
Score = 176, Expect = 1.6e-11, Identities = 34/101 (33%), Positives = 61/101 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+V ++GRL ++P+ + T+ G+  +R  +A +    ++  + +  F  CV W+ +A  +  Y  KG LV I G++   +Y  ++GK +Y  E+VIESI  L  +
  S:     2 MNRVVLIGRLTKEPELYYTKQGVAYARACVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIQTSNYDDEQGKRIYRTEVVIESITFLERR 106
>gi|171325305|ref|ZP_02913811.1| single-strand binding protein [Geobacillus sp. WCH70] >gi|171088729|gb|EDT35074.1| single-strand binding protein [Geobacillus sp. WCH70] (164 aa)
Score = 175, Expect = 2.1e-11, Identities = 37/103 (35%), Positives = 64/103 (62%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           +N+V +VGRL +DP+   T +G+  +  ++A     ++   + E  F  CV W+  A  + ++L KG L  +DG+L  RSY  ++G+ VYV E+V +S++ L  K+S
  S:     2 INRVILVGRLTRDPELRYTPSGVAVATFTLAVNRPFTNQQGEREADFINCVVWRRQAENVANFLKKGSLAGVDGRLQTRSYEGQDGRRVYVTEVVADSVQFLEPKSS 108
>gi|23100933|ref|NP_694400.1| single-strand DNA-binding protein [Oceanobacillus iheyensis HTE831] >gi|37999427|sp|Q8CX55|SSB_OCEIH Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|22779168|dbj|BAC15434.1| single-strand DNA-binding protein (phage-related protein) [Oceanobacillus iheyensis HTE831] (161 aa)
Score = 175, Expect = 2.1e-11, Identities = 40/109 (36%), Positives = 65/109 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           +N+V +VGRL +DP    T NG+  +  +IA     S+     E  F  CV W+  A  + +Y+ KG +V +DG++  R++  ++GKTVYV E+V +S++ L +K S     S
  S:     2 LNRVVLVGRLTRDPDLRYTPNGVAVANFNIAVNRPFSNQQGNREADFINCVIWRRPAENLANYMKKGSMVGVDGRIQTRNFEGQDGKTVYVTEVVADSVQFLETKGSQGGQDS 114
>gi|27469289|ref|NP_765926.1| single-strand DNA-binding protein of phage phi PVL [Staphylococcus epidermidis ATCC 12228] >gi|57865984|ref|YP_187645.1| single-stranded DNA-binding protein [Staphylococcus epidermidis RP62A] >gi|27316839|gb|AAO06014.1|AE016752_47 single-strand DNA-binding protein of phage phi PVL [Staphylococcus epidermidis ATCC 12228] >gi|57636642|gb|AAW53430.1| single-stranded DNA-binding protein [Staphylococcus epidermidis RP62A] (169 aa)
Score = 175, Expect = 2.2e-11, Identities = 37/113 (32%), Positives = 69/113 (61%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKN 113
           +N+V +VGRL +DP+   T +G++ +  ++A +  +     + E  F  CV ++  A  +N+YL KG L  +DG++  RSY ++EG+ ++V E+V +S++ L  KN+ +       N
  S:     2 LNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQAENVNNYLSKGSLAGVDGRIQSRSYENQEGRRIFVTEVVCDSVQFLEPKNAQHGGQRSQNN 118
>gi|153180345|ref|ZP_01933456.1| hypothetical protein LMMG_02941 [Listeria monocytogenes F6900] >gi|133732087|gb|EBA33785.1| hypothetical protein LMMG_02941 [Listeria monocytogenes F6900] (140 aa)
Score = 174, Expect = 2.8e-11, Identities = 45/134 (33%), Positives = 75/134 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSE 134
           MN+V +VGRL +DP    T  G+  +  ++A +  + N+N   E  F  CV W+  A  + ++L KG +  +DG++  R+Y   +GK V+V E+V ES++ L  KN+N   ++ +   N  N  NNN +       S+
  S:     2 MNRVVLVGRLTKDPDLRYTPAGVAVATFTLAVNRTFTNQNGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEDNDGKRVFVTEVVAESVQFLEPKNNNVEGATSNNYQNKANYSNNNQTSSYRADTSQ 139
>gi|153186937|ref|ZP_01936981.1| single-strand binding protein subfamily [Listeria monocytogenes J0161] >gi|153191855|ref|ZP_01939009.1| hypothetical protein LMPG_02253 [Listeria monocytogenes J2818] >gi|126940877|gb|EBA18789.1| single-strand binding protein subfamily [Listeria monocytogenes J0161] >gi|127764726|gb|EBA25251.1| hypothetical protein LMPG_02253 [Listeria monocytogenes J2818] (160 aa)
Score = 173, Expect = 3.1e-11, Identities = 43/139 (30%), Positives = 73/139 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDF 139
           MN+V +VGRL +DP    T  G   +  ++A     ++   + E  F  CV W+  A  + ++L KG +  +DG++  R+Y   +GK V+V E+V E+++ L  KN+N   ++ +   N  N  N N +       S+  D F
  S:     2 MNRVVLVGRLTKDPDLRYTPAGAAVATFTLAVNRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRIQTRNYEDNDGKRVFVTEVVAETVQFLEPKNNNAEGATSNNYQNQANYSNTNQTSSYRADTSQKSDSF 144
>gi|160916102|ref|ZP_02078309.1| hypothetical protein EUBDOL_02129 [Eubacterium dolichum DSM 3991] >gi|158431826|gb|EDP10115.1| hypothetical protein EUBDOL_02129 [Eubacterium dolichum DSM 3991] (156 aa)
Score = 173, Expect = 3.3e-11, Identities = 51/148 (34%), Positives = 79/148 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETY----FFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTS 148
           +N+V +VGR+ +DP    T +G +    ++A  D   K E      F   VAW  TA+ +  Y HKG LV ++G++  RSY  + GK VYV E+V +S++ L  K S NA  S +  Y P N+   +Y       V++    + S+FA   +
  S:     2 INRVVLVGRMTKDPVLRKTASGASVVSFTVAC-DRRIKTEGQPTADFINTVAWNRTADIVAQYTHKGSLVGVEGRIQTRSYDDQSGKRVYVTEVVADSVQFLEPKGSANANVSTNA-YVPQNSYEPSYE-----PVADTTPSYSSDFASSDT 146
>gi|167215002|ref|ZP_02285309.1| single-strand binding protein [Listeria monocytogenes FSL R2-503] (128 aa)
Score = 173, Expect = 3.5e-11, Identities = 43/122 (35%), Positives = 67/122 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNN 122
           MN+V +VGRL +DP    T  G   +  ++A     ++   + E  F  CV W+  A  + ++L KG +  +DG++  R+Y   +GK VYV EIV ES++ L  K +    S+ + N N  N  NN
  S:     2 MNRVILVGRLTKDPDLRYTPAGAAVATFTLAVNRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEGNDGKRVYVTEIVAESVQFLEPKLNAVEGSTPNNNQNEANYSNN 127
>gi|157325015|ref|YP_001468441.1| gp56 [Listeria phage A500] >gi|66733023|gb|AAY52842.1| gp56 [Listeria phage A500] (160 aa)
Score = 173, Expect = 3.8e-11, Identities = 44/139 (31%), Positives = 72/139 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDF 139
           MN+V +VGRL +DP    T  G   +  ++A +    +   + E  F  CV W+  A    ++L KG +  +DG++  R+Y   +GK V+V E+V E+++ L  KN N   ++ +   N  N  NNN +       S+  D F
  S:     2 MNRVVLVGRLTKDPDLRYTPAGAAVATFTLAVNRPFKNTQGEQEADFINCVVWRKPAENAANFLKKGSMAGVDGRVQTRNYEDSDGKRVFVTEVVAETVQFLEPKNINAEGATSNNYQNQANYSNNNKTSSYRADTSQKSDSF 144
>gi|87162071|ref|YP_494609.1| single-strand binding protein [Staphylococcus aureus subsp. aureus USA300] >gi|161510208|ref|YP_001575867.1| single-stranded DNA-binding protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727615|ref|ZP_02759892.1| single-stranded DNA-binding protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|87128045|gb|ABD22559.1| Single-strand binding protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|160369017|gb|ABX29988.1| single-stranded DNA-binding protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] (156 aa)
Score = 172, Expect = 4.9e-11, Identities = 42/125 (33%), Positives = 71/125 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYS 125
           +N+  +VGRL +DP+   TQNG+  +  ++A +  +     + E  F   + ++  A  +N YL KG L  +DG+L  R+Y +KEG+ VYV E++ +SI+ L  KNSN+    + +         + YS
  S:     2 LNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTRNYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYS 130
>gi|15923356|ref|NP_370890.1| single-strand DNA-binding protein of phage phi PVL [Staphylococcus aureus subsp. aureus Mu50] >gi|15926067|ref|NP_373600.1| single-strand DNA-binding protein of phage phi PVL [Staphylococcus aureus subsp. aureus N315] >gi|21282071|ref|NP_645159.1| single-strand DNA-binding protein of phage phi Sa 2mw [Staphylococcus aureus subsp. aureus MW2] >gi|49482596|ref|YP_039820.1| putative single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|49485246|ref|YP_042467.1| putative single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|57652626|ref|YP_185329.1| single-stranded DNA-binding protein [Staphylococcus aureus subsp. aureus COL] >gi|82750078|ref|YP_415819.1| single-strand DNA-binding protein [Staphylococcus aureus RF122] >gi|87160410|ref|YP_493081.1| single-strand binding protein [Staphylococcus aureus subsp. aureus USA300] >gi|88194148|ref|YP_498938.1| bacteriophage L54a, single-stranded DNA binding protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148266853|ref|YP_001245796.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH9] >gi|150392899|ref|YP_001315574.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH1] >gi|151220570|ref|YP_001331392.1| single-strand DNA-binding family protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|156978694|ref|YP_001440953.1| single-strand DNA-binding protein of phage phi PVL [Staphylococcus aureus subsp. aureus Mu3] >gi|161508638|ref|YP_001574297.1| single-stranded DNA-binding protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168729154|ref|ZP_02761431.1| single-stranded DNA-binding protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|81827919|sp|Q6GCA6|SSB2_STAAS Single-stranded DNA-binding protein 2 (SSB 2) (Helix-destabilizing protein 2) >gi|81859657|sp|Q5HIS8|SSB_STAAC Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|13700280|dbj|BAB41578.1| single-strand DNA-binding protein of phage phi PVL [Staphylococcus aureus subsp. aureus N315] >gi|14246134|dbj|BAB56528.1| single-strand DNA-binding protein of phage phi PVL [Staphylococcus aureus subsp. aureus Mu50] >gi|21203507|dbj|BAB94207.1| single-strand DNA-binding protein of phage phi Sa 2mw [Staphylococcus aureus subsp. aureus MW2] >gi|49240725|emb|CAG39386.1| putative single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|49243689|emb|CAG42113.1| putative single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|57286812|gb|AAW38906.1| single-stranded DNA-binding protein [Staphylococcus aureus subsp. aureus COL] >gi|82655609|emb|CAI80005.1| probable single-strand DNA-binding protein [Staphylococcus aureus RF122] >gi|87126384|gb|ABD20898.1| single-strand binding protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201706|gb|ABD29516.1| bacteriophage L54a, single-stranded DNA binding protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147739922|gb|ABQ48220.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH9] >gi|149945351|gb|ABR51287.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH1] >gi|150373370|dbj|BAF66630.1| single-strand DNA-binding family protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|156720829|dbj|BAF77246.1| single-strand DNA-binding protein of phage phi PVL [Staphylococcus aureus subsp. aureus Mu3] >gi|160367447|gb|ABX28418.1| single-stranded DNA-binding protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] (167 aa)
Score = 171, Expect = 5.4e-11, Identities = 37/103 (35%), Positives = 68/103 (66%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           +N+V +VGRL +DP+   T +G++ +  ++A +  +     + E  F  CV ++  A+ +N+YL KG L  +DG+L  R+Y ++EG+ V+V E+V +S++ L  KN+
  S:     2 LNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSRNYENQEGRRVFVTEVVCDSVQFLEPKNA 108
>gi|16799175|ref|NP_469443.1| hypothetical protein lin0097 [Listeria innocua Clip11262] >gi|37999746|sp|Q92FK7|SSB2_LISIN Single-stranded DNA-binding protein 2 (SSB 2) (Helix-destabilizing protein 2) >gi|16412517|emb|CAC95330.1| lin0097 [Listeria innocua] (159 aa)
Score = 171, Expect = 5.6e-11, Identities = 47/139 (33%), Positives = 73/139 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNY-NPTNTKNNNYSQQSNMSVSEAMDDF 139
           MN+V +VGRL +DP    T  G   +  ++A     ++   + E  F  CV W+  A    ++L KG +  +DG++  R+Y   +GK V+V E+V ES++ L  +N    A+S   NY N  N  NNN +       S+  D F
  S:     2 MNRVVLVGRLTKDPDLRYTPAGAAVATFTLAVNRTFTNQQGEREADFIQCVVWRKPAENAANFLKKGSMAGVDGRIQTRNYEDSDGKRVFVTEVVAESVQFLEPRNHAEGATS--NNYQNEANYSNNNKTSSYRADTSQKSDSF 143
>gi|66395540|ref|YP_239906.1| ORF032 [Staphylococcus phage 42E] >gi|62636033|gb|AAX91144.1| ORF032 [Bacteriophage 42e] (141 aa)
Score = 171, Expect = 6.0e-11, Identities = 43/124 (34%), Positives = 73/124 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNY 124
           +N+  +VGRL +DP+     NG++ +  +IA +  +     + E  F  CV ++  A  +N+YL KG L  +DG+L  RSY +K+G+ V+V E+V +S++ L  KN+N   ++       T T NN +
  S:     2 LNRTVLVGRLTKDPEYRTAPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSRSYENKDGQRVFVTEVVADSVQFLEPKNNNQQQNNNYHQQGQTQTGNNPF 129
>gi|124520273|ref|ZP_01695456.1| single-strand binding protein [Bacillus coagulans 36D1] >gi|124497763|gb|EAY45316.1| single-strand binding protein [Bacillus coagulans 36D1] (164 aa)
Score = 171, Expect = 6.5e-11, Identities = 39/114 (34%), Positives = 70/114 (61%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNY 114
           +N+V +VGRL +DP    T +G+T +  ++A     ++   + E  F  CV W+  A  + +YL KG L  +DG++  R+Y +++G+ VYV E+V +S++ L  +++N    S  +NY
  S:     2 LNRVVLVGRLTKDPDLRYTPSGVTVATFTLAVNRTFTNQQGEREADFINCVVWRKQAENVANYLKKGSLAGVDGRIQTRNYEAQDGRRVYVTEVVADSVQFLEPRSANQERGS-SQNY 118
>gi|171326648|ref|ZP_02915106.1| single-strand binding protein [Geobacillus sp. WCH70] >gi|171087370|gb|EDT33766.1| single-strand binding protein [Geobacillus sp. WCH70] (114 aa)
Score = 169, Expect = 9.3e-11, Identities = 35/103 (33%), Positives = 61/103 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE----TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           +N+V +VGRL +DP+   T +G   + I++A + N+   E    T F  C  W+  A    +Y  KG ++ + G++  R+Y  K+G+ VYV E+V ES++ +  K +
  S:     2 INQVVLVGRLTKDPELRYTADGAAVANITLAVTRNFRNAEGGIDTDFVQCTLWRKVAENTANYCRKGSIIGVMGRIQTRNYEKKDGQRVYVTEVVAESVRFMGGKTN 108
>gi|58336362|ref|YP_192947.1| single-stranded DNA-binding protein [Lactobacillus acidophilus NCFM] >gi|58253679|gb|AAV41916.1| single-stranded DNA-binding protein [Lactobacillus acidophilus NCFM] (172 aa)
Score = 169, Expect = 9.8e-11, Identities = 49/175 (28%), Positives = 90/175 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE----TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETF--KDDPFALNDDEDP 175
           +N+V +VGRL +DP+   T +GI+ +  ++A    +  ++      F  CV W+  A    ++  KG LV IDG++  RSY +K+G+ VYV E+V+++   L S+    A       Y P N   NN          +  ++F++N   + +     +++  ++ F    D   ++DD+ P
  S:     2 INRVVLVGRLTRDPELRTTGSGISVATFTLAVDRQFTNSQGERGADFISCVIWRKAAENFCNFTSKGSLVGIDGRIQTRSYDNKDGQRVYVTEVVVDNFSLLESRKDREARGQ-SGGYTPNNGNINN----------QPANNFQNNGGSQNNPQINNNQSSSQDPFAGSGDTIDISDDDLP 171
>gi|49484225|ref|YP_041449.1| putative single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|118725075|ref|YP_908811.1| putative single-strand DNA-binding protein [Staphylococcus aureus phage phiNM3] >gi|151222121|ref|YP_001332943.1| phage single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|81827983|sp|Q6GF73|SSB_STAAR Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|49242354|emb|CAG41066.1| putative single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|104641840|gb|ABF73182.1| putative single-strand DNA-binding protein [Staphylococcus aureus phage phiNM3] >gi|150374921|dbj|BAF68181.1| phage single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus str. Newman] (156 aa)
Score = 169, Expect = 1.0e-10, Identities = 42/125 (33%), Positives = 71/125 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYS 125
           +N+  +VGRL +DP+   TQ+G+  +  ++A +  +     + E  F   + ++  A  +N YL KG L  +DG+L  R+Y +KEG+ VYV E+V +SI+ L  KNSN+    + +         + YS
  S:     2 LNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTRNYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYS 130
>gi|15924973|ref|NP_372507.1| single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus Mu50] >gi|156980300|ref|YP_001442559.1| single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus Mu3] >gi|37999749|sp|Q931K4|SSB_STAAM Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|14247756|dbj|BAB58145.1| single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus Mu50] >gi|156722435|dbj|BAF78852.1| single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus Mu3] (156 aa)
Score = 168, Expect = 1.3e-10, Identities = 41/125 (32%), Positives = 71/125 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYS 125
           +N+  +VGRL +DP+   TQ+G+  +  ++A +  +     + E  F   + ++  A  +N YL KG L  +DG+L  R+Y +KEG+ VYV E++ +SI+ L  KNSN+    + +         + YS
  S:     2 LNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTRNYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYS 130
>gi|169335535|ref|ZP_02862728.1| hypothetical protein ANASTE_01949 [Anaerofustis stercorihominis DSM 17244] >gi|169258273|gb|EDS72239.1| hypothetical protein ANASTE_01949 [Anaerofustis stercorihominis DSM 17244] (140 aa)
Score = 168, Expect = 1.4e-10, Identities = 43/114 (37%), Positives = 64/114 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE----TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKN----SNNAASSIDKNY 114
           +NKV ++GRL +DP+  V  +G + S  ++A    +   +    T F P VAW  TA     YL KG   A+ G++  RSY + +G   YV E+V E +  L SKN    +NN+  S D  +
  S:     2 LNKVVLIGRLTRDPETRVLTSGSSVSTFTLAVDRTFKSRDGERGTDFIPIVAWGKTAELCGQYLSKGRQTAVAGRIQTRSYDANDGSKRYVTEVVAEEVTFLGSKNDGMRNNNSYKSQDNEF 123
>gi|149918458|ref|ZP_01906948.1| single-strand binding protein [Plesiocystis pacifica SIR-1] >gi|149820758|gb|EDM80168.1| single-strand binding protein [Plesiocystis pacifica SIR-1] (198 aa)
Score = 168, Expect = 1.5e-10, Identities = 40/98 (40%), Positives = 59/98 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN------ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPL 98
           +NKV +VG L +DP+   TQ G   +R+S+A++  W NK       ET +     W  TA   N+YL KG  V ++G+L  RSY  KEG   Y  EI+ ++++ L
  S:     4 INKVILVGNLGRDPELRYTQGGTAVARLSVATTRRWRNKQSNEMVEETEWHRVTVWGQTAEHCNNYLSKGRQVYVEGRLQTRSYDDKEGIKRYSTEIIADTVQFL 108
>gi|192809477|ref|ZP_03038152.1| single-strand binding protein [Geobacillus sp. Y412MC10] >gi|192802148|gb|EDV78653.1| single-strand binding protein [Geobacillus sp. Y412MC10] (164 aa)
Score = 167, Expect = 1.6e-10, Identities = 34/107 (31%), Positives = 63/107 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAA 107
           +N+V ++GRL +DP+   T +G+  ++ ++A     +    + E  F P V W+  A    +YL KG L A++G++  R+Y + EGK VYV E++ ++++ L S    +  
  S:     2 LNRVILIGRLTKDPELRYTPSGVAVTQFTLAVDRPFTGQGGEREADFIPVVTWRQLAETCANYLRKGRLTAVEGRIQVRNYENNEGKRVYVTEVIADNVRFLESNRETSGG 112
>gi|169187394|ref|ZP_02847553.1| single-strand binding protein [Paenibacillus sp. JDR-2] >gi|169005403|gb|EDS52255.1| single-strand binding protein [Paenibacillus sp. JDR-2] (176 aa)
Score = 167, Expect = 1.6e-10, Identities = 36/106 (33%), Positives = 62/106 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNA 106
           +N+V ++GRL +DP+   T  G+  ++ +IA     +    + E  F P V W+  A    +YL KG L A++G++  R+Y + EGK VYV E++ ++++ L S     A
  S:     2 LNRVILIGRLTRDPELRYTPAGVAVTQFTIAVDRPFTSGQGEREADFIPVVTWRQLAETCANYLRKGRLTAVEGRIQVRNYENNEGKRVYVTEVIADNVRFLESNREGGA 111
>gi|15927558|ref|NP_375091.1| single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus N315] >gi|30043970|ref|NP_835537.1| single-strand DNA-binding protein [Staphylococcus phage phiN315] >gi|148266761|ref|YP_001245704.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH9] >gi|148268456|ref|YP_001247399.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH9] >gi|150392805|ref|YP_001315480.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH1] >gi|150394518|ref|YP_001317193.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH1] >gi|37999457|sp|Q99SQ9|SSB_STAAN Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|13701777|dbj|BAB43070.1| single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus N315] >gi|147739830|gb|ABQ48128.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH9] >gi|147741525|gb|ABQ49823.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH9] >gi|149945257|gb|ABR51193.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH1] >gi|149946970|gb|ABR52906.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH1] (156 aa)
Score = 167, Expect = 1.6e-10, Identities = 41/125 (32%), Positives = 71/125 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYS 125
           +N+  +VGRL +DP+   TQ+G+  +  ++A +  +     + E  F   + ++  A  +N YL KG L  +DG+L  R+Y +KEG+ VYV E++ +SI+ L  KNSN+    + +         + YS
  S:     2 LNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTRNYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYS 130
>gi|89095672|ref|ZP_01168566.1| hypothetical protein B14911_03044 [Bacillus sp. NRRL B-14911] >gi|89089418|gb|EAR68525.1| hypothetical protein B14911_03044 [Bacillus sp. NRRL B-14911] (121 aa)
Score = 167, Expect = 1.7e-10, Identities = 35/109 (32%), Positives = 63/109 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           +N+  +VGRL ++P+  +T  G++ + I++A +  +       E  F  C  W+ TA     Y  KG L+ I G++  R+Y +++G+ VYV E++ E+++ L  K    A SS
  S:     2 INQAILVGRLTRNPELKITAEGVSVTNITLAVNRQYRNQQGEIEADFVQCTLWKKTAENTAQYCRKGSLIGITGRIQTRNYDNQDGRKVYVTEVIAETVRFLEPKREIAAGSS 114
>gi|158319095|ref|YP_001511602.1| single-strand binding protein [Alkaliphilus oremlandii OhILAs] >gi|158139294|gb|ABW17606.1| single-strand binding protein [Alkaliphilus oremlandii OhILAs] (137 aa)
Score = 167, Expect = 1.7e-10, Identities = 46/140 (32%), Positives = 76/140 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK-NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFE 140
           MN+V ++GRLA+DP+   T +G   +  SIA +  ++K  E  FF  V W  +A    +YL KG LV ++G+L  RSY ++ G+  Y+ E++ + ++ L   N         +   PT   ++  S   ++S  +AMDD E
  S:     1 MNRVILIGRLARDPELRFTASGKAVATFSIAVNRPFSKEKEADFFNIVVWGKSAENCANYLSKGRLVGLEGRLQSRSYETQTGEKRYITEVIADQVEFLEWGNK--------EGQTPTRRNDDFGSVDIDISEFQAMDDDE 133
>gi|9635210|ref|NP_058484.1| ssDNA binding protein [Staphylococcus phage PVL] >gi|156603906|ref|YP_001429853.1| ss-DNA-binding protein [Staphylococcus phage tp310-1] >gi|3341953|dbj|BAA31919.1| ssDNA binding protein [Staphylococcus phage PVL] >gi|154817992|gb|ABS87420.1| ss-DNA-binding protein [Staphylococcus phage tp310-1] (156 aa)
Score = 167, Expect = 1.8e-10, Identities = 41/125 (32%), Positives = 71/125 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYS 125
           +N+  +VGRL +DP+   TQ+G+  +  ++A +  +     + E  F   + ++  A  +N YL KG L  +DG+L  R+Y +KEG+ VYV E++ +SI+ L  KNSN+    + +         + YS
  S:     2 INRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTRNYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYS 130
>gi|89098225|ref|ZP_01171110.1| hypothetical protein B14911_10702 [Bacillus sp. NRRL B-14911] >gi|89087082|gb|EAR66198.1| hypothetical protein B14911_10702 [Bacillus sp. NRRL B-14911] (149 aa)
Score = 166, Expect = 1.9e-10, Identities = 43/125 (34%), Positives = 71/125 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPT----NTKNNNYS 125
           MN V +VGRL +DP    T NG+  +  ++A +  +     + ET +  CV W++ A  + ++L KG L  +DG +  R+Y  ++GK VYV E++   ++ L SK +N +        N T    N+ NN Y+
  S:     1 MNMVTLVGRLTKDPVLRYTPNGVPVASFTLAVNRTFTNQSGERETDYINCVVWRTPAENVANFLKKGSLAGVDGSIQTRTYEGQDGKLVYVTEVIARYVQFLDSKKNNQSQEQRRPESNNTPSGRNSNNNPYA 133
>gi|15677316|ref|NP_274471.1| single-stranded binding protein [Neisseria meningitidis MC58] >gi|15794566|ref|NP_284388.1| single-stranded binding protein [Neisseria meningitidis Z2491] >gi|121635146|ref|YP_975391.1| single-stranded binding protein [Neisseria meningitidis FAM18] >gi|54039620|sp|P66849|SSB_NEIMB Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|54042010|sp|P66848|SSB_NEIMA Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|7226702|gb|AAF41819.1| single-strand binding protein [Neisseria meningitidis MC58] >gi|120866852|emb|CAM10611.1| single-stranded binding protein [Neisseria meningitidis FAM18] >gi|121052468|emb|CAM08805.1| single-stranded binding protein [Neisseria meningitidis Z2491] (174 aa)
Score = 166, Expect = 2.0e-10, Identities = 40/135 (29%), Positives = 66/135 (48%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEA 135
           +NKV ++GRL +DP+     NG      S+A+S+ WN         T +     ++  A     YL KG LV ++G++  R Y  K+G      +IV   +K L  +N N+  +  ++ Y  +       +QQS    S+A
  S:     3 LNKVILIGRLGRDPEVRYMPNGEAVCNFSVATSETWNDRNGQRVERTEWHNITMYRKLAEIAGQYLKKGGLVYLEGRIQSRKYQGKDGIERTAYDIVANEMKMLGGRNENSGGAPYEEGYGQSQEAYQRPAQQSRQPASDA 143
>gi|59801407|ref|YP_208119.1| putative single-stranded DNA binding protein [Neisseria gonorrhoeae FA 1090] >gi|59718302|gb|AAW89707.1| putative single-stranded DNA binding protein [Neisseria gonorrhoeae FA 1090] (174 aa)
Score = 166, Expect = 2.0e-10, Identities = 40/135 (29%), Positives = 65/135 (48%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEA 135
           +NKV ++GRL +DP+     NG      S+A+S+ WN         T +     ++  A     YL KG LV ++G++  R Y  K+G      +IV   +K L  +N N+  +  D+ Y  +       +QQS     +A
  S:     3 LNKVILIGRLGRDPEVRYMPNGEAVCNFSVATSETWNDRNGQRVERTEWHNITMYRKLAEIAGQYLKKGGLVYLEGRIQSRKYQGKDGIERTAYDIVANEMKMLGGRNENSGGAPYDEGYGQSQEAYQRPAQQSRQPAPDA 143
>gi|153176213|ref|ZP_01931472.1| single-strand binding protein [Listeria monocytogenes FSL N3-165] >gi|133728926|gb|EBA30624.1| single-strand binding protein [Listeria monocytogenes FSL N3-165] (178 aa)
Score = 166, Expect = 2.1e-10, Identities = 36/101 (35%), Positives = 60/101 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+V +VGRL +DP+   T  G+  +  ++A     ++   + E  F  CV W+  A  + ++L KG +  +DG++  R+Y   +GK VYV EIV ES++ L  +
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEGNDGKRVYVTEIVAESVQFLEPR 106
>gi|16799117|ref|NP_469385.1| hypothetical protein lin0038 [Listeria innocua Clip11262] >gi|37999747|sp|Q92FR5|SSB1_LISIN Single-stranded DNA-binding protein 1 (SSB 1) (Helix-destabilizing protein 1) >gi|16412459|emb|CAC95271.1| ssb [Listeria innocua] (179 aa)
Score = 166, Expect = 2.1e-10, Identities = 36/101 (35%), Positives = 60/101 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+V +VGRL +DP+   T  G+  +  ++A     ++   + E  F  CV W+  A  + ++L KG +  +DG++  R+Y   +GK VYV EIV ES++ L  +
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEGNDGKRVYVTEIVAESVQFLEPR 106
>gi|16802093|ref|NP_463578.1| hypothetical protein lmo0045 [Listeria monocytogenes EGD-e] >gi|46906276|ref|YP_012665.1| single-strand binding protein [Listeria monocytogenes str. 4b F2365] >gi|47092170|ref|ZP_00229962.1| single-strand binding protein [Listeria monocytogenes str. 4b H7858] >gi|47095113|ref|ZP_00232725.1| single-strand binding protein [Listeria monocytogenes str. 1/2a F6854] >gi|153164870|ref|ZP_01926045.1| single-strand binding protein [Listeria monocytogenes FSL N1-017] >gi|153181077|ref|ZP_01934044.1| single-strand binding protein [Listeria monocytogenes F6900] >gi|153184404|ref|ZP_01935163.1| single-strand binding protein [Listeria monocytogenes J0161] >gi|153192688|ref|ZP_01939648.1| single-strand binding protein [Listeria monocytogenes J2818] >gi|153198011|ref|ZP_01942181.1| single-strand binding protein [Listeria monocytogenes 10403S] >gi|153200433|ref|ZP_01942595.1| single-strand binding protein [Listeria monocytogenes HPB2262] >gi|167015970|ref|ZP_02278503.1| single-strand binding protein [Listeria monocytogenes FSL J1-194] >gi|167211120|ref|ZP_02281427.1| single-strand binding protein [Listeria monocytogenes LO28] >gi|167215496|ref|ZP_02285803.1| single-strand binding protein [Listeria monocytogenes FSL R2-503] >gi|167216356|ref|ZP_02285992.1| single-strand binding protein [Listeria monocytogenes FSL J1-175] >gi|167342421|ref|ZP_02288351.1| single-strand binding protein [Listeria monocytogenes FSL J1-208] >gi|167403225|ref|ZP_02308060.1| single-strand binding protein [Listeria monocytogenes FSL J2-003] >gi|167452781|ref|ZP_02319004.1| single-strand binding protein [Listeria monocytogenes FSL J2-064] >gi|168267080|ref|ZP_02689045.1| single-strand binding protein [Listeria monocytogenes FSL J2-071] >gi|37999735|sp|Q8YAR8|SSB1_LISMO Single-stranded DNA-binding protein 1 (SSB 1) (Helix-destabilizing protein 1) >gi|16409404|emb|CAC98260.1| ssb [Listeria monocytogenes] >gi|46879540|gb|AAT02842.1| single-strand binding protein [Listeria monocytogenes str. 4b F2365] >gi|47016458|gb|EAL07379.1| single-strand binding protein [Listeria monocytogenes str. 1/2a F6854] >gi|47019372|gb|EAL10113.1| single-strand binding protein [Listeria monocytogenes str. 4b H7858] >gi|126942907|gb|EBA20641.1| single-strand binding protein [Listeria monocytogenes J0161] >gi|127632347|gb|EBA22029.1| single-strand binding protein [Listeria monocytogenes 10403S] >gi|127763725|gb|EBA24559.1| single-strand binding protein [Listeria monocytogenes J2818] >gi|133728570|gb|EBA30268.1| single-strand binding protein [Listeria monocytogenes FSL N1-017] >gi|133731595|gb|EBA33293.1| single-strand binding protein [Listeria monocytogenes F6900] >gi|133736711|gb|EBA38409.1| single-strand binding protein [Listeria monocytogenes HPB2262] (178 aa)
Score = 166, Expect = 2.1e-10, Identities = 36/101 (35%), Positives = 60/101 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+V +VGRL +DP+   T  G+  +  ++A     ++   + E  F  CV W+  A  + ++L KG +  +DG++  R+Y   +GK VYV EIV ES++ L  +
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEGNDGKRVYVTEIVAESVQFLEPR 106
>gi|18311623|ref|NP_563557.1| phage-related single-strand DNA-binding protein [Clostridium perfringens str. 13] >gi|110800412|ref|YP_697331.1| single-strand binding protein [Clostridium perfringens ATCC 13124] >gi|110801910|ref|YP_699890.1| single-strand binding protein [Clostridium perfringens SM101] >gi|168211573|ref|ZP_02637198.1| single-strand binding protein [Clostridium perfringens B str. ATCC 3626] >gi|168214827|ref|ZP_02640452.1| single-strand binding protein [Clostridium perfringens CPE str. F4969] >gi|168218035|ref|ZP_02643660.1| single-strand binding protein [Clostridium perfringens NCTC 8239] >gi|169343467|ref|ZP_02864467.1| single-strand binding protein [Clostridium perfringens C str. JGS1495] >gi|182626390|ref|ZP_02954143.1| single-strand binding protein [Clostridium perfringens D str. JGS1721] >gi|37999449|sp|Q8XH44|SSB_CLOPE Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|18146307|dbj|BAB82347.1| probable phage-related single-strand DNA-binding protein [Clostridium perfringens str. 13] >gi|110675059|gb|ABG84046.1| single-strand binding protein [Clostridium perfringens ATCC 13124] >gi|110682411|gb|ABG85781.1| single-strand binding protein [Clostridium perfringens SM101] >gi|169298419|gb|EDS80508.1| single-strand binding protein [Clostridium perfringens C str. JGS1495] >gi|170710461|gb|EDT22643.1| single-strand binding protein [Clostridium perfringens B str. ATCC 3626] >gi|170713736|gb|EDT25918.1| single-strand binding protein [Clostridium perfringens CPE str. F4969] >gi|177908264|gb|EDT70817.1| single-strand binding protein [Clostridium perfringens D str. JGS1721] >gi|182379919|gb|EDT77398.1| single-strand binding protein [Clostridium perfringens NCTC 8239] (150 aa)
Score = 166, Expect = 2.1e-10, Identities = 35/109 (32%), Positives = 61/109 (55%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           MNKV ++GRL +DP+ +F   +G   +R ++A +  + K+E  F  C+A+  T   I  Y+ KG  +A+ G +   SY +++G   Y  ++V+ES   + S N     +S
  S:     1 MNKVVLIGRLTKDPELRFAAGSGTAVARFTLAVNRQFKKDEADFISCIAFGKTGETIAQYITKGRQLAVSGNIRTGSYEAQDGTRRYTTDVVVESFDFIDSGNGGARGNS 110
>gi|88804216|ref|ZP_01119736.1| Single-strand binding protein [Robiginitalea biformata HTCC2501] >gi|88785095|gb|EAR16264.1| Single-strand binding protein [Robiginitalea biformata HTCC2501] (110 aa)
Score = 165, Expect = 2.6e-10, Identities = 36/89 (40%), Positives = 56/89 (62%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEI 90
           NKV ++G L QDP+  V   G   +R S+A+++ +         +T +   VAW   A+ + SYL+KG  VA++GKLI R Y ++EG+  YV E+
  S:     6 NKVQLIGNLGQDPEVTVLDGGGKMARFSLATNEIYKNAQGEKVTDTQWHQVVAWGKIADIVESYLNKGKEVAVEGKLIHRHYDTEEGQRKYVTEV 100
>gi|116871458|ref|YP_848239.1| single-strand binding protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116740336|emb|CAK19454.1| ssb [Listeria welshimeri serovar 6b str. SLCC5334] (177 aa)
Score = 165, Expect = 2.8e-10, Identities = 36/101 (35%), Positives = 60/101 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN+V +VGRL +DP+   T  G+  +  ++A     ++   + E  F  CV W+  A  + ++L KG +  +DG++  R+Y   +GK VYV EIV ES++ L  +
  S:     2 MNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEGNDGKRVYVTEIVAESVQFLEPR 106
>gi|66395761|ref|YP_240126.1| ORF034 [Staphylococcus phage 37] >gi|62636184|gb|AAX91295.1| ORF034 [Bacteriophage 37] (148 aa)
Score = 165, Expect = 3.1e-10, Identities = 36/103 (34%), Positives = 67/103 (65%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           +N+V +VGRL +DP+   T +G++ +  ++A +  +     + E  F  CV ++  A  +++YL KG L  +DG+L  RSY ++EG+ ++V E+V +S++ L  KN+
  S:     2 INRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRKQAENVSNYLFKGSLAGVDGRLQSRSYENQEGRRIFVTEVVCDSVQFLEPKNA 108
>gi|194098322|ref|YP_002001380.1| putative single-stranded DNA binding protein [Neisseria gonorrhoeae NCCP11945] >gi|193933612|gb|ACF29436.1| putative single-stranded DNA binding protein [Neisseria gonorrhoeae NCCP11945] (174 aa)
Score = 164, Expect = 3.5e-10, Identities = 40/135 (29%), Positives = 64/135 (47%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEA 135
           +NKV ++GRL +DP+     NG      S+A+S+ WN         T +     ++  A     YL KG LV ++G++  R Y  K+G      +IV   +K L  +N N+  +  D+ Y          +QQS     +A
  S:     3 LNKVILIGRLGRDPEVRYMPNGEAVCNFSVATSETWNDRNGQRVERTEWHNITMYRKLAEIAGQYLKKGGLVYLEGRIQSRKYQGKDGIERTAYDIVANEMKMLGGRNENSGGAPYDEGYGQNQEAYQRPAQQSRQPAPDA 143
>gi|148381564|ref|YP_001256105.1| single-strand binding protein [Clostridium botulinum A str. ATCC 3502] >gi|153930842|ref|YP_001385941.1| single-strand binding protein [Clostridium botulinum A str. ATCC 19397] >gi|153939968|ref|YP_001392983.1| single-strand binding protein [Clostridium botulinum F str. Langeland] >gi|168181094|ref|ZP_02615758.1| single-strand binding protein [Clostridium botulinum NCTC 2916] >gi|170755652|ref|YP_001783262.1| single-strand binding protein [Clostridium botulinum B1 str. Okra] >gi|170759014|ref|YP_001788969.1| single-strand binding protein [Clostridium botulinum A3 str. Loch Maree] >gi|187777389|ref|ZP_02993862.1| hypothetical protein CLOSPO_00945 [Clostridium sporogenes ATCC 15579] >gi|148291048|emb|CAL85185.1| single-strand binding protein [Clostridium botulinum A str. ATCC 3502] >gi|152926886|gb|ABS32386.1| single-strand binding protein [Clostridium botulinum A str. ATCC 19397] >gi|152935864|gb|ABS41362.1| single-strand binding protein [Clostridium botulinum F str. Langeland] >gi|169120864|gb|ACA44700.1| single-strand binding protein [Clostridium botulinum B1 str. Okra] >gi|169406003|gb|ACA54414.1| single-strand binding protein [Clostridium botulinum A3 str. Loch Maree] >gi|182668070|gb|EDT80049.1| single-strand binding protein [Clostridium botulinum NCTC 2916] >gi|187774317|gb|EDU38119.1| hypothetical protein CLOSPO_00945 [Clostridium sporogenes ATCC 15579] (148 aa)
Score = 164, Expect = 3.8e-10, Identities = 39/117 (33%), Positives = 64/117 (54%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPT 117
           MNKV ++GRL +DP+ +F   NG   +  ++A    ++K+   E  F P V W   A    +Y+ KG L+ + G++  RSY +K+G   YV E++ E +K L   N     S+ +    P+
  S:     1 MNKVVLIGRLTKDPELKFTPGNGTAVATFTLAVDRRFSKDGQREADFIPIVVWGKQAESTANYMSKGKLMGVSGRIQTRSYEAKDGTRRYVTEVIAEEVKFLEWGNKPTTDSTYNNGSEPS 121
>gi|153935512|ref|YP_001389348.1| single-strand binding protein [Clostridium botulinum A str. Hall] >gi|152931426|gb|ABS36925.1| single-strand binding protein [Clostridium botulinum A str. Hall] (148 aa)
Score = 164, Expect = 4.0e-10, Identities = 39/117 (33%), Positives = 64/117 (54%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPT 117
           MNKV ++GRL +DP+ +F   NG   +  ++A    ++K+   E  F P V W   A    +Y+ KG L+ + G++  RSY +K+G   YV E++ E +K L   N     S+ +    P+
  S:     1 MNKVVLIGRLTKDPELKFTPGNGTAVTTFTLAVDRRFSKDGQREADFIPIVVWGKQAESTANYMSKGKLMGVSGRIQTRSYEAKDGTRRYVTEVIAEEVKFLEWGNKPTTDSTYNNGSEPS 121
>gi|168183705|ref|ZP_02618369.1| single-strand binding protein [Clostridium botulinum Bf] >gi|182673193|gb|EDT85154.1| single-strand binding protein [Clostridium botulinum Bf] (148 aa)
Score = 163, Expect = 4.3e-10, Identities = 39/117 (33%), Positives = 64/117 (54%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPT 117
           MNKV ++GRL +DP+ +F   NG   +  ++A    ++K+   E  F P V W   A    +Y+ KG L+ + G++  RSY +K+G   YV E++ E +K L   N     S+ +    P+
  S:     1 MNKVVLIGRLTKDPELKFTPGNGTAVATFTLAVDRRFSKDGQREADFIPIVVWGKQAESTANYMSKGKLMGVSGRIQTRSYEAKDGTRRYVTEVIAEEVKFLEWGNKPTTDSTYNNGSEPS 121
>gi|160934673|ref|ZP_02082059.1| hypothetical protein CLOLEP_03546 [Clostridium leptum DSM 753] >gi|156866126|gb|EDO59498.1| hypothetical protein CLOLEP_03546 [Clostridium leptum DSM 753] (150 aa)
Score = 163, Expect = 4.4e-10, Identities = 40/109 (36%), Positives = 61/109 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           +N++ I GRL  DP+   TQ+ I+ +  SIA   N+     + ET FF   AW+STA F+  Y  KG L+ +DG+L  R Y  K+G     IEI  +++    SK +   + +
  S:     2 LNRITITGRLTHDPELRTTQSNISVTSFSIACQRNFKNGNGERETDFFDVTAWRSTAEFVTRYFSKGSLITVDGRLESRKYTDKDGNNRVAIEIKADNVYFGESKENKETSQT 114
>gi|42518092|ref|NP_964022.1| single-strand binding protein [Lactobacillus johnsonii NCC 533] >gi|41582376|gb|AAS07988.1| single-strand binding protein [Lactobacillus johnsonii NCC 533] (172 aa)
Score = 163, Expect = 4.6e-10, Identities = 48/156 (30%), Positives = 81/156 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE----TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTN---TKNNNYSQQSNMSVSEAMDDFESN-----FAQKTSSTNITSKN 156
           +N V +VGRL +DP    T +GI+ +  ++A    +  ++      F  CV W+  A    ++  KG LV I G++  R+Y  K+GK VYV E+++++   L S+       +   N+ P        NN+   S  S++ A    ESN     FA   S+ +I+  +
  S:     2 INNVVLVGRLTRDPDLRTTGSGISVATFTLAVDRQYTNSQGERGADFISCVIWRKAAENFANFTSKGSLVGIQGRIQTRTYDDKDGKRVYVTEVIVDNFSLLESRRDRENRQTNGGNFAPQGGNAPSTNNFGGSSAPSMNNAPASGESNKPQDPFADSGSTIDISDDD 169
>gi|18309269|ref|NP_561203.1| phage-related single-strand DNA binding protein [Clostridium perfringens str. 13] >gi|110800314|ref|YP_694743.1| single-strand DNA-binding protein [Clostridium perfringens ATCC 13124] >gi|110803675|ref|YP_697604.1| single-strand binding protein family [Clostridium perfringens SM101] >gi|168207451|ref|ZP_02633456.1| single-strand DNA-binding protein [Clostridium perfringens E str. JGS1987] >gi|168210400|ref|ZP_02636025.1| single-strand DNA-binding protein [Clostridium perfringens B str. ATCC 3626] >gi|168212794|ref|ZP_02638419.1| single-strand DNA-binding protein [Clostridium perfringens CPE str. F4969] >gi|168216624|ref|ZP_02642249.1| single-strand DNA-binding protein [Clostridium perfringens NCTC 8239] >gi|169344094|ref|ZP_02865080.1| single-strand DNA-binding protein [Clostridium perfringens C str. JGS1495] >gi|182626831|ref|ZP_02954568.1| single-strand DNA-binding protein [Clostridium perfringens D str. JGS1721] >gi|18143945|dbj|BAB79993.1| probable phage-related single-strand DNA binding protein [Clostridium perfringens str. 13] >gi|110674961|gb|ABG83948.1| single-strand DNA-binding protein [Clostridium perfringens ATCC 13124] >gi|110684176|gb|ABG87546.1| Single-strand binding protein family [Clostridium perfringens SM101] >gi|169297829|gb|EDS79926.1| single-strand DNA-binding protein [Clostridium perfringens C str. JGS1495] >gi|170661204|gb|EDT13887.1| single-strand DNA-binding protein [Clostridium perfringens E str. JGS1987] >gi|170711470|gb|EDT23652.1| single-strand DNA-binding protein [Clostridium perfringens B str. ATCC 3626] >gi|170715725|gb|EDT27907.1| single-strand DNA-binding protein [Clostridium perfringens CPE str. F4969] >gi|177907840|gb|EDT70440.1| single-strand DNA-binding protein [Clostridium perfringens D str. JGS1721] >gi|182381428|gb|EDT78907.1| single-strand DNA-binding protein [Clostridium perfringens NCTC 8239] (114 aa)
Score = 163, Expect = 4.6e-10, Identities = 34/96 (35%), Positives = 59/96 (61%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNKN----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIK 96
           MNK+ ++GRL +DP+ ++V       ++ +IA + N+  +    +  F P + W+  A     YL KGDL+++ G+LI RS+   EGK  Y++E+ +E  K
  S:     1 MNKIVLLGRLVKDPELRYVEGGEKVYTKFTIAVARNFKSSTGERKKDFIPIIMWEKKAEIACKYLKKGDLLSVSGRLITRSFEDTEGKRRYIVEVSVEDFK 101
>gi|70726793|ref|YP_253707.1| single strand DNA binding protein [Staphylococcus haemolyticus JCSC1435] >gi|68447517|dbj|BAE05101.1| single strand DNA binding protein [Staphylococcus haemolyticus JCSC1435] (142 aa)
Score = 163, Expect = 5.2e-10, Identities = 43/131 (32%), Positives = 78/131 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMS 131
           +N+V +VGRL +DP+   TQ+G+  +  ++A +  +     + E  F   V ++  A+ +N+YL KG+L  +DG++  RSY +KEG+ V+V E+V +S++ L  KN+N   S   +      + NN +    ++S
  S:     2 INRVILVGRLTKDPEFRTTQSGVNVATFTLAVNRTFTNAQGEREADFINIVVFRKQADNVNNYLKKGNLADVDGRIQSRSYENKEGQRVFVTEVVADSVQFLEPKNNNQQNSQPQQQRGQAQSGNNPFGNGPDIS 136
>gi|169635858|dbj|BAG12393.1| hypothetical protein [Enterococcus faecalis] (150 aa)
Score = 163, Expect = 5.3e-10, Identities = 41/126 (32%), Positives = 70/126 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQ 126
           +N V +VGRL +D     T NG+  +  ++A + N+ N+N   E  +  CV W+  A  + +Y  KG L+ + G+L  R+Y +++G+ +YV E+V+ES + L SK  +        N  P   + +N  Q
  S:     2 INNVTLVGRLTKDCDLRYTSNGVAVAAFTLAVNRNFTNQNGEREADYIQCVIWRKPAETLANYTRKGTLIGLVGRLQTRNYENQQGQRIYVTEVVVESFQLLESKEVSQQRGVNASNPTPVGQQESNTQQ 131
>gi|66396439|ref|YP_240791.1| ORF033 [Staphylococcus phage 92] >gi|62636853|gb|AAX91964.1| ORF033 [Bacteriophage 92] (140 aa)
Score = 163, Expect = 5.4e-10, Identities = 37/101 (36%), Positives = 63/101 (62%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +N+V +VGRL +DP+     NG++ +  +IA +  +     + E  F  CV ++  A  + +YL KG L  +DG+L  R+Y +K+G+ VYV E+V +S++ L  K
  S:     2 LNRVVLVGRLTKDPEYRTAPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVKNYLSKGSLAGVDGRLQTRNYENKDGQRVYVTEVVADSVQFLEPK 106
>gi|167771964|ref|ZP_02444017.1| hypothetical protein ANACOL_03337 [Anaerotruncus colihominis DSM 17241] >gi|167665762|gb|EDS09892.1| hypothetical protein ANACOL_03337 [Anaerotruncus colihominis DSM 17241] (138 aa)
Score = 162, Expect = 5.8e-10, Identities = 41/117 (35%), Positives = 60/117 (51%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTN 118
           N V I+GRL  DP+   T +G+  +  S+A          ++   FF  VAW+ TA     YL KG LV ++G+L  R +V+ +G   +V+EIV  +I    SK S +A         P N
  S:     3 NHVGIMGRLTADPELRQTVSGLAVTSFSLACQRGRKGPNGESAADFFTVVAWRGTAELAAKYLTKGRLVVVEGRLQTRKWVADDGTNRHVVEIVASAIHFADSKKSESAGDPPTPQGGPVN 123
>gi|21283650|ref|NP_646738.1| single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus MW2] >gi|49486796|ref|YP_044017.1| putative single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|37999443|sp|Q8NVN2|SSB_STAAW Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|81827821|sp|Q6G7V6|SSB1_STAAS Single-stranded DNA-binding protein 1 (SSB 1) (Helix-destabilizing protein 1) >gi|21205091|dbj|BAB95786.1| single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus MW2] >gi|49245239|emb|CAG43711.1| putative single-strand DNA-binding protein [Staphylococcus aureus subsp. aureus MSSA476] (156 aa)
Score = 162, Expect = 6.3e-10, Identities = 38/105 (36%), Positives = 66/105 (62%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNN 105
           +N+  +VGRL +DP+   TQ+G+  +  ++A +  +     + E  F   + ++  A  +N YL KG L  +DG+L  R+Y +KEG+ VYV E+V +SI+ L  KN+++
  S:     2 LNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTRNYENKEGQRVYVTEVVADSIQFLEPKNTDD 110
>gi|161870329|ref|YP_001599499.1| single-stranded binding protein [Neisseria meningitidis 053442] >gi|161595882|gb|ABX73542.1| single-stranded binding protein [Neisseria meningitidis 053442] (174 aa)
Score = 162, Expect = 6.3e-10, Identities = 39/135 (28%), Positives = 65/135 (48%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEA 135
           +NKV ++GRL +DP+     NG      S+A+S+ WN         T +     ++  A     YL KG LV ++G++  R Y  K+G      +IV   +K L  +N N+  +  ++ Y  +       +QQS     +A
  S:     3 LNKVILIGRLGRDPEVRYMPNGEAVCNFSVATSETWNDRNGQRVERTEWHNITMYRKLAEIAGQYLKKGGLVYLEGRIQSRKYQGKDGIERTAYDIVANEMKMLGGRNENSGGAPYEEGYGQSQEAYQRPAQQSRQPAPDA 143
>gi|167462796|ref|ZP_02327885.1| single-strand DNA-binding protein [Paenibacillus larvae subsp. larvae BRL-230010] (155 aa)
Score = 162, Expect = 6.4e-10, Identities = 37/105 (35%), Positives = 65/105 (61%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-----NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNN 105
           +N+V ++GRL +DP+   T +G+  ++ ++A    +      + ET F   V W+  A    +YL KG L A++G++  R+Y + EG+ VYV EIV ++++ L S N+ N
  S:     2 LNRVILIGRLTRDPELRYTPSGVAVTQFTLAVDRPYMNQQTRERETDFINIVTWRQLAETCANYLRKGRLTAVEGRIQVRNYENNEGRKVYVTEIVADNVRFLESNNAGN 111
>gi|184155145|ref|YP_001843485.1| single-strand binding protein [Lactobacillus fermentum IFO 3956] >gi|183226489|dbj|BAG27005.1| single-strand binding protein [Lactobacillus fermentum IFO 3956] (173 aa)
Score = 162, Expect = 6.8e-10, Identities = 42/130 (32%), Positives = 68/130 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNM 130
           +N+V + GRL +D +   TQNG   +R ++A S  +      + ET F  C  W+  A  +  Y  KG L+ +DG++    Y  ++GK VY  ++ I+S   LS +N++   S    NY   N   N   +Q N+
  S:     2 INRVVLTGRLTKDLELKYTQNGTAVARFTLAVSRQYKNKQTGERETDFISCEVWRQPAENLAKYAGKGSLIGVDGRIQTSHYTDRDGKEVYRTDVRIDSFALLSYRNNDANQSEQTGNYQ-ANVNFNAPQEQPNL 135
>gi|116628691|ref|YP_813863.1| single-stranded DNA-binding protein [Lactobacillus gasseri ATCC 33323] >gi|116094273|gb|ABJ59425.1| Single-stranded DNA-binding protein [Lactobacillus gasseri ATCC 33323] (172 aa)
Score = 162, Expect = 6.9e-10, Identities = 48/156 (30%), Positives = 80/156 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE----TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTN---TKNNNYSQQSNMSVSEAMDDFESN-----FAQKTSSTNITSKN 156
           +N V +VGRL +DP    T +GI+ +  ++A    +  ++      F  CV W+  A    ++  KG LV I G++  R+Y  K+GK VYV E+++++   L S+       +   N+ P        NN+   S  S + A    ESN     FA   S+ +I+  +
  S:     2 INNVVLVGRLTRDPDLRTTGSGISVATFTLAVDRQYTNSQGERGADFVSCVIWRKAAENFANFTSKGSLVGIQGRIQTRTYDDKDGKRVYVTEVIVDNFSLLESRRDRENRQTNGGNFAPQGGNAPSTNNFGGSSAPSTNNAPAGGESNKPQDPFADSGSTIDISDDD 169
>gi|138896484|ref|YP_001126937.1| single-strand DNA binding protein [Geobacillus thermodenitrificans NG80-2] >gi|134267997|gb|ABO68192.1| Single-strand DNA binding protein [Geobacillus thermodenitrificans NG80-2] (165 aa)
Score = 161, Expect = 7.5e-10, Identities = 55/175 (31%), Positives = 90/175 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFA-------LNDDEDP 175
           +N+V + GRL  DPQ   T +G+     ++A +  + N+N   E  F  CVAW+  A  I +YL KG +V IDG+L   SY  + G+ VY  ++V+++   L  +N++N+               + + Q+ N S  +A + F               K  E++ + DDPFA       +NDD+ P
  S:     2 INRVILTGRLTDDPQFRYTPSGVAVVTFTLAVTRPFANQNGVREADFIRCVAWRKQAENIANYLKKGSMVGIDGRLETGSY-ERNGRRVYYTQVVVDTATFLEPRNASNSGRK-------QRGDRDTFEQEKNAS-RKAREAF--------------MKPSEEQRWFDDPFADNGEPIEINDDDLP 164
>gi|149277326|ref|ZP_01883468.1| single-stranded DNA binding protein [Pedobacter sp. BAL39] >gi|149232203|gb|EDM37580.1| single-stranded DNA binding protein [Pedobacter sp. BAL39] (142 aa)
Score = 161, Expect = 8.4e-10, Identities = 42/121 (34%), Positives = 66/121 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN-----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKN 121
           +NKV +VG L +DP+      G+T +   +A+S+ +NK+     +T +   V W+  A   + YL KG LV I+GKL  RS+  +E    YV E+V E+   L  K+        D  + P +T+N
  S:     4 INKVILVGHLGKDPEVRHLDGGVTVASFPLATSETYNKDGKRIEQTEWHNIVLWRGLAEVASKYLQKGKLVYIEGKLRTRSFEDREKIKKYVTEVVAENFTILGRKS--------DFEHTPASTEN 121
>gi|52082635|ref|YP_081426.1| single-strand DNA-binding protein [Bacillus licheniformis ATCC 14580] >gi|52788034|ref|YP_093863.1| hypothetical protein BLi04362 [Bacillus licheniformis ATCC 14580] >gi|52005846|gb|AAU25788.1| single-strand DNA-binding protein [Bacillus licheniformis ATCC 14580] >gi|52350536|gb|AAU43170.1| Ssb [Bacillus licheniformis DSM 13] (170 aa)
Score = 161, Expect = 8.7e-10, Identities = 36/101 (35%), Positives = 61/101 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +N+V +VGRL +DP+   T +G   +  ++A     ++   + E  F  CV W+  A  + ++L KG L  +DG+L  RSY +++G+ VYV E+  ES++ L  K
  S:     2 LNRVVLVGRLTKDPELRYTPSGAAVATFTLAVNRTFTNQQGEREADFINCVVWRRQAENVANFLKKGSLAGVDGRLQTRSYENQQGQRVYVTEVQAESVQFLEPK 106
>gi|167463807|ref|ZP_02328896.1| Single-strand DNA-binding protein, phage-related protein [Paenibacillus larvae subsp. larvae BRL-230010] (134 aa)
Score = 161, Expect = 9.3e-10, Identities = 37/104 (35%), Positives = 67/104 (64%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-----NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPL-SSKNSN 104
           +N+V ++GRL +DP+   T +G+  ++ ++A    +      + ET F   V W+ TA    ++L KG L A++G++  R+Y + EG+ +YV E+V ++++ L SSKN N
  S:     2 LNRVVLIGRLTRDPELRYTPSGVAVTKFTLAVDRPYMNQQTRERETDFINIVTWRQTAEACANHLRKGRLTAVEGRIQVRNYENNEGRRIYVTEVVADNVRFLESSKNEN 111
>gi|169351669|ref|ZP_02868607.1| hypothetical protein CLOSPI_02450 [Clostridium spiroforme DSM 1552] >gi|169291891|gb|EDS74024.1| hypothetical protein CLOSPI_02450 [Clostridium spiroforme DSM 1552] (153 aa)
Score = 160, Expect = 9.7e-10, Identities = 41/143 (28%), Positives = 79/143 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNF 143
           +N+V +VGR+ +DP+   T  G   +  ++A + N+     + +  F  CV W+  A  +  Y  KG LV ++G++  RSY + +G+ VYV+E++ +S++ L ++ +   A S      P   +NN+     +M   E   +F+++F
  S:     2 INRVVLVGRMTRDPELRRTPQGDAVTSFTLAVNRNYTSRDGQQQADFINCVVWRKPAENVERYCSKGSLVGVEGRIQTRSYDNSQGQKVYVVEVICDSVQFLETRAARERAQS-----QPQMQQNND--NFYDMKTVELEKEFDNSF 141
>gi|20808452|ref|NP_623623.1| single-stranded DNA-binding protein [Thermoanaerobacter tengcongensis MB4] >gi|20517069|gb|AAM25227.1| Single-stranded DNA-binding protein [Thermoanaerobacter tengcongensis MB4] (153 aa)
Score = 160, Expect = 1.2e-09, Identities = 38/99 (38%), Positives = 54/99 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE----TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLS 99
           +NKV +VGR  +D ++ +T +G      S+A   N+   E    T F P VAW   A  +  Y  KG LVA+ G+L  R Y    GK V ++E+V E I  L+
  S:     3 LNKVMLVGRTTKDLKKLITPSGHPVVHFSLAVDRNYTNKEGNRETDFIPVVAWNRLAEILEQYAVKGTLVAVVGRLQTRRYTDGSGKNVRILEVVAEEISLLA 105
>gi|147679226|ref|YP_001213441.1| single-stranded DNA-binding protein [Pelotomaculum thermopropionicum SI] >gi|146275323|dbj|BAF61072.1| single-stranded DNA-binding protein [Pelotomaculum thermopropionicum SI] (137 aa)
Score = 160, Expect = 1.2e-09, Identities = 36/98 (36%), Positives = 57/98 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPL 98
           +NKV ++GRL QDP+   T  G+  +R ++A +    +   + ET F   V WQ  A    +Y+ KG LVA++G+L  RSY   +G      E+V E+++ L
  S:     2 LNKVILIGRLTQDPELRYTPGGVAVARFTLAVNRARLNKQGERETDFIDVVVWQKQAETCANYIRKGRLVAVEGRLQVRSYDDSQGIRRKAAEVVAETVRFL 103
>gi|58616114|ref|YP_195805.1| PcfS [Enterococcus faecalis] >gi|57489129|gb|AAW51336.1| PcfS [Enterococcus faecalis] (150 aa)
Score = 160, Expect = 1.2e-09, Identities = 41/126 (32%), Positives = 70/126 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQ 126
           +N V +VGRL +D     T +G+  +  ++A + N+ N+N   E  +  CV W+  A  + +Y  KG LV + G+L  R+Y +++G+ +YV E+V+ES + L SK  +        N  P   + +N  Q
  S:     2 INNVTLVGRLTKDCDLRYTSSGVAVAAFTLAVNRNFTNQNGEREADYIQCVIWRKPAETLANYTRKGTLVGLVGRLQTRNYENQQGQRIYVTEVVVESFQLLESKEVSQQRGVNASNPTPVGQQESNTQQ 131
>gi|153811350|ref|ZP_01964018.1| hypothetical protein RUMOBE_01742 [Ruminococcus obeum ATCC 29174] >gi|149832477|gb|EDM87561.1| hypothetical protein RUMOBE_01742 [Ruminococcus obeum ATCC 29174] (144 aa)
Score = 160, Expect = 1.2e-09, Identities = 42/138 (30%), Positives = 74/138 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQ--NGITQSRISIASSDNWNKNETY----FFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDD 138
           MNKV ++GRL +DPQ   TQ  + +  +R ++A      K E      F  CVA+  +A F+  Y+H+G  + + G++   SY +K+   VY  E++ E I+   SK +   +     +  P  T+N+ +     M++ E +D+
  S:     1 MNKVILMGRLTRDPQVRYTQGQDSMAIARFTLAVDRRGRKQEGQQDVDFPSCVAFGKSAEFVEKYVHQGTKIVLTGRIQTGSYTNKDNIKVYTTEVIAEDIEFAESKAAAEGSGGAGGHQKPEQTENDGF-----MNIPEGIDE 139
>gi|150387886|ref|YP_001317935.1| single-strand binding protein [Alkaliphilus metalliredigens QYMF] >gi|149947748|gb|ABR46276.1| single-strand binding protein [Alkaliphilus metalliredigens QYMF] (146 aa)
Score = 159, Expect = 1.4e-09, Identities = 43/125 (34%), Positives = 70/125 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK-NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYS 125
           MN+V ++GRLA+DP+   T +G   +  SIA +  ++K  +  FF  V W  TA    +YL KG LV +DG+L  RSY +K G   YV EIV + ++ L   + N+  +   +       K+++++
  S:     1 MNRVVMIGRLARDPELRFTASGKAVATFSIAVNKTFSKEKQADFFNVVVWNKTAENCANYLAKGRLVGLDGRLQSRSYETKNGDKRYVTEIVADQVEFLEWGDKNSQPNQTSQKPKQDFGKSDDFN 126
>gi|125973865|ref|YP_001037775.1| single-strand binding protein [Clostridium thermocellum ATCC 27405] >gi|125714090|gb|ABN52582.1| single-strand binding protein [Clostridium thermocellum ATCC 27405] (134 aa)
Score = 159, Expect = 1.5e-09, Identities = 41/124 (33%), Positives = 62/124 (50%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNY 124
           MNKV ++GRL QDP+   T  G       +A +  +++     +  FFP VAW+ T  F N+Y  KG  VAI G+L  RS+  ++G    + EI+ +      SK  N  +      + P NT    +
  S:     1 MNKVILMGRLTQDPELRHTTTGKAVCHFRLAVNRRFSRQGEQEQADFFPIVAWEKTGEFCNNYFRKGQQVAIIGRLQNRSWNDEQGNKRTITEIIADEAYFADSKKDNYTSGG----FEPENTDGEGF 124
>gi|167770482|ref|ZP_02442535.1| hypothetical protein ANACOL_01827 [Anaerotruncus colihominis DSM 17241] >gi|167667077|gb|EDS11207.1| hypothetical protein ANACOL_01827 [Anaerotruncus colihominis DSM 17241] (137 aa)
Score = 159, Expect = 1.6e-09, Identities = 37/108 (34%), Positives = 60/108 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAAS 108
           +NKV ++GR   DP+   T NG++ +   IA   N+N    + +  F   VAW+ TA FI  Y  KG ++A++G +  RSY  K G     +E++ E +     K+ N A++
  S:     2 LNKVILMGRFTADPELRQTPNGVSVTSFRIAVDRNFNSKDGERQADFINIVAWRQTAEFIVRYFVKGQMIALEGSIQTRSYEDKNGNKRMAVEVIAEHVWFAGGKSDNGASA 113
>gi|150019686|ref|YP_001311940.1| single-strand binding protein [Clostridium beijerinckii NCIMB 8052] >gi|149906151|gb|ABR36984.1| single-strand binding protein [Clostridium beijerinckii NCIMB 8052] (113 aa)
Score = 159, Expect = 1.6e-09, Identities = 39/107 (36%), Positives = 57/107 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNG-ITQSRISIASSDNWNK----NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAA 107
           MNK+ ++GRL +DP+   T+NG    ++ +IA   N+       E  F P   W   A  I  Y+ KG L+ + G+L   SY  KEG   Y+ E++ E  K L +K S   A
  S:     1 MNKIILLGRLVKDPELRHTENGEKIYTKFTIAVQRNFRLPDGIREADFIPIKVWGKKAEVIVKYMKKGSLITLSGRLRTGSYEDKEGNRKYIAEVIAEDFKFLENKKSQTEA 112
>gi|29377935|ref|NP_817061.1| single-strand binding protein [Enterococcus faecalis V583] >gi|29345387|gb|AAO83132.1| single-strand binding protein [Enterococcus faecalis V583] (150 aa)
Score = 158, Expect = 1.7e-09, Identities = 40/126 (31%), Positives = 70/126 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQ 126
           +N V +VGRL +D     T +G+  +  ++A + N+ N+N   E  +  CV W+  A  + +Y  KG L+ + G+L  R+Y +++G+ +YV E+V+ES + L SK  +        N  P   + +N  Q
  S:     2 INNVTLVGRLTKDCDLRYTSSGVAVAAFTLAVNRNFTNQNGEREADYIQCVIWRKPAETLANYTRKGTLIGLVGRLQTRNYENQQGQRIYVTEVVVESFQLLESKEVSQQRGVNASNPTPVGQQESNTQQ 131
>gi|169834676|ref|YP_001693245.1| single-strand binding protein [Clostridium botulinum B1 str. Okra] >gi|169834748|ref|YP_001715778.1| single-strand binding protein [Clostridium botulinum A3 str. Loch Maree] >gi|169123224|gb|ACA47059.1| single-strand binding protein [Clostridium botulinum B1 str. Okra] >gi|169408855|gb|ACA57265.1| single-strand binding protein [Clostridium botulinum A3 str. Loch Maree] (148 aa)
Score = 158, Expect = 1.7e-09, Identities = 42/138 (30%), Positives = 73/138 (52%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDD 138
           MNKV ++GRL +DP+ +F   NG   +  ++A    ++K+   E  F P V W   A    +Y+ KG L+ + G++  RSY +K+G   Y+ E++ E +K L   +     ++ D +YN  N   ++Y    +     + DD
  S:     1 MNKVVLIGRLTKDPELKFTPGNGTAVANFTLAVDRRFSKDGQREADFIPIVVWGKQAESTANYMSKGKLMGVSGRIQTRSYEAKDGTKRYITEVIAEEVKFLEWGDK----ATTDSSYN--NGSESSYQSGQDFGNGNSFDD 136
>gi|70727626|ref|YP_254542.1| single-strand DNA-binding protein of phage phi PVL [Staphylococcus haemolyticus JCSC1435] >gi|68448352|dbj|BAE05936.1| single-strand DNA-binding protein of phage phi PVL [Staphylococcus haemolyticus JCSC1435] (170 aa)
Score = 158, Expect = 1.9e-09, Identities = 36/113 (31%), Positives = 68/113 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKN 113
           +N+V +VGRL +DP+   T +G++ +  ++A +  +     + E  F   V ++  A  +N+YL KG L  +DG++  RSY ++EG+ ++V E+V +S++ L  KN+     +   N
  S:     2 INRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINVVVFRRQAENVNNYLFKGSLAGVDGRIQSRSYENQEGRRIFVTEVVADSVQFLEPKNAQGGQRNQSNN 118
>gi|121535340|ref|ZP_01667152.1| single-strand binding protein [Thermosinus carboxydivorans Nor1] >gi|121306032|gb|EAX46962.1| single-strand binding protein [Thermosinus carboxydivorans Nor1] (134 aa)
Score = 158, Expect = 2.1e-09, Identities = 39/103 (37%), Positives = 60/103 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSD--NWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           MNKV +VGRLAQDP+   TQ G   +  ++A +   +  + +T F P VAW+  A    + L KG  + ++G+L  RSY + +G+   V E+V  SI+ L  K +
  S:     1 MNKVILVGRLAQDPEVRYTQTGKAVASFNLAVNRYVSQGQQQTDFIPIVAWERLAETCGNNLTKGQRILVEGRLQIRSYETADGQKRRVAEVVALSIEFLERKQT 105
>gi|28209879|ref|NP_780823.1| single-strand binding protein [Clostridium tetani E88] >gi|37999423|sp|Q899R2|SSB_CLOTE Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|28202314|gb|AAO34760.1| single-strand binding protein [Clostridium tetani E88] (145 aa)
Score = 157, Expect = 2.2e-09, Identities = 41/123 (33%), Positives = 64/123 (52%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNK---NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNN 123
           MN+V ++GRL +DP+ +F    G   +   +A    ++K   NE  F P V W   A    +Y+ KG L+ I G++  RSY +K+G   YV E+V + +K L   N  ++ S    N+       NN
  S:     1 MNRVVLIGRLTKDPELKFTPGTGTAVTTFVLAVDRRFSKDGKNEADFIPVVVWGKQAESTANYMSKGKLIGISGRIQTRSYEAKDGTRRYVTEVVADEVKFLEWGNKQSSGSQGFNNFESDPLSYNN 127
>gi|15896954|ref|NP_350303.1| single strand DNA binding protein, SSB [Clostridium acetobutylicum ATCC 824] >gi|37999760|sp|Q97CX3|SSB3_CLOAB Single-stranded DNA-binding protein 3 (SSB 3) (Helix-destabilizing protein 3) >gi|15026829|gb|AAK81643.1|AE007867_10 Single strand DNA binding protein, SSB [Clostridium acetobutylicum ATCC 824] (144 aa)
Score = 157, Expect = 2.2e-09, Identities = 45/127 (35%), Positives = 68/127 (53%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNK---NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQ 127
           MNKV ++GRL +DP+ +F    G   +  ++A    + K    E  F P V W   A    +Y+ KG L+ + G++  RSY +K+G   YV EIV E ++ L   +SNN + + D+     N  N N S Q
  S:     1 MNKVVLIGRLTKDPELKFTPGTGTAVASFTLAVDRRFKKEGQQEADFIPIVVWGKQAESTANYMSKGKLMGVSGRIQTRSYDAKDGTRRYVTEIVAEEVQFLEWGSSNNNSMANDQ----FNNGNENGSMQ 127
>gi|29375127|ref|NP_814280.1| single-strand binding protein [Enterococcus faecalis V583] >gi|29377831|ref|NP_816959.1| single-strand binding protein [Enterococcus faecalis V583] >gi|21693279|gb|AAM75226.1|AF454824_20 EF0020 [Enterococcus faecalis] >gi|18104262|gb|AAL59448.1| putative ssb protein [Enterococcus faecalis] >gi|29342586|gb|AAO80351.1| single-strand binding protein [Enterococcus faecalis V583] >gi|29345283|gb|AAO83030.1| single-strand binding protein [Enterococcus faecalis V583] (152 aa)
Score = 157, Expect = 2.3e-09, Identities = 37/104 (35%), Positives = 63/104 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW----NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSN 104
           +N V +VGRL +DP    TQ+G    + ++A + N+    N+ E  F  CV W+  A  + +Y  KG L+ + G++  R+Y +++G+ +YV E+V ES + L S+  N
  S:     2 INNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTRNYENQQGQRIYVTEVVTESFQLLESREVN 109
>gi|11968235|ref|NP_072022.1| single-strand binding protein [Enterococcus faecalis] >gi|11767455|gb|AAG40440.1| single-strand binding protein [Enterococcus faecalis] (161 aa)
Score = 157, Expect = 2.4e-09, Identities = 38/104 (36%), Positives = 64/104 (61%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW----NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSN 104
           +N V +VGRL +DP    TQ+G    + ++A + N+    N+ E  F  CV W+  A  + +Y  KG L+ + G++  R+Y +++G+ VYV E+V+E+ + L SK  N
  S:     2 INNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYARKGTLIGLTGRIQTRNYDNQQGQRVYVTEVVVENFQLLESKEIN 109
>gi|168207305|ref|ZP_02633310.1| single-strand binding protein family [Clostridium perfringens E str. JGS1987] >gi|170661312|gb|EDT13995.1| single-strand binding protein family [Clostridium perfringens E str. JGS1987] (121 aa)
Score = 157, Expect = 2.5e-09, Identities = 35/115 (30%), Positives = 64/115 (55%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYN 115
           MNKV ++GRL +DP+ +F +  G   +R ++A +  + ++ET F  C+++  TA  I  +L KG L+AI G +   +Y +++G   Y  E++ ES   + S          ++ Y+
  S:     1 MNKVVLIGRLTKDPELRFTSVKGTPTARFTLAVARQFKRDETDFISCISYGKTAENIAKFLTKGRLLAISGSIRTGNYEAQDGTKRYTTEVLAESFDFIDSSKKLEKTEDWEEEYD 116
>gi|116332689|ref|YP_794216.1| single-stranded DNA-binding protein [Lactobacillus brevis ATCC 367] >gi|116098036|gb|ABJ63185.1| Single-stranded DNA-binding protein [Lactobacillus brevis ATCC 367] (188 aa)
Score = 156, Expect = 2.8e-09, Identities = 33/102 (32%), Positives = 60/102 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKN 102
           +N+V + GRL +D     TQ G   +  ++A     ++   + E  F  CV W+ +A    ++ HKG LV I+G++  R+Y +++G+ VYV E+V+E+   L  ++
  S:     2 INRVVLTGRLTRDVDLRYTQGGAAVATFTLAVDRRFTNQQGEREADFVSCVIWRKSAENFANFFHKGSLVGIEGRIQTRNYENQQGQRVYVTEVVVENFSFLEPRS 107
>gi|187935676|ref|YP_001886126.1| single-strand binding protein family [Clostridium botulinum B str. Eklund 17B] >gi|187723829|gb|ACD25050.1| single-strand binding protein family [Clostridium botulinum B str. Eklund 17B] (135 aa)
Score = 156, Expect = 3.0e-09, Identities = 41/109 (37%), Positives = 62/109 (56%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNW-NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE---SIKPLSSKNSNNAASS 109
           MNK   +GRL  D + QF    G   ++  IA  D + +  +TYF P V W  +A  ++SYL KG  VAI GK+  RS+  ++G   Y  EI  +    +K L  K ++N+++S
  S:     1 MNKWIGIGRLTSDAELQFTAGKGTAVAKFKIAIDDGYGDHKKTYFIPIVLWGKSAENLSSYLIKGTQVAISGKITTRSWDKQDGTKGYATEIAADMYGGVKLLGGKKNDNSSTS 114
>gi|152979537|ref|YP_001345166.1| single-strand binding protein [Actinobacillus succinogenes 130Z] >gi|150841260|gb|ABR75231.1| single-strand binding protein [Actinobacillus succinogenes 130Z] (159 aa)
Score = 156, Expect = 3.0e-09, Identities = 42/128 (32%), Positives = 68/128 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQS 128
           +NKV IVGRL  DP+     NG   + IS+A+S++WN       +  T +   V ++  A  +  YL KG  + ++G+L  R +  + G+  Y  EI  + ++ L S+NS         ++ P NT    YS+ S
  S:     4 VNKVIIVGRLGNDPEIRTMPNGEAVANISVATSESWNDRNTGERREVTEWHRIVFYRRQAEIVGEYLRKGSQIYVEGRLRTRKWQDQNGQDRYTTEIQGDVMQMLDSRNSQGG------DFAPQNTAPQQYSRSS 132
>gi|158520061|ref|YP_001527931.1| single-strand binding protein [Desulfococcus oleovorans Hxd3] >gi|158508887|gb|ABW65854.1| single-strand binding protein [Desulfococcus oleovorans Hxd3] (137 aa)
Score = 156, Expect = 3.1e-09, Identities = 40/101 (39%), Positives = 57/101 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +NK  IVGRL +DP+   TQ+G   +  S+A+S+ W        K  T +   VA+         YL KG LV +DG+L  RS+  K+G T Y  EIV  +++ L  K
  S:     4 VNKAIIVGRLGRDPELRYTQDGRAVASFSVATSEEWKDKDSGDKKERTEWHRVVAFGRLGEICGEYLAKGRLVYVDGRLQTRSW-EKDGVTRYTTEIVAANMQILEPK 110
>gi|196249488|ref|ZP_03148185.1| single-strand binding protein [Geobacillus sp. G11MC16] >gi|196210782|gb|EDY05544.1| single-strand binding protein [Geobacillus sp. G11MC16] (165 aa)
Score = 156, Expect = 3.2e-09, Identities = 54/175 (30%), Positives = 89/175 (50%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFA-------LNDDEDP 175
           +N+V + GRL  DPQ   T +G+     ++A +  + N+N   E  F  CVAW+  A  I +YL KG +V IDG+L   SY  + G+  Y  ++V+++   L  +N++N+               + + Q+ N S  +A + F               K  E++ + DDPFA       +NDD+ P
  S:     2 INRVILTGRLTDDPQFRYTPSGMAVVTFTLAVTRPFANQNGVREADFIRCVAWRKQAENIANYLKKGSMVGIDGRLETGSY-ERNGRRTYYTQVVVDTATFLEPRNASNSGRK-------QRGDRDTFEQEKNAS-RKAREAF--------------MKPSEEQRWFDDPFADNGEPIEINDDDLP 164
>gi|90960998|ref|YP_534914.1| single-strand DNA binding protein [Lactobacillus salivarius UCC118] >gi|90820192|gb|ABD98831.1| Single-strand DNA binding protein [Lactobacillus salivarius UCC118] (183 aa)
Score = 156, Expect = 3.3e-09, Identities = 53/170 (31%), Positives = 80/170 (47%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKD---DPFALN 170
           +N+  +VGRL +DP    T +G   +  ++A     ++   + E  F  CV W+  A    ++ HKG LV IDG++  RSY +++G  VYV E+V E+   L S+      +  D+         NNY   +N         F+SN    + S N    N       D   DPFA N
  S:     2 INRAILVGRLTRDPDLRYTASGAAVATFTVAVNRQFTNQQGEREADFINCVMWRKPAENFANFTHKGSLVGIDGRIQTRSYENQQGTRVYVTEVVAENFSLLESR------AEADRYREQHGMTQNNYG--NNAPSQNQASQFDSNPFGDSQSNNSFGGNTPANNGADNSADPFADN 170
>gi|71894544|ref|YP_278652.1| single stranded binding protein [Mycoplasma synoviae 53] >gi|71851332|gb|AAZ43941.1| single stranded binding protein [Mycoplasma synoviae 53] (188 aa)
Score = 156, Expect = 3.4e-09, Identities = 59/174 (33%), Positives = 97/174 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE---TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNY--NPTNTKNNNYS---QQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFALNDDED 174
           +NKV +VGR+  D     T+N I+ +R +IA +     N    + F P VAW++ A F+  Y+ KGD + ++GK+   SY + EG  V  I+I++++++ L+SKN  N  +    NY  N  + + N YS   Q  N+S+ E          +  SS+ + S+ E +E   DD  + ND E+
  S:     4 LNKVILVGRVTNDFLLQKTKNNISYARNTIAVTRYTTSNTQRVSDFLPFVAWRNQAEFLCKYVKKGDTILLEGKIQSNSYNNNEGTLVRSIDILVDNVQILASKNYVNITNYGQNNYSQNKASYQANTYSDLNQSVNLSIEE----------KDISSSAVFSRAETEE--DDDSISANDFEN 173
>gi|160915507|ref|ZP_02077718.1| hypothetical protein EUBDOL_01515 [Eubacterium dolichum DSM 3991] >gi|158432627|gb|EDP10916.1| hypothetical protein EUBDOL_01515 [Eubacterium dolichum DSM 3991] (159 aa)
Score = 156, Expect = 3.5e-09, Identities = 42/134 (31%), Positives = 70/134 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN---KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKN---YNPTNTKNNNYSQQSNMSVSE 134
           +N+  IVGRL +DP    T +G + +  ++A    +    +    F  C +W   A+ +  Y+ KG L+ ++G+L  RSY +K+GK   + E+V ES   L  K++ N A   D++   Y  T    N+  Q+     SE
  S:     2 INRAVIVGRLVRDPVLRKTTSGASVTSFTVAVDRKFKAEGQPTADFIQCTSWNKVADNVAKYMKKGFLIGVEGRLQTRSYENKDGKKQIICELVAESTAFLEQKDNRNTALQSDESVGGYKYTTDTTNSLPQEQQSGYSE 141
>gi|163815608|ref|ZP_02206981.1| hypothetical protein COPEUT_01783 [Coprococcus eutactus ATCC 27759] >gi|158449245|gb|EDP26240.1| hypothetical protein COPEUT_01783 [Coprococcus eutactus ATCC 27759] (150 aa)
Score = 155, Expect = 3.7e-09, Identities = 44/138 (31%), Positives = 76/138 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQ-----SRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPT-NTKNNNYSQQSNMSVSEAMDD 138
           MNKV ++GRL +DP+   +Q+  +      +R ++A    +N+N      F  CVA+  +A F   YL +G  +A+ G++   SY +K+G  VY  ++VIE  +   SK ++   S     Y P    + +N   +  MS+ E ++D
  S:     1 MNKVILMGRLTRDPEVRYSQSNSSDGQMAIARYTLAVDRRFNRNGDQNADFIGCVAFGKSAEFAEKYLKQGTKIAVTGRIQTGSYTNKDGNKVYTTDVVIEEQEFAESKAASGQTSG--GGYQPAGRPEPSNAGTEGFMSIPEGIED 145
>gi|116327957|ref|YP_797677.1| single-stranded DNA-binding protein [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116330838|ref|YP_800556.1| single-stranded DNA-binding protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116120701|gb|ABJ78744.1| Single-stranded DNA-binding protein [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116124527|gb|ABJ75798.1| Single-stranded DNA-binding protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (149 aa)
Score = 155, Expect = 3.7e-09, Identities = 38/102 (37%), Positives = 63/102 (61%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS-----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKN 102
           +N+V +VGRL +DP+ F + NG +    S+A+     S+   + E++FF C  W   A+ I  Y  KG  +AI+G+L + ++ + EGK    I IV+E+ + L SK+
  S:     5 INRVTLVGRLTRDPE-FKSINGTSLVNFSLANGRTYVSNGEKREESHFFDCEVWGKPADIIQQYCKKGKQIAIEGRLKQDTWETPEGKKASRIRIVVENFQLLGSKD 110
>gi|146329431|ref|YP_001209671.1| single-strand binding protein [Dichelobacter nodosus VCS1703A] >gi|146232901|gb|ABQ13879.1| single-strand binding protein [Dichelobacter nodosus VCS1703A] (151 aa)
Score = 155, Expect = 4.5e-09, Identities = 42/129 (32%), Positives = 72/129 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKN--NNYSQQSN 129
           +NKV ++G + +DP   V  NG   +  S+A+S +WN       + +T +  CVA++  A  I  Y+ KG  + I+G+L  R +  + G   Y  EI++  ++ L +  SNN A    K     N +N  N Y+++S+
  S:     4 INKVILIGNVGKDPDMRVMTNGEQVANFSLATSMSWNDRQSGEKREKTEWHRCVAYRRIAEIIGQYVRKGSKLYIEGRLETRKWQDQSGVERYTTEIIVNEMQMLGTVQSNNRAPQ-QKPQRKQNARNYANQYARESD 140
>gi|168205299|ref|ZP_02631304.1| single-strand binding protein family [Clostridium perfringens E str. JGS1987] >gi|170663214|gb|EDT15897.1| single-strand binding protein family [Clostridium perfringens E str. JGS1987] (138 aa)
Score = 154, Expect = 4.8e-09, Identities = 34/101 (33%), Positives = 58/101 (57%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MNKV ++GRL +DP+ +F   +G   +R ++A +  + K+E  F  C+A+  T   I  Y+ KG  +AI G +   SY +++G   Y  ++V+E    + SK
  S:     1 MNKVVLIGRLTKDPELRFAAGSGTAVARFTLAVNRQFKKDEVDFISCIAFGKTGETIAQYITKGRQLAISGNIRTGSYEAQDGTRRYTTDVVVEGFDFIDSK 102
>gi|66394702|ref|YP_240872.1| ORF033 [Staphylococcus phage X2] >gi|62636926|gb|AAX92037.1| ORF033 [Bacteriophage X2] (139 aa)
Score = 154, Expect = 5.1e-09, Identities = 37/101 (36%), Positives = 61/101 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +N+V +VGRL +DP+   T NG+     ++A +  +     + E  F   V ++  A  + +YL KG L  +DG+L  RSY +KEG+ V+V E+V +S++ L  K
  S:     2 LNRVVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTRSYDNKEGRRVFVTEVVADSVQFLEPK 106
>gi|82751466|ref|YP_417207.1| single strand DNA binding protein [Staphylococcus aureus RF122] >gi|82656997|emb|CAI81434.1| single strand DNA binding protein [Staphylococcus aureus RF122] (141 aa)
Score = 154, Expect = 5.1e-09, Identities = 40/124 (32%), Positives = 71/124 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNY 124
           +N++ +VGRL +DP+   T NG+     ++A +  +     + E  F   V ++  A  + +YL KG L  +DG+L  R+Y +K+G+ V+V E+V +S++ L  KN+N   ++       T T NN +
  S:     2 LNRIVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTRNYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQGQTQTGNNPF 129
>gi|85712774|ref|ZP_01043818.1| Single-stranded DNA-binding protein [Idiomarina baltica OS145] >gi|85693414|gb|EAQ31368.1| Single-stranded DNA-binding protein [Idiomarina baltica OS145] (204 aa)
Score = 154, Expect = 5.3e-09, Identities = 50/176 (28%), Positives = 89/176 (50%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKN--YNPTNTKNNNYSQQSNMSVSEAMDDFESN-----------FAQKTSSTNITSKNEEKETFKDDPFALNDDEDPD 176
           +NKV +VG L  DP+   TQN    + +SIA+S+ W        + +T +  CVA++  A     YL KG  V ++G+L  R +  ++G+  Y  EIVI  ++ L S+  +        N   N    +  N     N   ++   + +SN              +++  N    N+ ++  + +PF+ ++D D D
  S:     6 VNKVILVGNLGADPEVRYTQNSTAIANLSIATSETWKDKQTGEPREQTEWHRCVAYRRLAEIAGEYLKKGSKVYVEGRLQTRKWQGQDGQDRYTTEIVINEMQMLDSRGGSGMGQGQGMNQGMNQGMHQGMNQGMNQNQGGNQPAPNQQSNPNQGFGQQQGFQGGQSNQGNAMRSNQNQQPSQPEPFSPDNDFDDD 201
>gi|196251062|ref|ZP_03149743.1| single-strand binding protein [Geobacillus sp. G11MC16] >gi|196209434|gb|EDY04212.1| single-strand binding protein [Geobacillus sp. G11MC16] (164 aa)
Score = 154, Expect = 5.4e-09, Identities = 54/175 (30%), Positives = 87/175 (49%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFA-------LNDDEDP 175
           +N+V + GRL  DPQ   T +G+      +A +  + N+N   E  F  CVAW+  A  I +YL KG +V IDG+L   SY  + G+  Y  ++V+++   L                 P N  N+   Q+ +  + +     E N ++K     +  K  E++ + DDPFA       +NDD+ P
  S:     2 INRVILTGRLTDDPQFRYTPSGVAVVTFILAVTRPFANQNGVREADFIRCVAWRKQAENIANYLKKGSMVGIDGRLETGSY-ERNGRRTYYTQVVVDTATFLE----------------PRNASNSGRKQRGDRDIEQ-----EKNASRKAREAFM--KPPEEQRWFDDPFADNGEPIEINDDDLP 163
>gi|194246577|ref|YP_002004216.1| putative single-strand DNA-binding protein [Candidatus Phytoplasma mali] >gi|193806934|emb|CAP18366.1| putative single-strand DNA-binding protein [Candidatus Phytoplasma mali] (138 aa)
Score = 154, Expect = 5.5e-09, Identities = 41/118 (34%), Positives = 64/118 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE----TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTN 118
           +NKV +VGR+ +DP+       I   + S+A   N+   E    T F  CV W+  A  +  Y+ KG L+ I+G +   SY + +G   YV E+  +SI+ L  K SNN + +++ N N  N
  S:     2 INKVILVGRITKDPELRYVNLDIPTVKFSLAVGRNFTNKEGNKETDFISCVVWRKQAENLTKYITKGALLGIEGNIRTSSYDAPDGTRRYVTEVYCDSIQFLEPKKSNNFSDNLEINNNKKN 123
>gi|88801609|ref|ZP_01117137.1| single-strand binding protein [Polaribacter irgensii 23-P] >gi|88782267|gb|EAR13444.1| single-strand binding protein [Polaribacter irgensii 23-P] (131 aa)
Score = 154, Expect = 5.6e-09, Identities = 34/100 (34%), Positives = 61/100 (61%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           NKV ++GRL Q+P+    ++G   ++ S+A+ D++   E       Y+   +      N + +Y++KG  +A++GKL  RSY +KEG+  YV EI++  +  L +K
  S:    25 NKVQLIGRLGQEPEIVTFKDGNKMAKFSMATDDSYKDKEGTKVERAYWHNIIITGGLVNVVENYVNKGQEIALEGKLTNRSYETKEGEKRYVTEILVSELLLLGTK 130
>gi|116490137|ref|YP_809666.1| single-stranded DNA-binding protein [Oenococcus oeni PSU-1] >gi|116090862|gb|ABJ56016.1| Single-stranded DNA-binding protein [Oenococcus oeni PSU-1] (185 aa)
Score = 154, Expect = 6.0e-09, Identities = 44/143 (30%), Positives = 80/143 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSV-SEAMDDFESNF 143
           +N+V +VGRL +D +   T NG      +IA   N+     + E  F  CV W+  A    ++  KG +V ++G++  R+Y + +G+ VYV E+V+++ + L ++  + A  S  +N +  NT N     QSN ++ ++  + F+S F
  S:     2 INRVVLVGRLTRDVELRYTGNGDAVGSFTIAVERNFTNRAGEREADFISCVIWRKPAENFANFTGKGAMVGVEGRIQTRTYDNNQGQKVYVTEVVVDNFQLLETRAQSEARRS--QNGSAGNTGNTAPQSQSNFNIPNQQSNPFDSQF 147
>gi|65319467|ref|ZP_00392426.1| COG0629: Single-stranded DNA-binding protein [Bacillus anthracis str. A2012] (102 aa)
Score = 153, Expect = 6.3e-09, Identities = 29/92 (31%), Positives = 55/92 (59%)
  Q:    10 LAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           + ++P+ + T+ G+  +R+ +A +    ++  + +  F  CV W+ +A  +  Y  KG LV I G++  R+Y   +GK +Y+ E+VIESI  L  +
  S:     1 MTKEPELYYTKQGVAYARVCVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCTKGSLVGITGRIHTRNYEDDQGKRIYITEVVIESITFLERR 96
>gi|168184351|ref|ZP_02619015.1| single-strand binding protein [Clostridium botulinum Bf] >gi|182672477|gb|EDT84438.1| single-strand binding protein [Clostridium botulinum Bf] (148 aa)
Score = 153, Expect = 6.3e-09, Identities = 42/138 (30%), Positives = 71/138 (51%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDD 138
           MNKV ++GRL +DP+ +F   NG   +  ++A    ++K+   E  F P V W   A    +Y+ KG L+ + G++  RSY +K+G   Y+ E++ E +K L   +     ++ D +YN  N   ++Y            DD
  S:     1 MNKVVLIGRLTKDPELKFTPGNGTAVANFTLAVDRRFSKDGQREADFIPIVVWGKQAESTANYMSKGKLMGVSGRIQTRSYEAKDGTKRYITEVIAEEVKFLEWGDK----ATTDSSYN--NGSESSYQSDEGFGNGNNFDD 136
>gi|193216923|ref|YP_002000165.1| single-stranded DNA-binding protein [Mycoplasma arthritidis 158L3-1] >gi|193002246|gb|ACF07461.1| single-stranded DNA-binding protein [Mycoplasma arthritidis 158L3-1] (151 aa)
Score = 153, Expect = 6.5e-09, Identities = 41/104 (39%), Positives = 58/104 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN--KNETY--FFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSN 104
           MNKV +VGRLA  P Q  T + +  SR +I +   +N   NE    F PCVAW+  A F+N Y  KG L+ I+G +      +K+G     I I  + ++ L SK +N
  S:     1 MNKVILVGRLANKPYQGFTGSNVEYSRFTIVTRRTYNGANNEAISDFIPCVAWRQNAEFVNKYFDKGSLLLIEGTVQSSRITAKDGTISTSISINADRVQALESKATN 108
>gi|125974671|ref|YP_001038581.1| single-strand binding protein [Clostridium thermocellum ATCC 27405] >gi|196252197|ref|ZP_03150858.1| single-strand binding protein [Clostridium thermocellum DSM 4150] >gi|125714896|gb|ABN53388.1| single-strand binding protein [Clostridium thermocellum ATCC 27405] >gi|196198330|gb|EDX93166.1| single-strand binding protein [Clostridium thermocellum DSM 4150] (138 aa)
Score = 153, Expect = 6.6e-09, Identities = 37/103 (35%), Positives = 58/103 (56%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNKN----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           MNKV ++GRL +DP+ ++ T N    +  ++A    + +     +T FFP VAW  +A F + Y  KG  V + G+L  R++   EGK  YV E++ E +     K S
  S:     1 MNKVILMGRLTRDPELRYTTVNNTPVASFTLAVDRRFARQGEERQTDFFPIVAWDKSAEFCSKYFTKGLKVVVVGRLQTRTWDDNEGKRHYVTEVIAEELYFAEGKKS 108
>gi|86134870|ref|ZP_01053452.1| Single-strand binding protein [Tenacibaculum sp. MED152] >gi|85821733|gb|EAQ42880.1| Single-strand binding protein [Polaribacter dokdonensis MED152] (111 aa)
Score = 153, Expect = 7.0e-09, Identities = 39/100 (39%), Positives = 61/100 (61%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN------ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           NKV ++G L  +P+     +G   ++ SIA+++++  N      +T +   VAW  TA+ I  YL KG  VAI+GKL  R+Y +KEG+  Y+ EIV   +  L +K
  S:     6 NKVQLIGNLGNNPEIITLDSGKKLAKFSIATNESYKNNNGDKVTDTQWHNIVAWNKTADIIERYLQKGSEVAIEGKLTSRNYETKEGEKRYITEIVCNELLMLGNK 111
>gi|89890315|ref|ZP_01201825.1| single-strand DNA binding protein [Flavobacteria bacterium BBFL7] >gi|89517230|gb|EAS19887.1| single-strand DNA binding protein [Flavobacteria bacterium BBFL7] (112 aa)
Score = 153, Expect = 7.1e-09, Identities = 36/100 (36%), Positives = 59/100 (59%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           NKV ++G L Q P+  V  +G   ++ SIA++D +        N+T +   +AW  TA+ +  Y+ KG+ + ++GKL  RSY  K+G   YV EIV   +  + +K
  S:     6 NKVQLIGNLGQTPEIKVLDSGNKLAKFSIATTDRYKNKQGELVNDTQWHNIIAWGKTADIVEQYVQKGNQIGVEGKLTSRSYEDKDGIKRYVTEIVCSELLLMGNK 111
>gi|153810734|ref|ZP_01963402.1| hypothetical protein RUMOBE_01118 [Ruminococcus obeum ATCC 29174] >gi|149833130|gb|EDM88212.1| hypothetical protein RUMOBE_01118 [Ruminococcus obeum ATCC 29174] (149 aa)
Score = 153, Expect = 7.3e-09, Identities = 47/133 (35%), Positives = 70/133 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQ--NGITQSRISIASSDNW---NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVS 133
           MNKV ++GRL +DP+   +Q  N    +R ++A        N+    +  CV++  +A F   Y HKG  +AI G++   SY +K+G+ VY  +IVIE      SK    AAS  + + N  N  NN  +QQ     S
  S:     1 MNKVILMGRLTRDPEVRYSQGENATAVARFTLAVDRRIKRDNEASVDYINCVSFGRSAEFAEKYFHKGTKIAIAGRIQTGSYTNKDGQKVYTTDIVIEEQDFAESK----AASQQNNSGNAQNASNNQQAQQPKPQTS 134
>gi|78044015|ref|YP_358908.1| single-strand binding protein [Carboxydothermus hydrogenoformans Z-2901] >gi|77996130|gb|ABB15029.1| single-strand binding protein [Carboxydothermus hydrogenoformans Z-2901] (143 aa)
Score = 153, Expect = 7.7e-09, Identities = 41/130 (31%), Positives = 69/130 (53%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSS-KNSNNAASSIDKNYNPTNTKNNNYSQQSNMS 131
           NKV ++GRL +DP+   T  G   + I++A    +     + ET F   V WQ  A  +   L KG LV ++G+L  RSY  KEG+   V E+V E+++ L   KN+  A  ++   +   +   +++  +  +S
  S:     3 NKVILIGRLTRDPELRHTPQGTPVASITVAVDRPFTTKEGQRETDFIDVVVWQKLAETVARVLTKGRLVMVEGRLQIRSYTDKEGQKRRVYEVVGENVRFLDKPKNAGLAPGNLPDEFPAVDFDPSDFGTEIEIS 137
>gi|167773045|ref|ZP_02445098.1| hypothetical protein ANACOL_04434 [Anaerotruncus colihominis DSM 17241] >gi|167664978|gb|EDS09108.1| hypothetical protein ANACOL_04434 [Anaerotruncus colihominis DSM 17241] (152 aa)
Score = 153, Expect = 7.8e-09, Identities = 35/108 (32%), Positives = 61/108 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAAS 108
           +N+  ++GRL  DP+   T NG++ +   IA   N+N    + +  F   VAW+ TA F+  Y  KG ++A++G +  R+Y  K G     +EIV +++    SK +  A++
  S:     2 LNRAILMGRLVADPELRQTPNGVSVTSFRIAVDRNFNSKGGERQADFLDIVAWRQTAEFVTRYFTKGRMIALEGSIQTRNYEDKNGNKRTAVEIVADNVYFADSKPAGGASA 113
>gi|187935811|ref|YP_001893642.1| single-strand binding protein [Clostridium botulinum B str. Eklund 17B] >gi|187723963|gb|ACD14169.1| single-strand binding protein [Clostridium botulinum B str. Eklund 17B] (116 aa)
Score = 152, Expect = 8.6e-09, Identities = 41/112 (36%), Positives = 67/112 (59%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDK 112
           MNKV ++GRL +DP+ +F  +NG   ++I++A  D +N    + E  F P V W   A  I +Y+ KG  +AI G++  R+Y  K+G   YV E++   ++ LS  N+ N+  +  K
  S:     1 MNKVVLIGRLTKDPEVKFTQENGKAVTKITLAV-DKYNSKSGQKEADFVPIVVWDKQAESIGNYMKKGSQIAISGRIQTRNYEEKDGTKRYVTEVIASEVQFLSRVNNVNSEDNESK 116
>gi|183221481|ref|YP_001839477.1| single-stranded DNA binding protein (SSB; helix-destabilizing protein) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189911568|ref|YP_001963123.1| Single-stranded DNA-binding protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167776244|gb|ABZ94545.1| Single-stranded DNA-binding protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167779903|gb|ABZ98201.1| Single-stranded DNA binding protein (SSB; Helix-destabilizing protein) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (147 aa)
Score = 152, Expect = 9.0e-09, Identities = 45/139 (32%), Positives = 74/139 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS-----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDF 139
           +NKV ++GR+ +DP+ F + NG +    SIA+     ++   K ET++F CVAW   A+ +  Y  KG  VAI+G+L ++S+ + EGK    I + +ES + L  +       S D+          + S   +  VS   DD+
  S:     5 LNKVLLIGRMTRDPE-FKSVNGSSVVNFSIANNRVYVTNGEKKEETHYFDCVAWGRLADILKQYAGKGKQVAIEGRLQQQSWETPEGKKASKIRVYVESAQLLGGQGQGQGGGSGDR---------TDSSNSYDSGVSSGYDDY 138
>gi|146329809|ref|YP_001209056.1| single-strand binding protein [Dichelobacter nodosus VCS1703A] >gi|146233279|gb|ABQ14257.1| single-strand binding protein [Dichelobacter nodosus VCS1703A] (169 aa)
Score = 152, Expect = 9.0e-09, Identities = 37/105 (35%), Positives = 62/105 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNN 105
           +NKV +VG + Q+P   V  NG   +  S+A+S NWN       + +T +  CVA++  A  I  Y+ KG  + I+G+L  R +  + G   Y  EI++  ++ L S+NS++
  S:     4 VNKVILVGNVGQNPDVRVMTNGEQVANFSLATSMNWNDRQTGEKREKTEWHRCVAYRRLAEIIGQYVRKGSKLYIEGRLETRKWQDQNGIDRYTTEIIVNEMQMLDSRNSSS 115
>gi|184154484|ref|YP_001842824.1| single-strand binding protein [Lactobacillus fermentum IFO 3956] >gi|183225828|dbj|BAG26344.1| single-strand binding protein [Lactobacillus fermentum IFO 3956] (241 aa)
Score = 152, Expect = 9.1e-09, Identities = 36/103 (34%), Positives = 60/103 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETY-----FFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           +N+V + GRL +DP+   TQ+G    R SIA    +   ET      F  CV W+++A     + HKG LV +DG+L   +Y +++G+ VY  E+ +E+   L  +++
  S:     2 LNRVVLTGRLTRDPELTYTQSGTPVLRFSIAVDRQFKNRETGRRDADFINCVIWRTSAENFARFTHKGALVGLDGRLSTSNYENQQGQRVYRTEVTVENFALLEPRSA 109
>gi|160931687|ref|ZP_02079081.1| hypothetical protein CLOLEP_00518 [Clostridium leptum DSM 753] >gi|156869332|gb|EDO62704.1| hypothetical protein CLOLEP_00518 [Clostridium leptum DSM 753] (150 aa)
Score = 152, Expect = 9.1e-09, Identities = 40/128 (31%), Positives = 65/128 (50%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQS 128
           +N   ++GRL  DP+   T + +  +  ++A   ++ K+    +  F   VAW+STA F+  Y HKG LVA+ G +  RSY  KEG      E+V        + N + A    D +Y+    + N Y Q++
  S:     2 LNTAILMGRLTADPELRHTPSDVAVTSFTLAVDRSYVKSGADRQVDFIDIVAWRSTAEFVCRYFHKGQLVAVQGSIQTRSYTDKEGNKRKAFEVV--------ADNVHFAEPKRDSSYSQAPAQQNAYRQET 125
>gi|134301136|ref|YP_001114632.1| single-strand binding protein [Desulfotomaculum reducens MI-1] >gi|134053836|gb|ABO51807.1| single-strand binding protein [Desulfotomaculum reducens MI-1] (140 aa)
Score = 152, Expect = 9.8e-09, Identities = 37/98 (37%), Positives = 57/98 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPL 98
           +NK+ ++GRL +DP+   T NG+  +R++IA      +   + ET F   V WQ  A    + L KG L+A+DG+L  RSY   +G      E+V +SI+ L
  S:     2 LNKIILIGRLTRDPELRYTTNGVAVARLTIAVDRPQFNREREKETDFIDIVVWQKLAETCANNLGKGRLIAVDGRLQIRSYDDSQGIRRKAAEVVADSIRFL 103
>gi|16081142|ref|NP_391970.1| single-strand DNA-binding protein [Bacillus subtilis subsp. subtilis str. 168] >gi|586039|sp|P37455|SSB_BACSU Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|467374|dbj|BAA05220.1| single strand DNA binding protein [Bacillus subtilis] >gi|2636637|emb|CAB16127.1| single-strand DNA-binding protein [Bacillus subtilis subsp. subtilis str. 168] (172 aa)
Score = 152, Expect = 1.0e-08, Identities = 36/102 (35%), Positives = 62/102 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKN 102
           +N+V +VGRL +DP+   T NG   +  ++A +  +     + E  F  CV W+  A  + ++L KG L  +DG+L  R+Y +++G+ V+V E+  ES++ L  KN
  S:     2 LNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTRNYENQQGQRVFVTEVQAESVQFLEPKN 107
>gi|167755263|ref|ZP_02427390.1| hypothetical protein CLORAM_00768 [Clostridium ramosum DSM 1402] >gi|167705313|gb|EDS19892.1| hypothetical protein CLORAM_00768 [Clostridium ramosum DSM 1402] (160 aa)
Score = 152, Expect = 1.0e-08, Identities = 36/142 (25%), Positives = 74/142 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESN 142
           +N+V +VGR+ +DP+   T  G   +  ++A + N+     + +  F  CV W+  A  +  Y  KG LV ++G++  RSY + +G+ VYV+E++ +S++ L ++ +        +       +  N     +M   E   +F+++
  S:     2 INRVVLVGRMTRDPELRRTPQGDAVTSFTLAVNRNFTSRDGQQQADFINCVVWRKPAENVERYCSKGSLVGVEGRIQTRSYDNTQGQKVYVVEVICDSVQFLETRAARERQPQPQQQMQQPYQQPQNNDNFYDMKTVELEKEFDNS 147
>gi|121534825|ref|ZP_01666645.1| single-strand binding protein [Thermosinus carboxydivorans Nor1] >gi|121306620|gb|EAX47542.1| single-strand binding protein [Thermosinus carboxydivorans Nor1] (128 aa)
Score = 151, Expect = 1.1e-08, Identities = 37/101 (36%), Positives = 56/101 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSD--NWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MNK  +VGRLAQDP    TQ+G   +  ++A +      + +  F P VAW   A  + +YL KG  + ++G+L  RSY  K+G   +V E+V   ++ L  K
  S:     1 MNKAILVGRLAQDPDVRYTQSGKAVASFNLAVNRYVGQGQQQADFIPIVAWDKLAETVGNYLAKGQRILVEGRLQVRSY-EKDGAKRWVTEVVALHVEFLEQK 102
>gi|153092992|gb|EDN74013.1| single-stranded DNA-binding protein [Mannheimia haemolytica PHL213] (152 aa)
Score = 151, Expect = 1.1e-08, Identities = 45/122 (36%), Positives = 72/122 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNA----ASSIDKNYNPTNTKNN 122
           +NKV IVGRL  DP+     NG T ++IS+A+S  W        K  T +   +A+++ A+ I  YL KG  V ++GKL  R + +++G   +  EI+ + ++ L S +S N+    A+    N  PTN  N+
  S:     4 INKVIIVGRLGNDPELRTMPNGDTTAKISVATSTEWTDKVSGDKKQATEWHSIIAFRNLADIIGKYLKKGSQVYVEGKLRTRKWQAQDGTDRWTTEIIADQLQMLGSSSSGNSNNNWATEPAGNPPPTNPYNH 136
>gi|168795723|ref|ZP_02820730.1| single-strand binding protein [Escherichia coli O157:H7 str. EC4042] (181 aa)
Score = 151, Expect = 1.2e-08, Identities = 46/135 (34%), Positives = 75/135 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP-----------LSSKNSNNAASSIDKNYNP-TNTKNNNYSQQSNMSVSEA 135
           +NKV +VGRL +DP+     NG   + + +A+S++W        + +T +   V +   A     YL KG  V I+G+L  RS+    G T YV EI++++  P           LS K  N++A S+ +N    T T     S+   ++V+ A
  S:     6 INKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDKQTGEMREQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSW-EDNGITRYVTEILVKTTAPCRCWYVPQVLRLSRKRGNSSAVSLSRNRRRVTITGFQTISRSERLTVTTA 158
>gi|182416747|ref|ZP_02948144.1| single-stranded DNA-binding protein [Clostridium butyricum 5521] >gi|182379404|gb|EDT76899.1| single-stranded DNA-binding protein [Clostridium butyricum 5521] (150 aa)
Score = 151, Expect = 1.2e-08, Identities = 37/93 (39%), Positives = 56/93 (60%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE 93
           MNKV ++GRL +DP+ +F    G   + +++A  D +N    +NE  F P V W   A    +Y+ KG  VAI G++  RSY +K+G   YV E+V +
  S:     1 MNKVVLIGRLTKDPELRFTPGTGAAVTTLTLAV-DRYNPKTGQNEADFIPVVIWGKQAESTANYMSKGGQVAISGRIQTRSYDAKDGTKRYVTEVVAD 97
>gi|167768834|ref|ZP_02440887.1| hypothetical protein ANACOL_00151 [Anaerotruncus colihominis DSM 17241] >gi|167669006|gb|EDS13136.1| hypothetical protein ANACOL_00151 [Anaerotruncus colihominis DSM 17241] (155 aa)
Score = 151, Expect = 1.3e-08, Identities = 36/114 (31%), Positives = 65/114 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNY 114
           +N++ I+GRL +DP+   T NG + +  ++A   ++      + ET F   +AW+STA F+  Y  KG +  ++G+L  R +  ++G      E++ +S+    SK  N+  S  D+NY
  S:     2 LNRIIIMGRLTRDPELRSTPNGTSVASFTLAVDRDFKNKQTGEKETDFIDMIAWRSTAEFVARYFTKGRMAVVEGRLQIRLWEDRDGNKRKSAEVIADSVYFGDSKKDNDGRS--DQNY 118
>gi|118045781|ref|ZP_01514438.1| single-strand binding protein [Chloroflexus aggregans DSM 9485] >gi|117997793|gb|EAV11977.1| single-strand binding protein [Chloroflexus aggregans DSM 9485] (175 aa)
Score = 150, Expect = 1.4e-08, Identities = 37/115 (32%), Positives = 57/115 (49%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYN 115
           +NKV + G L  DP+   T  G   +   +AS+  W      +  ET +F  VAW       N YL KG  V I+G+L  R +V ++G+  Y  E++ + +  LSSK         +  Y+
  S:     5 LNKVQLTGHLGADPEMRYTAQGSPVTTFRVASNRTWRDKDGHSHEETEWFRIVAWDKLGEICNQYLTKGTRVYIEGRLQTRKWVDRDGQERYTTEVIAQDMIILSSKGERGPVPDAEPVYD 125
>gi|157694461|ref|YP_001488923.1| single-strand DNA-binding protein [Bacillus pumilus SAFR-032] >gi|194016522|ref|ZP_03055136.1| single-stranded DNA-binding protein (SSB) (Helix-destabilizingprotein) [Bacillus pumilus ATCC 7061] >gi|157683219|gb|ABV64363.1| single-strand DNA-binding protein [Bacillus pumilus SAFR-032] >gi|194011995|gb|EDW21563.1| single-stranded DNA-binding protein (SSB) (Helix-destabilizingprotein) [Bacillus pumilus ATCC 7061] (181 aa)
Score = 150, Expect = 1.4e-08, Identities = 35/101 (34%), Positives = 61/101 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +N+V +VGRL +DP+   T NG   +  ++A +  +     + E  F  CV W+  A  + ++L KG L  +DG+L  R+Y +++G+ V+V E+  ES++ L  K
  S:     2 LNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTRNYENQQGQRVFVTEVQAESVQFLEPK 106
>gi|148245121|ref|YP_001219814.1| single-strand DNA-binding protein [Clostridium kluyveri DSM 555] >gi|146337001|gb|ABQ23612.1| single-strand DNA-binding protein [Clostridium kluyveri DSM 555] (103 aa)
Score = 150, Expect = 1.4e-08, Identities = 34/98 (34%), Positives = 57/98 (58%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPL 98
           MN+  ++GRL +DP+ +F   NG   +  ++A +  ++K+   E  F P V W   A    +YL KG L  + G++  RSY +K+G   YV E+V + ++ L
  S:     1 MNRTVLIGRLTKDPELKFTPSNGTAVTTFTLAINRRFSKDGQQEADFIPIVVWGKIAESSANYLTKGKLAGVAGRIQTRSYEAKDGTMRYVTEVVADEVQFL 102
>gi|85860099|ref|YP_462301.1| single-strand DNA binding protein [Syntrophus aciditrophicus SB] >gi|85723190|gb|ABC78133.1| single-strand DNA binding protein [Syntrophus aciditrophicus SB] (139 aa)
Score = 150, Expect = 1.6e-08, Identities = 39/118 (33%), Positives = 67/118 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN-----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAA--SSIDKNYNPTN 118
           +NK  ++GRL +DP+   T +G   +  S+A+   W +KN     ET +   V +   A    +YL KG LV I+G++  RS+  K+G   Y  EI+ + +K LS K ++     +  + +++P N
  S:     2 INKAILIGRLGKDPEVRYTPDGAMVTSFSLATDRQWKDKNGERAQETEWHNIVVFGKLAEICGNYLAKGLLVYIEGRIRSRSWEGKDGVKRYTTEIIAQDMKMLSPKGADRGEVRTQAEGHFSPFN 127
>gi|191164897|ref|ZP_03026751.1| single-strand binding protein [Geobacter sp. M21] >gi|190993998|gb|EDV69472.1| single-strand binding protein [Geobacter sp. M21] (148 aa)
Score = 150, Expect = 1.6e-08, Identities = 40/121 (33%), Positives = 59/121 (48%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSD-------NWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKN 121
           +NKV ++G L +DP+   T  G   +  S+A+++       NW + +T +     W   A     YL KG  V I+G+L  R +  KEGK  Y  EIV E ++ LSSK          +   P    N
  S:     4 LNKVMLIGNLGKDPEVRYTAGGTAVASFSVATTEKFKGKDGNWEE-KTEWHNITLWARLAEIAGEYLSKGKTVYIEGRLQTRKWTDKEGKDRYTTEIVGEKMQMLSSKGEGGGGGGGQRQSRPQQDNN 130
>gi|148267298|ref|YP_001246241.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH9] >gi|150393348|ref|YP_001316023.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH1] >gi|189427138|ref|YP_001949814.1| putative single stranded DNA binding protein [Staphylococcus phage phiMR25] >gi|147740367|gb|ABQ48665.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH9] >gi|149945800|gb|ABR51736.1| single-strand binding protein [Staphylococcus aureus subsp. aureus JH1] >gi|189339049|dbj|BAG48113.1| putative single stranded DNA binding protein [Staphylococcus phage phiMR25] (142 aa)
Score = 150, Expect = 1.6e-08, Identities = 40/131 (30%), Positives = 71/131 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMS 131
           +N+  +VGRL +DP+     NG+     ++A +  +     + E  F   V ++  A  + +YL KG L  +DG+L  RSY +K G+ V+V E+V +S++ L  KN+N   ++       T T NN +   + ++
  S:     2 LNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTRSYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAIT 136
>gi|57651266|ref|YP_185231.1| prophage L54a, single-stranded DNA binding protein [Staphylococcus aureus subsp. aureus COL] >gi|81859662|sp|Q5HJ26|SSBP_STAAC Prophage-derived single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|57285452|gb|AAW37546.1| prophage L54a, single-stranded DNA binding protein [Staphylococcus aureus subsp. aureus COL] (139 aa)
Score = 150, Expect = 1.6e-08, Identities = 36/101 (35%), Positives = 60/101 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +N+  +VGRL +DP+   T NG+     ++A +  +     + E  F   V ++  A  + +YL KG L  +DG+L  RSY +KEG+ V+V E+V +S++ L  K
  S:     2 LNRTVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTRSYDNKEGRRVFVTEVVADSVQFLEPK 106
>gi|153093461|gb|EDN74449.1| bifunctional single-stranded DNA-binding protein/integrase [Mannheimia haemolytica PHL213] (324 aa)
Score = 150, Expect = 1.7e-08, Identities = 45/122 (36%), Positives = 72/122 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNA----ASSIDKNYNPTNTKNN 122
           +NKV IVGRL  DP+     NG + ++IS+A+S  W        K  T +   +A+++ A+ I  YL KG  V ++GKL  R + +++G   +  EI+ + ++ L S NS N+    A+    N  PTN  N+
  S:     4 INKVIIVGRLGNDPELRTMPNGDSVAKISVATSTEWTDKTSGEKKQATEWHSIIAFRNLADIIGKYLKKGSQVYVEGKLRTRKWQAQDGTDRWTTEIIADQLQMLGSSNSGNSNNNWATEPAGNPPPTNPYNH 136
>gi|15895193|ref|NP_348542.1| Phage related SSB-like protein [Clostridium acetobutylicum ATCC 824] >gi|37999761|sp|Q97HT8|SSB2_CLOAB Single-stranded DNA-binding protein 2 (SSB 2) (Helix-destabilizing protein 2) >gi|15024899|gb|AAK79882.1|AE007698_16 Phage related SSB-like protein [Clostridium acetobutylicum ATCC 824] (133 aa)
Score = 150, Expect = 1.7e-08, Identities = 37/104 (35%), Positives = 58/104 (55%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNK---NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLS-SKNSN 104
           MNK  ++GRL +DP+ +++   G      ++A    + K    E  F P V W   A    +Y+ KG L+ + G++  RSY +K+G   YV E+V E +K L   K+SN
  S:     1 MNKTILIGRLTKDPELKYIPNTGTATCNFTLAVDRRFKKEGQQEADFIPIVVWGKQAESTANYMSKGKLMGVSGRIQTRSYDAKDGTRRYVTEVVAEEVKFLEWGKDSN 109
>gi|16080684|ref|NP_391512.1| hypothetical protein BSU36310 [Bacillus subtilis subsp. subtilis str. 168] >gi|1763709|emb|CAB05949.1| ywpH [Bacillus subtilis] >gi|2636156|emb|CAB15648.1| ywpH [Bacillus subtilis subsp. subtilis str. 168] (113 aa)
Score = 150, Expect = 1.8e-08, Identities = 34/106 (32%), Positives = 58/106 (54%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAA 107
           N+V +VGRL +DP    T  G   + +++A + ++       E  +  C  W+ TA     Y  KG LV + G++  RSY ++EG  VYV E++ ++++ +  K    AA
  S:     3 NQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVNCTLWRKTAENTALYCQKGSLVGVSGRIQARSYENEEGVNVYVTEVLADTVRFMDPKPREKAA 112
>gi|52082156|ref|YP_080947.1| single-strand binding protein [Bacillus licheniformis ATCC 14580] >gi|52787548|ref|YP_093377.1| YwpH [Bacillus licheniformis ATCC 14580] >gi|52005367|gb|AAU25309.1| Single-strand binding protein [Bacillus licheniformis ATCC 14580] >gi|52350050|gb|AAU42684.1| YwpH [Bacillus licheniformis DSM 13] (115 aa)
Score = 149, Expect = 1.9e-08, Identities = 30/97 (30%), Positives = 55/97 (56%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPL 98
           N++ +VGRL +DP+   T +G+  + +++A S  +       E  F  C  W+ TA     Y  KG ++ + G++  R YV+ EG+  ++ E+V  S++ L
  S:     3 NEIMLVGRLTKDPELRYTSDGVPVANVTLAVSRPFKNAAGEVEADFVNCTLWRKTAVNTAEYCEKGSIIGLSGRIQTRQYVNSEGERTFITEVVARSVRFL 103
>gi|154687752|ref|YP_001422913.1| YwpH [Bacillus amyloliquefaciens FZB42] >gi|154353603|gb|ABS75682.1| YwpH [Bacillus amyloliquefaciens FZB42] (113 aa)
Score = 149, Expect = 2.0e-08, Identities = 33/100 (33%), Positives = 55/100 (55%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           N V +VGRL +DP+   T  GI  + I++A + N+     +  T F  C  W+  A     Y  KG +V + G++  RSY   +G  VYV E++ ++++ +  K
  S:     3 NHVMLVGRLTKDPELRFTAAGIPVAHITLAVNRNFKSASGETGTDFVNCTIWRKNAENTALYCQKGSMVGVSGRIQTRSYEKTDGVKVYVTEVMADTVRFMDQK 106
>gi|9634636|ref|NP_038310.1| ORF9 [Streptococcus phage 7201] >gi|6716352|gb|AAF26608.1|AF118440_6 ORF9 [Streptococcus thermophilus bacteriophage 7201] (148 aa)
Score = 149, Expect = 2.1e-08, Identities = 44/133 (33%), Positives = 75/133 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS---NNAASSIDKNYNPT-NTKNNNYSQQSNMSVS 133
           +N   +VGRL +DP+   T + I  +  S+A + N+     + E  F  CV W+  A  + ++  KG L+ I G++  RSY +++G+ VYV E+V E+ + L S+ +    NA +S  +   P    KN  YS +  + +S
  S:     2 INNTVLVGRLTKDPEFKYTGSNIAVASFSLAVNRNFKDANGEREADFINCVIWRQQAENLANWAKKGALIGITGRIQTRSYENQQGQRVYVTEVVAENFQMLESRAAREGGNANNSYSQQQVPNFARKNTEYSNKQPLDIS 142
>gi|154502405|ref|ZP_02039465.1| hypothetical protein RUMGNA_00218 [Ruminococcus gnavus ATCC 29149] >gi|153797030|gb|EDN79450.1| hypothetical protein RUMGNA_00218 [Ruminococcus gnavus ATCC 29149] (143 aa)
Score = 149, Expect = 2.2e-08, Identities = 41/115 (35%), Positives = 64/115 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQS---RISIA----SSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYN 115
           MNK  ++GR+ +DP+     NG  Q+   R ++A         N+    F PCVA+   A F+  Y HKG  V ++G++   SY ++EG+ VY  EI +  I+   SK    AA+  ++N N
  S:     2 MNKAILMGRMTRDPE-IRYSNGPEQTAVGRFTLAVDRRGQRQGNQQNADFIPCVAFGKKAEFVEKYTHKGTKVIVEGEIRTGSYTNREGRKVYTTEIYVSDIEFAESK----AAAEQNQNRN 118
>gi|134298844|ref|YP_001112340.1| single-strand binding protein [Desulfotomaculum reducens MI-1] >gi|134051544|gb|ABO49515.1| single-strand binding protein [Desulfotomaculum reducens MI-1] (136 aa)
Score = 149, Expect = 2.3e-08, Identities = 38/98 (38%), Positives = 57/98 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPL 98
           +NKV ++GRL +DP+   T NGI  +++++A      +   + ET F   V WQ  A    + L KG LVA+DG+L  RSY   +G      E+V E++K L
  S:     2 LNKVILIGRLTRDPELRYTTNGIAVAKLNLAVERPQFNREREKETDFIDIVVWQRLAEICANNLGKGRLVAVDGRLQVRSYDDNQGIRRKAAEVVAENVKFL 103
>gi|83589002|ref|YP_429011.1| single-strand binding protein [Moorella thermoacetica ATCC 39073] >gi|83571916|gb|ABC18468.1| single-strand binding protein [Moorella thermoacetica ATCC 39073] (154 aa)
Score = 148, Expect = 2.5e-08, Identities = 31/98 (31%), Positives = 57/98 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE----TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPL 98
           +N+V ++GRL +DP+   T +G+  +  ++A   N+   +    T F     W+  A    ++L KG LVA+DG+L  R+Y + +G+   V ++V E ++ L
  S:     2 LNRVILIGRLTRDPELRYTASGVAMTTFTLAVDRNFVNQQGERGTDFIRITVWRKLAETCANHLGKGRLVAVDGRLQTRTYETPDGQKRSVTDVVAEDVRFL 103
>gi|163754299|ref|ZP_02161421.1| single-strand binding protein [Kordia algicida OT-1] >gi|161325240|gb|EDP96567.1| single-strand binding protein [Kordia algicida OT-1] (110 aa)
Score = 148, Expect = 2.7e-08, Identities = 33/94 (35%), Positives = 57/94 (60%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESI 95
           N+V ++G L  DP+    ++G   ++ SIA+++ +   +      TY+   +AW  TA  +  YL KG  +AI+GKL  R+Y + EG+  YV E+++  I
  S:     6 NRVQLIGNLGNDPEIINLEDGKKIAKFSIATNETYKNAQGDKIENTYWHNLIAWNKTAEIVEKYLLKGKEIAIEGKLTNRTYETDEGEKKYVTEVLVNEI 105
>gi|118587177|ref|ZP_01544605.1| single-stranded DNA-binding protein [Oenococcus oeni ATCC BAA-1163] >gi|118432319|gb|EAV39057.1| single-stranded DNA-binding protein [Oenococcus oeni ATCC BAA-1163] (183 aa)
Score = 148, Expect = 2.8e-08, Identities = 43/142 (30%), Positives = 78/142 (54%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSV-SEAMDDFESNF 143
           N+V +VGRL +D +   T NG      +IA   N+     + E  F  CV W+  A    ++  KG +V ++G++  R+Y + +G+ VYV E+V+++ + L ++  + A  S  +N +  N  N     QSN ++ ++  + F+S F
  S:     1 NRVVLVGRLTRDVELRYTGNGDAVGSFTIAVERNFTNRAGEREADFISCVIWRKPAENFANFTGKGAMVGVEGRIQTRTYDNNQGQKVYVTEVVVDNFQLLETRAQSEARRS--QNGSAGNMGNTAPQSQSNFNIPNQQSNPFDSQF 145
>gi|91216094|ref|ZP_01253062.1| Single-strand binding protein [Psychroflexus torquis ATCC 700755] >gi|91185611|gb|EAS71986.1| Single-strand binding protein [Psychroflexus torquis ATCC 700755] (112 aa)
Score = 148, Expect = 2.8e-08, Identities = 39/100 (39%), Positives = 57/100 (56%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           N V ++G L QDP+     +G    + SIA+++ ++         TY+   +AW  TA+FI +Y+ KG  V I GKL  RSY +KEG+  Y+ EI    I   S K
  S:     6 NSVQLMGHLGQDPEVVNLDSGKKLVKFSIATNEYYHDTSGEKVTNTYWHNIIAWGKTASFIETYVKKGQEVLIKGKLAPRSYETKEGEKRYITEINCSEIVTTSQK 111
>gi|86743196|ref|YP_483596.1| single-strand DNA-binding protein [Frankia sp. CcI3] >gi|86570058|gb|ABD13867.1| single-strand binding protein [Frankia sp. CcI3] (186 aa)
Score = 148, Expect = 2.8e-08, Identities = 32/94 (34%), Positives = 52/94 (55%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIASS--------DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + +VG LA DP+   T NG   +  ++AS+        + W   E  F  C  W+  A  +   L KG  V + G+L +RS+ ++EG+   VIE+ ++ I P
  S:     7 ITVVGNLANDPELRFTPNGAAVASFTVASTPRTLDRQTNEWKDGEALFLRCSIWRQAAEHVAESLQKGARVIVTGRLKQRSFETREGEKRTVIELDVDEIGP 108
>gi|160881891|ref|YP_001560859.1| single-strand binding protein [Clostridium phytofermentans ISDg] >gi|160430557|gb|ABX44120.1| single-strand binding protein [Clostridium phytofermentans ISDg] (146 aa)
Score = 148, Expect = 2.8e-08, Identities = 36/117 (30%), Positives = 70/117 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQ--NGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPT 117
           MNKV ++GRL +DP+   +Q  N +  +R S+A + ++ +    +  FF C A+   A F   YL +G  + I G++ + +Y +K+G+ VY ++++++  +   SKN++ + S     Y P+
  S:     1 MNKVILMGRLTRDPEIRYSQGANSLAIARYSLAVNRSFKREGEPDADFFNCTAFGRNAEFAEKYLKQGTRILISGRIQQDNYTNKDGQKVYSVQVIVDEQEFAESKNASGSESG---GYQPS 119
>gi|163858084|ref|YP_001632382.1| single-strand binding protein [Bordetella petrii DSM 12804] >gi|163261812|emb|CAP44114.1| single-strand binding protein [Bordetella petrii] (159 aa)
Score = 148, Expect = 2.9e-08, Identities = 38/109 (34%), Positives = 59/109 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKE-GKTVYVIEIVIESIKPLSSKNSNNAASS 109
           +NKV I+G L +DP+   + +G+    IS+A+S NW        + ET +   V +   A     YL +G  V I+G+L  R +  KE G   Y  EIV E ++ L  + ++  A S
  S:     4 VNKVIIIGNLGRDPEIRYSADGVGICTISVATSTNWKDKATGEKREETEWHRIVFYNRLAEIAGEYLRQGSAVYIEGRLKTRKWQDKETGADRYSTEIVAEQMQMLGGRGADGQAPS 120
>gi|86140963|ref|ZP_01059522.1| Single-strand binding protein [Flavobacterium sp. MED217] >gi|85832905|gb|EAQ51354.1| Single-strand binding protein [Leeuwenhoekiella blandensis MED217] (110 aa)
Score = 148, Expect = 3.0e-08, Identities = 37/90 (41%), Positives = 56/90 (62%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN------ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIV 91
           NKV ++G L  DP+     +G   ++ SIA+++ +  N      +T +   VAW  TA  I +Y+ KG  VAI+GKL  RSY +K+G+  Y+ EIV
  S:     6 NKVQLIGNLGNDPEIVNLDSGKKLAKFSIATNETYKNNKGERVTDTQWHNVVAWGKTAEVIENYVTKGKEVAIEGKLTSRSYETKQGEKRYLTEIV 101
>gi|88711316|ref|ZP_01105404.1| single-strand binding protein [Flavobacteriales bacterium HTCC2170] >gi|88710257|gb|EAR02489.1| single-strand binding protein [Flavobacteriales bacterium HTCC2170] (110 aa)
Score = 148, Expect = 3.0e-08, Identities = 35/89 (39%), Positives = 56/89 (62%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEI 90
           NKV ++G L  DP+      G   ++ SIA+++++         +T +   VAW  TA  + +YL+KG+ VAI+GKL  RSY +KEG+  Y+ E+
  S:     6 NKVQLIGNLGNDPEIVNLDGGNKLAKFSIATNESYKNAQGEKVTDTQWHNVVAWGKTAEIVENYLNKGNEVAIEGKLTHRSYETKEGEKRYITEV 100
>gi|111226185|ref|YP_716979.1| single-strand DNA-binding protein [Frankia alni ACN14a] >gi|111153717|emb|CAJ65475.1| Single-strand binding protein 2 (SSB 2) (Helix-destabilizing protein 2) [Frankia alni ACN14a] (187 aa)
Score = 147, Expect = 3.1e-08, Identities = 31/94 (32%), Positives = 51/94 (54%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIASS--------DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + +VG L  DP+   T NG   +  +IAS+        + W   E  F  C  W+  A  +   L KG  V + G+L +RS+ ++EG+   VIE+ ++ + P
  S:     7 ITVVGNLTSDPELRFTSNGAAVASFTIASTPRTLDRQTNEWKDGEALFLRCSIWRQAAEHVAESLQKGARVIVTGRLKQRSFETREGEKRTVIELEVDEVGP 108
>gi|154688194|ref|YP_001423355.1| hypothetical protein RBAM_037990 [Bacillus amyloliquefaciens FZB42] >gi|154354045|gb|ABS76124.1| Ssb [Bacillus amyloliquefaciens FZB42] (172 aa)
Score = 147, Expect = 3.2e-08, Identities = 35/102 (34%), Positives = 62/102 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKN 102
           +N+V +VGRL +DP+   T +G   +  ++A +  +     + E  F  CV W+  A  + ++L KG L  +DG+L  R+Y +++G+ V+V E+  ES++ L  KN
  S:     2 LNRVVLVGRLTKDPELRYTPSGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTRNYENQQGQRVFVTEVQAESVQFLEPKN 107
>gi|145628571|ref|ZP_01784371.1| single-strand DNA-binding protein [Haemophilus influenzae 22.1-21] >gi|507347|gb|AAA60461.1| SSB >gi|144979041|gb|EDJ88727.1| single-strand DNA-binding protein [Haemophilus influenzae 22.1-21] (168 aa)
Score = 147, Expect = 3.2e-08, Identities = 44/128 (34%), Positives = 66/128 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKN------SNNAASSIDKNYNPTNTKNNNYSQQS 128
           +NKV IVG L  DP+     NG   + IS+A+S++WN       +  T +   V ++  A     YL KG  V ++G+L  R +  + G+  Y  EI  + ++ L  +N      SN   SS   +Y    T N N  Q S
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSESWNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKWQDQNGQDRYTTEIQGDVMQMLGGRNQNAGGFSNEMGSSPQPSYQARQTNNGNSYQSS 144
>gi|42629699|ref|ZP_00155244.1| COG0629: Single-stranded DNA-binding protein [Haemophilus influenzae R2846] (168 aa)
Score = 147, Expect = 3.2e-08, Identities = 47/142 (33%), Positives = 71/142 (50%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSID------KNYNPTNTKNNNY-------SQQSNMSVSEAMDDFESN 142
           +NKV IVG L  DP+     NG   + IS+A+S++WN       +  T +   V ++  A     YL KG  V ++G+L  R +  + G+  Y  EI  + ++ L  +N N   S  D       +Y    T N N         QQS       MD F+ +
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSESWNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKWQDQNGQDRYTTEIQGDVMQMLGGRNQNAGGSGNDMGGAPQSSYQARQTNNGNSYQSSRPAPQQSAPQAEPPMDGFDDD 165
>gi|148827387|ref|YP_001292140.1| single-strand DNA-binding protein [Haemophilus influenzae PittGG] >gi|148718629|gb|ABQ99756.1| single-strand DNA-binding protein [Haemophilus influenzae PittGG] (168 aa)
Score = 147, Expect = 3.3e-08, Identities = 44/128 (34%), Positives = 66/128 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKN------SNNAASSIDKNYNPTNTKNNNYSQQS 128
           +NKV IVG L  DP+     NG   + IS+A+S++WN       +  T +   V ++  A     YL KG  V ++G+L  R +  + G+  Y  EI  + ++ L  +N      SN   SS   +Y    T N N  Q S
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSESWNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKWQDQNGQDRYTTEIQGDVMQMLGGRNQNAGGFSNEMGSSPQPSYQARQTNNGNSYQSS 144
>gi|19745475|ref|NP_606611.1| putative single strand binding protein [Streptococcus pyogenes MGAS8232] >gi|37999718|sp|Q8P2H3|SSB1_STRP8 Single-stranded DNA-binding protein 1 (SSB 1) (Helix-destabilizing protein 1) >gi|19747591|gb|AAL97110.1| putative single strand binding protein [Streptococcus pyogenes MGAS8232] (130 aa)
Score = 147, Expect = 3.3e-08, Identities = 34/110 (30%), Positives = 68/110 (61%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSI 110
           +N V ++GRL +D +   T + +  ++ ++A + N+     + E  F  CV W+ +A  ++++  KG L+AI G++  R+Y +++G+ VYV E+V ES + L  +++    SS+
  S:     2 INNVVLIGRLTKDVELRYTPSQVACAQFTLAVNRNFKNQDGQKEADFINCVIWRKSAENLSNWAKKGQLIAITGRIQTRNYENQQGQRVYVTEVVAESFQILEKRDNTANTSSL 115
>gi|154482843|ref|ZP_02025291.1| hypothetical protein EUBVEN_00539 [Eubacterium ventriosum ATCC 27560] >gi|149736271|gb|EDM52157.1| hypothetical protein EUBVEN_00539 [Eubacterium ventriosum ATCC 27560] (149 aa)
Score = 147, Expect = 3.3e-08, Identities = 43/138 (31%), Positives = 75/138 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQ---SRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK---NSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDD 138
           MNKV ++GRL +DP+   + +G  Q   +R ++A    + ++      F  CVA+  +  F   Y H+G  +  +G++   SY  K+GKTVY  E+V+E+ +   SK   +SNN          PT    + +     M++ +++DD
  S:     1 MNKVILMGRLTRDPEVRYSTSGDNQLAIARYTLAVDRRFKRDGDQSADFIRCVAFGRSGEFAEKYFHQGTKIVAEGRIQTGSYQDKDGKTVYTTEVVVENQEFAESKATADSNNYQPQQPVASQPTAPAGDGF-----MNIPDSVDD 142
>gi|29374669|ref|NP_813821.1| single-strand binding protein [Enterococcus faecalis V583] >gi|37999373|sp|Q839Y9|SSB_ENTFA Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|29342127|gb|AAO79893.1| single-strand binding protein [Enterococcus faecalis V583] (188 aa)
Score = 147, Expect = 3.4e-08, Identities = 40/124 (32%), Positives = 74/124 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSN----NAASSIDKNYNPTNTKNNNY 124
           +N V +VGRL +DP    T +G   +  ++A + N+ N+N   E  F  CV W+  A  + +Y  KG L+ + G++  R+Y +++G+ VYV E+V E+ + L S++++        S + N N   ++N ++
  S:     2 INNVVLVGRLTKDPDLRYTASGSAVATFTLAVNRNFTNQNGDREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTRNYENQQGQRVYVTEVVCENFQLLESRSASEQRGTGGGSFNNNENGYQSQNRSF 133
>gi|60681802|ref|YP_211946.1| putative single-strand binding protein [Bacteroides fragilis NCTC 9343] >gi|60493236|emb|CAH08018.1| putative single-strand binding protein [Bacteroides fragilis NCTC 9343] (129 aa)
Score = 147, Expect = 3.8e-08, Identities = 36/101 (35%), Positives = 56/101 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE--------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +NK   +G + +D +   T+ GI  ++ SIA ++    N+        T + P VAW+  A  I  Y HKG  + I+G+   R Y + +G+   V EIV ESI+ L  K
  S:     3 VNKCIFIGNMGRDAEVRTTETGIKVAQFSIACTERAYTNKAGQTIPERTEWIPVVAWRGLAETIEKYTHKGSKLYIEGRFTTRKYETNDGQKRTVSEIVAESIEMLDPK 111
>gi|153810612|ref|ZP_01963280.1| hypothetical protein RUMOBE_00993 [Ruminococcus obeum ATCC 29174] >gi|149833791|gb|EDM88872.1| hypothetical protein RUMOBE_00993 [Ruminococcus obeum ATCC 29174] (152 aa)
Score = 147, Expect = 3.8e-08, Identities = 37/116 (31%), Positives = 66/116 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVT--QNGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNN--AASSIDKNYNP 116
           MNKV ++GRL +DP+   +  +N +  +R ++A    + ++      F  CV +   A F   Y H+G  + + G++   SY +++G+ VY  E+V+E  +   SK S++  AAS   +N  P
  S:     1 MNKVILMGRLTRDPEVRYSAGENALAIARYTLAVDRRFRRDGEATADFISCVVFGRGAEFAEKYFHQGIRIVVSGRIQTGSYTNRDGQKVYTTEVVVEEQEFAESKASSDSYAASHPQQNAAP 123
>gi|42523087|ref|NP_968467.1| single-strand binding protein [Bdellovibrio bacteriovorus HD100] >gi|39575292|emb|CAE79460.1| single-strand binding protein [Bdellovibrio bacteriovorus HD100] (143 aa)
Score = 147, Expect = 3.8e-08, Identities = 41/123 (33%), Positives = 71/123 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN-----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSS----KNSNNAASSIDKNYN---PTNTKNNN 123
           +NKV +VGRL  DP+     +G T +R+++A+S++W K+      T +     W   A     +L KG  V ++GKL  R +  ++G+  Y  EIV  +++ L +    K+S N+  + D N+    P  + N+N
  S:     4 VNKVILVGRLGADPEVKAIGSGSTVARLNLATSESWVKDGQRQERTEWHRITVWGKLAEICGKHLSKGRQVYVEGKLQTRQWEDQQGQKRYTTEIVASTVQFLGAAGGEKSSGNSMGNDDFNFQDFGPEPSFNSN 138
>gi|56459467|ref|YP_154748.1| single-stranded DNA-binding protein [Idiomarina loihiensis L2TR] >gi|56178477|gb|AAV81199.1| Single-stranded DNA-binding protein [Idiomarina loihiensis L2TR] (186 aa)
Score = 147, Expect = 3.9e-08, Identities = 34/101 (33%), Positives = 57/101 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +NKV ++G L  DP+   TQN    + +SIA+S+ W        + +T +  CVA++  A     YL KG  V ++G+L  R +  ++    Y  E+VI  ++ L S+
  S:     6 VNKVILIGNLGADPEVRYTQNSTAIANLSIATSETWKDKQTGEPREQTEWHRCVAYRRLAEIAGEYLKKGSKVYVEGRLQTRKWTGQDNVERYTTEVVINEMQMLDSR 113
>gi|68248857|ref|YP_247969.1| single-strand DNA-binding protein [Haemophilus influenzae 86-028NP] >gi|68057056|gb|AAX87309.1| Single-strand binding protein [Haemophilus influenzae 86-028NP] (168 aa)
Score = 146, Expect = 4.2e-08, Identities = 43/128 (33%), Positives = 66/128 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSID------KNYNPTNTKNNNYSQQS 128
           +NKV IVG L  DP+     NG   + IS+A+S++WN       +  T +   V ++  A     YL KG  V ++G+L  R +  + G+  Y  EI  + ++ L  +N N + S  D       +Y    T N N  Q S
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSESWNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKWQDQNGQDRYATEIQGDVMQMLGGRNQNASGSGNDMGGTPQSSYQARQTNNGNSYQSS 144
>gi|187935202|ref|YP_001887720.1| single-strand binding protein [Clostridium botulinum B str. Eklund 17B] >gi|187723355|gb|ACD24576.1| single-strand binding protein [Clostridium botulinum B str. Eklund 17B] (147 aa)
Score = 146, Expect = 4.3e-08, Identities = 43/129 (33%), Positives = 66/129 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSN 129
           MNKV ++GRL +DP+   T    T       + D +N    + E  F P V W   A    +Y+ KG  +AI G++  R+Y +K+G   YV E+V   ++ LS    +NA+ ++  NY      N  YS  +N
  S:     1 MNKVVLIGRLTKDPELRFTPGAGTAVTTLTLAVDKYNSKSGQKEADFVPVVVWGKQAESTANYMSKGSQMAISGRIQTRNYEAKDGTKRYVTEVVATEVQFLS---KSNASGNVGTNYG----NNTEYSSSNN 126
>gi|170718024|ref|YP_001785065.1| single-strand binding protein [Haemophilus somnus 2336] >gi|168826153|gb|ACA31524.1| single-strand binding protein [Haemophilus somnus 2336] (150 aa)
Score = 146, Expect = 4.6e-08, Identities = 39/114 (34%), Positives = 60/114 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNY 114
           +NKV IVG L  DP+     NG   + IS+A+S++W        +  T +   V ++  A     YL KG  + I+GKL  R +  + G+  Y  EI  E ++ L S+N+ N+      NY
  S:     4 INKVIIVGNLGNDPEMRTMPNGEAVANISVATSESWTDKNTGERREVTEWHRIVFYRRYAEICGQYLRKGSKIYIEGKLRTRKWQDQNGQERYTTEIQGELLQMLDSRNATNSVDGQQSNY 124
>gi|47459061|ref|YP_015923.1| single strand binding protein [Mycoplasma mobile 163K] >gi|47458390|gb|AAT27712.1| single strand binding protein [Mycoplasma mobile 163K] (175 aa)
Score = 146, Expect = 5.0e-08, Identities = 54/160 (33%), Positives = 92/160 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNG-ITQSRISIA-SSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSID--KNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKE 160
           MNKV +VGR+AQ  +   T N  I   R  +A   DN ++N   ++ F P +AW++TA F+N+Y++ GDLV+++G     ++ +   + V V E+ I +IK L SK + +         N+      N+N+S+ + +  SE     +S+  QKTS +  T  +E++E
  S:     6 MNKVLLVGRIAQKGELKETSNSNIPYVRFRVAVRKDNVSQNAREDSDFIPVIAWRNTATFVNNYMNIGDLVSVEGTFSTSTFKNSNDEFVNVYEVTISNIKSLESKKARDERKEFQGTNNFETKQKSNSNFSEPTFVDSSEN----KSSKIQKTSQSFKTETDEDEE 168
>gi|169826615|ref|YP_001696773.1| single-stranded DNA-binding protein (SSB) (helix-destabilizing protein) [Lysinibacillus sphaericus C3-41] >gi|168991103|gb|ACA38643.1| Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) [Lysinibacillus sphaericus C3-41] (143 aa)
Score = 146, Expect = 5.1e-08, Identities = 34/107 (31%), Positives = 60/107 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIK--PLSSKNSNNAA 107
           MN+V +VGR  +DP          Q+  S+A + N+  N    +T F  C  W   A  I  Y  KG L+  +G++  RS+V++E   +++ E+V+E ++   L  ++S+ A+
  S:    12 MNQVGLVGRFTKDPVLRYLSGNRVQTHFSLAINRNFKNNHGEIDTDFIFCTVWGRLAEHIVKYCGKGSLIGANGRIQTRSFVNEENTKIFMTEVVVEDVRFYQLKQRDSDEAS 124
>gi|153956491|ref|YP_001397256.1| hypothetical protein CKL_3909 [Clostridium kluyveri DSM 555] >gi|146349349|gb|EDK35885.1| Ssb3 [Clostridium kluyveri DSM 555] (146 aa)
Score = 146, Expect = 5.1e-08, Identities = 42/126 (33%), Positives = 70/126 (55%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPL-----SSKNSNNAASSIDKNYNPTNTKNNNYSQ 126
           MNKV ++GRL +DP+ +F    G   +  +IA    + ++   E  F P V W   A    +Y+ KG L+ I G++  RSY S++G   YV E++ E ++ L     S +++N    S D        KN+N+++
  S:     1 MNKVVLIGRLTKDPELRFTPGMGKAVTTFTIAVDRRFTRDGQREADFIPIVVWGKQAESTANYMSKGKLIGISGRIQTRSYESRDGIRKYVTEVIAEEVQFLEWGQKSVRDNNTEVLSEDFG------KNSNFNE 129
>gi|145640173|ref|ZP_01795757.1| single-strand DNA-binding protein [Haemophilus influenzae R3021] >gi|145274759|gb|EDK14621.1| single-strand DNA-binding protein [Haemophilus influenzae 22.4-21] (168 aa)
Score = 145, Expect = 5.7e-08, Identities = 47/142 (33%), Positives = 71/142 (50%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS------NNAASSIDKNYNPTNTKNNNY-------SQQSNMSVSEAMDDFESN 142
           +NKV IVG L  DP+     NG   + IS+A+S++WN       +  T +   V ++  A     YL KG  V ++G+L  R +  + G+  Y  EI  + ++ L  +N       N   SS   +Y    T N N         QQS       MD F+ +
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSESWNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKWQDQNGQDRYTTEIQGDVMQMLGGRNQNAGGYGNEMGSSPQPSYQARQTNNGNSYQSSRPAPQQSAPQAEPPMDGFDDD 165
>gi|148825471|ref|YP_001290224.1| single-strand DNA-binding protein [Haemophilus influenzae PittEE] >gi|148715631|gb|ABQ97841.1| single-strand DNA-binding protein [Haemophilus influenzae PittEE] (168 aa)
Score = 145, Expect = 6.0e-08, Identities = 43/129 (33%), Positives = 67/129 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNT-----KNNNYSQQSN 129
           +NKV IVG L  DP+     NG   + IS+A+S++WN       +  T +   V ++  A     YL KG  V ++G+L  R +  + G+  Y  EI  + ++ L  +N N    S D    P ++      NN  S QS+
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSESWNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKWQDQNGQDRYTTEIQGDVMQMLGGRNQNAGGYSNDMGSTPQSSYQARQTNNGGSYQSS 144
>gi|29375138|ref|NP_814291.1| single-strand binding protein [Enterococcus faecalis V583] >gi|21693289|gb|AAM75236.1|AF454824_30 EF0030 [Enterococcus faecalis] >gi|29342597|gb|AAO80362.1| single-strand binding protein [Enterococcus faecalis V583] (138 aa)
Score = 145, Expect = 6.2e-08, Identities = 36/103 (34%), Positives = 54/103 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           M K   VGRL +  +  VT  G   +  ++A      D     +T F  CV W   A  +  Y  KG L+A++G+L  RSY  ++G+T YV E+V+   + L SK +
  S:     1 MIKTSAVGRLTKSSELRVTSTGKAVANFALACKRERLDKEGNAQTTFIQCVIWGKPAEVLAKYTQKGSLIAVNGELQSRSYDDQQGQTHYVTELVVAGFEFLESKET 107
>gi|149004500|ref|ZP_01829220.1| putative single strand binding protein [Streptococcus pneumoniae SP14-BS69] >gi|147757599|gb|EDK64620.1| putative single strand binding protein [Streptococcus pneumoniae SP14-BS69] (138 aa)
Score = 145, Expect = 6.4e-08, Identities = 44/123 (35%), Positives = 69/123 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNN 123
           +N V +VGRL   P    T N ++  + ++A + N+ N+N   E  F    AW+ TA+ I  Y  KG L+ I G+L  RSY  K+G+  YV E++ ES+  L S+NS +   +  +N N +   + N
  S:     2 INNVTLVGRLVAPPDLRKTPNNVSSLQGTLAVNRNFKNENGEREADFINFQAWRGTADIIAQYCSKGSLIGIIGRLQVRSY-EKDGQRRYVTEVIAESVALLESRNSQHGQGNSFQNGNSSPFTDPN 127
>gi|145620479|ref|ZP_01776509.1| single-strand binding protein [Geobacter bemidjiensis Bem] >gi|144943228|gb|EDJ78323.1| single-strand binding protein [Geobacter bemidjiensis Bem] >gi|197089696|gb|ACH40967.1| single-strand binding protein [Geobacter bemidjiensis Bem] (146 aa)
Score = 145, Expect = 6.8e-08, Identities = 37/101 (36%), Positives = 56/101 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSD-------NWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +NKV ++G L +DP+   T  G   +  S+A+++       NW + +T +     W   A     YL KG  V I+G+L  R +  KEGK  Y  EIV E ++ LS+K
  S:     4 LNKVMLIGNLGKDPEVRYTAGGTAVASFSVATTEKFKGKDGNWEE-KTEWHNITLWARLAEIAGEYLSKGKTVYIEGRLQTRKWTDKEGKDRYTTEIVGEKMQMLSAK 110
>gi|163764634|ref|ZP_02171689.1| Single-stranded DNA-binding protein-like protein [Bacillus selenitireducens MLS10] >gi|160354815|gb|EDP81473.1| Single-stranded DNA-binding protein-like protein [Bacillus selenitireducens MLS10] (141 aa)
Score = 144, Expect = 7.2e-08, Identities = 38/116 (32%), Positives = 66/116 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKNETY---FFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK-NSNNAASSIDKNYNP 116
           MN+  + GR+A +P+   TQ+G    +  +A   ++ +K++ Y   F P VAW++TA  I  Y  KG  V I G+L   +Y+ K+      +E++ E +  L  K +++  A+ +DKN  P
  S:     1 MNQFSLAGRIANEPELGCTQHGKHYVKFQLAVKRSFRSKDQEYKTDFIPVVAWRNTAETIKEYCGKGSTVTITGRLAPMTYLPKDHSLYNRVEVIAEKVGFLHLKPSTDQQAACLDKNECP 121
>gi|188589779|ref|YP_001922703.1| single-strand binding protein [Clostridium botulinum E3 str. Alaska E43] >gi|188500060|gb|ACD53196.1| single-strand binding protein [Clostridium botulinum E3 str. Alaska E43] (147 aa)
Score = 144, Expect = 7.3e-08, Identities = 43/129 (33%), Positives = 66/129 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSN 129
           MNKV ++GRL +DP+   T    T       + D +N    + E  F P V W   A    +Y+ KG  +AI G++  R+Y +K+G   YV E+V   ++ LS    +NA+ ++  NY      N  YS  +N
  S:     1 MNKVVLIGRLTKDPELRFTPGAGTAVTTLTLAVDKYNSKSGQKEADFVPVVVWGKQAESTANYMSKGSQMAISGRIQTRNYEAKDGTKRYVTEVVATEVQFLS---KSNASGNVGTNYG----NNTEYSSSNN 126
>gi|145635157|ref|ZP_01790862.1| single-strand DNA-binding protein [Haemophilus influenzae PittAA] >gi|145267578|gb|EDK07577.1| single-strand DNA-binding protein [Haemophilus influenzae PittAA] (168 aa)
Score = 144, Expect = 7.4e-08, Identities = 43/128 (33%), Positives = 66/128 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNA------ASSIDKNYNPTNTKNNNYSQQS 128
           +NKV IVG L  DP+     NG   + IS+A+S++WN       +  T +   V ++  A     YL KG  V ++G+L  R +  + G+  Y  EI  + ++ L  +N N +       SS   +Y    T N N  Q S
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSESWNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKWQDQNGQDRYTTEIQGDVMQMLGGRNQNASGYGNEMGSSPQPSYQARQTNNGNSYQSS 144
>gi|134300456|ref|YP_001113952.1| single-strand binding protein [Desulfotomaculum reducens MI-1] >gi|134053156|gb|ABO51127.1| single-strand binding protein [Desulfotomaculum reducens MI-1] (224 aa)
Score = 144, Expect = 7.5e-08, Identities = 37/101 (36%), Positives = 58/101 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKE-GKTVYVIEIVIESIKPLSSK 101
           MN V I+GRL +DP+   TQNG   + +SIA     NK+E  FF C A++ TA  I + L KG  V + G+L +  +  ++ G+    ++I++ SI  +  K
  S:     1 MNSVNIIGRLTRDPELRYTQNGKAVTNMSIAVQRYGNKDEADFFDCTAFEKTAETIANNLTKGREVGVSGRLQQERWDDQQTGQKRSAVKIMVNSITFIGPK 102
>gi|187776998|ref|ZP_02993471.1| hypothetical protein CLOSPO_00543 [Clostridium sporogenes ATCC 15579] >gi|187773926|gb|EDU37728.1| hypothetical protein CLOSPO_00543 [Clostridium sporogenes ATCC 15579] (128 aa)
Score = 144, Expect = 7.6e-08, Identities = 37/109 (33%), Positives = 62/109 (56%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNK--NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           MN+V ++GRL +D + +++    ++  R  IA +  +NK  ++T + P V W   A  I+ Y+ KG L+++ G++  R+Y  K G   Y IEIV   IK L  K  +   S+
  S:    17 MNRVMLIGRLTKDAELKYIEDRDVSLLRFVIAVNRYYNKENSKTDYIPIVVWGRHAEAIHKYMEKGKLISVVGRIQARNYEDKNGNKKYGIEIVSNEIKFLDPKKIDKVVSN 128
>gi|145597064|ref|YP_001161361.1| single-strand binding protein [Salinispora tropica CNB-440] >gi|145306401|gb|ABP56983.1| single-strand binding protein [Salinispora tropica CNB-440] (169 aa)
Score = 144, Expect = 7.9e-08, Identities = 30/94 (31%), Positives = 50/94 (53%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIAS--------SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + ++G L  DP+   T +G   ++  +AS        S  W   E  F  C  W+  A  +   L +G  V + G+L +RSY ++EG+   VIE+ ++ I P
  S:     7 ITVIGNLTDDPELRFTPSGAAVAKFRVASTPRFFDKSSSEWKDGEPLFLSCTVWRQAAEHVAESLQRGTRVIVSGRLRQRSYETREGEKRTVIELEVDEIGP 108
>gi|145637152|ref|ZP_01792814.1| dihydrodipicolinate synthase [Haemophilus influenzae PittHH] >gi|145269597|gb|EDK09538.1| dihydrodipicolinate synthase [Haemophilus influenzae PittHH] (173 aa)
Score = 144, Expect = 8.2e-08, Identities = 43/135 (31%), Positives = 70/135 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNT-----KNNNYSQQSNMSVSEA 135
           +NKV IVG L  DP+     NG   + IS+A+S++WN       +  T +   V ++  A     YL KG  V ++G+L  R +  + G+  Y  EI  + ++ L  +N N  +   D    P ++      NN  S QS+ S  ++
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSESWNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKWQDQNGQDRYTTEIQGDVMQMLGGRNQNAGSYGNDMGGAPQSSYQARQTNNGGSYQSSRSAPQS 150
>gi|38230576|gb|AAR14310.1| ORF183 [Lactococcus phage ul36.13] (183 aa)
Score = 143, Expect = 8.9e-08, Identities = 35/102 (34%), Positives = 61/102 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKN 102
           +N V +VGRL +D +   T      +  S+A S ++     + ET F  CV W+  A  + ++ HKG L+ I G++  R+Y +++G+ VYV E+V +S + L S++
  S:     2 INNVVLVGRLTKDVELRYTPQNQATATFSLAVSRSFKNANGERETDFINCVIWRQQAENMANFTHKGSLIGITGRIQTRNYENQQGQRVYVTEVVADSFQLLESRS 107
>gi|57506252|ref|ZP_00372169.1| bacteriophage L54a, single-stranded DNA binding protein, putative [Campylobacter upsaliensis RM3195] >gi|57015437|gb|EAL52234.1| bacteriophage L54a, single-stranded DNA binding protein, putative [Campylobacter upsaliensis RM3195] (142 aa)
Score = 143, Expect = 9.0e-08, Identities = 41/119 (34%), Positives = 65/119 (54%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASS-----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTK 120
           NK+ I+G L +D +   TQ+G +    +IASS     +   K ET F   V +   A  +N YLHKG  V ++G++ + ++  KEGK  Y  ++++E++K L SK S   A +       T  K
  S:     3 NKITILGNLTKDVKLTATQSGASMVLNTIASSHKKVVNKEIKEETCFLDIVVFGKMAENMNQYLHKGSKVFVEGRVAQDTWQDKEGKNRYSYKVIVETMKFLDSKPSEAKAENTQATPKQTEAK 126
>gi|189347623|ref|YP_001944152.1| single-strand binding protein [Chlorobium limicola DSM 245] >gi|189341770|gb|ACD91173.1| single-strand binding protein [Chlorobium limicola DSM 245] (165 aa)
Score = 143, Expect = 9.5e-08, Identities = 50/139 (35%), Positives = 75/139 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSY-VSKEGKTVYVIEIVIESIKPLSSKNSN-------NAASSIDK---NYNPTNTKNNNY---SQQSNMSVSEAMDDF 139
           +NKV ++G L  DP+   T +G + S  ++A+S+N+       ++ T +   VAW   A   N YL KG  V I+G+L  RS+  SK G+  Y  EIV   ++ L S           +A  S D+   N  P  T+ N     SQ S  ++    DD 
  S:     5 LNKVMLIGHLGNDPELRTTASGQSVSNFTVATSENFKDATGNWQDRTEWHRIVAWGKLAEICNQYLKKGRQVYIEGRLQTRSWDDSKSGEKRYATEIVCTDMQMLGSPKDQGGNSGYGDAGQSFDRPQYNQMPRETRQNPTDFSSQPSGPAIENEKDDL 163
>gi|158319028|ref|YP_001511536.1| single-strand DNA-binding protein [Frankia sp. EAN1pec] >gi|158114433|gb|ABW16630.1| single-strand binding protein [Frankia sp. EAN1pec] (193 aa)
Score = 143, Expect = 9.9e-08, Identities = 32/94 (34%), Positives = 51/94 (54%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIASS--------DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + +VG L  DP+   T NG   +  ++AS+        + W   E  F  C  W+  A  +   L KG  V I G+L +RS+ ++EG+   VIE+ ++ I P
  S:     7 ITVVGNLTNDPELRFTPNGAAVASFTVASTPRTLDRGTNEWKDGEALFLRCSIWRQAAEHVAESLTKGARVIIQGRLKQRSFETREGEKRTVIELDVDEIGP 108
>gi|33519511|ref|NP_878343.1| single-strand DNA-binding protein [Candidatus Blochmannia floridanus] >gi|33517174|emb|CAD83556.1| single-strand DNA-binding protein [Candidatus Blochmannia floridanus] (158 aa)
Score = 143, Expect = 1.0e-07, Identities = 48/142 (33%), Positives = 79/142 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETYFFP-------CVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSV-SEAMDDFESN 142
           +NKV +VG L QDP+     NG   + ISIA++D W   +T  F         V +   A   +SYL KG  V I+G L  R + +++G+  Y  EI++ SI  +    SN  A + + + + T  K+++ S Q+N  + SE++ +F  +
  S:     6 INKVILVGYLGQDPEIRYMSNGNPVANISIATTDTWKDKQTNEFKEKTEWHRVVLFGKLAEITSSYLRKGSQVYIEGSLRTRKWQNQDGQDRYTTEIIV-SIGGVMQMLSNRYAEARNMDTDNTTNKSDSISDQNNHELNSESIVNFNED 154
>gi|150019893|ref|YP_001312147.1| single-strand binding protein [Clostridium beijerinckii NCIMB 8052] >gi|149906358|gb|ABR37191.1| single-strand binding protein [Clostridium beijerinckii NCIMB 8052] (149 aa)
Score = 143, Expect = 1.0e-07, Identities = 36/93 (38%), Positives = 56/93 (60%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE 93
           MNKV ++GRL +DP+ +F   +G   + +++A  D +N    + E  F P V W   A    +Y+ KG  VAI G++  RSY +K+G   YV E+V +
  S:     1 MNKVVLIGRLTKDPELRFTPGSGAAVTTLTLAV-DKYNTKTGQREADFVPVVVWGKQAESTANYMSKGSQVAISGRIQTRSYDAKDGTKRYVTEVVAD 97
>gi|69246713|ref|ZP_00604081.1| Single-strand binding protein [Enterococcus faecium DO] >gi|68195127|gb|EAN09586.1| Single-strand binding protein [Enterococcus faecium DO] (170 aa)
Score = 143, Expect = 1.0e-07, Identities = 34/104 (32%), Positives = 63/104 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSN 104
           +N V +VGRL +DP    T +G   +  ++A + N+       E  F  CV W+ +A  + +Y  KG L+ + G++  RSY +++G+ VYV E+V ++ + L S++++
  S:     2 INNVVLVGRLTKDPDLRYTASGTAVATFTLAVNRNFTNQSGNREADFINCVIWRKSAETLANYARKGTLLGVTGRIQTRSYDNQQGQRVYVTEVVADNFQLLESRSAS 109
>gi|153938536|ref|YP_001389764.1| single-strand nucleic acid-binding domain-containing protein [Clostridium botulinum F str. Langeland] >gi|168177739|ref|ZP_02612403.1| single-strand binding domain protein [Clostridium botulinum NCTC 2916] >gi|168181259|ref|ZP_02615923.1| single-strand binding domain protein [Clostridium botulinum Bf] >gi|170757660|ref|YP_001780048.1| single-strand nucleic acid-binding domain-containing protein [Clostridium botulinum B1 str. Okra] >gi|152934432|gb|ABS39930.1| single-strand binding domain protein [Clostridium botulinum F str. Langeland] >gi|169122872|gb|ACA46708.1| single-strand binding domain protein [Clostridium botulinum B1 str. Okra] >gi|182671080|gb|EDT83054.1| single-strand binding domain protein [Clostridium botulinum NCTC 2916] >gi|182675274|gb|EDT87235.1| single-strand binding domain protein [Clostridium botulinum Bf] (112 aa)
Score = 143, Expect = 1.0e-07, Identities = 37/109 (33%), Positives = 61/109 (55%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNK--NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           MN+V ++GRL +D + + +    ++  R  IA +  +NK  ++T + P V W   A  I+ Y+ KG L+++ G++  R+Y  K G   Y IEIV   IK L  K  +   S+
  S:     1 MNRVMLIGRLTKDAELKHIEDRDVSLLRFVIAVNRYYNKENSKTDYIPIVVWGRHAEAIHKYMKKGKLISVVGRIQARNYEDKNGNKKYGIEIVSNEIKFLDPKKIDKVVSN 112
>gi|24214376|ref|NP_711857.1| single-stranded DNA-binding protein [Leptospira interrogans serovar Lai str. 56601] >gi|45657960|ref|YP_002046.1| single-stranded DNA binding protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|24195311|gb|AAN48875.1|AE011345_9 Single-stranded DNA-binding protein [Leptospira interrogans serovar Lai str. 56601] >gi|45601201|gb|AAS70683.1| single-stranded DNA binding protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (150 aa)
Score = 143, Expect = 1.1e-07, Identities = 35/98 (35%), Positives = 59/98 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS-----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPL 98
           +N+V +VGR  +DP+ F + NG +    S+A+     S+   + E++FF C  W   A+ I  Y  KG  +AI+G+L + ++ + EGK    I IV+E+ + L
  S:     5 INRVTLVGRFTRDPE-FKSINGTSLVNFSLANGRTYVSNGEKREESHFFDCEVWGKPADIIQQYCKKGKQIAIEGRLKQDTWETPEGKKASRIRIVVENFQLL 106
>gi|81427624|ref|YP_394621.1| single-stranded DNA binding protein (Ssb) [Lactobacillus sakei subsp. sakei 23K] >gi|78609263|emb|CAI54310.1| Single-stranded DNA binding protein (Ssb) [Lactobacillus sakei subsp. sakei 23K] (170 aa)
Score = 143, Expect = 1.1e-07, Identities = 41/131 (31%), Positives = 70/131 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK----NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMS 131
           +N+V +VGRL +D     T +G      S+A +  +       E  F  CV W+ +A    ++  KG LV +DG+L  R+Y +++G+ VYV E+V+++   L S+ +         + N  N+  +N SQQS  +
  S:     2 INRVVLVGRLTRDVDLRYTSSGAAVGTFSMAVNRQFTNANGDREADFINCVIWRKSAENFANFTKKGSLVGVDGRLQTRNYENQQGQRVYVTEVVVDNFSLLESRTTTEQRQGDGASQN-FNSNQSNGSQQSGFT 135
>gi|116006863|ref|YP_788046.1| single-stranded DNA-binding protein [Escherichia coli] >gi|115500718|dbj|BAF33949.1| SSB, single-strand binding protein [Escherichia coli] (175 aa)
Score = 143, Expect = 1.1e-07, Identities = 34/94 (36%), Positives = 56/94 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIES 94
           +NKV +VGRL +DP+     NG   + + +A+S++W        + +T +   V +   A     YLHKG+ V I+G+L  RS+    G T YV EI++++
  S:     6 INKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDKQTGEIREQTEWHRVVLFGKLAEVAGEYLHKGEQVYIEGQLRTRSW-EDNGITRYVTEILVKT 105
>gi|145632493|ref|ZP_01788227.1| single-strand DNA-binding protein [Haemophilus influenzae 3655] >gi|144986688|gb|EDJ93240.1| single-strand DNA-binding protein [Haemophilus influenzae 3655] (173 aa)
Score = 143, Expect = 1.1e-07, Identities = 43/135 (31%), Positives = 69/135 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNT-----KNNNYSQQSNMSVSEA 135
           +NKV IVG L  DP+     NG   + IS+A+S++WN       +  T +   V ++  A     YL KG  V ++G+L  R +  + G+  Y  EI  + ++ L  +N N      D    P ++      NN  S QS+ S  ++
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSESWNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKWQDQNGQDRYTTEIQGDVMQMLGGRNQNAGGYGNDMGGVPQSSYQARQTNNGGSYQSSRSAPQS 150
>gi|159040548|ref|YP_001539801.1| single-strand binding protein [Salinispora arenicola CNS-205] >gi|157919383|gb|ABW00811.1| single-strand binding protein [Salinispora arenicola CNS-205] (167 aa)
Score = 143, Expect = 1.1e-07, Identities = 30/94 (31%), Positives = 50/94 (53%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIAS--------SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + ++G L  DP+   T +G   ++  +AS        S  W   E  F  C  W+  A  +   L +G  V + G+L +RSY ++EG+   VIE+ ++ I P
  S:     7 ITVIGNLTDDPELRFTPSGAAVAKFRVASTPRFFDKSSSEWKDGEPLFLSCTVWRQAAEHVAESLQRGTRVIVSGRLRQRSYETREGEKRTVIELEVDEIGP 108
>gi|91794661|ref|YP_564312.1| single-strand binding protein [Shewanella denitrificans OS217] >gi|91716663|gb|ABE56589.1| single-strand binding protein [Shewanella denitrificans OS217] (231 aa)
Score = 143, Expect = 1.1e-07, Identities = 39/108 (36%), Positives = 60/108 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE---SIKPLSSKNSNNAAS 108
           +NKV IVG L QDP+     NG   + I++A+S++W   +      T +   V +   A     YL KG  V ++GKL  R +  + G+  Y  EIV++   S++ L S+N N   S
  S:     6 VNKVIIVGNLGQDPEVRYMPNGNAVANITVATSESWKDQQGQQQERTEWHRVVMFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQSGQDKYTTEIVVDQSGSMQMLGSRNQNQGPS 122
>gi|22538002|ref|NP_688853.1| prophage LambdaSa2, single-strand binding protein [Streptococcus agalactiae 2603V/R] >gi|37999688|sp|Q8DXI7|SSB4_STRA5 Single-stranded DNA-binding protein 4 (SSB 4) (Helix-destabilizing protein 4) >gi|22534904|gb|AAN00726.1|AE014276_7 prophage LambdaSa2, single-strand binding protein [Streptococcus agalactiae 2603V/R] (138 aa)
Score = 142, Expect = 1.2e-07, Identities = 34/117 (29%), Positives = 67/117 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK----NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPT 117
           +N V ++GRL +D +   T + I  +  ++A + N+       E  F  CV W+  A  + ++  KG L+ I G++  RSY +++G+ +YV E+V +S + L  ++++   +S+D    P+
  S:     2 INNVVLIGRLTRDVELRYTPSNIANATFNLAVNRNFKNAAGDREADFINCVMWRQQAENLANWTKKGMLIGITGRIQTRSYENQQGQRIYVTEVVADSFQILEKRDNSTNQASMDDQLPPS 122
>gi|71900498|ref|ZP_00682628.1| Single-strand binding protein [Xylella fastidiosa Ann-1] >gi|71729738|gb|EAO31839.1| Single-strand binding protein [Xylella fastidiosa Ann-1] (172 aa)
Score = 142, Expect = 1.3e-07, Identities = 41/142 (28%), Positives = 65/142 (45%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETYFFPCVAWQSTANF------INSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESN 142
           +NKV +VG L  +P    TQ+G+T + IS+A+S      E        W     F         YLHKG    I+G +    +  ++G+  YV EI+ + +  L  ++    +S I     P   +NN      N + + A DDF  +
  S:    29 INKVILVGNLGNEPDIKYTQSGMTITSISLATSSKRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEGAIRYDKFTGQDGQERYVTEIIADQMHMLGGRDE--GSSGITPQRRPAKVRNN------NKAYAYAGDDFHDD 168
>gi|113461865|ref|YP_719934.1| single-stranded DNA binding protein [Haemophilus somnus 129PT] >gi|112823908|gb|ABI25997.1| single-stranded DNA binding protein [Haemophilus somnus 129PT] (149 aa)
Score = 142, Expect = 1.3e-07, Identities = 41/127 (32%), Positives = 65/127 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQ 127
           +NKV IVG L  DP+     NG   S IS+A+S++W        +  T +   V ++  A  +  YL KG  V ++G+L  R +  + G+  Y  EI  + ++ L S+N  N+      +Y  TN      +QQ
  S:     4 INKVIIVGNLGADPEVRTMPNGEAVSNISVATSESWTDKTTGEKRELTEWHRIVFYRRQAEIVGEYLRKGSKVYVEGRLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNVANSVEG-QASYQATNQSAKTMTQQ 136
>gi|15923854|ref|NP_371388.1| single strand DNA binding protein [Staphylococcus aureus subsp. aureus Mu50] >gi|156979190|ref|YP_001441449.1| single strand DNA binding protein [Staphylococcus aureus subsp. aureus Mu3] >gi|37999750|sp|Q932A8|SSBP_STAAM Prophage-derived single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|14246633|dbj|BAB57026.1| single strand DNA binding protein [Staphylococcus aureus subsp. aureus Mu50] >gi|156721325|dbj|BAF77742.1| single strand DNA binding protein [Staphylococcus aureus subsp. aureus Mu3] (141 aa)
Score = 142, Expect = 1.3e-07, Identities = 34/101 (33%), Positives = 60/101 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +N+  +VGRL +DP+   T NG+     ++A +  +     + E  F   V ++  A  + +YL KG L  +DG+L  R+Y +K+G+ V+V E+V +S++ L  K
  S:     2 LNRTVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTRNYENKDGQRVFVTEVVADSVQFLEPK 106
>gi|16272208|ref|NP_438419.1| single-strand DNA-binding protein [Haemophilus influenzae Rd KW20] >gi|1174443|sp|P44409|SSB_HAEIN Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|1573216|gb|AAC21916.1| single-stranded DNA binding protein (ssb) [Haemophilus influenzae Rd KW20] (168 aa)
Score = 142, Expect = 1.3e-07, Identities = 42/128 (32%), Positives = 64/128 (50%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSID------KNYNPTNTKNNNYSQQS 128
           +NKV IVG L  DP+     NG   + IS+A+S++WN       +  T +   V ++  A     YL KG  V ++G+L  R +  + G+  Y  EI  + ++ L  +N N      D       +Y    T N N  Q S
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSESWNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKWQDQNGQDRYTTEIQGDVMQMLGGRNQNAGGYGNDMGGAPQSSYQARQTNNGNSYQSS 144
>gi|55821725|ref|YP_140167.1| single-strand DNA-binding protein [Streptococcus thermophilus LMG 18311] >gi|55823645|ref|YP_142086.1| single-strand DNA-binding protein [Streptococcus thermophilus CNRZ1066] >gi|116628445|ref|YP_821064.1| single-strand DNA-binding protein [Streptococcus thermophilus LMD-9] >gi|55737710|gb|AAV61352.1| single strand binding protein [Streptococcus thermophilus LMG 18311] >gi|55739630|gb|AAV63271.1| single strand binding protein [Streptococcus thermophilus CNRZ1066] >gi|116101722|gb|ABJ66868.1| Single-stranded DNA-binding protein [Streptococcus thermophilus LMD-9] (172 aa)
Score = 142, Expect = 1.3e-07, Identities = 38/123 (30%), Positives = 69/123 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNN 123
           +N V +VGR+ +D +   T + +  +  S+A + N+     + ET F  CV W+  A  + ++  KG LV I G++  R+Y +++G+ VYV E+V ++ + L S+ +    S    +YN     N+N
  S:     2 INNVVLVGRMTRDAELRYTPSNVAVATFSLAVNRNFKGANGERETDFINCVIWRQQAENLANWAKKGALVGITGRIQTRNYENQQGQRVYVTEVVADNFQMLESRAAREGHSG--GSYNVGGFDNSN 126
>gi|42630549|ref|ZP_00156088.1| COG0629: Single-stranded DNA-binding protein [Haemophilus influenzae R2866] >gi|145639839|ref|ZP_01795440.1| dihydrodipicolinate synthase [Haemophilus influenzae PittII] >gi|145271057|gb|EDK10973.1| dihydrodipicolinate synthase [Haemophilus influenzae PittII] (168 aa)
Score = 142, Expect = 1.4e-07, Identities = 42/128 (32%), Positives = 65/128 (50%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSID------KNYNPTNTKNNNYSQQS 128
           +NKV IVG L  DP+     NG   + IS+A+S++WN       +  T +   V ++  A     YL KG  V ++G+L  R +  + G+  Y  EI  + ++ L  +N N +    D       +Y    T N N  Q S
  S:     4 INKVIIVGHLGNDPEIRTMPNGDAVANISVATSESWNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKWQDQNGQDRYTTEIQGDVMQMLGGRNQNASGYGNDMGGVPQSSYQARQTNNGNSYQSS 144
>gi|170760990|ref|YP_001785732.1| single-strand nucleic acid-binding domain-containing protein [Clostridium botulinum A3 str. Loch Maree] >gi|169407979|gb|ACA56390.1| single-strand binding domain protein [Clostridium botulinum A3 str. Loch Maree] (112 aa)
Score = 142, Expect = 1.4e-07, Identities = 36/109 (33%), Positives = 61/109 (55%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNK--NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           MN+V ++GRL +D + + +    ++  R  IA +  +NK  ++T + P V W   A  I+ Y+ KG L+++ G++  R+Y  K G   Y +EIV   IK L  K  +   S+
  S:     1 MNRVMLIGRLTKDAELKHIEDRDVSLLRFVIAVNRYYNKENSKTDYIPVVVWGRHAEAIHKYMKKGKLISVIGRIQARNYEDKNGNKKYGVEIVSNEIKFLDPKKIDKVVSN 112
>gi|159901474|ref|YP_001547721.1| single-strand binding protein [Herpetosiphon aurantiacus ATCC 23779] >gi|159894513|gb|ABX07593.1| single-strand binding protein [Herpetosiphon aurantiacus ATCC 23779] (166 aa)
Score = 142, Expect = 1.5e-07, Identities = 33/91 (36%), Positives = 50/91 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIV 91
           +NKV I+GRL +DP+   T  G   +  ++A+   W       ++ET +F  V W   A   N YL KG  V I+G+L  RS+    G+  +  E+V
  S:     5 LNKVMIIGRLGKDPEMRFTPQGTPVTNFTVAAGRQWKDPNGETRDETEWFSVVVWNKLAEICNQYLTKGSRVYIEGRLQTRSWDDDSGQKRFRTEVV 101
>gi|187602514|ref|ZP_02988738.1| single-strand binding protein [Chloroflexus sp. Y-400-fl] >gi|187485334|gb|EDU23311.1| single-strand binding protein [Chloroflexus sp. Y-400-fl] (138 aa)
Score = 142, Expect = 1.5e-07, Identities = 35/109 (32%), Positives = 61/109 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYV-SKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           +NKV I+GRL  DP+   T +G   +   +A+S  W        +ET +F  VAW   A   + YL +G  V I+G+L  R++  ++ G+T   +E++++ +  L  + S +   S
  S:     5 LNKVMIIGRLGVDPELRYTASGAPVATFRVAASRQWRDQNGDLHDETEWFNVVAWNRLAEICHQYLSRGARVYIEGRLQTRTWEDAQSGQTRSRVEVIVQDMILLDQRPSRSDEPS 120
>gi|163789441|ref|ZP_02183880.1| single-strand binding protein [Carnobacterium sp. AT7] >gi|159875295|gb|EDP69360.1| single-strand binding protein [Carnobacterium sp. AT7] (111 aa)
Score = 141, Expect = 1.6e-07, Identities = 33/101 (32%), Positives = 57/101 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN-------ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MN + +VGRL ++    V    I + R+ I ++    K        +  F P VAW   A  +  Y  KG +V + G++  RSYV+KE  T++++E+++E +  L +K
  S:     1 MNTIGLVGRLVRE----VELKDIGEDRVVINNTLAVAKKVRKEKGPQADFIPIVAWGQVAKLMQLYCEKGHMVGLTGRIQSRSYVNKEEDTIFIVEMLVEEVHFLQNK 104
>gi|51894454|ref|YP_077145.1| single-strand DNA-binding protein [Symbiobacterium thermophilum IAM 14863] >gi|51858143|dbj|BAD42301.1| single-strand DNA-binding protein [Symbiobacterium thermophilum IAM 14863] (139 aa)
Score = 141, Expect = 1.6e-07, Identities = 32/100 (32%), Positives = 57/100 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIA----SSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSS 100
           +N V ++GRL +DP+   T +G   + + +A    + +   + ET F   V W+  A  + +YL KG LVA+ G+L  R Y +++G+     E+V  +++ L S
  S:     2 LNSVVLIGRLTKDPELRYTPSGKAVATLRLAVDRGTVNQQGERETDFIDIVVWEKQAETVANYLQKGRLVAVQGRLQIRQYTTQDGQKREKAEVVATTVRFLDS 105
>gi|2127447|pir||S67490 single-stranded DNA-binding protein - Eubacterium sp >gi|662792|gb|AAA79866.1| single-stranded DNA binding protein [uncultured eubacterium] >gi|1095221|prf||2108276A ssDNA-binding protein (181 aa)
Score = 141, Expect = 1.6e-07, Identities = 43/162 (26%), Positives = 83/162 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETF 162
           +N+V ++GRL +D +   TQ+G      S+A +  +     + E  F   V W+  A    ++  KG LVAI+G+L  R+Y + +G+ VYV E+V+++   L S+  ++   + + +  P++    ++   S+ +    +D F S  A + +    T  N+    F
  S:     2 INRVVLIGRLTRDVELRYTQSGTAVGTFSLAVNRQFTNQAGEREADFINAVIWRKAAENFANFTGKGALVAIEGRLQTRNYENNQGQRVYVTEVVVDNFSLLESRAESDKRRAQNGSSEPSHQGGASFGAPSDNAFG-GVDPFAS--ASQANPQATTPTNDAPNPF 164
>gi|126648037|ref|ZP_01720531.1| single-strand binding protein [Algoriphagus sp. PR1] >gi|126575630|gb|EAZ79940.1| single-strand binding protein [Algoriphagus sp. PR1] (127 aa)
Score = 141, Expect = 1.7e-07, Identities = 36/108 (33%), Positives = 61/108 (56%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN------ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           N+V ++GRL    +      G T  ++S+A+++ +         ET +   VAW   A+ ++ Y  KG  +AI+GKL  RSY  KEG   Y+ E+V++SI  +  + +N  A +
  S:     6 NRVQLIGRLGSKVEIKNLDGGKTLGKVSMATNEYYKNQKGERVEETTWHNIVAWGKQADLLDKYTDKGSEIAIEGKLSNRSYEDKEGNKRYISEVVVQSILLMGDRKANVPAGA 119
>gi|104773265|ref|YP_618245.1| single-stranded DNA-binding protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513236|ref|YP_812142.1| single-stranded DNA-binding protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103422346|emb|CAI96854.1| Single-stranded DNA-binding protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116092551|gb|ABJ57704.1| Single-stranded DNA-binding protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (191 aa)
Score = 141, Expect = 1.8e-07, Identities = 34/101 (33%), Positives = 60/101 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +N V +VGRL +DP+   T +GI+ +  ++A    +     + E  F  CV W+  A    ++  KG LV I G++  R+Y +K+G+ VYV E+++++   L S+
  S:     2 INNVVLVGRLTRDPELRTTGSGISVATFTLAVDRQFTNASGQREADFISCVIWRKAAENFCNFTSKGSLVGIQGRIQTRNYDNKDGQRVYVTEVLVDNFSLLESR 106
>gi|74316456|ref|YP_314196.1| single-strand binding protein [Thiobacillus denitrificans ATCC 25259] >gi|74055951|gb|AAZ96391.1| Single-strand binding protein [Thiobacillus denitrificans ATCC 25259] (157 aa)
Score = 141, Expect = 1.8e-07, Identities = 38/142 (26%), Positives = 64/142 (45%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETYFFPCVAWQS------TANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNN---NYSQQSNMSVSEAMDDFESN 142
           +NKV +VG L +DP+     +G   + ++IA++D +            W        TA     YL KG  V ++G +  R Y  KEG   Y  EI  + ++ L S++     + +D  +N    ++    N    S    S   DD + +
  S:     4 VNKVILVGNLGRDPEMRYLPSGEAVANLAIATTDKYKDKSGQMVEQTEWHRVSFFGRTAEVCGQYLKKGSQVYVEGSIRTRKYTDKEGVEKYATEIRGDRMQMLGSRSGGGGVADMDDGFNQAPQRSQPRGNAPAGSQRPASSGFDDMDDD 154
>gi|158316807|ref|YP_001509315.1| single-strand binding protein [Frankia sp. EAN1pec] >gi|158112212|gb|ABW14409.1| single-strand binding protein [Frankia sp. EAN1pec] (171 aa)
Score = 141, Expect = 1.8e-07, Identities = 32/92 (34%), Positives = 51/92 (55%)
  Q:     6 IVGRLAQDPQQFVTQNGITQSRISIASS--------DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           ++G+LA DP+   T NG   +  +IAS+        + W   +  F  C  W+  A  +   L KG  V   G+L +RS+ +KEG+   VIE+ ++ I P
  S:     9 VIGQLASDPELRFTPNGAAVASFTIASTPRIYDKQANEWKDGQALFLRCSIWRQAAENVAESLTKGTRVIAQGRLKQRSFETKEGEKRTVIELEVDEIGP 108
>gi|2780885|pdb|1KAW|A Chain A, Structure Of Single Stranded Dna Binding Protein (Ssb) >gi|2780886|pdb|1KAW|B Chain B, Structure Of Single Stranded Dna Binding Protein (Ssb) >gi|2780887|pdb|1KAW|C Chain C, Structure Of Single Stranded Dna Binding Protein (Ssb) >gi|2780888|pdb|1KAW|D Chain D, Structure Of Single Stranded Dna Binding Protein (Ssb) (135 aa)
Score = 141, Expect = 1.8e-07, Identities = 32/92 (34%), Positives = 52/92 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV +VG L QDP+     NG   + I++A+S++W        K +T +   V +   A   + YL KG  V I+G+L  R +  + G+  Y  E+V+
  S:     5 VNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVV 103
>gi|156740055|ref|YP_001430184.1| single-strand binding protein [Roseiflexus castenholzii DSM 13941] >gi|156231383|gb|ABU56166.1| single-strand binding protein [Roseiflexus castenholzii DSM 13941] (175 aa)
Score = 141, Expect = 1.9e-07, Identities = 36/111 (32%), Positives = 58/111 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKE-GKTVYVIEIVIESIKPLSSKNSNNAASSID 111
           +NKV + G L  DP+   T  G   +   +AS+ +W        ++T +F  VAW   A   N YL KG  V I+G+L  RS+  +  G+  Y+ E+V + +  L+ K     ++  D
  S:     5 LNKVMLTGHLGADPEMRFTPQGSAVTTFRVASNRSWKSGDGIQHDDTEWFRIVAWDKLAEICNEYLKKGTRVYIEGRLQTRSWEDRNTGEKRYMTEVVAQDMIILTPKGDRIPSAEAD 122
>gi|125717092|ref|YP_001034225.1| single-strand DNA-binding protein [Streptococcus sanguinis SK36] >gi|125497009|gb|ABN43675.1| Single-strand DNA-binding protein (conjugal DNA-protein transfer system), putative [Streptococcus sanguinis SK36] (131 aa)
Score = 141, Expect = 1.9e-07, Identities = 36/100 (36%), Positives = 55/100 (55%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           NKV ++GRL   P+   T N  + +R ++A +  +     + E  F   V W   A  + SY  KG L+++DG+L  R Y  KEG T YV E++  S + L S+
  S:     3 NKVIVIGRLTATPELHKTANEKSVARATVAVNRRYKSQSGEREADFANVVVWGRLAETLASYASKGSLISLDGELRTRRY-EKEGATHYVTEVLCHSFQLLESR 105
>gi|69245565|ref|ZP_00603503.1| Single-strand binding protein [Enterococcus faecium DO] >gi|68195692|gb|EAN10130.1| Single-strand binding protein [Enterococcus faecium DO] (161 aa)
Score = 141, Expect = 2.0e-07, Identities = 50/175 (28%), Positives = 89/175 (50%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFALNDDEDP 175
           +N V +VGRL +DP    T +G   +  ++A + N+ N+N   E  F  CV W+  A  + +   KG L+ + G++  R+Y +++G+ VYV E+V ++ + L SK +               T++  ++ QS+ S S A   FE    + T++ N    N  +  F      ++DD+ P
  S:     2 INNVTLVGRLTKDPDLRYTASGTAVATFTLAVNRNFANQNGNREADFINCVIWRKPAETMATLAKKGGLIGVVGRIQTRTYDNQQGQRVYVTEVVADNFQLLESKAA---------------TESRAHADQSSTSPSTAT--FEQ---RDTATPNNNGLNASQNPFGGQSIDISDDDLP 160
>gi|168181364|ref|ZP_02616028.1| single-strand binding protein family [Clostridium botulinum Bf] >gi|182675359|gb|EDT87320.1| single-strand binding protein family [Clostridium botulinum Bf] (135 aa)
Score = 140, Expect = 2.0e-07, Identities = 42/126 (33%), Positives = 62/126 (49%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQ 126
           MNK+ +VGRL +DP+  F    G   ++ ++A +    D     E  F PCV +   A  I +Y+ KG    + G+L    YV KEG   +  +IVIE  + L  K S         N N +N  + NY +
  S:     1 MNKIQLVGRLTKDPELTFAPGTGTAVTKFTLAVNRPQFDKSKPQEADFIPCVCFGKRAEAIANYVQKGHRFGLSGRLQINKYVDKEGNNRWSTDIVIEDFEFLQDKGSK-------INENQSNESSTNYEE 124
>gi|126654101|ref|ZP_01725923.1| hypothetical protein BB14905_12910 [Bacillus sp. B14905] >gi|126589409|gb|EAZ83558.1| hypothetical protein BB14905_12910 [Bacillus sp. B14905] (132 aa)
Score = 140, Expect = 2.0e-07, Identities = 33/110 (30%), Positives = 59/110 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSI 110
           MN+V +VGR  +DP          Q+  S+A + N+  +    +T F  C  W   A  I  Y  KG L+  +G++  RS+V++E   +++ E+V+E ++    K  ++  +SI
  S:     1 MNQVGLVGRFTKDPVLRYLSGNRVQTHFSLAINRNFKNSHGEVDTDFIFCTVWGRLAEHIVKYCGKGSLIGANGRIQTRSFVNEENTKIFMTEVVVEDVRFYQLKQRDSDEASI 114
>gi|77918257|ref|YP_356072.1| ssDNA-binding protein [Pelobacter carbinolicus DSM 2380] >gi|77544340|gb|ABA87902.1| ssDNA-binding protein [Pelobacter carbinolicus DSM 2380] (157 aa)
Score = 140, Expect = 2.0e-07, Identities = 35/106 (33%), Positives = 61/106 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNA 106
           +NKV +VG L +DP+   T +G   +  S+A+++ +      ++ +T +   VAW+  A     YL KG  V I+GK+  RSY  ++G   Y+ EIV + ++ L     +N+
  S:     3 VNKVILVGNLGKDPELRYTASGTAVANFSLATTERYKDRDGNSQEKTEWHNIVAWRQLAEICGKYLSKGRQVYIEGKIQTRSYEDRDGNRRYITEIVADQMQMLGRPGDDNS 114
>gi|167622573|ref|YP_001672867.1| single-strand binding protein [Shewanella halifaxensis HAW-EB4] >gi|167352595|gb|ABZ75208.1| single-strand binding protein [Shewanella halifaxensis HAW-EB4] (223 aa)
Score = 140, Expect = 2.0e-07, Identities = 38/113 (33%), Positives = 62/113 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE---SIKPLSSKNSNNAASSIDKN 113
           +NKV +VG L QDP+     NG   + I++A+S++W   +      T +   V +   A     YL KG  V ++GKL  R +  + G+  Y  E+V++   S++ L S+N N  A +   N
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSESWKDQQGQQQERTEWHRVVMFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQSGQDRYSTEVVVDQSGSMQMLGSRNQNAGAPAQGGN 127
>gi|30410826|ref|NP_660857.2| single-strand binding protein [Buchnera aphidicola str. Sg (Schizaphis graminum)] (176 aa)
Score = 140, Expect = 2.0e-07, Identities = 46/143 (32%), Positives = 77/143 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE---SIKPLSSKNSNNAASSIDKNYNPTNTK----NNNYSQQSNMSVSEAMDDFESNF 143
           +NKV ++G L QDP+     NG     +++A+S+NW       NK +T +   V +   A     YL KG  V I+G L  R +  + G   Y  E+++    +++ L ++NSN+   ++++N N   TK    NN+  +   +  SE   D E  F
  S:    20 VNKVILIGHLGQDPEVRYMPNGNAVVNMTLATSENWKDKNTGENKEKTEWHRIVLFGKLAEIAGEYLRKGSQVYIEGSLQTRKWQDQNGLERYTTEVIVNIGGTMQMLGNRNSNSHNVTLNENNNIVKTKKIEINNSPKKIEKIDSSEIDFDDEIPF 176
>gi|55823733|ref|YP_142174.1| single-strand DNA-binding protein [Streptococcus thermophilus CNRZ1066] >gi|116628525|ref|YP_821144.1| single-strand DNA-binding protein [Streptococcus thermophilus LMD-9] >gi|55739718|gb|AAV63359.1| single strand binding protein [Streptococcus thermophilus CNRZ1066] >gi|116101802|gb|ABJ66948.1| Single-stranded DNA-binding protein [Streptococcus thermophilus LMD-9] (130 aa)
Score = 140, Expect = 2.0e-07, Identities = 39/117 (33%), Positives = 65/117 (55%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTN 118
           NKV ++GRL   P+   T +  + +R+++A +  +     + E  F   V W   A  + SY  KG L+++DG+L  R Y  K+G+T YV E++  S + L S+    A  ++ +N NP N
  S:     3 NKVILIGRLTATPEMVKTASDRSFTRVTVAVNRRYKTQNGEREADFITVVVWGRLAETLASYASKGSLISLDGELRTRKY-DKDGQTHYVTEVLCSSFQLLESR----AQRAVREN-NPDN 117
>gi|109289980|ref|YP_655512.1| single-stranded DNA binding protein [Mannheimia phage phiMHaA1] >gi|90110586|gb|ABD90596.1| single-stranded DNA binding protein [Bacteriophage phi-MhaA1-PHL101] >gi|90110637|gb|ABD90646.1| single-stranded DNA binding protein [Bacteriophage phi-MhaA1-BAA410] >gi|153092305|gb|EDN73374.1| single-stranded DNA-binding protein [Mannheimia haemolytica PHL213] (150 aa)
Score = 140, Expect = 2.1e-07, Identities = 44/135 (32%), Positives = 64/135 (47%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEA 135
           MN V +VGRL QDP     QNG   + +S+A+S+ W        K  T +   V ++  A     Y+ KG LV+I GK+  R +    G    + EI+ E ++ LSS   N   +       P   +N    +Q N  V  A
  S:     1 MNLVTLVGRLGQDPDIRTMQNGEKAAALSVATSEKWTDKQTGVKKESTEWHRVVLYRRLAEIAELYVKKGHLVSIIGKIKTRKWTDSNGVERSITEIIAEQMQMLSSGEKNTPNT-------PNKAENKPQPKQKNQDVMTA 135
>gi|154508267|ref|ZP_02043909.1| hypothetical protein ACTODO_00763 [Actinomyces odontolyticus ATCC 17982] >gi|153797901|gb|EDN80321.1| hypothetical protein ACTODO_00763 [Actinomyces odontolyticus ATCC 17982] (188 aa)
Score = 140, Expect = 2.1e-07, Identities = 29/94 (30%), Positives = 53/94 (56%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIASS--------DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + ++G L  DP+   TQ+G   +  ++AS+          W   +T F  C  W+ TA  +   L KG  V + G+L +RSY +++G+   V+E+ ++ + P
  S:     7 ITVIGNLTADPELRWTQSGAAVADFTVASTPRTYDRNAGEWRDGDTLFMRCSVWRETAENVAESLRKGMRVIVQGRLTQRSYDTQQGERRTVVELQVDEVGP 108
>gi|168214618|ref|ZP_02640243.1| single-strand binding protein family [Clostridium perfringens CPE str. F4969] >gi|170713919|gb|EDT26101.1| single-strand binding protein family [Clostridium perfringens CPE str. F4969] (139 aa)
Score = 140, Expect = 2.1e-07, Identities = 40/131 (30%), Positives = 69/131 (52%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNKN----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLS-SKNSNNAASSIDKNYNPTNTKNNNYSQQSNMS 131
           MNKV ++GRL +DP+ +F    G   SR ++A + ++       E  F  C+A+  T   I  Y+ KG  +AI G +   SY +++G   Y  ++V+E    +  SK  N+   +        NT +N++S   +M+
  S:     1 MNKVILIGRLTKDPELRFTASKGTAVSRFTLAVNRSYKNEAGEYEADFISCIAYGKTGENIAQYMTKGRQLAISGNIRTGSYEAQDGTRRYTTDVVVEGFNFIDYSKRENDFGGAF-------NTPDNSFSSNDDMT 130
>gi|167629108|ref|YP_001679607.1| single-strand binding protein [Heliobacterium modesticaldum Ice1] >gi|167591848|gb|ABZ83596.1| single-strand binding protein [Heliobacterium modesticaldum Ice1] (178 aa)
Score = 140, Expect = 2.2e-07, Identities = 35/98 (35%), Positives = 59/98 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE--------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKE-GKTVYVIEIVIESIKPL 98
           +N+V ++GRL +DP+   T +GI     SIA     + ++        T +F    W   A   + YLHKG LVA+DG+L  RS+  ++ G+   V+E+V ++++ L
  S:     2 LNRVILIGRLGRDPELRHTNSGIPVCSFSIAVDRPQSSSQRQAGAEKITDWFTINVWNQQAITCSQYLHKGRLVAVDGRLQTRSWTDQQSGQKRSVVEVVADTVRFL 108
>gi|116491826|ref|YP_803561.1| single-stranded DNA-binding protein [Pediococcus pentosaceus ATCC 25745] >gi|116101976|gb|ABJ67119.1| Single-stranded DNA-binding protein [Pediococcus pentosaceus ATCC 25745] (175 aa)
Score = 140, Expect = 2.2e-07, Identities = 49/156 (31%), Positives = 86/156 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIAS----SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNY---------NPTNTKNNNYSQQSNMSVSEAMDDFESN--FAQKTSSTNITSKN 156
           +N+  +VGRL +DP+   T +G      ++A     +++  + E  F  CV W+  A    ++  KG LV IDG++  RSY +++G+ VYV E+V E+   L S++S+      + N+          PT++ N     QSN S ++  ++   N  FA    S +I+  +
  S:     2 INRTVLVGRLTRDPELRYTGSGAAVVTFTVAVNRQFTNSQGEREADFINCVMWRKAAENFANFTRKGSLVGIDGRIQTRSYENQQGQRVYVTEVVAENFSLLESRSSSERRQGGENNFGNNQSAPSQQPTSSGNPFDGGQSNNSGAQQPNNSNPNDPFANSGQSIDISDDD 172
>gi|166030696|ref|ZP_02233525.1| hypothetical protein DORFOR_00370 [Dorea formicigenerans ATCC 27755] >gi|166029488|gb|EDR48245.1| hypothetical protein DORFOR_00370 [Dorea formicigenerans ATCC 27755] (154 aa)
Score = 140, Expect = 2.2e-07, Identities = 35/106 (33%), Positives = 61/106 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQ---NGITQSRISIASSDNWNKN----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNA 106
           MNKV ++GRL +DP+   +Q   N +  +R ++A    + +N       F  CVA+   A F   Y  +G  V + G++   SY +K+G+ VY  ++V+E  +   SK +++A
  S:     1 MNKVILMGRLTRDPEVRYSQGGENSLAIARYTLAVDRRFKRNGDEQTADFIGCVAFGRNAEFAEKYFRQGLKVVVTGRIQTGSYTNKDGQKVYTTDVVVEEQEFAESKATSDA 113
>gi|148654987|ref|YP_001275192.1| single-strand binding protein [Roseiflexus sp. RS-1] >gi|148567097|gb|ABQ89242.1| single-strand binding protein [Roseiflexus sp. RS-1] (176 aa)
Score = 140, Expect = 2.2e-07, Identities = 47/167 (28%), Positives = 82/167 (49%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKE-GKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKN-NNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDD-PF 167
           +NKV + G L  DP+   T  G   +   +AS+ +W        ++T +F  VAW   A   N YL KG  V I+G+L  RS+  +  G+  Y+ E+V + +  L+ K     A   ++    T+ +   +  +++    +  M    SN   + S+T   ++N  +   +DD PF
  S:     5 LNKVMLTGHLGADPEMRFTPQGSAVTTFRVASNRSWKSGDGVQHDDTEWFRIVAWDKLAEICNEYLKKGTRVYIEGRLQTRSWDDRNTGEKRYITEVVAQDMIILTPKGDRMPAVDTEE----TDVREVGSAPRRAPAPSAPDMPAPVSNGPARASATRAPARNTPQPIEEDDIPF 176
>gi|148657504|ref|YP_001277709.1| single-strand binding protein [Roseiflexus sp. RS-1] >gi|148569614|gb|ABQ91759.1| single-strand binding protein [Roseiflexus sp. RS-1] (151 aa)
Score = 140, Expect = 2.3e-07, Identities = 35/112 (31%), Positives = 55/112 (49%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDK 112
           +NKV I+GRL +DP+   T  G   +  S+A+   W         ET +F  V W   A   + +L K   V I+G+L  R +  + G T Y  E+V   +  L S+    ++   D+
  S:     5 LNKVMIIGRLGKDPEMRYTPGGSPVTTFSVATGRQWKDGSGELHEETEWFNVVTWNKLAEICHEHLRKSSRVYIEGRLQTRHWEDQNGVTHYRTEVVASDMIMLDSRGPRESSQYGDE 122
>gi|163846448|ref|YP_001634492.1| single-strand binding protein [Chloroflexus aurantiacus J-10-fl] >gi|187603188|ref|ZP_02989408.1| single-strand binding protein [Chloroflexus sp. Y-400-fl] >gi|163667737|gb|ABY34103.1| single-strand binding protein [Chloroflexus aurantiacus J-10-fl] >gi|187484843|gb|EDU22824.1| single-strand binding protein [Chloroflexus sp. Y-400-fl] (176 aa)
Score = 140, Expect = 2.3e-07, Identities = 34/115 (29%), Positives = 54/115 (46%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYN 115
           +NKV + G L  DP+   T  G   +   +AS+  W         ET +F  VAW       N YL KG  V ++G+L  R +  ++G+  Y  E++ + +  LS K         +  Y+
  S:     5 LNKVQLTGHLGADPEMRYTAQGSAVTTFRVASNRTWRDKDGNTHEETEWFRVVAWDKLGEICNQYLTKGTRVYVEGRLQTRKWTDRDGQDRYTTEVIAQDMIILSPKGERGPIPDAEPAYD 125
>gi|154498400|ref|ZP_02036778.1| hypothetical protein BACCAP_02389 [Bacteroides capillosus ATCC 29799] >gi|150272468|gb|EDM99653.1| hypothetical protein BACCAP_02389 [Bacteroides capillosus ATCC 29799] (161 aa)
Score = 140, Expect = 2.3e-07, Identities = 32/114 (28%), Positives = 59/114 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETY-----FFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNY 114
           +N++ ++GRL +DP+   TQ G   +  S+A   ++   +T      F   VAW+ TA F++ +  KG L  ++G+L  R +  ++G      E++ E++    SK    A      +Y
  S:     2 LNRIILMGRLTRDPELRHTQTGTPVASFSLAVDRDFKDKQTGEKATDFIDVVAWRQTAEFVSRFFTKGRLAVVEGRLQIRDWTDRDGGKRRSAEVIAENVYFGDSKRDAEAGGYSAPSY 120
>gi|194440094|ref|ZP_03072148.1| plasmid-derived single-stranded DNA-binding protein [Escherichia coli 101-1] >gi|194420979|gb|EDX37012.1| plasmid-derived single-stranded DNA-binding protein [Escherichia coli 101-1] (175 aa)
Score = 140, Expect = 2.5e-07, Identities = 34/94 (36%), Positives = 56/94 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIES 94
           +NKV +VGRL +DP+     NG   + + +A+S++W        + +T +   V +   A     YLHKG+ V I+G+L  RS+    G T YV EI++++
  S:     6 INKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDKQTGEIREQTEWHRVVLFGKLAEVAGEYLHKGEQVYIEGQLRTRSW-EDNGITRYVTEILVKT 105
>gi|148378396|ref|YP_001252937.1| single-strand binding protein [Clostridium botulinum A str. ATCC 3502] >gi|148287880|emb|CAL81946.1| single-strand binding protein [Clostridium botulinum A str. ATCC 3502] (112 aa)
Score = 140, Expect = 2.5e-07, Identities = 37/109 (33%), Positives = 61/109 (55%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNK--NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           MN+V ++GRL +D + + +    ++  R  IA +  +NK  ++T + P V W   A  I+ Y+ KG L+++ G++  R+Y  K G   Y IEIV   IK L  K  +   S+
  S:     1 MNRVMLIGRLTKDAELKQIEDRDVSLLRFVIAVNRYYNKENSKTDYIPIVVWGRHAEAIHKYMKKGKLISVVGRIQARNYEDKNGNKKYGIEIVSNEIKFLDPKKIDKVVSN 112
>gi|15838245|ref|NP_298933.1| single-strand DNA-binding protein [Xylella fastidiosa 9a5c] >gi|9106701|gb|AAF84453.1|AE003991_5 single-stranded DNA binding protein [Xylella fastidiosa 9a5c] (151 aa)
Score = 140, Expect = 2.5e-07, Identities = 42/142 (29%), Positives = 68/142 (47%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETYFFPCVAWQSTANF------INSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESN 142
           +NKV +VG L  +P    TQ+G+T + IS+A+S      E        W     F         YLHKG    I+G +    +   +G+  YV EI+ + +  L S+N    +S I     P   +NN+   +++ + + A DDF  +
  S:     5 INKVILVGNLGNEPDIKYTQSGMTITSISLATSSKRKDREGDTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEGAIRYDKFTGNDGQERYVTEIIADQMHMLGSRNE--GSSGITPQRRPAKVRNND---KASKAYAYAGDDFHDD 147
>gi|21233694|ref|NP_639992.1| single-strand DNA binding protein [Proteus vulgaris] >gi|21202878|dbj|BAB93594.1| Single-strand DNA binding protein [Proteus vulgaris] (154 aa)
Score = 140, Expect = 2.5e-07, Identities = 32/92 (34%), Positives = 53/92 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV IVG+L QDP+     NG + + IS+A+S+ W        + +T +   V +   A+ +  YL KG  + I+G+L  R +  + G   Y  E+V+
  S:     6 VNKVIIVGKLGQDPEVHAMANGGSVANISVATSETWRDKQTGEQREKTEWHRVVFFGKLADVVGEYLRKGSQIYIEGQLSTRKWQDQSGADRYTTEVVV 104
>gi|148274146|ref|YP_001223707.1| single-strand DNA-binding protein [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147832076|emb|CAN03049.1| single-strand binding protein [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (183 aa)
Score = 139, Expect = 2.6e-07, Identities = 34/94 (36%), Positives = 52/94 (55%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIAS--------SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + +VG L  DP+   TQNG+  +  +IAS        S++W   +  F     W+  A  + S L KG  V   G+L +RSY +KEG+    IE+ ++ I P
  S:     7 ITVVGNLTSDPELRYTQNGLAVANFTIASTPRSFDRASNDWKDGDALFLRASVWREFAEHVASSLTKGSRVVATGRLKQRSYETKEGEKRTSIELEVDEIGP 108
>gi|57867635|ref|YP_189268.1| single-stranded DNA-binding protein family [Staphylococcus epidermidis RP62A] >gi|57638293|gb|AAW55081.1| single-stranded DNA-binding protein family [Staphylococcus epidermidis RP62A] (131 aa)
Score = 139, Expect = 2.7e-07, Identities = 42/117 (35%), Positives = 67/117 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW----NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPT 117
           +NK+ IVGR+ +D Q +  ++    +   +A+  N+    N+  T +  C A+  TA  I  Y  +G LV I G++  R Y  KEG+T +V E+ +E+IK +S KN NN   S ++  N T
  S:     2 LNKIVIVGRMTKDAQIYEKEDNKIAT-FCVATERNYKDDINEISTDYLLCKAFGKTATNIEKYTSQGTLVGITGQMRSRKY-EKEGQTHFVTELYVETIKFMSPKNKNNETPSDNQFENNT 120
>gi|168187294|ref|ZP_02621929.1| single-stranded DNA-binding protein [Clostridium botulinum C str. Eklund] >gi|169294799|gb|EDS76932.1| single-stranded DNA-binding protein [Clostridium botulinum C str. Eklund] (148 aa)
Score = 139, Expect = 2.7e-07, Identities = 38/123 (30%), Positives = 64/123 (52%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNN 123
           MN+V +VGRL +DP+ +F    G   +  ++A +  +      +  F P V W   A    +Y+ KG  V + G +  RSY +K+G   YV EIV + ++ L S+N+ +         N  ++ NN+
  S:     1 MNRVVLVGRLTKDPELRFTPGAGKAVATFTLAVNRRFKSQGQPDADFLPIVVWGKQAENTANYVGKGSQVGVSGAIHTRSYEAKDGTRRYVTEIVADEVQFLDSRNAVSRTEPRSTGMNEFDSSNND 127
>gi|153093065|gb|EDN74081.1| single-stranded DNA-binding protein [Mannheimia haemolytica PHL213] (147 aa)
Score = 139, Expect = 2.8e-07, Identities = 38/106 (35%), Positives = 59/106 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNA 106
           +NKV IVG L  DP+     NG   + IS+A+S++WN       +  T +   V ++  A     YL KG  V I+G+L  R +  + G+  Y  EI  + ++ L S+NS+N 
  S:     4 INKVIIVGNLGNDPEMRTMPNGEAVANISVATSESWNDKNTGERRELTEWHRIVFYRRQAEVCGQYLRKGSKVYIEGRLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRNSSNG 116
>gi|170016528|ref|YP_001727447.1| single-stranded DNA binding protein [Leuconostoc citreum KM20] >gi|169803385|gb|ACA82003.1| Single-stranded DNA binding protein [Leuconostoc citreum KM20] (181 aa)
Score = 139, Expect = 2.9e-07, Identities = 42/155 (27%), Positives = 82/155 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSK 155
           +N+V ++GRL +D +   TQ+G      S+A +  +     + E  F   V W+  A    ++  KG LVA++G+L  R+Y + +G+ VYV E+V+++   L S+  ++   + +     T + +N++    + +   A+D F +   Q T  +  TS+
  S:     2 INRVVLIGRLTRDVELRYTQSGTAVGTFSLAVNRQFTNQSGEREADFINAVIWRKAAENFANFTGKGALVAVEGRLQTRNYENNQGQRVYVTEVVVDNFSLLESRAESDKRRAQNGTSATTPSNDNHFGGSESNNNFNAVDPF-AGANQNTQKSTATSE 159
>gi|120435582|ref|YP_861268.1| single-stranded DNA-binding protein [Gramella forsetii KT0803] >gi|117577732|emb|CAL66201.1| single-stranded DNA-binding protein [Gramella forsetii KT0803] (119 aa)
Score = 139, Expect = 3.1e-07, Identities = 38/106 (35%), Positives = 59/106 (55%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN------ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAA 107
           NKV ++G + Q P+    ++G   +  SIA+++ +  +      ET +   V W      +  Y+  G  +AI+GKL  RSY +KEG+  YV E+V   I  L  KN NN+A
  S:     7 NKVQLIGNVGQTPEIKNFESGKKLATFSIATNEFYKNSNGEKVQETQWHNIVVWGKITEIVEKYVGTGKEIAIEGKLTNRSYETKEGEKRYVTEVVASEILLLGVKNDNNSA 118
>gi|15837084|ref|NP_297772.1| single-strand DNA-binding protein [Xylella fastidiosa 9a5c] >gi|9105333|gb|AAF83292.1|AE003898_4 single-stranded DNA binding protein [Xylella fastidiosa 9a5c] (148 aa)
Score = 139, Expect = 3.1e-07, Identities = 38/123 (30%), Positives = 59/123 (47%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETYFFPCVAWQSTANF------INSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNN 123
           +NKV +VG L  +P+   TQ+G+T + IS+A+S      E        W     F         YLHKG    I+G +    +   +G+  YV EI+ + +  L S+N    +S I     P   +NN+
  S:     5 INKVILVGNLGNEPEIKYTQSGMTITSISLATSSGRKDREGNPQERTEWHRVKFFGKLGEIAGDYLHKGSQCYIEGTIRYDKFTGNDGQERYVTEIIADQMHMLGSRNE--GSSGITPQRRPAKARNND 131
>gi|116873887|ref|YP_850668.1| single-strand binding protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742765|emb|CAK21889.1| ssb-2 [Listeria welshimeri serovar 6b str. SLCC5334] (121 aa)
Score = 139, Expect = 3.3e-07, Identities = 33/102 (32%), Positives = 57/102 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIA----SSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKN 102
           +N+V +VGRL +DP+   T        +++A      +    N+  F  CV W   A     +  KG L+ I G+L  R+Y++KE + +Y+ E+++  I+ LSS+N
  S:     2 INQVTLVGRLTKDPELKWTTEDRAVLNLTVALNRFGKNKRVDNDADFIQCVVWGKRAEATAEFCSKGQLIGIVGELQSRNYLNKEEQKIYITEVLVHQIRYLSSRN 107
>gi|115304283|ref|YP_762581.1| hypothetical protein Q54_gp12 [Lactococcus phage Q54] >gi|94483037|gb|ABF22567.1| unknown [Lactococcus phage Q54] (165 aa)
Score = 138, Expect = 3.4e-07, Identities = 33/103 (32%), Positives = 59/103 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           +N V +VGRL +DP+   T  GI     ++A + N+  +    E  F   V W+  A  +  Y  KG L+ I G++  R+Y +++G+ +YV E+V ++ + L S+ +
  S:     3 INNVTLVGRLVRDPELKNTAQGIANVSFTLAVNRNYKNDQGQREADFINVVIWRKQAELLAQYATKGALIGITGRIQTRNYENQQGQRIYVTEVVADNFQLLESRGA 109
>gi|194467827|ref|ZP_03073813.1| single-strand binding protein [Lactobacillus reuteri 100-23] >gi|194452680|gb|EDX41578.1| single-strand binding protein [Lactobacillus reuteri 100-23] (164 aa)
Score = 138, Expect = 3.4e-07, Identities = 43/129 (33%), Positives = 69/129 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNA------ASSIDKNYNPTNTKNNNYSQQSN 129
           +N+  + GRL +DP+   T +G    + +IA    +     + E  F   V W+  A    ++ HKG LV IDG++  R+Y +K+G+ VYV EI ++S   L  +  NN       +S    N   +N+   N + QSN
  S:     2 LNRAILTGRLTRDPELRYTTSGTAVVQATIAVDRQFKNQQGEREADFINLVIWRKAAENFANFTHKGSLVGIDGRIQTRTYENKQGQRVYVTEINVDSFSLLEPRQENNQQPNNNYSSQAPNNNATSNSSRQNQNAQSN 140
>gi|145631076|ref|ZP_01786851.1| dihydrodipicolinate synthase [Haemophilus influenzae 22.4-21] >gi|144983361|gb|EDJ90843.1| dihydrodipicolinate synthase [Haemophilus influenzae R3021] (167 aa)
Score = 138, Expect = 3.5e-07, Identities = 41/128 (32%), Positives = 64/128 (50%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS-----NNAASSIDKNYNPTNTKNNNYSQQS 128
           +NKV IVG L  DP+     NG   + IS+A+S++WN       +  T +   V ++  A     YL KG  V ++G+L  R +  + G+  Y  EI  + ++ L  +N      N+       +Y    T N N  Q S
  S:     4 VNKVIIVGHLGNDPEIRTMPNGDAVANISVATSESWNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKWQDQNGQDRYTTEIQGDVMQMLGGRNQNAGYGNDMGGVPQPSYQARQTNNGNSYQSS 143
>gi|167750474|ref|ZP_02422601.1| hypothetical protein EUBSIR_01450 [Eubacterium siraeum DSM 15702] >gi|167656625|gb|EDS00755.1| hypothetical protein EUBSIR_01450 [Eubacterium siraeum DSM 15702] (163 aa)
Score = 138, Expect = 3.5e-07, Identities = 39/121 (32%), Positives = 60/121 (49%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNN 122
           NKV ++GR+  D +   T  G +     IA    +       ++ FF  VAW++ A FI+ Y  KG ++ I+G+L  RSY  K G T Y+ EI+++       K +N   +S      P N   N
  S:     3 NKVIMMGRIVNDLELRSTPAGASVLSFRIAVDRRFQTKGEDRKSDFFNVVAWRNEAEFISRYFAKGRMILIEGELQNRSYQDKNGNTAYITEIIVDRSTFTGEKANNTQGTSSAYQSYPGNAAKN 127
>gi|116515274|ref|YP_802903.1| hypothetical protein BCc_357 [Buchnera aphidicola str. Cc (Cinara cedri)] >gi|116257128|gb|ABJ90810.1| single-strand DNA-binding protein [Buchnera aphidicola str. Cc (Cinara cedri)] (181 aa)
Score = 138, Expect = 3.6e-07, Identities = 54/167 (32%), Positives = 84/167 (50%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE---SIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPF 167
           +NKV ++G L QDP      NG T   I++A+SD W       NK +T +   V +   A     YL KG  V I+G L  R +  + G   Y  EIV+    S++ L S+N+NN+  S  KN +  +  N+  + +S      + D+   N  Q+  S  + S ++     +D PF
  S:     6 VNKVILIGYLGQDPDIRYMPNGGTVVNITLATSDTWKDKHTGENKEKTEWHRVVLFGKIAEISGQYLKKGSQVYIEGSLQTRKWKDQNGLDRYTTEIVVSVTGSMQMLGSRNTNNSFKSSVKN-SQDDFLNDKNTSRSIHKKKLSDDNLLKNEYQQQKSHLVDSTSKIDFDDEDIPF 181
>gi|153816338|ref|ZP_01969006.1| hypothetical protein RUMTOR_02590 [Ruminococcus torques ATCC 27756] >gi|145846299|gb|EDK23217.1| hypothetical protein RUMTOR_02590 [Ruminococcus torques ATCC 27756] (147 aa)
Score = 138, Expect = 3.6e-07, Identities = 33/106 (31%), Positives = 58/106 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQ--NGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNA 106
           MNK  +VGRL +DP+   +Q  N    +R ++A    + ++      F PCV +  +A F   Y  +G  V++ G++   SY +K+G  VY  E+++E  +   S+  + A
  S:     1 MNKAVLVGRLTRDPEVRYSQGDNTTAVARYTVAVDRRFKRDGEPTADFIPCVVFGRSAEFAEKYFRQGMRVSVSGRIQTGSYTNKDGMKVYTTEVIVEEQEFAESRAESEA 111
>gi|11968217|ref|NP_072004.1| single-strand binding protein, putative [Enterococcus faecalis] >gi|11767437|gb|AAG40422.1| single-strand binding protein, putative [Enterococcus faecalis] (158 aa)
Score = 138, Expect = 3.6e-07, Identities = 37/103 (35%), Positives = 55/103 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           M ++  VGRL +  +   T NG + + +++A      DN     T F  CV W   A     Y  KG LV ++G+L  RSY  ++G T YV E+V+E  + L SK +
  S:     1 MIQLSAVGRLTKGAELRTTTNGKSVANVTLACKRKRPDNNGNVPTTFIQCVLWGKPAQVFAKYTQKGALVGVNGELQTRSYDDQQGVTHYVTELVVEDFEFLESKET 107
>gi|189501614|ref|YP_001957331.1| single-strand binding protein [Candidatus Amoebophilus asiaticus 5a2] >gi|189497055|gb|ACE05602.1| single-strand binding protein [Candidatus Amoebophilus asiaticus 5a2] (136 aa)
Score = 138, Expect = 3.8e-07, Identities = 35/103 (33%), Positives = 58/103 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           +N+V ++G L +DP+    +NG  +   ++A+++ +   E      T +   V W   A     YL KG  V I+GKL  RSY  K+G+  Y+ E+V +++  L SK S
  S:     4 VNRVILLGNLGKDPEIRHLENGRARVSFTLATNEFYKNKEGEKVTSTEWHNVVLWSPLAEIAEKYLTKGKQVYIEGKLTNRSYTDKDGQAKYITEVVGQNLVLLGSKES 112
>gi|42560586|ref|NP_975037.1| single-strand binding protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492082|emb|CAE76679.1| Single-strand binding protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] (146 aa)
Score = 138, Expect = 3.8e-07, Identities = 42/134 (31%), Positives = 77/134 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE-TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLS-SKNSNNAASSIDKNYNPTN-TKNNNYSQQSNMSVSE 134
           MN+V +VGR+ +D +  V +NG      ++A S+   K E T + PC A+  TA  +  YL KG L++++G++  R+  + +GK   ++ ++ E +  L  +KN NN  +  + N+ P   T+ N+ S   ++ VS+
  S:     1 MNRVNLVGRITRDLELRVAKNGSKFVFFTVAVSEFSTKEEKTNYIPCSAFDRTAENMVKYLSKGSLISVEGRITTRNNQTPDGKFETIVNVLAERVNFLEPAKNRNNMTTEQNDNFTPNQPTQQNSDSSFDDLVVSD 137
>gi|15674172|ref|NP_268347.1| single-strand DNA-binding protein [Lactococcus lactis subsp. lactis Il1403] >gi|37999773|sp|Q9CDM9|SSB2_LACLA Single-stranded DNA-binding protein 2 (SSB 2) (Helix-destabilizing protein 2) >gi|12725254|gb|AAK06288.1|AE006448_6 single-strand binding protein [Lactococcus lactis subsp. lactis Il1403] (166 aa)
Score = 138, Expect = 3.9e-07, Identities = 37/129 (28%), Positives = 70/129 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNN---AASSIDKNYNPTNTKNNNYSQQSN 129
           +N V +VGR+ +DP+   T      +  S+A +  +     + E  F  CV W+  A  + ++  KG L+ + G++  R+Y +++G+ VYV E+V +S + L S+++       +S      P+ + NN    Q+N
  S:     2 INNVVLVGRITRDPELRYTPQNQAVATFSLAVNRQFKNANGEREADFINCVIWRQQAENLANWAKKGALIGVTGRIQTRNYENQQGQRVYVTEVVADSFQMLESRSAREGMGGGTSAGSYSAPSQSTNNTPRPQTN 137
>gi|189466525|ref|ZP_03015310.1| hypothetical protein BACINT_02900 [Bacteroides intestinalis DSM 17393] >gi|189434789|gb|EDV03774.1| hypothetical protein BACINT_02900 [Bacteroides intestinalis DSM 17393] (152 aa)
Score = 138, Expect = 3.9e-07, Identities = 32/103 (31%), Positives = 58/103 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK--------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           +NKV ++G + +DP+     +GI  + + +A++D              T +   V W+  A     Y+HKGD + ++GK+  RSY  + G   YV EI ++S++ LS + +
  S:     3 VNKVILIGNVGRDPEVRYLDSGIAVASLPLATTDRAYTLANGTQVPERTEWHNLVLWRGLAETAEKYVHKGDKLYVEGKIRTRSYDDQTGAKRYVTEIFVDSMEMLSPRGT 113
>gi|8569289|pdb|1QVC|A Chain A, Crystal Structure Analysis Of Single Stranded Dna Binding Protein (Ssb) From E.Coli >gi|8569290|pdb|1QVC|B Chain B, Crystal Structure Analysis Of Single Stranded Dna Binding Protein (Ssb) From E.Coli >gi|8569291|pdb|1QVC|C Chain C, Crystal Structure Analysis Of Single Stranded Dna Binding Protein (Ssb) From E.Coli >gi|8569292|pdb|1QVC|D Chain D, Crystal Structure Analysis Of Single Stranded Dna Binding Protein (Ssb) From E.Coli (145 aa)
Score = 138, Expect = 3.9e-07, Identities = 32/92 (34%), Positives = 52/92 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV +VG L QDP+     NG   + I++A+S++W        K +T +   V +   A   + YL KG  V I+G+L  R +  + G+  Y  E+V+
  S:     5 VNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVV 103
>gi|188159687|ref|ZP_02512750.2| Single-strand binding protein [Mycoplasma mycoides subsp. mycoides LC str. GM12] (146 aa)
Score = 138, Expect = 4.0e-07, Identities = 42/134 (31%), Positives = 77/134 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE-TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLS-SKNSNNAASSIDKNYNPTN-TKNNNYSQQSNMSVSE 134
           MN+V +VGR+ +D +  V +NG      ++A S+   + E T + PC A+  TA  +  YL KG L++++G++  R+  + +GK   ++ ++ E +  L  SKN NN  +  + N+ P   T+ N+ S   ++ VS+
  S:     1 MNRVNLVGRITRDLELRVAKNGSKFVFFTVAVSEFSTREEKTNYIPCSAFDKTAENMVKYLSKGSLISVEGRITTRNNQTPDGKFETIVNVLAERVNFLEPSKNRNNMTTEQNDNFTPNQPTQQNSDSSFDDLVVSD 137
>gi|89211327|ref|ZP_01189697.1| Single-strand binding protein [Halothermothrix orenii H 168] >gi|89159069|gb|EAR78747.1| Single-strand binding protein [Halothermothrix orenii H 168] (133 aa)
Score = 138, Expect = 4.0e-07, Identities = 39/111 (35%), Positives = 63/111 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKL-IRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSID 111
           +N+V ++GRL +DP+   T NG   S  ++A   N+     + +  F   V W+  A     +L KG LVA+DG L IR+S   ++G+T Y  E+V ++++ L   + NN   S D
  S:     2 LNRVVLIGRLVRDPELRYTSNGTPVSNFTLAVERNYTNQQGERDVDFIKIVTWRKLAETCAHHLGKGRLVAVDGSLQIRKS--ERDGRTYYNPEVVADNVRFLDWPSDNNRNKSRD 115
>gi|115372015|ref|ZP_01459327.1| single-strand binding protein [Stigmatella aurantiaca DW4/3-1] >gi|115378034|ref|ZP_01465214.1| single-strand binding protein [Stigmatella aurantiaca DW4/3-1] >gi|115364973|gb|EAU64028.1| single-strand binding protein [Stigmatella aurantiaca DW4/3-1] >gi|115370980|gb|EAU69903.1| single-strand binding protein [Stigmatella aurantiaca DW4/3-1] (159 aa)
Score = 138, Expect = 4.0e-07, Identities = 34/103 (33%), Positives = 53/103 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN-----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           +NKV ++G L  DP+   T  G   +   IA+SD+W +KN      T +   V W   A     YL KG    ++G+L  R +  KE +  Y  E+V  S+  L  +++
  S:     5 VNKVILIGNLGADPEVRFTPGGQAVANFRIATSDSWTDKNGQKQERTEWHRIVVWGKLAELCGEYLKKGRQCFVEGRLQTREWTDKENRKNYTTEVVASSVTFLGGRDA 113
>gi|118443896|ref|YP_876990.1| single-stranded DNA binding protein [Clostridium novyi NT] >gi|118134352|gb|ABK61396.1| single-stranded DNA binding protein [Clostridium novyi NT] (148 aa)
Score = 138, Expect = 4.1e-07, Identities = 36/121 (29%), Positives = 62/121 (51%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKN 121
           MN+V +VGRL +DP+ +F    G   +  ++A +  +      E  F P V W   A    +Y+ KG  V + G +  RSY +K+G   YV E+V + ++ L S+++ +         N  ++ N
  S:     1 MNRVVLVGRLTKDPELRFTPGAGKAVATFTLAVNRRFKSQGQPEADFLPIVVWGKQAENTANYVGKGSQVGVSGSIHTRSYEAKDGTRRYVTEVVADEVQFLDSRSAVSRTEPRSTGMNENDSSN 125
>gi|56477626|ref|YP_159215.1| single-strand binding protein (SSB) (helix-destabilizing protein) [Azoarcus sp. EbN1] >gi|56313669|emb|CAI08314.1| Single-strand binding protein (SSB) (Helix-destabilizing protein) [Azoarcus sp. EbN1] (163 aa)
Score = 138, Expect = 4.1e-07, Identities = 34/108 (31%), Positives = 57/108 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAAS 108
           +NKV ++G L +DP+     +G     I++A+S+ W        K +T +   V +   A  +  YL KG  + ++G+L  R +  KEG+  Y  EI  + +K L S+     AS
  S:     4 LNKVILIGNLGKDPETRYAPSGDAICNITVATSETWKDKATGEKKEQTEWHRVVFFGRLAEIVAQYLRKGSQIYVEGRLQTRKWQDKEGQDRYTTEIRGDEMKMLGSRQGAGDAS 118
>gi|83855800|ref|ZP_00949329.1| Single-strand binding protein [Croceibacter atlanticus HTCC2559] >gi|83849600|gb|EAP87468.1| Single-strand binding protein [Croceibacter atlanticus HTCC2559] (110 aa)
Score = 138, Expect = 4.2e-07, Identities = 37/98 (37%), Positives = 60/98 (61%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN-----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLS 99
           N V ++G L QDP+    ++G   ++ SIA+++++ +KN     +TY+   VAW  TA  + +Y+ KG  VAI GKL  RS+  K+G   Y  E+V   +  +S
  S:     6 NNVQLIGNLGQDPEIINLESGKKLAKFSIATNESYKDKNGEKVEQTYWHNIVAWGKTAEIVENYVCKGKEVAITGKLTNRSWDDKDGNKRYTTEVVCSELLMMS 109
>gi|33323524|gb|AAQ07494.1|AF503408_18 Ssb [Enterobacteria phage P7] (162 aa)
Score = 138, Expect = 4.4e-07, Identities = 47/142 (33%), Positives = 71/142 (50%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNN--YS----QQSNMSVSEAMDDFESN 142
           +NKV ++G L QDP+     NG T  R+SIA++++W        K +T +   V +   A   + YL KG  V I+GKL  R +    G   Y  EI++     +    +    S     +  +N   N+  YS     QSN + SE   DFE +
  S:     6 VNKVILIGTLGQDPEIRYIPNGGTVGRLSIATNESWRDKQTGQQKEQTEWHRVVLFGKLAEIASEYLRKGSQVYIEGKLKTRKWTDDAGVERYTTEIIVSQGGTMQMIGARRDDSQFSNGWGQSNQPQNHQQYSGGSKPQSNAN-SEPPMDFEDD 159
>gi|55821817|ref|YP_140259.1| single-strand DNA-binding protein [Streptococcus thermophilus LMG 18311] >gi|55737802|gb|AAV61444.1| single strand binding protein [Streptococcus thermophilus LMG 18311] (130 aa)
Score = 137, Expect = 4.4e-07, Identities = 38/117 (32%), Positives = 65/117 (55%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTN 118
           NKV ++GRL   P+   T +  + +R+++A +  +     + E  F   V W   A  + SY  KG L+++DG++  R Y  K+G+T YV E++  S + L S+    A  ++ +N NP N
  S:     3 NKVILIGRLTATPEMVKTASDRSFTRVTVAVNRRYKTQNGEREADFITVVVWGRLAETLASYASKGSLISLDGEIRTRKY-DKDGQTHYVTEVLCSSFQLLESR----AQRAVREN-NPDN 117
>gi|171057246|ref|YP_001789595.1| single-strand binding protein [Leptothrix cholodnii SP-6] >gi|170774691|gb|ACB32830.1| single-strand binding protein [Leptothrix cholodnii SP-6] (183 aa)
Score = 137, Expect = 4.4e-07, Identities = 33/98 (33%), Positives = 54/98 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPL 98
           +NKV ++G L +DP+   T +G     +S+A++ NW        + ET +   V +   A     YL KG  V ++G+L  R +  KEG+  Y  EIV + ++ L
  S:     4 VNKVILIGNLGRDPEVRYTPSGAAVCNVSVATTRNWKSKDGGERQEETEWHRVVFYDRLAEIAGEYLRKGRPVYVEGRLKTRKWQDKEGRDQYTTEIVADQMQLL 108
>gi|9954963|pdb|1EYG|A Chain A, Crystal Structure Of Chymotryptic Fragment Of E. Coli Ssb Bound To Two 35-Mer Single Strand Dnas >gi|9954964|pdb|1EYG|B Chain B, Crystal Structure Of Chymotryptic Fragment Of E. Coli Ssb Bound To Two 35-Mer Single Strand Dnas >gi|9954965|pdb|1EYG|C Chain C, Crystal Structure Of Chymotryptic Fragment Of E. Coli Ssb Bound To Two 35-Mer Single Strand Dnas >gi|9954966|pdb|1EYG|D Chain D, Crystal Structure Of Chymotryptic Fragment Of E. Coli Ssb Bound To Two 35-Mer Single Strand Dnas (116 aa)
Score = 137, Expect = 4.5e-07, Identities = 32/92 (34%), Positives = 52/92 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV +VG L QDP+     NG   + I++A+S++W        K +T +   V +   A   + YL KG  V I+G+L  R +  + G+  Y  E+V+
  S:     6 VNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVV 104
>gi|191169627|ref|ZP_03031337.1| plasmid-derived single-stranded DNA-binding protein [Escherichia coli B7A] >gi|190900334|gb|EDV60173.1| plasmid-derived single-stranded DNA-binding protein [Escherichia coli B7A] (175 aa)
Score = 137, Expect = 4.5e-07, Identities = 34/94 (36%), Positives = 55/94 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIES 94
           +NKV +VGRL +DP+     NG   + + +A+S++W        + +T +   V +   A     YLHKG  V I+G+L  RS+    G T YV EI++++
  S:     6 INKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDKQTGEIREQTEWHRVVLFGKLAEVAGEYLHKGAQVYIEGQLRTRSW-EDNGITRYVTEILVKT 105
>gi|163787104|ref|ZP_02181551.1| Single-strand binding protein [Flavobacteriales bacterium ALC-1] >gi|159876992|gb|EDP71049.1| Single-strand binding protein [Flavobacteriales bacterium ALC-1] (110 aa)
Score = 137, Expect = 4.6e-07, Identities = 33/90 (36%), Positives = 55/90 (61%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIV 91
           NKV ++G L  DP+    ++G T ++ +IA+++++         +T +   VAW  TA  +  Y+ KG  VAI+GKL  RS+  K+G   Y+ E+V
  S:     6 NKVQLIGNLGNDPEITNFESGKTLAKFAIATNESYKNAQGEKVTDTQWHNIVAWGKTAQIVEKYITKGKEVAIEGKLTTRSWEDKDGMKRYITEVV 101
>gi|154504755|ref|ZP_02041493.1| hypothetical protein RUMGNA_02264 [Ruminococcus gnavus ATCC 29149] >gi|153794929|gb|EDN77349.1| hypothetical protein RUMGNA_02264 [Ruminococcus gnavus ATCC 29149] (139 aa)
Score = 137, Expect = 4.8e-07, Identities = 32/102 (31%), Positives = 56/102 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQN--GITQSRISIASSDNWNKNETY---FFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKN 102
           MNKV ++GRL +DP+   +Q       +R ++A    + +       F PCV +  +A F   Y  +G  +++ G++   SY +K+G  VY  E+V+E  +   SK+
  S:     1 MNKVVLMGRLTRDPEVRYSQGEPATAVARYTLAVERRFQREGAQTADFIPCVVFGKSAEFAEKYFRQGLRISVSGRIQTGSYTNKDGIKVYTTEVVVEEQEFAESKS 107
>gi|81176903|ref|ZP_00875865.1| Single-strand binding protein [Streptococcus suis 89/1591] >gi|80976345|gb|EAP39962.1| Single-strand binding protein [Streptococcus suis 89/1591] (131 aa)
Score = 137, Expect = 4.8e-07, Identities = 36/100 (36%), Positives = 57/100 (56%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           NKV ++GRL   P+   T NG   +R+++A +  +     + E  F   + W   A  + SY +KG L++IDG+L  R Y  K+G   YV EI+ +S + L S+
  S:     3 NKVILIGRLTAQPELTQTPNGKNLTRVTVAVNRRFKTENGEREADFLNVIFWGKLAETLVSYGNKGSLISIDGELRTRKY-EKDGSNHYVTEILGQSFQLLESR 105
>gi|27468613|ref|NP_765250.1| single strand DNA binding protein [Staphylococcus epidermidis ATCC 12228] >gi|37999426|sp|Q8CNK0|SSB_STAES Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|27316160|gb|AAO05294.1|AE016749_240 single strand DNA binding protein [Staphylococcus epidermidis ATCC 12228] (131 aa)
Score = 137, Expect = 4.8e-07, Identities = 42/117 (35%), Positives = 67/117 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW----NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPT 117
           +NK+ IVGR+ +D Q +  ++    +   +A+  N+    N+  T +  C A+  TA  I  Y  +G LV I G++  R Y  KEG+T +V E+ +E+IK +S KN NN   S ++  N T
  S:     2 LNKIVIVGRMTKDAQIYEKEDNKIAT-FCVATERNYKDDNNEISTDYLLCKAFGKTATNIEKYTSQGTLVGITGQMRSRKY-EKEGQTHFVTELYVETIKFMSPKNKNNETPSDNQFENNT 120
>gi|84497234|ref|ZP_00996056.1| single-strand DNA-binding protein [Janibacter sp. HTCC2649] >gi|84382122|gb|EAP98004.1| single-strand DNA-binding protein [Janibacter sp. HTCC2649] (205 aa)
Score = 137, Expect = 4.9e-07, Identities = 33/94 (35%), Positives = 51/94 (54%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIAS--------SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + IVG L  DP+   T +G   +  ++AS        S+ W   ET F  C  W+  A  +   L +G  V + G+L  RSY +KEG+   VIE+ ++ + P
  S:     7 ITIVGNLTGDPELRFTPSGAAVANFTVASTPRTFDRQSNEWKDGETLFMRCSVWRDAAENVAESLARGTRVIVTGRLKSRSYDTKEGEKRTVIELDVDEVGP 108
>gi|154503455|ref|ZP_02040515.1| hypothetical protein RUMGNA_01279 [Ruminococcus gnavus ATCC 29149] >gi|153795555|gb|EDN77975.1| hypothetical protein RUMGNA_01279 [Ruminococcus gnavus ATCC 29149] (148 aa)
Score = 137, Expect = 5.0e-07, Identities = 33/109 (30%), Positives = 60/109 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQ--NGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           MNKV +VGRL +DP+   +Q  +    +R ++A    + ++      F PCV +  +A F   Y  +G  +++ G++   SY +K+G  VY  E+++E  +   S+  + A  S
  S:     1 MNKVVLVGRLTRDPEVRYSQGDSATAVARYTVAVDRRFKRDGEPTADFIPCVVFGRSAEFAEKYFRQGMRISVSGRIQTGSYTNKDGVRVYTTEVIVEDQEFAESRAESEANRS 114
>gi|71274903|ref|ZP_00651191.1| Single-strand binding protein [Xylella fastidiosa Dixon] >gi|71898791|ref|ZP_00680959.1| Single-strand binding protein [Xylella fastidiosa Ann-1] >gi|170729834|ref|YP_001775267.1| single-stranded DNA binding protein [Xylella fastidiosa M12] >gi|71164635|gb|EAO14349.1| Single-strand binding protein [Xylella fastidiosa Dixon] >gi|71731377|gb|EAO33440.1| Single-strand binding protein [Xylella fastidiosa Ann-1] >gi|167964627|gb|ACA11637.1| single-stranded DNA binding protein [Xylella fastidiosa M12] (172 aa)
Score = 137, Expect = 5.0e-07, Identities = 40/142 (28%), Positives = 64/142 (45%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETYFFPCVAWQSTANF------INSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESN 142
           +NKV +VG L  +P    TQ+G+T + IS+A+S      E        W     F         YLHKG    I+G +    +  ++G+  YV EI+ + +  L  +     +S I     P   +NN      + + + A DDF  +
  S:    29 INKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEGTIRYDKFTGQDGQERYVTEIIADQMHMLGGRGE--GSSGITPQRQPAKVRNN------DKAYAYAGDDFHDD 168
>gi|160944121|ref|ZP_02091351.1| hypothetical protein FAEPRAM212_01623 [Faecalibacterium prausnitzii M21/2] >gi|158444797|gb|EDP21801.1| hypothetical protein FAEPRAM212_01623 [Faecalibacterium prausnitzii M21/2] (159 aa)
Score = 137, Expect = 5.3e-07, Identities = 38/117 (32%), Positives = 57/117 (48%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPT 117
           +N V I+GRLA+DP+   T  G   +   IA      D   ++   +   VAW   A F+  Y  KG L+ +DG+L  R Y  K G     +E+V  +I     K+SN    +  +N  P+
  S:     2 LNVVAIMGRLARDPEMRQTTTGKNVASFRIACDRGRRDANGQSVADWIDVVAWDRQAEFVCRYFQKGSLIVVDGRLQSRQYQDKTGANRTAVEVVANNINFAGPKSSNAGDGNGYQNAAPS 122
>gi|159900623|ref|YP_001546870.1| single-strand binding protein [Herpetosiphon aurantiacus ATCC 23779] >gi|159893662|gb|ABX06742.1| single-strand binding protein [Herpetosiphon aurantiacus ATCC 23779] (192 aa)
Score = 137, Expect = 5.4e-07, Identities = 38/106 (35%), Positives = 57/106 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKE-GKTVYVIEIVIESIKPLSSKNSNNA 106
           +NKV + GRL  DP+   T  G   +   +AS+ +W       + +T +F  VAW   A   N YL+KG  V I+G+   RS+V ++ G+T Y  EIV   +  L  +    A
  S:     5 LNKVQLTGRLGADPEMRFTPQGTAVTTFRVASNRSWKTAEGEQREDTEWFSIVAWNKLAEICNQYLNKGTRVYIEGRSQTRSWVEEQSGQTRYKTEIVANDMIILDGRREGMA 117
>gi|148543251|ref|YP_001270621.1| single-strand binding protein [Lactobacillus reuteri F275] >gi|184152663|ref|YP_001841004.1| single-strand binding protein [Lactobacillus reuteri F275] >gi|148530285|gb|ABQ82284.1| single-strand binding protein [Lactobacillus reuteri F275] >gi|183224007|dbj|BAG24524.1| single-strand binding protein [Lactobacillus reuteri F275] (187 aa)
Score = 137, Expect = 5.5e-07, Identities = 36/128 (28%), Positives = 69/128 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQS 128
           +N+  + GRL +DP+   T +G      ++A    + N+N   +  F  CV W+ +A   +++ HKG LV I+G++  R+Y +++G  VYV E+V+++   L  +   N   +      P N+   ++  Q+
  S:     2 LNRAVLTGRLTRDPELRYTTSGTAVVSFTLAVDRQFRNQNGDRDADFINCVIWRKSAENFSNFTHKGSLVGIEGRIQTRNYENQQGNRVYVTEVVVDNFALLEPR--QNGGMNQSGVQQPFNSNQQSFGAQA 131
>gi|182418217|ref|ZP_02949517.1| single-strand binding protein family [Clostridium butyricum 5521] >gi|182378035|gb|EDT75575.1| single-strand binding protein family [Clostridium butyricum 5521] (117 aa)
Score = 137, Expect = 5.6e-07, Identities = 36/101 (35%), Positives = 53/101 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGIT-QSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MNK+ ++GRL +DP+    +NG    +R  IA   N+       E  F   V W   A  I  +  KG L+ + G+L   SY  K+G   Y+ E+V E  K +S+K
  S:     1 MNKIILLGRLIKDPELKQNENGDKLYTRFVIAVQRNFKLPDGTREADFITVVVWGKKAEIICKHTQKGSLITVSGRLRTGSYEDKDGIKRYIAEVVAEDFKFISTK 106
>gi|50955941|ref|YP_063229.1| single-strand DNA-binding protein [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50952423|gb|AAT90124.1| single-strand DNA-binding protein [Leifsonia xyli subsp. xyli str. CTCB07] (170 aa)
Score = 136, Expect = 6.0e-07, Identities = 34/94 (36%), Positives = 50/94 (53%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIASS--------DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + +VG L  DP+   TQNG+  +  +IAS+        + W   E  F     W+  A  +   L KG  V   G+L +RSY +KEG+    IE+ I+ I P
  S:     7 ITVVGNLTSDPELRYTQNGLAVANFTIASTPRTFDRQANEWKDGEALFLRASVWRDFAEHVAGSLTKGSRVIAQGRLKQRSYETKEGEKRTSIELEIDEIGP 108
>gi|22537852|ref|NP_688703.1| single-strand DNA-binding protein [Streptococcus agalactiae 2603V/R] >gi|25011797|ref|NP_736192.1| single-strand DNA-binding protein [Streptococcus agalactiae NEM316] >gi|76787244|ref|YP_330322.1| single-strand DNA-binding protein [Streptococcus agalactiae A909] >gi|76798961|ref|ZP_00781162.1| Single-strand binding protein 1 (SSB 1) (Helix-destabilizing protein1) [Streptococcus agalactiae 18RS21] >gi|77406987|ref|ZP_00784003.1| single-strand binding protein [Streptococcus agalactiae H36B] >gi|77413684|ref|ZP_00789868.1| single-strand binding protein [Streptococcus agalactiae 515] >gi|54039628|sp|P66851|SSB1_STRA5 Single-stranded DNA-binding protein 1 (SSB 1) (Helix-destabilizing protein 1) >gi|54042224|sp|P66850|SSB1_STRA3 Single-stranded DNA-binding protein 1 (SSB 1) (Helix-destabilizing protein 1) >gi|22534747|gb|AAN00576.1|AE014269_20 single-strand binding protein [Streptococcus agalactiae 2603V/R] >gi|24413338|emb|CAD47417.1| Unknown [Streptococcus agalactiae NEM316] >gi|76562301|gb|ABA44885.1| single-strand binding protein 1 [Streptococcus agalactiae A909] >gi|76585682|gb|EAO62239.1| Single-strand binding protein 1 (SSB 1) (Helix-destabilizing protein1) [Streptococcus agalactiae 18RS21] >gi|77160284|gb|EAO71411.1| single-strand binding protein [Streptococcus agalactiae 515] >gi|77174411|gb|EAO77264.1| single-strand binding protein [Streptococcus agalactiae H36B] (163 aa)
Score = 136, Expect = 6.0e-07, Identities = 43/138 (31%), Positives = 74/138 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNT--KNNNYSQQSNMSVSEAMDD 138
           +N V +VGR+ +D +   T +    +  S+A + N+     + E  F  CV W+  A  + ++  KG LV I G++  R+Y +++G+ VYV E+V ES + L S+ +    S    N    N    NN+YS  S  + + + D+
  S:     2 INNVVLVGRMTRDAELRYTPSNQAVATFSLAVNRNFKNQSGEREADFINCVIWRQQAENLANWAKKGALVGITGRIQTRNYENQQGQRVYVTEVVAESFQLLESRATREGGSPNSYNNGGYNNAPSNNSYSASSQQTPNFSRDE 145
>gi|153814778|ref|ZP_01967446.1| hypothetical protein RUMTOR_00993 [Ruminococcus torques ATCC 27756] >gi|145847809|gb|EDK24727.1| hypothetical protein RUMTOR_00993 [Ruminococcus torques ATCC 27756] (134 aa)
Score = 136, Expect = 6.3e-07, Identities = 32/93 (34%), Positives = 51/93 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQ--NGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE 93
           MNK  ++GRL +DP+    Q  N    +R ++A    + K+   ET F  C  +   A F   YL KG  + + G++   SYV++EG  VY   +++E
  S:     1 MNKTILMGRLTKDPEVKYLQDENSTAMARYTLAVDRRYRKDGKAETDFISCATFGKNAEFAEKYLKKGLKILVSGRIQTGSYVNQEGNKVYATNVIVE 98
>gi|15088755|ref|NP_150144.1| putative SSB protein [Streptococcus phage MM1] >gi|15074901|emb|CAC48078.1| putative SSB protein [Streptococcus pneumoniae bacteriophage MM1] (181 aa)
Score = 136, Expect = 6.4e-07, Identities = 46/175 (26%), Positives = 85/175 (48%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS---NNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETF--KDDPFALNDDEDP 175
           +N V +VGRL +D +   TQ+ I  +  ++A +    +   + E  F  CV W+  A  + ++  KG L+ + G +  RSY +++G+ VYV E+V  + + L S+NS   N         Y      N   S Q+  S  +     + +F +  ++  +     +   F    +P  ++DD+ P
  S:     2 INNVVLVGRLTRDAELRYTQSNIAVATFTLAVNRPFKNEAGEREADFINCVIWRQLAENLANWAKKGSLIGVTGVIQTRSYDNQQGQRVYVTEVVASNFQLLESRNSQQNNQGHQDHHGGYQQQGYSNQGSSFQNGNSYGQ-----QGSFVEGNTTNLVPDFTRDNNPFGRPTNPLDISDDDLP 180
>gi|73747028|gb|AAZ82424.1| putative ssDNA-binding protein [Streptococcus pneumoniae bacteriophage MM1 1998] (181 aa)
Score = 136, Expect = 6.4e-07, Identities = 46/175 (26%), Positives = 85/175 (48%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS---NNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETF--KDDPFALNDDEDP 175
           +N V +VGRL +D +   TQ+ I  +  ++A +    +   + E  F  CV W+  A  + ++  KG L+ + G +  RSY +++G+ VYV E+V  + + L S+NS   N         Y      N   S Q+  S  +     + +F +  ++  +     +   F    +P  ++DD+ P
  S:     2 INNVVLVGRLTRDAELRYTQSNIAVATFTLAVNRPFKNEAGEREADFINCVIWRQLAENLANWAKKGSLIGVTGVIQTRSYDNQQGQRVYVTEVVASNFQLLESRNSQQNNQGHQDHHGGYQQQGYSNQGSSFQNGNSYGQ-----QGSFVEGNTTNLVPDFTRDNNPFGRPTNPLDISDDDLP 180
>gi|25091285|sp|Q8K933|SSB_BUCAP Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|21623439|gb|AAM68068.1| single-strand binding protein [Buchnera aphidicola str. Sg (Schizaphis graminum)] (162 aa)
Score = 136, Expect = 6.5e-07, Identities = 39/120 (32%), Positives = 67/120 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE---SIKPLSSKNSNNAASSIDKNYNPTNTK 120
           +NKV ++G L QDP+     NG     +++A+S+NW       NK +T +   V +   A     YL KG  V I+G L  R +  + G   Y  E+++    +++ L ++NSN+   ++++N N   TK
  S:     6 VNKVILIGHLGQDPEVRYMPNGNAVVNMTLATSENWKDKNTGENKEKTEWHRIVLFGKLAEIAGEYLRKGSQVYIEGSLQTRKWQDQNGLERYTTEVIVNIGGTMQMLGNRNSNSHNVTLNENNNIVKTK 135
>gi|77414337|ref|ZP_00790494.1| prophage LambdaSa1, single-strand binding protein [Streptococcus agalactiae 515] >gi|77159629|gb|EAO70783.1| prophage LambdaSa1, single-strand binding protein [Streptococcus agalactiae 515] (138 aa)
Score = 136, Expect = 6.5e-07, Identities = 35/134 (26%), Positives = 74/134 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSE 134
           +N + +VGR+ +D +   T + +  +  ++A +  + +     ET F  CV W+ +A  + ++  KG L+ I G +  R+Y +++G+ +YV E+V E+ + L S+NS    +         N+ N+++   + M +S+
  S:     2 INNIVLVGRMTKDAELRHTPSQVAVATFTLAVNRRFKEQNGERETDFINCVIWRQSAENLANWAKKGTLIGITGHIQTRNYENQQGQRIYVTEVVAENFQLLESRNSQQQTN------QSGNSSNSHFGNANKMDISD 133
>gi|120553681|ref|YP_958032.1| single-strand binding protein [Marinobacter aquaeolei VT8] >gi|120323530|gb|ABM17845.1| single-strand binding protein [Marinobacter aquaeolei VT8] (174 aa)
Score = 136, Expect = 6.7e-07, Identities = 33/93 (35%), Positives = 51/93 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNET-YFFPCVAWQ------STANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE 93
           +NKV ++G L QDP    T NG     +++A+ +++   +T    P   W         A     YL KG  V I+GKL  R + +KEG+ VY  E+V++
  S:     5 VNKVILIGNLGQDPDTRYTPNGNAVVNLNLATDESYKDRQTGQLVPKTEWHRVVLFGKVAEVAGQYLRKGSKVYIEGKLQTRKWQNKEGQDVYTTEVVVD 104
>gi|167766038|ref|ZP_02438091.1| hypothetical protein CLOSS21_00531 [Clostridium sp. SS2/1] >gi|167712118|gb|EDS22697.1| hypothetical protein CLOSS21_00531 [Clostridium sp. SS2/1] (147 aa)
Score = 136, Expect = 6.8e-07, Identities = 37/104 (35%), Positives = 61/104 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQ--NGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE-----SIKPLSSKNSN 104
           MNKV ++GRL +DP    +Q    +  +R ++A    + +N   +  F  CVA+  TA F   YL +G  + + G++   SY +++G  VY  E+VIE       K  +++NSN
  S:     1 MNKVVLMGRLTRDPDVRYSQGETPLAIARYTLAVDRRFKRNGEQDADFINCVAFGRTAEFAEKYLKQGTKMVVSGRIQTGSYTNRDGVKVYTTEVVIEEQDFAESKAAAAQNSN 114
>gi|170760318|ref|YP_001787287.1| single-strand binding protein family [Clostridium botulinum A3 str. Loch Maree] >gi|169407307|gb|ACA55718.1| single-strand binding protein family [Clostridium botulinum A3 str. Loch Maree] (136 aa)
Score = 136, Expect = 6.9e-07, Identities = 38/118 (32%), Positives = 63/118 (53%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK-------NSNNAASSIDKNYNPTN 118
           MNK+ +VGRL +DP+  F    G   ++ ++A +    D   + E  F PCV +   A  I +Y+ KG    + G+L    YV KEG   +  ++V+E  + L  K        SN ++   +K+  P +
  S:     1 MNKIQLVGRLTKDPELTFAPGTGTAVTKFTLAVNRPQFDKSKQQEADFIPCVCFGKRAEAIANYVQKGHRFGLSGRLQINKYVDKEGNNRWSTDVVVEDFEFLQDKGARINESQSNESSVDYEKDLTPVD 130
>gi|17977995|emb|CAC83134.1| putative single stranded DNA-binding protein [Bacteriophage CP-1639] (170 aa)
Score = 136, Expect = 7.1e-07, Identities = 33/109 (30%), Positives = 61/109 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI---ESIKPLSSKNSNNAASS 109
           +N+V I+GRL QDP+   + +G   + +++A+S+ W        K +T +   V     A   + YL KG  V ++GKL  R +  + G+  +  E+++    +++ L  K  +N  SS
  S:     5 VNRVIIIGRLGQDPEVRYSPSGTAFANLTVATSEQWRDKKTGEQKEQTEWHRVVMSGKLAEIASEYLRKGSEVYLEGKLRTRKWQDQSGQDRFTTEVIVGVGGAMQMLGGKQGSNEQSS 123
>gi|15804651|ref|NP_290692.1| single-strand DNA-binding protein [Escherichia coli O157:H7 EDL933] >gi|25294292|pir||E86099 ssDNA-binding protein [imported] - Escherichia coli (strain O157:H7, substrain EDL933) >gi|12519013|gb|AAG59257.1|AE005639_1 ssDNA-binding protein [Escherichia coli O157:H7 EDL933] (178 aa)
Score = 136, Expect = 7.1e-07, Identities = 32/92 (34%), Positives = 52/92 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV +VG L QDP+     NG   + I++A+S++W        K +T +   V +   A   + YL KG  V I+G+L  R +  + G+  Y  E+V+
  S:     6 VNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVV 104
>gi|170783386|ref|YP_001711720.1| single-strand binding protein (helix-destabilizing protein) [Clavibacter michiganensis subsp. sepedonicus] >gi|169157956|emb|CAQ03166.1| single-strand binding protein (helix-destabilizing protein) [Clavibacter michiganensis subsp. sepedonicus] (184 aa)
Score = 136, Expect = 7.2e-07, Identities = 34/94 (36%), Positives = 51/94 (54%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIAS--------SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + +VG L  DP+   TQNG+  +  +IAS        S++W      F     W+  A  + S L KG  V   G+L +RSY +KEG+    IE+ ++ I P
  S:     7 ITVVGNLTSDPELRYTQNGLAVANFTIASTPRSFDRASNDWKDGNALFLRASVWREFAEHVASSLTKGSRVVATGRLKQRSYETKEGEKRTSIELEVDEIGP 108
>gi|153855508|ref|ZP_01996627.1| hypothetical protein DORLON_02641 [Dorea longicatena DSM 13814] >gi|149752030|gb|EDM61961.1| hypothetical protein DORLON_02641 [Dorea longicatena DSM 13814] (154 aa)
Score = 136, Expect = 7.2e-07, Identities = 36/106 (33%), Positives = 60/106 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQ--NGITQSRISIASSDNWNKNE-----TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNA 106
           MNKV ++GRL +DP+   +Q  N    +R ++A    + +N        F  CVA+  +A F   Y  +G  V + G++   SY +KEG+ VY  ++V+E  +   SK  ++A
  S:     1 MNKVILMGRLTRDPEVRYSQGENSTAIARYTLAVDRRFRRNNDGEQTADFIGCVAFGRSAEFAEKYFRQGLKVIVTGRIQTGSYTNKEGQKVYTTDVVVEDQEFAESKAVSDA 113
>gi|157960400|ref|YP_001500434.1| single-strand binding protein [Shewanella pealeana ATCC 700345] >gi|157845400|gb|ABV85899.1| single-strand binding protein [Shewanella pealeana ATCC 700345] (222 aa)
Score = 136, Expect = 7.2e-07, Identities = 38/115 (33%), Positives = 63/115 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE---SIKPLSSKNSNNAASSIDKNYN 115
           +NKV +VG L QDP+     NG   + I++A+S++W   +      T +   V +   A     YL KG  V ++GKL  R +  + G+  Y  E+V++   S++ L S+N +  A +   N N
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSESWKDQQGQQQERTEWHRVVMFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQSGQDRYSTEVVVDQGGSMQMLGSRNQSGGAPAQGGNQN 129
>gi|187731172|ref|YP_001882751.1| single-stranded DNA-binding protein [Shigella boydii CDC 3083-94] >gi|187428164|gb|ACD07438.1| single-stranded DNA-binding protein [Shigella boydii CDC 3083-94] (171 aa)
Score = 136, Expect = 7.2e-07, Identities = 32/92 (34%), Positives = 52/92 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV +VG L QDP+     NG   + I++A+S++W        K +T +   V +   A   + YL KG  V I+G+L  R +  + G+  Y  E+V+
  S:     6 VNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVV 104
>gi|51247433|pdb|1SRU|A Chain A, Crystal Structure Of Full Length E. Coli Ssb Protein >gi|51247434|pdb|1SRU|B Chain B, Crystal Structure Of Full Length E. Coli Ssb Protein >gi|51247435|pdb|1SRU|C Chain C, Crystal Structure Of Full Length E. Coli Ssb Protein >gi|51247436|pdb|1SRU|D Chain D, Crystal Structure Of Full Length E. Coli Ssb Protein (113 aa)
Score = 136, Expect = 7.3e-07, Identities = 32/92 (34%), Positives = 52/92 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV +VG L QDP+     NG   + I++A+S++W        K +T +   V +   A   + YL KG  V I+G+L  R +  + G+  Y  E+V+
  S:     6 VNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVV 104
>gi|153815822|ref|ZP_01968490.1| hypothetical protein RUMTOR_02067 [Ruminococcus torques ATCC 27756] >gi|145846847|gb|EDK23765.1| hypothetical protein RUMTOR_02067 [Ruminococcus torques ATCC 27756] (144 aa)
Score = 136, Expect = 7.4e-07, Identities = 34/104 (32%), Positives = 58/104 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN--ETYFFP-CVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSN 104
           +N V + GRL +DP    T  G + +R ++A    + ++   T  FP CVA+  TA FI  Y  +G  + + G++   SY +K+G  VY  +++ E +    SK+S+
  S:     3 INSVNLTGRLTRDPDVRYTDGGTSIARFTLAVDRRFKQDGGPTADFPSCVAFGKTAEFIERYFRQGMKLELTGRIQSGSYTNKDGVKVYTTDVIAEQVGFGESKSSS 109
>gi|94271007|ref|ZP_01291871.1| Single-strand binding protein [delta proteobacterium MLMS-1] >gi|93450585|gb|EAT01712.1| Single-strand binding protein [delta proteobacterium MLMS-1] (137 aa)
Score = 136, Expect = 7.5e-07, Identities = 37/101 (36%), Positives = 55/101 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-----NKNE-TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +NKV ++G L  DP+   +Q G   +   IA+++ W     NK E T +   VA++  A     YL KG  V I+G+L  R +  K+G   Y  EIV   +K L+ K
  S:     2 INKVILIGNLGADPEVRYSQAGDAVTTFRIATTEVWRGQDGNKVEQTEWHRIVAFKRLAEICGEYLGKGSRVYIEGRLQTRKWQDKDGNDRYTTEIVAREMKMLTPK 108
>gi|71277762|ref|YP_267679.1| single-strand binding protein [Colwellia psychrerythraea 34H] >gi|71143502|gb|AAZ23975.1| single-strand binding protein [Colwellia psychrerythraea 34H] (233 aa)
Score = 136, Expect = 7.5e-07, Identities = 33/93 (35%), Positives = 54/93 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE 93
           +NKV IVG L +DP+     NG   + I++A+SD+W        K++T +   V +   A     YL KG  V ++G L  R + +++G+  Y  EIV++
  S:     4 VNKVIIVGNLGKDPEVRFMPNGGAVANITVATSDSWKDKQTGEQKDKTEWHRVVMFGKLAEIAGEYLKKGSKVYLEGSLQTRKWTNQQGQDQYTTEIVLQ 103
>gi|24375515|ref|NP_719558.1| single-strand binding protein [Shewanella oneidensis MR-1] >gi|37999432|sp|Q8EA81|SSB_SHEON Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|24350384|gb|AAN57002.1|AE015834_5 single-strand binding protein [Shewanella oneidensis MR-1] (238 aa)
Score = 136, Expect = 7.5e-07, Identities = 36/102 (35%), Positives = 58/102 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE---SIKPLSSKN 102
           +NKV +VG L QDP+     NG   + I++A+S++W   +      T +   V +   A     YL KG  V ++GKL  R +  + G+  Y  E+VI+   S++ L S+N
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSESWKDQQGQQQERTEWHRVVLFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQSGQDRYSTEVVIDQSGSMQMLGSRN 116
>gi|47096946|ref|ZP_00234522.1| single-strand binding protein [Listeria monocytogenes str. 1/2a F6854] >gi|47014656|gb|EAL05613.1| single-strand binding protein [Listeria monocytogenes str. 1/2a F6854] (108 aa)
Score = 135, Expect = 7.5e-07, Identities = 33/102 (32%), Positives = 60/102 (58%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNK---NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKN 102
           +N+V +VGRL ++P+ ++ T++    +     +    NK   N+  F  CV W   A     +  KG LV + G+L  R+Y++KE + +Y+ E+++  I+ LSS+N
  S:     2 INQVTLVGRLTKEPELKWTTEDRAVLNLTLALNRFGKNKRVDNDADFIQCVIWGKRAEATAEFCTKGQLVGVVGELQSRNYLNKEEQKIYITEVLVHQIRYLSSRN 107
>gi|171778915|ref|ZP_02919977.1| hypothetical protein STRINF_00838 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282561|gb|EDT47985.1| hypothetical protein STRINF_00838 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (131 aa)
Score = 135, Expect = 7.6e-07, Identities = 37/109 (33%), Positives = 60/109 (55%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK-----NSNNAASSI 110
           NKV ++GRL   P+   T    + +R+++A +  +     + E  F   V W   A  + SY  KG L+++DG+L  R Y  K+G T YV E++  S + L S+       NN A+ +
  S:     3 NKVIMIGRLTVQPELVTTPTEKSVTRVTLAVNRRFKSQNGEREADFISLVVWGRLAETLVSYAGKGSLISVDGELRTRKY-EKDGHTNYVTEVLCHSFQLLESRAQRAMRENNVANDL 119
>gi|169832586|ref|YP_001693506.1| single-stranded DNA-binding protein (SSB) (helix-destabilizingprotein) [Streptococcus pneumoniae Hungary19A-6] >gi|168995088|gb|ACA35700.1| single-stranded DNA-binding protein (SSB) (Helix-destabilizingprotein) [Streptococcus pneumoniae Hungary19A-6] (181 aa)
Score = 135, Expect = 7.8e-07, Identities = 46/175 (26%), Positives = 86/175 (49%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS---NNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETF--KDDPFALNDDEDP 175
           +N V +VGRL +D +   TQ+ I  +  ++A +    +   + E  F  CV W+ +A  + ++  KG L+ + G +  RSY +++G+ VYV E+V  + + L S+NS   N         Y      N   S Q+  S  +     + +F +  ++  +     +   F    +P  ++DD+ P
  S:     2 INNVVLVGRLTRDAELRYTQSNIAVATFTLAVNRPFKNEAGEREADFINCVIWRQSAENLVNWAKKGSLIGVTGVIQTRSYDNQQGQRVYVTEVVASNFQLLESRNSQQNNQGHQDHHGGYQQQGYSNQGSSFQNGNSYGQ-----QGSFLEGNTTNLVPDFTRDNNPFGRPTNPLDISDDDLP 180
>gi|160892970|ref|ZP_02073758.1| hypothetical protein CLOL250_00507 [Clostridium sp. L2-50] >gi|156865053|gb|EDO58484.1| hypothetical protein CLOL250_00507 [Clostridium sp. L2-50] (146 aa)
Score = 135, Expect = 7.8e-07, Identities = 44/138 (31%), Positives = 75/138 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQ--NGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKN-NNYSQQSNMSVSEAMDD 138
           MNKV ++GRL +DP+   +Q  + +  +R ++A    +N+N      F  CVA+  +A F   YL +G  +   G++   SY +K+G  VY  ++VIE  +      S  ++SS   +Y P    +  N S +  MS+ E ++D
  S:     1 MNKVILMGRLTRDPEIRYSQGNDQMAIARYTLAVDRRFNRNGDQTADFINCVAFGRSAEFAEKYLKQGTKIVATGRIQTGSYTNKDGNKVYTTDVVIEDQE---FAESKGSSSSDGGSYQPAGRPSPANASAEGFMSIPEGIED 141
>gi|157151033|ref|YP_001451168.1| single-strand DNA-binding protein [Streptococcus gordonii str. Challis substr. CH1] >gi|157075827|gb|ABV10510.1| single-stranded DNA-binding protein [Streptococcus gordonii str. Challis substr. CH1] (131 aa)
Score = 135, Expect = 8.0e-07, Identities = 37/100 (37%), Positives = 55/100 (55%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           NKV I+GRL   P+   T N  + +R +IA +    D   + E  F   V W  +A  + SY  KG L+++DG+L  R Y  K+G T YV E++    + L S+
  S:     3 NKVIIIGRLTATPELHKTSNEKSVTRATIAVNRRYKDQNGEREADFINIVLWGKSAETLASYASKGSLISLDGELRTRRY-EKDGVTHYVTEVLGHGFQLLESR 105
>gi|82779525|ref|YP_405874.1| single-strand DNA-binding protein [Shigella dysenteriae Sd197] >gi|81243673|gb|ABB64383.1| ssDNA-binding protein [Shigella dysenteriae Sd197] (178 aa)
Score = 135, Expect = 8.0e-07, Identities = 32/92 (34%), Positives = 52/92 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV +VG L QDP+     NG   + I++A+S++W        K +T +   V +   A   + YL KG  V I+G+L  R +  + G+  Y  E+V+
  S:     6 VNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVV 104
>gi|15834295|ref|NP_313068.1| single-strand DNA-binding protein [Escherichia coli O157:H7 str. Sakai] >gi|16131885|ref|NP_418483.1| single-stranded DNA-binding protein [Escherichia coli str. K-12 substr. MG1655] >gi|26250861|ref|NP_756901.1| single-strand DNA-binding protein [Escherichia coli CFT073] >gi|30064648|ref|NP_838819.1| single-strand DNA-binding protein [Shigella flexneri 2a str. 2457T] >gi|56480523|ref|NP_709860.2| single-strand DNA-binding protein [Shigella flexneri 2a str. 301] >gi|74314553|ref|YP_312972.1| single-strand DNA-binding protein [Shigella sonnei Ss046] >gi|82546402|ref|YP_410349.1| single-strand DNA-binding protein [Shigella boydii Sb227] >gi|89110780|ref|AP_004560.1| Single-stranded DNA-binding protein [Escherichia coli W3110] >gi|110644406|ref|YP_672136.1| single-strand DNA-binding protein [Escherichia coli 536] >gi|110807924|ref|YP_691444.1| single-strand DNA-binding protein [Shigella flexneri 5 str. 8401] >gi|157158944|ref|YP_001465559.1| single-strand DNA-binding protein [Escherichia coli E24377A] >gi|157163528|ref|YP_001460846.1| single-strand DNA-binding protein [Escherichia coli HS] >gi|162138311|ref|YP_543584.2| single-strand DNA-binding protein [Escherichia coli UTI89] >gi|162317560|ref|YP_859663.2| single-strand DNA-binding protein [Escherichia coli APEC O1] >gi|168707353|ref|ZP_02739630.1| single-strand DNA-binding protein [Escherichia coli O157:H7 str. EC4045] >gi|168719535|ref|ZP_02751812.1| single-strand DNA-binding protein [Escherichia coli O157:H7 str. EC4206] >gi|168737105|ref|ZP_02769382.1| single-strand DNA-binding protein [Escherichia coli O157:H7 str. EC4115] >gi|168748095|ref|ZP_02773117.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC4113] >gi|168755227|ref|ZP_02780234.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC4401] >gi|168760906|ref|ZP_02785913.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC4501] >gi|168766317|ref|ZP_02791324.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC4486] >gi|168774415|ref|ZP_02799422.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC4196] >gi|168780470|ref|ZP_02805477.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC4076] >gi|168784673|ref|ZP_02809680.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC869] >gi|168794498|ref|ZP_02819505.1| single-strand DNA-binding protein [Escherichia coli O157:H7 str. EC4042] >gi|168798280|ref|ZP_02823287.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC508] >gi|170021942|ref|YP_001726896.1| single-strand binding protein [Escherichia coli ATCC 8739] >gi|170083515|ref|YP_001732835.1| single-stranded DNA-binding protein [Escherichia coli str. K12 substr. DH10B] >gi|170682295|ref|YP_001746449.1| single-stranded DNA-binding protein [Escherichia coli SMS-3-5] >gi|188492327|ref|ZP_02999597.1| single-stranded DNA-binding protein [Escherichia coli 53638] >gi|191168798|ref|ZP_03030574.1| single-stranded DNA-binding protein [Escherichia coli B7A] >gi|191171973|ref|ZP_03033518.1| single-stranded DNA-binding protein [Escherichia coli F11] >gi|193063066|ref|ZP_03044158.1| single-stranded DNA-binding protein [Escherichia coli E22] >gi|193067881|ref|ZP_03048847.1| single-stranded DNA-binding protein [Escherichia coli E110019] >gi|194426835|ref|ZP_03059388.1| single-stranded DNA-binding protein [Escherichia coli B171] >gi|194432319|ref|ZP_03064607.1| single-stranded DNA-binding protein [Shigella dysenteriae 1012] >gi|194437161|ref|ZP_03069259.1| single-stranded DNA-binding protein [Escherichia coli 101-1] >gi|195935843|ref|ZP_03081225.1| single-strand DNA-binding protein [Escherichia coli O157:H7 str. EC4024] >gi|84028792|sp|P0AGE0|SSB_ECOLI Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|84028790|sp|P0AGE2|SSB_ECO57 Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|84028791|sp|P0AGE1|SSB_ECOL6 Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|84028793|sp|P0AGE3|SSB_SHIFL Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|37926356|pdb|1EQQ|A Chain A, Single Stranded Dna Binding Protein And Ssdna Complex >gi|37926357|pdb|1EQQ|B Chain B, Single Stranded Dna Binding Protein And Ssdna Complex >gi|37926358|pdb|1EQQ|C Chain C, Single Stranded Dna Binding Protein And Ssdna Complex >gi|37926359|pdb|1EQQ|D Chain D, Single Stranded Dna Binding Protein And Ssdna Complex >gi|26111292|gb|AAN83475.1|AE016770_275 Single-strand binding protein [Escherichia coli CFT073] >gi|396394|gb|AAC43153.1| single-strand DNA-binding protein [Escherichia coli] >gi|1790494|gb|AAC77029.1| single-stranded DNA-binding protein [Escherichia coli str. K-12 substr. MG1655] >gi|13364518|dbj|BAB38464.1| ssDNA-binding protein [Escherichia coli O157:H7 str. Sakai] >gi|30042907|gb|AAP18630.1| ssDNA-binding protein [Shigella flexneri 2a str. 2457T] >gi|56384074|gb|AAN45567.2| ssDNA-binding protein [Shigella flexneri 2a str. 301] >gi|73858030|gb|AAZ90737.1| ssDNA-binding protein [Shigella sonnei Ss046] >gi|81247813|gb|ABB68521.1| ssDNA-binding protein [Shigella boydii Sb227] >gi|85676811|dbj|BAE78061.1| Single-stranded DNA-binding protein [Escherichia coli W3110] >gi|110345998|gb|ABG72235.1| single-strand binding protein [Escherichia coli 536] >gi|110617472|gb|ABF06139.1| ssDNA-binding protein [Shigella flexneri 5 str. 8401] >gi|157069208|gb|ABV08463.1| single-stranded DNA-binding protein [Escherichia coli HS] >gi|157080974|gb|ABV20682.1| single-stranded DNA-binding protein [Escherichia coli E24377A] >gi|169756870|gb|ACA79569.1| single-strand binding protein [Escherichia coli ATCC 8739] >gi|169891350|gb|ACB05057.1| Single-stranded DNA-binding protein [Escherichia coli str. K12 substr. DH10B] >gi|170520013|gb|ACB18191.1| single-stranded DNA-binding protein [Escherichia coli SMS-3-5] >gi|187769924|gb|EDU33768.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC4196] >gi|188017416|gb|EDU55538.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC4113] >gi|188487526|gb|EDU62629.1| single-stranded DNA-binding protein [Escherichia coli 53638] >gi|189001691|gb|EDU70677.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC4076] >gi|189357468|gb|EDU75887.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC4401] >gi|189364141|gb|EDU82560.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC4486] >gi|189368538|gb|EDU86954.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC4501] >gi|189374931|gb|EDU93347.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC869] >gi|189379074|gb|EDU97490.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC508] >gi|190901176|gb|EDV60949.1| single-stranded DNA-binding protein [Escherichia coli B7A] >gi|190907738|gb|EDV67332.1| single-stranded DNA-binding protein [Escherichia coli F11] >gi|192931325|gb|EDV83927.1| single-stranded DNA-binding protein [Escherichia coli E22] >gi|192958856|gb|EDV89293.1| single-stranded DNA-binding protein [Escherichia coli E110019] >gi|194415171|gb|EDX31440.1| single-stranded DNA-binding protein [Escherichia coli B171] >gi|194419522|gb|EDX35603.1| single-stranded DNA-binding protein [Shigella dysenteriae 1012] >gi|194423717|gb|EDX39706.1| single-stranded DNA-binding protein [Escherichia coli 101-1] (178 aa)
Score = 135, Expect = 8.0e-07, Identities = 32/92 (34%), Positives = 52/92 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV +VG L QDP+     NG   + I++A+S++W        K +T +   V +   A   + YL KG  V I+G+L  R +  + G+  Y  E+V+
  S:     6 VNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVV 104
>gi|19746681|ref|NP_607817.1| putative single strand binding protein [Streptococcus pyogenes MGAS8232] >gi|19748904|gb|AAL98316.1| putative single strand binding protein [Streptococcus pyogenes MGAS8232] (139 aa)
Score = 135, Expect = 8.2e-07, Identities = 34/123 (27%), Positives = 69/123 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNN 123
           +N V +VGR+ +D +   T + +  +  ++A +  + +     E  F  CV W+ +A  + ++  KG L+ I G++  R+Y +++G+ VYV E+V ++ + L S+N  +   +  +N N     N+N
  S:     2 INNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGITGRIQTRNYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSN 128
>gi|149008045|ref|ZP_01831593.1| single-strand binding protein [Streptococcus pneumoniae SP18-BS74] >gi|21538804|emb|CAD35756.1| hypothetical protein [Bacteriophage VO1] >gi|147760453|gb|EDK67430.1| single-strand binding protein [Streptococcus pneumoniae SP18-BS74] (181 aa)
Score = 135, Expect = 8.2e-07, Identities = 34/103 (33%), Positives = 60/103 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           +N V +VGRL +D +   TQ+ I  +  ++A +    +   + E  F  CV W+  A  + ++  KG L+ + G +  RSY +++G+ VYV E+V  + + L S+NS
  S:     2 INNVVLVGRLTRDAELRYTQSNIAVATFTLAVNRPFKNEAGEREADFINCVIWRQLAENLANWAKKGSLIGVTGVIQTRSYDNQQGQRVYVTEVVASNFQLLESRNS 108
>gi|168822792|ref|ZP_02834792.1| single-strand binding protein [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] (184 aa)
Score = 135, Expect = 8.5e-07, Identities = 34/92 (36%), Positives = 52/92 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV IVG L QDP+     NG   + +S+A+S++W        +  T +   V +   A   + YL KG  V ++G+L  R++    G T YV EIV+
  S:     6 INKVIIVGNLGQDPEVRYMPNGGAVANLSLATSESWRDKQTGEMRENTEWHRVVLFGKLAEVASEYLRKGAQVYVEGQLRTRNWQDDSGVTRYVTEIVV 104
>gi|169824837|ref|YP_001692448.1| phage-related single-strand DNA-binding protein [Finegoldia magna ATCC 29328] >gi|167831642|dbj|BAG08558.1| phage-related single-strand DNA-binding protein [Finegoldia magna ATCC 29328] (171 aa)
Score = 135, Expect = 8.5e-07, Identities = 35/109 (32%), Positives = 63/109 (57%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIA-----------SSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           MN V ++GRL +DP+ ++     +  +R S+A            ++N N+    F  CVA+  TA  I  Y HKG+ +AI G +   SY +++G+ +Y  +++++    + S NS   + S
  S:     1 MNNVSLMGRLTRDPEVRYSANTQLANARFSVAVDRRLSKEKRMEAENNNQPTADFINCVAFGRTAEVIGQYFHKGNRIAITGHIQTGSYENQQGQRIYTTDVIVDQFDFVESSNSQPNSGS 121
>gi|112943099|gb|ABI26296.1| single-stranded DNA-binding protein [Lactobacillus reuteri] (187 aa)
Score = 135, Expect = 8.7e-07, Identities = 37/127 (29%), Positives = 68/127 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK-----NSNNAASSIDKNYNPTNTKNNNYSQQ 127
           +N+  + GRL +DP+   T +G      ++A    + N+N   +  F  CV W+ +A   +++ HKG LV I+G++  R+Y +++G  VYV E+V+++   L  +     N +      + N     T+   Y  Q
  S:     2 LNRAVLTGRLTRDPELRYTTSGTAVVSFTLAVDRQFRNQNGDRDADFINCVIWRKSAENFSNFTHKGSLVGIEGRIQTRNYENQQGNRVYVTEVVVDNFALLEPRQNGGMNQSGVQQPFNNNQQSFGTQAPQYGSQ 137
>gi|194467410|ref|ZP_03073397.1| single-strand binding protein [Lactobacillus reuteri 100-23] >gi|194454446|gb|EDX43343.1| single-strand binding protein [Lactobacillus reuteri 100-23] (187 aa)
Score = 135, Expect = 8.7e-07, Identities = 36/128 (28%), Positives = 68/128 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQS 128
           +N+  + GRL +DP+   T +G      ++A    + N+N   +  F  CV W+ +A   +++ HKG LV I+G++  R+Y +++G  VYV E+V+++   L  +   N   +      P N    ++  Q+
  S:     2 LNRAVLTGRLTRDPELRYTTSGTAVVSFTLAVDRQFRNQNGDRDADFINCVIWRKSAENFSNFTHKGSLVGIEGRIQTRNYENQQGNRVYVTEVVVDNFALLEPR--QNGGMNQSGVQQPFNNNQQSFGAQA 131
>gi|147870|gb|AAA24649.1| single-strand DNA-binding protein (ssb) (178 aa)
Score = 135, Expect = 9.0e-07, Identities = 32/92 (34%), Positives = 52/92 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV +VG L QDP+     NG   + I++A+S++W        K +T +   V +   A   + YL KG  V I+G+L  R +  + G+  Y  E+V+
  S:     6 VNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVV 104
>gi|46908695|ref|YP_015084.1| single-strand binding protein [Listeria monocytogenes str. 4b F2365] >gi|153168628|ref|ZP_01928451.1| hypothetical protein LMHG_01572 [Listeria monocytogenes FSL N1-017] >gi|153204109|ref|ZP_01944959.1| hypothetical protein LMSG_02297 [Listeria monocytogenes HPB2262] >gi|167015611|ref|ZP_02278144.1| single-strand binding protein [Listeria monocytogenes FSL J1-194] >gi|167215197|ref|ZP_02285504.1| single-strand binding protein [Listeria monocytogenes FSL R2-503] >gi|167454990|ref|ZP_02321213.1| single-strand binding protein [Listeria monocytogenes FSL J2-064] >gi|46881967|gb|AAT05261.1| single-strand binding protein [Listeria monocytogenes str. 4b F2365] >gi|133726191|gb|EBA27889.1| hypothetical protein LMHG_01572 [Listeria monocytogenes FSL N1-017] >gi|133734341|gb|EBA36039.1| hypothetical protein LMSG_02297 [Listeria monocytogenes HPB2262] (121 aa)
Score = 135, Expect = 9.1e-07, Identities = 33/110 (30%), Positives = 60/110 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIA----SSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSI 110
           +N+V +VGRL ++P+   T        +++A      +    N+  F  CV W   A     +  KG LV + G+L  R+Y++KE + +Y+ E+++  I+ LSS+N +    +I
  S:     2 INQVTLVGRLTKEPELKWTAEDRAVLNLTLALNRFGKNKRVDNDADFIQCVIWGKRAEATAEFCAKGQLVGVVGELQSRNYLNKEEQKIYITEVLVHQIRYLSSRNKDERVVNI 115
>gi|118726031|ref|ZP_01574664.1| single-strand binding protein [Clostridium cellulolyticum H10] >gi|118664587|gb|EAV71216.1| single-strand binding protein [Clostridium cellulolyticum H10] (142 aa)
Score = 135, Expect = 9.3e-07, Identities = 39/117 (33%), Positives = 63/117 (53%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNA--ASSIDKNYNPT 117
           MNKV ++GRL +DP  ++ + N    +  ++A +  + +    +  F   VAW  +A F   Y  KG  VA+ G++  R++   EGK  YV E+V E      SK ++ A  + S  K Y+ T
  S:     1 MNKVLLMGRLTKDPDLRYTSGNNTAVASFTLAVNRRFAREGQPQADFINIVAWDRSAEFCGKYFTKGMQVAVVGRIQTRTWDDNEGKRHYVTEVVAEETYFADSKRNSEAGNSGSTQKTYSET 123
>gi|118048523|ref|ZP_01517124.1| single-strand binding protein [Chloroflexus aggregans DSM 9485] >gi|117994966|gb|EAV09206.1| single-strand binding protein [Chloroflexus aggregans DSM 9485] (138 aa)
Score = 135, Expect = 9.5e-07, Identities = 34/105 (32%), Positives = 57/105 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYV-SKEGKTVYVIEIVIESIKPLSSKNSNN 105
           +NKV I+GRL  DP+   T  G   +   +A+S  W         ET +F  VAW   A   + YL +G  V I+G+L  R++  ++ G+    +E++ + +  L S+ S +
  S:     5 LNKVSIIGRLGADPEFRYTAAGTPVATFRVATSRQWRDPNGHLHEETEWFHVVAWNRLAEICHQYLSRGARVYIEGRLQTRTWEDAQSGQQRSRVEVIAQDMILLESRESRS 116
>gi|167554080|ref|ZP_02347821.1| single-strand binding protein [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] (185 aa)
Score = 135, Expect = 9.7e-07, Identities = 35/92 (38%), Positives = 51/92 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV IVG L QDP+     NG   + +S+A+S++W        +  T +   V +   A     YL KG  V I+G+L  R++    G T YV EIV+
  S:     6 VNKVIIVGNLGQDPEIRYIPNGSAVANLSLATSESWRDKQTGEMRENTEWHRVVLFGKLAEVAGEYLRKGSQVFIEGQLRTRNWQDDSGVTRYVTEIVV 104
>gi|88858653|ref|ZP_01133294.1| Single-strand binding protein (SSB) (Helix-destabilizing protein) [Pseudoalteromonas tunicata D2] >gi|88818879|gb|EAR28693.1| Single-strand binding protein (SSB) (Helix-destabilizing protein) [Pseudoalteromonas tunicata D2] (238 aa)
Score = 134, Expect = 1.0e-06, Identities = 34/107 (31%), Positives = 59/107 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKNETYFFPCVAWQST------ANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE----SIKPLSSKNSNNAA 107
           +NKV +VG L QDP+     NG   + +S+A+++++ +KN         W         A  +  Y+ KG  + ++GKL  R +  K+G+  Y  EIV++     ++ L  +N N  A
  S:     5 VNKVILVGNLGQDPEVRYMPNGSAVANVSLATAESYKDKNTGQMVDKTEWHRVVFFGKLAEIVGEYVRKGSQIYVEGKLQTRKWTDKDGQEKYTTEIVVDGFTGQMQMLGGRNENAQA 122
>gi|169823543|ref|YP_001691046.1| single-strand binding protein [Finegoldia magna ATCC 29328] >gi|167832163|dbj|BAG09078.1| single-strand binding protein [Finegoldia magna ATCC 29328] (155 aa)
Score = 134, Expect = 1.1e-06, Identities = 37/105 (35%), Positives = 60/105 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETY-----------FFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNN 105
           MN V ++GRL +D +   TQ+ +   R ++A +    K++             F  CVA+   A  I  Y+ KG  V++ G+L   SY +KEG+TVY  ++V+E    + S N +N
  S:     1 MNNVTLMGRLTRDVELRYTQSQVAIGRFTVAVNRRLTKDKRQQAEANNQPTADFISCVAFGKQAETIAQYVSKGMRVSLSGRLQTGSYQNKEGQTVYTTDVVVEQFDFIDSNNQHN 116
>gi|109302854|ref|YP_654856.1| gp101 [Mycobacterium phage 244] >gi|194303153|ref|YP_002014568.1| gp100 [Mycobacterium phage Kostya] >gi|88910145|gb|ABD58076.1| gp101 [Mycobacteriophage 244] >gi|194153201|gb|ACF34267.1| gp100 [Mycobacterium phage Kostya] (146 aa)
Score = 134, Expect = 1.1e-06, Identities = 32/95 (33%), Positives = 50/95 (52%)
  Q:     3 KVFIVGRLAQDPQQFVTQNGITQSRISIASSD-------NWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           +V +VG L  DP+   TQ G   +  ++ S++       NW   +  F  C  W+  A  +   L KG  V + G L +RS+ +KEG    VIE+ ++ I P
  S:     6 QVHLVGTLTADPELRFTQGGQAVANFTVVSNERRRDAQGNWVDGDATFLRCTIWRDAAENVAESLQKGQRVIVHGYLKQRSFETKEGDKRTVIEVEVDEIGP 107
>gi|157148035|ref|YP_001455354.1| single-strand DNA-binding protein [Citrobacter koseri ATCC BAA-895] >gi|157085240|gb|ABV14918.1| hypothetical protein CKO_03842 [Citrobacter koseri ATCC BAA-895] (178 aa)
Score = 134, Expect = 1.1e-06, Identities = 32/92 (34%), Positives = 52/92 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV +VG L QDP+     NG   + I++A+S++W        K +T +   V +   A   + YL KG  V I+G+L  R +  + G+  Y  E+V+
  S:     6 VNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKQTGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDKYTTEVVV 104
>gi|117929339|ref|YP_873890.1| single-strand binding protein [Acidothermus cellulolyticus 11B] >gi|117649802|gb|ABK53904.1| single-strand binding protein [Acidothermus cellulolyticus 11B] (153 aa)
Score = 134, Expect = 1.1e-06, Identities = 32/113 (28%), Positives = 61/113 (53%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIASS--------DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNP 116
           + +VG L  DP+   T +G   ++  +AS+        + W   E+ F  C  W+ TA  +   L +G  V + G+L +RSY +K+G+   V E+ ++ + P S +N++   +   ++  P
  S:     8 ITLVGNLVDDPELRFTPSGQAVAKFRVASTPRYLDRQTNEWKDGESLFLTCNVWRQTAENVAESLSRGMRVIVQGRLKQRSYETKDGERRTVFEVDVDDVGP-SLRNASAKVTKASRSGGP 127
>gi|51246431|ref|YP_066315.1| single-strand binding protein (Ssb) [Desulfotalea psychrophila LSv54] >gi|50877468|emb|CAG37308.1| probable single-strand binding protein (Ssb) [Desulfotalea psychrophila LSv54] (142 aa)
Score = 134, Expect = 1.1e-06, Identities = 32/101 (31%), Positives = 52/101 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +NK  ++G L  DP+   T NG   + + +A+++ W       +  T +   +AW   A     YL+KG  V I+GK+  R +  + G   Y  EIV   +K LS +
  S:     2 INKAILIGNLGADPEIRSTGNGTQVATLRLATTERWKDQSGQMQESTEWHRVIAWGRLAEICGEYLNKGARVYIEGKIQTRKWQDQSGNDRYSTEIVAREMKMLSPR 108
>gi|195952828|ref|YP_002121118.1| single-strand binding protein [Hydrogenobaculum sp. Y04AAS1] >gi|195932440|gb|ACG57140.1| single-strand binding protein [Hydrogenobaculum sp. Y04AAS1] (152 aa)
Score = 134, Expect = 1.1e-06, Identities = 39/138 (28%), Positives = 80/138 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLS--SKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDD 138
           +NKV ++GRL +DP+  +  +G     ISIA + N+      K E ++F   A+ + A+ +++ + KG ++ ++G+L +  + S++GK +  + IV ESIK +S      N A++  D +    N ++ N  +     + ++++D
  S:     2 INKVILIGRLTKDPELRILPSGNKTIDISIAYNRNYRVNNEWKEEAHYFDVKAYGALADRLSTQISKGYMILVEGRLAQDRWTSQDGKNMSKVSIVAESIKIISRPQGTQNKASAQEDLSEGFYNDEDINGIENIKSDIEKSLED 146
>gi|156741509|ref|YP_001431638.1| single-strand binding protein [Roseiflexus castenholzii DSM 13941] >gi|156232837|gb|ABU57620.1| single-strand binding protein [Roseiflexus castenholzii DSM 13941] (152 aa)
Score = 134, Expect = 1.2e-06, Identities = 34/101 (33%), Positives = 50/101 (49%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +NKV I+GRL +DP+   T  G   +  S+A+   W         ET +F  V W   A     +L K   V I+G+L  R +  + G T Y  E+V   +  L S+
  S:     5 LNKVMIIGRLGKDPEMRHTPGGSPVTTFSVATGRQWKDGSGELHEETEWFNVVTWNKLAEICYEHLRKSSRVYIEGRLQTRHWEDQNGVTHYRTEVVASDMIMLDSR 111
>gi|154487193|ref|ZP_02028600.1| hypothetical protein BIFADO_01034 [Bifidobacterium adolescentis L2-32] >gi|154085056|gb|EDN84101.1| hypothetical protein BIFADO_01034 [Bifidobacterium adolescentis L2-32] (161 aa)
Score = 134, Expect = 1.2e-06, Identities = 33/94 (35%), Positives = 50/94 (53%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIASS--------DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + IVG L  DP+     NG T +  +IAS+        + W   +  F  C AW+  A+     L KG  V   G+L +RSY +++G    VIE+ ++ I P
  S:     7 ITIVGNLTADPEIRTLSNGGTVANFTIASTPRVYNSQANQWEDGQALFLRCSAWRDLASHCAQTLRKGMRVIAQGRLQQRSYQAQDGSNRTVIELQVDEIGP 108
>gi|29565980|ref|NP_817551.1| gp102 [Mycobacterium phage Cjw1] >gi|194303395|ref|YP_002014420.1| gp99 [Mycobacterium phage Porky] >gi|29424705|gb|AAN01716.1| gp102 [Mycobacteriophage CJW1] >gi|194150880|gb|ACF33916.1| gp99 [Mycobacterium phage Porky] (146 aa)
Score = 134, Expect = 1.2e-06, Identities = 32/95 (33%), Positives = 50/95 (52%)
  Q:     3 KVFIVGRLAQDPQQFVTQNGITQSRISIASSD-------NWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           +V +VG L  DP+   TQ G   +  ++ S++       NW   +  F  C  W+  A  +   L KG  V + G L +RS+ +KEG    VIE+ ++ I P
  S:     6 QVHLVGTLTADPELRFTQGGQAVANFTVVSNERRRDAQGNWVDGDATFLRCTIWRDAAENVAESLQKGQRVIVHGYLKQRSFETKEGDKRTVIEVEVDEIGP 107
>gi|16271789|ref|NP_438126.1| single-strand binding protein [Temperate phage phiNIH1.1] >gi|21910785|ref|NP_665053.1| putative single-strand DNA-binding protein - phage associated [Streptococcus pyogenes MGAS315] >gi|28876363|ref|NP_795558.1| putative single-strand DNA-binding protein [Streptococcus pyogenes phage 315.4] >gi|28895526|ref|NP_801876.1| putative single strand binding protein [Streptococcus pyogenes SSI-1] >gi|71903930|ref|YP_280733.1| phage single-strand DNA binding protein [Streptococcus pyogenes MGAS6180] >gi|94990853|ref|YP_598953.1| phage single-strand DNA binding protein [Streptococcus pyogenes MGAS10270] >gi|16156181|gb|AAL15055.1| single-strand binding protein [temperate phage PhiNIH1.1] >gi|21904989|gb|AAM79856.1| putative single-strand DNA-binding protein - phage-associated [Streptococcus pyogenes MGAS315] >gi|28810775|dbj|BAC63709.1| putative single strand binding protein [Streptococcus pyogenes SSI-1] >gi|71803025|gb|AAX72378.1| phage single-strand DNA binding protein [Streptococcus pyogenes MGAS6180] >gi|94544361|gb|ABF34409.1| phage single-strand DNA binding protein [Streptococcus pyogenes MGAS10270] (139 aa)
Score = 134, Expect = 1.2e-06, Identities = 33/123 (26%), Positives = 69/123 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNN 123
           +N V +VGR+ +D +   T + +  +  ++A +  + +     E  F  CV W+ +A  + ++  KG L+ + G++  R+Y +++G+ VYV E+V ++ + L S+N  +   +  +N N     N+N
  S:     2 INNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTRNYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSN 128
>gi|16804561|ref|NP_466046.1| hypothetical protein lmo2523 [Listeria monocytogenes EGD-e] >gi|153175775|ref|ZP_01931079.1| hypothetical protein LMIG_01596 [Listeria monocytogenes FSL N3-165] >gi|153180613|ref|ZP_01933656.1| hypothetical protein LMMG_02032 [Listeria monocytogenes F6900] >gi|153184901|ref|ZP_01935549.1| hypothetical protein LMOG_01467 [Listeria monocytogenes J0161] >gi|153192179|ref|ZP_01939224.1| hypothetical protein LMPG_01309 [Listeria monocytogenes J2818] >gi|153197171|ref|ZP_01941441.1| hypothetical protein LMRG_01725 [Listeria monocytogenes 10403S] >gi|167058598|ref|ZP_02280855.1| hypothetical protein LmonF_25380 [Listeria monocytogenes FSL F2-515] >gi|167213165|ref|ZP_02283472.1| hypothetical protein LmonL_22626 [Listeria monocytogenes LO28] >gi|167405350|ref|ZP_02310107.1| hypothetical protein LmonocytFSL_20911 [Listeria monocytogenes FSL J2-003] >gi|16412011|emb|CAD00601.1| lmo2523 [Listeria monocytogenes] >gi|126942413|gb|EBA20152.1| hypothetical protein LMOG_01467 [Listeria monocytogenes J0161] >gi|127633222|gb|EBA22639.1| hypothetical protein LMRG_01725 [Listeria monocytogenes 10403S] >gi|127764507|gb|EBA25039.1| hypothetical protein LMPG_01309 [Listeria monocytogenes J2818] >gi|133729200|gb|EBA30898.1| hypothetical protein LMIG_01596 [Listeria monocytogenes FSL N3-165] >gi|133732006|gb|EBA33704.1| hypothetical protein LMMG_02032 [Listeria monocytogenes F6900] (121 aa)
Score = 134, Expect = 1.2e-06, Identities = 33/110 (30%), Positives = 60/110 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIA----SSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSI 110
           +N+V +VGRL ++P+   T        +++A      +    N+  F  CV W   A     +  KG LV + G+L  R+Y++KE + +Y+ E+++  I+ LSS+N +    +I
  S:     2 INQVTLVGRLTKEPELKWTTEDRAVLNLTLALNRFGKNKRVDNDADFIQCVIWGKRAEATAEFCTKGQLVGVVGELQSRNYLNKEEQKIYITEVLVHQIRYLSSRNKDERVVNI 115
>gi|150024196|ref|YP_001295022.1| hypothetical protein FP0083 [Flavobacterium psychrophilum JIP02/86] >gi|149770737|emb|CAL42201.1| Protein of unknown function [Flavobacterium psychrophilum JIP02/86] (126 aa)
Score = 134, Expect = 1.2e-06, Identities = 35/100 (35%), Positives = 62/100 (62%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW--NKNE----TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           NKV ++G +  DP+  + + G   ++++IA+++++  +KNE    T +    AW  TA  I S++ KG  +A++GKL  R+Y  K+G   Y  E+V+  +  L SK
  S:    21 NKVQLIGNVGNDPEIKILEGGKKLAKLTIATNESYYNDKNEKVTDTQWHNLTAWGKTAEIIESFVTKGKEIAVEGKLTHRNYDDKDGIKRYYTEVVVNELLLLGSK 126
>gi|29377819|ref|NP_816947.1| single-strand binding protein [Enterococcus faecalis V583] >gi|29345271|gb|AAO83018.1| single-strand binding protein [Enterococcus faecalis V583] (158 aa)
Score = 134, Expect = 1.2e-06, Identities = 36/103 (34%), Positives = 54/103 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           M ++  VGRL +  +   T NG + + +++A      D      T F  CV W   A     Y  KG LV ++G+L  RSY  ++G T YV E+V+E  + L SK +
  S:     1 MIQLSAVGRLTKGAELRTTTNGKSVANVTLACKRKRPDTNGNVPTTFIQCVLWGKPAQVFAKYTQKGALVGVNGELQTRSYDDQQGVTHYVTELVVEDFEFLESKET 107
>gi|168266755|ref|ZP_02688720.1| hypothetical protein LmonFSL_15830 [Listeria monocytogenes FSL J2-071] (121 aa)
Score = 134, Expect = 1.2e-06, Identities = 34/110 (30%), Positives = 63/110 (57%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNK---NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSI 110
           +N+V +VGRL ++P+ ++ T++    +     +    NK   N+  F  CV W   A     +  KG LV + G+L  R+Y++KE + +Y+ E+++  I+ LSS+N +    +I
  S:     2 INQVTLVGRLTKEPELKWTTEDRAVLNLTLALNRFGKNKRIDNDADFIQCVIWGKRAEATAEFCSKGQLVGVVGELQSRNYLNKEEQKIYITEVLVHQIRYLSSRNKDERVINI 115
>gi|124262891|ref|YP_001023361.1| single-stranded DNA-binding protein [Methylibium petroleiphilum PM1] >gi|124262137|gb|ABM97126.1| Single-stranded DNA-binding protein [Methylibium petroleiphilum PM1] (169 aa)
Score = 134, Expect = 1.3e-06, Identities = 36/98 (36%), Positives = 53/98 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPL 98
           +NKV I+G L +DP+   T +G     IS+A++ NW        + ET +   V +   A     YL KG  V I+G+L  R +  K+GK  Y  EIV   ++ L
  S:     4 VNKVHILGNLGRDPEVRYTPSGSAVCNISVATTRNWKNKDSGEKQEETEWHRVVLYDRLAEIAGEYLKKGRPVYIEGRLKTRKWQDKDGKDQYTTEIVANEMQLL 108
>gi|16763010|ref|NP_458627.1| single-strand DNA-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29144497|ref|NP_807839.1| single-strand DNA-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|37999807|sp|Q9RHF4|SSB2_SALTI Single-stranded DNA-binding protein 2 (SSB 2) (Helix-destabilizing protein 2) >gi|25294300|pir||AB1027 single strand binding protein [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|6513859|gb|AAF14810.1| single strand binding protein [Salmonella typhi] >gi|16505317|emb|CAD09315.1| single strand binding protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29140135|gb|AAO71699.1| single strand binding protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|32454454|gb|AAP83026.1| single-strand DNA-binding protein [Salmonella enterica subsp. enterica serovar Paratyphi C] (178 aa)
Score = 134, Expect = 1.3e-06, Identities = 36/103 (34%), Positives = 54/103 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE---SIKPLSSKNS 103
           +NKV +VG L QDP+     NG     +S+A+SD W        K  T +   V +   A   + YL KG  V I+G L  R +  + G   Y  E+V+    +++ L  +NS
  S:     6 VNKVILVGNLGQDPEVRYMPNGGAVVNLSLATSDTWTDKQTGDKKERTEWHRVVLYGKLAEIASEYLRKGSQVYIEGALRTRKWTDQSGVEKYTTEVVVSQSGTMQMLGGRNS 118
>gi|154486249|ref|ZP_02027656.1| hypothetical protein BIFADO_00052 [Bifidobacterium adolescentis L2-32] >gi|154084112|gb|EDN83157.1| hypothetical protein BIFADO_00052 [Bifidobacterium adolescentis L2-32] (181 aa)
Score = 134, Expect = 1.3e-06, Identities = 40/121 (33%), Positives = 63/121 (52%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIASSD--------NWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDK-----------NYNPTNTKNNNY 124
           + I+G L ++P+   T NG   +  +IASSD         W   +T F  C  W   A  +   LHKG  V   G+L +RSY + +G    V+E+ ++ I P S +N+      I +           N +P N  +N +
  S:     7 ITIIGNLTREPELRSTSNGENVANFTIASSDRRFNRQTNQWEDGDTLFMNCSVWGGMAQHVAQSLHKGMGVIAQGRLKQRSYQANDGTQRTVVELRVDEIGP-SLRNATAQVQRIQRGGAQAAPQGGFNPSPNNVPSNGF 145
>gi|91075172|gb|ABE10053.1| single strand DNA-binding protein [Escherichia coli UTI89] (199 aa)
Score = 134, Expect = 1.3e-06, Identities = 32/92 (34%), Positives = 52/92 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV +VG L QDP+     NG   + I++A+S++W        K +T +   V +   A   + YL KG  V I+G+L  R +  + G+  Y  E+V+
  S:    27 VNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVV 125
>gi|18104278|gb|AAL59464.1| putative ssb protein [Enterococcus faecalis] (147 aa)
Score = 133, Expect = 1.3e-06, Identities = 36/103 (34%), Positives = 54/103 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           M ++  VGRL +  +   T NG + + +++A      D      T F  CV W   A     Y  KG LV ++G+L  RSY  ++G T YV E+V+E  + L SK +
  S:     1 MIQLSAVGRLTKGAELRTTTNGKSVANVTLACKRKRPDTNGNVPTTFIQCVLWGKPAQVFAKYTQKGALVGVNGELQTRSYDDQQGVTHYVTELVVEDFEFLESKET 107
>gi|116619042|ref|YP_819413.1| single-stranded DNA-binding protein [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097889|gb|ABJ63040.1| Single-stranded DNA-binding protein [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (188 aa)
Score = 133, Expect = 1.4e-06, Identities = 38/122 (31%), Positives = 68/122 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNN 122
           +N+V ++GRL +D +   TQ+G+     S+A +  +     + E  F   V W+  A    ++  KG LVA++G+L  R+Y +  G+ VYV E+V+++   L S+    A S   ++ N ++  NN
  S:     2 INRVVLIGRLTRDVELRYTQSGVAVGTFSLAVNRQFTNASGEREADFINAVIWRKAAENFANFTGKGALVAVEGRLQTRNYENNAGQRVYVTEVVVDNFSLLESR----AESEKRRSQNGSSASNN 123
>gi|167753208|ref|ZP_02425335.1| hypothetical protein ALIPUT_01479 [Alistipes putredinis DSM 17216] >gi|167659139|gb|EDS03269.1| hypothetical protein ALIPUT_01479 [Alistipes putredinis DSM 17216] (160 aa)
Score = 133, Expect = 1.4e-06, Identities = 30/114 (26%), Positives = 61/114 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSD-------NWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNY 114
           +NKV ++G +  DP+    ++G   +R+ +A+++       N  K  T +     W+  A+ ++ Y++KG  + I+G+L  R +  K+    Y  EI+ + +K L  +  N +A +    Y
  S:     2 VNKVILIGNVGVDPEVRTLESGAKVARVRLATTERLFDRQANETKEHTEWHTITLWRGLADVVDRYVNKGSQIYIEGRLRTREWTDKDNNKRYTTEILADDMKLLGRRGDNQSAGAPAGGY 122
>gi|115515464|gb|ABJ03539.1| single strand DNA-binding protein [Escherichia coli APEC O1] (197 aa)
Score = 133, Expect = 1.4e-06, Identities = 32/92 (34%), Positives = 52/92 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV +VG L QDP+     NG   + I++A+S++W        K +T +   V +   A   + YL KG  V I+G+L  R +  + G+  Y  E+V+
  S:    25 VNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVV 123
>gi|56961730|gb|AAW31821.1| Orf146 [Dichelobacter nodosus] (146 aa)
Score = 133, Expect = 1.5e-06, Identities = 30/96 (31%), Positives = 57/96 (59%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNET-------YFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIK 96
           +NKV ++G + Q+P   +  N    +  S+A++ +WN  +T        +  CVA++  A  I  Y+ KG  + ++G+L  R + S+EG   Y+ EI+++ I+
  S:     4 VNKVILLGYVGQNPDVRIMTNEQQVANFSLATNISWNDRQTGEKCTKTEWHRCVAYRRLAEIIGQYVRKGSQLYLEGRLETRKWKSQEGDKHYMTEIIVDEIQ 106
>gi|171464183|ref|YP_001798296.1| single-strand binding protein [Polynucleobacter necessarius STIR1] >gi|171193721|gb|ACB44682.1| single-strand binding protein [Polynucleobacter necessarius STIR1] (151 aa)
Score = 133, Expect = 1.5e-06, Identities = 42/138 (30%), Positives = 66/138 (47%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNET-YFFPCVAWQSTANF------INSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDD 138
           +NKV IVG + +DP+     +G   + IS+A+SD +   +T        W   A F         YL KG  V ++G+L  R +    G+  Y  EIV E+++ L  K    +A    ++Y  +     +    SN +   AMDD
  S:     4 VNKVIIVGNVGRDPETRYMPSGDAVTNISVATSDRYKDKQTGEMKETTEWHRVAFFGKLAEIAGQYLKKGSQVYVEGRLRTRKWTDASGQEKYSTEIVAETMQMLGGKPVGGSADG-GESYARSKPAEQSALVASNAASLGAMDD 147
>gi|150005383|ref|YP_001300127.1| single-strand DNA-binding protein [Bacteroides vulgatus ATCC 8482] >gi|149933807|gb|ABR40505.1| single-strand DNA-binding protein [Bacteroides vulgatus ATCC 8482] (125 aa)
Score = 133, Expect = 1.5e-06, Identities = 34/112 (30%), Positives = 57/112 (50%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK--------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDK 112
           +NK  ++G L +DP     + G+   + S+A++               T +   V W+  A     YLHKGD V ++G++  RS+  K G    V+E   ES++ ++ K     ASS D+
  S:     3 VNKAILLGHLGKDPDVRYLEGGVAVGQFSLATTKRAQTLPNGTQIPERTEWHNIVVWRGIAETAKKYLHKGDKVYVEGEIRSRSFEDKNGVRHTVVETFAESMEMVTVKQQTQHASSDDE 122
>gi|120600326|ref|YP_964900.1| single-strand binding protein [Shewanella sp. W3-18-1] >gi|124545570|ref|ZP_01704763.1| single-strand binding protein [Shewanella putrefaciens 200] >gi|120560419|gb|ABM26346.1| single-strand binding protein [Shewanella sp. W3-18-1] >gi|124510913|gb|EAY54980.1| single-strand binding protein [Shewanella putrefaciens 200] (236 aa)
Score = 133, Expect = 1.5e-06, Identities = 36/107 (33%), Positives = 58/107 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE---SIKPLSSKNSNNAA 107
           +NKV +VG L QDP+     NG   + I++A+S++W   +      T +   V +   A     YL KG  V ++GKL  R +  + G+  Y  E+VI+   S++ L S+     A
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSESWKDQQGQQQERTEWHRVVLFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQSGQDRYSTEVVIDQSGSMQMLGSRGQGGQA 121
>gi|163846601|ref|YP_001634645.1| single-strand binding protein [Chloroflexus aurantiacus J-10-fl] >gi|163667890|gb|ABY34256.1| single-strand binding protein [Chloroflexus aurantiacus J-10-fl] (138 aa)
Score = 133, Expect = 1.5e-06, Identities = 34/109 (31%), Positives = 60/109 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYV-SKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           +NKV I+GRL  DP+   T +    +   +A+S  W        +ET +F  VAW   A   + YL +G  V I+G+L  R++  ++ G+T   +E++++ +  L  + S +   S
  S:     5 LNKVMIIGRLGVDPELRYTASDAPVATFRVAASRQWRDQNGDLHDETEWFNVVAWNRLAEICHQYLSRGARVYIEGRLQTRTWEDAQSGQTRSRVEVIVQDMILLDQRPSRSDEPS 120
>gi|29346907|ref|NP_810410.1| single-strand binding protein (SSB) [Bacteroides thetaiotaomicron VPI-5482] >gi|37999425|sp|Q8A7M7|SSB_BACTN Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|29338805|gb|AAO76604.1| single-strand binding protein (SSB) [Bacteroides thetaiotaomicron VPI-5482] (161 aa)
Score = 133, Expect = 1.5e-06, Identities = 33/109 (30%), Positives = 59/109 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK--------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           +NKV ++G + QDP+      G   +   +A++D              T +   VA    A  ++ Y+HKGD + ++GK+  RSY  + G   Y+ EI +++++ LS K +N  A +
  S:     3 VNKVILIGNVGQDPRVKYFDTGSAVATFPLATTDRGYTLANGTQIPERTEWHNIVASNRLAEIVDKYVHKGDKLYLEGKIRTRSYSDQSGAMRYITEIFVDNMEMLSPKGANTGAGA 119
>gi|88854481|ref|ZP_01129148.1| single-strand DNA-binding protein [marine actinobacterium PHSC20C1] >gi|88816289|gb|EAR26144.1| single-strand DNA-binding protein [marine actinobacterium PHSC20C1] (172 aa)
Score = 133, Expect = 1.5e-06, Identities = 33/94 (35%), Positives = 49/94 (52%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIAS--------SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + +VG L  DP+   TQ G+  +  +IAS        S+ W   E  F     W+  A  +   L KG  V   G+L +RSY +KEG+    +E+ I+ I P
  S:     7 ITVVGNLTADPELRYTQGGLAVANFTIASTPRTFDRASNEWKDGEALFLRASCWREFAEHVAGTLTKGSRVIAQGRLRQRSYETKEGEKRTSMELEIDEIGP 108
>gi|146296358|ref|YP_001180129.1| single-strand binding protein [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409934|gb|ABP66938.1| single-strand binding protein [Caldicellulosiruptor saccharolyticus DSM 8903] (160 aa)
Score = 133, Expect = 1.5e-06, Identities = 32/95 (33%), Positives = 53/95 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW---NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESI 95
           MNKV ++GRL +DP+  +T N    +  ++A +  +   N  +  F P VAW   A F  +YL KG  V + G+L  R++  +  +  Y+ E++ E I
  S:     1 MNKVILMGRLTRDPEFRLTANNTPVANFTLAVNRRFRRENDQDADFIPIVAWSRLAEFSKNYLKKGRQVVVIGRLQLRTWDDESNRRHYITEVIAEEI 98
>gi|20066002|ref|NP_612868.1| putative single stranded DNA binding protein [Clostridium phage phi3626] >gi|168211314|ref|ZP_02636939.1| single-strand binding protein family [Clostridium perfringens B str. ATCC 3626] >gi|19908333|gb|AAL96809.1| putative single stranded DNA binding protein [bacteriophage phi3626] >gi|170710688|gb|EDT22870.1| single-strand binding protein family [Clostridium perfringens B str. ATCC 3626] (138 aa)
Score = 133, Expect = 1.6e-06, Identities = 38/123 (30%), Positives = 62/123 (50%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLS-SKNSNNAASSIDKNYNPTNTKNNN 123
           MNKV ++GRL +DP+ +F    G   +R ++A +  +     + E  F  C+A+      I  Y+ KG  +AI G +   SY  KEG   Y   +V+E    +  +K  N+   +      P N+ NN+
  S:     1 MNKVVLIGRLTKDPELRFTATKGTAVARFTLAVNRKYKGENGEYEADFIQCIAYGKPGEIIAQYMTKGRQLAIVGNIRTGSYEDKEGTKRYTTGVVVEGFDFIDYAKRENDFGGAFS---TPDNSFNND 126
>gi|78356588|ref|YP_388037.1| single-strand binding protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78218993|gb|ABB38342.1| single-strand binding protein [Desulfovibrio desulfuricans G20] (166 aa)
Score = 133, Expect = 1.6e-06, Identities = 33/101 (32%), Positives = 57/101 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +NKV ++GRL  DP+   +Q+G   +R+ IA+S+ +   E      T +   V +Q  A    +YL KG +V ++G L  R +  ++G+  Y  EI  + ++ L  K
  S:     3 LNKVMLIGRLGADPELKYSQSGTPVARMRIATSETYTDREGNRQESTEWHTVVVFQRQAENCANYLSKGSMVYVEGSLQTRQWQDQQGQNRYTTEIKGQRVQFLDRK 109
>gi|157372339|ref|YP_001480328.1| single-strand binding protein [Serratia proteamaculans 568] >gi|157324103|gb|ABV43200.1| single-strand binding protein [Serratia proteamaculans 568] (181 aa)
Score = 133, Expect = 1.6e-06, Identities = 33/92 (35%), Positives = 49/92 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV +VG L QDP+     NG   + I++A+S++W        K +T +   V +   A     YL KG  V I+G L  R +  + G   Y  EIV+
  S:     6 VNKVILVGHLGQDPEVRYMPNGGAVANITLATSESWRDKATGEQKEKTEWHRVVLFGKLAEIAGEYLRKGSQVYIEGFLQTRKWTDQAGVEKYTTEIVV 104
>gi|94986935|ref|YP_594868.1| single-stranded DNA-binding protein [Lawsonia intracellularis PHE/MN1-00] >gi|94731184|emb|CAJ54546.1| Single-stranded DNA-binding protein [Lawsonia intracellularis PHE/MN1-00] (151 aa)
Score = 133, Expect = 1.6e-06, Identities = 44/138 (31%), Positives = 73/138 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-----NKNE-TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSN--NAASSIDKNYNPTNTKNNNYSQQSNM-SVSEAMDD 138
           +NKV I+GRL +DP+   TQ G     ++IA+ +++     NK E T +     +Q  A     YL KG LV ++G L  R +  ++G+  Y  EI  + ++ L  K ++        ++  + TNT+ N +   S   S +  MDD
  S:     2 LNKVMIIGRLGRDPEIRYTQTGSPVCSLNIATDESYTDRDGNKVERTEWHRVSVFQRAAENCGQYLSKGSLVFVEGNLQTRKWQDQQGQDRYTTEIKAQRVQFLDRKGADLGQGLYQQEQPVSSTNTQQNGFEDISPFPSEASGMDD 148
>gi|116513138|ref|YP_812045.1| single-strand DNA-binding protein [Lactococcus lactis subsp. cremoris SK11] >gi|125625230|ref|YP_001033713.1| single-strand DNA-binding protein [Lactococcus lactis subsp. cremoris MG1363] >gi|116108792|gb|ABJ73932.1| Single-stranded DNA-binding protein [Lactococcus lactis subsp. cremoris SK11] >gi|124494038|emb|CAL99038.1| Single-strand binding protein [Lactococcus lactis subsp. cremoris MG1363] (166 aa)
Score = 133, Expect = 1.6e-06, Identities = 36/129 (27%), Positives = 70/129 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYN---PTNTKNNNYSQQSN 129
           +N V +VGR+ +DP+   T      +  S+A +  +     + E  F  CV W+  A  + ++  KG L+ + G++  R+Y +++G+ VYV E+V +S + L S+++ +         +   P+ + NN    Q+N
  S:     2 INNVVLVGRITRDPELRYTPQNQAVATFSLAVNRQFKNANGEREADFINCVIWRQQAENLANWAKKGALIGVTGRIQTRNYENQQGQRVYVTEVVADSFQMLESRSARDGMGGGASAGSYSAPSQSTNNTPRPQTN 137
>gi|47094416|ref|ZP_00232104.1| single-strand binding protein [Listeria monocytogenes str. 4b H7858] >gi|47017210|gb|EAL08055.1| single-strand binding protein [Listeria monocytogenes str. 4b H7858] (121 aa)
Score = 133, Expect = 1.6e-06, Identities = 33/110 (30%), Positives = 59/110 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIA----SSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSI 110
           +N+V +VGRL ++P+   T        ++ A      +    N+  F  CV W   A     +  KG LV + G+L  R+Y++KE + +Y+ E+++  I+ LSS+N +    +I
  S:     2 INQVTLVGRLTKEPELKWTAEDRAVLNLTFALNRFGKNKRVDNDADFIQCVIWGKRAEATAEFCAKGQLVGVVGELQSRNYLNKEEQKIYITEVLVHQIRYLSSRNKDERVVNI 115
>gi|167626924|ref|YP_001677424.1| single-strand DNA binding protein [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167596925|gb|ABZ86923.1| single-strand DNA binding protein [Francisella philomiragia subsp. philomiragia ATCC 25017] (162 aa)
Score = 133, Expect = 1.7e-06, Identities = 35/107 (32%), Positives = 58/107 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN-ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAA 107
           +NKV ++GRL  DP+   TQNG T + +SIA++D   +N  T +   V +  +A  I  Y +KG  + I+G+L    +  K G   Y  E+V  + + ++  NS   +
  S:     6 VNKVILLGRLGNDPEVRTTQNGTTVATLSIATNDGMGENITTEWHRVVVFGKSAEAIQRYANKGTQLFIEGRLRTNKWQDKNGNMQYTTEVVASNFQFVAGGNSQGGS 113
>gi|109896479|ref|YP_659734.1| single-strand binding protein [Pseudoalteromonas atlantica T6c] >gi|109698760|gb|ABG38680.1| single-strand binding protein [Pseudoalteromonas atlantica T6c] (200 aa)
Score = 132, Expect = 1.7e-06, Identities = 30/98 (30%), Positives = 55/98 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPL 98
           +NKV +VG L QDP+     NG   + +SIA+S++W   +      T +     ++  A     YL KG  + ++GKL  R +  ++G+  Y  E++++ ++ L
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANLSIATSESWKDQQGQMQERTEWHRLTMYRRLAEVAGEYLRKGSQIYVEGKLQTRKWQDQQGQDKYTTEVIVDQMQML 109
>gi|15894232|ref|NP_347581.1| single-stranded DNA-binding protein [Clostridium acetobutylicum ATCC 824] >gi|37999762|sp|Q97KH4|SSB1_CLOAB Single-stranded DNA-binding protein 1 (SSB 1) (Helix-destabilizing protein 1) >gi|15023848|gb|AAK78921.1|AE007610_1 Single-stranded DNA-binding protein [Clostridium acetobutylicum ATCC 824] (110 aa)
Score = 132, Expect = 1.8e-06, Identities = 32/101 (31%), Positives = 56/101 (55%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           MNK+ ++GR+ ++P  + +   G  +   +IA +    +   +NE  F P   W  TA  +  Y+ KG LV + G+L  R+Y   +G   Y+ E+V E ++ L +K
  S:     1 MNKILLIGRMTKNPSIKQIETTGNNRCNFTIAVNRRVRNTNGENEADFIPVTVWGKTAENVARYMKKGYLVGVSGRLQVRTYQDVDGNRKYITEVVGEEVQFLETK 106
>gi|149114921|ref|ZP_01841670.1| single-strand binding protein [Shewanella baltica OS223] >gi|146865370|gb|EDK50697.1| single-strand binding protein [Shewanella baltica OS223] (236 aa)
Score = 132, Expect = 1.9e-06, Identities = 36/107 (33%), Positives = 58/107 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE---SIKPLSSKNSNNAA 107
           +NKV +VG L QDP+     NG   + I++A+S++W   +      T +   V +   A     YL KG  V ++GKL  R +  + G+  Y  E+VI+   S++ L S+     A
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSESWKDQQGQQQERTEWHRVVLFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQSGQDRYSTEVVIDQSGSMQMLGSRGQGGQA 121
>gi|160881115|ref|YP_001560083.1| single-strand binding protein [Clostridium phytofermentans ISDg] >gi|160429781|gb|ABX43344.1| single-strand binding protein [Clostridium phytofermentans ISDg] (141 aa)
Score = 132, Expect = 1.9e-06, Identities = 34/105 (32%), Positives = 61/105 (58%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNN 105
           MNKV ++ RL +DP+ ++   NG   +   IA +  + ++   +  FF CV +   A F   YL KG  +AI G +   +Y +K+G+ VY  +I+++ ++   SK+S +
  S:     1 MNKVMMICRLTKDPEIRYGQANGTAIASYGIAVNRRFKRDGEPDADFFNCVCFGRNAEFAEKYLAKGSKIAIVGSIQNENYTNKDGQKVYSTKILVDEMEFAESKSSGS 109
>gi|22536744|ref|NP_687595.1| prophage LambdaSa1, single-strand binding protein [Streptococcus agalactiae 2603V/R] >gi|37999690|sp|Q8E0Z9|SSB3_STRA5 Single-stranded DNA-binding protein 3 (SSB 3) (Helix-destabilizing protein 3) >gi|22533587|gb|AAM99467.1|AE014217_22 prophage LambdaSa1, single-strand binding protein [Streptococcus agalactiae 2603V/R] (138 aa)
Score = 132, Expect = 1.9e-06, Identities = 37/134 (27%), Positives = 72/134 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSE 134
           +N + +VGR+ +D +   T +    +  S+A + N+     + E  F  CV W+  A  + ++  KG LV I G++  R+Y +++G+ +YV E+V E+ + L S+NS    +         N+ N+ +   + M +S+
  S:     2 INNIVLVGRMTKDAELRYTPSNQAVATFSLAVNRNFKNQSGEREADFINCVIWRQQAENLANWAKKGALVGITGRIQTRNYENQQGQRIYVTEVVAENFQLLESRNSQQQTN------QSGNSSNSYFGNANKMDISD 133
>gi|146291745|ref|YP_001182169.1| single-strand binding protein [Shewanella putrefaciens CN-32] >gi|145563435|gb|ABP74370.1| single-strand binding protein [Shewanella putrefaciens CN-32] (236 aa)
Score = 132, Expect = 1.9e-06, Identities = 36/107 (33%), Positives = 58/107 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE---SIKPLSSKNSNNAA 107
           +NKV +VG L QDP+     NG   + I++A+S++W   +      T +   V +   A     YL KG  V ++GKL  R +  + G+  Y  E+VI+   S++ L S+     A
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSESWKDQQGQQQERTEWHRVVLFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQSGQDRYSTEVVIDQSGSMQMLGSRGQGGQA 121
>gi|124265304|ref|YP_001019308.1| single-strand binding protein [Methylibium petroleiphilum PM1] >gi|124258079|gb|ABM93073.1| single-strand binding protein [Methylibium petroleiphilum PM1] (173 aa)
Score = 132, Expect = 1.9e-06, Identities = 33/98 (33%), Positives = 52/98 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN-------ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPL 98
           +NKV ++G L +DP+   T +G     IS+A++ NW          ET +   V +   A     YL KG  V ++G+L  R +  K+G   Y  EI+ E ++ L
  S:     4 INKVILIGNLGRDPEVRYTPSGSAVCNISLATTRNWKSKDSGDKVEETEWHRVVFYDRLAEIAGEYLKKGRPVYVEGRLKTRKWQDKDGAEKYTTEIIAEQMQLL 108
>gi|126175947|ref|YP_001052096.1| single-strand binding protein [Shewanella baltica OS155] >gi|152999106|ref|YP_001364787.1| single-strand binding protein [Shewanella baltica OS185] >gi|160873703|ref|YP_001553019.1| single-strand binding protein [Shewanella baltica OS195] >gi|125999152|gb|ABN63227.1| single-strand binding protein [Shewanella baltica OS155] >gi|151363724|gb|ABS06724.1| single-strand binding protein [Shewanella baltica OS185] >gi|160859225|gb|ABX47759.1| single-strand binding protein [Shewanella baltica OS195] (234 aa)
Score = 132, Expect = 1.9e-06, Identities = 36/107 (33%), Positives = 58/107 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE---SIKPLSSKNSNNAA 107
           +NKV +VG L QDP+     NG   + I++A+S++W   +      T +   V +   A     YL KG  V ++GKL  R +  + G+  Y  E+VI+   S++ L S+     A
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSESWKDQQGQQQERTEWHRVVLFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQSGQDRYSTEVVIDQSGSMQMLGSRGQGGQA 121
>gi|119773656|ref|YP_926396.1| single-strand binding protein [Shewanella amazonensis SB2B] >gi|119766156|gb|ABL98726.1| single-strand binding protein [Shewanella amazonensis SB2B] (234 aa)
Score = 132, Expect = 1.9e-06, Identities = 33/93 (35%), Positives = 52/93 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE 93
           +NKV +VG L QDP+     NG   + I++A+S++W  N+      T +   V +   A     YL KG  V ++GKL  R +  + G+  Y  EIV++
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSESWKDNQGQQQERTEWHRVVMFGKLAEIAGEYLRKGSQVYLEGKLQTRKWKDQSGQDRYTTEIVVD 104
>gi|91776774|ref|YP_546530.1| single-strand binding protein [Methylobacillus flagellatus KT] >gi|91710761|gb|ABE50689.1| single-strand binding protein [Methylobacillus flagellatus KT] (167 aa)
Score = 132, Expect = 2.0e-06, Identities = 34/98 (34%), Positives = 55/98 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPL 98
           +NKV +VG L +DP+     NG   +  SIA++D+W       +  T +   V ++  A     YL KG  V I+G+L  R + +KEG+  Y  EI+ + ++ L
  S:     4 VNKVILVGNLGRDPEVRYMPNGEAVANFSIATTDSWKDKNGQRQERTEWHNIVMYRRLAEIAGEYLKKGRPVYIEGRLQTRKWQTKEGQDRYTTEIIADQMQML 107
>gi|110599474|ref|ZP_01387712.1| single-strand binding protein [Geobacter sp. FRC-32] >gi|110549853|gb|EAT63041.1| single-strand binding protein [Geobacter sp. FRC-32] (148 aa)
Score = 132, Expect = 2.0e-06, Identities = 33/99 (33%), Positives = 53/99 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLS 99
           +NKV ++G L +DP+   T  G   +  S+A++D +       + +T +     W   A     YL KG  V I+G+L  R +  ++GK  Y  EIV E ++ LS
  S:     4 LNKVMLIGNLGKDPEVRYTAAGTAVASFSLATTDRFKSKSGEWEEKTEWHNITLWSRLAEIAGEYLSKGKTVYIEGRLQTRKWQDRDGKDRYTTEIVGEKMQMLS 108
>gi|149882804|ref|YP_001294783.1| single-stranded DNA-binding protein [Microbacterium phage Min1] >gi|148763435|gb|ABR10453.1| single-stranded DNA-binding protein [Microbacterium phage Min1] (154 aa)
Score = 132, Expect = 2.0e-06, Identities = 32/94 (34%), Positives = 48/94 (51%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIASS--------DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + +VG L  DP+   TQNG+  +  +IAS+        + W   E  F     W+  A  +   L KG  V   G+L +RSY  +EG     IE+ ++ I P
  S:     7 ITVVGNLTADPELRYTQNGLPVANFTIASTPRTFDRQANEWKDGEALFLRASVWREFAEHVAGSLTKGMRVIASGRLKQRSYQDREGNNRTAIELEVDEIGP 108
>gi|116512808|ref|YP_811715.1| single-stranded DNA-binding protein [Lactococcus lactis subsp. cremoris SK11] >gi|116108462|gb|ABJ73602.1| Single-stranded DNA-binding protein [Lactococcus lactis subsp. cremoris SK11] (141 aa)
Score = 132, Expect = 2.0e-06, Identities = 39/134 (29%), Positives = 72/134 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSN-MSVSE 134
           +N V +VGR+ ++P+   TQ     +  ++A +  +     + E  F  CV W  +A  + ++ HKG L+ + G +  R+Y +++G+ VY+ E+V  + + L   N  N     ++  NP +   NN S  S+ M VS+
  S:     2 INNVTLVGRITKEPELRYTQQNKAVASFTLAVNRAFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVTGSIQTRNYENQQGQRVYITEVVASNFQVLEKSNQANG----ERVSNPASKPQNNDSFGSDPMEVSD 136
>gi|30250374|ref|NP_842444.1| single-strand binding protein family [Nitrosomonas europaea ATCC 19718] >gi|37999371|sp|Q82S98|SSB_NITEU Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|30181169|emb|CAD86365.1| Single-strand binding protein family [Nitrosomonas europaea ATCC 19718] (149 aa)
Score = 132, Expect = 2.0e-06, Identities = 37/142 (26%), Positives = 68/142 (47%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSN--MSVSEAMDDFESN 142
           +NKV ++G L +DP+     +G   + ++IA++D W       +  T +   V +   A     YL KG  + I+G+L  R +  K     Y  EIV + ++ L  ++   +       Y+P   ++++Y  QS      +   DD E +
  S:     4 LNKVMLIGNLGRDPEIRYMPSGDAMANLNIATTDTWKDKGGEKQERTEWHRVVMFGKQAEIAGEYLKKGSQIYIEGRLQTRKWTDKSNVERYTTEIVADRMQMLGGRSGGGS-------YDPPADRDHDYQSQSTPPAKSNTGFDDMEDD 146
>gi|10954410|ref|NP_067548.1| single strand binding protein [Aggregatibacter actinomycetemcomitans] >gi|10880887|gb|AAG24401.1|AF302424_1 single strand binding protein [Actinobacillus actinomycetemcomitans] (145 aa)
Score = 132, Expect = 2.1e-06, Identities = 34/90 (37%), Positives = 53/90 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKNE------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEI 90
           +NKV IVGRL  +P+     NG + + +S+A+S++W +KN       T +   V ++  A     YLHKG  V I+G+L  R +  + G+  Y  EI
  S:     4 VNKVIIVGRLGNEPEMRAMPNGESVANLSVATSESWTDKNTGERREVTEWHRIVFYRRQAEVCGEYLHKGSQVYIEGRLKTRKWQDQSGQDRYTTEI 100
>gi|94987734|ref|YP_595835.1| single-strand DNA-binding protein [Streptococcus pyogenes MGAS9429] >gi|94991602|ref|YP_599701.1| single-strand DNA-binding protein [Streptococcus pyogenes MGAS2096] >gi|94541242|gb|ABF31291.1| single-strand DNA binding protein [Streptococcus pyogenes MGAS9429] >gi|94545110|gb|ABF35157.1| Single-strand DNA binding protein [Streptococcus pyogenes MGAS2096] (131 aa)
Score = 132, Expect = 2.1e-06, Identities = 35/100 (35%), Positives = 54/100 (54%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           NKV  +GRL   P+   T      +R+S+A +  +     + E  F   V W   A  + SY  KG L++IDG+L  R Y  K+G+  YV E++ +S + L S+
  S:     3 NKVIAIGRLVAKPELVKTATDKHVARLSLAVNRRFKNASGEREADFISVVVWGKLAETLVSYASKGSLISIDGELRTRKY-DKDGQVHYVTEVLCQSFQLLESR 105
>gi|19745296|ref|NP_606432.1| single-strand DNA-binding protein [Streptococcus pyogenes MGAS8232] >gi|19747395|gb|AAL96931.1| putative single-strand binding protein [Streptococcus pyogenes MGAS8232] (131 aa)
Score = 132, Expect = 2.1e-06, Identities = 35/100 (35%), Positives = 54/100 (54%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           NKV  +GRL   P+   T      +R+S+A +  +     + E  F   V W   A  + SY  KG L++IDG+L  R Y  K+G+  YV E++ +S + L S+
  S:     3 NKVIAIGRLVAKPELVKTATDKHVARLSLAVNRRFKNASGEREAGFISVVVWGKLAETLVSYASKGSLMSIDGELRTRKY-DKDGQVHYVTEVLCQSFQLLESR 105
>gi|149004412|ref|ZP_01829152.1| single strand binding protein (SSB) [Streptococcus pneumoniae SP14-BS69] >gi|147757661|gb|EDK64679.1| single strand binding protein (SSB) [Streptococcus pneumoniae SP14-BS69] (140 aa)
Score = 132, Expect = 2.1e-06, Identities = 35/123 (28%), Positives = 70/123 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK---------NSNNAASSIDKNYNPTNTKNNN 123
           +N V +VGRL +D +   TQ+ +  +  ++  +  +     + E  F  CV W+  A  + ++  KG L+ I G++  R+Y +++G+ VYV E+V E+ + +  K         N +  A +  +N NP +  +++
  S:     2 INNVVLVGRLTKDAELRYTQSNVAVATFTLVVNRTFKSENGEREADFINCVMWRKQAENLANWAKKGALIGITGRIQTRTYDNQQGQRVYVTEVVAENFQLMEFKKDGSQPVVDNHDQQAPNFARNSNPMDISDDD 137
>gi|187934592|ref|YP_001886957.1| single-strand binding protein [Clostridium botulinum B str. Eklund 17B] >gi|187722745|gb|ACD23966.1| single-strand binding protein [Clostridium botulinum B str. Eklund 17B] (140 aa)
Score = 131, Expect = 2.2e-06, Identities = 39/124 (31%), Positives = 60/124 (48%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNY 124
           MNK  ++GRL +DP+   T    T       + D +N    + E  F P V W   A    +Y+ KG  +AI G++  R+Y +K+G   YV E+V   ++ LS   +N    S   N+   N    N+
  S:     1 MNKAVLIGRLTKDPELRFTPGAGTAVTTLTLAVDKYNSKSGQKEADFVPVVVWGKQAESTANYMTKGSQMAISGRIQTRNYEAKDGTKRYVTEVVATEVQFLSKGANNQDNGS--NNFGNINQDYGNF 126
>gi|195978937|ref|YP_002124181.1| single-strand binding protein Ssb [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975642|gb|ACG63168.1| single-strand binding protein Ssb [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (131 aa)
Score = 131, Expect = 2.2e-06, Identities = 38/109 (34%), Positives = 59/109 (54%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK-----NSNNAASSI 110
           NKV ++GRL   P+   T       R ++A +  +     + E  F   VAW   A  + SY  KG L+++DG+L  R Y  K G+T +V E++  S + L S+       NNAA+ +
  S:     3 NKVILIGRLVAKPELTKTLTDKQVVRFTLAVNRRFKTTTGEREVDFINVVAWGGLAETLASYASKGSLLSLDGELRTRKY-DKAGQTHFVTEVLCHSFQLLESRAQRAIRENNAANDL 119
>gi|126648050|ref|ZP_01720544.1| single-strand binding protein [Algoriphagus sp. PR1] >gi|126575643|gb|EAZ79953.1| single-strand binding protein [Algoriphagus sp. PR1] (225 aa)
Score = 131, Expect = 2.3e-06, Identities = 35/108 (32%), Positives = 60/108 (55%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN------ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           N+V ++GRL    +      G T  ++S+A+++ +         ET +   VAW   A+ ++ Y  KG  +AI+ KL  RSY  KEG   Y+ E+V++SI  +  + +N  A +
  S:   104 NRVQLIGRLGSKIEIKNLDGGKTLGKVSMATNEYYKNQKGERVEETTWHNIVAWGKQADLLDKYTDKGSEIAIEDKLSNRSYEDKEGNKRYISEVVVQSILLMGDRKANVPAGA 217
>gi|16801728|ref|NP_471996.1| hypothetical protein lin2667 [Listeria innocua Clip11262] >gi|16415203|emb|CAC97893.1| lin2667 [Listeria innocua] (121 aa)
Score = 131, Expect = 2.3e-06, Identities = 33/101 (32%), Positives = 55/101 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIA----SSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +N+V +VGRL ++P+   T        ++IA      +    N+  F  CV W   A     +  KG LV + G+L  R Y++KE + VY+ E+++  I+ LSS+
  S:     2 INQVTLVGRLTKEPELKWTTEDRAVLNLTIALNRFRKNKRVDNDADFIQCVIWGKRAEATAEFCSKGQLVGVIGELQSRQYLNKEEQKVYITEVLVHQIRYLSSR 106
>gi|194435945|ref|ZP_03068048.1| single-strand binding protein [Escherichia coli 101-1] >gi|194425488|gb|EDX41472.1| single-strand binding protein [Escherichia coli 101-1] (161 aa)
Score = 131, Expect = 2.3e-06, Identities = 31/94 (32%), Positives = 51/94 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIES 94
           +NKV ++G L QDP      NG   + I++A+S+ W        + +T +   V +   A   + YL KG  V IDG+L  R +  + G+  Y  E+V+ +
  S:     6 INKVILIGYLGQDPDIRYMPNGGAVASIALATSETWRDKQTGEMREQTEWHRVVLFGKLAEVASEYLRKGAQVYIDGQLRTRKWTDQTGQERYTTEVVVHT 106
>gi|169832352|ref|YP_001718334.1| single-strand binding protein [Candidatus Desulforudis audaxviator MP104C] >gi|169639196|gb|ACA60702.1| single-strand binding protein [Candidatus Desulforudis audaxviator MP104C] (142 aa)
Score = 131, Expect = 2.4e-06, Identities = 31/98 (31%), Positives = 53/98 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPL 98
           +NK+ ++GRLA+DP+   T +G   +  ++A      D      T F   VAW+        +L KG LV ++G+L  RSY   +G    V E++ ++++ L
  S:     2 LNKIILIGRLARDPELRYTPSGTPVAGFTVAVDRPFVDKQGNRGTDFIDVVAWRKLGETCARHLGKGRLVCVEGRLELRSYEDNQGIRRKVAEVIADNVRFL 103
>gi|146298630|ref|YP_001193221.1| single-strand binding protein [Flavobacterium johnsoniae UW101] >gi|146153048|gb|ABQ03902.1| single-strand binding protein [Flavobacterium johnsoniae UW101] (108 aa)
Score = 131, Expect = 2.4e-06, Identities = 32/94 (34%), Positives = 53/94 (56%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN------ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESI 95
           N+V ++G    DP+    ++G   + ++IA+++ +         +T +    AW  TA  I  ++ KG  VAIDGKL  RSY  K G+  Y+ E+V+  I
  S:     6 NRVQLIGNAGNDPEVKTLESGKKLAHLTIATNEIYRNEKGDKVEQTEWHRVTAWGKTAEIIEKFVVKGKEVAIDGKLTHRSYDDKNGEKKYITEVVVNEI 105
>gi|15617138|ref|NP_240351.1| single-strand binding protein [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11387134|sp|P57610|SSB_BUCAI Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|25294289|pir||E84993 single-strand binding protein [imported] - Buchnera sp. (strain APS) >gi|10039203|dbj|BAB13237.1| single-strand binding protein [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (171 aa)
Score = 131, Expect = 2.4e-06, Identities = 41/123 (33%), Positives = 66/123 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE---SIKPLSSKNSNNAASSI-DKNYNPTNTKNNN 123
           +NKV ++G L QDP+     NG     +++A+S+NW       NK +T +   V +   A     YL KG  V I+G L  R +  + G   Y  EI++    +++ L ++NSN  A ++ DKN      K  +
  S:     6 VNKVILIGHLGQDPEVRYMPNGNAVVNMTLATSENWKDKNTGENKEKTEWHRIVLFGKLAEIAGEYLRKGSQVYIEGSLQTRKWQDQNGLERYTTEIIVNIGGTMQMLGNRNSNLQAMTVNDKNSTGIKIKKTD 139
>gi|148266407|ref|YP_001233113.1| single-strand binding protein [Geobacter uraniireducens Rf4] >gi|146399907|gb|ABQ28540.1| single-strand binding protein [Geobacter uraniireducens Rf4] (149 aa)
Score = 131, Expect = 2.4e-06, Identities = 33/99 (33%), Positives = 54/99 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLS 99
           +NKV ++G L +DP+   T +G   +  S+A+S+ +       + +T +     W   A     YL KG  V I+G+L  R +  ++GK  Y  EIV E ++ LS
  S:     4 LNKVMLIGNLGKDPEVRYTASGTAVASFSLATSEKFKNKSGEWEEKTEWHNVTLWARLAEIAGEYLSKGKTVYIEGRLQTRKWQDRDGKDRYTTEIVGEKMQMLS 108
>gi|171779261|ref|ZP_02920232.1| hypothetical protein STRINF_01109 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282317|gb|EDT47744.1| hypothetical protein STRINF_01109 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (168 aa)
Score = 131, Expect = 2.5e-06, Identities = 42/148 (28%), Positives = 77/148 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN---ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTS 148
           +N V +VGR+ +D +   T +    +  ++A + N+ N+N   E  F  CV W+  A  + ++  KG LV + G++  R+Y +++G+ VY+ E+V ++ + L S+ +    SS   +YN     N++    SN   S        NF +  S
  S:     2 INNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQNGEREADFINCVIWRQQAENLANWAKKGTLVGVTGRIQTRNYENQQGQRVYITEVVADNFQILESRATREGQSS--GSYNGGFNNNSSLDGSSNGGFSSQSSQQTPNFGRDES 151
>gi|160886220|ref|ZP_02067223.1| hypothetical protein BACOVA_04227 [Bacteroides ovatus ATCC 8483] >gi|156108105|gb|EDO09850.1| hypothetical protein BACOVA_04227 [Bacteroides ovatus ATCC 8483] (183 aa)
Score = 131, Expect = 2.5e-06, Identities = 33/109 (30%), Positives = 59/109 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK--------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           +N+V +VG + QDP+      G   +   +A++D              T +   VA    A  ++ Y+HKGD + ++GK+  RSY  + G   Y+ EI +++++ LS K +N  A +
  S:    27 VNRVILVGNVGQDPRVKYFDTGSAVATFPLATTDRGYTLANGTQIPERTEWHNIVASNRLAEIVDKYVHKGDKLYLEGKIRTRSYSDQSGAMRYITEIYVDNMEMLSPKGANPGAGA 143
>gi|148990117|ref|ZP_01821357.1| single-strand binding protein family protein [Streptococcus pneumoniae SP6-BS73] >gi|147924511|gb|EDK75599.1| single-strand binding protein family protein [Streptococcus pneumoniae SP6-BS73] (131 aa)
Score = 131, Expect = 2.5e-06, Identities = 38/109 (34%), Positives = 59/109 (54%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASS----DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK-----NSNNAASSI 110
           NKV ++GRL   P+   T N  + +R +IA +    D   + E  F   V W   A  + SY  KG L+++DG+L  R +  K G+  YVIE+++   + L S+       NNA   +
  S:     3 NKVIMIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREADFVNMVLWGRLAETLASYATKGSLISVDGELRTRRF-EKNGQMNYVIEVLVTGFQLLESRAQRAMRENNAGQDL 119
>gi|91206337|ref|YP_538691.1| single-stranded DNA-binding protein [Escherichia coli UTI89] >gi|91075788|gb|ABE10668.1| single strand DNA-binding protein [Escherichia coli UTI89] (188 aa)
Score = 131, Expect = 2.6e-06, Identities = 34/94 (36%), Positives = 53/94 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIES 94
           +NKV +VGRL +DP+     NG   + + +A+S+ W        K +T +   V +   A     YL KG  V I+G+L  RS+    G T YV EI++++
  S:    19 INKVILVGRLGKDPEVRYIPNGGAVANLQVATSETWRDKQTGEMKEQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSW-EDNGITRYVTEILVKT 118
>gi|191165491|ref|ZP_03027332.1| single-stranded DNA-binding protein [Escherichia coli B7A] >gi|190904414|gb|EDV64122.1| single-stranded DNA-binding protein [Escherichia coli B7A] (171 aa)
Score = 131, Expect = 2.6e-06, Identities = 33/109 (30%), Positives = 59/109 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI---ESIKPLSSKNSNNAASS 109
           +NKV I+GRL  DP+   + +G   + +++A+S+ W        K +T +   V     A   + YL KG  V ++GKL  R +  + G+  +  E+++    +++ L  K   N  SS
  S:     6 VNKVIIIGRLGHDPEIRYSPSGTAFANLTVATSEQWRDKQTGEQKEQTEWHRVVMSGKLAEIASEYLRKGSEVYLEGKLRTRKWQDQSGQDRFTTEVIVGVGGTMQMLGGKQGGNEQSS 124
>gi|167763391|ref|ZP_02435518.1| hypothetical protein BACSTE_01765 [Bacteroides stercoris ATCC 43183] >gi|167698685|gb|EDS15264.1| hypothetical protein BACSTE_01765 [Bacteroides stercoris ATCC 43183] (151 aa)
Score = 131, Expect = 2.7e-06, Identities = 31/103 (30%), Positives = 58/103 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK--------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           +NKV ++G + +DP+      G+  +   +A+SD              T +   V W+  A     Y+HKGD + ++GK+  RSY  + G   YV EI +++++ LS++++
  S:     3 VNKVILLGNVGRDPEVRYLDTGVAVATFPLATSDRAYTLANGTQVPERTEWHNLVLWRGLAETAEKYVHKGDKLYVEGKIRTRSYDDQTGAKRYVTEIFVDNMEMLSARSA 113
>gi|119718880|ref|YP_925845.1| single-strand binding protein [Nocardioides sp. JS614] >gi|119539541|gb|ABL84158.1| single-strand binding protein [Nocardioides sp. JS614] (188 aa)
Score = 131, Expect = 2.7e-06, Identities = 29/94 (30%), Positives = 48/94 (51%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIASS--------DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + +VG L  DP+   T +G   +   IAS+        + W   +  F  C  W+  A  +   L +G  V + G+L  R+Y ++EG+   V EI +E + P
  S:     7 ITVVGNLVDDPELRFTPSGAAVANFRIASTPRTFDRQTNEWKDGDALFLSCSVWRQAAENVAESLQRGMRVVVQGRLKSRTYETREGEKRTVFEIEVEEVGP 108
>gi|169176785|ref|ZP_02838492.1| single-strand binding protein [Arthrobacter chlorophenolicus A6] >gi|169015140|gb|EDS61661.1| single-strand binding protein [Arthrobacter chlorophenolicus A6] (193 aa)
Score = 131, Expect = 2.7e-06, Identities = 33/94 (35%), Positives = 50/94 (53%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIAS--------SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + ++G L  DP+   T +G   +  +IAS        S+ W   ET F     W+  A  +   L KG  V + G+L  RSY +KEG+   VIE+ ++ I P
  S:     7 ITVIGNLTNDPELRFTPSGSAVANFTIASTPRTFDRQSNEWKDGETLFLRAAVWREAAENVAESLTKGMRVIVTGRLKSRSYETKEGEKRTVIELEVDEIGP 108
>gi|121610654|ref|YP_998461.1| single-strand binding protein [Verminephrobacter eiseniae EF01-2] >gi|121555294|gb|ABM59443.1| single-strand binding protein [Verminephrobacter eiseniae EF01-2] (167 aa)
Score = 131, Expect = 2.7e-06, Identities = 50/167 (29%), Positives = 76/167 (45%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNET-YFFPCVAWQST------ANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDD-PF 167
           +NK  IVG L +DP+     +G   + +SIA++D W   +T        W         A     YL KG  V ++G L  R +  K+G   Y  EI  + +K L S+  ++ ASS      P +  +    Q    S        ESN  Q  ++T+ + +N   E + DD PF
  S:     4 VNKAIIVGYLGRDPEMRTFPSGDQVATVSIATTDRWKDKQTGQLKEATEWHRAVFNGRLAEIAGQYLRKGAQVYVEGSLRTRKWTDKDGVDRYSTEIRADQMKMLGSR--DHGASSAGSPAGPADNGSKYPGQHGKSS--------ESNEMQAAAATH-SFQNGNPEDYDDDIPF 167
>gi|191173636|ref|ZP_03035161.1| plasmid-derived single-stranded DNA-binding protein [Escherichia coli F11] >gi|190906116|gb|EDV65730.1| plasmid-derived single-stranded DNA-binding protein [Escherichia coli F11] (175 aa)
Score = 131, Expect = 2.8e-06, Identities = 34/94 (36%), Positives = 53/94 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIES 94
           +NKV +VGRL +DP+     NG   + + +A+S+ W        K +T +   V +   A     YL KG  V I+G+L  RS+    G T YV EI++++
  S:     6 INKVILVGRLGKDPEVRYIPNGGAVANLQVATSETWRDKQTGEMKEQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSW-EDNGITRYVTEILVKT 105
>gi|124483560|emb|CAM32653.1| single-strand DNA-binding protein (helix-destabilizing protein) [Herbaspirillum seropedicae] (173 aa)
Score = 131, Expect = 2.8e-06, Identities = 32/101 (31%), Positives = 56/101 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +NKV IVG L +DP+     NG   + I++A++++W        K  T +     ++  A     YL KG  + ++G+L  R +  KEG   Y  EI+ ++++ L S+
  S:     4 VNKVIIVGNLGRDPETRYMPNGEAVTNIAVATTESWKDKNTGEKKELTEWHRITFYRKLAEIAGQYLKKGSQIYVEGRLQTRKWQDKEGVERYTTEIIADTMQMLGSR 111
>gi|77412638|ref|ZP_00788914.1| single-strand binding protein [Streptococcus agalactiae CJB111] >gi|77161310|gb|EAO72345.1| single-strand binding protein [Streptococcus agalactiae CJB111] (163 aa)
Score = 131, Expect = 2.8e-06, Identities = 44/138 (31%), Positives = 75/138 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNT--KNNNYSQQSNMSVSEAMDD 138
           +N V +VGR+ +D +   T +    +  S+A + N+     + E  F  CV W+  A  + ++  KG LV I G++  R+Y +++G+ VYV E+V ES + L S+ +    SS   N    N    NN+YS  S  + + + D+
  S:     2 INNVVLVGRMTRDAELRYTPSNQAVATFSLAVNRNFKNQSGEREADFINCVIWRQQAENLANWAKKGALVGITGRIQTRNYENQQGQRVYVTEVVAESFQLLESRATREGGSSNSYNNGGYNNAPSNNSYSASSQQTPNFSRDE 145
>gi|194536865|ref|YP_002072018.1| single-strand binding protein [Vibrio cholerae V51] >gi|125621478|gb|EAZ49812.1| single-strand binding protein [Vibrio cholerae V51] (178 aa)
Score = 131, Expect = 2.8e-06, Identities = 30/92 (32%), Positives = 51/92 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV ++G L QDP+     +G     +++A+S+ W        K +T +     +  TA FI  Y  KG  V +DG+L  R +  ++G+  Y  E+V+
  S:     6 VNKVILIGNLGQDPEVRYMPSGDAMVNLTVATSETWRDKATGEQKEKTEWHRVSVFGKTAEFIGEYARKGTQVYVDGQLQTRKWQDQQGQERYTTEVVV 104
>gi|152968281|ref|YP_001364065.1| single-strand binding protein [Kineococcus radiotolerans SRS30216] >gi|151362798|gb|ABS05801.1| single-strand binding protein [Kineococcus radiotolerans SRS30216] (198 aa)
Score = 130, Expect = 2.9e-06, Identities = 30/94 (31%), Positives = 51/94 (54%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIAS--------SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           V ++G L  DP+   T +G   +  ++AS        S+ W   ET F  C  W+  A  +   L +G  V + G+L  R++ +KEG+   VIE+ ++ + P
  S:     7 VTLIGNLTNDPELRFTPSGAAVANFTVASTPRTFDRQSNEWKDGETLFMRCAIWREAAENVAESLTRGTRVVVTGRLQSRTFDTKEGEKRTVIEMQVDEVGP 108
>gi|171742015|ref|ZP_02917822.1| hypothetical protein BIFDEN_01118 [Bifidobacterium dentium ATCC 27678] >gi|171277629|gb|EDT45290.1| hypothetical protein BIFDEN_01118 [Bifidobacterium dentium ATCC 27678] (218 aa)
Score = 130, Expect = 2.9e-06, Identities = 33/94 (35%), Positives = 52/94 (55%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIASSD-NWNKN-------ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + +VG L  DP+   T NG + +  +IAS+   WN+N       +  F  C AW+  A      L KG  V   G+L +RSY +++G    V+E+ ++ I P
  S:     7 ITVVGNLTADPEIRTTGNGASVASFTIASTPRTWNRNSNQFEDGQALFMRCSAWRDMAEHCAQSLSKGMRVIAQGRLQQRSYQAQDGSQRTVVEMQVDEIGP 108
>gi|78188206|ref|YP_378544.1| single-strand binding protein [Chlorobium chlorochromatii CaD3] >gi|78170405|gb|ABB27501.1| Single-strand binding protein [Chlorobium chlorochromatii CaD3] (172 aa)
Score = 130, Expect = 2.9e-06, Identities = 35/117 (29%), Positives = 61/117 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSY-VSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPT 117
           +NKV ++G L  DP+   T +G + +  ++A+++N+       +  T +   +AW   A   N YL KG  V ++G+L  RS+   K G+  Y  EIV   ++ L S        S  + Y+ +
  S:    17 LNKVMLIGHLGTDPELRTTTSGQSVANFTLATNENYKDSSGNLQERTEWHRIIAWGKLAEICNQYLKKGRQVYVEGRLQTRSWDDQKTGEKKYTTEIVCSDMQMLGSPREQMGGESTMQPYDQS 140
>gi|86130837|ref|ZP_01049436.1| Single-strand binding protein [Cellulophaga sp. MED134] >gi|85818248|gb|EAQ39408.1| Single-strand binding protein [Dokdonia donghaensis MED134] (112 aa)
Score = 130, Expect = 2.9e-06, Identities = 38/101 (37%), Positives = 55/101 (54%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-NKN-----ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKN 102
           NKV ++GRL QDPQ     +G   +  S+A+ D++ +KN       Y+   V        + SY+ KG  +AI+GKL  RS+  K+G   Y  EIV   +  LS  N
  S:     6 NKVQLIGRLGQDPQITTFPDGNKIANFSMATDDSYKDKNGQKIERAYWHNIVVRGGLVKVVESYVQKGQEIAIEGKLTNRSWEDKDGIKRYTTEIVCNELLMLSKNN 112
>gi|71275344|ref|ZP_00651630.1| Single-strand binding protein [Xylella fastidiosa Dixon] >gi|71901024|ref|ZP_00683135.1| Single-strand binding protein [Xylella fastidiosa Ann-1] >gi|71163644|gb|EAO13360.1| Single-strand binding protein [Xylella fastidiosa Dixon] >gi|71729210|gb|EAO31330.1| Single-strand binding protein [Xylella fastidiosa Ann-1] (148 aa)
Score = 130, Expect = 3.0e-06, Identities = 36/123 (29%), Positives = 57/123 (46%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETYFFPCVAWQSTANF------INSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNN 123
           +NKV +VG L  +P    TQ+G+T + IS+A+S      E        W     F         YLHKG    I+G +    +  ++G+  YV EI+ + +  L  +     +S I     P   +NN+
  S:     5 INKVILVGNLGNEPDIKYTQSGMTITSISLATSSKRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEGTIRYDKFTGQDGQERYVTEIIADQMHMLGGRGE--GSSGITPQRRPAKVRNND 131
>gi|22536364|ref|NP_687215.1| single-strand DNA-binding protein [Streptococcus agalactiae 2603V/R] >gi|76787189|ref|YP_328914.1| single-strand DNA-binding protein [Streptococcus agalactiae A909] >gi|76799267|ref|ZP_00781437.1| Single-strand binding protein 2 (SSB 2) (Helix-destabilizing protein2) [Streptococcus agalactiae 18RS21] >gi|77406778|ref|ZP_00783813.1| single-strand binding protein [Streptococcus agalactiae H36B] >gi|77407919|ref|ZP_00784670.1| single-strand binding protein [Streptococcus agalactiae COH1] >gi|77410942|ref|ZP_00787298.1| single-strand binding protein [Streptococcus agalactiae CJB111] >gi|37999691|sp|Q8E220|SSB2_STRA5 Single-stranded DNA-binding protein 2 (SSB 2) (Helix-destabilizing protein 2) >gi|22533190|gb|AAM99087.1|AE014200_6 single-strand binding protein [Streptococcus agalactiae 2603V/R] >gi|76562246|gb|ABA44830.1| single-strand binding protein 2 [Streptococcus agalactiae A909] >gi|76585379|gb|EAO61967.1| Single-strand binding protein 2 (SSB 2) (Helix-destabilizing protein2) [Streptococcus agalactiae 18RS21] >gi|77162997|gb|EAO73952.1| single-strand binding protein [Streptococcus agalactiae CJB111] >gi|77173466|gb|EAO76584.1| single-strand binding protein [Streptococcus agalactiae COH1] >gi|77174621|gb|EAO77455.1| single-strand binding protein [Streptococcus agalactiae H36B] (131 aa)
Score = 130, Expect = 3.0e-06, Identities = 34/100 (34%), Positives = 55/100 (55%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           NKV ++GRL   P+   T    + +R ++A +  +     + E  F   V W   A  + SY  KG L++IDG+L  R Y  K+G+T Y+ E++  S + L S+
  S:     3 NKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWGRLAETLASYGTKGSLISIDGELRTRKY-EKDGQTHYITEVLASSFQLLESR 105
>gi|182437466|ref|YP_001825185.1| putative single-strand DNA-binding protein [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178465982|dbj|BAG20502.1| putative single-strand DNA-binding protein [Streptomyces griseus subsp. griseus NBRC 13350] (204 aa)
Score = 130, Expect = 3.0e-06, Identities = 32/100 (32%), Positives = 52/100 (52%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIASS--------DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           + +VG L  DP+   T +G   ++  +AS+        + W   E  F  C  W+  A  +   L +G  V + G+L +RSY  +EG    V E+ +E + P S KN+
  S:     7 ITVVGNLVDDPELRFTPSGAAVAKFRVASTPRIFDRQTNEWKDGEGLFLTCSVWRQAAENVAESLQRGMRVVVQGRLKQRSYEDREGVKRTVYELDVEEVGP-SLKNA 113
>gi|90020643|ref|YP_526470.1| single-stranded DNA-binding protein [Saccharophagus degradans 2-40] >gi|89950243|gb|ABD80258.1| single-strand binding protein [Saccharophagus degradans 2-40] (175 aa)
Score = 130, Expect = 3.1e-06, Identities = 36/101 (35%), Positives = 53/101 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE-------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           +NKV IVG L QDP+   T +G   + +SIA+S+ W   +       T +   V +   A     YL KG  V I+G L  R +  + G+  Y  EIV   ++ L S+
  S:     6 VNKVIIVGNLGQDPETKYTASGAAITNVSIATSETWKDKQTGQAQERTEWHRVVFFNRLAEIAGEYLRKGSKVYIEGALRTRKWQDQGGQDRYTTEIVANEMQMLDSR 113
>gi|58039355|ref|YP_191319.1| single-strand DNA binding protein [Gluconobacter oxydans 621H] >gi|58001769|gb|AAW60663.1| Single-strand DNA binding protein [Gluconobacter oxydans 621H] (188 aa)
Score = 130, Expect = 3.1e-06, Identities = 35/96 (36%), Positives = 56/96 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAW-QSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIK 96
           +NKV +VG L +DP+   TQ+G     +++A+SD WN       K  T +   V + + TA+    YL KG  V I+G+L  R +  + G+  Y  E+VI+  +
  S:     5 VNKVILVGNLGKDPEVRNTQSGAKIVNLTVATSDTWNDKQSGERKERTEWHRVVIFNERTADVAERYLRKGRKVYIEGELRTRKWTDQSGQEKYTTEVVIDRFR 108
>gi|10956771|ref|NP_061716.1| single-strand binding protein [Xylella fastidiosa 9a5c] >gi|37999802|sp|Q9PHE7|SSB1_XYLFA Single-stranded DNA-binding protein 1 (SSB 1) (Helix-destabilizing protein 1) >gi|9112298|gb|AAF85629.1|AE003851_60 single-strand binding protein [Xylella fastidiosa 9a5c] (136 aa)
Score = 130, Expect = 3.1e-06, Identities = 34/105 (32%), Positives = 56/105 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW------NKNE-TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNN 105
           +NK+ ++G L  DP     Q+G     +S+A++D W      NK E T +   V +   A  +  +L KG  + ++G L  R++  KEG   Y  EI+ + ++ L  K  NN
  S:     4 LNKMQLIGNLGADPDIRYMQDGTPTVTVSVATTDTWKDKDTGNKEEKTEWHRVVFFGGLAEIVGEFLKKGSQIYVEGALRSRNWTDKEGNKRYTTEIMAKEMQMLGKKQDNN 115
>gi|95928586|ref|ZP_01311333.1| single-strand binding protein [Desulfuromonas acetoxidans DSM 684] >gi|95135376|gb|EAT17028.1| single-strand binding protein [Desulfuromonas acetoxidans DSM 684] (181 aa)
Score = 130, Expect = 3.1e-06, Identities = 34/104 (32%), Positives = 55/104 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSN 104
           +NKV +VG L +DP+   T +G      S+A+S+ +       + +T +   VAW+  A     YLHKG  + I+G L  R +  ++G   Y  EIV   ++ L   + N
  S:     3 VNKVILVGNLGKDPELRYTPSGAAVVNFSLATSETYKDRDGNRQTKTEWHNIVAWRQLAEICGKYLHKGKQIYIEGALQTRKWQDRDGNDRYTTEIVANQMQMLGRADEN 112
>gi|58000347|ref|YP_190159.1| single-stranded DNA-binding protein [Escherichia coli] >gi|169546540|ref|YP_001711979.1| hypothetical protein pVM01_p130 [Escherichia coli] >gi|57903247|gb|AAW58877.1| single-stranded DNA binding protein [Escherichia coli] >gi|168831092|gb|ACA34873.1| Ssb [Escherichia coli] (179 aa)
Score = 130, Expect = 3.1e-06, Identities = 33/94 (35%), Positives = 54/94 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIES 94
           +NKV +VGRL +DP+     NG   + + +A+S++W        + +T +   V +   A     YL KG  V I+G+L  RS+    G T YV EI++++
  S:     6 INKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDKQTGEMREQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSW-EDNGITRYVTEILVKT 105
>gi|53712848|ref|YP_098840.1| single-strand binding protein [Bacteroides fragilis YCH46] >gi|60681072|ref|YP_211216.1| putative single-strand binding protein [Bacteroides fragilis NCTC 9343] >gi|52215713|dbj|BAD48306.1| single-strand binding protein [Bacteroides fragilis YCH46] >gi|60492506|emb|CAH07276.1| putative single-strand binding protein [Bacteroides fragilis NCTC 9343] (152 aa)
Score = 130, Expect = 3.1e-06, Identities = 31/107 (28%), Positives = 58/107 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNK--------NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAA 107
           +NKV ++G + +DP+      GI  +   +A++D              T +   V W+  A     Y+HKGD + ++GK+  RSY  + G   YV EI +++++ L+ K + + +
  S:     3 VNKVILIGNVGKDPEVRYLDTGIAVASFPLATTDRAYTLSNGTQVPERTEWHNLVLWRGLAETAEKYVHKGDKLYVEGKIRTRSYDDQNGAKRYVTEIFVDNMEMLTPKGTGSGS 117
>gi|15603815|ref|NP_246889.1| single-strand DNA-binding protein [Pasteurella multocida subsp. multocida str. Pm70] >gi|37999461|sp|Q9CJP4|SSB_PASMU Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|12722386|gb|AAK04034.1| Ssb [Pasteurella multocida subsp. multocida str. Pm70] (166 aa)
Score = 130, Expect = 3.1e-06, Identities = 37/102 (36%), Positives = 57/102 (55%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW---NKNE----TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKN 102
           +NKV IVG L  DP+     NG   + IS+A+S++W   N NE    T +   V ++  A     YL KG  V ++G+L  R +  + G+  Y  EI  + ++ L S+N
  S:     4 VNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEGRLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRN 112
>gi|87160183|ref|YP_494698.1| single-stranded DNA- binding protein family [Staphylococcus aureus subsp. aureus USA300] >gi|168727143|ref|ZP_02759420.1| hypothetical protein Sauraur_01948 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|87126157|gb|ABD20671.1| single-stranded DNA- binding protein family [Staphylococcus aureus subsp. aureus USA300_FPR3757] (115 aa)
Score = 130, Expect = 3.3e-06, Identities = 40/105 (38%), Positives = 64/105 (60%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNET------YFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNN 105
           +NK+ IVGRL +D Q F  ++    +   +A+  N+ K+E       Y F C A+   A+ I  Y ++G LV I G++  R Y  K+G+T +V E+ +E+IK +S K+ NN
  S:     2 LNKIVIVGRLTKDAQIFEKEDRKIAT-FCVATHRNY-KDENGEIVCDYLF-CKAFGKLASNIEKYTNQGTLVGITGQMRSRKY-DKDGQTHFVTELYVETIKFMSPKSQNN 108
>gi|160940068|ref|ZP_02087413.1| hypothetical protein CLOBOL_04957 [Clostridium bolteae ATCC BAA-613] >gi|158436648|gb|EDP14415.1| hypothetical protein CLOBOL_04957 [Clostridium bolteae ATCC BAA-613] (154 aa)
Score = 130, Expect = 3.4e-06, Identities = 34/103 (33%), Positives = 60/103 (58%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQN--GITQSRISIA-------SSDNWNKNETY-FFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           MN+V ++GRL +DP+   +Q    +  +R ++A         D+  + +T  F  CVA+   A F   Y  +G  V + G++   SYV+KEG+ VY  E++++  +   SK +
  S:     1 MNRVILMGRLTRDPEVRYSQGERSMAIARYTLAVDRRGRRGQDSSAEQQTADFINCVAFDRAAEFAEKYFRQGMRVLVSGRIQTGSYVNKEGQKVYTTEVILDDQEFADSKGA 113
>gi|21909629|ref|NP_663897.1| single-strand DNA-binding protein [Streptococcus pyogenes MGAS315] >gi|28895007|ref|NP_801357.1| single-strand DNA-binding protein [Streptococcus pyogenes SSI-1] >gi|50913497|ref|YP_059469.1| single-strand DNA-binding protein [Streptococcus pyogenes MGAS10394] >gi|71909916|ref|YP_281466.1| single-strand DNA-binding protein [Streptococcus pyogenes MGAS5005] >gi|94989613|ref|YP_597713.1| single-strand DNA-binding protein [Streptococcus pyogenes MGAS10270] >gi|94993505|ref|YP_601603.1| single-strand DNA-binding protein [Streptococcus pyogenes MGAS10750] >gi|139472980|ref|YP_001127695.1| single-strand DNA-binding protein [Streptococcus pyogenes str. Manfredo] >gi|73919453|sp|Q5XE77|SSB1_STRP6 Single-stranded DNA-binding protein 1 (SSB 1) (Helix-destabilizing protein 1) >gi|21903811|gb|AAM78700.1| single-stranded DNA-binding protein, phage-associated? [Streptococcus pyogenes MGAS315] >gi|28810252|dbj|BAC63190.1| putative single stranded DNA-binding protein [Streptococcus pyogenes SSI-1] >gi|50902571|gb|AAT86286.1| Single-strand DNA binding protein [Streptococcus pyogenes MGAS10394] >gi|71852698|gb|AAZ50721.1| single-strand DNA binding protein [Streptococcus pyogenes MGAS5005] >gi|94543121|gb|ABF33169.1| Single-strand DNA binding protein [Streptococcus pyogenes MGAS10270] >gi|94547013|gb|ABF37059.1| Single-strand DNA binding protein [Streptococcus pyogenes MGAS10750] >gi|134271226|emb|CAM29442.1| putative single stranded DNA-binding protein [Streptococcus pyogenes str. Manfredo] (131 aa)
Score = 130, Expect = 3.4e-06, Identities = 35/100 (35%), Positives = 54/100 (54%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           NKV  +GRL   P+   T      +R+S+A +  +     + E  F   V W   A  + SY  KG L++IDG+L  R Y  K+G+  YV E++ +S + L S+
  S:     3 NKVIAIGRLVAKPELVKTATDKHVARLSLAVNRRFKNASGEREADFISVVVWGKLAETLVSYASKGSLMSIDGELRTRKY-DKDGQVHYVTEVLCQSFQLLESR 105
>gi|71902766|ref|YP_279569.1| single-strand DNA-binding protein [Streptococcus pyogenes MGAS6180] >gi|71801861|gb|AAX71214.1| single-strand DNA binding protein [Streptococcus pyogenes MGAS6180] (131 aa)
Score = 130, Expect = 3.5e-06, Identities = 35/100 (35%), Positives = 54/100 (54%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           NKV  +GRL   P+   T      +R+S+A +  +     + E  F   V W   A  + SY  KG L++IDG+L  R Y  K+G+  YV E++ +S + L S+
  S:     3 NKVIAIGRLVAKPELVKTATDKHVARLSLAVNRRFKNASGEREADFISIVVWGKLAETLVSYASKGSLMSIDGELRTRKY-DKDGQVHYVTEVLCQSFQLLESR 105
>gi|13786543|ref|NP_112675.1| SSB [Lactococcus phage TP901-1] >gi|13661686|gb|AAK38029.1|AF304433_12 SSB [Lactococcus lactis bacteriophage TP901-1] >gi|12829834|gb|AAG15561.1| putative single stranded binding protein [Lactococcus phage TP901-1] (150 aa)
Score = 130, Expect = 3.6e-06, Identities = 32/109 (29%), Positives = 57/109 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           +N V +VGRL +DP+   T          +A +  +     + E  F  CV W+  A  +  +  KG L+ I G++  R+Y +++G+ VYV E+V ++ + L S  +    +S
  S:     2 INNVVLVGRLTRDPELRYTPQNQAVGTFGLAVNRQFKNANGEREADFINCVIWRQQAENLAKFAKKGALIGITGRIQTRNYENQQGQKVYVTEVVADTFQMLESNKTQGQQAS 114
>gi|120435704|ref|YP_861390.1| single-stranded DNA-binding protein [Gramella forsetii KT0803] >gi|117577854|emb|CAL66323.1| single-stranded DNA-binding protein [Gramella forsetii KT0803] (119 aa)
Score = 130, Expect = 3.7e-06, Identities = 34/94 (36%), Positives = 55/94 (58%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN------ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESI 95
           NKV ++G + Q P+    + G   +  SIA+++ +  +      +T +   VAW  TA  + +Y+  G  +AI+GKL  RSY SKEG+  YV E++   I
  S:     6 NKVQLIGNVGQTPEIKNLERGKKVASFSIATNEFYKNSKGEKVQDTQWHNVVAWGKTAEIVENYVGTGKEIAIEGKLTNRSYESKEGEKRYVTEVIASEI 105
>gi|160940798|ref|ZP_02088140.1| hypothetical protein CLOBOL_05692 [Clostridium bolteae ATCC BAA-613] >gi|158436318|gb|EDP14085.1| hypothetical protein CLOBOL_05692 [Clostridium bolteae ATCC BAA-613] (147 aa)
Score = 130, Expect = 3.7e-06, Identities = 35/104 (33%), Positives = 60/104 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQN--GITQSRISIA-------SSDNWNKNETY-FFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSN 104
           MN+V ++GRL +DP    TQ    +  +R ++A         D+  + +T  F  CVA+   A F   Y  +G  V + G++   SYV++EG+ VY  +IV++  +   SK ++
  S:     1 MNRVILMGRLTKDPDIRYTQGERSMAIARYTLAVDRRGRRGQDSSAEQQTADFINCVAFDRAAEFAEKYFRQGMRVLVSGRIQTGSYVNQEGRKVYTTDIVLDDQEFADSKGAS 114
>gi|75994530|ref|YP_325644.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 EDL933] >gi|149930831|ref|YP_001294727.1| single-stranded DNA-binding protein [Escherichia coli] >gi|37695819|gb|AAR00481.1|AF401292_84 w0063 [Escherichia coli] >gi|3822198|gb|AAC70152.1| single strand binding protein [Escherichia coli O157:H7] (163 aa)
Score = 129, Expect = 3.7e-06, Identities = 33/94 (35%), Positives = 54/94 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIES 94
           +NKV +VGRL +DP+     NG   + + +A+S++W        + +T +   V +   A     YL KG  V I+G+L  RS+    G T YV EI++++
  S:    19 INKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDKQTGEMREQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSW-EDNGITRYVTEILVKT 118
>gi|46401640|ref|YP_006485.1| Ssb [Enterobacteria phage P1] >gi|60415932|sp|Q9XJG4|SSB_BPP1 Single-stranded DNA-binding protein (SSB-P1) >gi|4426959|gb|AAD20631.1| single-stranded DNA-binding protein SSB-P1 [enterobacteria phage P1] >gi|33338667|gb|AAQ13990.1| Ssb [Enterobacteria phage P1] >gi|33338776|gb|AAQ14098.1| Ssb [Enterobacteria phage P1] (162 aa)
Score = 129, Expect = 3.7e-06, Identities = 43/137 (31%), Positives = 66/137 (48%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNN--YS----QQSNMSVSEAMD 137
           +NKV ++G L QDP+     NG    R+SIA++++W        K +T +   V +   A   + YL KG  V I+GKL  R +    G   Y  EI++     +    +    S     +  +N   N+  YS     QSN +    MD
  S:     6 VNKVILIGTLGQDPEIRYIPNGGAVGRLSIATNESWRDKQTGQQKEQTEWHKVVLFGKLAEIASEYLRKGSQVYIEGKLKTRKWTDDAGVERYTTEIIVSQGGTMQMIGARRDDSQSSNGWGQSNQPQNHQQYSGGGKPQSNANNEPPMD 155
>gi|126662867|ref|ZP_01733866.1| single-stranded DNA binding protein [Flavobacteria bacterium BAL38] >gi|126626246|gb|EAZ96935.1| single-stranded DNA binding protein [Flavobacteria bacterium BAL38] (107 aa)
Score = 129, Expect = 3.8e-06, Identities = 33/94 (35%), Positives = 54/94 (57%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKN------ETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESI 95
           N V ++G + Q+P+    + G   + ISIA+++ + K       +T +    AW  TA+ I  ++ KG  +AI+GKL  RSY  K+G   YV E+V   +
  S:     3 NSVQLIGHVGQEPEIKNLEGGKKLANISIATNEVYYKENGDKVEQTQWHRVSAWGKTADIIERFVTKGKEIAIEGKLTHRSYDDKDGNKRYVTEVVANEV 102
>gi|73853254|ref|YP_308750.1| single-stranded DNA-binding protein [Escherichia coli] >gi|73476838|gb|AAZ76453.1| Single-stranded DNA binding protein [Escherichia coli] (177 aa)
Score = 129, Expect = 3.8e-06, Identities = 33/94 (35%), Positives = 53/94 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIES 94
           +NKV +VGRL +DP+     NG   + + +A+S+ W        + +T +   V +   A     YL KG  V I+G+L  RS+    G T YV EI++++
  S:     6 INKVIVVGRLGKDPEVRYIPNGGAVANLQVATSETWRDKQTGEMREQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSW-EDNGITRYVTEILVKT 105
>gi|15828449|ref|NP_302712.1| single-strand DNA-binding protein [Mycobacterium leprae TN] >gi|13432209|sp|P46390|SSB_MYCLE Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|2959411|emb|CAA17953.1| single-stranded binding protein [Mycobacterium leprae] >gi|13093879|emb|CAC32216.1| single strand binding protein [Mycobacterium leprae] (168 aa)
Score = 129, Expect = 3.8e-06, Identities = 30/94 (31%), Positives = 49/94 (52%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIAS--------SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + IVG L  DP+   T +G      ++AS        S  W   E  F  C  W+  A  +   L +G  V + G+L +RS+ ++EG+   V+E+ ++ I P
  S:     7 ITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDGEALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVEVEVDEIGP 108
>gi|189218766|ref|YP_001939407.1| Single-stranded DNA-binding protein [Methylokorus infernorum V4] >gi|189185624|gb|ACD82809.1| Single-stranded DNA-binding protein [Methylacidiphilum infernorum V4] (145 aa)
Score = 129, Expect = 3.9e-06, Identities = 37/118 (31%), Positives = 63/118 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIA------SSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPL--SSKNSNNAASSIDKNYNPTN 118
           +NKVF++G L +DP+   T  G     IS+A      S D   K+E  F   V W   A     YL KG L+ ++G+L    + +KEG+    +++  + I+ L  +  ++ +AA     + +PT+
  S:     4 LNKVFLIGNLTRDPECRYTPKGTPVGDISLAINSSFRSQDGQIKDEVCFVDVVIWGRQAETCKEYLQKGSLIFVEGRLQMEQWETKEGEKRTRMKVRADRIQFLGKAKGSAPSAAMETQPSKSPTS 129
>gi|110798693|ref|YP_696038.1| single-strand DNA-binding protein [Clostridium perfringens ATCC 13124] >gi|110673340|gb|ABG82327.1| single-strand DNA-binding protein [Clostridium perfringens ATCC 13124] (129 aa)
Score = 129, Expect = 3.9e-06, Identities = 34/103 (33%), Positives = 57/103 (55%)
  Q:     1 MNKVFIVGRLAQDPQ-QFVTQNGITQSRISIASSDNWNK----NETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNS 103
           MNKV +VGRL++DP+ +F    G   +R ++A + ++ K     E  F  C+A+   A  I  YL KG   +I G +   SY +++G   Y+  I ++    + S +S
  S:     1 MNKVVLVGRLSKDPELRFTANKGTAVTRFTLAVNRDFKKEDGTQEADFINCIAYSKRAEVIAKYLTKGKRFSISGSIRTGSYDAQDGTRRYITYIAVDGFDFIDSSDS 108
>gi|116672661|ref|YP_833594.1| single-strand binding protein [Arthrobacter sp. FB24] >gi|116612770|gb|ABK05494.1| single-strand binding protein [Arthrobacter sp. FB24] (192 aa)
Score = 129, Expect = 3.9e-06, Identities = 33/94 (35%), Positives = 50/94 (53%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIAS--------SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + ++G L  DP+   T +G   +  +IAS        S+ W   ET F     W+  A  +   L KG  V + G+L  RSY +KEG+   VIE+ ++ I P
  S:     7 ITVIGNLTNDPELRFTPSGSAVANFTIASTPRTFDRQSNEWKDGETLFLRASVWREAAENVAESLTKGMRVIVSGRLKSRSYETKEGEKRTVIELEVDEIGP 108
>gi|56807745|ref|ZP_00365608.1| COG0629: Single-stranded DNA-binding protein [Streptococcus pyogenes M49 591] (131 aa)
Score = 129, Expect = 3.9e-06, Identities = 35/100 (35%), Positives = 54/100 (54%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           NKV  +GRL   P+   T      +R+S+A +  +     + E  F   V W   A  + SY  KG L++IDG+L  R Y  K+G+  YV E++ +S + L S+
  S:     3 NKVTAIGRLVAKPELVKTATDKHVARLSLAVNRRFKNASGEREADFISVVVWGKLAETLVSYASKGSLISIDGELRTRKY-DKDGQVHYVTEVLCQSFQLLESR 105
>gi|85060106|ref|YP_455808.1| single-strand DNA-binding protein [Sodalis glossinidius str. 'morsitans'] >gi|84780626|dbj|BAE75403.1| single-strand binding protein [Sodalis glossinidius str. 'morsitans'] (175 aa)
Score = 129, Expect = 4.0e-06, Identities = 44/172 (25%), Positives = 76/172 (44%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE---SIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFALNDD 172
           +NKV +VG L QDP+     NG   + I++A+S++W        K +T +   V +   A     YL KG  V I+G L  R +  + G+  Y  E+V+    +++ L  +    AAS                 QQS   + +      + F+   +  +  ++N       + P   +DD
  S:     6 VNKVILVGNLGQDPEVRHMPNGGAVANITLATSESWRDKQTGETKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGSLQTRKWQDQSGQDRYTTEVVVNVGGTMQMLGGRQGGAAASG---------------GQQSGWGLPQQPQGNNAQFSGGNAPASRRAQNSAPAPSNEPPMDFDDD 172
>gi|27904962|ref|NP_778088.1| single-strand binding protein [Buchnera aphidicola str. Bp (Baizongia pistaciae)] >gi|32699636|sp|Q89A53|SSB_BUCBP Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|27904360|gb|AAO27193.1| single-strand binding protein [Buchnera aphidicola str. Bp (Baizongia pistaciae)] (166 aa)
Score = 129, Expect = 4.0e-06, Identities = 41/135 (30%), Positives = 71/135 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE---SIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNMSVSEA 135
           +NKV ++G L QDP     QNG   + I++A+S+ W        K +T +   V +   A     YL KG  V I+G L  R +  + G   Y+ EI++    +++ L S+NS++  +S   + N  N      S++   S +++
  S:     6 INKVILIGYLGQDPDVRYMQNGSAVTNITLATSETWKDKNNGEIKEKTEWHRIVFFNKLAEIAGEYLKKGSQVYIEGSLQTRKWKDQNGIERYITEIIVSVGGTMQMLGSRNSSSLTASSGLSKNNDNLSKQLLSEKKQESFNDS 150
>gi|191636834|ref|YP_001986000.1| Single-stranded DNA-binding protein [Lactobacillus casei] >gi|190711136|emb|CAQ65142.1| Single-stranded DNA-binding protein [Lactobacillus casei BL23] (198 aa)
Score = 129, Expect = 4.0e-06, Identities = 50/170 (29%), Positives = 81/170 (47%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSN--------NAASSIDKNYNPTNTKNNNYSQQ--SNMSVSEAMDDFESNFAQKTSSTNITSKNEEKETFKDDPFALN 170
           +N V + GRL +D     TQ+G      ++A    +     + ET F  CV W+ +A    ++  KG +V ++G +  R+Y + +G+ VYV E+V+E+   L S+ +         N A   ++NY       NN  Q   S  S     +   SN  Q  +++     N        DPFA N
  S:     2 LNSVALTGRLTRDVDLRYTQSGTAVGSFTLAVDRQFRSANGERETDFINCVIWRKSAENFANFTKKGSMVGVEGHIQTRTYDNAQGQKVYVTEVVVENFALLESRATTQQRPSEAANPAGQGNQNYGGGQQFGNNQPQNPPSFGSQGAPNNASSSNPGQNPAASQNQGGNSAANPANPDPFANN 185
>gi|886304|gb|AAB53120.1| putative (140 aa)
Score = 129, Expect = 4.0e-06, Identities = 30/94 (31%), Positives = 49/94 (52%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIAS--------SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + IVG L  DP+   T +G      ++AS        S  W   E  F  C  W+  A  +   L +G  V + G+L +RS+ ++EG+   V+E+ ++ I P
  S:     7 ITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEWKDGEALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVEVEVDEIGP 108
>gi|15607196|ref|NP_214568.1| single-strand DNA-binding protein [Mycobacterium tuberculosis H37Rv] >gi|15839431|ref|NP_334468.1| single-strand DNA-binding protein [Mycobacterium tuberculosis CDC1551] >gi|31791231|ref|NP_853724.1| single-strand DNA-binding protein [Mycobacterium bovis AF2122/97] >gi|121635964|ref|YP_976187.1| single-strand DNA-binding protein [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148659814|ref|YP_001281337.1| single-strand DNA-binding protein [Mycobacterium tuberculosis H37Ra] >gi|148821244|ref|YP_001285998.1| single-strand DNA-binding protein [Mycobacterium tuberculosis F11] >gi|167970580|ref|ZP_02552857.1| single-strand DNA-binding protein [Mycobacterium tuberculosis H37Ra] >gi|194542504|ref|YP_002077534.1| single-strand binding protein ssb (helix-destabilizing protein) [Mycobacterium tuberculosis C] >gi|61247663|sp|P0A610|SSB_MYCTU Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|61247664|sp|P0A611|SSB_MYCBO Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|46015798|pdb|1UE1|A Chain A, Crystal Structure Of The Single-Stranded Dna-Binding Protein From Mycobacterium Tuberculosis >gi|46015799|pdb|1UE1|B Chain B, Crystal Structure Of The Single-Stranded Dna-Binding Protein From Mycobacterium Tuberculosis >gi|46015800|pdb|1UE5|A Chain A, Crystal Structure Of The Single-Stranded Dna-Binding Protein From Mycobacterium Tuberculosis >gi|46015801|pdb|1UE5|B Chain B, Crystal Structure Of The Single-Stranded Dna-Binding Protein From Mycobacterium Tuberculosis >gi|46015802|pdb|1UE6|A Chain A, Crystal Structure Of The Single-Stranded Dna-Binding Protein From Mycobacterium Tuberculosis >gi|46015803|pdb|1UE6|B Chain B, Crystal Structure Of The Single-Stranded Dna-Binding Protein From Mycobacterium Tuberculosis >gi|46015804|pdb|1UE6|C Chain C, Crystal Structure Of The Single-Stranded Dna-Binding Protein From Mycobacterium Tuberculosis >gi|46015805|pdb|1UE6|D Chain D, Crystal Structure Of The Single-Stranded Dna-Binding Protein From Mycobacterium Tuberculosis >gi|46015806|pdb|1UE7|A Chain A, Crystal Structure Of The Single-Stranded Dna-Binding Protein From Mycobacterium Tuberculosis >gi|46015807|pdb|1UE7|B Chain B, Crystal Structure Of The Single-Stranded Dna-Binding Protein From Mycobacterium Tuberculosis >gi|46015808|pdb|1UE7|C Chain C, Crystal Structure Of The Single-Stranded Dna-Binding Protein From Mycobacterium Tuberculosis >gi|46015809|pdb|1UE7|D Chain D, Crystal Structure Of The Single-Stranded Dna-Binding Protein From Mycobacterium Tuberculosis >gi|1568593|emb|CAB02532.1| PROBABLE SINGLE-STRAND BINDING PROTEIN SSB (HELIX-DESTABILIZING PROTEIN) [Mycobacterium tuberculosis H37Rv] >gi|13879103|gb|AAK44282.1| single-strand binding protein [Mycobacterium tuberculosis CDC1551] >gi|31616816|emb|CAD92917.1| PROBABLE SINGLE-STRAND BINDING PROTEIN SSB (HELIX-DESTABILIZING PROTEIN) [Mycobacterium bovis AF2122/97] >gi|121491611|emb|CAL70069.1| Probable single-strand binding protein ssb [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124603246|gb|EAY61521.1| single-strand binding protein ssb (helix-destabilizing protein) [Mycobacterium tuberculosis C] >gi|134152024|gb|EBA44069.1| single-strand binding protein ssb (helix-destabilizing protein) [Mycobacterium tuberculosis str. Haarlem] >gi|148503966|gb|ABQ71775.1| single-strand DNA-binding protein [Mycobacterium tuberculosis H37Ra] >gi|148719771|gb|ABR04396.1| single-strand binding protein ssb (helix-destabilizing protein) [Mycobacterium tuberculosis F11] (164 aa)
Score = 129, Expect = 4.1e-06, Identities = 30/94 (31%), Positives = 50/94 (53%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIASS--------DNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + IVG L  DP+   T +G   +  ++AS+          W   E  F  C  W+  A  +   L +G  V + G+L +RS+ ++EG+   VIE+ ++ I P
  S:     7 ITIVGNLTADPELRFTPSGAAVANFTVASTPRIYDRQTGEWKDGEALFLRCNIWREAAENVAESLTRGARVIVSGRLKQRSFETREGEKRTVIEVEVDEIGP 108
>gi|134903|sp|P28043|SSB2_ECOLI Plasmid-derived single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) (179 aa)
Score = 129, Expect = 4.1e-06, Identities = 33/94 (35%), Positives = 53/94 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIES 94
           +NKV +VGRL +DP+     NG   + + +A+S+ W        + +T +   V +   A     YL KG  V I+G+L  RS+    G T YV EI++++
  S:     6 INKVILVGRLGKDPEVRYIPNGGAVANLQVATSETWRDKQTGKMREQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSW-EDNGITRYVTEILVKT 105
>gi|10955315|ref|NP_052656.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. Sakai] >gi|168712007|ref|ZP_02744284.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC4045] >gi|168721246|ref|ZP_02753523.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC4206] >gi|168738936|ref|ZP_02771213.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC4115] >gi|168752311|ref|ZP_02777333.1| single-strand binding protein family [Escherichia coli O157:H7 str. EC4113] >gi|168758957|ref|ZP_02783964.1| single-strand binding protein family [Escherichia coli O157:H7 str. EC4401] >gi|168763064|ref|ZP_02788071.1| single-strand binding protein family [Escherichia coli O157:H7 str. EC4501] >gi|168769264|ref|ZP_02794271.1| single-strand binding protein family [Escherichia coli O157:H7 str. EC4486] >gi|168777513|ref|ZP_02802520.1| single-strand binding protein family [Escherichia coli O157:H7 str. EC4196] >gi|168784340|ref|ZP_02809347.1| single-strand binding protein family [Escherichia coli O157:H7 str. EC4076] >gi|168790146|ref|ZP_02815153.1| single-strand binding protein family [Escherichia coli O157:H7 str. EC869] >gi|168801260|ref|ZP_02826267.1| single-strand binding protein family [Escherichia coli O157:H7 str. EC508] >gi|195939991|ref|ZP_03085373.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC4024] >gi|3337047|dbj|BAA31806.1| single-strand binding protein [Escherichia coli O157:H7 str. Sakai] >gi|187767263|gb|EDU31107.1| single-strand binding protein family [Escherichia coli O157:H7 str. EC4196] >gi|188013818|gb|EDU51940.1| single-strand binding protein family [Escherichia coli O157:H7 str. EC4113] >gi|188998480|gb|EDU67476.1| single-strand binding protein family [Escherichia coli O157:H7 str. EC4076] >gi|189354334|gb|EDU72753.1| single-strand binding protein family [Escherichia coli O157:H7 str. EC4401] >gi|189361618|gb|EDU80037.1| single-strand binding protein family [Escherichia coli O157:H7 str. EC4486] >gi|189366719|gb|EDU85135.1| single-strand binding protein family [Escherichia coli O157:H7 str. EC4501] >gi|189370343|gb|EDU88759.1| single-strand binding protein family [Escherichia coli O157:H7 str. EC869] >gi|189376575|gb|EDU94991.1| single-strand binding protein family [Escherichia coli O157:H7 str. EC508] (150 aa)
Score = 129, Expect = 4.2e-06, Identities = 33/94 (35%), Positives = 54/94 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIES 94
           +NKV +VGRL +DP+     NG   + + +A+S++W        + +T +   V +   A     YL KG  V I+G+L  RS+    G T YV EI++++
  S:     6 INKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDKQTGEMREQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSW-EDNGITRYVTEILVKT 105
>gi|167038653|ref|YP_001666231.1| single-strand binding protein [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167041003|ref|YP_001663988.1| single-strand binding protein [Thermoanaerobacter sp. X514] >gi|166855243|gb|ABY93652.1| single-strand binding protein [Thermoanaerobacter sp. X514] >gi|166857487|gb|ABY95895.1| single-strand binding protein [Thermoanaerobacter pseudethanolicus ATCC 33223] (150 aa)
Score = 129, Expect = 4.2e-06, Identities = 31/113 (27%), Positives = 61/113 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW----NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKN 113
           +NKV ++GRL +DP    + N +  +  ++A + N+     +  T F P V W+  A    + L KG L+A+ G +  R++    G   +V E+V + ++ L  K+   ++ + ++N
  S:     2 LNKVILIGRLTKDPVMRYSANMVPVTTFTLAVNRNYVTQSGERPTDFIPIVTWRKLAEICANNLKKGRLIAVTGSIQTRTWDDNSGNRHWVTEVVADDVRFLEPKSGFGSSGNAEEN 118
>gi|33337378|gb|AAQ13360.1|U66100_2 ssb homolog [Streptococcus pyogenes] (119 aa)
Score = 129, Expect = 4.2e-06, Identities = 35/100 (35%), Positives = 53/100 (53%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSK 101
           NKV  +GRL   P+   T      +R+S+A +  +     + E  F   V W   A  + SY  KG L+ IDG+L  R Y  K+G+  YV E++ +S + L S+
  S:     3 NKVIAIGRLVAKPELVKTATDKHVARLSLAVNRRFKNASGEREADFISVVVWGKLAETLVSYASKGSLIFIDGELRTRKY-DKDGQVHYVTEVLCQSFQLLESR 105
>gi|20809109|ref|NP_624280.1| single-stranded DNA-binding protein [Thermoanaerobacter tengcongensis MB4] >gi|37999446|sp|Q8R6M2|SSB_THETN Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|20517787|gb|AAM25884.1| Single-stranded DNA-binding protein [Thermoanaerobacter tengcongensis MB4] (150 aa)
Score = 129, Expect = 4.3e-06, Identities = 32/109 (29%), Positives = 58/109 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW----NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           +NKV ++GRL +DP    T + +  +  ++A + N+     +  T F P V W+  A    + L KG LVA+ G +  R++    G   +V E+V + ++ L  K+   + S+
  S:     2 LNKVILIGRLTKDPVMRYTSDMVPVTTFTLAVNRNYVSQSGERPTDFIPIVTWRKLAEICANNLKKGRLVAVTGSIQTRTWDDSSGNRHWVTEVVADDVRFLEPKSGFGSGSA 114
>gi|193070216|ref|ZP_03051161.1| plasmid-derived single-stranded DNA-binding protein [Escherichia coli E110019] >gi|192956535|gb|EDV86993.1| plasmid-derived single-stranded DNA-binding protein [Escherichia coli E110019] (179 aa)
Score = 129, Expect = 4.3e-06, Identities = 33/94 (35%), Positives = 54/94 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIES 94
           +NKV +VGRL +DP+     NG   + + +A+S++W        + +T +   V +   A     YL KG  V I+G+L  RS+    G T YV EI++++
  S:     6 INKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDKQTGEIREQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSW-EDNGITRYVTEILVKT 105
>gi|193070408|ref|ZP_03051349.1| plasmid-derived single-stranded DNA-binding protein [Escherichia coli E110019] >gi|192956227|gb|EDV86689.1| plasmid-derived single-stranded DNA-binding protein [Escherichia coli E110019] (175 aa)
Score = 129, Expect = 4.3e-06, Identities = 33/94 (35%), Positives = 54/94 (57%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIES 94
           +NKV +VGRL +DP+     NG   + + +A+S++W        + +T +   V +   A     YL KG  V I+G+L  RS+    G T YV EI++++
  S:     6 INKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDKQTGEMREQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSW-EDNGITRYVTEILVKT 105
>gi|134916|sp|P25762|SSB_SERMA Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|47270|emb|CAA46208.1| single-stranded DNA-binding protein [Serratia marcescens] (176 aa)
Score = 129, Expect = 4.3e-06, Identities = 33/92 (35%), Positives = 50/92 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV +VG L QDP+     NG   + I++A+S++W        K +T +   V +   A     YL KG  V I+G L  R +  + G+  Y  EIV+
  S:     6 VNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEQKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGSLQTRKWQDQSGQDRYTTEIVV 104
>gi|114321893|ref|YP_743576.1| single-strand binding protein [Alkalilimnicola ehrlichei MLHE-1] >gi|114228287|gb|ABI58086.1| single-strand binding protein [Alkalilimnicola ehrlichei MLHE-1] (154 aa)
Score = 129, Expect = 4.5e-06, Identities = 35/130 (26%), Positives = 60/130 (46%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQSNM 130
           +NKV ++G L  DP+   T NG   + + +A++D W        +  T +   V +   A     YL KG  V I+G+L  R +  ++G+  Y  EIV   ++ L S+             +     ++   +Q NM
  S:     5 VNKVILIGNLGVDPEVRYTANGSAVTNVRLATTDTWRDKQSGEQQERTEWHRIVFFGKLAEIAGEYLRKGSKVYIEGRLQTRKWQGQDGQDRYTTEIVANDMQMLDSRGGAGDMGGSGGGQSRGRPADDRGGRQDNM 141
>gi|195940138|ref|ZP_03085520.1| single-stranded DNA-binding protein [Escherichia coli O157:H7 str. EC4024] (109 aa)
Score = 129, Expect = 4.6e-06, Identities = 33/94 (35%), Positives = 53/94 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIES 94
           +NKV +VGRL  DP+     NG   + + +A+S++W        + +T +   V +   A     YL KG  V I+G+L  RS+    G T YV EI++++
  S:     6 INKVILVGRLGNDPEVRYIPNGGAVANLQVATSESWRDKQTGEMREQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSW-EDNGITRYVTEILVKT 105
>gi|21674759|ref|NP_662824.1| single-strand binding protein [Chlorobium tepidum TLS] >gi|37999707|sp|Q8KB47|SSB1_CHLTE Single-stranded DNA-binding protein 1 (SSB 1) (Helix-destabilizing protein 1) >gi|21647972|gb|AAM73166.1| single-strand binding protein [Chlorobium tepidum TLS] (162 aa)
Score = 129, Expect = 4.7e-06, Identities = 37/115 (32%), Positives = 62/115 (53%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSY-VSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYN 115
           +NKV ++G L  DP++  T +G +    ++A+S+ +       +  T +   VAW   A+  + YL KG  V I+G+L  RS+  +K G   Y  EIV   ++ L +K+S    S    + N
  S:     5 LNKVMLIGHLGNDPERRETASGQSVVNFTLATSEGFKDSSGNLQERTEWHRIVAWGKLADICSQYLKKGRQVYIEGRLQTRSWDDNKTGDKKYATEIVCTDMQMLGAKDSGGGTSDASYSQN 126
>gi|37999440|sp|Q8KSB6|SSB_ARTAU Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|21686516|gb|AAM74937.1|AF517942_1 single-stranded DNA-binding protein [Arthrobacter aurescens] (171 aa)
Score = 129, Expect = 4.7e-06, Identities = 33/94 (35%), Positives = 50/94 (53%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIAS--------SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           + ++G L  DP+   T +G   +  +IAS        S+ W   ET F     W+  A  +   L KG  V + G+L  RSY +KEG+   VIE+ ++ I P
  S:     7 ITVIGNLTSDPELRFTPSGSAVANFTIASTPRTFDRQSNEWKDGETLFLRASVWREAAENVAESLTKGTRVIVSGRLKSRSYETKEGEKRTVIELEVDEIGP 108
>gi|227555|prf||1706408C ssDNA binding protein (178 aa)
Score = 129, Expect = 4.8e-06, Identities = 33/94 (35%), Positives = 53/94 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIES 94
           +NKV +VGRL +DP+     NG   + + +A+S+ W        + +T +   V +   A     YL KG  V I+G+L  RS+    G T YV EI++++
  S:     5 INKVILVGRLGKDPEVRYIPNGGAVANLQVATSETWRDKQTGKMREQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSW-EDNGITRYVTEILVKT 104
>gi|16120662|ref|NP_403975.1| single-strand DNA-binding protein [Yersinia pestis CO92] >gi|22124496|ref|NP_667919.1| single-strand DNA-binding protein [Yersinia pestis KIM] >gi|45440334|ref|NP_991873.1| single-strand DNA-binding protein [Yersinia pestis biovar Microtus str. 91001] >gi|51594734|ref|YP_068925.1| single-strand DNA-binding protein [Yersinia pseudotuberculosis IP 32953] >gi|108809950|ref|YP_653866.1| single-strand DNA-binding protein [Yersinia pestis Antiqua] >gi|108813505|ref|YP_649272.1| single-strand DNA-binding protein [Yersinia pestis Nepal516] >gi|145600894|ref|YP_001164970.1| single-strand DNA-binding protein [Yersinia pestis Pestoides F] >gi|150260629|ref|ZP_01917357.1| single-strand binding protein [Yersinia pestis CA88-4125] >gi|153949889|ref|YP_001402714.1| single-strand DNA-binding protein [Yersinia pseudotuberculosis IP 31758] >gi|162419729|ref|YP_001605325.1| single-strand DNA-binding protein [Yersinia pestis Angola] >gi|165926670|ref|ZP_02222502.1| single-strand binding protein [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936564|ref|ZP_02225132.1| single-strand binding protein [Yersinia pestis biovar Orientalis str. IP275] >gi|166010586|ref|ZP_02231484.1| single-strand binding protein [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213923|ref|ZP_02239958.1| single-strand binding protein [Yersinia pestis biovar Antiqua str. B42003004] >gi|167402473|ref|ZP_02307930.1| single-strand binding protein [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167419378|ref|ZP_02311131.1| single-strand binding protein [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167426200|ref|ZP_02317953.1| single-strand binding protein [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170026063|ref|YP_001722568.1| single-strand binding protein [Yersinia pseudotuberculosis YPIII] >gi|186893737|ref|YP_001870849.1| single-strand binding protein [Yersinia pseudotuberculosis PB1/+] >gi|37999452|sp|Q8ZJ06|SSB_YERPE Single-stranded DNA-binding protein (SSB) (Helix-destabilizing protein) >gi|21957289|gb|AAM84170.1|AE013660_5 ssDNA-binding protein [Yersinia pestis KIM] >gi|45435190|gb|AAS60750.1| single-strand binding protein [Yersinia pestis biovar Microtus str. 91001] >gi|51588016|emb|CAH19620.1| single-strand binding protein [Yersinia pseudotuberculosis IP 32953] >gi|108777153|gb|ABG19672.1| single-strand binding protein [Yersinia pestis Nepal516] >gi|108781863|gb|ABG15921.1| single-strand binding protein [Yersinia pestis Antiqua] >gi|115346141|emb|CAL19009.1| single-strand binding protein [Yersinia pestis CO92] >gi|145212590|gb|ABP41997.1| single-strand binding protein [Yersinia pestis Pestoides F] >gi|149290037|gb|EDM40114.1| single-strand binding protein [Yersinia pestis CA88-4125] >gi|152961384|gb|ABS48845.1| single-strand binding protein [Yersinia pseudotuberculosis IP 31758] >gi|162352544|gb|ABX86492.1| single-strand binding protein [Yersinia pestis Angola] >gi|165915680|gb|EDR34289.1| single-strand binding protein [Yersinia pestis biovar Orientalis str. IP275] >gi|165921293|gb|EDR38517.1| single-strand binding protein [Yersinia pestis biovar Orientalis str. F1991016] >gi|165990676|gb|EDR42977.1| single-strand binding protein [Yersinia pestis biovar Antiqua str. E1979001] >gi|166204898|gb|EDR49378.1| single-strand binding protein [Yersinia pestis biovar Antiqua str. B42003004] >gi|166963372|gb|EDR59393.1| single-strand binding protein [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167048161|gb|EDR59569.1| single-strand binding protein [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167054911|gb|EDR64713.1| single-strand binding protein [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752597|gb|ACA70115.1| single-strand binding protein [Yersinia pseudotuberculosis YPIII] >gi|186696763|gb|ACC87392.1| single-strand binding protein [Yersinia pseudotuberculosis PB1/+] (182 aa)
Score = 129, Expect = 4.8e-06, Identities = 32/92 (34%), Positives = 50/92 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNW-------NKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVI 92
           +NKV +VG L QDP+     NG   + I++A+S++W        K +T +   V +   A     YL KG  V I+G L  R +  + G+  Y  E+V+
  S:     6 VNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKQTGEQKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGALQTRKWQDQSGQERYTTEVVV 104
>gi|145641709|ref|ZP_01797285.1| single-strand DNA-binding protein [Haemophilus influenzae R3021] >gi|145273523|gb|EDK13393.1| single-strand DNA-binding protein [Haemophilus influenzae 22.4-21] (146 aa)
Score = 129, Expect = 4.8e-06, Identities = 35/109 (32%), Positives = 56/109 (51%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           +NKV IVG L  DP+     NG   + IS+A+S++W        K +T +   V ++  A     YL KG  V I+G+L  R +  + G+  Y  EI  + ++ L  +     + S
  S:     4 INKVIIVGHLGNDPEMRTMPNGEQVANISVATSESWTDKNSGEKKTQTEWHRIVFYRRQAEICGQYLQKGSQVYIEGRLKTRKWQDQNGQDRYTTEIQGDVLQMLGGRQDEQKSQS 119
>gi|19746763|ref|NP_607899.1| single-strand DNA-binding protein [Streptococcus pyogenes MGAS8232] >gi|139473172|ref|YP_001127887.1| single-strand DNA-binding protein [Streptococcus pyogenes str. Manfredo] >gi|37999717|sp|Q8NZJ0|SSB2_STRP8 Single-stranded DNA-binding protein 2 (SSB 2) (Helix-destabilizing protein 2) >gi|19748994|gb|AAL98398.1| putative single strand binding protein [Streptococcus pyogenes MGAS8232] >gi|134271418|emb|CAM29638.1| single strand binding protein (SSB) [Streptococcus pyogenes str. Manfredo] (163 aa)
Score = 129, Expect = 4.8e-06, Identities = 30/109 (27%), Positives = 62/109 (56%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASS 109
           +N V +VGR+ +D +   T + +  +  ++A +  +     + E  F  CV W+  A  + ++  KG L+ I G++  R+Y +++G+ VYV E+V ++ + L S+ +    S+
  S:     2 INNVVLVGRMTKDAELRYTPSQVAVATFTLAVNRTFKSQNGEREADFINCVIWRQPAENLANWAKKGALIGITGRIQTRNYENQQGQRVYVTEVVADNFQMLESRATREGGST 114
>gi|38234757|ref|NP_940524.1| single-strand DNA-binding protein [Corynebacterium diphtheriae NCTC 13129] >gi|38201021|emb|CAE50744.1| single-strand DNA binding protein [Corynebacterium diphtheriae] (171 aa)
Score = 128, Expect = 4.9e-06, Identities = 32/94 (34%), Positives = 49/94 (52%)
  Q:     4 VFIVGRLAQDPQQFVTQNGITQSRISIAS--------SDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKP 97
           V IVG L  DP+   T NG+  +   +AS        S+ W   +  F  C  W   A  +   L KG  V + G+L +RSY ++EG+   V+E+  + + P
  S:     8 VTIVGNLVADPELRFTPNGVAVTSFRVASTSKKYDSRSNQWVDGDAVFLQCNIWHQAAENVAESLTKGMRVIVTGRLRQRSYETREGEKCTVMELEADEVGP 109
>gi|114046043|ref|YP_736593.1| single-strand binding protein [Shewanella sp. MR-7] >gi|113887485|gb|ABI41536.1| single-strand binding protein [Shewanella sp. MR-7] (236 aa)
Score = 128, Expect = 4.9e-06, Identities = 32/93 (34%), Positives = 51/93 (54%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNE------TYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIE 93
           +NKV +VG L QDP+     NG   + I++A+S++W   +      T +   V +   A     YL KG  V ++GKL  R +  + G+  Y  E+VI+
  S:     6 VNKVILVGNLGQDPEVRYMPNGNAVANITVATSESWKDQQGQQQERTEWHRVVLFGKLAEITGEYLRKGSQVYLEGKLQTRKWKDQSGQDRYSTEVVID 104
>gi|116493584|ref|YP_805318.1| single-stranded DNA-binding protein [Lactobacillus casei ATCC 334] >gi|116103734|gb|ABJ68876.1| Single-stranded DNA-binding protein [Lactobacillus casei ATCC 334] (198 aa)
Score = 128, Expect = 4.9e-06, Identities = 49/170 (28%), Positives = 81/170 (47%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSN--------NAASSIDKNYNPTNTKNNNYSQQSNMSVSEAMDDFES--NFAQKTSSTNITSKNEEKETFKDDPFALN 170
           +N V + GRL +D     TQ+G      ++A    +     + ET F  CV W+ +A    ++  KG +V ++G +  R+Y + +G+ VYV E+V+E+   L S+ +         N A   ++NY       NN  Q      S+   +  S  N  Q  +++     N        DPFA N
  S:     2 LNSVALTGRLTRDVDLRYTQSGTAVGSFTLAVDRQFRSANGERETDFINCVIWRKSAENFANFTKKGSMVGVEGHIQTRTYDNAQGQKVYVTEVVVENFALLESRATTQQRPSEPANPAGQGNQNYGGGQQFGNNQPQNPPSFGSQGAPNNASSPNPGQNPAASQNQGGNSAANPANPDPFANN 185
>gi|25010253|ref|NP_734648.1| single-strand DNA-binding protein [Streptococcus agalactiae NEM316] >gi|77413380|ref|ZP_00789573.1| single-strand binding protein [Streptococcus agalactiae 515] >gi|37999692|sp|Q8E7H6|SSB2_STRA3 Single-stranded DNA-binding protein 2 (SSB 2) (Helix-destabilizing protein 2) >gi|23094605|emb|CAD45823.1| Unknown [Streptococcus agalactiae NEM316] >gi|77160550|gb|EAO71668.1| single-strand binding protein [Streptococcus agalactiae 515] (131 aa)
Score = 128, Expect = 4.9e-06, Identities = 33/101 (32%), Positives = 56/101 (55%)
  Q:     2 NKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN----KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKN 102
           NKV ++GRL   P+   T    + +R ++A +  +     + E  F   V W   A  + SY  KG L+++DG+L  R Y  K+G+T Y+ E++  S + L S++
  S:     3 NKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWGRLAETLASYGTKGSLISVDGELRTRKY-EKDGQTHYITEVLASSFQLLESRS 106
>gi|50086413|ref|YP_047923.1| ssDNA-binding protein controls activity of RecBCD nuclease [Acinetobacter sp. ADP1] >gi|49532389|emb|CAG70101.1| ssDNA-binding protein controls activity of RecBCD nuclease [Acinetobacter sp. ADP1] (192 aa)
Score = 128, Expect = 5.0e-06, Identities = 39/128 (30%), Positives = 64/128 (50%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWN-------KNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKEGKTVYVIEIVIESIKPLSSKNSNNAASSIDKNYNPTNTKNNNYSQQS 128
           +NKV +VG L +DP+     NG + ++ SIA+S+ W        K +T +   V           YL KG  V I+G L  R +  + G+  Y  EI  + ++ L +++  +   S   ++N     NNN  QQ+
  S:     4 VNKVILVGTLGRDPETKTFPNGGSLTQFSIATSEAWTDKSTGERKEQTEWHRIVLHNRLGEIAQQYLRKGSKVYIEGSLRTRQWTDQNGQERYTTEIRGDQMQMLDTRSQGDQPMSGGNDFNQPRF-NNNAPQQN 137
>gi|167957111|ref|ZP_02544185.1| single-strand binding protein [candidate division TM7 single-cell isolate TM7c] (127 aa)
Score = 128, Expect = 5.2e-06, Identities = 29/91 (31%), Positives = 48/91 (52%)
  Q:     1 MNKVFIVGRLAQDPQQFVTQNGITQSRISIASSDNWNKNETYFFPCVAWQSTANFINSYLHKGDLVAIDGKLIRRSYVSKE-GKTVYVIEIV 91
           +N+V ++GRL +DP+   T +G       +A      + +  FF  +AW+ T   +N YL KG    I G+L + S+  K+ GK    +E+V
  S:     5 INQVILMGRLTRDPEMRTTASGKNVCSFGLAVDRQGQEGQADFFDVIAWEKTGELVNQYLSKGRRCLIQGRLRQDSWEDKDTGKKRNRVEVV 96