>gi|26553570|ref|NP_757504.1| ribosomal protein S18 [Mycoplasma penetrans HF-2] >gi|59798909|sp|Q8EWT5|RS18_MYCPE 30S ribosomal protein S18 >gi|26453576|dbj|BAC43908.1| ribosomal protein S18 [Mycoplasma penetrans HF-2] (154 aa)
Score = 428, Expect = 6.1e-41, Identities = 107/107 (100%), Positives = 107/107 (100%)
  Q:    48 SVEKTEVKETKKSSDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           SVEKTEVKETKKSSDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD
  S:    48 SVEKTEVKETKKSSDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
>gi|167940726|ref|ZP_02527801.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 8] >gi|167958959|ref|ZP_02546031.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167973255|ref|ZP_02555532.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167974085|ref|ZP_02556362.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|167975519|ref|ZP_02557796.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|167988271|ref|ZP_02569942.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|168337929|ref|ZP_02694544.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 10] >gi|168362598|ref|ZP_02695777.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|168808141|ref|ZP_02829200.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 2] >gi|195867992|ref|ZP_03079988.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903293|gb|EDT49582.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209001|gb|EDU06044.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019112|gb|EDU57152.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998109|gb|EDU67206.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659849|gb|EDX53229.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660326|gb|EDX53587.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (79 aa)
Score = 177, Expect = 7.5e-12, Identities = 40/67 (59%), Positives = 53/67 (79%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RKK C L AKG EHVDYKDVELL +++  N KIASR++T A ++ Q R++NAIKRAR V L+P+V++
  S:    13 RKKVCILSAKGIEHVDYKDVELLQRFINNNNKIASRRVTGASARMQRRIANAIKRARFVGLLPYVKE 79
>gi|13358116|ref|NP_078390.1| ribosomal protein S18 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167971294|ref|ZP_02553571.1| ribosomal protein S18 [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168281884|ref|ZP_02689551.1| ribosomal protein S18 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308033|ref|ZP_02690708.1| ribosomal protein S18 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762263|ref|YP_001752636.1| ribosomal protein S18 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|189029695|sp|B1AJJ2|RS18_UREP2 30S ribosomal protein S18 >gi|11387108|sp|Q9PPT8|RS18_UREPA 30S ribosomal protein S18 >gi|11357040|pir||A82875 ribosomal protein S18 UU552 [imported] - Ureaplasma urealyticum >gi|6899558|gb|AAF30965.1|AE002154_1 ribosomal protein S18 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827840|gb|ACA33102.1| ribosomal protein S18 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902461|gb|EDT48750.1| ribosomal protein S18 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675876|gb|EDT87781.1| ribosomal protein S18 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700896|gb|EDU19178.1| ribosomal protein S18 [Ureaplasma parvum serovar 6 str. ATCC 27818] (79 aa)
Score = 172, Expect = 2.5e-11, Identities = 40/67 (59%), Positives = 53/67 (79%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RKK C L AKG EHVDYKDVELL +++  N KIASR++T A ++ Q R++NAIKRAR V L+P+V++
  S:    13 RKKVCILSAKGIEHVDYKDVELLQRFINNNNKIASRRVTGASARMQRRIANAIKRARFVGLLPYVKE 79
>gi|94971562|ref|YP_593610.1| SSU ribosomal protein S18P [Acidobacteria bacterium Ellin345] >gi|94553612|gb|ABF43536.1| SSU ribosomal protein S18P [Acidobacteria bacterium Ellin345] (123 aa)
Score = 163, Expect = 3.0e-10, Identities = 32/65 (49%), Positives = 47/65 (72%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RRKK CK C +  + +DYKDV LL +++  + KI  R++T  C+ HQ R+S+AIK+AR +AL+PF
  S:    55 RRKKVCKFCVEKIDAIDYKDVRLLGQFVAESGKIVPRRLTGVCTPHQRRLSDAIKQARNIALLPF 119
>gi|13507969|ref|NP_109918.1| 30S ribosomal protein S18 [Mycoplasma pneumoniae M129] >gi|2500476|sp|P75541|RS18_MYCPN 30S ribosomal protein S18 >gi|1674303|gb|AAB96249.1| ribosomal protein S18 [Mycoplasma pneumoniae M129] (104 aa)
Score = 161, Expect = 5.9e-10, Identities = 34/68 (50%), Positives = 47/68 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDY-KDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           R KK+C+ CA GQ  +D   D+E L ++L+P  KI  R+IT  C  HQ  V+ A+KRAR +AL+PFV+D
  S:    36 RSKKYCRFCAIGQLRIDLIDDLEALKRFLSPYAKINPRRITGNCQMHQRHVAKALKRARYLALVPFVKD 104
>gi|139439449|ref|ZP_01772890.1| Hypothetical protein COLAER_01910 [Collinsella aerofaciens ATCC 25986] >gi|133775228|gb|EBA39048.1| Hypothetical protein COLAER_01910 [Collinsella aerofaciens ATCC 25986] (88 aa)
Score = 158, Expect = 1.1e-09, Identities = 32/64 (50%), Positives = 48/64 (75%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           R+K+C+ C +  E +DYKD +LL KY+T   KI  R++T AC++HQ  ++NAIKRAR +AL+P+
  S:    11 RRKYCQFCKENTEFIDYKDTQLLRKYMTDRGKIKPRRVTGACTQHQHDIANAIKRAREMALLPY 74
>gi|166030697|ref|ZP_02233526.1| hypothetical protein DORFOR_00371 [Dorea formicigenerans ATCC 27755] >gi|166029489|gb|EDR48246.1| hypothetical protein DORFOR_00371 [Dorea formicigenerans ATCC 27755] (88 aa)
Score = 156, Expect = 1.9e-09, Identities = 40/88 (45%), Positives = 54/88 (61%)
  Q:    67 FNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           ++   RP   + R  P +  RRKK C  C K    +DYKDV  L KY++   KI  R+IT  C+KHQ  ++ AIKRAR VAL+P+V+D
  S:     3 YDKAARPEGGFKRRNPGR--RRKKVCVFCGKENNEIDYKDVAKLRKYVSERGKILPRRITGNCAKHQRALTVAIKRARHVALMPYVQD 88
>gi|12044944|ref|NP_072754.1| 30S ribosomal protein S18 [Mycoplasma genitalium G37] >gi|1350949|sp|P47338|RS18_MYCGE 30S ribosomal protein S18 >gi|3844679|gb|AAC71310.1| ribosomal protein S18 [Mycoplasma genitalium G37] >gi|166078670|gb|ABY79288.1| ribosomal protein S18 [synthetic Mycoplasma genitalium JCVI-1.0] (105 aa)
Score = 156, Expect = 2.1e-09, Identities = 33/68 (48%), Positives = 50/68 (73%)
  Q:    87 RRKKFCKLCAKGQEHVDY-KDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           R KK+C+ CA GQ  +D+  D+E + ++L+P  KI  R+IT  C+ HQ  V+NA+KRAR +AL+PF++D
  S:    37 RAKKYCRFCAIGQLRIDFIDDLEAIKRFLSPYAKINPRRITGNCNMHQRHVANALKRARYLALVPFIKD 105
>gi|66880323|ref|ZP_00405305.1| COG0238: Ribosomal protein S18 [Mycoplasma genitalium G-37] (104 aa)
Score = 155, Expect = 2.9e-09, Identities = 33/68 (48%), Positives = 50/68 (73%)
  Q:    87 RRKKFCKLCAKGQEHVDY-KDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           R KK+C+ CA GQ  +D+  D+E + ++L+P  KI  R+IT  C+ HQ  V+NA+KRAR +AL+PF++D
  S:    36 RAKKYCRFCAIGQLRIDFIDDLEAIKRFLSPYAKINPRRITGNCNMHQRHVANALKRARYLALVPFIKD 104
>gi|114777954|ref|ZP_01452868.1| ribosomal protein S18 [Mariprofundus ferrooxydans PV-1] >gi|114551741|gb|EAU54293.1| ribosomal protein S18 [Mariprofundus ferrooxydans PV-1] (119 aa)
Score = 154, Expect = 3.0e-09, Identities = 41/113 (36%), Positives = 63/113 (55%)
  Q:    39 STAKKATTASVEKTEVKETKKSSDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +T  +AT A   +    +  +   ++ +    DRP     R    +  RR+KFCK CA+    +DYK+ +LL  ++T   KI   ++T  CS HQ R++ AIKRAR++ALIPF
  S:     4 ATKTEATAAPRPQAARPQGDRPQGDRPQRPQGDRP---QRRPAAGRFQRRRKFCKFCAEKNVTIDYKNPDLLRGFITERYKILPSRVTGTCSSHQRRLTTAIKRARVLALIPF 113
>gi|148653438|ref|YP_001280531.1| 30S ribosomal protein S18 [Psychrobacter sp. PRwf-1] >gi|172048535|sp|A5WFZ0|RS18_PSYWF 30S ribosomal protein S18 >gi|148572522|gb|ABQ94581.1| SSU ribosomal protein S18P [Psychrobacter sp. PRwf-1] (75 aa)
Score = 154, Expect = 3.6e-09, Identities = 32/65 (49%), Positives = 49/65 (75%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G  H+DYKDVELL +Y++ N KI   +IT   +K+Q +++ AIK+AR +AL+P+
  S:     6 RRRKFCRFTAEGITHIDYKDVELLKQYISDNGKIVPSRITGTSNKYQRQLATAIKQARYLALLPY 70
>gi|71065895|ref|YP_264622.1| 30S ribosomal protein S18 [Psychrobacter arcticus 273-4] >gi|93005859|ref|YP_580296.1| 30S ribosomal protein S18 [Psychrobacter cryohalolentis K5] >gi|123264648|sp|Q1QBZ1|RS18_PSYCK 30S ribosomal protein S18 >gi|123748116|sp|Q4FS20|RS18_PSYA2 30S ribosomal protein S18 >gi|71038880|gb|AAZ19188.1| SSU ribosomal protein S18P [Psychrobacter arcticus 273-4] >gi|92393537|gb|ABE74812.1| SSU ribosomal protein S18P [Psychrobacter cryohalolentis K5] (76 aa)
Score = 152, Expect = 6.2e-09, Identities = 31/65 (47%), Positives = 49/65 (75%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G  H+DYKDVELL +Y++ N KI   +IT   +K+Q +++ AIK+AR ++L+P+
  S:     6 RRRKFCRFTAEGITHIDYKDVELLKQYISDNGKIVPSRITGTSTKYQRQLATAIKQARYLSLLPY 70
>gi|85859721|ref|YP_461923.1| SSU ribosomal protein S18P [Syntrophus aciditrophicus SB] >gi|85722812|gb|ABC77755.1| SSU ribosomal protein S18P [Syntrophus aciditrophicus SB] (88 aa)
Score = 147, Expect = 2.2e-08, Identities = 32/65 (49%), Positives = 46/65 (70%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           R+K+CK C+     +DYK  ++L+ Y+T   KI  R+IT +CSKHQ  ++ AIKRAR +AL+PFV
  S:    19 RRKYCKFCSDSTIKIDYKRPDILHDYITERGKIMPRRITGSCSKHQRELTQAIKRARSIALLPFV 83
>gi|154503456|ref|ZP_02040516.1| hypothetical protein RUMGNA_01280 [Ruminococcus gnavus ATCC 29149] >gi|153795556|gb|EDN77976.1| hypothetical protein RUMGNA_01280 [Ruminococcus gnavus ATCC 29149] (90 aa)
Score = 146, Expect = 2.5e-08, Identities = 39/91 (42%), Positives = 54/91 (59%)
  Q:    64 KKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           K  +    RP   + +  P +  RRKK C  C K    +DYKDV  L KY++   KI  R+IT  C+KHQ  ++ AIKRAR +AL+P+V+D
  S:     2 KMAYEKGSRPEGGFKKRGPAR--RRKKVCVFCGKENNEIDYKDVAKLKKYVSERGKILPRRITGNCAKHQRALTVAIKRARHIALMPYVQD 90
>gi|161899036|ref|YP_077144.2| 30S ribosomal protein S18 [Symbiobacterium thermophilum IAM 14863] (76 aa)
Score = 146, Expect = 2.6e-08, Identities = 30/60 (50%), Positives = 41/60 (68%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           C  C    EHVDYKD   L +Y+T   KI  R+I+  C++HQ +++ AIKRARI+AL+PF
  S:    14 CSFCVDKIEHVDYKDAARLKRYITERGKILPRRISGNCARHQRQLTVAIKRARIMALLPF 73
>gi|51858142|dbj|BAD42300.1| 30S ribosomal protein S18 [Symbiobacterium thermophilum IAM 14863] (64 aa)
Score = 145, Expect = 3.5e-08, Identities = 30/60 (50%), Positives = 41/60 (68%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           C  C    EHVDYKD   L +Y+T   KI  R+I+  C++HQ +++ AIKRARI+AL+PF
  S:     2 CSFCVDKIEHVDYKDAARLKRYITERGKILPRRISGNCARHQRQLTVAIKRARIMALLPF 61
>gi|167773044|ref|ZP_02445097.1| hypothetical protein ANACOL_04433 [Anaerotruncus colihominis DSM 17241] >gi|167664977|gb|EDS09107.1| hypothetical protein ANACOL_04433 [Anaerotruncus colihominis DSM 17241] (86 aa)
Score = 145, Expect = 4.2e-08, Identities = 31/77 (40%), Positives = 47/77 (61%)
  Q:    78 NRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +RG    +  RKK C  C      +DYKDV  L +YL+   KI  R++T  C++HQ +++ AIKRAR + L+P++ D
  S:    10 SRGPRGNRKGRKKVCAFCVDKLGPIDYKDVPRLRRYLSERAKIVPRRVTGTCARHQRQLTLAIKRARHIGLLPYISD 86
>gi|54020444|ref|YP_115817.1| 30S ribosomal protein S18 [Mycoplasma hyopneumoniae 232] >gi|161611220|ref|YP_279087.2| 30S ribosomal protein S18 [Mycoplasma hyopneumoniae J] >gi|161611227|ref|YP_287690.2| 30S ribosomal protein S18 [Mycoplasma hyopneumoniae 7448] >gi|166221070|sp|Q4A872|RS18_MYCH7 30S ribosomal protein S18 >gi|166221071|sp|Q4AA45|RS18_MYCHJ 30S ribosomal protein S18 >gi|59798622|sp|Q600Z8|RS18_MYCH2 30S ribosomal protein S18 >gi|53987617|gb|AAV27818.1| 30s ribosomal protein S18 [Mycoplasma hyopneumoniae 232] >gi|144227556|gb|AAZ44376.2| 30S ribosomal protein S18 [Mycoplasma hyopneumoniae J] >gi|144575366|gb|AAZ53667.2| 30s ribosomal protein S18 [Mycoplasma hyopneumoniae 7448] (87 aa)
Score = 144, Expect = 5.3e-08, Identities = 27/63 (42%), Positives = 43/63 (68%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C+ C     ++DYKD+E+L +++    KI   +IT  C+KHQ +++ A+KRAR VAL+PF+ D
  S:    14 CQFCEAKLFYIDYKDIEVLQRFINTFGKIQPSRITGNCAKHQRKLALAVKRARFVALLPFIGD 76
>gi|117925749|ref|YP_866366.1| SSU ribosomal protein S18P [Magnetococcus sp. MC-1] >gi|117609505|gb|ABK44960.1| SSU ribosomal protein S18P [Magnetococcus sp. MC-1] (106 aa)
Score = 144, Expect = 5.5e-08, Identities = 34/81 (41%), Positives = 49/81 (60%)
  Q:    72 RPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RP A   R +     RR+K C  CA     +DYKD ++L +Y+T   K+   +IT  C+ HQ ++S AIKRAR +AL+PF+
  S:    28 RPLASARRPF----FRRRKVCPFCADKGLKIDYKDPKMLSRYITERGKMVPSRITGVCAPHQRKLSVAIKRARNIALLPFI 104
>gi|116626134|ref|YP_828290.1| SSU ribosomal protein S18P [Solibacter usitatus Ellin6076] >gi|116229296|gb|ABJ88005.1| SSU ribosomal protein S18P [Solibacter usitatus Ellin6076] (99 aa)
Score = 143, Expect = 5.8e-08, Identities = 28/65 (43%), Positives = 47/65 (72%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RRKK C+ C +  + ++YKDV++L+ ++    KI  R+I+  C+ HQ R+++AIK+AR +AL+PF
  S:    31 RRKKVCRFCVEKIDDINYKDVKMLHAFVAERGKIVPRRISGVCAPHQRRLTDAIKKARNIALLPF 95
>gi|31544817|ref|NP_853395.1| 30S ribosomal protein S18 [Mycoplasma gallisepticum R] >gi|59798824|sp|Q7NAM3|RS18_MYCGA 30S ribosomal protein S18 >gi|31541663|gb|AAP56963.1| RpsR [Mycoplasma gallisepticum R] (108 aa)
Score = 143, Expect = 6.3e-08, Identities = 38/70 (54%), Positives = 47/70 (67%)
  Q:    85 QGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + R +K C  CAKG   VDYKDV  L K L    KI SR+ +  C+ HQ  VSNAIK+ARI+AL+PFV+D
  S:    39 KSRSRKLCHFCAKGILKVDYKDVNTLRKNLNSYAKIVSRRQSGNCNLHQRHVSNAIKKARIMALLPFVKD 108
>gi|163784039|ref|ZP_02178996.1| ribosomal protein S18 [Hydrogenivirga sp. 128-5-R1-1] >gi|159880696|gb|EDP74243.1| ribosomal protein S18 [Hydrogenivirga sp. 128-5-R1-1] (79 aa)
Score = 143, Expect = 6.3e-08, Identities = 34/85 (40%), Positives = 55/85 (64%)
  Q:    68 NPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           NP  +PF +          +RKK+CK CA+G E  DYK++++L ++++   KI   +I+  C KHQ +++ AIKRAR +AL+P+V
  S:     4 NPAQKPFFQ----------KRKKYCKFCAEGIEP-DYKNIDILKEFISERGKIVPSRISGTCGKHQRKLAVAIKRARQLALLPYV 77
>gi|167760811|ref|ZP_02432938.1| hypothetical protein CLOSCI_03196 [Clostridium scindens ATCC 35704] >gi|167661698|gb|EDS05828.1| hypothetical protein CLOSCI_03196 [Clostridium scindens ATCC 35704] (88 aa)
Score = 143, Expect = 7.0e-08, Identities = 32/63 (50%), Positives = 42/63 (66%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C  C K    +DYKDV  L KY++   KI  R+IT  C+KHQ  ++ AIKRAR VAL+P+V+D
  S:    26 CVFCGKENNEIDYKDVAKLRKYISERGKILPRRITGNCAKHQRALTVAIKRARHVALMPYVQD 88
>gi|47459060|ref|YP_015922.1| 30S ribosomal protein S18 [Mycoplasma mobile 163K] >gi|59798718|sp|Q6KI65|RS18_MYCMO 30S ribosomal protein S18 >gi|47458389|gb|AAT27711.1| 30S ribosomal protein s18 [Mycoplasma mobile 163K] (84 aa)
Score = 142, Expect = 8.9e-08, Identities = 34/67 (50%), Positives = 47/67 (70%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + K C    +  +++DYKDVEL+ KY+  + KI S KIT  C+KHQ  +SN IKRARI+ALIPF+ +
  S:    14 KPKPCFFHVEKIKYIDYKDVELVSKYINNHGKILSSKITGNCAKHQRLISNVIKRARIMALIPFISE 80
>gi|29654192|ref|NP_819884.1| ribosomal protein S18 [Coxiella burnetii RSA 493] >gi|153209209|ref|ZP_01947275.1| ribosomal protein S18 [Coxiella burnetii 'MSU Goat Q177'] >gi|154705894|ref|YP_001424310.1| ribosomal protein S18 [Coxiella burnetii Dugway 5J108-111] >gi|161829761|ref|YP_001596842.1| ribosomal protein S18 [Coxiella burnetii RSA 331] >gi|165918540|ref|ZP_02218626.1| ribosomal protein S18 [Coxiella burnetii RSA 334] >gi|189029674|sp|A9KFL6|RS18_COXBN 30S ribosomal protein S18 >gi|189029675|sp|A9ND52|RS18_COXBR 30S ribosomal protein S18 >gi|59798886|sp|Q83D75|RS18_COXBU 30S ribosomal protein S18 >gi|29541458|gb|AAO90398.1| ribosomal protein S18 [Coxiella burnetii RSA 493] >gi|120575464|gb|EAX32088.1| ribosomal protein S18 [Coxiella burnetii 'MSU Goat Q177'] >gi|154355180|gb|ABS76642.1| ribosomal protein S18 [Coxiella burnetii Dugway 5J108-111] >gi|161761628|gb|ABX77270.1| ribosomal protein S18 [Coxiella burnetii RSA 331] >gi|165917786|gb|EDR36390.1| ribosomal protein S18 [Coxiella burnetii RSA 334] (73 aa)
Score = 142, Expect = 9.3e-08, Identities = 30/65 (46%), Positives = 43/65 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RRKKFC   AK  + +DYKDV  L  Y+  + ++   +IT  C+KHQ ++S AIK AR +AL+P+
  S:     4 RRKKFCAFDAKNLQEIDYKDVNTLKDYIMESGRVVPSRITGTCAKHQRQISRAIKLARYLALLPY 68
>gi|59798883|sp|Q82XQ8|RS18_NITEU 30S ribosomal protein S18 (76 aa)
Score = 141, Expect = 1.1e-07, Identities = 27/65 (41%), Positives = 48/65 (73%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +RKKFC+  A+G +H+DYKD++LL  +++ N +I   +IT   + +Q +++ AI+RAR +AL+P+
  S:     8 KRKKFCRFTAEGIKHIDYKDIDLLKDFVSENGRIIPARITGTRAYYQRQLNLAIERARFLALLPY 72
>gi|189485365|ref|YP_001956306.1| 30S ribosomal protein S18 [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287324|dbj|BAG13845.1| 30S ribosomal protein S18 [uncultured Termite group 1 bacterium phylotype Rs-D17] (100 aa)
Score = 141, Expect = 1.1e-07, Identities = 38/97 (39%), Positives = 56/97 (57%)
  Q:    55 KETKKSSDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K   ++   K   +   RP  K+ R  P     RKK C+ CA   E +DYK++ LL+ ++T   KI S ++T  C+KHQ  +  AIKRAR++AL+PF
  S:     6 KPAGQAKPQKYSTDAYGRPAGKFRRNGP----IRKKVCRFCADKVE-IDYKNLSLLHTFVTEKGKILSGRMTGTCAKHQRELDTAIKRARMIALLPF 97
>gi|160944120|ref|ZP_02091350.1| hypothetical protein FAEPRAM212_01622 [Faecalibacterium prausnitzii M21/2] >gi|158444796|gb|EDP21800.1| hypothetical protein FAEPRAM212_01622 [Faecalibacterium prausnitzii M21/2] (71 aa)
Score = 140, Expect = 1.3e-07, Identities = 32/67 (47%), Positives = 43/67 (64%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RKK C  C    + +DYKDV  L KY++   KI  R++T  C+ HQ  ++ AIKRAR VAL+P+V D
  S:     5 RKKVCSFCVDRIDTIDYKDVPRLRKYVSERAKIIPRRVTGTCAYHQRALTIAIKRARHVALMPYVSD 71
>gi|46447225|ref|YP_008590.1| ribosomal protein S18 [Candidatus Protochlamydia amoebophila UWE25] >gi|59798733|sp|Q6MAT4|RS18_PARUW 30S ribosomal protein S18 >gi|46400866|emb|CAF24315.1| probable ribosomal protein S18 [Candidatus Protochlamydia amoebophila UWE25] (86 aa)
Score = 139, Expect = 1.7e-07, Identities = 34/79 (43%), Positives = 51/79 (64%)
  Q:    76 KYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           KYN  Y + + +++K C   A G   +DYKD++ L K++T   KI  R+IT   + HQ +++ AIKRAR VAL+PFV +
  S:     7 KYNSDYSDARSKKRKRCPFTAAGIREIDYKDIDTLTKFITERGKILPRRITGVSAYHQKKLTAAIKRARHVALLPFVAE 85
>gi|90408976|ref|ZP_01217108.1| ribosomal protein S18 [Psychromonas sp. CNPT3] >gi|90309924|gb|EAS38077.1| ribosomal protein S18 [Psychromonas sp. CNPT3] (75 aa)
Score = 139, Expect = 1.7e-07, Identities = 31/65 (47%), Positives = 46/65 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G   +DYKDV  L  Y+T + KI   +IT  C+K+Q +++ AIKRAR ++LIP+
  S:     6 RRRKFCRFTAEGVSEIDYKDVTTLKNYITESGKIVPSRITGTCAKYQRQLARAIKRARYLSLIPY 70
>gi|119947024|ref|YP_944704.1| ribosomal protein S18 [Psychromonas ingrahamii 37] >gi|166220979|sp|A1T040|RS18_PSYIN 30S ribosomal protein S18 >gi|119865628|gb|ABM05105.1| SSU ribosomal protein S18P [Psychromonas ingrahamii 37] (75 aa)
Score = 139, Expect = 1.8e-07, Identities = 30/65 (46%), Positives = 46/65 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G   +DYKDV  L  Y+T + KI   +IT  C+K+Q +++ AIKRAR ++L+P+
  S:     6 RRRKFCRFTAEGVSEIDYKDVVTLKNYITESGKIVPSRITGTCAKYQRQLARAIKRARYLSLLPY 70
>gi|82703070|ref|YP_412636.1| 30S ribosomal protein S18 [Nitrosospira multiformis ATCC 25196] >gi|82411135|gb|ABB75244.1| SSU ribosomal protein S18P [Nitrosospira multiformis ATCC 25196] (94 aa)
Score = 139, Expect = 1.8e-07, Identities = 29/65 (44%), Positives = 47/65 (72%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +R+KFC+  A+G + VDYKD+ELL  ++  N KI   +IT   S++Q ++S A++RAR +AL+P+
  S:    26 KRRKFCRFTAEGIKTVDYKDIELLKDFINENGKIIPARITGTKSRYQRQLSTAVERARFLALLPY 90
>gi|89100929|ref|ZP_01173776.1| ribosomal protein S18 [Bacillus sp. NRRL B-14911] >gi|89084338|gb|EAR63492.1| ribosomal protein S18 [Bacillus sp. NRRL B-14911] (81 aa)
Score = 139, Expect = 1.9e-07, Identities = 29/61 (47%), Positives = 44/61 (72%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           C   A G  H+DYKDV+LL K+++   KI  R++T   +K+Q +++ AIKRARI+AL+P+V
  S:    18 CYFTANGITHIDYKDVDLLKKFISERGKILPRRVTGTNAKYQRKLTVAIKRARIMALLPYV 78
>gi|194366361|ref|YP_002028971.1| ribosomal protein S18 [Stenotrophomonas maltophilia R551-3] >gi|194349165|gb|ACF52288.1| ribosomal protein S18 [Stenotrophomonas maltophilia R551-3] (76 aa)
Score = 139, Expect = 1.9e-07, Identities = 32/65 (49%), Positives = 47/65 (72%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFCK  A+G + +DYKD+  L +YLT N KI   ++T   SK+Q +++ A+KRAR +ALIP+
  S:     6 RRRKFCKFTAEGVKEIDYKDLNTLRQYLTENGKIVPSRVTGTKSKYQRQLATAVKRARFLALIPY 70
>gi|21242371|ref|NP_641953.1| 30S ribosomal protein S18 [Xanthomonas axonopodis pv. citri str. 306] >gi|78047218|ref|YP_363393.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|190575040|ref|YP_001972885.1| 30s ribosomal subunit protein S18 [Stenotrophomonas maltophilia K279a] >gi|123771403|sp|Q3BV20|RS18_XANC5 30S ribosomal protein S18 >gi|23822134|sp|Q8PM13|RS18_XANAC 30S ribosomal protein S18 >gi|21107808|gb|AAM36489.1| 30S ribosomal protein S18 [Xanthomonas axonopodis pv. citri str. 306] >gi|78035648|emb|CAJ23339.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|190012962|emb|CAQ46594.1| 30s ribosomal subunit protein S18 [Stenotrophomonas maltophilia K279a] (76 aa)
Score = 139, Expect = 2.0e-07, Identities = 32/65 (49%), Positives = 47/65 (72%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFCK  A+G + +DYKD+  L +YLT N KI   ++T   SK+Q +++ A+KRAR +ALIP+
  S:     6 RRRKFCKFTAEGVKEIDYKDLNTLRQYLTENGKIVPSRVTGTKSKYQRQLATAVKRARFLALIPY 70
>gi|169335534|ref|ZP_02862727.1| hypothetical protein ANASTE_01948 [Anaerofustis stercorihominis DSM 17244] >gi|169258272|gb|EDS72238.1| hypothetical protein ANASTE_01948 [Anaerofustis stercorihominis DSM 17244] (81 aa)
Score = 138, Expect = 2.2e-07, Identities = 31/68 (45%), Positives = 43/68 (63%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RRKK C  C    EH+DYKD +LL KY++   KI  R++T  C+KHQ  V+ A+  AR  AL+P+  +
  S:    14 RRKKVCYFCENKIEHIDYKDTKLLKKYVSERYKILPRRVTGTCAKHQRGVTQAVNIARNAALLPYTTE 81
>gi|171325304|ref|ZP_02913810.1| ribosomal protein S18 [Geobacillus sp. WCH70] >gi|171088728|gb|EDT35073.1| ribosomal protein S18 [Geobacillus sp. WCH70] (78 aa)
Score = 138, Expect = 2.3e-07, Identities = 32/75 (42%), Positives = 50/75 (66%)
  Q:    80 GYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           G    + +R+K C   A G  H+DYKDV+LL K+++   KI  R++T   +K+Q +++ AIKRAR +AL+P+V D
  S:     3 GRKGGRAKRRKVCYFTANGITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLPYVAD 77
>gi|21672804|ref|NP_660871.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|25009169|sp|Q8K919|RS18_BUCAP 30S ribosomal protein S18 >gi|21623454|gb|AAM68082.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Sg (Schizaphis graminum)] (75 aa)
Score = 138, Expect = 2.3e-07, Identities = 30/65 (46%), Positives = 46/65 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G + +DYKD+ +L  Y+T N KI   +IT   +K Q ++S AIK+AR +AL+P+
  S:     6 RRRKFCRFTAEGIQEIDYKDIAMLKNYITENGKIVPSRITGTRAKFQRQLSRAIKKARYLALLPY 70
>gi|15839149|ref|NP_299837.1| 30S ribosomal protein S18 [Xylella fastidiosa 9a5c] >gi|11387104|sp|Q9PAF8|RS18_XYLFA 30S ribosomal protein S18 >gi|9107772|gb|AAF85357.1|AE004063_6 30S ribosomal protein S18 [Xylella fastidiosa 9a5c] (76 aa)
Score = 138, Expect = 2.5e-07, Identities = 32/65 (49%), Positives = 47/65 (72%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFCK  A+G + +DYKD+  L +YLT N KI   ++T   SK+Q +++ A+KRAR +ALIP+
  S:     6 RRRKFCKFTAEGIKEIDYKDLNTLRQYLTENGKIVPSRVTGTKSKYQRQLTTAVKRARFLALIPY 70
>gi|154249360|ref|YP_001410185.1| ribosomal protein S18 [Fervidobacterium nodosum Rt17-B1] >gi|154153296|gb|ABS60528.1| ribosomal protein S18 [Fervidobacterium nodosum Rt17-B1] (76 aa)
Score = 138, Expect = 2.5e-07, Identities = 34/70 (48%), Positives = 48/70 (68%)
  Q:    84 KQGRRK-KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVR 153
           +Q RRK K CK+C    E+VDYKD+ +L  +L    KI  R++T  C+KHQ  V  AIKRAR +AL+P+++
  S:     5 RQRRRKVKACKMCEMNVEYVDYKDIRILKDFLNEKGKILPRRLTGNCAKHQRMVKIAIKRARQMALLPYIK 75
>gi|20809108|ref|NP_624279.1| 30S ribosomal protein S18 [Thermoanaerobacter tengcongensis MB4] >gi|23822145|sp|Q8R6M3|RS18_THETN 30S ribosomal protein S18 >gi|20517786|gb|AAM25883.1| Ribosomal protein S18 [Thermoanaerobacter tengcongensis MB4] (89 aa)
Score = 138, Expect = 2.6e-07, Identities = 29/60 (48%), Positives = 41/60 (68%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           C  CA   + +DYKDV  L KY+T   KI  R+IT  C++HQ +++ AIKRAR +AL+P+
  S:    27 CAFCADNIDRIDYKDVARLRKYITERGKILPRRITGNCARHQRQLTKAIKRARQIALLPY 86
>gi|126647679|ref|ZP_01720184.1| putative 30S ribosomal protein S18 [Algoriphagus sp. PR1] >gi|126576355|gb|EAZ80633.1| putative 30S ribosomal protein S18 [Algoriphagus sp. PR1] (83 aa)
Score = 137, Expect = 2.9e-07, Identities = 31/72 (43%), Positives = 48/72 (66%)
  Q:    83 NKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           N+   RKK+C+    G +++DYKD   L K++    KI  R++T   +K+Q +V+NAIK+AR +AL+PFV D
  S:     9 NRGENRKKYCRFKKHGIKYIDYKDPNFLLKFVNEQGKILPRRLTGNSAKYQKKVANAIKKARHLALLPFVTD 80
>gi|163812255|ref|ZP_02203931.1| ribosomal protein S18 [Dehalococcoides sp. VS] >gi|157404089|gb|EDO70133.1| ribosomal protein S18 [Dehalococcoides sp. VS] (147 aa)
Score = 137, Expect = 2.9e-07, Identities = 35/85 (41%), Positives = 52/85 (61%)
  Q:    70 QDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           QDRP  +  RG   +   ++K C  CA+    +DYKD   L +Y++   KI  R+ T  C++HQ  ++NAIKRAR +AL+PFV +
  S:     4 QDRP-NRPARGGRGRYTPKRKICSFCAEKVSRIDYKDSAKLARYISDRGKIEPRRRTGTCARHQRALANAIKRARFIALMPFVSE 87
>gi|167747438|ref|ZP_02419565.1| hypothetical protein ANACAC_02158 [Anaerostipes caccae DSM 14662] >gi|167652800|gb|EDR96929.1| hypothetical protein ANACAC_02158 [Anaerostipes caccae DSM 14662] (84 aa)
Score = 137, Expect = 3.1e-07, Identities = 37/78 (47%), Positives = 52/78 (66%)
  Q:    77 YNRG-YPNKQGRRK---KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           YNRG  PN++   +   K C  C +    +DYKDV  L KY++   KI  R+IT  C+KHQ  V++AIKRAR +AL+P+ +D
  S:     3 YNRGDSPNRRRGGRRRRKVCAFCTEADAVIDYKDVATLKKYVSERGKILPRRITGTCAKHQRAVTSAIKRARHLALMPYTQD 84
>gi|167629778|ref|YP_001680277.1| 30S ribosomal protein s18 [Heliobacterium modesticaldum Ice1] >gi|167592518|gb|ABZ84266.1| 30S ribosomal protein s18 [Heliobacterium modesticaldum Ice1] (86 aa)
Score = 137, Expect = 3.1e-07, Identities = 31/60 (51%), Positives = 41/60 (68%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           C  C    E VDYK+V  L KY+T   KI  R+++  C+KHQ +++NAIKRAR VAL+PF
  S:    23 CFFCVDKIETVDYKEVGKLRKYITERGKILPRRVSGCCAKHQRQLTNAIKRARHVALLPF 82
>gi|116513237|ref|YP_812143.1| 30S ribosomal protein S18 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122275992|sp|Q04CW7|RS18_LACDB 30S ribosomal protein S18 >gi|116092552|gb|ABJ57705.1| SSU ribosomal protein S18P [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (78 aa)
Score = 137, Expect = 3.1e-07, Identities = 28/61 (45%), Positives = 44/61 (72%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   ++VDYKDV+LL  +++   KI  R++T   +K+Q +V+NAIKRARI+ L+PFV +
  S:    17 IAANHIDYVDYKDVDLLKHFISERGKILPRRVTGTSAKNQRKVANAIKRARIMGLLPFVAE 77
>gi|150019892|ref|YP_001312146.1| 30S ribosomal protein S18 [Clostridium beijerinckii NCIMB 8052] >gi|189029672|sp|A6M3L0|RS18_CLOB8 30S ribosomal protein S18 >gi|149906357|gb|ABR37190.1| ribosomal protein S18 [Clostridium beijerinckii NCIMB 8052] (86 aa)
Score = 137, Expect = 3.4e-07, Identities = 37/92 (40%), Positives = 53/92 (57%)
  Q:    63 NKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +++E N   RP  K  R        RKK C  C    E +DYKD+  L KY+T   KI  R+I+  C+KHQ  ++++IKRAR +AL+PF  +
  S:     2 SREEGNNGRRPGGKMRRS-------RKKVCAFCVDKAEFIDYKDINKLRKYVTERGKILPRRISGTCAKHQRELTSSIKRARNIALLPFTTE 86
>gi|23100932|ref|NP_694399.1| 30S ribosomal protein S18 [Oceanobacillus iheyensis HTE831] >gi|59798907|sp|Q8EKV5|RS18_OCEIH 30S ribosomal protein S18 >gi|22779167|dbj|BAC15433.1| 30S ribosomal protein S18 [Oceanobacillus iheyensis HTE831] (76 aa)
Score = 137, Expect = 3.4e-07, Identities = 28/63 (44%), Positives = 44/63 (69%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C   A G  H+DYKDV+LL ++++   KI  R++T   +K+Q +++ AIKRAR +AL+P+V D
  S:    14 CYFTANGITHIDYKDVDLLRRFISERGKILPRRVTGTSAKYQRKLTIAIKRARTMALLPYVAD 76
>gi|168187295|ref|ZP_02621930.1| ribosomal protein S18 [Clostridium botulinum C str. Eklund] >gi|169294783|gb|EDS76916.1| ribosomal protein S18 [Clostridium botulinum C str. Eklund] (78 aa)
Score = 137, Expect = 3.5e-07, Identities = 32/63 (50%), Positives = 40/63 (63%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C  CA     +DYKDV  L KY+T   KI  R+I+  C+KHQ  ++ AIKRAR VAL+PF  D
  S:    16 CAFCADKSSSIDYKDVNKLRKYVTERGKILPRRISGNCAKHQRELTLAIKRARNVALLPFTTD 78
>gi|118444188|ref|YP_876991.1| 30S ribosomal protein S18 [Clostridium novyi NT] >gi|166220947|sp|A0PX89|RS18_CLONN 30S ribosomal protein S18 >gi|118134644|gb|ABK61688.1| ribosomal protein S18 [Clostridium novyi NT] (78 aa)
Score = 137, Expect = 3.5e-07, Identities = 32/63 (50%), Positives = 40/63 (63%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C  CA     +DYKDV  L KY+T   KI  R+I+  C+KHQ  ++ AIKRAR VAL+PF  D
  S:    16 CAFCADKSSSIDYKDVNKLRKYVTERGKILPRRISGNCAKHQRELTLAIKRARNVALLPFTTD 78
>gi|119897011|ref|YP_932224.1| 30S ribosomal protein S18 [Azoarcus sp. BH72] >gi|169184424|ref|ZP_02844721.1| ribosomal protein S18 [Thauera sp. MZ1T] >gi|119669424|emb|CAL93337.1| 30S ribosomal protein S18 [Azoarcus sp. BH72] >gi|169008609|gb|EDS55415.1| ribosomal protein S18 [Thauera sp. MZ1T] (91 aa)
Score = 136, Expect = 3.6e-07, Identities = 29/65 (44%), Positives = 46/65 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +R+KFC+  A+  E VDYKDV++L  ++T N KI   +IT   + +Q ++S A+KRAR +AL+P+
  S:    22 KRRKFCRFTAEKIEEVDYKDVDILKDFITENAKIMPARITGTKAGYQRQLSVAVKRARFLALMPY 86
>gi|157363691|ref|YP_001470458.1| ribosomal protein S18 [Thermotoga lettingae TMO] >gi|157314295|gb|ABV33394.1| ribosomal protein S18 [Thermotoga lettingae TMO] (78 aa)
Score = 136, Expect = 3.7e-07, Identities = 29/60 (48%), Positives = 42/60 (70%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVR 153
           LC    E+VDYKD+ LL ++LT   KI  +++T  C+KHQ  +  AIKRAR +AL+PF++
  S:    18 LCEMKVEYVDYKDLRLLNEFLTDKAKIIPKRVTGNCAKHQRMIKIAIKRARHMALLPFIK 77
>gi|146296359|ref|YP_001180130.1| 30S ribosomal protein S18 [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409935|gb|ABP66939.1| SSU ribosomal protein S18P [Caldicellulosiruptor saccharolyticus DSM 8903] (91 aa)
Score = 136, Expect = 3.8e-07, Identities = 31/70 (44%), Positives = 48/70 (68%)
  Q:    83 NKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           ++Q ++K+ C  C +    +DYKDV  L K+LT   KI  R+ T  C++HQ +++ AIKRARI+AL+PF+
  S:    20 SRQKKKKRVCSFCVERIYDIDYKDVNRLKKFLTERGKIMPRRTTGNCARHQRQLTRAIKRARILALLPFI 89
>gi|15617154|ref|NP_240367.1| 30S ribosomal protein S18 [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11387089|sp|P57626|RS18_BUCAI 30S ribosomal protein S18 >gi|25294830|pir||E84995 30S ribosomal protein S18 [imported] - Buchnera sp. (strain APS) >gi|10039219|dbj|BAB13253.1| 30S ribosomal protein S18 [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (75 aa)
Score = 136, Expect = 3.9e-07, Identities = 30/65 (46%), Positives = 47/65 (72%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G + +DYKD+ +L  Y+T + KI   +IT   +K+Q ++S AIKRAR +AL+P+
  S:     6 RRRKFCRFTAEGVQEIDYKDIAVLKNYITESGKIVPSRITGTRAKYQRQLSRAIKRARYLALLPY 70
>gi|94263201|ref|ZP_01287018.1| Ribosomal protein S18 [delta proteobacterium MLMS-1] >gi|94270367|ref|ZP_01291725.1| Ribosomal protein S18 [delta proteobacterium MLMS-1] >gi|93450833|gb|EAT01866.1| Ribosomal protein S18 [delta proteobacterium MLMS-1] >gi|93456419|gb|EAT06539.1| Ribosomal protein S18 [delta proteobacterium MLMS-1] (78 aa)
Score = 136, Expect = 4.1e-07, Identities = 28/64 (43%), Positives = 42/64 (65%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           R+K C+ CA     +DYKD++ L  +LT   KI  R+I   C++HQ ++  AIKRAR +AL+P+
  S:     9 RRKVCRFCADKSLVIDYKDIKNLRGFLTERGKIIPRRIYGNCARHQRQLCEAIKRARQIALLPY 72
>gi|110835050|ref|YP_693909.1| 30S ribosomal protein S18 [Alcanivorax borkumensis SK2] >gi|123149283|sp|Q0VMG1|RS18_ALCBS 30S ribosomal protein S18 >gi|110648161|emb|CAL17637.1| 30S ribosomal protein S18 [Alcanivorax borkumensis SK2] >gi|196193309|gb|EDX88268.1| ribosomal protein S18 [Alcanivorax sp. DG881] (76 aa)
Score = 136, Expect = 4.2e-07, Identities = 28/65 (43%), Positives = 48/65 (73%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G E++DYKD++ L  Y+T   KI   +IT   +++Q ++++AIK+AR +AL+P+
  S:     6 RRRKFCRFTAEGVEYIDYKDLDTLKAYITETGKIVPSRITGTKARYQRQLASAIKQARFLALLPY 70
>gi|153855507|ref|ZP_01996626.1| hypothetical protein DORLON_02640 [Dorea longicatena DSM 13814] >gi|149752029|gb|EDM61960.1| hypothetical protein DORLON_02640 [Dorea longicatena DSM 13814] (88 aa)
Score = 136, Expect = 4.2e-07, Identities = 30/63 (47%), Positives = 41/63 (65%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C  C K    +DYKD   L KY++   KI  R+IT  C+KHQ  ++ AIKRAR +AL+P+V+D
  S:    26 CVFCGKENNEIDYKDTAKLRKYISERGKILPRRITGNCAKHQRALTVAIKRARHIALMPYVQD 88
>gi|114568043|ref|YP_755197.1| ribosomal protein S18 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338978|gb|ABI69826.1| SSU ribosomal protein S18P [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (74 aa)
Score = 136, Expect = 4.3e-07, Identities = 29/63 (46%), Positives = 42/63 (66%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C  CA   E VDYK++  L +Y+T   KI  R+IT  C+ HQ +++ AIKRARI+AL+P+  +
  S:    12 CNWCADKIEVVDYKEIPRLRRYITERGKILPRRITGNCAHHQRQLTVAIKRARIMALLPYTSE 74
>gi|21231018|ref|NP_636935.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|58582038|ref|YP_201054.1| 30S ribosomal protein S18 [Xanthomonas oryzae pv. oryzae KACC10331] >gi|66768977|ref|YP_243739.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris str. 8004] >gi|84623950|ref|YP_451322.1| 30S ribosomal protein S18 [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|166711573|ref|ZP_02242780.1| 30S ribosomal protein S18 [Xanthomonas oryzae pv. oryzicola BLS256] >gi|188576349|ref|YP_001913278.1| ribosomal protein S18 [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188992091|ref|YP_001904101.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris] >gi|75508188|sp|Q5H052|RS18_XANOR 30S ribosomal protein S18 >gi|81305059|sp|Q4UTA4|RS18_XANC8 30S ribosomal protein S18 >gi|123739106|sp|Q2P329|RS18_XANOM 30S ribosomal protein S18 >gi|23822129|sp|Q8PAC1|RS18_XANCP 30S ribosomal protein S18 >gi|21112642|gb|AAM40859.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|58426632|gb|AAW75669.1| 30S ribosomal protein S18 [Xanthomonas oryzae pv. oryzae KACC10331] >gi|66574309|gb|AAY49719.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris str. 8004] >gi|84367890|dbj|BAE69048.1| 30S ribosomal protein S18 [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|167733851|emb|CAP52057.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris] >gi|188520801|gb|ACD58746.1| ribosomal protein S18 [Xanthomonas oryzae pv. oryzae PXO99A] (76 aa)
Score = 136, Expect = 4.3e-07, Identities = 31/65 (47%), Positives = 47/65 (72%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFCK  A+G + +DYKD+  L +YLT N KI   ++T   SK+Q +++ A+KR+R +ALIP+
  S:     6 RRRKFCKFTAEGVKEIDYKDLNTLRQYLTENGKIVPSRVTGTKSKYQRQLATAVKRSRFLALIPY 70
>gi|153810611|ref|ZP_01963279.1| hypothetical protein RUMOBE_00992 [Ruminococcus obeum ATCC 29174] >gi|149833790|gb|EDM88871.1| hypothetical protein RUMOBE_00992 [Ruminococcus obeum ATCC 29174] (87 aa)
Score = 136, Expect = 4.4e-07, Identities = 28/63 (44%), Positives = 42/63 (66%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C  C K    +DYKDV  L KY++   KI  R+IT  C+KHQ  ++ A+KRAR ++++P+V+D
  S:    25 CVFCGKENNEIDYKDVAKLRKYVSERGKILPRRITGNCAKHQRALTVAVKRARHLSMMPYVQD 87
>gi|104773266|ref|YP_618246.1| 30S ribosomal protein S18 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|123252027|sp|Q1GC35|RS18_LACDA 30S ribosomal protein S18 >gi|103422347|emb|CAI96855.1| 30S ribosomal protein S18 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (78 aa)
Score = 136, Expect = 4.5e-07, Identities = 28/61 (45%), Positives = 43/61 (70%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   ++VDYKDV+LL  +++   KI  R +T   +K+Q +V+NAIKRARI+ L+PFV +
  S:    17 IAANHIDYVDYKDVDLLKHFISERGKILPRSVTGTSAKNQRKVANAIKRARIMGLLPFVAE 77
>gi|78043292|ref|YP_358909.1| 30S ribosomal protein S18 [Carboxydothermus hydrogenoformans Z-2901] >gi|77995407|gb|ABB14306.1| ribosomal protein S18 [Carboxydothermus hydrogenoformans Z-2901] (76 aa)
Score = 135, Expect = 4.9e-07, Identities = 33/65 (50%), Positives = 44/65 (67%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           R+K+ C  C      VDYKDV  L KY+T   KI  R+I+  C++HQ R++ AIKRARI+AL+PF
  S:     9 RKKRVCAFCVDKIVDVDYKDVNRLKKYITERGKILPRRISGNCARHQRRLTTAIKRARIMALLPF 73
>gi|150020533|ref|YP_001305887.1| ribosomal protein S18 [Thermosipho melanesiensis BI429] >gi|166222253|sp|A6LKQ1|RS18_THEM4 30S ribosomal protein S18 >gi|149793054|gb|ABR30502.1| ribosomal protein S18 [Thermosipho melanesiensis BI429] (75 aa)
Score = 135, Expect = 5.0e-07, Identities = 34/70 (48%), Positives = 50/70 (71%)
  Q:    84 KQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVR 153
           ++ ++ K CKLC    ++VDYKDV+LL ++LT   KI  R++T  C+KHQ  V  AIKRAR +AL+P+V+
  S:     5 RRKKKPKVCKLCQSKIDYVDYKDVKLLREFLTEKEKIIPRRVTGNCAKHQRMVKIAIKRARQMALLPYVK 74
>gi|160931686|ref|ZP_02079080.1| hypothetical protein CLOLEP_00517 [Clostridium leptum DSM 753] >gi|156869331|gb|EDO62703.1| hypothetical protein CLOLEP_00517 [Clostridium leptum DSM 753] (86 aa)
Score = 135, Expect = 5.3e-07, Identities = 28/63 (44%), Positives = 40/63 (63%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C  C    E +DYKDV  L +Y++   KI  R++T  C++HQ  ++ AIKRAR +AL+PF  D
  S:    24 CGFCVDKVESIDYKDVARLRRYISERAKILPRRVTGTCARHQRELTVAIKRARHLALLPFSSD 86
>gi|73748806|ref|YP_308045.1| 30S ribosomal protein S18 [Dehalococcoides sp. CBDB1] >gi|147669567|ref|YP_001214385.1| 30S ribosomal protein S18 [Dehalococcoides sp. BAV1] >gi|73660522|emb|CAI83129.1| ribosomal protein S18 [Dehalococcoides sp. CBDB1] >gi|146270515|gb|ABQ17507.1| SSU ribosomal protein S18P [Dehalococcoides sp. BAV1] (147 aa)
Score = 135, Expect = 5.7e-07, Identities = 35/85 (41%), Positives = 52/85 (61%)
  Q:    70 QDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           QDRP  +  RG   +   ++K C  CA+    +DYKD   L +Y++   KI  R+ T  C++HQ  ++NAIKRAR +AL+PFV +
  S:     4 QDRP-NRPARGGRGRYTPKRKICSFCAEKVSRIDYKDSAKLARYISDRGKIEPRRRTGTCARHQRALANAIKRARFIALMPFVSE 87
>gi|189425664|ref|YP_001952841.1| ribosomal protein S18 [Geobacter lovleyi SZ] >gi|189421923|gb|ACD96321.1| ribosomal protein S18 [Geobacter lovleyi SZ] (110 aa)
Score = 135, Expect = 5.9e-07, Identities = 29/65 (44%), Positives = 42/65 (64%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +R+K C+ CA+    +DYKD   L  ++T   KI  R+I+  CSKHQ  ++ AIKRAR +AL+P 
  S:    39 QRRKVCRFCAEKDTTIDYKDPRTLRYFITERGKIVPRRISGNCSKHQREITEAIKRARNLALLPL 103
>gi|15618861|ref|NP_225147.1| 30S ribosomal protein S18 [Chlamydophila pneumoniae CWL029] >gi|15836485|ref|NP_301009.1| 30S ribosomal protein S18 [Chlamydophila pneumoniae J138] >gi|16752078|ref|NP_445444.1| 30S ribosomal protein S18 [Chlamydophila pneumoniae AR39] >gi|33242320|ref|NP_877261.1| 30S ribosomal protein S18 [Chlamydophila pneumoniae TW-183] >gi|6707742|sp|Q9Z6V4|RS18_CHLPN 30S ribosomal protein S18 >gi|4377277|gb|AAD19090.1| S18 Ribosomal Protein [Chlamydophila pneumoniae CWL029] >gi|7189819|gb|AAF38692.1| ribosomal protein S18 [Chlamydophila pneumoniae AR39] >gi|8979326|dbj|BAA99160.1| S18 ribosomal protein [Chlamydophila pneumoniae J138] >gi|33236831|gb|AAP98918.1| 30S ribosomal protein S18 [Chlamydophila pneumoniae TW-183] (82 aa)
Score = 135, Expect = 5.9e-07, Identities = 35/75 (46%), Positives = 49/75 (65%)
  Q:    78 NRGYPNKQGRRKKFCKLC---AKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           N+   N + RRK+F K C   + G + +DYKDVE L K++T   K+  R+IT   S+ Q  +S AIKRAR + L+PFV
  S:     2 NKPVHNNEHRRKRFNKKCPFVSAGWKTIDYKDVETLKKFITERGKVLPRRITGVSSRFQGVLSQAIKRARHLGLLPFV 79
>gi|154498399|ref|ZP_02036777.1| hypothetical protein BACCAP_02388 [Bacteroides capillosus ATCC 29799] >gi|150272467|gb|EDM99652.1| hypothetical protein BACCAP_02388 [Bacteroides capillosus ATCC 29799] (79 aa)
Score = 135, Expect = 6.1e-07, Identities = 29/65 (44%), Positives = 41/65 (63%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           K C  C    EH+DYKD   L ++L+   KI  R+ T  C+ HQ +++ AIKRAR +AL+P+V D
  S:    15 KVCTFCVDKVEHIDYKDAVKLRRFLSERSKILPRRTTGTCAMHQRQLTEAIKRARQIALLPYVTD 79
>gi|28199811|ref|NP_780125.1| 30S ribosomal protein S18 [Xylella fastidiosa Temecula1] >gi|71275195|ref|ZP_00651482.1| Ribosomal protein S18 [Xylella fastidiosa Dixon] >gi|71898275|ref|ZP_00680449.1| Ribosomal protein S18 [Xylella fastidiosa Ann-1] >gi|71899833|ref|ZP_00681983.1| Ribosomal protein S18 [Xylella fastidiosa Ann-1] >gi|170731186|ref|YP_001776619.1| 30S ribosomal protein S18 [Xylella fastidiosa M12] >gi|182682563|ref|YP_001830723.1| ribosomal protein S18 [Xylella fastidiosa M23] >gi|32129999|sp|Q87A84|RS18_XYLFT 30S ribosomal protein S18 >gi|28057932|gb|AAO29774.1| 30S ribosomal protein S18 [Xylella fastidiosa Temecula1] >gi|71164004|gb|EAO13719.1| Ribosomal protein S18 [Xylella fastidiosa Dixon] >gi|71730424|gb|EAO32505.1| Ribosomal protein S18 [Xylella fastidiosa Ann-1] >gi|71732014|gb|EAO34071.1| Ribosomal protein S18 [Xylella fastidiosa Ann-1] >gi|167965979|gb|ACA12989.1| 30S ribosomal protein S18 [Xylella fastidiosa M12] >gi|182632673|gb|ACB93449.1| ribosomal protein S18 [Xylella fastidiosa M23] (76 aa)
Score = 134, Expect = 6.7e-07, Identities = 30/65 (46%), Positives = 46/65 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFCK  A+G + +DYKD+  L +YLT N +I   ++T   SK+Q +++ A+K AR +ALIP+
  S:     6 RRRKFCKFTAEGIKEIDYKDLNTLRQYLTENGRIVPSRVTGTKSKYQRQLTTAVKLARFLALIPY 70
>gi|152977671|ref|YP_001377188.1| 30S ribosomal protein S18 [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189029666|sp|A7GVN5|RS18_BACCN 30S ribosomal protein S18 >gi|152026423|gb|ABS24193.1| ribosomal protein S18 [Bacillus cereus subsp. cytotoxis NVH 391-98] (77 aa)
Score = 134, Expect = 6.8e-07, Identities = 30/73 (41%), Positives = 49/73 (67%)
  Q:    80 GYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           G    + +R+K C   A G  H+DYKDV+LL ++++   KI  R++T   +K+Q +++ AIKRAR +AL+P+V
  S:     3 GRKGGRAKRRKVCFFTANGITHIDYKDVDLLKRFVSERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLPYV 75
>gi|149182312|ref|ZP_01860791.1| RpsR [Bacillus sp. SG-1] >gi|148850004|gb|EDL64175.1| RpsR [Bacillus sp. SG-1] (65 aa)
Score = 133, Expect = 8.2e-07, Identities = 28/61 (45%), Positives = 43/61 (70%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           C   + G  H+DYKDV+LL K+++   KI  R++T   +K+Q R++ AIKRAR +AL+P+V
  S:     2 CYFTSNGITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRRLTRAIKRARTMALLPYV 62
>gi|156741510|ref|YP_001431639.1| ribosomal protein S18 [Roseiflexus castenholzii DSM 13941] >gi|156232838|gb|ABU57621.1| ribosomal protein S18 [Roseiflexus castenholzii DSM 13941] (90 aa)
Score = 133, Expect = 9.1e-07, Identities = 31/67 (46%), Positives = 43/67 (64%)
  Q:    86 GRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           G R+K C  CA     VDYKDV+ L + ++   KI  R+ T  C++HQ  ++ AIKRAR +AL+PFV
  S:    18 GARRKVCAFCADKIRVVDYKDVKRLQRCMSERGKILPRRRTGVCARHQRSLTVAIKRARHMALLPFV 84
>gi|30248220|ref|NP_840290.1| 30S ribosomal protein S18 [Nitrosomonas europaea ATCC 19718] >gi|30180105|emb|CAD84107.1| Ribosomal protein S18 [Nitrosomonas europaea ATCC 19718] (92 aa)
Score = 133, Expect = 9.9e-07, Identities = 27/65 (41%), Positives = 48/65 (73%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +RKKFC+  A+G +H+DYKD++LL  +++ N +I   +IT   + +Q +++ AI+RAR +AL+P+
  S:    24 KRKKFCRFTAEGIKHIDYKDIDLLKDFVSENGRIIPARITGTRAYYQRQLNLAIERARFLALLPY 88
>gi|162455220|ref|YP_001617587.1| hypothetical protein sce6938 [Sorangium cellulosum 'So ce 56'] >gi|161165802|emb|CAN97107.1| rpsR [Sorangium cellulosum 'So ce 56'] (106 aa)
Score = 133, Expect = 1.0e-06, Identities = 31/81 (38%), Positives = 50/81 (61%)
  Q:    71 DRPFAKYNRGYPNKQGRR----KKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           DR F +      +  GRR    K+ C+ CA     +DYKD + L  +++   K+  R+I+  C++HQ +V+ +IKRAR +AL+PF
  S:    18 DRDFGRTPDLNADAPGRRRTGRKRVCRYCADKALVIDYKDPQALKYFISERGKVVPRRISGNCARHQRKVTLSIKRARNIALLPF 102
>gi|161506643|ref|YP_001576591.1| 30S ribosomal protein S18 [Lactobacillus helveticus DPC 4571] >gi|172048334|sp|A8YW49|RS18_LACH4 30S ribosomal protein S18 >gi|160347632|gb|ABX26306.1| 30S ribosomal protein S18 [Lactobacillus helveticus DPC 4571] (77 aa)
Score = 133, Expect = 1.0e-06, Identities = 28/61 (45%), Positives = 45/61 (73%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   ++VDYKDV+LL ++++   KI  R++T   +K+Q +V+NAIKRARI+ L+PFV +
  S:    16 IAANHIDYVDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKVANAIKRARIMGLLPFVAE 76
>gi|83589003|ref|YP_429012.1| 30S ribosomal protein S18 [Moorella thermoacetica ATCC 39073] >gi|83571917|gb|ABC18469.1| SSU ribosomal protein S18P [Moorella thermoacetica ATCC 39073] (75 aa)
Score = 133, Expect = 1.0e-06, Identities = 27/63 (42%), Positives = 40/63 (63%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C  C    E VDYKDV  L +Y++   KI  R+I+  C+ HQ +++ AIKRAR +AL+P+  +
  S:    13 CSFCVDKIEQVDYKDVNRLRRYISERGKILPRRISGNCAHHQRQLTRAIKRARALALLPYTAE 75
>gi|78224039|ref|YP_385786.1| 30S ribosomal protein S18 [Geobacter metallireducens GS-15] >gi|123742790|sp|Q39RR3|RS18_GEOMG 30S ribosomal protein S18 >gi|78195294|gb|ABB33061.1| SSU ribosomal protein S18P [Geobacter metallireducens GS-15] (106 aa)
Score = 133, Expect = 1.0e-06, Identities = 35/96 (36%), Positives = 53/96 (55%)
  Q:    55 KETKKSSDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIP 150
           +ET    +  +     +RP  + N     +  +R+K C+ CA     +DYKD  +L  ++T   KI  R+I+  CSKHQ  ++ AIKRAR +ALIP
  S:     3 EETTVRPERTERSERPERPQYRGNGPRKRRPFQRRKVCRFCADKDLVIDYKDPRVLRSFITERGKIVPRRISGNCSKHQREITEAIKRARNIALIP 98
>gi|54778771|gb|AAV39605.1| ribosomal protein S18 [synthetic construct] (102 aa)
Score = 132, Expect = 1.1e-06, Identities = 28/65 (43%), Positives = 46/65 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G + +DYKD+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR ++L+P+
  S:    30 RRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPY 94
>gi|158319096|ref|YP_001511603.1| ribosomal protein S18 [Alkaliphilus oremlandii OhILAs] >gi|158139295|gb|ABW17607.1| ribosomal protein S18 [Alkaliphilus oremlandii OhILAs] (78 aa)
Score = 132, Expect = 1.1e-06, Identities = 28/63 (44%), Positives = 41/63 (65%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C  CA   +++DYKDV  L KY+T   KI  R+I+  C+ HQ  ++ AIKR+R +AL+P+  D
  S:    16 CVFCADKSKNIDYKDVHKLKKYITERGKILPRRISGNCAIHQRELTQAIKRSRHIALLPYTMD 78
>gi|118587178|ref|ZP_01544606.1| ribosomal protein S18 [Oenococcus oeni ATCC BAA-1163] >gi|118432320|gb|EAV39058.1| ribosomal protein S18 [Oenococcus oeni ATCC BAA-1163] (106 aa)
Score = 132, Expect = 1.2e-06, Identities = 29/53 (54%), Positives = 41/53 (77%)
  Q:   100 EHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           ++VDYKD ELL +++  N KI  R+IT   SK+Q +++ AIKRARI+AL+PFV
  S:    51 DYVDYKDTELLQRFIADNGKILPRRITGTSSKNQRKIATAIKRARIMALLPFV 103
>gi|18311622|ref|NP_563556.1| 30S ribosomal protein S18 [Clostridium perfringens str. 13] >gi|110801194|ref|YP_697330.1| 30S ribosomal protein S18 [Clostridium perfringens ATCC 13124] >gi|110801451|ref|YP_699889.1| 30S ribosomal protein S18 [Clostridium perfringens SM101] >gi|168207913|ref|ZP_02633918.1| ribosomal protein S18 [Clostridium perfringens E str. JGS1987] >gi|168211574|ref|ZP_02637199.1| ribosomal protein S18 [Clostridium perfringens B str. ATCC 3626] >gi|168214826|ref|ZP_02640451.1| ribosomal protein S18 [Clostridium perfringens CPE str. F4969] >gi|168218034|ref|ZP_02643659.1| ribosomal protein S18 [Clostridium perfringens NCTC 8239] >gi|169343454|ref|ZP_02864454.1| ribosomal protein S18 [Clostridium perfringens C str. JGS1495] >gi|182626399|ref|ZP_02954152.1| ribosomal protein S18 [Clostridium perfringens D str. JGS1721] >gi|122958625|sp|Q0TM10|RS18_CLOP1 30S ribosomal protein S18 >gi|123341463|sp|Q0SPR8|RS18_CLOPS 30S ribosomal protein S18 >gi|20978678|sp|Q8XH45|RS18_CLOPE 30S ribosomal protein S18 >gi|18146306|dbj|BAB82346.1| 30S ribosomal protein S18 [Clostridium perfringens str. 13] >gi|110675841|gb|ABG84828.1| ribosomal protein S18 [Clostridium perfringens ATCC 13124] >gi|110681952|gb|ABG85322.1| ribosomal protein S18 [Clostridium perfringens SM101] >gi|169298406|gb|EDS80495.1| ribosomal protein S18 [Clostridium perfringens C str. JGS1495] >gi|170660796|gb|EDT13479.1| ribosomal protein S18 [Clostridium perfringens E str. JGS1987] >gi|170710455|gb|EDT22637.1| ribosomal protein S18 [Clostridium perfringens B str. ATCC 3626] >gi|170713723|gb|EDT25905.1| ribosomal protein S18 [Clostridium perfringens CPE str. F4969] >gi|177908273|gb|EDT70826.1| ribosomal protein S18 [Clostridium perfringens D str. JGS1721] >gi|182379953|gb|EDT77432.1| ribosomal protein S18 [Clostridium perfringens NCTC 8239] (80 aa)
Score = 132, Expect = 1.2e-06, Identities = 32/67 (47%), Positives = 45/67 (67%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RKK C  C    E +DYKDV  L KY+T   KI  R+I+  C+KHQ ++++AIKR+R +AL+PF  +
  S:    14 RKKVCIFCVDKAESIDYKDVAKLKKYITERGKILPRRISGTCAKHQRQLTDAIKRSRNIALLPFTTE 80
>gi|50364897|ref|YP_053322.1| 30S ribosomal protein S18 [Mesoplasma florum L1] >gi|59798695|sp|Q6F235|RS18_MESFL 30S ribosomal protein S18 >gi|50363453|gb|AAT75438.1| 30S ribosomal protein S18 [Mesoplasma florum L1] (76 aa)
Score = 132, Expect = 1.2e-06, Identities = 28/54 (51%), Positives = 41/54 (75%)
  Q:   101 HVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           ++DYKDVELL K+++ N +I  R+IT    KHQ +++ AIKRAR +AL+P+V D
  S:    23 YIDYKDVELLKKFISGNGQILPRRITGTSPKHQRQLAVAIKRARQMALLPYVID 76
>gi|182416746|ref|ZP_02948143.1| ribosomal protein S18 [Clostridium butyricum 5521] >gi|182379403|gb|EDT76898.1| ribosomal protein S18 [Clostridium butyricum 5521] (85 aa)
Score = 132, Expect = 1.4e-06, Identities = 31/67 (46%), Positives = 43/67 (64%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RKK C  C    E +DYKD+  L KY+T   KI  R+I+  C+KHQ  ++ +IKRAR +AL+PF  +
  S:    19 RKKVCAFCVDKAEFIDYKDINKLRKYVTERGKILPRRISGTCAKHQRELTTSIKRARNIALLPFTTE 85
>gi|147679225|ref|YP_001213440.1| 30S ribosomal protein S18 [Pelotomaculum thermopropionicum SI] >gi|146275322|dbj|BAF61071.1| ribosomal protein S18 [Pelotomaculum thermopropionicum SI] (76 aa)
Score = 132, Expect = 1.4e-06, Identities = 35/71 (49%), Positives = 48/71 (67%)
  Q:    84 KQGRR--KKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           ++GRR  K+ C  C    E VDYKDV+ L KY+T   KI  R+I+  C+KHQ  ++ AIKRAR +AL+PF  +
  S:     4 EKGRRGKKRICNFCVDKAEVVDYKDVQRLKKYITERGKILPRRISGNCAKHQRLLTTAIKRARNIALLPFTAE 76
>gi|70727625|ref|YP_254541.1| 30S ribosomal protein S18 [Staphylococcus haemolyticus JCSC1435] >gi|123762271|sp|Q4L342|RS18_STAHJ 30S ribosomal protein S18 >gi|68448351|dbj|BAE05935.1| 30S ribosomal protein S18 [Staphylococcus haemolyticus JCSC1435] (80 aa)
Score = 131, Expect = 1.4e-06, Identities = 30/66 (45%), Positives = 45/66 (68%)
  Q:    89 KKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           KK C   A G  H+DYKD ELL ++++   KI  R++T   +K+Q  ++ AIKRAR +AL+P+V+D
  S:    13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMALLPYVKD 78
>gi|110638978|ref|YP_679187.1| 30S ribosomal protein S18 [Cytophaga hutchinsonii ATCC 33406] >gi|110281659|gb|ABG59845.1| SSU ribosomal protein S18P [Cytophaga hutchinsonii ATCC 33406] (83 aa)
Score = 131, Expect = 1.4e-06, Identities = 29/72 (40%), Positives = 45/72 (62%)
  Q:    83 NKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           N+   RKK+C+    G  ++DYKD   L K++    KI  R++T    K+Q +VS A+KRAR++ L+P+V D
  S:     9 NRVENRKKYCRFKKMGIFYIDYKDPNFLLKFVNEQGKILPRRLTGTSLKYQRKVSQAVKRARLIGLLPYVTD 80
>gi|56477753|ref|YP_159342.1| 30S ribosomal protein S18 [Azoarcus sp. EbN1] >gi|56313796|emb|CAI08441.1| 30S Ribosomal protein S18 [Azoarcus sp. EbN1] (91 aa)
Score = 131, Expect = 1.4e-06, Identities = 29/65 (44%), Positives = 46/65 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +R+KFC+  A+  E VDYKDV++L  ++T N KI   +IT   + +Q ++S A+KRAR +AL+P+
  S:    22 KRRKFCRFTAEKIEEVDYKDVDILKDFVTENSKIMPARITGTKAGYQRQLSTAVKRARFLALLPY 86
>gi|58336363|ref|YP_192948.1| 30S ribosomal protein S18 [Lactobacillus acidophilus NCFM] >gi|75507681|sp|Q5FN07|RS18_LACAC 30S ribosomal protein S18 >gi|58253680|gb|AAV41917.1| 30S Ribosomal protein S18 [Lactobacillus acidophilus NCFM] (78 aa)
Score = 131, Expect = 1.5e-06, Identities = 28/61 (45%), Positives = 45/61 (73%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   ++VDYKDV+LL ++++   KI  R++T   +K+Q +V+NAIKRARI+ L+PFV +
  S:    17 IAANHIDYVDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKVANAIKRARIMGLLPFVAE 77
>gi|15639055|ref|NP_218501.1| 30S ribosomal protein S18 [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025295|ref|YP_001933067.1| ribosomal protein S18 [Treponema pallidum subsp. pallidum SS14] >gi|6094164|sp|O83100|RS18_TREPA 30S ribosomal protein S18 >gi|3322319|gb|AAC65056.1| ribosomal protein S18 (rpsR) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189017870|gb|ACD70488.1| ribosomal protein S18 [Treponema pallidum subsp. pallidum SS14] (99 aa)
Score = 131, Expect = 1.5e-06, Identities = 33/70 (47%), Positives = 47/70 (67%)
  Q:    83 NKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           N+Q  RKK C+ C + +   DYKD + L +++T   KI  R+IT  C+KHQ RV+  +KR+R VAL+PFV
  S:    28 NRQFYRKKVCRFCTQ-KLLADYKDPDTLRRFITERGKILPRRITGTCAKHQRRVALEVKRSRAVALLPFV 96
>gi|115378659|ref|ZP_01465809.1| ribosomal protein S18 [Stigmatella aurantiaca DW4/3-1] >gi|115364325|gb|EAU63410.1| ribosomal protein S18 [Stigmatella aurantiaca DW4/3-1] (146 aa)
Score = 131, Expect = 1.6e-06, Identities = 30/64 (46%), Positives = 42/64 (65%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RKK C+ CA+    VD+KD   L  ++T   KI  R+I+  C+KHQ  V+ AIKRAR +AL+P+
  S:    78 RKKVCRFCAEKNAKVDFKDQATLKYFVTERGKIIPRRISGNCAKHQREVAIAIKRARGLALLPY 141
>gi|11467693|ref|NP_050745.1| ribosomal protein S18 [Guillardia theta] >gi|6094134|sp|O78488|RR18_GUITH Chloroplast 30S ribosomal protein S18 >gi|3603018|gb|AAC35679.1| ribosomal protein S18 [Guillardia theta] (73 aa)
Score = 131, Expect = 1.7e-06, Identities = 29/56 (51%), Positives = 41/56 (73%)
  Q:    97 KGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           K  + +DYKDVELL K+LT   KI  R+IT    K Q+R++ A+KRARI++L+PF+
  S:    12 KKDDFIDYKDVELLSKFLTEQGKILPRRITGLTMKQQSRLTKAVKRARILSLLPFI 67
>gi|51246448|ref|YP_066332.1| 30S ribosomal protein S18 [Desulfotalea psychrophila LSv54] >gi|59798684|sp|Q6AK01|RS18_DESPS 30S ribosomal protein S18 >gi|50877485|emb|CAG37325.1| probable 30S ribosomal protein S18 [Desulfotalea psychrophila LSv54] (81 aa)
Score = 131, Expect = 1.7e-06, Identities = 27/64 (42%), Positives = 43/64 (67%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RKK C+ CA  +  +DYKDV++L  +++   KI  R+I   C+ HQ ++  A+KRAR +AL+P+
  S:    12 RKKVCRFCADKELVIDYKDVKVLRNFVSERGKIIPRRIVGTCASHQRQLCEAVKRARQIALLPY 75
>gi|52841821|ref|YP_095620.1| 30S ribosomal protein S18 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|54294365|ref|YP_126780.1| 30S ribosomal protein S18 [Legionella pneumophila str. Lens] >gi|54297504|ref|YP_123873.1| 30S ribosomal protein S18 [Legionella pneumophila str. Paris] >gi|148359128|ref|YP_001250335.1| 30S ribosomal protein S18 [Legionella pneumophila str. Corby] >gi|81679230|sp|Q5WWL9|RS18_LEGPL 30S ribosomal protein S18 >gi|81679473|sp|Q5X4X1|RS18_LEGPA 30S ribosomal protein S18 >gi|81680465|sp|Q5ZV49|RS18_LEGPH 30S ribosomal protein S18 >gi|166220957|sp|A5IC89|RS18_LEGPC 30S ribosomal protein S18 >gi|52628932|gb|AAU27673.1| 30S ribosomal protein S18 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|53751289|emb|CAH12700.1| 30S ribosomal subunit protein S18 [Legionella pneumophila str. Paris] >gi|53754197|emb|CAH15674.1| 30S ribosomal subunit protein S18 [Legionella pneumophila str. Lens] >gi|148280901|gb|ABQ54989.1| 30S ribosomal protein S18 [Legionella pneumophila str. Corby] (75 aa)
Score = 131, Expect = 1.8e-06, Identities = 27/65 (41%), Positives = 41/65 (63%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RRKK C+  A+G   +DYKD+ LL  Y+T   KI   +IT   ++ Q +++ AIK AR + L+P+
  S:     6 RRKKMCRFSAEGGNEIDYKDINLLKNYITETGKIVPSRITGTQTRFQRQLAKAIKHARFIGLLPY 70
>gi|71906857|ref|YP_284444.1| SSU ribosomal protein S18P [Dechloromonas aromatica RCB] >gi|71846478|gb|AAZ45974.1| SSU ribosomal protein S18P [Dechloromonas aromatica RCB] (91 aa)
Score = 130, Expect = 1.8e-06, Identities = 26/65 (40%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +R+KFC+  A+  E +DYKDV++L +++  N KI   ++T   + +Q ++  AIKRAR +AL+P+
  S:    22 KRRKFCRFTAEKVEQIDYKDVDVLKEFIQENAKIMPARLTGTKAGYQRQLGTAIKRARFMALLPY 86
>gi|119776194|ref|YP_928934.1| 30S ribosomal protein S18 [Shewanella amazonensis SB2B] >gi|166222237|sp|A1SA58|RS18_SHEAM 30S ribosomal protein S18 >gi|119768694|gb|ABM01265.1| ribosomal protein S18 [Shewanella amazonensis SB2B] (75 aa)
Score = 130, Expect = 1.9e-06, Identities = 28/65 (43%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G   +DYKD+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR ++L+P+
  S:     6 RRRKFCRFTAEGVAEIDYKDIATLKNYITESGKIVPSRITGTSAKYQRQLARAIKRARYLSLLPY 70
>gi|163815607|ref|ZP_02206980.1| hypothetical protein COPEUT_01782 [Coprococcus eutactus ATCC 27759] >gi|158449244|gb|EDP26239.1| hypothetical protein COPEUT_01782 [Coprococcus eutactus ATCC 27759] (87 aa)
Score = 130, Expect = 1.9e-06, Identities = 28/63 (44%), Positives = 43/63 (68%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C+ CA  +  +DYKD   L KY++   KI  R+IT  C+KHQ  ++ A+KRAR +A++P+V+D
  S:    25 CEYCANKEAVIDYKDSNALRKYISERGKILPRRITGTCAKHQRAITIAVKRARQIAVLPYVQD 87
>gi|89897780|ref|YP_521267.1| 30S ribosomal protein S18 [Desulfitobacterium hafniense Y51] >gi|109647906|ref|ZP_01371809.1| ribosomal protein S18 [Desulfitobacterium hafniense DCB-2] >gi|89337228|dbj|BAE86823.1| 30S ribosomal protein S18 [Desulfitobacterium hafniense Y51] >gi|109640996|gb|EAT50551.1| ribosomal protein S18 [Desulfitobacterium hafniense DCB-2] (76 aa)
Score = 130, Expect = 1.9e-06, Identities = 28/61 (45%), Positives = 40/61 (65%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           C  C    E +DYKD   + KY+T   KI  R+I+  C+KHQ +V+ AIKRAR +AL+P++
  S:    14 CSFCVDKVESIDYKDTHKIRKYITERGKILPRRISGNCAKHQRQVTVAIKRARHIALLPYI 74
>gi|15896953|ref|NP_350302.1| 30S ribosomal protein S18 [Clostridium acetobutylicum ATCC 824] >gi|20978716|sp|Q97CX4|RS18_CLOAB 30S ribosomal protein S18 >gi|15026828|gb|AAK81642.1|AE007867_9 Ribosomal protein S18 [Clostridium acetobutylicum ATCC 824] (90 aa)
Score = 130, Expect = 1.9e-06, Identities = 30/67 (44%), Positives = 44/67 (65%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           ++K C  C +  E +DYKD+  L KY+T   KI  R+I+  C+KHQ  ++ AIKRAR +AL+PF  +
  S:    24 KRKICSFCMEKSESIDYKDINKLRKYVTERGKILPRRISGNCAKHQRELTIAIKRARNIALLPFTTE 90
>gi|187932713|ref|YP_001887719.1| ribosomal protein S18 [Clostridium botulinum B str. Eklund 17B] >gi|188587867|ref|YP_001922702.1| ribosomal protein S18 [Clostridium botulinum E3 str. Alaska E43] >gi|187720866|gb|ACD22087.1| ribosomal protein S18 [Clostridium botulinum B str. Eklund 17B] >gi|188498148|gb|ACD51284.1| ribosomal protein S18 [Clostridium botulinum E3 str. Alaska E43] (83 aa)
Score = 130, Expect = 1.9e-06, Identities = 29/67 (43%), Positives = 45/67 (67%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           ++K C  C    + +DYKD+  L KY+T   KI  R+I+  C+KHQ ++++AIKRAR +AL+PF  +
  S:    17 KRKVCAFCVDKADSIDYKDINKLRKYVTERGKILPRRISGTCAKHQRQLTDAIKRARNIALLPFTTE 83
>gi|69246714|ref|ZP_00604082.1| Ribosomal protein S18 [Enterococcus faecium DO] >gi|68195128|gb|EAN09587.1| Ribosomal protein S18 [Enterococcus faecium DO] (78 aa)
Score = 130, Expect = 2.0e-06, Identities = 26/61 (42%), Positives = 44/61 (72%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   E++DYKD+ELL ++++   KI  R++T   +K+Q +++ AIKRARI+ L+PFV +
  S:    17 IAANHIEYIDYKDIELLKRFISERGKILPRRVTGTGAKNQRKITVAIKRARIMGLLPFVSE 77
>gi|24375416|ref|NP_719459.1| 30S ribosomal protein S18 [Shewanella oneidensis MR-1] >gi|113971590|ref|YP_735383.1| 30S ribosomal protein S18 [Shewanella sp. MR-4] >gi|114046198|ref|YP_736748.1| 30S ribosomal protein S18 [Shewanella sp. MR-7] >gi|117919155|ref|YP_868347.1| 30S ribosomal protein S18 [Shewanella sp. ANA-3] >gi|120600212|ref|YP_964786.1| 30S ribosomal protein S18 [Shewanella sp. W3-18-1] >gi|124550559|ref|ZP_01708070.1| ribosomal protein S18 [Shewanella putrefaciens 200] >gi|126175836|ref|YP_001051985.1| ribosomal protein S18 [Shewanella baltica OS155] >gi|146291860|ref|YP_001182284.1| 30S ribosomal protein S18 [Shewanella putrefaciens CN-32] >gi|149115223|ref|ZP_01841969.1| ribosomal protein S18 [Shewanella baltica OS223] >gi|152999252|ref|YP_001364933.1| 30S ribosomal protein S18 [Shewanella baltica OS185] >gi|160873865|ref|YP_001553181.1| 30S ribosomal protein S18 [Shewanella baltica OS195] >gi|122943538|sp|Q0HF41|RS18_SHESM 30S ribosomal protein S18 >gi|123030904|sp|Q0HYW4|RS18_SHESR 30S ribosomal protein S18 >gi|166222238|sp|A3D8Q3|RS18_SHEB5 30S ribosomal protein S18 >gi|166222239|sp|A6WJ81|RS18_SHEB8 30S ribosomal protein S18 >gi|166222241|sp|A4Y3F2|RS18_SHEPC 30S ribosomal protein S18 >gi|166222242|sp|A0KT22|RS18_SHESA 30S ribosomal protein S18 >gi|166222243|sp|A1RNI7|RS18_SHESW 30S ribosomal protein S18 >gi|189029687|sp|A9L122|RS18_SHEB9 30S ribosomal protein S18 >gi|59798905|sp|Q8EAH4|RS18_SHEON 30S ribosomal protein S18 >gi|24350257|gb|AAN56903.1|AE015825_2 ribosomal protein S18 [Shewanella oneidensis MR-1] >gi|113886274|gb|ABI40326.1| ribosomal protein S18 [Shewanella sp. MR-4] >gi|113887640|gb|ABI41691.1| ribosomal protein S18 [Shewanella sp. MR-7] >gi|117611487|gb|ABK46941.1| ribosomal protein S18 [Shewanella sp. ANA-3] >gi|120560305|gb|ABM26232.1| ribosomal protein S18 [Shewanella sp. W3-18-1] >gi|124507442|gb|EAY51592.1| ribosomal protein S18 [Shewanella putrefaciens 200] >gi|125999041|gb|ABN63116.1| ribosomal protein S18 [Shewanella baltica OS155] >gi|145563550|gb|ABP74485.1| ribosomal protein S18 [Shewanella putrefaciens CN-32] >gi|146865036|gb|EDK50395.1| ribosomal protein S18 [Shewanella baltica OS223] >gi|151363870|gb|ABS06870.1| ribosomal protein S18 [Shewanella baltica OS185] >gi|160859387|gb|ABX47921.1| ribosomal protein S18 [Shewanella baltica OS195] (75 aa)
Score = 130, Expect = 2.0e-06, Identities = 28/65 (43%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G   +DYKD+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR ++L+P+
  S:     6 RRRKFCRFTAEGVAEIDYKDIVTLKNYITESGKIVPSRITGTSAKYQRQLARAIKRARYLSLLPY 70
>gi|119713694|gb|ABL97744.1| ribosomal protein S18 [uncultured marine bacterium EB0_41B09] (75 aa)
Score = 130, Expect = 2.0e-06, Identities = 27/65 (41%), Positives = 46/65 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +R+++C+  A+G   VDYKDV +L  ++T N K+   +IT   +++Q ++S A+KRAR +AL+PF
  S:     7 KRRRYCRFSAEGISEVDYKDVSILKDFITENGKLIPARITGTKARYQRQLSTAVKRARFLALLPF 71
>gi|153956490|ref|YP_001397255.1| 30S ribosomal protein S18 [Clostridium kluyveri DSM 555] >gi|189029673|sp|A5N438|RS18_CLOK5 30S ribosomal protein S18 >gi|146349348|gb|EDK35884.1| RpsR [Clostridium kluyveri DSM 555] (84 aa)
Score = 130, Expect = 2.0e-06, Identities = 30/67 (44%), Positives = 43/67 (64%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           ++K C  C    E +DYKD+  L KY+T   KI  R+I+  C+KHQ  ++ AIKRAR +AL+PF  +
  S:    18 KRKVCAFCMDKSEFIDYKDINKLRKYVTERGKILPRRISGNCAKHQRELTRAIKRARNIALLPFTTE 84
>gi|57234187|ref|YP_181760.1| 30S ribosomal protein S18 [Dehalococcoides ethenogenes 195] >gi|57224635|gb|AAW39692.1| ribosomal protein S18 [Dehalococcoides ethenogenes 195] (147 aa)
Score = 130, Expect = 2.1e-06, Identities = 34/85 (40%), Positives = 52/85 (61%)
  Q:    70 QDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           Q+RP  +  RG   +   ++K C  CA+    +DYKD   L +Y++   KI  R+ T  C++HQ  ++NAIKRAR +AL+PFV +
  S:     4 QERP-NRPARGGRGRYTPKRKICSFCAEKVSRIDYKDSAKLARYISDRGKIEPRRRTGTCARHQRALANAIKRARFIALMPFVSE 87
>gi|52082634|ref|YP_081425.1| 30S ribosomal protein S18 [Bacillus licheniformis ATCC 14580] >gi|52788033|ref|YP_093862.1| 30S ribosomal protein S18 [Bacillus licheniformis ATCC 14580] >gi|81690794|sp|Q65CP5|RS18_BACLD 30S ribosomal protein S18 >gi|52005845|gb|AAU25787.1| ribosomal protein S18 [Bacillus licheniformis ATCC 14580] >gi|52350535|gb|AAU43169.1| RpsR [Bacillus licheniformis DSM 13] (79 aa)
Score = 130, Expect = 2.2e-06, Identities = 27/61 (44%), Positives = 43/61 (70%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           C   + G  H+DYKDV+LL K+++   KI  R++T   +K+Q +++ AIKRAR +AL+P+V
  S:    16 CYFTSNGITHIDYKDVDLLRKFISERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLPYV 76
>gi|152990910|ref|YP_001356632.1| 30S ribosomal protein S18 [Nitratiruptor sp. SB155-2] >gi|166220964|sp|A6Q466|RS18_NITSB 30S ribosomal protein S18 >gi|151422771|dbj|BAF70275.1| 30S ribosomal protein S18 [Nitratiruptor sp. SB155-2] (91 aa)
Score = 130, Expect = 2.3e-06, Identities = 31/71 (43%), Positives = 44/71 (61%)
  Q:    84 KQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           K+  +K+ CK C +    +DYKD+EL+   L+   KI  R++T  C KHQ  V  AIKRAR  AL+P++ D
  S:     4 KRRFKKRTCKYCEQKVTFIDYKDIELIKHSLSERYKIMPRRLTGNCKKHQVMVEEAIKRARHAALVPYIVD 74
>gi|118594784|ref|ZP_01552131.1| 30S ribosomal protein S18 [Methylophilales bacterium HTCC2181] >gi|118440562|gb|EAV47189.1| 30S ribosomal protein S18 [Methylophilales bacterium HTCC2181] (75 aa)
Score = 130, Expect = 2.3e-06, Identities = 27/65 (41%), Positives = 47/65 (72%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +R+++C+  A+G + VDYKD++LL  ++T N K+   +IT   SK+Q ++  A+KRAR +AL+P+
  S:     7 KRRRYCRFSAEGIKEVDYKDIDLLKDFITENGKLIPARITGTKSKYQRQLGTAVKRARFLALLPY 71
>gi|77361356|ref|YP_340931.1| 30S ribosomal subunit protein S18 [Pseudoalteromonas haloplanktis TAC125] >gi|123588590|sp|Q3II81|RS18_PSEHT 30S ribosomal protein S18 >gi|76876267|emb|CAI87489.1| 30S ribosomal subunit protein S18 [Pseudoalteromonas haloplanktis TAC125] (75 aa)
Score = 130, Expect = 2.3e-06, Identities = 29/65 (44%), Positives = 46/65 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G + +DYKD+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR +AL+P+
  S:     6 RRRKFCRFKAEGVQQIDYKDLATLRNYVTESGKIVPSRITGTSAKYQRQLATAIKRARYLALLPY 70
>gi|116490138|ref|YP_809667.1| SSU ribosomal protein S18P [Oenococcus oeni PSU-1] >gi|122277671|sp|Q04HQ5|RS18_OENOB 30S ribosomal protein S18 >gi|116090863|gb|ABJ56017.1| SSU ribosomal protein S18P [Oenococcus oeni PSU-1] (106 aa)
Score = 129, Expect = 2.3e-06, Identities = 29/53 (54%), Positives = 41/53 (77%)
  Q:   100 EHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           ++VDYKD ELL +++  N KI  R+IT   SK+Q +++ AIKRARI+AL+PFV
  S:    51 DYVDYKDTELLQRFIADNGKILPRRITGTSSKNQRKIATAIKRARIMALLPFV 103
>gi|56965862|ref|YP_177596.1| 30S ribosomal protein S18 [Bacillus clausii KSM-K16] >gi|59798604|sp|Q5WAH5|RS18_BACSK 30S ribosomal protein S18 >gi|56912108|dbj|BAD66636.1| 30S ribosomal protein S18 [Bacillus clausii KSM-K16] (77 aa)
Score = 129, Expect = 2.4e-06, Identities = 30/68 (44%), Positives = 47/68 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +R+K C   A    H+DYKDV+LL ++++   KI  R++T   +K+Q +++ AIKRAR VAL+P+V D
  S:     8 KRRKVCFFTANKITHIDYKDVDLLKRFISERGKILPRRVTGTSAKYQRKLTVAIKRARQVALLPYVND 75
>gi|116515284|ref|YP_802913.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Cc (Cinara cedri)] >gi|122285320|sp|Q056X9|RS18_BUCCC 30S ribosomal protein S18 >gi|116257138|gb|ABJ90820.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Cc (Cinara cedri)] (75 aa)
Score = 129, Expect = 2.4e-06, Identities = 29/65 (44%), Positives = 44/65 (67%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G + +DYKD+ +L  Y+T N KI   +IT   +K+Q ++S AIK AR +  IP+
  S:     6 RRRKFCRFTAEGIKKIDYKDIMILKNYITENGKIVPSRITGTKAKYQRQLSRAIKIARFLGFIPY 70
>gi|169351670|ref|ZP_02868608.1| hypothetical protein CLOSPI_02451 [Clostridium spiroforme DSM 1552] >gi|169291892|gb|EDS74025.1| hypothetical protein CLOSPI_02451 [Clostridium spiroforme DSM 1552] (76 aa)
Score = 129, Expect = 2.6e-06, Identities = 30/67 (44%), Positives = 45/67 (67%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RKK C        ++DYKDVELL ++++ N KI  R++T   +K+Q  ++ AIKRAR +AL+P+V D
  S:    10 RKKVCYFTKNNITYIDYKDVELLKRFVSANGKIIPRRVTGTSAKYQRMLATAIKRARQMALLPYVGD 76
>gi|164686462|ref|ZP_02210490.1| hypothetical protein CLOBAR_00027 [Clostridium bartlettii DSM 16795] >gi|164604473|gb|EDQ97938.1| hypothetical protein CLOBAR_00027 [Clostridium bartlettii DSM 16795] (75 aa)
Score = 129, Expect = 2.7e-06, Identities = 28/63 (44%), Positives = 41/63 (65%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C+ CA     +DYK+ + L KY+T   KI  R+I+  C+KHQ  ++ AIKRAR +AL+P+  D
  S:    13 CQFCASKDARIDYKNTQRLQKYITERGKILPRRISGTCAKHQRELTVAIKRARNLALLPYTLD 75
>gi|152992022|ref|YP_001357743.1| 30S ribosomal protein S18 [Sulfurovum sp. NBC37-1] >gi|166222250|sp|A6Q7C7|RS18_SULNB 30S ribosomal protein S18 >gi|151423883|dbj|BAF71386.1| 30S ribosomal protein S18 [Sulfurovum sp. NBC37-1] (87 aa)
Score = 129, Expect = 2.9e-06, Identities = 30/67 (44%), Positives = 43/67 (64%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +K+FCK C +  + +DYKD+  L   L+   KI  R++T  C +HQ  V+ AIKRAR  ALIP++ D
  S:     8 KKRFCKYCEQKVDFIDYKDLNSLKFSLSERFKIMPRRLTGNCKRHQEMVTVAIKRARQTALIPYIVD 74
>gi|50085516|ref|YP_047026.1| 30S ribosomal protein S18 [Acinetobacter sp. ADP1] >gi|59798698|sp|Q6F9Q9|RS18_ACIAD 30S ribosomal protein S18 >gi|49531492|emb|CAG69204.1| 30S ribosomal protein S18 [Acinetobacter sp. ADP1] (75 aa)
Score = 128, Expect = 3.0e-06, Identities = 28/65 (43%), Positives = 47/65 (72%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+   ++DYKD++ L +Y+T N KI   +IT   +++Q +++ AIK+AR +ALIP+
  S:     6 RRRKFCRFTAENVAYIDYKDIDTLKQYITENGKIVPSRITGTKARYQRQLALAIKQARYLALIPY 70
>gi|124009489|ref|ZP_01694165.1| ribosomal protein S18 [Microscilla marina ATCC 23134] >gi|123984938|gb|EAY24901.1| ribosomal protein S18 [Microscilla marina ATCC 23134] (83 aa)
Score = 128, Expect = 3.1e-06, Identities = 30/67 (44%), Positives = 44/67 (65%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RKK+C+    G +++DYKD   L K++    KI  R+IT    K+Q +VS A+KRAR +AL+P+V D
  S:    14 RKKYCRFKKNGIKYIDYKDPNFLLKFVNDQGKILPRRITGTSLKYQRKVSQAVKRARHLALLPYVTD 80
>gi|148269458|ref|YP_001243918.1| ribosomal protein S18 [Thermotoga petrophila RKU-1] >gi|166222254|sp|A5IJG9|RS18_THEP1 30S ribosomal protein S18 >gi|147735002|gb|ABQ46342.1| SSU ribosomal protein S18P [Thermotoga petrophila RKU-1] (75 aa)
Score = 128, Expect = 3.1e-06, Identities = 28/60 (46%), Positives = 40/60 (66%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVR 153
           LC    ++VDYKD  LL ++LT   KI  +++T  CSKHQ  V  AIKRAR + L+P+++
  S:    15 LCEMELDYVDYKDTRLLSEFLTDKGKIIPKRLTGNCSKHQRMVKVAIKRARQMGLLPYLK 74
>gi|167766039|ref|ZP_02438092.1| hypothetical protein CLOSS21_00532 [Clostridium sp. SS2/1] >gi|167712119|gb|EDS22698.1| hypothetical protein CLOSS21_00532 [Clostridium sp. SS2/1] (84 aa)
Score = 128, Expect = 3.1e-06, Identities = 30/62 (48%), Positives = 40/62 (64%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K C  C +    +DYKDV  L KY++   KI  R+IT  C+KHQ  V+ AIKRAR +AL+P+
  S:    20 KVCAFCTEADAVIDYKDVATLKKYVSERGKILPRRITGTCAKHQRAVTGAIKRARHLALMPY 81
>gi|167948932|ref|ZP_02536006.1| 30S ribosomal protein S18 [Endoriftia persephone 'Hot96_1+Hot96_2'] (74 aa)
Score = 128, Expect = 3.2e-06, Identities = 29/65 (44%), Positives = 46/65 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RRKK+C+  A+G   +DYKD+ LL  Y++ + KI   +IT   +K+Q +++ AIKRAR +AL+P+
  S:     6 RRKKYCRFTAEGITDIDYKDLNLLKAYVSESGKIVPSRITGTKAKYQRQLATAIKRARYLALLPY 70
>gi|91783365|ref|YP_558571.1| 30S ribosomal protein S18 [Burkholderia xenovorans LB400] >gi|123168536|sp|Q13ZH0|RS18_BURXL 30S ribosomal protein S18 >gi|91687319|gb|ABE30519.1| SSU ribosomal protein S18P [Burkholderia xenovorans LB400] (91 aa)
Score = 128, Expect = 3.3e-06, Identities = 34/83 (40%), Positives = 50/83 (60%)
  Q:    69 PQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           P  + F K  R   N   +RKKFC+  A G +H+DYKD+E L  ++  N KI   ++T   S +Q ++  AIKRAR +AL+P+
  S:     4 PTGKKFDK-RRQQQNPLFKRKKFCRFTAAGVDHIDYKDLETLKDFIGENGKITPARLTGTKSHYQRQLDTAIKRARFLALVPY 85
>gi|158425931|ref|YP_001527223.1| ribosomal protein S18 [Azorhizobium caulinodans ORS 571] >gi|158332820|dbj|BAF90305.1| ribosomal protein S18 [Azorhizobium caulinodans ORS 571] (85 aa)
Score = 128, Expect = 3.3e-06, Identities = 29/66 (43%), Positives = 39/66 (59%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKDV LL +Y++   KI   +IT   +K Q  +S AIKRAR + L+PFV
  S:    18 RRRKTCPFSGPNAPKIDYKDVRLLQRYISERGKIVPSRITAVSAKKQRELSAAIKRARFLGLLPFV 83
>gi|91775681|ref|YP_545437.1| 30S ribosomal protein S18 [Methylobacillus flagellatus KT] >gi|123078871|sp|Q1H1P1|RS18_METFK 30S ribosomal protein S18 >gi|91709668|gb|ABE49596.1| SSU ribosomal protein S18P [Methylobacillus flagellatus KT] (75 aa)
Score = 128, Expect = 3.3e-06, Identities = 27/65 (41%), Positives = 47/65 (72%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +R+++C+  A+G + VDYKDV+LL  ++  N KI   +IT   +K+Q +++ A+KRAR +AL+P+
  S:     7 KRRRYCRFSAEGIKQVDYKDVDLLKDFINENGKIIPARITGTKAKYQRQLTTAVKRARFLALLPY 71
>gi|55821724|ref|YP_140166.1| 30S ribosomal protein S18 [Streptococcus thermophilus LMG 18311] >gi|55823644|ref|YP_142085.1| 30S ribosomal protein S18 [Streptococcus thermophilus CNRZ1066] >gi|116628444|ref|YP_821063.1| 30S ribosomal protein S18 [Streptococcus thermophilus LMD-9] >gi|81676514|sp|Q5LY50|RS18_STRT1 30S ribosomal protein S18 >gi|81676666|sp|Q5M2Q5|RS18_STRT2 30S ribosomal protein S18 >gi|122266961|sp|Q03IV5|RS18_STRTD 30S ribosomal protein S18 >gi|55737709|gb|AAV61351.1| 30S ribosomal protein S18 [Streptococcus thermophilus LMG 18311] >gi|55739629|gb|AAV63270.1| 30S ribosomal protein S18 [Streptococcus thermophilus CNRZ1066] >gi|116101721|gb|ABJ66867.1| SSU ribosomal protein S18P [Streptococcus thermophilus LMD-9] (79 aa)
Score = 128, Expect = 3.3e-06, Identities = 32/68 (47%), Positives = 49/68 (72%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RRKKF  + A   E+VDYKD ELL ++++   KI  R++T   +K+Q +V+ AIKRAR++AL+P+V +
  S:    11 RRKKFDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTAIKRARVMALMPYVNE 78
>gi|33863012|ref|NP_894572.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9313] >gi|124023182|ref|YP_001017489.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9303] >gi|166220972|sp|A2C9R4|RS18_PROM3 30S ribosomal protein S18 >gi|59798838|sp|Q7TUZ8|RS18_PROMM 30S ribosomal protein S18 >gi|33634929|emb|CAE20915.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9313] >gi|123963468|gb|ABM78224.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9303] (73 aa)
Score = 128, Expect = 3.4e-06, Identities = 28/51 (54%), Positives = 39/51 (76%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKDV+LL K++T   KI  R++T   SK Q  ++NA+KRARI+AL+PFV
  S:    19 IDYKDVDLLKKFITDRGKILPRRLTGLTSKQQRDLTNAVKRARIIALLPFV 69
>gi|32491010|ref|NP_871264.1| hypothetical protein WGLp261 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|31340412|sp|Q8D2U3|RS18_WIGBR 30S ribosomal protein S18 >gi|25166216|dbj|BAC24407.1| rpsR [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (75 aa)
Score = 128, Expect = 3.4e-06, Identities = 27/65 (41%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+   +   ++DYKD+ LL  Y+T N KI   +IT   +++Q ++S A+KRAR ++L+P+
  S:     6 RRRKFCRFTLEKINNIDYKDIILLKNYITENGKIVPSRITGTRARYQRQLSRAVKRARYLSLLPY 70
>gi|119502819|ref|ZP_01624904.1| 30S ribosomal protein S18 [marine gamma proteobacterium HTCC2080] >gi|119461165|gb|EAW42255.1| 30S ribosomal protein S18 [marine gamma proteobacterium HTCC2080] (75 aa)
Score = 128, Expect = 3.4e-06, Identities = 30/65 (46%), Positives = 47/65 (72%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFCK  A+G + +DYKD+E L +Y+T   KI   +IT   +K+Q +++ A+KRAR +AL+P+
  S:     6 RRRKFCKFTAEGVKEIDYKDLETLKQYITETGKIVPSRITGTKAKYQRQLATAVKRARFLALLPY 70
>gi|157373898|ref|YP_001472498.1| ribosomal protein S18 [Shewanella sediminis HAW-EB3] >gi|157963398|ref|YP_001503432.1| ribosomal protein S18 [Shewanella pealeana ATCC 700345] >gi|163749305|ref|ZP_02156554.1| ribosomal protein S18 [Shewanella benthica KT99] >gi|167625579|ref|YP_001675873.1| ribosomal protein S18 [Shewanella halifaxensis HAW-EB4] >gi|170728535|ref|YP_001762561.1| ribosomal protein S18 [Shewanella woodyi ATCC 51908] >gi|189029688|sp|B0TUU7|RS18_SHEHH 30S ribosomal protein S18 >gi|189029689|sp|A8H8L0|RS18_SHEPA 30S ribosomal protein S18 >gi|189029690|sp|A8FR97|RS18_SHESH 30S ribosomal protein S18 >gi|157316272|gb|ABV35370.1| ribosomal protein S18 [Shewanella sediminis HAW-EB3] >gi|157848398|gb|ABV88897.1| ribosomal protein S18 [Shewanella pealeana ATCC 700345] >gi|161331024|gb|EDQ01950.1| ribosomal protein S18 [Shewanella benthica KT99] >gi|167355601|gb|ABZ78214.1| ribosomal protein S18 [Shewanella halifaxensis HAW-EB4] >gi|169813882|gb|ACA88466.1| ribosomal protein S18 [Shewanella woodyi ATCC 51908] (75 aa)
Score = 128, Expect = 3.5e-06, Identities = 28/65 (43%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G   +DYKD+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR ++L+P+
  S:     6 RRRKFCRFTAEGVTEIDYKDIVTLKNYITESGKIVPSRITGTNAKYQRQLARAIKRARYLSLLPY 70
>gi|163790927|ref|ZP_02185350.1| 30S ribosomal protein S18 [Carnobacterium sp. AT7] >gi|159873769|gb|EDP67850.1| 30S ribosomal protein S18 [Carnobacterium sp. AT7] (79 aa)
Score = 128, Expect = 3.5e-06, Identities = 30/68 (44%), Positives = 47/68 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +R+K     A   EHVDYKDV+LL ++++   +I  R++T   +K+Q +++ AIKRARI+ L+PFV D
  S:    10 KRRKVDFFAANHIEHVDYKDVDLLKRFISERGRILPRRVTGTYAKNQRKLTKAIKRARIMGLLPFVTD 77
>gi|121997453|ref|YP_001002240.1| ribosomal protein S18 [Halorhodospira halophila SL1] >gi|166220954|sp|A1WUS6|RS18_HALHL 30S ribosomal protein S18 >gi|121588858|gb|ABM61438.1| SSU ribosomal protein S18P [Halorhodospira halophila SL1] (74 aa)
Score = 128, Expect = 3.6e-06, Identities = 28/65 (43%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+K+CK  A+G + +DYKD+  L  Y+T   KI   +IT   +++Q +++ AIKRAR +AL+P+
  S:     6 RRRKYCKFTAEGVKEIDYKDLNTLKNYITDTGKIVPSRITGTSARYQRQLARAIKRARYLALLPY 70
>gi|127514210|ref|YP_001095407.1| ribosomal protein S18 [Shewanella loihica PV-4] >gi|166222240|sp|A3QI50|RS18_SHELP 30S ribosomal protein S18 >gi|126639505|gb|ABO25148.1| ribosomal protein S18 [Shewanella loihica PV-4] (75 aa)
Score = 128, Expect = 3.6e-06, Identities = 28/65 (43%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G   +DYKD+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR ++L+P+
  S:     6 RRRKFCRFTAEGVTEIDYKDIATLKNYITESGKIVPSRITGTNAKYQRQLARAIKRARYLSLLPY 70
>gi|83319872|ref|YP_424024.1| 30S ribosomal protein S18 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|123726538|sp|Q2ST89|RS18_MYCCT 30S ribosomal protein S18 >gi|83283758|gb|ABC01690.1| 30S ribosomal protein S18 [Mycoplasma capricolum subsp. capricolum ATCC 27343] (75 aa)
Score = 128, Expect = 3.8e-06, Identities = 27/53 (50%), Positives = 41/53 (77%)
  Q:   100 EHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +++DYKDVELL K+++PN +I  R+IT    K Q +++ AIKRAR +AL+P+V
  S:    21 KYIDYKDVELLKKFISPNGQILPRRITGTSLKDQRQLALAIKRARQMALLPYV 73
>gi|119471281|ref|ZP_01613784.1| 30S ribosomal subunit protein S18 [Alteromonadales bacterium TW-7] >gi|119445747|gb|EAW27030.1| 30S ribosomal subunit protein S18 [Alteromonadales bacterium TW-7] (75 aa)
Score = 128, Expect = 3.8e-06, Identities = 29/65 (44%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G + +DYKD+  L  Y+T + KI   +IT   +K Q +++ AIKRAR +AL+P+
  S:     6 RRRKFCRFKAEGVQQIDYKDLATLRNYVTESGKIVPSRITGTSAKFQRQLATAIKRARYLALLPY 70
>gi|189501828|ref|YP_001957545.1| hypothetical protein Aasi_0398 [Candidatus Amoebophilus asiaticus 5a2] >gi|189497269|gb|ACE05816.1| hypothetical protein Aasi_0398 [Candidatus Amoebophilus asiaticus 5a2] (83 aa)
Score = 128, Expect = 3.8e-06, Identities = 28/67 (41%), Positives = 47/67 (70%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +KK+C+    G ++VDYK+++ L+++L    KI  R+I+    K+Q +V+ AIKRAR +AL+P+V D
  S:    14 KKKYCRFKKLGIKYVDYKNLDFLFRFLNEQGKILPRRISGNSLKYQKKVAQAIKRARHLALLPYVTD 80
>gi|42560585|ref|NP_975036.1| 30S ribosomal protein S18 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|167925658|ref|ZP_02512749.1| 30S ribosomal protein S18 [Mycoplasma mycoides subsp. mycoides LC str. GM12] >gi|59798739|sp|Q6MUK6|RS18_MYCMS 30S ribosomal protein S18 >gi|42492081|emb|CAE76678.1| 30S ribosomal protein S18 [Mycoplasma mycoides subsp. mycoides SC str. PG1] (75 aa)
Score = 127, Expect = 4.0e-06, Identities = 26/53 (49%), Positives = 41/53 (77%)
  Q:   100 EHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +++DYKD+ELL K+++PN +I  R+IT    K Q +++ AIKRAR +AL+P+V
  S:    21 KYIDYKDIELLKKFISPNGQILPRRITGTSPKDQRQLALAIKRARQMALLPYV 73
>gi|91791881|ref|YP_561532.1| 30S ribosomal protein S18 [Shewanella denitrificans OS217] >gi|123166502|sp|Q12RW7|RS18_SHEDO 30S ribosomal protein S18 >gi|91713883|gb|ABE53809.1| ribosomal protein S18 [Shewanella denitrificans OS217] (75 aa)
Score = 127, Expect = 4.0e-06, Identities = 27/65 (41%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  ++G   +DYKD+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR ++L+P+
  S:     6 RRRKFCRFTSEGVAEIDYKDIVTLKNYITESGKIVPSRITGTSAKYQRQLARAIKRARYLSLLPY 70
>gi|119509768|ref|ZP_01628913.1| 30S ribosomal protein S18 [Nodularia spumigena CCY9414] >gi|119465634|gb|EAW46526.1| 30S ribosomal protein S18 [Nodularia spumigena CCY9414] (71 aa)
Score = 127, Expect = 4.3e-06, Identities = 30/51 (58%), Positives = 37/51 (72%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKDV+LL KY+T   KI  R+IT    K Q  ++ AIKRARIVAL+PFV
  S:    17 IDYKDVDLLRKYITERGKILPRRITGLTCKQQRDLTLAIKRARIVALLPFV 67
>gi|146319486|ref|YP_001199198.1| 30S ribosomal protein S18 [Streptococcus suis 05ZYH33] >gi|146321678|ref|YP_001201389.1| 30S ribosomal protein S18 [Streptococcus suis 98HAH33] >gi|166222247|sp|A4W3Q0|RS18_STRS2 30S ribosomal protein S18 >gi|166222249|sp|A4VXF9|RS18_STRSY 30S ribosomal protein S18 >gi|145690292|gb|ABP90798.1| 30S ribosomal protein S18 [Streptococcus suis 05ZYH33] >gi|145692484|gb|ABP92989.1| 30S ribosomal protein S18 [Streptococcus suis 98HAH33] (79 aa)
Score = 127, Expect = 4.4e-06, Identities = 32/68 (47%), Positives = 48/68 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RRKK   + A   E+VDYKD ELL ++++   KI  R++T   +K+Q +V+ AIKRAR++AL+PFV +
  S:    11 RRKKVDYIAANKIEYVDYKDTELLSRFISERGKILPRRVTGTSAKNQRKVTTAIKRARVMALLPFVNE 78
>gi|15834432|ref|NP_313205.1| 30S ribosomal protein S18 [Escherichia coli O157:H7 str. Sakai] >gi|16132024|ref|NP_418623.1| 30S ribosomal subunit protein S18 [Escherichia coli str. K-12 substr. MG1655] >gi|16763210|ref|NP_458827.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|24115555|ref|NP_710065.1| 30S ribosomal protein S18 [Shigella flexneri 2a str. 301] >gi|26251099|ref|NP_757139.1| 30S ribosomal protein S18 [Escherichia coli CFT073] >gi|29144689|ref|NP_808031.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|30065573|ref|NP_839744.1| 30S ribosomal protein S18 [Shigella flexneri 2a str. 2457T] >gi|37528390|ref|NP_931735.1| 30S ribosomal protein S18 [Photorhabdus luminescens subsp. laumondii TTO1] >gi|56416184|ref|YP_153259.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62182837|ref|YP_219254.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|74314683|ref|YP_313102.1| 30S ribosomal protein S18 [Shigella sonnei Ss046] >gi|82546556|ref|YP_410503.1| 30S ribosomal protein S18 [Shigella boydii Sb227] >gi|82779400|ref|YP_405749.1| 30S ribosomal protein S18 [Shigella dysenteriae Sd197] >gi|89110922|ref|AP_004702.1| 30S ribosomal subunit protein S18 [Escherichia coli W3110] >gi|91213751|ref|YP_543737.1| 30S ribosomal protein S18 [Escherichia coli UTI89] >gi|110644559|ref|YP_672289.1| 30S ribosomal protein S18 [Escherichia coli 536] >gi|110808116|ref|YP_691636.1| 30S ribosomal protein S18 [Shigella flexneri 5 str. 8401] >gi|146310038|ref|YP_001175112.1| 30S ribosomal protein S18 [Enterobacter sp. 638] >gi|152973068|ref|YP_001338214.1| 30S ribosomal protein S18 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|156932423|ref|YP_001436339.1| 30S ribosomal protein S18 [Enterobacter sakazakii ATCC BAA-894] >gi|157147826|ref|YP_001455145.1| 30S ribosomal protein S18 [Citrobacter koseri ATCC BAA-895] >gi|157158640|ref|YP_001465702.1| 30S ribosomal protein S18 [Escherichia coli E24377A] >gi|157163667|ref|YP_001460985.1| 30S ribosomal protein S18 [Escherichia coli HS] >gi|161505105|ref|YP_001572217.1| 30S ribosomal protein S18 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|161617665|ref|YP_001591630.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|168219637|ref|ZP_02644869.1| ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168226761|ref|ZP_02651992.1| ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168263253|ref|ZP_02685226.1| ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168464722|ref|ZP_02698625.1| ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168474035|ref|ZP_02703058.1| ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168707517|ref|ZP_02739794.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4045] >gi|168718612|ref|ZP_02750889.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4206] >gi|168736515|ref|ZP_02768792.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4115] >gi|168751446|ref|ZP_02776468.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4113] >gi|168754774|ref|ZP_02779781.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4401] >gi|168760445|ref|ZP_02785452.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4501] >gi|168766482|ref|ZP_02791489.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4486] >gi|168774085|ref|ZP_02799092.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4196] >gi|168780635|ref|ZP_02805642.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4076] >gi|168784840|ref|ZP_02809847.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC869] >gi|168792168|ref|ZP_02817175.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4042] >gi|168801858|ref|ZP_02826865.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC508] >gi|170021788|ref|YP_001726742.1| ribosomal protein S18 [Escherichia coli ATCC 8739] >gi|170083647|ref|YP_001732967.1| 30S ribosomal subunit protein S18 [Escherichia coli str. K12 substr. DH10B] >gi|170680020|ref|YP_001746596.1| ribosomal protein S18 [Escherichia coli SMS-3-5] >gi|170766627|ref|ZP_02901080.1| ribosomal protein S18 [Escherichia albertii TW07627] >gi|183600324|ref|ZP_02961817.1| hypothetical protein PROSTU_03885 [Providencia stuartii ATCC 25827] >gi|187732798|ref|YP_001882891.1| ribosomal protein S18 [Shigella boydii CDC 3083-94] >gi|188495594|ref|ZP_03002864.1| ribosomal protein S18 [Escherichia coli 53638] >gi|188535071|ref|YP_001908868.1| 30S ribosomal protein S18 [Erwinia tasmaniensis] >gi|191165620|ref|ZP_03027460.1| ribosomal protein S18 [Escherichia coli B7A] >gi|191170703|ref|ZP_03032255.1| ribosomal protein S18 [Escherichia coli F11] >gi|193065998|ref|ZP_03047056.1| ribosomal protein S18 [Escherichia coli E22] >gi|193070855|ref|ZP_03051787.1| ribosomal protein S18 [Escherichia coli E110019] >gi|194426593|ref|ZP_03059147.1| ribosomal protein S18 [Escherichia coli B171] >gi|194434584|ref|ZP_03066841.1| ribosomal protein S18 [Shigella dysenteriae 1012] >gi|194439537|ref|ZP_03071611.1| ribosomal protein S18 [Escherichia coli 101-1] >gi|194446807|ref|YP_002043646.1| ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194449942|ref|YP_002048435.1| ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194472416|ref|ZP_03078400.1| ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194734283|ref|YP_002117333.1| ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195935992|ref|ZP_03081374.1| 30S ribosomal protein S18 [Escherichia coli O157:H7 str. EC4024] >gi|67472372|sp|P0A7T7|RS18_ECOLI 30S ribosomal protein S18 >gi|75505387|sp|Q57GI9|RS18_SALCH 30S ribosomal protein S18 >gi|81677980|sp|Q5PJ56|RS18_SALPA 30S ribosomal protein S18 >gi|123047658|sp|Q0SX84|RS18_SHIF8 30S ribosomal protein S18 >gi|123084302|sp|Q1R358|RS18_ECOUT 30S ribosomal protein S18 >gi|123343273|sp|Q0T9J1|RS18_ECOL5 30S ribosomal protein S18 >gi|123728279|sp|Q31TD3|RS18_SHIBS 30S ribosomal protein S18 >gi|123728458|sp|Q328J7|RS18_SHIDS 30S ribosomal protein S18 >gi|123759489|sp|Q3YUE5|RS18_SHISS 30S ribosomal protein S18 >gi|166220942|sp|A8AMJ6|RS18_CITK8 30S ribosomal protein S18 >gi|166220951|sp|A7MM78|RS18_ENTS8 30S ribosomal protein S18 >gi|166220955|sp|A6THB3|RS18_KLEP7 30S ribosomal protein S18 >gi|167011188|sp|A7ZV73|RS18_ECO24 30S ribosomal protein S18 >gi|167011189|sp|A8A7U8|RS18_ECOHS 30S ribosomal protein S18 >gi|167011190|sp|A4W5T1|RS18_ENT38 30S ribosomal protein S18 >gi|189029651|sp|A9N520|RS18_SALPB 30S ribosomal protein S18 >gi|189029677|sp|B1IT04|RS18_ECOLC 30S ribosomal protein S18 >gi|189029686|sp|A9MFK9|RS18_SALAR 30S ribosomal protein S18 >gi|67472373|sp|P0A7T8|RS18_ECOL6 30S ribosomal protein S18 >gi|67472374|sp|P0A7T9|RS18_ECO57 30S ribosomal protein S18 >gi|67472375|sp|P0A7U0|RS18_PHOLL 30S ribosomal protein S18 >gi|67472376|sp|P0A7U1|RS18_SALTI 30S ribosomal protein S18 >gi|67472377|sp|P0A7U2|RS18_SHIFL 30S ribosomal protein S18 >gi|25294828|pir||AI1052 30s ribosomal chain protein S18 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|116666565|pdb|1VS5|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|116666617|pdb|1VS7|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|26111531|gb|AAN83713.1|AE016771_224 30S ribosomal protein S18 [Escherichia coli CFT073] >gi|42847|emb|CAA27654.1| unnamed protein product [Escherichia coli] >gi|537043|gb|AAA97098.1| 30S ribosomal subunit protein S18 [Escherichia coli] >gi|1790646|gb|AAC77159.1| 30S ribosomal subunit protein S18 [Escherichia coli str. K-12 substr. MG1655] >gi|13364655|dbj|BAB38601.1| 30S ribosomal subunit protein S18 [Escherichia coli O157:H7 str. Sakai] >gi|16505518|emb|CAD06870.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp. enterica serovar Typhi] >gi|24054886|gb|AAN45772.1| 30S ribosomal subunit protein S18 [Shigella flexneri 2a str. 301] >gi|29140328|gb|AAO71891.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|30043837|gb|AAP19556.1| 30S ribosomal subunit protein S18 [Shigella flexneri 2a str. 2457T] >gi|36787828|emb|CAE16943.1| 30S ribosomal protein S18 [Photorhabdus luminescens subsp. laumondii TTO1] >gi|56130441|gb|AAV79947.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62130470|gb|AAX68173.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|73858160|gb|AAZ90867.1| 30S ribosomal subunit protein S18 [Shigella sonnei Ss046] >gi|81243548|gb|ABB64258.1| 30S ribosomal subunit protein S18 [Shigella dysenteriae Sd197] >gi|81247967|gb|ABB68675.1| 30S ribosomal subunit protein S18 [Shigella boydii Sb227] >gi|85676953|dbj|BAE78203.1| 30S ribosomal subunit protein S18 [Escherichia coli W3110] >gi|91075325|gb|ABE10206.1| 30S ribosomal subunit protein S18 [Escherichia coli UTI89] >gi|110346151|gb|ABG72388.1| 30S ribosomal protein S18 [Escherichia coli 536] >gi|110617664|gb|ABF06331.1| 30S ribosomal subunit protein S18 [Shigella flexneri 5 str. 8401] >gi|145316914|gb|ABP59061.1| SSU ribosomal protein S18P [Enterobacter sp. 638] >gi|150957917|gb|ABR79947.1| 30S ribosomal protein S18 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|156530677|gb|ABU75503.1| hypothetical protein ESA_00202 [Enterobacter sakazakii ATCC BAA-894] >gi|157069347|gb|ABV08602.1| ribosomal protein S18 [Escherichia coli HS] >gi|157080670|gb|ABV20378.1| ribosomal protein S18 [Escherichia coli E24377A] >gi|157085031|gb|ABV14709.1| hypothetical protein CKO_03630 [Citrobacter koseri ATCC BAA-895] >gi|160866452|gb|ABX23075.1| hypothetical protein SARI_03239 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|161367029|gb|ABX70797.1| hypothetical protein SPAB_05528 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|169756716|gb|ACA79415.1| ribosomal protein S18 [Escherichia coli ATCC 8739] >gi|169891482|gb|ACB05189.1| 30S ribosomal subunit protein S18 [Escherichia coli str. K12 substr. DH10B] >gi|170124065|gb|EDS92996.1| ribosomal protein S18 [Escherichia albertii TW07627] >gi|170517738|gb|ACB15916.1| ribosomal protein S18 [Escherichia coli SMS-3-5] >gi|187429790|gb|ACD09064.1| ribosomal protein S18 [Shigella boydii CDC 3083-94] >gi|187770314|gb|EDU34158.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4196] >gi|188014502|gb|EDU52624.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4113] >gi|188020113|gb|EDU58153.1| hypothetical protein PROSTU_03885 [Providencia stuartii ATCC 25827] >gi|188030113|emb|CAO97999.1| 30S ribosomal protein S18 [Erwinia tasmaniensis] >gi|188490793|gb|EDU65896.1| ribosomal protein S18 [Escherichia coli 53638] >gi|189001716|gb|EDU70702.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4076] >gi|189357840|gb|EDU76259.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4401] >gi|189364286|gb|EDU82705.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4486] >gi|189368871|gb|EDU87287.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4501] >gi|189374715|gb|EDU93131.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC869] >gi|189376068|gb|EDU94484.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC508] >gi|190904315|gb|EDV64024.1| ribosomal protein S18 [Escherichia coli B7A] >gi|190908927|gb|EDV68514.1| ribosomal protein S18 [Escherichia coli F11] >gi|192926321|gb|EDV80957.1| ribosomal protein S18 [Escherichia coli E22] >gi|192955801|gb|EDV86272.1| ribosomal protein S18 [Escherichia coli E110019] >gi|194405470|gb|ACF65692.1| ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194408246|gb|ACF68465.1| ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194415332|gb|EDX31600.1| ribosomal protein S18 [Escherichia coli B171] >gi|194417169|gb|EDX33281.1| ribosomal protein S18 [Shigella dysenteriae 1012] >gi|194421536|gb|EDX37549.1| ribosomal protein S18 [Escherichia coli 101-1] >gi|194458780|gb|EDX47619.1| ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194684675|emb|CAR46619.1| 30S ribosomal protein S18 [Proteus mirabilis HI4320] >gi|194709785|gb|ACF89006.1| ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195632565|gb|EDX51019.1| ribosomal protein S18 [Salmonella enterica subsp. enterica serovar Newport str. SL317] (75 aa)
Score = 127, Expect = 4.6e-06, Identities = 28/65 (43%), Positives = 46/65 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G + +DYKD+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR ++L+P+
  S:     6 RRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPY 70
>gi|158520026|ref|YP_001527896.1| ribosomal protein S18 [Desulfococcus oleovorans Hxd3] >gi|158508852|gb|ABW65819.1| ribosomal protein S18 [Desulfococcus oleovorans Hxd3] (83 aa)
Score = 127, Expect = 4.9e-06, Identities = 27/65 (41%), Positives = 43/65 (66%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           R+K+C+ CA     +DYK+ + L  ++T   KI  R+I+  C+KHQ  ++  IKRAR +AL+P+V
  S:    14 RRKYCRFCADSSLPIDYKNPKSLKSFITERGKIIPRRISGTCAKHQRAITREIKRARTIALLPYV 78
>gi|114564510|ref|YP_752024.1| 30S ribosomal protein S18 [Shewanella frigidimarina NCIMB 400] >gi|122298732|sp|Q07XS9|RS18_SHEFN 30S ribosomal protein S18 >gi|114335803|gb|ABI73185.1| ribosomal protein S18 [Shewanella frigidimarina NCIMB 400] (75 aa)
Score = 127, Expect = 5.0e-06, Identities = 26/65 (40%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  ++G   +DYKD+  L  Y+T + KI   +IT   +++Q +++ AIKRAR ++L+P+
  S:     6 RRRKFCRFTSEGVVEIDYKDIVTLKNYITESGKIVPSRITGTSARYQRQLARAIKRARYLSLLPY 70
>gi|160940069|ref|ZP_02087414.1| hypothetical protein CLOBOL_04958 [Clostridium bolteae ATCC BAA-613] >gi|158436649|gb|EDP14416.1| hypothetical protein CLOBOL_04958 [Clostridium bolteae ATCC BAA-613] (89 aa)
Score = 127, Expect = 5.0e-06, Identities = 38/88 (43%), Positives = 49/88 (55%)
  Q:    67 FNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           FN  DRP        P    RRKK C  C      +DYKDV  L +Y++   KI  R+IT  C+KHQ  ++ AIKRAR +AL+P+  D
  S:     3 FNKTDRPDGA-KMRRPGGMRRRKKVCVFCGDKNGTIDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALTVAIKRARHIALMPYTCD 89
>gi|186685032|ref|YP_001868228.1| ribosomal protein S18 [Nostoc punctiforme PCC 73102] >gi|186467484|gb|ACC83285.1| ribosomal protein S18 [Nostoc punctiforme PCC 73102] (71 aa)
Score = 126, Expect = 5.2e-06, Identities = 29/56 (51%), Positives = 40/56 (71%)
  Q:    97 KGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           K  E +DYKDV+LL K++T   KI  R+IT   S+ Q  ++ AIKR+RIVAL+PF+
  S:    12 KPGEPIDYKDVDLLRKFVTERGKILPRRITGLTSQQQRELTLAIKRSRIVALLPFI 67
>gi|15643371|ref|NP_228415.1| ribosomal protein S18 [Thermotoga maritima MSB8] >gi|7388156|sp|Q9WZ74|RS18_THEMA 30S ribosomal protein S18 >gi|4981125|gb|AAD35690.1|AE001735_3 ribosomal protein S18 [Thermotoga maritima MSB8] (75 aa)
Score = 126, Expect = 5.2e-06, Identities = 28/60 (46%), Positives = 40/60 (66%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVR 153
           LC    ++VDYKD  LL ++LT   KI  +++T  CSKHQ  V  AIKRAR + L+P+++
  S:    15 LCEMKLDYVDYKDTRLLSEFLTDKGKIIPKRLTGNCSKHQRMVKVAIKRARQMGLLPYLK 74
>gi|170692294|ref|ZP_02883457.1| ribosomal protein S18 [Burkholderia graminis C4D1M] >gi|170142724|gb|EDT10889.1| ribosomal protein S18 [Burkholderia graminis C4D1M] (91 aa)
Score = 126, Expect = 5.3e-06, Identities = 34/83 (40%), Positives = 50/83 (60%)
  Q:    69 PQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           P  + F K  R   N   +RKKFC+  A G E++DYKD+E L  ++  N KI   ++T   S +Q ++  AIKRAR +AL+P+
  S:     4 PTGKKFDK-RRQQQNPLFKRKKFCRFTAAGVEYIDYKDIETLKDFIGENGKITPARLTGTKSHYQRQLDTAIKRARFLALVPY 85
>gi|29374670|ref|NP_813822.1| 30S ribosomal protein S18 [Enterococcus faecalis V583] >gi|59798885|sp|Q839Y8|RS18_ENTFA 30S ribosomal protein S18 >gi|29342128|gb|AAO79894.1| ribosomal protein S18 [Enterococcus faecalis V583] (79 aa)
Score = 126, Expect = 5.3e-06, Identities = 27/61 (44%), Positives = 43/61 (70%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   E++DYKD ELL ++++   KI  R++T   +K+Q +++ AIKRARI+ L+PFV D
  S:    17 IAANHIEYIDYKDTELLKRFISERGKILPRRVTGTGAKNQRKLTIAIKRARIMGLLPFVSD 77
>gi|88858916|ref|ZP_01133557.1| 30S ribosomal subunit protein S18 [Pseudoalteromonas tunicata D2] >gi|88819142|gb|EAR28956.1| 30S ribosomal subunit protein S18 [Pseudoalteromonas tunicata D2] (75 aa)
Score = 126, Expect = 5.4e-06, Identities = 29/65 (44%), Positives = 46/65 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G + +DYKD+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR +AL+P+
  S:     6 RRRKFCRFKAEGVQKIDYKDLATLRNYVTESGKIVPSRITGTSAKYQRQLAAAIKRARYLALLPY 70
>gi|22299604|ref|NP_682851.1| 30S ribosomal protein S18 [Thermosynechococcus elongatus BP-1] >gi|59798900|sp|Q8DH98|RS18_SYNEL 30S ribosomal protein S18 >gi|22295788|dbj|BAC09613.1| 30S ribosomal protein S18 [Thermosynechococcus elongatus BP-1] (71 aa)
Score = 126, Expect = 5.5e-06, Identities = 25/51 (49%), Positives = 39/51 (76%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKDV+LL +++T   KI  R++T   +K Q +++ AIKRARI+AL+PF+
  S:    17 IDYKDVDLLRRFITERGKILPRRVTGLTAKQQRQLAVAIKRARIMALLPFL 67
>gi|95930451|ref|ZP_01313187.1| ribosomal protein S18 [Desulfuromonas acetoxidans DSM 684] >gi|95133491|gb|EAT15154.1| ribosomal protein S18 [Desulfuromonas acetoxidans DSM 684] (85 aa)
Score = 126, Expect = 5.6e-06, Identities = 29/76 (38%), Positives = 47/76 (61%)
  Q:    79 RGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +G P ++  R+K C+ CA     +DYK+V  L  +++   KI  R+I+  C+ HQ +V+ AIKRAR +AL+ F  +
  S:     6 KGAPRRRFGRRKGCRFCADSSLKIDYKEVRTLRYFISERGKIVPRRISGNCATHQRKVTEAIKRARNIALLSFTSN 81
>gi|126701289|ref|YP_001090186.1| 30S ribosomal protein S18 [Clostridium difficile 630] >gi|145952498|ref|ZP_01801508.1| hypothetical protein CdifQ_04004249 [Clostridium difficile QCD-32g58] >gi|168695977|ref|ZP_02728254.1| 30S ribosomal protein S18 [Clostridium difficile QCD-37x79] >gi|168714875|ref|ZP_02747152.1| 30S ribosomal protein S18 [Clostridium difficile QCD-63q42] >gi|168724954|ref|ZP_02757231.1| 30S ribosomal protein S18 [Clostridium difficile QCD-76w55] >gi|168732190|ref|ZP_02764467.1| 30S ribosomal protein S18 [Clostridium difficile QCD-97b34] >gi|196124285|ref|ZP_03116034.1| 30S ribosomal protein S18 [Clostridium difficile ATCC 43255] >gi|196160201|ref|ZP_03120762.1| 30S ribosomal protein S18 [Clostridium difficile CIP 107932] >gi|196163199|ref|ZP_03123730.1| 30S ribosomal protein S18 [Clostridium difficile QCD-23m63] >gi|122973570|sp|Q181R4|RS18_CLOD6 30S ribosomal protein S18 >gi|115252726|emb|CAJ70570.1| 30S ribosomal protein S18 [Clostridium difficile 630] (75 aa)
Score = 126, Expect = 5.8e-06, Identities = 28/63 (44%), Positives = 40/63 (63%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C+ CA     +DYK  + L KY+T   KI  R+I+  C+KHQ  ++ AIKRAR +AL+P+  D
  S:    13 CQFCADKNAKIDYKSTQRLQKYITERGKILPRRISGTCAKHQRELTVAIKRARNIALLPYTLD 75
>gi|15804791|ref|NP_290832.1| 30S ribosomal protein S18 [Escherichia coli O157:H7 EDL933] >gi|12519193|gb|AAG59398.1|AE005652_15 30S ribosomal subunit protein S18 [Escherichia coli O157:H7 EDL933] (75 aa)
Score = 126, Expect = 5.8e-06, Identities = 27/65 (41%), Positives = 46/65 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G + +DY+D+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR ++L+P+
  S:     6 RRRKFCRFTAEGVQEIDYEDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPY 70
>gi|167403226|ref|ZP_02308061.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL J2-003] (88 aa)
Score = 126, Expect = 5.8e-06, Identities = 29/66 (43%), Positives = 46/66 (69%)
  Q:    89 KKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +K C   + G  H+DYKDVELL K+++   KI  R++T   +K+Q +++ AIKR+R +AL+PFV +
  S:    21 EKVCYFTSNGITHIDYKDVELLKKFVSERGKILPRRVTGTSAKYQRKLTVAIKRSRQMALLPFVAE 86
>gi|89211328|ref|ZP_01189698.1| Ribosomal protein S18 [Halothermothrix orenii H 168] >gi|89159070|gb|EAR78748.1| Ribosomal protein S18 [Halothermothrix orenii H 168] (70 aa)
Score = 126, Expect = 5.8e-06, Identities = 31/69 (44%), Positives = 47/69 (68%)
  Q:    86 GRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
            RR K C  C   +  +DYK+V+ L ++LT   KI  R+IT  C+KHQ +++ AIKRAR +AL+P+V++
  S:     2 ARRNKPCYFCTNKKAKLDYKEVKTLERFLTNRGKIVPRRITGNCAKHQRQLTRAIKRARNIALLPYVKE 70
>gi|116491827|ref|YP_803562.1| SSU ribosomal protein S18P [Pediococcus pentosaceus ATCC 25745] >gi|122266709|sp|Q03I52|RS18_PEDPA 30S ribosomal protein S18 >gi|116101977|gb|ABJ67120.1| SSU ribosomal protein S18P [Pediococcus pentosaceus ATCC 25745] (78 aa)
Score = 126, Expect = 6.0e-06, Identities = 26/61 (42%), Positives = 43/61 (70%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   E++DYKD ELL ++++   KI  R+++   +K+Q R++ AIKRARI+ L+PFV +
  S:    17 IAANHIEYIDYKDTELLKRFISERGKILPRRVSGTSAKNQRRLTIAIKRARIMGLLPFVAE 77
>gi|33865759|ref|NP_897318.1| 30S ribosomal protein S18 [Synechococcus sp. WH 8102] >gi|78184710|ref|YP_377145.1| 30S ribosomal protein S18 [Synechococcus sp. CC9902] >gi|78212867|ref|YP_381646.1| 30S ribosomal protein S18 [Synechococcus sp. CC9605] >gi|87124491|ref|ZP_01080340.1| ribosomal protein S18 [Synechococcus sp. RS9917] >gi|88808524|ref|ZP_01124034.1| 30S ribosomal protein S18 [Synechococcus sp. WH 7805] >gi|113953413|ref|YP_730544.1| 30S ribosomal protein S18 [Synechococcus sp. CC9311] >gi|116070581|ref|ZP_01467850.1| 30S ribosomal protein S18 [Synechococcus sp. BL107] >gi|148239628|ref|YP_001225015.1| 30S ribosomal protein S18 [Synechococcus sp. WH 7803] >gi|194476530|ref|YP_002048709.1| 30S ribosomal protein S18 [Paulinella chromatophora] >gi|123327838|sp|Q0IAH8|RS18_SYNS3 30S ribosomal protein S18 >gi|123743319|sp|Q3AJZ1|RS18_SYNSC 30S ribosomal protein S18 >gi|123743504|sp|Q3AVJ4|RS18_SYNS9 30S ribosomal protein S18 >gi|166222251|sp|A5GLA3|RS18_SYNPW 30S ribosomal protein S18 >gi|59798843|sp|Q7U6W1|RS18_SYNPX 30S ribosomal protein S18 >gi|33632929|emb|CAE07740.1| 30S ribosomal protein S18 [Synechococcus sp. WH 8102] >gi|78169004|gb|ABB26101.1| SSU ribosomal protein S18P [Synechococcus sp. CC9902] >gi|78197326|gb|ABB35091.1| ribosomal protein S18 [Synechococcus sp. CC9605] >gi|86168063|gb|EAQ69321.1| ribosomal protein S18 [Synechococcus sp. RS9917] >gi|88787512|gb|EAR18669.1| 30S ribosomal protein S18 [Synechococcus sp. WH 7805] >gi|113880764|gb|ABI45722.1| ribosomal protein S18 [Synechococcus sp. CC9311] >gi|116065986|gb|EAU71743.1| 30S ribosomal protein S18 [Synechococcus sp. BL107] >gi|147848167|emb|CAK23718.1| 30S ribosomal protein S18 [Synechococcus sp. WH 7803] >gi|171191537|gb|ACB42499.1| 30S ribosomal protein S18 [Paulinella chromatophora] (73 aa)
Score = 126, Expect = 6.0e-06, Identities = 28/51 (54%), Positives = 39/51 (76%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKDV+LL K++T   KI  R++T   +K Q  ++NA+KRARIVAL+PFV
  S:    19 IDYKDVDLLKKFITERGKILPRRLTGLTAKQQRDLTNAVKRARIVALLPFV 69
>gi|167457633|ref|ZP_02323844.1| ribosomal protein S18 [Anaeromyxobacter dehalogenans 2CP-1] >gi|167416009|gb|EDR82728.1| ribosomal protein S18 [Anaeromyxobacter dehalogenans 2CP-1] (133 aa)
Score = 126, Expect = 6.2e-06, Identities = 27/62 (43%), Positives = 39/62 (62%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K C+ CA     VDYKD   +  +LT   KI  R+I+  C+KHQ  V+ AIKR R++A++P+
  S:    67 KVCRFCADKALKVDYKDQGQMKYFLTERGKIIPRRISGNCAKHQREVATAIKRGRMLAILPY 128
>gi|163765255|ref|ZP_02172288.1| ribosomal protein S18 [Anaeromyxobacter sp. K] >gi|196170394|gb|ACG71367.1| ribosomal protein S18 [Anaeromyxobacter sp. K] (135 aa)
Score = 126, Expect = 6.2e-06, Identities = 27/62 (43%), Positives = 39/62 (62%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K C+ CA     VDYKD   +  +LT   KI  R+I+  C+KHQ  V+ AIKR R++A++P+
  S:    69 KVCRFCADKALKVDYKDQGQMKYFLTERGKIIPRRISGNCAKHQREVATAIKRGRMLAILPY 130
>gi|149279559|ref|ZP_01885688.1| 30S ribosomal protein S18 [Pedobacter sp. BAL39] >gi|149229595|gb|EDM34985.1| 30S ribosomal protein S18 [Pedobacter sp. BAL39] (87 aa)
Score = 126, Expect = 6.3e-06, Identities = 28/73 (38%), Positives = 43/73 (58%)
  Q:    82 PNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           P     RKK+C+    G +++DYKD   L K++    KI  R++T    K Q +V+ A+KR+R + L+PFV D
  S:    12 PKVDDNRKKYCRFKKNGIKYIDYKDANFLLKFINDQGKILPRRLTGTSLKFQRKVAQAVKRSRHIGLLPFVAD 84
>gi|15674171|ref|NP_268346.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis Il1403] >gi|116513137|ref|YP_812044.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris SK11] >gi|125625229|ref|YP_001033712.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris MG1363] >gi|122939895|sp|Q02VU1|RS18_LACLS 30S ribosomal protein S18 >gi|166220956|sp|A2RNZ2|RS18_LACLM 30S ribosomal protein S18 >gi|13878750|sp|Q9CDN0|RS18_LACLA 30S ribosomal protein S18 >gi|12725253|gb|AAK06287.1|AE006448_5 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis Il1403] >gi|116108791|gb|ABJ73931.1| SSU ribosomal protein S18P [Lactococcus lactis subsp. cremoris SK11] >gi|124494037|emb|CAL99037.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris MG1363] (81 aa)
Score = 126, Expect = 6.3e-06, Identities = 33/68 (48%), Positives = 47/68 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RRKK   + A   E VDYKD ELL ++++   KI  R++T   +K+Q +V NAIKRAR++AL+PFV +
  S:    11 RRKKVDFIAANKIEVVDYKDTELLKRFISERGKILPRRVTGTSAKNQRKVVNAIKRARVMALLPFVAE 78
>gi|15834805|ref|NP_296564.1| 30S ribosomal protein S18 [Chlamydia muridarum Nigg] >gi|7404461|sp|P24286|RS18_CHLMU 30S ribosomal protein S18 >gi|7190222|gb|AAF39059.1| ribosomal protein S18 [Chlamydia muridarum Nigg] (81 aa)
Score = 126, Expect = 6.5e-06, Identities = 31/70 (44%), Positives = 46/70 (65%)
  Q:    83 NKQGRRKKFCKLC---AKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           + + RRK+F K C   + G + +DYKDV  L +++T   KI  R+IT   S+ Q  ++ A+KRAR V L+PFV
  S:     6 HNEHRRKRFAKKCPFVSAGWKTIDYKDVVTLKRFITERGKILPRRITGVSSRFQALLAQAVKRARHVGLLPFV 78
>gi|78485707|ref|YP_391632.1| ribosomal protein S18 [Thiomicrospira crunogena XCL-2] >gi|123741575|sp|Q31FW5|RS18_THICR 30S ribosomal protein S18 >gi|78363993|gb|ABB41958.1| SSU ribosomal protein S18P [Thiomicrospira crunogena XCL-2] (75 aa)
Score = 126, Expect = 6.6e-06, Identities = 29/64 (45%), Positives = 44/64 (68%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RKKFC+   +G + +DYKD++ L  Y+T   KI   +IT   +K+Q ++S AIKRAR +AL+P+
  S:     7 RKKFCRFTVEGVKEIDYKDLDTLKSYITETGKIVPSRITGTSAKYQRQLSTAIKRARYLALLPY 70
>gi|90416567|ref|ZP_01224498.1| 30S ribosomal protein S18 [marine gamma proteobacterium HTCC2207] >gi|90331766|gb|EAS46994.1| 30S ribosomal protein S18 [marine gamma proteobacterium HTCC2207] (75 aa)
Score = 126, Expect = 6.6e-06, Identities = 27/65 (41%), Positives = 46/65 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G   +DYKD++ L  Y++ + KI   +IT   +++Q +++ AIKRAR +AL+P+
  S:     6 RRRKFCRFSAEGAPEIDYKDLDTLKGYVSESGKIVPSRITGTKARYQRQLAEAIKRARYIALLPY 70
>gi|27469288|ref|NP_765925.1| 30S ribosomal protein S18 [Staphylococcus epidermidis ATCC 12228] >gi|57865985|ref|YP_187646.1| 30S ribosomal protein S18 [Staphylococcus epidermidis RP62A] >gi|38258566|sp|Q8CQP6|RS18_STAES 30S ribosomal protein S18 >gi|71153728|sp|Q5HRZ3|RS18_STAEQ 30S ribosomal protein S18 >gi|27316838|gb|AAO06013.1|AE016752_46 30S ribosomal protein S18 [Staphylococcus epidermidis ATCC 12228] >gi|57636643|gb|AAW53431.1| ribosomal protein S18 [Staphylococcus epidermidis RP62A] (80 aa)
Score = 126, Expect = 6.6e-06, Identities = 29/66 (43%), Positives = 45/66 (68%)
  Q:    89 KKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           KK C   A G  H+DYKD ELL ++++   KI  R++T   +K+Q  ++ AIKRAR +AL+P+V++
  S:    13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMALLPYVKE 78
>gi|121535339|ref|ZP_01667151.1| ribosomal protein S18 [Thermosinus carboxydivorans Nor1] >gi|121306031|gb|EAX46961.1| ribosomal protein S18 [Thermosinus carboxydivorans Nor1] (76 aa)
Score = 126, Expect = 6.7e-06, Identities = 30/67 (44%), Positives = 44/67 (65%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +KK C  C    E VDYKDV  L +++T   KI  R+I+  C++HQ +++ AIKRAR +AL+PF  +
  S:    10 KKKVCSFCVDKIERVDYKDVPRLRRFITERGKILPRRISGNCARHQRQLTLAIKRARNMALLPFTAE 76
>gi|126642217|ref|YP_001085201.1| 30S ribosomal protein S18 [Acinetobacter baumannii ATCC 17978] >gi|169633237|ref|YP_001706973.1| 30S ribosomal protein S18 [Acinetobacter baumannii SDF] >gi|169795503|ref|YP_001713296.1| 30S ribosomal protein S18 [Acinetobacter baumannii AYE] >gi|184158695|ref|YP_001847034.1| putative 30S ribosomal protein S18 [Acinetobacter baumannii ACICU] >gi|166220917|sp|A3M6Q5|RS18_ACIBT 30S ribosomal protein S18 >gi|126388101|gb|ABO12599.1| 30S ribosomal protein S18 [Acinetobacter baumannii ATCC 17978] >gi|169148430|emb|CAM86296.1| 30S ribosomal protein S18 [Acinetobacter baumannii] >gi|169152029|emb|CAP00909.1| 30S ribosomal protein S18 [Acinetobacter baumannii] >gi|183210289|gb|ACC57687.1| putative 30S ribosomal protein S18 [Acinetobacter baumannii ACICU] (75 aa)
Score = 126, Expect = 6.7e-06, Identities = 27/65 (41%), Positives = 47/65 (72%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+   ++DYKD++ L +Y+T N KI   +IT   +++Q +++ AIK+AR ++LIP+
  S:     6 RRRKFCRFTAENVAYIDYKDIDTLKQYITENGKIVPSRITGTKARYQRQLALAIKQARYLSLIPY 70
>gi|56422015|ref|YP_149333.1| 30S ribosomal protein S18 (BS21) [Geobacillus kaustophilus HTA426] >gi|196249872|ref|ZP_03148568.1| ribosomal protein S18 [Geobacillus sp. G11MC16] >gi|81675665|sp|Q5KU71|RS18_GEOKA 30S ribosomal protein S18 >gi|585939|sp|P10806|RS18_BACST 30S ribosomal protein S18 (BS21) (BS19) >gi|56381857|dbj|BAD77765.1| 30S ribosomal protein S18 (BS21) [Geobacillus kaustophilus HTA426] >gi|196210748|gb|EDY05511.1| ribosomal protein S18 [Geobacillus sp. G11MC16] (78 aa)
Score = 125, Expect = 6.9e-06, Identities = 28/63 (44%), Positives = 43/63 (68%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C   A    H+DYKDV+LL K+++   KI  R++T   +K+Q +++ AIKRAR +AL+P+V D
  S:    15 CYFTANNITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLPYVAD 77
>gi|114319745|ref|YP_741428.1| SSU ribosomal protein S18P [Alkalilimnicola ehrlichei MLHE-1] >gi|122312361|sp|Q0AB49|RS18_ALHEH 30S ribosomal protein S18 >gi|114226139|gb|ABI55938.1| SSU ribosomal protein S18P [Alkalilimnicola ehrlichei MLHE-1] (74 aa)
Score = 125, Expect = 6.9e-06, Identities = 27/65 (41%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+K+C+  A+G + +DYKD+  L  Y+T   KI   +IT   +++Q +++ AIKRAR +AL+P+
  S:     6 RRRKYCRFTAEGVKEIDYKDLNTLRNYVTETGKIVPSRITGTSARYQRQLARAIKRARYLALLPY 70
>gi|33357895|pdb|1P6G|R Chain R, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome >gi|33357972|pdb|1P87|R Chain R, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Initiation-Like State Of E. Coli 70s Ribosome >gi|83754056|pdb|2AVY|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|83754112|pdb|2AW7|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 30s Subunit Of The Second 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|118138070|pdb|2I2P|R Chain R, Crystal Structure Of Ribosome With Messenger Rna And The Anticodon Stem-Loop Of P-Site Trna. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|118138141|pdb|2I2U|R Chain R, Crystal Structure Of Ribosome With Messenger Rna And The Anticodon Stem-Loop Of P-Site Trna. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|157836038|pdb|2QOU|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Spectinomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836085|pdb|2QOW|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Spectinomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836142|pdb|2QOY|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin And Neomycin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Spectinomycin And Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836189|pdb|2QP0|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin And Neomycin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Spectinomycin And Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|158429715|pdb|2QAL|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Neomycin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429767|pdb|2QAN|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Neomycin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429825|pdb|2QB9|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429877|pdb|2QBB|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429929|pdb|2QBD|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The First 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429981|pdb|2QBF|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The Second 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158430035|pdb|2QBH|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The First 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158430088|pdb|2QBJ|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The Second 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158431388|pdb|2Z4K|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Paromomycin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The First 70s Ribosome, With Paromomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158431441|pdb|2Z4M|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Paromomycin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The Second 70s Ribosome, With Paromomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|168988805|pdb|2VHO|R Chain R, Structure Of Pdf Binding Helix In Complex With The Ribosome (Part 3 Of 4) >gi|168988826|pdb|2VHP|R Chain R, Structure Of Pdf Binding Helix In Complex With The Ribosome (Part 4 Of 4) (74 aa)
Score = 125, Expect = 7.0e-06, Identities = 28/65 (43%), Positives = 46/65 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G + +DYKD+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR ++L+P+
  S:     5 RRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPY 69
>gi|154688193|ref|YP_001423354.1| 30S ribosomal protein S18 [Bacillus amyloliquefaciens FZB42] >gi|154354044|gb|ABS76123.1| RpsR [Bacillus amyloliquefaciens FZB42] (81 aa)
Score = 125, Expect = 7.1e-06, Identities = 27/61 (44%), Positives = 43/61 (70%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           C   + G  H+DYKDV+LL K+++   KI  R++T   +K+Q +++ AIKRAR +AL+P+V
  S:    18 CYFTSNGITHIDYKDVDLLRKFVSERGKILPRRVTGTNAKYQRKLTIAIKRARQMALLPYV 78
>gi|167575873|ref|ZP_02368747.1| 30S ribosomal protein S18 [Borrelia valaisiana VS116] >gi|195948167|ref|ZP_03089353.1| 30S ribosomal protein S18 [Borrelia garinii PBr] (96 aa)
Score = 125, Expect = 7.3e-06, Identities = 36/89 (40%), Positives = 53/89 (59%)
  Q:    65 KEFNPQDRPFAKYNRGYPNKQGRR---KKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVR 153
           ++ N +D  F     G+      R   +K CK C  G+ H DYKD + L K++T   KI  ++IT   +KHQ R++  IKRAR +AL+PFV+
  S:     5 RDVNQRDSRFENQQDGFKKNSNFRFFKRKSCKFCDSGK-HPDYKDFDFLKKFITEQGKILPKRITGTSAKHQRRLALEIKRARYMALLPFVK 95
>gi|30023496|ref|NP_835127.1| 30S ribosomal protein S18 [Bacillus cereus ATCC 14579] >gi|42784668|ref|NP_981915.1| 30S ribosomal protein S18 [Bacillus cereus ATCC 10987] >gi|47568671|ref|ZP_00239368.1| ribosomal protein S18 [Bacillus cereus G9241] >gi|166982574|ref|ZP_02254006.1| ribosomal protein S18 [Bacillus cereus AH187] >gi|167937974|ref|ZP_02525049.1| ribosomal protein S18 [Bacillus cereus AH1134] >gi|168137547|ref|ZP_02580776.1| ribosomal protein S18 [Bacillus cereus B4264] >gi|168143825|ref|ZP_02587054.1| ribosomal protein S18 [Bacillus cereus G9842] >gi|168160951|ref|ZP_02596184.1| ribosomal protein S18 [Bacillus cereus H3081.97] >gi|59798780|sp|Q72WV5|RS18_BACC1 30S ribosomal protein S18 >gi|59798875|sp|Q814G7|RS18_BACCR 30S ribosomal protein S18 >gi|29899057|gb|AAP12328.1| SSU ribosomal protein S18P [Bacillus cereus ATCC 14579] >gi|42740600|gb|AAS44523.1| ribosomal protein S18 [Bacillus cereus ATCC 10987] >gi|47554659|gb|EAL13013.1| ribosomal protein S18 [Bacillus cereus G9241] (77 aa)
Score = 125, Expect = 7.3e-06, Identities = 29/73 (39%), Positives = 48/73 (65%)
  Q:    80 GYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           G    + +R+K C   A G   +DYKDV+LL ++++   KI  R++T   +K+Q +++ AIKRAR +AL+P+V
  S:     3 GRKGGRAKRRKVCFFTANGITRIDYKDVDLLKRFVSERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLPYV 75
>gi|15901383|ref|NP_345987.1| 30S ribosomal protein S18 [Streptococcus pneumoniae TIGR4] >gi|15903437|ref|NP_358987.1| 30S ribosomal protein S18 [Streptococcus pneumoniae R6] >gi|24380218|ref|NP_722173.1| 30S ribosomal protein S18 [Streptococcus mutans UA159] >gi|111658382|ref|ZP_01409069.1| hypothetical protein SpneT_02000461 [Streptococcus pneumoniae TIGR4] >gi|116516750|ref|YP_816828.1| 30S ribosomal protein S18 [Streptococcus pneumoniae D39] >gi|125717306|ref|YP_001034439.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK36] >gi|148984887|ref|ZP_01818140.1| hypothetical protein CGSSp3BS71_09631 [Streptococcus pneumoniae SP3-BS71] >gi|148988585|ref|ZP_01820018.1| hypothetical protein CGSSp6BS73_08674 [Streptococcus pneumoniae SP6-BS73] >gi|148992571|ref|ZP_01822239.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae SP9-BS68] >gi|148997397|ref|ZP_01825002.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae SP11-BS70] >gi|149003239|ref|ZP_01828135.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae SP14-BS69] >gi|149007548|ref|ZP_01831183.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae SP18-BS74] >gi|149011777|ref|ZP_01832973.1| hypothetical protein CGSSp19BS75_07412 [Streptococcus pneumoniae SP19-BS75] >gi|149021813|ref|ZP_01835820.1| hypothetical protein CGSSp23BS72_09623 [Streptococcus pneumoniae SP23-BS72] >gi|157150434|ref|YP_001451145.1| 30S ribosomal protein S18 [Streptococcus gordonii str. Challis substr. CH1] >gi|168484972|ref|ZP_02709917.1| ribosomal protein S18 [Streptococcus pneumoniae CDC1873-00] >gi|168487509|ref|ZP_02712017.1| ribosomal protein S18 [Streptococcus pneumoniae CDC1087-00] >gi|168488799|ref|ZP_02712998.1| ribosomal protein S18 [Streptococcus pneumoniae SP195] >gi|168491569|ref|ZP_02715712.1| ribosomal protein S18 [Streptococcus pneumoniae CDC0288-04] >gi|168493440|ref|ZP_02717583.1| ribosomal protein S18 [Streptococcus pneumoniae CDC3059-06] >gi|168575265|ref|ZP_02721228.1| ribosomal protein S18 [Streptococcus pneumoniae MLV-016] >gi|169832520|ref|YP_001694944.1| ribosomal protein S18 [Streptococcus pneumoniae Hungary19A-6] >gi|171779262|ref|ZP_02920233.1| hypothetical protein STRINF_01110 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|182684495|ref|YP_001836242.1| 30S ribosomal protein S18 [Streptococcus pneumoniae CGSP14] >gi|122278326|sp|Q04JL0|RS18_STRP2 30S ribosomal protein S18 >gi|166222248|sp|A3CL34|RS18_STRSV 30S ribosomal protein S18 >gi|189029694|sp|A8AZD5|RS18_STRGC 30S ribosomal protein S18 >gi|54039416|sp|P66473|RS18_STRR6 30S ribosomal protein S18 >gi|54039417|sp|P66474|RS18_STRMU 30S ribosomal protein S18 >gi|54042150|sp|P66472|RS18_STRPN 30S ribosomal protein S18 >gi|24378225|gb|AAN59479.1|AE015012_8 30S ribosomal protein S18 [Streptococcus mutans UA159] >gi|14973029|gb|AAK75627.1| ribosomal protein S18 [Streptococcus pneumoniae TIGR4] >gi|15459045|gb|AAL00198.1| 30S Ribosomal protein S18 [Streptococcus pneumoniae R6] >gi|116077326|gb|ABJ55046.1| ribosomal protein S18 [Streptococcus pneumoniae D39] >gi|125497223|gb|ABN43889.1| 30S ribosomal protein S18, putative [Streptococcus sanguinis SK36] >gi|147756452|gb|EDK63493.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae SP11-BS70] >gi|147758699|gb|EDK65696.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae SP14-BS69] >gi|147760907|gb|EDK67877.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae SP18-BS74] >gi|147764208|gb|EDK71140.1| hypothetical protein CGSSp19BS75_07412 [Streptococcus pneumoniae SP19-BS75] >gi|147922909|gb|EDK74025.1| hypothetical protein CGSSp3BS71_09631 [Streptococcus pneumoniae SP3-BS71] >gi|147925786|gb|EDK76861.1| hypothetical protein CGSSp6BS73_08674 [Streptococcus pneumoniae SP6-BS73] >gi|147928588|gb|EDK79602.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae SP9-BS68] >gi|147930049|gb|EDK81036.1| hypothetical protein CGSSp23BS72_09623 [Streptococcus pneumoniae SP23-BS72] >gi|157075228|gb|ABV09911.1| ribosomal protein S18 [Streptococcus gordonii str. Challis substr. CH1] >gi|168995022|gb|ACA35634.1| ribosomal protein S18 [Streptococcus pneumoniae Hungary19A-6] >gi|171282318|gb|EDT47745.1| hypothetical protein STRINF_01110 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|172041899|gb|EDT49945.1| ribosomal protein S18 [Streptococcus pneumoniae CDC1873-00] >gi|182629829|gb|ACB90777.1| 30S ribosomal protein S18 [Streptococcus pneumoniae CGSP14] >gi|183569672|gb|EDT90200.1| ribosomal protein S18 [Streptococcus pneumoniae CDC1087-00] >gi|183572611|gb|EDT93139.1| ribosomal protein S18 [Streptococcus pneumoniae SP195] >gi|183574282|gb|EDT94810.1| ribosomal protein S18 [Streptococcus pneumoniae CDC0288-04] >gi|183576411|gb|EDT96939.1| ribosomal protein S18 [Streptococcus pneumoniae CDC3059-06] >gi|183578889|gb|EDT99417.1| ribosomal protein S18 [Streptococcus pneumoniae MLV-016] (79 aa)
Score = 125, Expect = 7.6e-06, Identities = 32/68 (47%), Positives = 48/68 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RRKK   + A   E+VDYKD ELL ++++   KI  R++T   +K+Q +V+ AIKRAR++AL+PFV +
  S:    11 RRKKVDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTAIKRARVMALMPFVNE 78
>gi|50812313|ref|NP_391969.2| 30S ribosomal protein S18 [Bacillus subtilis subsp. subtilis str. 168] >gi|585940|sp|P21475|RS18_BACSU 30S ribosomal protein S18 (BS21) >gi|32468848|emb|CAB16126.2| ribosomal protein S18 [Bacillus subtilis subsp. subtilis str. 168] (79 aa)
Score = 125, Expect = 7.8e-06, Identities = 27/61 (44%), Positives = 43/61 (70%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           C   + G  H+DYKDV+LL K+++   KI  R++T   +K+Q +++ AIKRAR +AL+P+V
  S:    16 CYFTSNGITHIDYKDVDLLKKFVSERGKILPRRVTGTNAKYQRKLTAAIKRARQMALLPYV 76
>gi|148381563|ref|YP_001256104.1| ribosomal protein S18 [Clostridium botulinum A str. ATCC 3502] >gi|153932032|ref|YP_001385940.1| 30S ribosomal protein S18 [Clostridium botulinum A str. ATCC 19397] >gi|153934477|ref|YP_001389347.1| 30S ribosomal protein S18 [Clostridium botulinum A str. Hall] >gi|153939405|ref|YP_001392982.1| 30S ribosomal protein S18 [Clostridium botulinum F str. Langeland] >gi|168181093|ref|ZP_02615757.1| ribosomal protein S18 [Clostridium botulinum NCTC 2916] >gi|168183704|ref|ZP_02618368.1| ribosomal protein S18 [Clostridium botulinum Bf] >gi|170756238|ref|YP_001783261.1| ribosomal protein S18 [Clostridium botulinum B1 str. Okra] >gi|170759820|ref|YP_001788968.1| ribosomal protein S18 [Clostridium botulinum A3 str. Loch Maree] >gi|166220944|sp|A7FZG9|RS18_CLOB1 30S ribosomal protein S18 >gi|166220945|sp|A5I7Z9|RS18_CLOBH 30S ribosomal protein S18 >gi|166220946|sp|A7GJM2|RS18_CLOBL 30S ribosomal protein S18 >gi|148291047|emb|CAL85184.1| 30S ribosomal protein S18 [Clostridium botulinum A str. ATCC 3502] >gi|152928076|gb|ABS33576.1| ribosomal protein S18 [Clostridium botulinum A str. ATCC 19397] >gi|152930391|gb|ABS35890.1| ribosomal protein S18 [Clostridium botulinum A str. Hall] >gi|152935301|gb|ABS40799.1| ribosomal protein S18 [Clostridium botulinum F str. Langeland] >gi|169121450|gb|ACA45286.1| ribosomal protein S18 [Clostridium botulinum B1 str. Okra] >gi|169406809|gb|ACA55220.1| ribosomal protein S18 [Clostridium botulinum A3 str. Loch Maree] >gi|182668122|gb|EDT80101.1| ribosomal protein S18 [Clostridium botulinum NCTC 2916] >gi|182673233|gb|EDT85194.1| ribosomal protein S18 [Clostridium botulinum Bf] (80 aa)
Score = 125, Expect = 7.8e-06, Identities = 30/67 (44%), Positives = 45/67 (67%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           ++K C  CA+  E +DYKD+  L K++T   KI  R+I+  C+KHQ  ++ AIKRAR +AL+PF  +
  S:    14 KRKVCTFCAEKSEAIDYKDINKLRKFVTERGKILPRRISGNCAKHQRELTRAIKRARNIALLPFTTE 80
>gi|53803659|ref|YP_114469.1| ribosomal protein S18 [Methylococcus capsulatus str. Bath] >gi|59798627|sp|Q606H9|RS18_METCA 30S ribosomal protein S18 >gi|53757420|gb|AAU91711.1| ribosomal protein S18 [Methylococcus capsulatus str. Bath] (76 aa)
Score = 125, Expect = 8.1e-06, Identities = 26/68 (38%), Positives = 48/68 (70%)
  Q:    84 KQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +Q +R+++C+  A+  + +DYKD++ L +Y++   KI   +IT   +K+Q +++ AIKRAR +AL+PF
  S:     3 RQFKRRRYCRFTAEDVKEIDYKDLDTLREYVSETGKIVPSRITGTSAKYQRQLATAIKRARFLALLPF 70
>gi|50122532|ref|YP_051699.1| 30S ribosomal protein S18 [Pectobacterium atrosepticum SCRI1043] >gi|59798691|sp|Q6D137|RS18_ERWCT 30S ribosomal protein S18 >gi|49613058|emb|CAG76509.1| 30S ribosomal protein S18 [Erwinia carotovora subsp. atroseptica SCRI1043] (75 aa)
Score = 125, Expect = 8.1e-06, Identities = 28/65 (43%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G   +DYKD+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR ++L+P+
  S:     6 RRRKFCRFTAEGVVEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPY 70
>gi|153002998|ref|YP_001377323.1| ribosomal protein S18 [Anaeromyxobacter sp. Fw109-5] >gi|152026571|gb|ABS24339.1| ribosomal protein S18 [Anaeromyxobacter sp. Fw109-5] (143 aa)
Score = 125, Expect = 8.6e-06, Identities = 26/62 (41%), Positives = 39/62 (62%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K C+ CA     VDYKD   +  +LT   KI  R+I+  C+KHQ  V+ A+KR R++A++P+
  S:    77 KVCRFCADKTLKVDYKDQSQMKYFLTERGKIIPRRISGNCAKHQREVATAVKRGRMLAILPY 138
>gi|33861426|ref|NP_892987.1| 30S ribosomal protein S18 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|78779316|ref|YP_397428.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9312] >gi|123966183|ref|YP_001011264.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9515] >gi|123968526|ref|YP_001009384.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. AS9601] >gi|126696329|ref|YP_001091215.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9301] >gi|157413359|ref|YP_001484225.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9215] >gi|123741464|sp|Q31AV3|RS18_PROM9 30S ribosomal protein S18 >gi|166220970|sp|A3PCY9|RS18_PROM0 30S ribosomal protein S18 >gi|166220973|sp|A2BWJ6|RS18_PROM5 30S ribosomal protein S18 >gi|166220974|sp|A2BR66|RS18_PROMS 30S ribosomal protein S18 >gi|167011192|sp|A8G4V8|RS18_PROM2 30S ribosomal protein S18 >gi|59798835|sp|Q7TUA0|RS18_PROMP 30S ribosomal protein S18 >gi|33634003|emb|CAE19328.1| 30S Ribosomal protein S18 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|78712815|gb|ABB49992.1| SSU ribosomal protein S18P [Prochlorococcus marinus str. MIT 9312] >gi|123198636|gb|ABM70277.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. AS9601] >gi|123200549|gb|ABM72157.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9515] >gi|126543372|gb|ABO17614.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9301] >gi|157387934|gb|ABV50639.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9215] (73 aa)
Score = 125, Expect = 8.6e-06, Identities = 29/51 (56%), Positives = 38/51 (74%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKDVELL K++T   KI  R++T   SK Q  ++ A+KRARIVAL+PFV
  S:    19 IDYKDVELLKKFITERGKILPRRMTGLTSKQQRDLTLAVKRARIVALLPFV 69
>gi|15605536|ref|NP_220322.1| 30S ribosomal protein S18 [Chlamydia trachomatis D/UW-3/CX] >gi|76789545|ref|YP_328631.1| 30S ribosomal protein S18 [Chlamydia trachomatis A/HAR-13] >gi|166154144|ref|YP_001654262.1| 30S ribosomal protein S18 [Chlamydia trachomatis 434/Bu] >gi|166155019|ref|YP_001653274.1| 30S ribosomal protein S18 [Chlamydia trachomatis L2b/UCH-1/proctitis] >gi|123606576|sp|Q3KKN9|RS18_CHLTA 30S ribosomal protein S18 >gi|6831541|sp|O84808|RS18_CHLTR 30S ribosomal protein S18 >gi|3329268|gb|AAC68397.1| S18 Ribosomal Protein [Chlamydia trachomatis D/UW-3/CX] >gi|76168075|gb|AAX51083.1| SSU ribosomal protein S18P [Chlamydia trachomatis A/HAR-13] >gi|165930132|emb|CAP03616.1| SSU ribosomal protein S18 [Chlamydia trachomatis 434/Bu] >gi|165931007|emb|CAP06570.1| SSU ribosomal protein S18 [Chlamydia trachomatis L2b/UCH-1/proctitis] (81 aa)
Score = 125, Expect = 8.6e-06, Identities = 31/70 (44%), Positives = 46/70 (65%)
  Q:    83 NKQGRRKKFCKLC---AKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           + + RRK+F K C   + G + +DYKDV  L +++T   KI  R+IT   S+ Q  ++ A+KRAR V L+PFV
  S:     6 HNEHRRKRFAKKCPFVSAGWKTIDYKDVTTLKRFITERGKILPRRITGVSSRFQALLAQAVKRARHVGLLPFV 78
>gi|149194318|ref|ZP_01871415.1| 30S ribosomal protein S18 [Caminibacter mediatlanticus TB-2] >gi|149135493|gb|EDM23972.1| 30S ribosomal protein S18 [Caminibacter mediatlanticus TB-2] (93 aa)
Score = 125, Expect = 8.7e-06, Identities = 29/60 (48%), Positives = 38/60 (63%)
  Q:    95 CAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C    +++ YKD+EL+   L+   KI  R++T  C KHQ  V  AIKRAR VALIP+V D
  S:    17 CEMKVDYIGYKDLELIKYSLSERYKIMPRRLTGTCKKHQDMVQKAIKRARQVALIPYVVD 76
>gi|114332337|ref|YP_748559.1| 30S ribosomal protein S18 [Nitrosomonas eutropha C91] >gi|114309351|gb|ABI60594.1| SSU ribosomal protein S18P [Nitrosomonas eutropha C91] (92 aa)
Score = 125, Expect = 8.7e-06, Identities = 28/65 (43%), Positives = 47/65 (72%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +RKKFC+  A+G + +DYKDV+LL  +++ N +I   +IT   S +Q +++ AI+RAR +AL+P+
  S:    24 KRKKFCRFTAEGIKKIDYKDVDLLKDFISENGRIIPARITGTRSYYQRQLNLAIERARFLALLPY 88
>gi|39995772|ref|NP_951723.1| 30S ribosomal protein S18 [Geobacter sulfurreducens PCA] >gi|59798802|sp|Q74FE3|RS18_GEOSL 30S ribosomal protein S18 >gi|39982536|gb|AAR33996.1| ribosomal protein S18 [Geobacter sulfurreducens PCA] (103 aa)
Score = 124, Expect = 8.9e-06, Identities = 34/80 (42%), Positives = 48/80 (60%)
  Q:    71 DRPFAKYNRGYPNKQGR---RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIP 150
           +RP     RG   ++ R   R+K C+ CA     +DYKD  +L  ++T   KI  R+I+  CS HQ  ++ AIKRAR +ALIP
  S:    13 ERPERPQQRGSGPRKRRPFQRRKVCRFCADKTLVIDYKDPRVLRSFITERGKIVPRRISGNCSAHQREITEAIKRARNIALIP 95
>gi|467373|dbj|BAA05219.1| ribosomal protein S18 [Bacillus subtilis] (81 aa)
Score = 124, Expect = 8.9e-06, Identities = 27/61 (44%), Positives = 43/61 (70%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           C   + G  H+DYKDV+LL K+++   KI  R++T   +K+Q +++ AIKRAR +AL+P+V
  S:    18 CYFTSNGITHIDYKDVDLLKKFVSERGKILPRRVTGTNAKYQRKLTAAIKRARQMALLPYV 78
>gi|83945280|ref|ZP_00957629.1| 30S ribosomal protein S18 [Oceanicaulis alexandrii HTCC2633] >gi|83851450|gb|EAP89306.1| 30S ribosomal protein S18 [Oceanicaulis alexandrii HTCC2633] (84 aa)
Score = 124, Expect = 9.0e-06, Identities = 27/68 (39%), Positives = 43/68 (63%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RR+K C    +    +DYKD++LL +Y++   KI   +IT   +K Q  ++ AIKRAR++AL+P+  D
  S:    17 RRRKVCPFSGENAPKIDYKDIKLLQRYMSERGKIVPSRITAVSAKKQRELARAIKRARVLALLPYAVD 84
>gi|16767639|ref|NP_463254.1| 30S ribosomal protein S18 [Salmonella typhimurium LT2] >gi|20978699|sp|Q8ZK81|RS18_SALTY 30S ribosomal protein S18 >gi|16422955|gb|AAL23213.1| 30S ribosomal subunit protein S18 [Salmonella typhimurium LT2] (75 aa)
Score = 124, Expect = 9.2e-06, Identities = 28/65 (43%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G + +DYKD+  L  Y+T + KI   +IT   +K+Q ++  AIKRAR ++L+P+
  S:     6 RRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLRRAIKRARYLSLLPY 70
>gi|226308|prf||1506337A ribosomal protein S18 (77 aa)
Score = 124, Expect = 9.5e-06, Identities = 28/63 (44%), Positives = 43/63 (68%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C   A    H+DYKDV+LL K+++   KI  R++T   +K+Q +++ AIKRAR +AL+P+V D
  S:    14 CYFTANNITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLPYVAD 76
>gi|187777390|ref|ZP_02993863.1| hypothetical protein CLOSPO_00946 [Clostridium sporogenes ATCC 15579] >gi|187774318|gb|EDU38120.1| hypothetical protein CLOSPO_00946 [Clostridium sporogenes ATCC 15579] (80 aa)
Score = 124, Expect = 9.6e-06, Identities = 29/67 (43%), Positives = 44/67 (65%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           ++K C  C +  E +DYKD+  L K++T   KI  R+I+  C+KHQ  ++ AIKRAR +AL+PF  +
  S:    14 KRKVCTFCMEKSEAIDYKDINKLRKFVTERGKILPRRISGNCAKHQRELTRAIKRARNIALLPFTTE 80
>gi|148265697|ref|YP_001232403.1| 30S ribosomal protein S18 [Geobacter uraniireducens Rf4] >gi|189029678|sp|A5G7R2|RS18_GEOUR 30S ribosomal protein S18 >gi|146399197|gb|ABQ27830.1| SSU ribosomal protein S18P [Geobacter uraniireducens Rf4] (91 aa)
Score = 124, Expect = 9.7e-06, Identities = 28/64 (43%), Positives = 42/64 (65%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIP 150
           +R+K C+ CA  Q  +DYKD   L  +++   KI  R+I+  C+KHQ  ++ AIKRAR +AL+P
  S:    20 QRRKVCRFCADKQVSIDYKDPRTLRYFISERGKIIPRRISGNCAKHQREITEAIKRARNIALLP 83
>gi|157825190|ref|YP_001492910.1| 30S ribosomal protein S18 [Rickettsia akari str. Hartford] >gi|166220982|sp|A8GLX7|RS18_RICAH 30S ribosomal protein S18 >gi|157799148|gb|ABV74402.1| 30S ribosomal protein S18 [Rickettsia akari str. Hartford] (95 aa)
Score = 124, Expect = 9.7e-06, Identities = 29/66 (43%), Positives = 44/66 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C L       +DYK+ ELL K+++   ++   +IT  C+K Q +++NAIK ARI+AL+PFV
  S:    26 RRRKGCPLSVHNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILALLPFV 91
>gi|74318121|ref|YP_315861.1| 30S ribosomal protein S18 [Thiobacillus denitrificans ATCC 25259] >gi|74057616|gb|AAZ98056.1| ribosomal protein S18 [Thiobacillus denitrificans ATCC 25259] (95 aa)
Score = 124, Expect = 9.9e-06, Identities = 26/65 (40%), Positives = 44/65 (67%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +R+KFC+  A+    VDYKDV++L +++  N +I   +IT   + +Q ++  AIKRAR +AL+P+
  S:    27 KRRKFCRFTAEKVVEVDYKDVDVLKEFIAENGRIIPARITGTKAHYQRQLGTAIKRARFLALMPY 91
>gi|29840574|ref|NP_829680.1| 30S ribosomal protein S18 [Chlamydophila caviae GPIC] >gi|33301610|sp|Q821W8|RS18_CHLCV 30S ribosomal protein S18 >gi|29834924|gb|AAP05558.1| ribosomal protein S18 [Chlamydophila caviae GPIC] (82 aa)
Score = 124, Expect = 1.0e-05, Identities = 34/77 (44%), Positives = 49/77 (63%)
  Q:    78 NRGYPNKQGRRKKFCKLC---AKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           N+   N + RRK+F K C   + G + +DYKD E L K++T   KI  R+IT   S+ Q  ++ AIKRAR + L+PFV +
  S:     2 NKPVHNNEHRRKRFNKKCPFVSAGWKTIDYKDTETLKKFITERGKILPRRITGVSSRFQGTLTLAIKRARHIGLLPFVAE 81
>gi|87303683|ref|ZP_01086458.1| 30S ribosomal protein S18 [Synechococcus sp. WH 5701] >gi|87281788|gb|EAQ73753.1| 30S ribosomal protein S18 [Synechococcus sp. WH 5701] (73 aa)
Score = 124, Expect = 1.0e-05, Identities = 27/51 (52%), Positives = 39/51 (76%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKDV+LL K++T   KI  R+++   +K Q  ++NA+KRARIVAL+PFV
  S:    19 IDYKDVDLLKKFITERGKILPRRLSGLTAKQQRDLTNAVKRARIVALLPFV 69
>gi|42527183|ref|NP_972281.1| 30S ribosomal protein S18 [Treponema denticola ATCC 35405] >gi|59798792|sp|Q73M34|RS18_TREDE 30S ribosomal protein S18 >gi|41817607|gb|AAS12192.1| ribosomal protein S18 [Treponema denticola ATCC 35405] (89 aa)
Score = 124, Expect = 1.0e-05, Identities = 31/65 (47%), Positives = 46/65 (70%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RKK C+ CA+ +  +DYK+ + L +++T   KI  R+IT  C+KHQ +++  IKRAR VAL+PFV
  S:    23 RKKVCRFCAQ-KVKIDYKEPDALRRFITERGKILPRRITGTCAKHQRKLAVEIKRARAVALLPFV 86
>gi|89898004|ref|YP_515114.1| 30S ribosomal protein S18 [Chlamydophila felis Fe/C-56] >gi|123763226|sp|Q255R9|RS18_CHLFF 30S ribosomal protein S18 >gi|89331376|dbj|BAE80969.1| 30S ribosomal protein S18 [Chlamydophila felis Fe/C-56] (82 aa)
Score = 124, Expect = 1.0e-05, Identities = 33/75 (44%), Positives = 47/75 (62%)
  Q:    78 NRGYPNKQGRRKKFCKLC---AKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           N+   N + RRK+F K C   + G + +DYKD E L K++T   KI  R+IT   S+ Q  ++ AIKRAR +  +PFV
  S:     2 NKPVHNNEHRRKRFNKKCPFVSAGWKTIDYKDTETLKKFITERGKILPRRITGVSSRFQGILTLAIKRARHIGFLPFV 79
>gi|62185391|ref|YP_220176.1| 30S ribosomal protein S18 [Chlamydophila abortus S26/3] >gi|62148458|emb|CAH64228.1| 30S ribosomal protein S18 [Chlamydophila abortus S26/3] (87 aa)
Score = 124, Expect = 1.1e-05, Identities = 33/76 (43%), Positives = 48/76 (63%)
  Q:    77 YNRGYPNKQGRRKKFCKLC---AKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +N+   N + RRK+F K C   + G + +DYKD E L K++T   KI  R+IT   S+ Q  ++ AIKRAR +  +PFV
  S:     6 HNKPVHNNEHRRKRFNKKCPFVSAGWKTIDYKDTETLKKFITEKGKILPRRITGVSSRFQGILTLAIKRARHIGFLPFV 84
>gi|16799118|ref|NP_469386.1| 30S ribosomal protein S18 [Listeria innocua Clip11262] >gi|16802094|ref|NP_463579.1| 30S ribosomal protein S18 [Listeria monocytogenes EGD-e] >gi|46906277|ref|YP_012666.1| 30S ribosomal protein S18 [Listeria monocytogenes str. 4b F2365] >gi|47092171|ref|ZP_00229963.1| ribosomal protein S18 [Listeria monocytogenes str. 4b H7858] >gi|47095114|ref|ZP_00232726.1| ribosomal protein S18 [Listeria monocytogenes str. 1/2a F6854] >gi|116871459|ref|YP_848240.1| 30S ribosomal protein S18 [Listeria welshimeri serovar 6b str. SLCC5334] >gi|153164871|ref|ZP_01926046.1| ribosomal protein S18 [Listeria monocytogenes FSL N1-017] >gi|153176214|ref|ZP_01931473.1| ribosomal protein S18 [Listeria monocytogenes FSL N3-165] >gi|153181078|ref|ZP_01934045.1| ribosomal protein S18 [Listeria monocytogenes F6900] >gi|153184405|ref|ZP_01935164.1| ribosomal protein S18 [Listeria monocytogenes J0161] >gi|153192689|ref|ZP_01939649.1| ribosomal protein S18 [Listeria monocytogenes J2818] >gi|153198012|ref|ZP_01942182.1| ribosomal protein S18 [Listeria monocytogenes 10403S] >gi|153200434|ref|ZP_01942596.1| ribosomal protein S18 [Listeria monocytogenes HPB2262] >gi|167015971|ref|ZP_02278504.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL J1-194] >gi|167052253|ref|ZP_02278651.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL F2-515] >gi|167215497|ref|ZP_02285804.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL R2-503] >gi|167216357|ref|ZP_02285993.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL J1-175] >gi|167342422|ref|ZP_02288352.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL J1-208] >gi|167452782|ref|ZP_02319005.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL J2-064] >gi|168267081|ref|ZP_02689046.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL J2-071] >gi|123463368|sp|A0AEM3|RS18_LISW6 30S ribosomal protein S18 >gi|54039413|sp|P66462|RS18_LISIN 30S ribosomal protein S18 >gi|54042148|sp|P66461|RS18_LISMO 30S ribosomal protein S18 >gi|59798761|sp|Q725B8|RS18_LISMF 30S ribosomal protein S18 >gi|16409405|emb|CAC98261.1| ribosomal protein S18 [Listeria monocytogenes] >gi|16412460|emb|CAC95272.1| ribosomal protein S18 [Listeria innocua] >gi|46879541|gb|AAT02843.1| ribosomal protein S18 [Listeria monocytogenes str. 4b F2365] >gi|47016459|gb|EAL07380.1| ribosomal protein S18 [Listeria monocytogenes str. 1/2a F6854] >gi|47019373|gb|EAL10114.1| ribosomal protein S18 [Listeria monocytogenes str. 4b H7858] >gi|116740337|emb|CAK19455.1| rpsR [Listeria welshimeri serovar 6b str. SLCC5334] >gi|126942908|gb|EBA20642.1| ribosomal protein S18 [Listeria monocytogenes J0161] >gi|127632348|gb|EBA22030.1| ribosomal protein S18 [Listeria monocytogenes 10403S] >gi|127763726|gb|EBA24560.1| ribosomal protein S18 [Listeria monocytogenes J2818] >gi|133728571|gb|EBA30269.1| ribosomal protein S18 [Listeria monocytogenes FSL N1-017] >gi|133728927|gb|EBA30625.1| ribosomal protein S18 [Listeria monocytogenes FSL N3-165] >gi|133731596|gb|EBA33294.1| ribosomal protein S18 [Listeria monocytogenes F6900] >gi|133736712|gb|EBA38410.1| ribosomal protein S18 [Listeria monocytogenes HPB2262] (79 aa)
Score = 124, Expect = 1.1e-05, Identities = 30/66 (45%), Positives = 46/66 (69%)
  Q:    89 KKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           KK C   + G  H+DYKDVELL K+++   KI  R++T   +K+Q +++ AIKR+R +AL+PFV +
  S:    12 KKVCYFTSNGITHIDYKDVELLKKFVSERGKILPRRVTGTSAKYQRKLTVAIKRSRQMALLPFVAE 77
>gi|15891988|ref|NP_359702.1| 30S ribosomal protein S18 [Rickettsia conorii str. Malish 7] >gi|34580977|ref|ZP_00142457.1| 30S ribosomal protein S18 [Rickettsia sibirica 246] >gi|157827936|ref|YP_001494178.1| 30S ribosomal protein S18 [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165932624|ref|YP_001649413.1| 30S ribosomal protein S18 [Rickettsia rickettsii str. Iowa] >gi|166220985|sp|A8GQJ5|RS18_RICRS 30S ribosomal protein S18 >gi|189029685|sp|B0BVY1|RS18_RICRO 30S ribosomal protein S18 >gi|20140122|sp|Q92JK2|RS18_RICCN 30S ribosomal protein S18 >gi|15619102|gb|AAL02603.1| 30S ribosomal protein S18 [Rickettsia conorii str. Malish 7] >gi|28262362|gb|EAA25866.1| 30S ribosomal protein S18 [Rickettsia sibirica 246] >gi|157800417|gb|ABV75670.1| 30S ribosomal protein S18 [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165907711|gb|ABY72007.1| SSU ribosomal protein S18P [Rickettsia rickettsii str. Iowa] (95 aa)
Score = 124, Expect = 1.1e-05, Identities = 29/66 (43%), Positives = 44/66 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C L       +DYK+ ELL K+++   ++   +IT  C+K Q +++NAIK ARI+AL+PFV
  S:    26 RRRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILALLPFV 91
>gi|170288132|ref|YP_001738370.1| ribosomal protein S18 [Thermotoga sp. RQ2] >gi|170175635|gb|ACB08687.1| ribosomal protein S18 [Thermotoga sp. RQ2] (75 aa)
Score = 124, Expect = 1.1e-05, Identities = 27/60 (45%), Positives = 40/60 (66%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVR 153
           LC    ++VDYKD  LL ++LT   KI  +++T  C+KHQ  V  AIKRAR + L+P+++
  S:    15 LCEMKLDYVDYKDTRLLSEFLTDKGKIIPKRLTGTCAKHQRMVKVAIKRARQMGLLPYLK 74
>gi|117929338|ref|YP_873889.1| 30S ribosomal protein S18 [Acidothermus cellulolyticus 11B] >gi|166220918|sp|A0LWU3|RS18_ACIC1 30S ribosomal protein S18 >gi|117649801|gb|ABK53903.1| SSU ribosomal protein S18P [Acidothermus cellulolyticus 11B] (78 aa)
Score = 124, Expect = 1.1e-05, Identities = 26/60 (43%), Positives = 41/60 (68%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           C  C +G  +VDYKD  LL K+++   KI +R++T  C++HQ  V+ AIK +R +AL+P+
  S:    14 CVFCKEGITYVDYKDTNLLRKFISDRGKIRARRVTGNCAQHQRDVATAIKNSREMALLPY 73
>gi|116074877|ref|ZP_01472138.1| 30S ribosomal protein S18 [Synechococcus sp. RS9916] >gi|116068099|gb|EAU73852.1| 30S ribosomal protein S18 [Synechococcus sp. RS9916] (73 aa)
Score = 124, Expect = 1.1e-05, Identities = 27/51 (52%), Positives = 39/51 (76%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKDV+LL K++T   KI  R++T   +K Q  ++NA+KRARIVA++PFV
  S:    19 IDYKDVDLLKKFITERGKILPRRLTGLTAKQQRDLTNAVKRARIVAMLPFV 69
>gi|160902036|ref|YP_001567617.1| ribosomal protein S18 [Petrotoga mobilis SJ95] >gi|160359680|gb|ABX31294.1| ribosomal protein S18 [Petrotoga mobilis SJ95] (76 aa)
Score = 124, Expect = 1.1e-05, Identities = 31/75 (41%), Positives = 46/75 (61%)
  Q:    80 GYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
            Y  K+ +R K CKLC    E++DYKDV  L +++    KI  ++I   C+KHQ  V  AI+RAR + L+P+V +
  S:     2 AYVKKERKRIKKCKLCRDNVEYIDYKDVRKLKEFMNDKGKILPKRINGNCAKHQRMVRTAIQRARKMMLVPYVNE 76
>gi|51598376|ref|YP_072564.1| 30S ribosomal protein S18 [Borrelia garinii PBi] >gi|59798661|sp|Q662P9|RS18_BORGA 30S ribosomal protein S18 >gi|51572947|gb|AAU06972.1| ribosomal protein S18 [Borrelia garinii PBi] (96 aa)
Score = 124, Expect = 1.1e-05, Identities = 35/89 (39%), Positives = 53/89 (59%)
  Q:    65 KEFNPQDRPFAKYNRGYPNKQGRR---KKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVR 153
           ++ N +D  F     G+      R   +K CK C  G+ H DYKD + L K++T   KI  ++IT   +KHQ R++  +KRAR +AL+PFV+
  S:     5 RDVNQRDSRFENQQDGFKKNSNFRFFKRKSCKFCDSGK-HPDYKDFDFLKKFITEQGKILPKRITGTSAKHQRRLALEVKRARYMALLPFVK 95
>gi|160881890|ref|YP_001560858.1| 30S ribosomal protein S18 [Clostridium phytofermentans ISDg] >gi|160430556|gb|ABX44119.1| ribosomal protein S18 [Clostridium phytofermentans ISDg] (91 aa)
Score = 123, Expect = 1.2e-05, Identities = 29/63 (46%), Positives = 42/63 (66%)
  Q:    92 CKLCA-KGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C  CA K  + +DYKDV  L +Y++   KI  R+IT  C+KHQ  ++ A+KRAR +AL+P+  D
  S:    28 CAFCADKNHKEIDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALTVAVKRARHIALMPYTLD 91
>gi|73663680|ref|YP_302461.1| 30S ribosomal protein S18 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|123747836|sp|Q49UQ2|RS18_STAS1 30S ribosomal protein S18 >gi|72496195|dbj|BAE19516.1| 30S ribosomal protein S18 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (80 aa)
Score = 123, Expect = 1.2e-05, Identities = 28/66 (42%), Positives = 45/66 (68%)
  Q:    89 KKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           KK C   A G  H+DYKD ELL ++++   KI  R++T   +K+Q  ++ AIKR+R +AL+P+V++
  S:    13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTLAIKRSRHMALLPYVKE 78
>gi|17231943|ref|NP_488491.1| 30S ribosomal protein S18 [Nostoc sp. PCC 7120] >gi|75907544|ref|YP_321840.1| 30S ribosomal protein S18 [Anabaena variabilis ATCC 29413] >gi|123731561|sp|Q3MDJ1|RS18_ANAVT 30S ribosomal protein S18 >gi|20978694|sp|Q8YNW0|RS18_ANASP 30S ribosomal protein S18 >gi|17133587|dbj|BAB76150.1| 30S ribosomal protein S18 [Nostoc sp. PCC 7120] >gi|75701269|gb|ABA20945.1| SSU ribosomal protein S18P [Anabaena variabilis ATCC 29413] (71 aa)
Score = 123, Expect = 1.2e-05, Identities = 28/56 (50%), Positives = 40/56 (71%)
  Q:    97 KGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           K  E +DYKDV+LL K++T   KI  R+IT   +K Q  ++ AIKR+R+VAL+PF+
  S:    12 KPGEPIDYKDVDLLRKFITERGKILPRRITGLTAKQQRELTLAIKRSRLVALLPFI 67
>gi|172059038|ref|YP_001815498.1| ribosomal protein S18 [Exiguobacterium sibiricum 255-15] >gi|171991559|gb|ACB62481.1| ribosomal protein S18 [Exiguobacterium sibiricum 255-15] (76 aa)
Score = 123, Expect = 1.2e-05, Identities = 27/63 (42%), Positives = 42/63 (66%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C   +    H+DYKDVELL ++++   KI  R++T   +K+Q  ++ AIKR+R +ALIP+V D
  S:    14 CYFTSNHITHIDYKDVELLKRFISERGKILPRRVTGTSAKYQRPLTIAIKRSRQMALIPYVAD 76
>gi|184154485|ref|YP_001842825.1| 30S ribosomal protein S18 [Lactobacillus fermentum IFO 3956] >gi|183225829|dbj|BAG26345.1| 30S ribosomal protein S18 [Lactobacillus fermentum IFO 3956] (78 aa)
Score = 123, Expect = 1.2e-05, Identities = 26/61 (42%), Positives = 43/61 (70%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   E++DYKD +LL ++++   KI  R++T   +K+Q R++ AIKRARI+ L+PFV +
  S:    17 IAANHIEYIDYKDTDLLRRFISERGKILPRRVTGTSAKNQRRLTIAIKRARIMGLLPFVAE 77
>gi|86156546|ref|YP_463331.1| SSU ribosomal protein S18P [Anaeromyxobacter dehalogenans 2CP-C] >gi|85773057|gb|ABC79894.1| SSU ribosomal protein S18P [Anaeromyxobacter dehalogenans 2CP-C] (135 aa)
Score = 123, Expect = 1.2e-05, Identities = 27/62 (43%), Positives = 39/62 (62%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K C+ CA     VDYKD   +  +LT   KI  R+I+  C+KHQ  V+ AIKR R++A++P+
  S:    69 KVCRFCADKTLKVDYKDQGQMKYFLTERGKIIPRRISGNCAKHQREVATAIKRGRMLAILPY 130
>gi|168692471|ref|ZP_02725263.1| 30S ribosomal protein S18 [Borrelia burgdorferi 94a] >gi|195955333|ref|ZP_03094026.1| 30S ribosomal protein S18 [Borrelia burgdorferi CA-11.2a] (96 aa)
Score = 123, Expect = 1.2e-05, Identities = 37/89 (41%), Positives = 53/89 (59%)
  Q:    65 KEFNPQDRPFAKYNRGYPNKQGRR---KKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVR 153
           ++ N +D  F     G+      R   +K CK C  G+ H DYKD E L K++T   KI  ++IT   +KHQ R++  IKRAR +AL+PFV+
  S:     5 RDTNQRDSRFENQQDGFKKNSNFRFFKRKSCKFCDSGK-HPDYKDFEFLKKFITEQGKILPKRITGTSAKHQRRLALEIKRARYMALLPFVK 95
>gi|145618653|ref|ZP_01774710.1| ribosomal protein S18 [Geobacter bemidjiensis Bem] >gi|191163073|ref|ZP_03024950.1| ribosomal protein S18 [Geobacter sp. M21] >gi|144945031|gb|EDJ80099.1| ribosomal protein S18 [Geobacter bemidjiensis Bem] >gi|190995856|gb|EDV71307.1| ribosomal protein S18 [Geobacter sp. M21] >gi|197088496|gb|ACH39767.1| ribosomal protein S18 [Geobacter bemidjiensis Bem] (92 aa)
Score = 123, Expect = 1.2e-05, Identities = 29/64 (45%), Positives = 42/64 (65%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIP 150
           +R+K C+ CA  Q  +DYKD   L  +++   KI  R+I+  CSKHQ  ++ AIKRAR +AL+P
  S:    21 QRRKVCRFCADKQVTIDYKDPRTLRYFVSERGKIIPRRISGNCSKHQREITEAIKRARNIALLP 84
>gi|34499093|ref|NP_903308.1| 30S ribosomal protein S18 [Chromobacterium violaceum ATCC 12472] >gi|59798832|sp|Q7NRY9|RS18_CHRVO 30S ribosomal protein S18 >gi|34104944|gb|AAQ61300.1| 30S ribosomal protein S18 [Chromobacterium violaceum ATCC 12472] (75 aa)
Score = 123, Expect = 1.2e-05, Identities = 27/65 (41%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +RKKFC+  A+G + +DYK V+LL  ++  N KI   +IT   +++Q +++ AIKRAR +A +P+
  S:     7 KRKKFCRFTAEGIKEIDYKSVDLLKDFIAENGKIIPARITGTKARYQRQLTTAIKRARFLAFLPY 71
>gi|42520621|ref|NP_966536.1| 30S ribosomal protein S18 [Wolbachia endosymbiont of Drosophila melanogaster] >gi|58698590|ref|ZP_00373488.1| ribosomal protein S18 [Wolbachia endosymbiont of Drosophila ananassae] >gi|99034686|ref|ZP_01314626.1| hypothetical protein Wendoof_01000557 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] >gi|59798787|sp|Q73GZ6|RS18_WOLPM 30S ribosomal protein S18 >gi|42410360|gb|AAS14470.1| ribosomal protein S18 [Wolbachia endosymbiont of Drosophila melanogaster] >gi|58534886|gb|EAL58987.1| ribosomal protein S18 [Wolbachia endosymbiont of Drosophila ananassae] (91 aa)
Score = 123, Expect = 1.3e-05, Identities = 28/65 (43%), Positives = 42/65 (64%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR K C L A   E +DYK+++LL K+ +   +I  R++T  C+K Q ++  AI RAR +ALIP+
  S:    22 RRSKVCPLAASKDEDIDYKNIDLLSKFTSDYGRILPRRLTGVCAKKQRKLRLAIIRARFLALIPY 86
>gi|169830183|ref|YP_001700341.1| 30S ribosomal protein S18 [Lysinibacillus sphaericus C3-41] >gi|168994671|gb|ACA42211.1| 30S ribosomal protein S18 [Lysinibacillus sphaericus C3-41] (78 aa)
Score = 123, Expect = 1.3e-05, Identities = 26/63 (41%), Positives = 43/63 (68%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C   A    H+DYKDV+LL K+++   KI  R++T   +K+Q ++++AIK +RI+ L+PFV +
  S:    14 CYFTANNITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTSAIKVSRIMGLLPFVAE 76
>gi|148377544|ref|YP_001256420.1| 30S ribosomal protein S18 [Mycoplasma agalactiae PG2] >gi|148291590|emb|CAL58976.1| 30S ribosomal protein S18 [Mycoplasma agalactiae PG2] (107 aa)
Score = 123, Expect = 1.3e-05, Identities = 32/71 (45%), Positives = 50/71 (70%)
  Q:    84 KQGRR-KKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           K+GR  ++ C+LC    E+VDYK+VE + K+++   +I     T  C++HQ +V+NAIKRAR +ALIP+ +D
  S:     8 KKGRNLRRKCELCETNIEYVDYKNVEFITKFISGIGQIKPHVSTGTCARHQRKVANAIKRARFMALIPYTKD 79
>gi|148657503|ref|YP_001277708.1| ribosomal protein S18 [Roseiflexus sp. RS-1] >gi|148569613|gb|ABQ91758.1| SSU ribosomal protein S18P [Roseiflexus sp. RS-1] (90 aa)
Score = 123, Expect = 1.4e-05, Identities = 29/63 (46%), Positives = 40/63 (63%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           K C  CA     VDYKDV+ L + ++   KI  R+ T  C++HQ  ++ AIKRAR +AL+PFV
  S:    22 KVCMFCADQIRVVDYKDVKRLQRCMSERGKILPRRRTGVCARHQRSLTVAIKRARHMALLPFV 84
>gi|15923357|ref|NP_370891.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus Mu50] >gi|15926068|ref|NP_373601.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus N315] >gi|21282072|ref|NP_645160.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus MW2] >gi|49482597|ref|YP_039821.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49485247|ref|YP_042468.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus MSSA476] >gi|57652627|ref|YP_185330.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus COL] >gi|82750079|ref|YP_415820.1| 30S ribosomal protein S18 [Staphylococcus aureus RF122] >gi|87160951|ref|YP_493082.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus USA300] >gi|88194149|ref|YP_498939.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148266854|ref|YP_001245797.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus JH9] >gi|150392900|ref|YP_001315575.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus JH1] >gi|151220571|ref|YP_001331393.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156978695|ref|YP_001440954.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus Mu3] >gi|161508639|ref|YP_001574298.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168729153|ref|ZP_02761430.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|123098065|sp|Q2G111|RS18_STAA8 30S ribosomal protein S18 >gi|123736012|sp|Q2FJP6|RS18_STAA3 30S ribosomal protein S18 >gi|123741000|sp|Q2YVJ0|RS18_STAAB 30S ribosomal protein S18 >gi|166222245|sp|A7WY61|RS18_STAA1 30S ribosomal protein S18 >gi|172048763|sp|A6QE49|RS18_STAAE 30S ribosomal protein S18 >gi|189029691|sp|A6TYM0|RS18_STAA2 30S ribosomal protein S18 >gi|189029692|sp|A5IPU8|RS18_STAA9 30S ribosomal protein S18 >gi|189029693|sp|A8YZJ3|RS18_STAAT 30S ribosomal protein S18 >gi|54039414|sp|P66468|RS18_STAAN 30S ribosomal protein S18 >gi|54039415|sp|P66469|RS18_STAAW 30S ribosomal protein S18 >gi|54042149|sp|P66467|RS18_STAAM 30S ribosomal protein S18 >gi|56749541|sp|Q6GCA5|RS18_STAAS 30S ribosomal protein S18 >gi|56749588|sp|Q6GJV1|RS18_STAAR 30S ribosomal protein S18 >gi|71153727|sp|Q5HIS7|RS18_STAAC 30S ribosomal protein S18 >gi|13700281|dbj|BAB41579.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus N315] >gi|14246135|dbj|BAB56529.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus Mu50] >gi|21203508|dbj|BAB94208.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus MW2] >gi|49240726|emb|CAG39387.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49243690|emb|CAG42114.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus MSSA476] >gi|57286813|gb|AAW38907.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus COL] >gi|82655610|emb|CAI80006.1| 30S ribosomal protein S18 [Staphylococcus aureus RF122] >gi|87126925|gb|ABD21439.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201707|gb|ABD29517.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147739923|gb|ABQ48221.1| SSU ribosomal protein S18P [Staphylococcus aureus subsp. aureus JH9] >gi|149945352|gb|ABR51288.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus JH1] >gi|150373371|dbj|BAF66631.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156720830|dbj|BAF77247.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus Mu3] >gi|160367448|gb|ABX28419.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus USA300_TCH1516] (80 aa)
Score = 123, Expect = 1.4e-05, Identities = 28/66 (42%), Positives = 45/66 (68%)
  Q:    89 KKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           KK C   A G  H+DYKD ELL ++++   KI  R++T   +K+Q  ++ AIKR+R +AL+P+V++
  S:    13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRSRHMALLPYVKE 78
>gi|167750475|ref|ZP_02422602.1| hypothetical protein EUBSIR_01451 [Eubacterium siraeum DSM 15702] >gi|167656626|gb|EDS00756.1| hypothetical protein EUBSIR_01451 [Eubacterium siraeum DSM 15702] (99 aa)
Score = 123, Expect = 1.4e-05, Identities = 40/96 (41%), Positives = 56/96 (58%)
  Q:    59 KSSDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +S  NK++    +R   + +   P K+  RKK C  CA   E +DYKDV  L K +T   KI  R++T  C+ HQ  ++ AIK+AR VALIP+V D
  S:     5 RSDQNKEDKTMSEREKNEKSTVRPMKR-TRKKVCAFCADRAEFIDYKDVAKLRKCMTERYKILPRRVTGCCAYHQRELTTAIKKARQVALIPYVSD 99
>gi|167471171|ref|ZP_02335875.1| SSU ribosomal protein S18P [Rickettsia africae ESF-5] (95 aa)
Score = 123, Expect = 1.4e-05, Identities = 29/66 (43%), Positives = 44/66 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C L       +DYK+ ELL K+++   ++   +IT  C+K Q +++NAIK ARI+AL+PFV
  S:    26 RRRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILALLPFV 91
>gi|88810600|ref|ZP_01125857.1| 30S ribosomal protein S18 [Nitrococcus mobilis Nb-231] >gi|88792230|gb|EAR23340.1| 30S ribosomal protein S18 [Nitrococcus mobilis Nb-231] (74 aa)
Score = 123, Expect = 1.5e-05, Identities = 28/65 (43%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+K+C+  A+G   +DYKD+  L  Y+T   KI   +IT   +K+Q ++++AIKRAR +AL+P+
  S:     6 RRRKYCRFTAEGVREIDYKDLNTLKSYVTETGKIVPSRITGTRAKYQRQLASAIKRARYLALLPY 70
>gi|16123683|ref|NP_406996.1| 30S ribosomal protein S18 [Yersinia pestis CO92] >gi|22124560|ref|NP_667983.1| 30S ribosomal protein S18 [Yersinia pestis KIM] >gi|45440398|ref|NP_991937.1| 30S ribosomal protein S18 [Yersinia pestis biovar Microtus str. 91001] >gi|51594792|ref|YP_068983.1| 30S ribosomal protein S18 [Yersinia pseudotuberculosis IP 32953] >gi|77973978|ref|ZP_00829521.1| COG0238: Ribosomal protein S18 [Yersinia frederiksenii ATCC 33641] >gi|77977620|ref|ZP_00833064.1| COG0238: Ribosomal protein S18 [Yersinia intermedia ATCC 29909] >gi|108806085|ref|YP_650001.1| 30S ribosomal protein S18 [Yersinia pestis Antiqua] >gi|108813441|ref|YP_649208.1| 30S ribosomal protein S18 [Yersinia pestis Nepal516] >gi|123440775|ref|YP_001004767.1| 30S ribosomal protein S18 [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|145600833|ref|YP_001164909.1| 30S ribosomal protein S18 [Yersinia pestis Pestoides F] >gi|153949310|ref|YP_001402591.1| 30S ribosomal protein S18 [Yersinia pseudotuberculosis IP 31758] >gi|153997314|ref|ZP_02022414.1| 30S ribosomal protein S18 [Yersinia pestis CA88-4125] >gi|157368695|ref|YP_001476684.1| 30S ribosomal protein S18 [Serratia proteamaculans 568] >gi|162420420|ref|YP_001605262.1| 30S ribosomal protein S18 [Yersinia pestis Angola] >gi|165928152|ref|ZP_02223984.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165937415|ref|ZP_02225978.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str. IP275] >gi|166011310|ref|ZP_02232208.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213997|ref|ZP_02240032.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str. B42003004] >gi|167401213|ref|ZP_02306713.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167420501|ref|ZP_02312254.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423736|ref|ZP_02315489.1| ribosomal protein S18 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170025997|ref|YP_001722502.1| ribosomal protein S18 [Yersinia pseudotuberculosis YPIII] >gi|186893801|ref|YP_001870913.1| ribosomal protein S18 [Yersinia pseudotuberculosis PB1/+] >gi|122979828|sp|Q1CBW6|RS18_YERPA 30S ribosomal protein S18 >gi|123246216|sp|Q1CEH2|RS18_YERPN 30S ribosomal protein S18 >gi|166222257|sp|A1JIT0|RS18_YERE8 30S ribosomal protein S18 >gi|166222258|sp|A4TRM4|RS18_YERPP 30S ribosomal protein S18 >gi|167011194|sp|A8G8W6|RS18_SERP5 30S ribosomal protein S18 >gi|167011195|sp|A7FMW3|RS18_YERP3 30S ribosomal protein S18 >gi|20978696|sp|Q8ZB83|RS18_YERPE 30S ribosomal protein S18 >gi|59798666|sp|Q66FA0|RS18_YERPS 30S ribosomal protein S18 >gi|21957360|gb|AAM84234.1|AE013667_7 30S ribosomal subunit protein S18 [Yersinia pestis KIM] >gi|45435255|gb|AAS60814.1| 30S ribosomal protein S18 [Yersinia pestis biovar Microtus str. 91001] >gi|51588074|emb|CAH19680.1| 30S ribosomal protein S18 [Yersinia pseudotuberculosis IP 32953] >gi|108777089|gb|ABG19608.1| SSU ribosomal protein S18P [Yersinia pestis Nepal516] >gi|108777998|gb|ABG12056.1| SSU ribosomal protein S18P [Yersinia pestis Antiqua] >gi|115349162|emb|CAL22125.1| 30S ribosomal protein S18 [Yersinia pestis CO92] >gi|122087736|emb|CAL10521.1| 30S ribosomal protein S18 [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|145212529|gb|ABP41936.1| 30S ribosomal protein S18 [Yersinia pestis Pestoides F] >gi|149288951|gb|EDM39031.1| 30S ribosomal protein S18 [Yersinia pestis CA88-4125] >gi|152960805|gb|ABS48266.1| ribosomal protein S18 [Yersinia pseudotuberculosis IP 31758] >gi|157320459|gb|ABV39556.1| ribosomal protein S18 [Serratia proteamaculans 568] >gi|162353235|gb|ABX87183.1| ribosomal protein S18 [Yersinia pestis Angola] >gi|165914520|gb|EDR33134.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str. IP275] >gi|165919839|gb|EDR37140.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165989694|gb|EDR41995.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166204792|gb|EDR49272.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str. B42003004] >gi|166961307|gb|EDR57328.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167049238|gb|EDR60646.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057906|gb|EDR67652.1| ribosomal protein S18 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752531|gb|ACA70049.1| ribosomal protein S18 [Yersinia pseudotuberculosis YPIII] >gi|186696827|gb|ACC87456.1| ribosomal protein S18 [Yersinia pseudotuberculosis PB1/+] (75 aa)
Score = 123, Expect = 1.5e-05, Identities = 27/65 (41%), Positives = 44/65 (67%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G   +DYKD+  L  Y+T + KI   +IT   +K+Q +++  IKRAR ++L+P+
  S:     6 RRRKFCRFTAEGVVEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARCIKRARYLSLLPY 70
>gi|15603919|ref|NP_220434.1| 30S ribosomal protein S18 [Rickettsia prowazekii str. Madrid E] >gi|6226086|sp|Q9ZEA5|RS18_RICPR 30S ribosomal protein S18 >gi|3860610|emb|CAA14511.1| 30S RIBOSOMAL PROTEIN S18 (rpsR) [Rickettsia prowazekii] (95 aa)
Score = 122, Expect = 1.5e-05, Identities = 29/66 (43%), Positives = 44/66 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C L       +DYK+ ELL K+++   ++   +IT  C+K Q +++NAIK ARI+AL+PFV
  S:    26 RRRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILALLPFV 91
>gi|153872064|ref|ZP_02001064.1| Ribosomal protein S18 [Beggiatoa sp. PS] >gi|152071467|gb|EDN68933.1| Ribosomal protein S18 [Beggiatoa sp. PS] (75 aa)
Score = 122, Expect = 1.5e-05, Identities = 28/65 (43%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RRKK+C+  A+G + +DYKD+ LL  Y+T   KI   +IT   +K+Q +++ A+K AR +AL+P+
  S:     6 RRKKYCRFTAEGIKEIDYKDLNLLKGYVTETGKIVPSRITGTRTKYQRQLATAVKLARFLALLPY 70
>gi|56750435|ref|YP_171136.1| 30S ribosomal protein S18 [Synechococcus elongatus PCC 6301] >gi|81299932|ref|YP_400140.1| 30S ribosomal protein S18 [Synechococcus elongatus PCC 7942] >gi|81676949|sp|Q5N503|RS18_SYNP6 30S ribosomal protein S18 >gi|123769262|sp|Q31P66|RS18_SYNP7 30S ribosomal protein S18 >gi|56685394|dbj|BAD78616.1| 30S ribosomal protein S18 [Synechococcus elongatus PCC 6301] >gi|81168813|gb|ABB57153.1| SSU ribosomal protein S18P [Synechococcus elongatus PCC 7942] (71 aa)
Score = 122, Expect = 1.5e-05, Identities = 27/56 (48%), Positives = 40/56 (71%)
  Q:    97 KGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           K  + +DYKDV+LL K++T   KI  R+IT   ++ Q  ++ AIKRARI+AL+PF+
  S:    12 KPSDPIDYKDVDLLRKFITERGKILPRRITGLTARQQRDLAVAIKRARILALLPFL 67
>gi|148260511|ref|YP_001234638.1| 30S ribosomal protein S18 [Acidiphilium cryptum JF-5] >gi|146402192|gb|ABQ30719.1| SSU ribosomal protein S18P [Acidiphilium cryptum JF-5] (95 aa)
Score = 122, Expect = 1.6e-05, Identities = 29/68 (42%), Positives = 41/68 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RR+K C         +DYKDV LL ++L+   KI   +IT   +K Q  ++ AIKRAR +AL+P+V D
  S:    28 RRRKACPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELARAIKRARFLALLPYVVD 95
>gi|121605292|ref|YP_982621.1| ribosomal protein S18 [Polaromonas naphthalenivorans CJ2] >gi|166220969|sp|A1VPX2|RS18_POLNA 30S ribosomal protein S18 >gi|120594261|gb|ABM37700.1| SSU ribosomal protein S18P [Polaromonas naphthalenivorans CJ2] (94 aa)
Score = 122, Expect = 1.6e-05, Identities = 30/87 (34%), Positives = 51/87 (58%)
  Q:    65 KEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K FN   RP     R   +   +RK+FC+  A G E +DYKD++ L  +++ N KI   ++T   +  Q +++ A+KRAR +A++P+
  S:     5 KRFNKDKRP----KRNTQSLLFKRKRFCRFTAAGVEEIDYKDIDTLRDFVSENGKIIPARLTGTRAIFQRQINTAVKRARFLAMLPY 87
>gi|30265490|ref|NP_847867.1| 30S ribosomal protein S18 [Bacillus anthracis str. Ames] >gi|47531058|ref|YP_022407.1| 30S ribosomal protein S18 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49188309|ref|YP_031562.1| 30S ribosomal protein S18 [Bacillus anthracis str. Sterne] >gi|49481204|ref|YP_039462.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52145280|ref|YP_086737.1| 30S ribosomal protein S18 [Bacillus cereus E33L] >gi|65317453|ref|ZP_00390412.1| COG0238: Ribosomal protein S18 [Bacillus anthracis str. A2012] >gi|118480500|ref|YP_897651.1| 30S ribosomal protein S18 [Bacillus thuringiensis str. Al Hakam] >gi|163943152|ref|YP_001648036.1| 30S ribosomal protein S18 [Bacillus weihenstephanensis KBAB4] >gi|165873035|ref|ZP_02217656.1| ribosomal protein S18 [Bacillus anthracis str. A0488] >gi|166997087|ref|ZP_02263546.1| ribosomal protein S18 [Bacillus cereus AH820] >gi|167635075|ref|ZP_02393392.1| ribosomal protein S18 [Bacillus anthracis str. A0442] >gi|167641758|ref|ZP_02400001.1| ribosomal protein S18 [Bacillus anthracis str. A0193] >gi|170689458|ref|ZP_02880648.1| ribosomal protein S18 [Bacillus anthracis str. A0465] >gi|170707550|ref|ZP_02898003.1| ribosomal protein S18 [Bacillus anthracis str. A0389] >gi|177655284|ref|ZP_02936838.1| ribosomal protein S18 [Bacillus anthracis str. A0174] >gi|190569300|ref|ZP_03022194.1| ribosomal protein S18 [Bacillus anthracis Tsiankovskii-I] >gi|196036074|ref|ZP_03103474.1| ribosomal protein S18 [Bacillus cereus W] >gi|196041980|ref|ZP_03109267.1| ribosomal protein S18 [Bacillus cereus NVH0597-99] >gi|196045471|ref|ZP_03112702.1| ribosomal protein S18 [Bacillus cereus 03BB108] >gi|166220922|sp|A0RLQ1|RS18_BACAH 30S ribosomal protein S18 >gi|59798636|sp|Q630D0|RS18_BACCZ 30S ribosomal protein S18 >gi|59798712|sp|Q6HAG4|RS18_BACHK 30S ribosomal protein S18 >gi|59798878|sp|Q81JI4|RS18_BACAN 30S ribosomal protein S18 >gi|30260168|gb|AAP29353.1| ribosomal protein S18 [Bacillus anthracis str. Ames] >gi|47506206|gb|AAT34882.1| ribosomal protein S18 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49182236|gb|AAT57612.1| ribosomal protein S18 [Bacillus anthracis str. Sterne] >gi|49332760|gb|AAT63406.1| ribosomal protein S18 (30S ribosomal protein S18) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51978749|gb|AAU20299.1| ribosomal protein S18 (30S ribosomal protein S18) [Bacillus cereus E33L] >gi|118419725|gb|ABK88144.1| SSU ribosomal protein S18P [Bacillus thuringiensis str. Al Hakam] >gi|163865349|gb|ABY46408.1| ribosomal protein S18 [Bacillus weihenstephanensis KBAB4] >gi|164711247|gb|EDR16803.1| ribosomal protein S18 [Bacillus anthracis str. A0488] >gi|167510312|gb|EDR85715.1| ribosomal protein S18 [Bacillus anthracis str. A0193] >gi|167529549|gb|EDR92299.1| ribosomal protein S18 [Bacillus anthracis str. A0442] >gi|170127546|gb|EDS96420.1| ribosomal protein S18 [Bacillus anthracis str. A0389] >gi|170666560|gb|EDT17333.1| ribosomal protein S18 [Bacillus anthracis str. A0465] >gi|172080211|gb|EDT65303.1| ribosomal protein S18 [Bacillus anthracis str. A0174] >gi|190559607|gb|EDV13598.1| ribosomal protein S18 [Bacillus anthracis Tsiankovskii-I] >gi|195991241|gb|EDX55209.1| ribosomal protein S18 [Bacillus cereus W] >gi|196023678|gb|EDX62354.1| ribosomal protein S18 [Bacillus cereus 03BB108] >gi|196027235|gb|EDX65855.1| ribosomal protein S18 [Bacillus cereus NVH0597-99] (77 aa)
Score = 122, Expect = 1.6e-05, Identities = 28/73 (38%), Positives = 48/73 (65%)
  Q:    80 GYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           G    + +R+K C   + G   +DYKDV+LL ++++   KI  R++T   +K+Q +++ AIKRAR +AL+P+V
  S:     3 GRKGGRAKRRKVCFFTSNGITRIDYKDVDLLKRFVSERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLPYV 75
>gi|160900659|ref|YP_001566241.1| ribosomal protein S18 [Delftia acidovorans SPH-1] >gi|160366243|gb|ABX37856.1| ribosomal protein S18 [Delftia acidovorans SPH-1] (93 aa)
Score = 122, Expect = 1.6e-05, Identities = 32/87 (36%), Positives = 51/87 (58%)
  Q:    65 KEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K+FN   RP     R   +   +RK+FC+    G E +DYKDV+ L  ++  N KI   ++T   + +Q +++ AIKRAR +AL+P+
  S:     5 KKFNKDKRP----KRNTQSLLFKRKRFCRFTVAGVEEIDYKDVDTLRDFIGENGKIVPARLTGTRAIYQRQLNTAIKRARFLALVPY 87
>gi|51473301|ref|YP_067058.1| 30S ribosomal protein S18 [Rickettsia typhi str. Wilmington] >gi|59798674|sp|Q68XR6|RS18_RICTY 30S ribosomal protein S18 >gi|51459613|gb|AAU03576.1| 30S ribosomal protein S18 [Rickettsia typhi str. Wilmington] (95 aa)
Score = 122, Expect = 1.6e-05, Identities = 29/66 (43%), Positives = 44/66 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C L       +DYK+ ELL K+++   ++   +IT  C+K Q +++NAIK ARI+AL+PFV
  S:    26 RRRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILALLPFV 91
>gi|114569762|ref|YP_756442.1| SSU ribosomal protein S18P [Maricaulis maris MCS10] >gi|114340224|gb|ABI65504.1| SSU ribosomal protein S18P [Maricaulis maris MCS10] (84 aa)
Score = 122, Expect = 1.6e-05, Identities = 27/68 (39%), Positives = 42/68 (61%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RR+K C    +    +D+KD +LL +Y++   KI   +IT   +K Q  ++ AIKRAR +AL+P+V D
  S:    17 RRRKVCPFSGENAPAIDFKDPKLLLRYMSERGKIVPSRITAVSAKKQRELARAIKRARQLALLPYVVD 84
>gi|73541692|ref|YP_296212.1| 30S ribosomal protein S18 [Ralstonia eutropha JMP134] >gi|72119105|gb|AAZ61368.1| SSU ribosomal protein S18P [Ralstonia eutropha JMP134] (92 aa)
Score = 122, Expect = 1.6e-05, Identities = 32/94 (34%), Positives = 52/94 (55%)
  Q:    58 KKSSDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K+ + NKK F  Q+  F            +RK+FC+    G E +DYKD++ L  ++  N KI   ++T   + +Q ++  AIKRAR +AL+P+
  S:     5 KRDNKNKKRFQQQNPLF------------KRKRFCRFTVAGVEQIDYKDLDTLKDFIGDNGKITPARLTGTKAHYQRQLDTAIKRARFLALMPY 86
>gi|15603043|ref|NP_246115.1| 30S ribosomal protein S18 [Pasteurella multocida subsp. multocida str. Pm70] >gi|13431845|sp|P57916|RS18_PASMU 30S ribosomal protein S18 >gi|12721529|gb|AAK03262.1| RpS18 [Pasteurella multocida subsp. multocida str. Pm70] (75 aa)
Score = 122, Expect = 1.7e-05, Identities = 29/65 (44%), Positives = 44/65 (67%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+    +DYKDV  L  Y+T + KI   +IT   +K+Q +++ AIKRAR +AL+P+
  S:     6 RRRKFCRFTAENVVEIDYKDVATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLALLPY 70
>gi|22537851|ref|NP_688702.1| 30S ribosomal protein S18 [Streptococcus agalactiae 2603V/R] >gi|25011796|ref|NP_736191.1| 30S ribosomal protein S18 [Streptococcus agalactiae NEM316] >gi|76786818|ref|YP_330321.1| 30S ribosomal protein S18 [Streptococcus agalactiae A909] >gi|76798964|ref|ZP_00781165.1| ribosomal protein S18 [Streptococcus agalactiae 18RS21] >gi|77406986|ref|ZP_00784002.1| ribosomal protein S18 [Streptococcus agalactiae H36B] >gi|77410339|ref|ZP_00786755.1| ribosomal protein S18 [Streptococcus agalactiae COH1] >gi|77412637|ref|ZP_00788913.1| ribosomal protein S18 [Streptococcus agalactiae CJB111] >gi|123601328|sp|Q3JZI2|RS18_STRA1 30S ribosomal protein S18 >gi|59798902|sp|Q8DXY3|RS18_STRA5 30S ribosomal protein S18 >gi|59798903|sp|Q8E3K2|RS18_STRA3 30S ribosomal protein S18 >gi|22534746|gb|AAN00575.1|AE014269_19 ribosomal protein S18 [Streptococcus agalactiae 2603V/R] >gi|24413337|emb|CAD47416.1| 30S ribosomal protein S18 [Streptococcus agalactiae NEM316] >gi|76561875|gb|ABA44459.1| ribosomal protein S18 [Streptococcus agalactiae A909] >gi|76585685|gb|EAO62242.1| ribosomal protein S18 [Streptococcus agalactiae 18RS21] >gi|77161309|gb|EAO72344.1| ribosomal protein S18 [Streptococcus agalactiae CJB111] >gi|77171052|gb|EAO74505.1| ribosomal protein S18 [Streptococcus agalactiae COH1] >gi|77174410|gb|EAO77263.1| ribosomal protein S18 [Streptococcus agalactiae H36B] (79 aa)
Score = 122, Expect = 1.7e-05, Identities = 31/68 (45%), Positives = 48/68 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RRKK   + A   E+VDYKD ELL ++++   KI  R++T   +K+Q +V+ AIKRAR++AL+P+V +
  S:    11 RRKKVDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTAIKRARVMALMPYVNE 78
>gi|150387887|ref|YP_001317936.1| ribosomal protein S18 [Alkaliphilus metalliredigens QYMF] >gi|149947749|gb|ABR46277.1| ribosomal protein S18 [Alkaliphilus metalliredigens QYMF] (76 aa)
Score = 122, Expect = 1.8e-05, Identities = 27/63 (42%), Positives = 39/63 (61%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C  CA     +DYK+V  L KY+T   KI  R+I+  C+ HQ  ++ AIKR+R +AL+P+  D
  S:    14 CTFCADKSSKIDYKEVHKLKKYVTERGKILPRRISGNCAIHQRDITQAIKRSRHIALLPYTID 76
>gi|94310915|ref|YP_584125.1| 30S ribosomal protein S18 [Ralstonia metallidurans CH34] >gi|113868253|ref|YP_726742.1| 30S ribosomal protein S18 [Ralstonia eutropha H16] >gi|122946776|sp|Q0K9E7|RS18_RALEH 30S ribosomal protein S18 >gi|122987924|sp|Q1LLX0|RS18_RALME 30S ribosomal protein S18 >gi|93354767|gb|ABF08856.1| SSU ribosomal protein S18P [Ralstonia metallidurans CH34] >gi|113527029|emb|CAJ93374.1| SSU ribosomal protein S18 [Ralstonia eutropha H16] (92 aa)
Score = 122, Expect = 1.8e-05, Identities = 32/94 (34%), Positives = 52/94 (55%)
  Q:    58 KKSSDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K+ + NKK F  Q+  F            +RK+FC+    G E +DYKD++ L  ++  N KI   ++T   + +Q ++  AIKRAR +AL+P+
  S:     5 KRDNKNKKRFQQQNPLF------------KRKRFCRFTVAGVEQIDYKDLDTLKDFIGDNGKITPARLTGTKAHYQRQLDTAIKRARFLALMPY 86
>gi|52424526|ref|YP_087663.1| 30S ribosomal protein S18 [Mannheimia succiniciproducens MBEL55E] >gi|113461579|ref|YP_719648.1| 30S ribosomal protein S18 [Haemophilus somnus 129PT] >gi|152978437|ref|YP_001344066.1| 30S ribosomal protein S18 [Actinobacillus succinogenes 130Z] >gi|170718759|ref|YP_001783944.1| ribosomal protein S18 [Haemophilus somnus 2336] >gi|123132188|sp|Q0I4E7|RS18_HAES1 30S ribosomal protein S18 >gi|171704224|sp|A6VMD4|RS18_ACTSZ 30S ribosomal protein S18 >gi|189029679|sp|B0US45|RS18_HAES2 30S ribosomal protein S18 >gi|59798655|sp|Q65VD2|RS18_MANSM 30S ribosomal protein S18 >gi|52306578|gb|AAU37078.1| RpsR protein [Mannheimia succiniciproducens MBEL55E] >gi|112823622|gb|ABI25711.1| SSU ribosomal protein S18P [Haemophilus somnus 129PT] >gi|150840160|gb|ABR74131.1| ribosomal protein S18 [Actinobacillus succinogenes 130Z] >gi|168826888|gb|ACA32259.1| ribosomal protein S18 [Haemophilus somnus 2336] (75 aa)
Score = 122, Expect = 1.8e-05, Identities = 28/65 (43%), Positives = 44/65 (67%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+    +DYKD+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR +AL+P+
  S:     6 RRRKFCRFTAENVVEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLALLPY 70
>gi|15594459|ref|NP_212247.1| 30S ribosomal protein S18 [Borrelia burgdorferi B31] >gi|167931794|ref|ZP_02518881.1| 30S ribosomal protein S18 [Borrelia burgdorferi 156a] >gi|167933593|ref|ZP_02520668.1| 30S ribosomal protein S18 [Borrelia burgdorferi ZS7] >gi|167943776|ref|ZP_02530850.1| 30S ribosomal protein S18 [Borrelia burgdorferi Bol26] >gi|168526395|ref|ZP_02720034.1| 30S ribosomal protein S18 [Borrelia burgdorferi 118a] >gi|168579947|ref|ZP_02723935.1| 30S ribosomal protein S18 [Borrelia burgdorferi 72a] >gi|195949916|ref|ZP_03091016.1| 30S ribosomal protein S18 [Borrelia burgdorferi WI91-23] >gi|195950727|ref|ZP_03091824.1| 30S ribosomal protein S18 [Borrelia burgdorferi 29805] >gi|195958804|ref|ZP_03095013.1| 30S ribosomal protein S18 [Borrelia sp. SV1] >gi|6226082|sp|O51140|RS18_BORBU 30S ribosomal protein S18 >gi|2687990|gb|AAC66493.1| ribosomal protein S18 (rpsR) [Borrelia burgdorferi B31] (96 aa)
Score = 122, Expect = 1.8e-05, Identities = 36/89 (40%), Positives = 53/89 (59%)
  Q:    65 KEFNPQDRPFAKYNRGYPNKQGRR---KKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVR 153
           ++ N +D  F     G+      R   +K CK C  G+ H DYKD + L K++T   KI  ++IT   +KHQ R++  IKRAR +AL+PFV+
  S:     5 RDTNQRDSRFENQQDGFKKNSNFRFFKRKSCKFCDSGK-HPDYKDFDFLKKFITEQGKILPKRITGTSAKHQRRLALEIKRARYMALLPFVK 95
>gi|170077198|ref|YP_001733836.1| ribosomal protein S18 [Synechococcus sp. PCC 7002] >gi|169884867|gb|ACA98580.1| ribosomal protein S18 [Synechococcus sp. PCC 7002] (71 aa)
Score = 122, Expect = 1.8e-05, Identities = 27/51 (52%), Positives = 38/51 (74%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKDVELL K++T   KI  R+IT   ++ Q  V+ AIKRAR++AL+PF+
  S:    17 IDYKDVELLRKFITERGKILPRRITGLTARQQRDVNTAIKRARMLALLPFI 67
>gi|53715145|ref|YP_101137.1| 30S ribosomal protein S18 [Bacteroides fragilis YCH46] >gi|60683081|ref|YP_213225.1| 30S ribosomal protein S18 [Bacteroides fragilis NCTC 9343] >gi|81313865|sp|Q5L9B6|RS18_BACFN 30S ribosomal protein S18 >gi|59798649|sp|Q64PH8|RS18_BACFR 30S ribosomal protein S18 >gi|52218010|dbj|BAD50603.1| 30S ribosomal protein S18 [Bacteroides fragilis YCH46] >gi|60494515|emb|CAH09312.1| putative 30S ribosomal protein S18 [Bacteroides fragilis NCTC 9343] (90 aa)
Score = 122, Expect = 1.9e-05, Identities = 28/57 (49%), Positives = 38/57 (66%)
  Q:    98 GQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           G +++DYKD E L K+L    KI  R+IT    K Q R++ A+KRAR +AL+PFV D
  S:    31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPFVTD 87
>gi|187251761|ref|YP_001876243.1| ribosomal protein S18 [Elusimicrobium minutum Pei191] >gi|186971921|gb|ACC98906.1| ribosomal protein S18 [Elusimicrobium minutum Pei191] (113 aa)
Score = 122, Expect = 1.9e-05, Identities = 35/113 (30%), Positives = 63/113 (55%)
  Q:    39 STAKKATTASVEKTEVKETKKSSDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           S  K   T +  +   +   ++  +++   P   PF K       +   R+K CKLCA+  E+VDYK+ + +  +   + KI SR+IT  C+KHQ ++++A+KR R +A++P+
  S:     2 SEEKIVNTEAAPEAVAERPARAERSERPERPAKGPFGK------KRFESRRKVCKLCAEKIENVDYKNFQFIKSFTMDSGKILSRRITGTCAKHQRQIASAVKRDRNLAILPY 108
>gi|187923778|ref|YP_001895420.1| ribosomal protein S18 [Burkholderia phytofirmans PsJN] >gi|187714972|gb|ACD16196.1| ribosomal protein S18 [Burkholderia phytofirmans PsJN] (91 aa)
Score = 122, Expect = 1.9e-05, Identities = 33/83 (39%), Positives = 49/83 (59%)
  Q:    69 PQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           P  + F K  R   N   +RKKFC+  A   +H+DYKD+E L  ++  N KI   ++T   S +Q ++  AIKRAR +AL+P+
  S:     4 PTGKKFDK-RRQQQNPLFKRKKFCRFTAANVDHIDYKDLETLKDFIGENGKITPARLTGTKSHYQRQLDTAIKRARFLALVPY 85
>gi|118726032|ref|ZP_01574665.1| ribosomal protein S18 [Clostridium cellulolyticum H10] >gi|118664588|gb|EAV71217.1| ribosomal protein S18 [Clostridium cellulolyticum H10] (97 aa)
Score = 122, Expect = 2.0e-05, Identities = 27/64 (42%), Positives = 42/64 (65%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +KK C  C      +DYKDV  + KY++   KI  R+I+  C+KHQ +++ A+KRAR +AL+P+
  S:    31 KKKVCSFCVDKATDIDYKDVAKIRKYVSERGKILPRRISGNCAKHQRQLTVAVKRARHIALLPY 94
>gi|15675656|ref|NP_269830.1| 30S ribosomal protein S18 [Streptococcus pyogenes M1 GAS] >gi|19746762|ref|NP_607898.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS8232] >gi|21911116|ref|NP_665384.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS315] >gi|28895199|ref|NP_801549.1| 30S ribosomal protein S18 [Streptococcus pyogenes SSI-1] >gi|50914911|ref|YP_060883.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS10394] >gi|71904202|ref|YP_281005.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS6180] >gi|71911366|ref|YP_282916.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS5005] >gi|94989188|ref|YP_597289.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS9429] >gi|94991129|ref|YP_599229.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS10270] >gi|94993075|ref|YP_601174.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS2096] >gi|94995008|ref|YP_603106.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS10750] >gi|139473173|ref|YP_001127888.1| 30S ribosomal protein S18 [Streptococcus pyogenes str. Manfredo] >gi|195977489|ref|YP_002122733.1| 30S ribosomal protein S18 [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|122986815|sp|Q1J524|RS18_STRPF 30S ribosomal protein S18 >gi|123080292|sp|Q1JF74|RS18_STRPD 30S ribosomal protein S18 >gi|123382262|sp|Q1JA31|RS18_STRPB 30S ribosomal protein S18 >gi|123382494|sp|Q1JK78|RS18_STRPC 30S ribosomal protein S18 >gi|123761392|sp|Q48RL0|RS18_STRPM 30S ribosomal protein S18 >gi|166222246|sp|A2RCR6|RS18_STRPG 30S ribosomal protein S18 >gi|54039418|sp|P66476|RS18_STRP3 30S ribosomal protein S18 >gi|54039419|sp|P66477|RS18_STRP8 30S ribosomal protein S18 >gi|54042151|sp|P66475|RS18_STRP1 30S ribosomal protein S18 >gi|59798612|sp|Q5XA63|RS18_STRP6 30S ribosomal protein S18 >gi|13622868|gb|AAK34551.1| 30S ribosomal protein S18 [Streptococcus pyogenes M1 GAS] >gi|19748993|gb|AAL98397.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS8232] >gi|21905326|gb|AAM80187.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS315] >gi|28810445|dbj|BAC63382.1| 30S ribosomal protein S18 [Streptococcus pyogenes SSI-1] >gi|50903985|gb|AAT87700.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS10394] >gi|71803297|gb|AAX72650.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS6180] >gi|71854148|gb|AAZ52171.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS5005] >gi|94542696|gb|ABF32745.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS9429] >gi|94544637|gb|ABF34685.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS10270] >gi|94546583|gb|ABF36630.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS2096] >gi|94548516|gb|ABF38562.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS10750] >gi|134271419|emb|CAM29639.1| 30S ribosomal protein S18 [Streptococcus pyogenes str. Manfredo] >gi|195974194|gb|ACG61720.1| 30S ribosomal protein S18 [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (79 aa)
Score = 121, Expect = 2.0e-05, Identities = 31/68 (45%), Positives = 48/68 (70%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RRKK   + A   E+VDYKD ELL ++++   KI  R++T   +K+Q +V+ AIKRAR++AL+P+V +
  S:    11 RRKKVDFIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTAIKRARVMALMPYVNE 78
>gi|154247048|ref|YP_001418006.1| ribosomal protein S18 [Xanthobacter autotrophicus Py2] >gi|154161133|gb|ABS68349.1| ribosomal protein S18 [Xanthobacter autotrophicus Py2] (88 aa)
Score = 121, Expect = 2.0e-05, Identities = 28/66 (42%), Positives = 39/66 (59%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKDV LL +Y++   KI   +IT   +K Q  +S AIKR+R + L+PFV
  S:    21 RRRKTCPFSGPNAPKIDYKDVRLLQRYISERGKIVPSRITAVSAKKQRELSAAIKRSRFLGLLPFV 86
>gi|91788895|ref|YP_549847.1| SSU ribosomal protein S18P [Polaromonas sp. JS666] >gi|123059688|sp|Q128U3|RS18_POLSJ 30S ribosomal protein S18 >gi|91698120|gb|ABE44949.1| SSU ribosomal protein S18P [Polaromonas sp. JS666] (94 aa)
Score = 121, Expect = 2.0e-05, Identities = 30/87 (34%), Positives = 50/87 (57%)
  Q:    65 KEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K FN   RP     R   +   +RK+FC+  A G E +DYKD++ L  ++  N KI   ++T   +  Q +++ A+KRAR +A++P+
  S:     5 KRFNKDKRP----KRNTQSLLFKRKRFCRFTAAGVEEIDYKDIDTLRDFVAENGKIIPARLTGTRAIFQRQINTAVKRARFLAMLPY 87
>gi|167730534|emb|CAO81446.1| 30S ribosomal subunit protein S18 [Candidatus Cloacamonas acidaminovorans] (78 aa)
Score = 121, Expect = 2.0e-05, Identities = 25/61 (40%), Positives = 42/61 (68%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           C+ CA  +  +DYK++++L  Y++   KI   ++T  C+KHQ +++  IKRAR +ALIP+V
  S:    16 CRFCANKEIQIDYKNIDVLKPYISEVGKIEPARLTGTCAKHQRKLTTEIKRARQMALIPYV 76
>gi|58038780|ref|YP_190744.1| 30S ribosomal protein S18 [Gluconobacter oxydans 621H] >gi|58001194|gb|AAW60088.1| SSU ribosomal protein S18P [Gluconobacter oxydans 621H] (96 aa)
Score = 121, Expect = 2.0e-05, Identities = 28/66 (42%), Positives = 40/66 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKDV LL ++L+   KI   +IT   +K Q  ++ AIKRAR +AL+P+V
  S:    29 RRRKSCPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELAQAIKRARFLALLPYV 94
>gi|72382180|ref|YP_291535.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. NATL2A] >gi|124025720|ref|YP_001014836.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. NATL1A] >gi|123759898|sp|Q46KZ6|RS18_PROMT 30S ribosomal protein S18 >gi|166220971|sp|A2C261|RS18_PROM1 30S ribosomal protein S18 >gi|72002030|gb|AAZ57832.1| SSU ribosomal protein S18P [Prochlorococcus marinus str. NATL2A] >gi|123960788|gb|ABM75571.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. NATL1A] (73 aa)
Score = 121, Expect = 2.0e-05, Identities = 27/51 (52%), Positives = 38/51 (74%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKDVELL K++T   KI  R++T   +K Q  ++ A+KRARI+AL+PFV
  S:    19 IDYKDVELLKKFITDRGKILPRRLTGLTAKQQRDLTTAVKRARIIALLPFV 69
>gi|145652240|gb|ABP88170.1| hypothetical protein [Borrelia lonestari] (124 aa)
Score = 121, Expect = 2.1e-05, Identities = 31/72 (43%), Positives = 45/72 (62%)
  Q:    82 PNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVR 153
           PN +  +KK CK C   +   DYKD + L K++T   KI  R+IT   +KHQ  ++  IK+AR +AL+PFV+
  S:    53 PNFRFFKKKTCKFCDIDKVP-DYKDFDFLKKFITDQGKILPRRITGTSAKHQRCLALEIKKARYMALLPFVK 123
>gi|120609917|ref|YP_969595.1| SSU ribosomal protein S18P [Acidovorax avenae subsp. citrulli AAC00-1] >gi|166220916|sp|A1TLI3|RS18_ACIAC 30S ribosomal protein S18 >gi|120588381|gb|ABM31821.1| SSU ribosomal protein S18P [Acidovorax avenae subsp. citrulli AAC00-1] (93 aa)
Score = 121, Expect = 2.1e-05, Identities = 32/87 (36%), Positives = 51/87 (58%)
  Q:    65 KEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K+FN   RP     R   +   +RK+FC+    G E +DYKDV+ L  ++  N KI   ++T   + +Q +++ AIKRAR +AL+P+
  S:     5 KKFNKDKRP----KRNTQSLLFKRKRFCRFTVAGVEEIDYKDVDTLRDFIAENGKIIPARLTGTRAIYQRQLNTAIKRARFLALVPY 87
>gi|67458534|ref|YP_246158.1| 30S ribosomal protein S18 [Rickettsia felis URRWXCal2] >gi|75536999|sp|Q4UN65|RS18_RICFE 30S ribosomal protein S18 >gi|67004067|gb|AAY60993.1| 30S ribosomal protein S18 [Rickettsia felis URRWXCal2] (95 aa)
Score = 121, Expect = 2.2e-05, Identities = 29/66 (43%), Positives = 44/66 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C L       +DYK+ ELL K+++   ++   +IT  C+K Q +++NAIK ARI+AL+PFV
  S:    26 RRRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILALLPFV 91
>gi|167755264|ref|ZP_02427391.1| hypothetical protein CLORAM_00769 [Clostridium ramosum DSM 1402] >gi|167705314|gb|EDS19893.1| hypothetical protein CLORAM_00769 [Clostridium ramosum DSM 1402] (76 aa)
Score = 121, Expect = 2.3e-05, Identities = 29/65 (44%), Positives = 44/65 (67%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RKK C        ++DYKDVELL ++++ N KI  R++T   +K+Q  ++ AIKRAR +AL+P+V
  S:    10 RKKVCYFTKNKITYIDYKDVELLKRFVSANGKIIPRRVTGTSAKYQRMLATAIKRARQMALLPYV 74
>gi|118726048|ref|ZP_01574681.1| ribosomal protein S18 [Clostridium cellulolyticum H10] >gi|118664604|gb|EAV71233.1| ribosomal protein S18 [Clostridium cellulolyticum H10] (96 aa)
Score = 121, Expect = 2.3e-05, Identities = 26/67 (38%), Positives = 43/67 (64%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +KK C  C      +DYKD+  + KY++   KI  R+I+  C+KHQ +++ A+KRAR +AL+P+  +
  S:    30 KKKVCSFCVDKATDIDYKDIAKIRKYVSERGKILPRRISGNCAKHQRQLTVAVKRARHIALLPYTAE 96
>gi|150384307|ref|ZP_01923007.1| ribosomal protein S18 [Victivallis vadensis ATCC BAA-548] >gi|150259288|gb|EDM96528.1| ribosomal protein S18 [Victivallis vadensis ATCC BAA-548] (77 aa)
Score = 121, Expect = 2.3e-05, Identities = 31/66 (46%), Positives = 43/66 (65%)
  Q:    84 KQGRRK-----KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALI 149
           +QGRR+     K C+ C     ++D+KD E L K+ T   KI  R+IT  C  HQ  ++ AIKRARI+AL+
  S:     6 RQGRRRSPAKPKICRFCEAKVSYIDFKDAETLMKFQTEKGKIMPRRITGTCLDHQKMLATAIKRARIIALV 76
>gi|150002620|ref|YP_001297364.1| 30S ribosomal protein S18 [Bacteroides vulgatus ATCC 8482] >gi|189462618|ref|ZP_03011403.1| hypothetical protein BACCOP_03310 [Bacteroides coprocola DSM 17136] >gi|166220923|sp|A6KWD6|RS18_BACV8 30S ribosomal protein S18 >gi|149931044|gb|ABR37742.1| 30S ribosomal protein S18 [Bacteroides vulgatus ATCC 8482] >gi|189430779|gb|EDU99763.1| hypothetical protein BACCOP_03310 [Bacteroides coprocola DSM 17136] (89 aa)
Score = 121, Expect = 2.4e-05, Identities = 28/57 (49%), Positives = 38/57 (66%)
  Q:    98 GQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           G +++DYKD E L K+L    KI  R+IT    K Q R++ A+KRAR +AL+PFV D
  S:    30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPFVTD 86
>gi|160892971|ref|ZP_02073759.1| hypothetical protein CLOL250_00508 [Clostridium sp. L2-50] >gi|156865054|gb|EDO58485.1| hypothetical protein CLOL250_00508 [Clostridium sp. L2-50] (87 aa)
Score = 121, Expect = 2.5e-05, Identities = 27/63 (42%), Positives = 40/63 (63%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C  CA     +DYKD   L +Y++   KI  R+IT  C+KHQ  ++ A+KRAR +A++P+V D
  S:    25 CVFCADKTAVIDYKDANKLKRYISERGKILPRRITGNCAKHQRALTVAVKRARQIAILPYVVD 87
>gi|121595517|ref|YP_987413.1| SSU ribosomal protein S18P [Acidovorax sp. JS42] >gi|166220919|sp|A1WAR2|RS18_ACISJ 30S ribosomal protein S18 >gi|120607597|gb|ABM43337.1| SSU ribosomal protein S18P [Acidovorax sp. JS42] (93 aa)
Score = 121, Expect = 2.5e-05, Identities = 32/87 (36%), Positives = 51/87 (58%)
  Q:    65 KEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K+FN   RP     R   +   +RK+FC+    G E +DYKDV+ L  ++  N KI   ++T   + +Q +++ AIKRAR +AL+P+
  S:     5 KKFNKDKRP----KRNTQSLLFKRKRFCRFTVAGVEEIDYKDVDTLRDFIAENGKIIPARLTGTRAIYQRQLNTAIKRARFLALLPY 87
>gi|187478663|ref|YP_786687.1| 30S ribosomal protein S18 [Bordetella avium 197N] >gi|123725072|sp|Q2KZ21|RS18_BORA1 30S ribosomal protein S18 >gi|115423249|emb|CAJ49782.1| 30S ribosomal protein S18 [Bordetella avium 197N] (90 aa)
Score = 121, Expect = 2.5e-05, Identities = 26/65 (40%), Positives = 44/65 (67%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +R+KFC+  A G E +DYKD++ L  ++  N KI   ++T   + +Q ++ +AIKRAR +AL+P+
  S:    21 KRRKFCRFTAAGVEEIDYKDLDTLRDFVQENGKIIPARLTGTRAIYQRQLDSAIKRARFLALLPY 85
>gi|91204936|ref|YP_537291.1| 30S ribosomal protein S18 [Rickettsia bellii RML369-C] >gi|157827736|ref|YP_001496800.1| 30S ribosomal protein S18 [Rickettsia bellii OSU 85-389] >gi|166220983|sp|A8GY13|RS18_RICB8 30S ribosomal protein S18 >gi|123084595|sp|Q1RKB2|RS18_RICBR 30S ribosomal protein S18 >gi|91068480|gb|ABE04202.1| 30S ribosomal protein S18 [Rickettsia bellii RML369-C] >gi|157803040|gb|ABV79763.1| 30S ribosomal protein S18 [Rickettsia bellii OSU 85-389] (94 aa)
Score = 121, Expect = 2.5e-05, Identities = 29/66 (43%), Positives = 44/66 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C L       +DYK+ ELL K+++   ++   +IT  C+K Q +++NAIK ARI+AL+PFV
  S:    25 RRRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILALLPFV 90
>gi|77958751|ref|ZP_00822779.1| COG0238: Ribosomal protein S18 [Yersinia bercovieri ATCC 43970] (75 aa)
Score = 121, Expect = 2.5e-05, Identities = 27/65 (41%), Positives = 43/65 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+G   +DYKD+  L  Y+T + KI   +IT   +K Q +++  IKRAR ++L+P+
  S:     6 RRRKFCRFTAEGVVEIDYKDIATLKNYITESGKIVPSRITGTRAKFQRQLARCIKRARYLSLLPY 70
>gi|126661839|ref|ZP_01732838.1| 30S ribosomal protein S18 [Flavobacteria bacterium BAL38] >gi|126625218|gb|EAZ95907.1| 30S ribosomal protein S18 [Flavobacteria bacterium BAL38] (98 aa)
Score = 120, Expect = 2.6e-05, Identities = 28/68 (41%), Positives = 45/68 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + KK+C+    G +++DYKD + L K++    KI  R++T    K+Q +VS A+KRAR +AL+P+V D
  S:    28 KTKKYCRFKKSGIKYIDYKDADFLLKFVNEQGKILPRRLTGTSLKYQRKVSVAVKRARHLALMPYVAD 95
>gi|116667427|pdb|2GY9|R Chain R, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 >gi|116667479|pdb|2GYB|R Chain R, Structure Of The 30s Subunit Of A Secm-Stalled E. Coli Ribosome Complex Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1143 (69 aa)
Score = 120, Expect = 2.6e-05, Identities = 27/64 (42%), Positives = 45/64 (70%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           R+KFC+  A+G + +DYKD+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR ++L+P+
  S:     1 RRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPY 64
>gi|108803692|ref|YP_643629.1| SSU ribosomal protein S18P [Rubrobacter xylanophilus DSM 9941] >gi|108764935|gb|ABG03817.1| ribosomal protein S18 [Rubrobacter xylanophilus DSM 9941] (81 aa)
Score = 120, Expect = 2.6e-05, Identities = 28/74 (37%), Positives = 46/74 (62%)
  Q:    79 RGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +G    +  +KK C  C +  E+VDYKD  +L ++ +   KI +R++T  C +HQ   + AIKRAR +AL+P++
  S:     5 KGGATTRSGKKKVCVFCKENIEYVDYKDYNMLRRFTSERGKIRARRVTGLCPQHQRETARAIKRAREMALLPYI 78
>gi|169832351|ref|YP_001718333.1| ribosomal protein S18 [Candidatus Desulforudis audaxviator MP104C] >gi|169639195|gb|ACA60701.1| ribosomal protein S18 [Candidatus Desulforudis audaxviator MP104C] (75 aa)
Score = 120, Expect = 2.6e-05, Identities = 27/63 (42%), Positives = 37/63 (58%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C  C      +DYKD   L KY+T   KI  R+IT  C+ HQ  ++ +IKR+R +AL+PF  D
  S:    13 CSFCVDKIAVIDYKDTPRLKKYITERGKILPRRITGNCAHHQRMLTVSIKRSRHMALLPFSTD 75
>gi|171463205|ref|YP_001797318.1| ribosomal protein S18 [Polynucleobacter necessarius STIR1] >gi|171192743|gb|ACB43704.1| ribosomal protein S18 [Polynucleobacter necessarius STIR1] (84 aa)
Score = 120, Expect = 2.6e-05, Identities = 27/65 (41%), Positives = 43/65 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +RK++C+    G E +DYKDV+ L  ++  N KI   ++T   +K+Q ++  AIKRAR +AL+PF
  S:    14 KRKRYCRFTVAGVEQIDYKDVDTLKGFIGENAKITPARLTGTKAKYQRQLDTAIKRARYLALLPF 78
>gi|49474087|ref|YP_032129.1| 30S ribosomal protein S18 [Bartonella quintana str. Toulouse] >gi|59798702|sp|Q6G061|RS18_BARQU 30S ribosomal protein S18 >gi|49239591|emb|CAF25948.1| 30s ribosomal protein s18 [Bartonella quintana str. Toulouse] (82 aa)
Score = 120, Expect = 2.7e-05, Identities = 27/66 (40%), Positives = 40/66 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKD++LL +Y++   KI   +IT    K Q  ++NAIKRAR + L+P+V
  S:    15 RRRKTCPFSGANAPKIDYKDIKLLQRYISERGKIVPSRITAVSQKRQRELANAIKRARFLGLLPYV 80
>gi|126651975|ref|ZP_01724167.1| ribosomal protein S18 [Bacillus sp. B14905] >gi|126591244|gb|EAZ85353.1| ribosomal protein S18 [Bacillus sp. B14905] (78 aa)
Score = 120, Expect = 2.7e-05, Identities = 25/63 (39%), Positives = 43/63 (68%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C   +    H+DYKDV+LL K+++   KI  R++T   +K+Q ++++AIK +RI+ L+PFV +
  S:    14 CYFTSNNITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTSAIKVSRIMGLLPFVAE 76
>gi|111114935|ref|YP_709553.1| 30S ribosomal protein S18 [Borrelia afzelii PKo] >gi|167942863|ref|ZP_02529937.1| 30S ribosomal protein S18 [Borrelia afzelii ACA-1] >gi|123047064|sp|Q0SP51|RS18_BORAP 30S ribosomal protein S18 >gi|110890209|gb|ABH01377.1| ribosomal protein S18 [Borrelia afzelii PKo] (96 aa)
Score = 120, Expect = 2.7e-05, Identities = 35/89 (39%), Positives = 53/89 (59%)
  Q:    65 KEFNPQDRPFAKYNRGYPNKQGRR---KKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVR 153
           ++ N +D  F     G+      R   +K CK C  G+ H DYK+ + L K++T   KI  ++IT   +KHQ R++  IKRAR +AL+PFV+
  S:     5 RDVNQRDSRFENQQDGFKKNSNFRFFKRKSCKFCDSGK-HPDYKEFDFLKKFITEQGKILPKRITGTSAKHQRRLALEIKRARYMALLPFVK 95
>gi|34540404|ref|NP_904883.1| 30S ribosomal protein S18 [Porphyromonas gingivalis W83] >gi|188994504|ref|YP_001928756.1| 30S ribosomal protein S18 [Porphyromonas gingivalis ATCC 33277] >gi|59798820|sp|Q7MWL2|RS18_PORGI 30S ribosomal protein S18 >gi|34396717|gb|AAQ65782.1| ribosomal protein S18 [Porphyromonas gingivalis W83] >gi|188594184|dbj|BAG33159.1| 30S ribosomal protein S18 [Porphyromonas gingivalis ATCC 33277] (90 aa)
Score = 120, Expect = 2.8e-05, Identities = 28/57 (49%), Positives = 37/57 (64%)
  Q:    98 GQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           G  ++DYKD E L K+L    KI  R+IT    K Q RV+ A+KRAR +AL+P+V D
  S:    31 GIRYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARHLALLPYVTD 87
>gi|157803227|ref|YP_001491776.1| 30S ribosomal protein S18 [Rickettsia canadensis str. McKiel] >gi|166220984|sp|A8EXA8|RS18_RICCK 30S ribosomal protein S18 >gi|157784490|gb|ABV72991.1| 30S ribosomal protein S18 [Rickettsia canadensis str. McKiel] (95 aa)
Score = 120, Expect = 2.8e-05, Identities = 29/66 (43%), Positives = 44/66 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C L       +DYK+ ELL K+++   ++   +IT  C+K Q +++NAIK ARI+AL+PFV
  S:    26 RRRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILALLPFV 91
>gi|85058325|ref|YP_454027.1| 30S ribosomal protein S18 [Sodalis glossinidius str. 'morsitans'] >gi|123766478|sp|Q2NW53|RS18_SODGM 30S ribosomal protein S18 >gi|84778845|dbj|BAE73622.1| 30S ribosomal protein S18 [Sodalis glossinidius str. 'morsitans'] (75 aa)
Score = 120, Expect = 2.9e-05, Identities = 27/65 (41%), Positives = 44/65 (67%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+   +G   +DYKD+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR ++L+P+
  S:     6 RRRKFCRFTTEGVVEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPY 70
>gi|16272489|ref|NP_438703.1| 30S ribosomal protein S18 [Haemophilus influenzae Rd KW20] >gi|32033888|ref|ZP_00134159.1| COG0238: Ribosomal protein S18 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|33152179|ref|NP_873532.1| 30S ribosomal protein S18 [Haemophilus ducreyi 35000HP] >gi|42629993|ref|ZP_00155538.1| COG0238: Ribosomal protein S18 [Haemophilus influenzae R2846] >gi|42630826|ref|ZP_00156365.1| COG0238: Ribosomal protein S18 [Haemophilus influenzae R2866] >gi|68249142|ref|YP_248254.1| 30S ribosomal protein S18 [Haemophilus influenzae 86-028NP] >gi|145628926|ref|ZP_01784726.1| 30S ribosomal protein S18 [Haemophilus influenzae 22.1-21] >gi|145630274|ref|ZP_01786055.1| 30S ribosomal protein S18 [Haemophilus influenzae 22.4-21] >gi|145633503|ref|ZP_01789232.1| 30S ribosomal protein S18 [Haemophilus influenzae 3655] >gi|145635374|ref|ZP_01791076.1| 30S ribosomal protein S18 [Haemophilus influenzae PittAA] >gi|145637414|ref|ZP_01793073.1| 30S ribosomal protein S18 [Haemophilus influenzae PittHH] >gi|145638545|ref|ZP_01794154.1| 30S ribosomal protein S18 [Haemophilus influenzae PittII] >gi|145640518|ref|ZP_01796102.1| 30S ribosomal protein S18 [Haemophilus influenzae R3021] >gi|148825181|ref|YP_001289934.1| 30S ribosomal protein S18 [Haemophilus influenzae PittEE] >gi|148827736|ref|YP_001292489.1| 30S ribosomal protein S18 [Haemophilus influenzae PittGG] >gi|165976597|ref|YP_001652190.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|167855349|ref|ZP_02478116.1| 30S ribosomal protein S18 [Haemophilus parasuis 29755] >gi|190150497|ref|YP_001969022.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|81336451|sp|Q4QN03|RS18_HAEI8 30S ribosomal protein S18 >gi|166220952|sp|A5U9V0|RS18_HAEIE 30S ribosomal protein S18 >gi|166220953|sp|A5UH50|RS18_HAEIG 30S ribosomal protein S18 >gi|54039411|sp|P66458|RS18_HAEDU 30S ribosomal protein S18 >gi|54042146|sp|P66457|RS18_HAEIN 30S ribosomal protein S18 >gi|1573530|gb|AAC22203.1| ribosomal protein S18 (rpS18) [Haemophilus influenzae Rd KW20] >gi|33148401|gb|AAP95921.1| 30S ribosomal protein S18 [Haemophilus ducreyi 35000HP] >gi|68057341|gb|AAX87594.1| 30S ribosomal protein S18 [Haemophilus influenzae 86-028NP] >gi|144979396|gb|EDJ89082.1| 30S ribosomal protein S18 [Haemophilus influenzae 22.1-21] >gi|144984009|gb|EDJ91446.1| 30S ribosomal protein S18 [Haemophilus influenzae R3021] >gi|144985872|gb|EDJ92480.1| 30S ribosomal protein S18 [Haemophilus influenzae 3655] >gi|145267380|gb|EDK07382.1| 30S ribosomal protein S18 [Haemophilus influenzae PittAA] >gi|145269360|gb|EDK09304.1| 30S ribosomal protein S18 [Haemophilus influenzae PittHH] >gi|145272140|gb|EDK12048.1| 30S ribosomal protein S18 [Haemophilus influenzae PittII] >gi|145275104|gb|EDK14966.1| 30S ribosomal protein S18 [Haemophilus influenzae 22.4-21] >gi|148715341|gb|ABQ97551.1| 30S ribosomal protein S18 [Haemophilus influenzae PittEE] >gi|148718978|gb|ABR00106.1| 30S ribosomal protein S18 [Haemophilus influenzae PittGG] >gi|153093304|gb|EDN74300.1| ribosomal protein S18 [Mannheimia haemolytica PHL213] >gi|165876698|gb|ABY69746.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|167853497|gb|EDS24744.1| 30S ribosomal protein S18 [Haemophilus parasuis 29755] >gi|189915628|gb|ACE61880.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (75 aa)
Score = 120, Expect = 2.9e-05, Identities = 27/65 (41%), Positives = 44/65 (67%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+    +DYKD+  L  Y++ + KI   +IT   +K+Q +++ AIKRAR +AL+P+
  S:     6 RRRKFCRFTAENVVEIDYKDIATLKNYISESGKIVPSRITGTRAKYQRQLARAIKRARYLALLPY 70
>gi|77919594|ref|YP_357409.1| ribosomal protein S18 [Pelobacter carbinolicus DSM 2380] >gi|77545677|gb|ABA89239.1| SSU ribosomal protein S18P [Pelobacter carbinolicus DSM 2380] (91 aa)
Score = 120, Expect = 2.9e-05, Identities = 26/62 (41%), Positives = 40/62 (64%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K C+ CA     +DYK++  L  ++T   KI  R+I+  C++HQ ++  AIKRAR +AL+PF
  S:    23 KGCRFCADNTLKIDYKEIRNLRYFITERGKIVPRRISGNCAEHQRKIREAIKRARNIALLPF 84
>gi|89900979|ref|YP_523450.1| ribosomal protein S18 [Rhodoferax ferrireducens T118] >gi|123397182|sp|Q21WD4|RS18_RHOFD 30S ribosomal protein S18 >gi|89345716|gb|ABD69919.1| SSU ribosomal protein S18P [Rhodoferax ferrireducens T118] (94 aa)
Score = 120, Expect = 2.9e-05, Identities = 30/87 (34%), Positives = 51/87 (58%)
  Q:    65 KEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K FN +D+   +  R   N   +RK+FC+    G E +DYKD++ L  ++  N KI   ++T   +  Q +++ AIKRAR +A++P+
  S:     5 KRFNNKDK---RPKRPAQNLLFKRKRFCRFTVTGVEEIDYKDIDTLRDFIAENGKIIPARLTGTRAIFQRQLNTAIKRARFLAMLPY 88
>gi|94677019|ref|YP_589000.1| ribosomal protein S18 [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|122988100|sp|Q1LSR4|RS18_BAUCH 30S ribosomal protein S18 >gi|94220169|gb|ABF14328.1| ribosomal protein S18 [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (75 aa)
Score = 120, Expect = 2.9e-05, Identities = 27/65 (41%), Positives = 44/65 (67%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+    +DYKD+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR ++L+P+
  S:     6 RRRKFCRFTAEDVIEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPY 70
>gi|116628692|ref|YP_813864.1| ribosomal protein S18 [Lactobacillus gasseri ATCC 33323] >gi|122274310|sp|Q047E6|RS18_LACGA 30S ribosomal protein S18 >gi|116094274|gb|ABJ59426.1| SSU ribosomal protein S18P [Lactobacillus gasseri ATCC 33323] (77 aa)
Score = 120, Expect = 3.0e-05, Identities = 24/61 (39%), Positives = 44/61 (72%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   +++DYKDV+LL ++++   KI  R++T   +K+Q +++ AIKRAR++ L+PFV +
  S:    16 IAANHIDYIDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKLTVAIKRARVMGLLPFVAE 76
>gi|157964105|ref|YP_001498929.1| 30S ribosomal protein S18 [Rickettsia massiliae MTU5] >gi|167011193|sp|A8F0E6|RS18_RICM5 30S ribosomal protein S18 >gi|157843881|gb|ABV84382.1| 30S ribosomal protein S18 [Rickettsia massiliae MTU5] (95 aa)
Score = 120, Expect = 3.2e-05, Identities = 28/66 (42%), Positives = 44/66 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C L       +DYK+ ELL K+++   ++   +IT  C+K Q +++NA+K ARI+AL+PFV
  S:    26 RRRKGCPLSVPHAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAVKIARILALLPFV 91
>gi|146328891|ref|YP_001210004.1| 30S ribosomal protein S18 [Dichelobacter nodosus VCS1703A] >gi|146232361|gb|ABQ13339.1| 30S ribosomal protein S18 [Dichelobacter nodosus VCS1703A] (71 aa)
Score = 120, Expect = 3.2e-05, Identities = 27/66 (40%), Positives = 43/66 (65%)
  Q:    86 GRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
            RRK+ C+  A+G + +DYKD+E L  Y+T   KI   +IT     +Q +++ A+KRAR +AL+P+
  S:     2 ARRKRICRFTAEGVKEIDYKDLETLKAYITEVGKIVPARITGTNVFYQRQLATAVKRARFLALLPY 67
>gi|117618475|ref|YP_855253.1| ribosomal protein S18 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166220920|sp|A0KG68|RS18_AERHH 30S ribosomal protein S18 >gi|117559882|gb|ABK36830.1| ribosomal protein S18 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (76 aa)
Score = 120, Expect = 3.2e-05, Identities = 28/65 (43%), Positives = 44/65 (67%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+    +DYKD+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR +AL+P+
  S:     6 RRRKFCRFTAENVTEIDYKDIVTLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLALLPY 70
>gi|163857367|ref|YP_001631665.1| 30S ribosomal protein S18 [Bordetella petrii DSM 12804] >gi|163261095|emb|CAP43397.1| 30S ribosomal protein S18 [Bordetella petrii] (90 aa)
Score = 120, Expect = 3.3e-05, Identities = 26/65 (40%), Positives = 43/65 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +R+KFC+  A G E +DYKD++ L  ++  N KI   ++T   + +Q ++  AIKRAR +AL+P+
  S:    21 KRRKFCRFTAAGVEEIDYKDLDTLRDFVQENGKIIPARLTGTKAHYQRQLDTAIKRARFLALLPY 85
>gi|121602413|ref|YP_988808.1| 30S ribosomal protein S18 [Bartonella bacilliformis KC583] >gi|166220924|sp|A1US55|RS18_BARBK 30S ribosomal protein S18 >gi|120614590|gb|ABM45191.1| ribosomal protein S18 [Bartonella bacilliformis KC583] (82 aa)
Score = 120, Expect = 3.3e-05, Identities = 27/66 (40%), Positives = 40/66 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKD++LL +Y++   KI   +IT    K Q  ++NAIKRAR + L+P+V
  S:    15 RRRKTCPFSGTNVAKIDYKDIKLLQRYISERGKIVPSRITAVSQKKQRELANAIKRARFLGLLPYV 80
>gi|118052430|ref|ZP_01520977.1| ribosomal protein S18 [Comamonas testosteroni KF-1] >gi|118000558|gb|EAV14715.1| ribosomal protein S18 [Comamonas testosteroni KF-1] (93 aa)
Score = 119, Expect = 3.4e-05, Identities = 31/87 (35%), Positives = 51/87 (58%)
  Q:    65 KEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K+FN   RP     R   +   +RK+FC+    G E +DYKDV+ L  ++  N KI   ++T   + +Q +++ AIKRAR +A++P+
  S:     5 KKFNKDKRP----KRNTQSLLFKRKRFCRFTVAGVEEIDYKDVDTLRDFIAENGKIVPARLTGTRAIYQRQLNTAIKRARFLAMLPY 87
>gi|27904981|ref|NP_778107.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Bp (Baizongia pistaciae)] >gi|29611842|sp|P59502|RS18_BUCBP 30S ribosomal protein S18 >gi|27904379|gb|AAO27212.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Bp (Baizongia pistaciae)] (75 aa)
Score = 119, Expect = 3.4e-05, Identities = 25/65 (38%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+   +  + +DYKD+ +L  Y+T + KI   +IT   +++Q +++ AIKRAR ++L+P+
  S:     6 RRRKFCRFTVEKIKEIDYKDLSMLKNYITESGKIVPSRITGTSARYQRQLARAIKRARYLSLLPY 70
>gi|73539550|ref|YP_299917.1| 30S ribosomal protein S18 [Ralstonia eutropha JMP134] >gi|72122887|gb|AAZ65073.1| SSU ribosomal protein S18P [Ralstonia eutropha JMP134] (92 aa)
Score = 119, Expect = 3.5e-05, Identities = 24/65 (36%), Positives = 43/65 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +RK++C+    G E +DYKD++ L  ++  N KI   ++T   + +Q +++ AIKRAR +AL+P+
  S:    22 KRKRYCRFTVAGVEQIDYKDLDTLKDFIGDNGKITPARLTGTKAHYQRQLNTAIKRARFLALLPY 86
>gi|146301223|ref|YP_001195814.1| 30S ribosomal protein S18 [Flavobacterium johnsoniae UW101] >gi|146155641|gb|ABQ06495.1| SSU ribosomal protein S18P [Flavobacterium johnsoniae UW101] (98 aa)
Score = 119, Expect = 3.5e-05, Identities = 28/68 (41%), Positives = 45/68 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + KK+C+    G +++DYKD + L K++    KI  R++T    K+Q +VS A+KRAR +AL+P+V D
  S:    28 KTKKYCRFKKSGIKYIDYKDADFLLKFVNEQGKILPRRLTGTSLKYQRKVSVAVKRARHLALMPYVAD 95
>gi|15964890|ref|NP_385243.1| 30S ribosomal protein S18 [Sinorhizobium meliloti 1021] >gi|150395964|ref|YP_001326431.1| 30S ribosomal protein S18 [Sinorhizobium medicae WSM419] >gi|166222244|sp|A6U7G6|RS18_SINMW 30S ribosomal protein S18 >gi|20978707|sp|Q92QZ8|RS18_RHIME 30S ribosomal protein S18 >gi|15074069|emb|CAC45716.1| Putative 30S ribosomal protein S18 [Sinorhizobium meliloti 1021] >gi|150027479|gb|ABR59596.1| ribosomal protein S18 [Sinorhizobium medicae WSM419] (82 aa)
Score = 119, Expect = 3.5e-05, Identities = 26/66 (39%), Positives = 38/66 (57%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKDV LL +Y++   KI   +IT    K Q  ++ AIKRAR + L+P++
  S:    15 RRRKTCPFSGANAPRIDYKDVRLLQRYISERGKIVPSRITAVSQKKQRELAQAIKRARFLGLLPYI 80
>gi|150025893|ref|YP_001296719.1| 30S ribosomal protein S18 [Flavobacterium psychrophilum JIP02/86] >gi|149772434|emb|CAL43916.1| 30S ribosomal protein S18 [Flavobacterium psychrophilum JIP02/86] (98 aa)
Score = 119, Expect = 3.6e-05, Identities = 27/68 (39%), Positives = 44/68 (64%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + KK+C+    G +++DYKD + L K++    KI  R++T    K+Q +VS A+KRAR +A +P+V D
  S:    28 KTKKYCRFKKSGIKYIDYKDADFLLKFVNEQGKILPRRLTGTSLKYQRKVSVAVKRARHLAFMPYVAD 95
>gi|186475678|ref|YP_001857148.1| ribosomal protein S18 [Burkholderia phymatum STM815] >gi|184192137|gb|ACC70102.1| ribosomal protein S18 [Burkholderia phymatum STM815] (91 aa)
Score = 119, Expect = 3.6e-05, Identities = 32/83 (38%), Positives = 49/83 (59%)
  Q:    69 PQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           P  + F K  R   N   +RKKFC+  A G E +DYKD++ L  ++  N KI   ++T   + +Q ++  AIKRAR +AL+P+
  S:     4 PTGKKFDK-RRQQQNPLFKRKKFCRFTAAGVEQIDYKDIDTLKDFIGENGKITPARLTGTKAHYQRQLDTAIKRARFLALMPY 85
>gi|86357077|ref|YP_468969.1| 30S ribosomal protein S18 [Rhizobium etli CFN 42] >gi|190891121|ref|YP_001977663.1| 30S ribosomal protein S18 [Rhizobium etli CIAT 652] >gi|123724812|sp|Q2KA94|RS18_RHIEC 30S ribosomal protein S18 >gi|86281179|gb|ABC90242.1| 30S ribosomal protein S18 [Rhizobium etli CFN 42] >gi|190696400|gb|ACE90485.1| 30S ribosomal protein S18 [Rhizobium etli CIAT 652] (82 aa)
Score = 119, Expect = 3.6e-05, Identities = 27/66 (40%), Positives = 38/66 (57%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKDV LL +Y++   KI   +IT    K Q  ++ AIKRAR + L+P+V
  S:    15 RRRKTCPFSGANAPRIDYKDVRLLQRYISERGKIVPSRITAVSQKKQRELAQAIKRARFLGLLPYV 80
>gi|15616610|ref|NP_244916.1| 30S ribosomal protein S18 [Bacillus halodurans C-125] >gi|11387101|sp|Q9K5P0|RS18_BACHD 30S ribosomal protein S18 >gi|10176673|dbj|BAB07767.1| 30S ribosomal protein S18 [Bacillus halodurans C-125] (77 aa)
Score = 119, Expect = 3.6e-05, Identities = 29/68 (42%), Positives = 46/68 (67%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +R+K C       E +DYKDV+LL K+++   KI  R++T   +K+Q +++ AIKRAR +AL+P+V D
  S:     8 KRRKVCYFTVNKIEKIDYKDVDLLKKFVSERGKILPRRVTGTSAKYQRQLTTAIKRARQIALLPYVTD 75
>gi|149926828|ref|ZP_01915087.1| 30S ribosomal protein S18 [Limnobacter sp. MED105] >gi|149824380|gb|EDM83598.1| 30S ribosomal protein S18 [Limnobacter sp. MED105] (89 aa)
Score = 119, Expect = 3.6e-05, Identities = 29/76 (38%), Positives = 45/76 (59%)
  Q:    76 KYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K  R   N   +RKKFC+      E +DYKD++ L  +++ N KI   +IT   + +Q ++  AIKRAR +AL+P+
  S:    10 KGRRPQQNPLFKRKKFCRFTVGKVEQIDYKDIDTLKDFISENGKIMPARITGTKANYQRQLDTAIKRARFLALLPY 85
>gi|114797845|ref|YP_760859.1| ribosomal protein S18 [Hyphomonas neptunium ATCC 15444] >gi|114738019|gb|ABI76144.1| ribosomal protein S18 [Hyphomonas neptunium ATCC 15444] (85 aa)
Score = 119, Expect = 3.8e-05, Identities = 28/66 (42%), Positives = 44/66 (66%)
  Q:    86 GRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           GRR+K      +  + +DYKDV++L +Y++   KI   +IT    K+Q +++ AIKRAR++ALIPF
  S:    17 GRRRKVDPFTGQHAQEIDYKDVKMLQRYISEKGKIVPSRITAVNLKNQRKLAQAIKRARMLALIPF 82
>gi|167038652|ref|YP_001666230.1| 30S ribosomal protein S18 [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167041002|ref|YP_001663987.1| 30S ribosomal protein S18 [Thermoanaerobacter sp. X514] >gi|166855242|gb|ABY93651.1| ribosomal protein S18 [Thermoanaerobacter sp. X514] >gi|166857486|gb|ABY95894.1| ribosomal protein S18 [Thermoanaerobacter pseudethanolicus ATCC 33223] (88 aa)
Score = 119, Expect = 3.8e-05, Identities = 28/60 (46%), Positives = 40/60 (66%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           C  C    + +DYKDV  L KY+T   KI  R+IT  C++HQ +++ AIKRAR +AL+P+
  S:    26 CAFCTDNIDKIDYKDVARLRKYITERGKILPRRITGNCARHQRQLTKAIKRARQIALLPY 85
>gi|103487385|ref|YP_616946.1| 30S ribosomal protein S18 [Sphingopyxis alaskensis RB2256] >gi|98977462|gb|ABF53613.1| SSU ribosomal protein S18P [Sphingopyxis alaskensis RB2256] (74 aa)
Score = 119, Expect = 3.8e-05, Identities = 29/66 (43%), Positives = 40/66 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C   AK    +DYKDV LL  YL+   KI   +IT   +K Q  ++ AIKRAR + L+P++
  S:     7 RRRKTCPFSAKDAPVIDYKDVRLLQGYLSERGKIVPSRITAVSTKKQRELAKAIKRARHIGLLPYI 72
>gi|160890914|ref|ZP_02071917.1| hypothetical protein BACUNI_03359 [Bacteroides uniformis ATCC 8492] >gi|167764865|ref|ZP_02436986.1| hypothetical protein BACSTE_03257 [Bacteroides stercoris ATCC 43183] >gi|156859913|gb|EDO53344.1| hypothetical protein BACUNI_03359 [Bacteroides uniformis ATCC 8492] >gi|167697534|gb|EDS14113.1| hypothetical protein BACSTE_03257 [Bacteroides stercoris ATCC 43183] (90 aa)
Score = 119, Expect = 3.8e-05, Identities = 28/57 (49%), Positives = 38/57 (66%)
  Q:    98 GQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           G +++DYKD E L K+L    KI  R+IT    K Q RV+ A+KRAR +AL+P+V D
  S:    31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARHLALLPYVTD 87
>gi|160885186|ref|ZP_02066189.1| hypothetical protein BACOVA_03184 [Bacteroides ovatus ATCC 8483] >gi|156109536|gb|EDO11281.1| hypothetical protein BACOVA_03184 [Bacteroides ovatus ATCC 8483] (90 aa)
Score = 119, Expect = 3.8e-05, Identities = 27/57 (47%), Positives = 37/57 (64%)
  Q:    98 GQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           G  ++DYKD E L K+L    KI  R+IT    K Q R++ A+KRAR +AL+P+V D
  S:    31 GIRYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPYVTD 87
>gi|108761622|ref|YP_633233.1| ribosomal protein S18 [Myxococcus xanthus DK 1622] >gi|108465502|gb|ABF90687.1| ribosomal protein S18 [Myxococcus xanthus DK 1622] (131 aa)
Score = 119, Expect = 3.9e-05, Identities = 27/60 (45%), Positives = 39/60 (65%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           C+ CA+    VD+KD   L  ++T   KI  R+I+  C+KHQ  V+ AIKRAR +AL+P+
  S:    67 CRFCAEKNASVDFKDQATLKYFVTERGKIIPRRISGNCAKHQREVAVAIKRARGIALLPY 126
>gi|157694460|ref|YP_001488922.1| 30S ribosomal protein S18 [Bacillus pumilus SAFR-032] >gi|167011187|sp|A8FJE5|RS18_BACP2 30S ribosomal protein S18 >gi|157683218|gb|ABV64362.1| ribosomal protein S18 [Bacillus pumilus SAFR-032] (79 aa)
Score = 119, Expect = 3.9e-05, Identities = 25/61 (40%), Positives = 43/61 (70%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           C   + G  H+DYKDV+LL K+++   KI  R++T   +K+Q +++ AIK++R +AL+P+V
  S:    16 CFFTSNGITHIDYKDVDLLRKFVSERGKILPRRVTGTSAKYQRKLTLAIKKSRQMALLPYV 76
>gi|42518093|ref|NP_964023.1| 30S ribosomal protein S18 [Lactobacillus johnsonii NCC 533] >gi|59798807|sp|Q74M26|RS18_LACJO 30S ribosomal protein S18 >gi|41582377|gb|AAS07989.1| 30S ribosomal protein S19 [Lactobacillus johnsonii NCC 533] (78 aa)
Score = 119, Expect = 3.9e-05, Identities = 24/61 (39%), Positives = 44/61 (72%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   +++DYKDV+LL ++++   KI  R++T   +K+Q +++ AIKRAR++ L+PFV +
  S:    17 IAANHIDYIDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKLTVAIKRARVMGLLPFVAE 77
>gi|83749657|ref|ZP_00946638.1| SSU ribosomal protein S18P [Ralstonia solanacearum UW551] >gi|83723659|gb|EAP70856.1| SSU ribosomal protein S18P [Ralstonia solanacearum UW551] (95 aa)
Score = 119, Expect = 4.0e-05, Identities = 33/98 (33%), Positives = 54/98 (55%)
  Q:    54 VKETKKSSDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           + + ++ + NKK F  Q+  F            +RKKFC+    G E +DYKD++ L  ++  N KI   ++T   S +Q ++  AIKRAR +AL+P+
  S:     4 MNKKQRDAKNKKRFQQQNPLF------------KRKKFCRFTVAGVEQIDYKDLDTLKDFIGENGKITPARLTGTRSHYQRQLDTAIKRARFLALMPY 89
>gi|56552122|ref|YP_162961.1| 30S ribosomal protein S18 [Zymomonas mobilis subsp. mobilis ZM4] >gi|56543696|gb|AAV89850.1| ribosomal protein S18 [Zymomonas mobilis subsp. mobilis ZM4] (74 aa)
Score = 119, Expect = 4.0e-05, Identities = 28/66 (42%), Positives = 40/66 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C   AK    +DYKDV LL  +++   KI   +IT   +K Q  ++ AIKRAR + L+PF+
  S:     7 RRRKSCPFAAKDAPKIDYKDVRLLQGFVSERGKIVPSRITAVSAKKQRELARAIKRARHIGLLPFI 72
>gi|145297777|ref|YP_001140618.1| ribosomal protein S18 [Aeromonas salmonicida subsp. salmonicida A449] >gi|166220921|sp|A4SIZ8|RS18_AERS4 30S ribosomal protein S18 >gi|142850549|gb|ABO88870.1| ribosomal protein S18 [Aeromonas salmonicida subsp. salmonicida A449] (76 aa)
Score = 119, Expect = 4.1e-05, Identities = 28/65 (43%), Positives = 44/65 (67%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+KFC+  A+    +DYKD+  L  Y+T + KI   +IT   +K+Q +++ AIKRAR +AL+P+
  S:     6 RRRKFCRFTAENVTEIDYKDIVTLKNYVTESGKIVPSRITGTRAKYQRQLARAIKRARYLALLPY 70
>gi|114328879|ref|YP_746036.1| 30S ribosomal protein S18 [Granulibacter bethesdensis CGDNIH1] >gi|114317053|gb|ABI63113.1| SSU ribosomal protein S18P [Granulibacter bethesdensis CGDNIH1] (91 aa)
Score = 119, Expect = 4.1e-05, Identities = 27/66 (40%), Positives = 40/66 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKDV LL ++L+   KI   +IT   +K Q  ++ AIKRAR +AL+P++
  S:    24 RRRKSCPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELAQAIKRARFLALLPYI 89
>gi|163725805|ref|ZP_02133324.1| ribosomal protein S18 [Desulfatibacillum alkenivorans AK-01] >gi|161400832|gb|EDQ25081.1| ribosomal protein S18 [Desulfatibacillum alkenivorans AK-01] (82 aa)
Score = 119, Expect = 4.3e-05, Identities = 27/61 (44%), Positives = 38/61 (62%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           C+ CA     ++YKD   L  + T   KI  R+I+  C+KHQ  ++ AIKRAR +AL+PFV
  S:    16 CRFCADKTLEINYKDPRTLKYFTTERGKIVPRRISGTCAKHQRALTTAIKRARAIALMPFV 76
>gi|118579197|ref|YP_900447.1| 30S ribosomal protein S18 [Pelobacter propionicus DSM 2379] >gi|166220968|sp|A1AM19|RS18_PELPD 30S ribosomal protein S18 >gi|118501907|gb|ABK98389.1| SSU ribosomal protein S18P [Pelobacter propionicus DSM 2379] (94 aa)
Score = 119, Expect = 4.3e-05, Identities = 27/68 (39%), Positives = 42/68 (61%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +R+K C+ CA+    +DYK+   L  ++T   KI  R+I+  CS HQ  ++ AIKRAR +AL+P   +
  S:    23 QRRKVCRFCAEKNLTIDYKEPRTLRYFITERGKIVPRRISGNCSAHQREITEAIKRARNLALLPIASN 90
>gi|81427625|ref|YP_394622.1| 30S ribosomal protein S18 [Lactobacillus sakei subsp. sakei 23K] >gi|123742279|sp|Q38ZR6|RS18_LACSS 30S ribosomal protein S18 >gi|78609264|emb|CAI54311.1| 30S Ribosomal protein S18 [Lactobacillus sakei subsp. sakei 23K] (79 aa)
Score = 119, Expect = 4.3e-05, Identities = 25/61 (40%), Positives = 43/61 (70%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   E++DYKD +LL ++++   KI  R+++   +K+Q R++ AIKRARI+ L+PFV +
  S:    18 IAANHIEYIDYKDTDLLKRFISERGKILPRRVSGTSAKNQRRLTIAIKRARIMGLLPFVTE 78
>gi|148543252|ref|YP_001270622.1| 30S ribosomal protein S18 [Lactobacillus reuteri F275] >gi|184152664|ref|YP_001841005.1| 30S ribosomal protein S18 [Lactobacillus reuteri F275] >gi|194467411|ref|ZP_03073398.1| ribosomal protein S18 [Lactobacillus reuteri 100-23] >gi|167011191|sp|A5VHG1|RS18_LACRF 30S ribosomal protein S18 >gi|148530286|gb|ABQ82285.1| SSU ribosomal protein S18P [Lactobacillus reuteri F275] >gi|183224008|dbj|BAG24525.1| 30S ribosomal protein S18 [Lactobacillus reuteri F275] >gi|194454447|gb|EDX43344.1| ribosomal protein S18 [Lactobacillus reuteri 100-23] (78 aa)
Score = 119, Expect = 4.4e-05, Identities = 25/61 (40%), Positives = 43/61 (70%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   E++DYKD +LL ++++   KI  R++T   +K+Q +++ AIKRARI+ L+PFV +
  S:    17 IAANHIEYIDYKDTDLLRRFISERGKILPRRVTGTSAKNQRKLTIAIKRARIMGLLPFVAE 77
>gi|116750608|ref|YP_847295.1| ribosomal protein S18 [Syntrophobacter fumaroxidans MPOB] >gi|116699672|gb|ABK18860.1| SSU ribosomal protein S18P [Syntrophobacter fumaroxidans MPOB] (81 aa)
Score = 118, Expect = 4.4e-05, Identities = 25/61 (40%), Positives = 39/61 (63%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIP 150
           K C+ C   +  +DYKD + L  ++T   KI  R+I+  C+KHQ  ++ A+KRAR +AL+P
  S:    14 KVCRFCVDSELKIDYKDSKTLRYFVTERGKIVPRRISGNCAKHQRELTLAVKRARQIALLP 74
>gi|75763190|ref|ZP_00742955.1| SSU ribosomal protein S18P [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74489322|gb|EAO52773.1| SSU ribosomal protein S18P [Bacillus thuringiensis serovar israelensis ATCC 35646] (64 aa)
Score = 118, Expect = 4.6e-05, Identities = 26/61 (42%), Positives = 42/61 (68%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           C   A G   +DYKDV+LL ++++   KI  R++T   +K+Q +++ AIKRAR +AL+P+V
  S:     2 CFFTANGITRIDYKDVDLLKRFVSERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLPYV 62
>gi|150010521|ref|YP_001305264.1| 30S ribosomal protein S18 [Parabacteroides distasonis ATCC 8503] >gi|154491708|ref|ZP_02031334.1| hypothetical protein PARMER_01319 [Parabacteroides merdae ATCC 43184] >gi|149938945|gb|ABR45642.1| 30S ribosomal protein S18 [Parabacteroides distasonis ATCC 8503] >gi|154087949|gb|EDN86994.1| hypothetical protein PARMER_01319 [Parabacteroides merdae ATCC 43184] (89 aa)
Score = 118, Expect = 4.7e-05, Identities = 28/57 (49%), Positives = 38/57 (66%)
  Q:    98 GQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           G +++DYKD E L K+L    KI  R+IT    K Q RV+ A+KRAR +AL+P+V D
  S:    30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARHLALLPYVTD 86
>gi|153808732|ref|ZP_01961400.1| hypothetical protein BACCAC_03031 [Bacteroides caccae ATCC 43185] >gi|149128558|gb|EDM19776.1| hypothetical protein BACCAC_03031 [Bacteroides caccae ATCC 43185] (90 aa)
Score = 118, Expect = 4.8e-05, Identities = 27/57 (47%), Positives = 38/57 (66%)
  Q:    98 GQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           G +++DYKD E L K+L    KI  R+IT    K Q R++ A+KRAR +AL+P+V D
  S:    31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPYVTD 87
>gi|121607971|ref|YP_995778.1| ribosomal protein S18 [Verminephrobacter eiseniae EF01-2] >gi|166222255|sp|A1WGK3|RS18_VEREI 30S ribosomal protein S18 >gi|121552611|gb|ABM56760.1| SSU ribosomal protein S18P [Verminephrobacter eiseniae EF01-2] (93 aa)
Score = 118, Expect = 4.8e-05, Identities = 32/87 (36%), Positives = 50/87 (57%)
  Q:    65 KEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K+FN   RP     R   +   +RK+FC+    G E +DYKDV+ L  ++  N KI   ++T   +  Q +++ AIKRAR +AL+P+
  S:     5 KKFNKDKRP----KRNTQSLLFKRKRFCRFTVTGVEEIDYKDVDTLRDFIAENGKIIPARLTGTRAIFQRQLNTAIKRARFLALVPY 87
>gi|162149102|ref|YP_001603563.1| 30S ribosomal protein S18 [Gluconacetobacter diazotrophicus PAl 5] >gi|187598782|ref|ZP_02985031.1| ribosomal protein S18 [Gluconacetobacter diazotrophicus PAl 5] >gi|161787679|emb|CAP57275.1| putative 30S ribosomal protein S18 [Gluconacetobacter diazotrophicus PAl 5] >gi|187489182|gb|EDU27134.1| ribosomal protein S18 [Gluconacetobacter diazotrophicus PAl 5] (91 aa)
Score = 118, Expect = 4.9e-05, Identities = 27/66 (40%), Positives = 40/66 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKDV LL ++L+   KI   +IT   +K Q  ++ AIKRAR +AL+P++
  S:    24 RRRKSCPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELAQAIKRARFMALLPYI 89
>gi|87199436|ref|YP_496693.1| 30S ribosomal protein S18 [Novosphingobium aromaticivorans DSM 12444] >gi|87135117|gb|ABD25859.1| SSU ribosomal protein S18P [Novosphingobium aromaticivorans DSM 12444] (74 aa)
Score = 118, Expect = 4.9e-05, Identities = 27/66 (40%), Positives = 39/66 (59%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C    K    +DYKDV LL  +++   KI   +IT   +K Q  +S AIKRAR + L+P++
  S:     7 RRRKSCPFSGKNAPKIDYKDVRLLQGFMSERGKIVPSRITAVSAKKQRELSQAIKRARHIGLLPYI 72
>gi|13476509|ref|NP_108079.1| 30S ribosomal protein S18 [Mesorhizobium loti MAFF303099] >gi|20978722|sp|Q984T9|RS18_RHILO 30S ribosomal protein S18 >gi|14027270|dbj|BAB54224.1| 30S ribosomal protein S18 [Mesorhizobium loti MAFF303099] (82 aa)
Score = 118, Expect = 5.0e-05, Identities = 27/66 (40%), Positives = 38/66 (57%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKDV LL +Y++   KI   +IT    K Q  ++ AIKRAR + L+P+V
  S:    15 RRRKTCPFSGANAPKIDYKDVRLLQRYISERGKIVPSRITAVSQKKQRELAKAIKRARFLGLLPYV 80
>gi|124520272|ref|ZP_01695455.1| ribosomal protein S18 [Bacillus coagulans 36D1] >gi|124497762|gb|EAY45315.1| ribosomal protein S18 [Bacillus coagulans 36D1] (79 aa)
Score = 118, Expect = 5.3e-05, Identities = 27/63 (42%), Positives = 43/63 (68%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C   A    H+DYKDV+LL K+++   KI  R++T   +K+Q +++ AIKRAR +AL+P+V +
  S:    15 CYFTANHITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTTAIKRARQMALLPYVAE 77
>gi|116251320|ref|YP_767158.1| 30S ribosomal protein S18 [Rhizobium leguminosarum bv. viciae 3841] >gi|167358797|ref|ZP_02293447.1| ribosomal protein S18 [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|169198562|ref|ZP_02857871.1| ribosomal protein S18 [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|122988597|sp|Q1MJ11|RS18_RHIL3 30S ribosomal protein S18 >gi|115255968|emb|CAK07049.1| putative 30S ribosomal protein S18 [Rhizobium leguminosarum bv. viciae 3841] >gi|167074308|gb|EDR78134.1| ribosomal protein S18 [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|169087691|gb|EDS67406.1| ribosomal protein S18 [Rhizobium leguminosarum bv. trifolii WSM2304] (82 aa)
Score = 118, Expect = 5.3e-05, Identities = 27/66 (40%), Positives = 38/66 (57%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKDV LL +Y++   KI   +IT    K Q  ++ AIKRAR + L+P+V
  S:    15 RRRKTCPFSGANAPRIDYKDVRLLQRYISERGKIVPSRITAVSQKKQRELAQAIKRARFLGLLPYV 80
>gi|90960999|ref|YP_534915.1| 30S ribosomal protein S18 [Lactobacillus salivarius UCC118] >gi|123270037|sp|Q1WVN7|RS18_LACS1 30S ribosomal protein S18 >gi|90820193|gb|ABD98832.1| SSU ribosomal protein S18P [Lactobacillus salivarius UCC118] (78 aa)
Score = 118, Expect = 5.6e-05, Identities = 25/61 (40%), Positives = 43/61 (70%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   E++DYKD +LL ++++   KI  R++T   +K+Q +++ AIKRARI+ L+PFV +
  S:    17 IAANHIEYIDYKDTDLLRRFISERGKILPRRVTGTSAKNQRKLTVAIKRARIMGLLPFVAE 77
>gi|169187395|ref|ZP_02847554.1| ribosomal protein S18 [Paenibacillus sp. JDR-2] >gi|169005404|gb|EDS52256.1| ribosomal protein S18 [Paenibacillus sp. JDR-2] (94 aa)
Score = 117, Expect = 5.9e-05, Identities = 33/94 (35%), Positives = 54/94 (57%)
  Q:    61 SDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           S  ++E    +RP  K+  G    + +R+K C        H+DYKD +LL K+++   KI  R++T   +K+Q  ++ AIKRAR VAL+P+  +
  S:     2 SFKQREGGDGERPERKFG-GRKGGRNKRRKVCFFTVNKITHIDYKDTDLLKKFISERGKILPRRVTGTSAKYQRLLTVAIKRARTVALLPYTTE 94
>gi|134095345|ref|YP_001100420.1| 30S ribosomal protein S18 [Herminiimonas arsenicoxydans] >gi|133739248|emb|CAL62297.1| 30S ribosomal protein S18 [Herminiimonas arsenicoxydans] (94 aa)
Score = 117, Expect = 6.2e-05, Identities = 33/81 (40%), Positives = 47/81 (58%)
  Q:    71 DRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           D+   K  R   N   +RKKFC+  A   E VDYKDV+ L  ++  N KI   ++T   + +Q +V  AIKRAR +AL+P+
  S:     8 DKSKLKEKRKQQNPLFKRKKFCRFTAAHVEQVDYKDVDTLKDFVQENGKIMPARLTGTKAIYQRQVDTAIKRARFLALLPY 88
>gi|110634267|ref|YP_674475.1| 30S ribosomal protein S18 [Mesorhizobium sp. BNC1] >gi|122965901|sp|Q11H15|RS18_MESSB 30S ribosomal protein S18 >gi|110285251|gb|ABG63310.1| SSU ribosomal protein S18P [Mesorhizobium sp. BNC1] (82 aa)
Score = 117, Expect = 6.3e-05, Identities = 27/66 (40%), Positives = 39/66 (59%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKDV+LL +Y++   KI   +IT    K Q  ++ AIKRAR + L+P+V
  S:    15 RRRKTCPFSGANAPKIDYKDVKLLQRYISERGKIVPSRITAVSQKKQRELARAIKRARFLGLLPYV 80
>gi|125974670|ref|YP_001038580.1| 30S ribosomal protein S18 [Clostridium thermocellum ATCC 27405] >gi|196252196|ref|ZP_03150857.1| ribosomal protein S18 [Clostridium thermocellum DSM 4150] >gi|166220948|sp|A3DHF8|RS18_CLOTH 30S ribosomal protein S18 >gi|125714895|gb|ABN53387.1| SSU ribosomal protein S18P [Clostridium thermocellum ATCC 27405] >gi|196198329|gb|EDX93165.1| ribosomal protein S18 [Clostridium thermocellum DSM 4150] (94 aa)
Score = 117, Expect = 6.5e-05, Identities = 31/67 (46%), Positives = 44/67 (65%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +KK C  C    E +DYKDV  L KY++   KI  R+I+  C+KHQ +++ AIKRAR +AL+P+  D
  S:    28 KKKICAFCVDKVERIDYKDVAKLKKYISERGKILPRRISGNCAKHQRQLTVAIKRARHIALLPYTAD 94
>gi|163759110|ref|ZP_02166196.1| 30S ribosomal protein S18 [Hoeflea phototrophica DFL-43] >gi|162283514|gb|EDQ33799.1| 30S ribosomal protein S18 [Hoeflea phototrophica DFL-43] (82 aa)
Score = 117, Expect = 6.5e-05, Identities = 27/66 (40%), Positives = 38/66 (57%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKDV LL +Y++   KI   +IT    K Q  ++ AIKRAR + L+P+V
  S:    15 RRRKTCPFSGANAPKIDYKDVRLLQRYISERGKIVPSRITAVSQKKQRELAKAIKRARFLGLLPYV 80
>gi|49475325|ref|YP_033366.1| 30S ribosomal protein S18 [Bartonella henselae str. Houston-1] >gi|59798706|sp|Q6G447|RS18_BARHE 30S ribosomal protein S18 >gi|49238131|emb|CAF27339.1| 30S ribosomal protein s18 [Bartonella henselae str. Houston-1] (82 aa)
Score = 117, Expect = 6.5e-05, Identities = 27/66 (40%), Positives = 40/66 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKD++LL +Y++   KI   +IT    K Q  ++NAIKRAR + L+P+V
  S:    15 RRRKTCPFSGTNAPKIDYKDIKLLQRYISERGKIVPSRITAISQKKQRELANAIKRARFLGLLPYV 80
>gi|148553013|ref|YP_001260595.1| 30S ribosomal protein S18 [Sphingomonas wittichii RW1] >gi|148498203|gb|ABQ66457.1| SSU ribosomal protein S18P [Sphingomonas wittichii RW1] (74 aa)
Score = 117, Expect = 6.7e-05, Identities = 27/66 (40%), Positives = 40/66 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C   AK    +DYKDV LL  +++   KI   +IT   +K Q  ++ AIKRAR + L+P++
  S:     7 RRRKSCPFSAKDAPRIDYKDVRLLQGFVSERGKIVPSRITAVSAKKQRELAQAIKRARHIGLLPYI 72
>gi|91204547|emb|CAJ70775.1| strongly similar to 30S ribosomal subunit protein S18 [Candidatus Kuenenia stuttgartiensis] (73 aa)
Score = 117, Expect = 6.7e-05, Identities = 29/61 (47%), Positives = 40/61 (65%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           C+ C  G E VDYKD++ L K  T   K+ SRK +  C++HQ  V  +IKRAR +AL+P+V
  S:    12 CRFCRMGVEEVDYKDIQNLQKLATTRGKLFSRKRSGNCARHQRSVKMSIKRARFMALLPYV 72
>gi|116493585|ref|YP_805319.1| ribosomal protein S18 [Lactobacillus casei ATCC 334] >gi|191636835|ref|YP_001986001.1| 30S ribosomal protein S18 [Lactobacillus casei] >gi|122264952|sp|Q03D45|RS18_LACC3 30S ribosomal protein S18 >gi|116103735|gb|ABJ68877.1| SSU ribosomal protein S18P [Lactobacillus casei ATCC 334] >gi|190711137|emb|CAQ65143.1| 30S ribosomal protein S18 [Lactobacillus casei BL23] (78 aa)
Score = 117, Expect = 6.7e-05, Identities = 25/61 (40%), Positives = 42/61 (68%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   E++DYKD  LL ++++   KI  R++T   +K+Q +++ AIKRARI+ L+PFV +
  S:    17 IAANHIEYIDYKDTNLLDRFISERGKILPRRVTGTSAKNQRKLTIAIKRARIMGLLPFVSE 77
>gi|78066641|ref|YP_369410.1| 30S ribosomal protein S18 [Burkholderia sp. 383] >gi|170703446|ref|ZP_02894217.1| ribosomal protein S18 [Burkholderia ambifaria IOP40-10] >gi|170733231|ref|YP_001765178.1| ribosomal protein S18 [Burkholderia cenocepacia MC0-3] >gi|171321592|ref|ZP_02910523.1| ribosomal protein S18 [Burkholderia ambifaria MEX-5] >gi|194563189|ref|YP_002098212.1| Ribosomal protein S18 [Burkholderia dolosa AUO158] >gi|123742574|sp|Q39FK0|RS18_BURS3 30S ribosomal protein S18 >gi|77967386|gb|ABB08766.1| SSU ribosomal protein S18P [Burkholderia sp. 383] >gi|124894813|gb|EAY68693.1| Ribosomal protein S18 [Burkholderia dolosa AUO158] >gi|169816473|gb|ACA91056.1| ribosomal protein S18 [Burkholderia cenocepacia MC0-3] >gi|170131644|gb|EDT00201.1| ribosomal protein S18 [Burkholderia ambifaria IOP40-10] >gi|171093125|gb|EDT38342.1| ribosomal protein S18 [Burkholderia ambifaria MEX-5] (91 aa)
Score = 117, Expect = 6.7e-05, Identities = 33/83 (39%), Positives = 48/83 (57%)
  Q:    69 PQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           P  + F K  R   N   +RKKFC+  A G E +DYKD E L  ++  N KI   ++T   + +Q ++  AIKRAR +AL+P+
  S:     4 PTGKKFDK-RRQQQNPLFKRKKFCRFTAAGVEQIDYKDTETLKDFIGENGKITPARLTGTKAHYQRQLDTAIKRARFLALLPY 85
>gi|188587503|ref|YP_001919048.1| SSU ribosomal protein S18P [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352190|gb|ACB86460.1| SSU ribosomal protein S18P [Natranaerobius thermophilus JW/NM-WN-LF] (74 aa)
Score = 117, Expect = 6.9e-05, Identities = 30/68 (44%), Positives = 45/68 (66%)
  Q:    84 KQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           ++ RR K C  CA+    V YKD++ L KY+T   KI  R+I   C+KHQ +++ AIK+AR +AL+P+
  S:     3 RRRRRNKVCSFCAEKTTTVSYKDLDRLKKYITERGKILPRRINGNCAKHQRQLTTAIKKARQLALLPY 70
>gi|33593750|ref|NP_881394.1| 30S ribosomal protein S18 [Bordetella pertussis Tohama I] >gi|33597056|ref|NP_884699.1| 30S ribosomal protein S18 [Bordetella parapertussis 12822] >gi|33600901|ref|NP_888461.1| 30S ribosomal protein S18 [Bordetella bronchiseptica RB50] >gi|59798865|sp|Q7VV91|RS18_BORPE 30S ribosomal protein S18 >gi|59798870|sp|Q7W7P6|RS18_BORPA 30S ribosomal protein S18 >gi|59798872|sp|Q7WL33|RS18_BORBR 30S ribosomal protein S18 >gi|33563823|emb|CAE43067.1| 30s ribosomal protein s18 [Bordetella pertussis Tohama I] >gi|33566507|emb|CAE37763.1| 30s ribosomal protein s18 [Bordetella parapertussis] >gi|33568501|emb|CAE32413.1| 30s ribosomal protein s18 [Bordetella bronchiseptica RB50] (90 aa)
Score = 117, Expect = 7.1e-05, Identities = 26/65 (40%), Positives = 43/65 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +R+KFC+  A G E +DYKD++ L  ++  N KI   ++T   + +Q ++  AIKRAR +AL+P+
  S:    21 KRRKFCRFTAAGVEEIDYKDLDTLRDFVQENGKIIPARLTGTRAIYQRQLDTAIKRARFLALLPY 85
>gi|149071994|ref|YP_001293556.1| ribosomal protein S18 [Rhodomonas salina] >gi|134302945|gb|ABO70749.1| ribosomal protein S18 [Rhodomonas salina] (73 aa)
Score = 117, Expect = 7.2e-05, Identities = 26/51 (50%), Positives = 38/51 (74%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKDVELL  +LT   KI  +++T   +K Q +V+ AIKRAR+++L+PFV
  S:    17 IDYKDVELLSNFLTEQGKILPKRLTGLTNKQQNKVTKAIKRARMLSLLPFV 67
>gi|145588609|ref|YP_001155206.1| ribosomal protein S18 [Polynucleobacter sp. QLW-P1DMWA-1] >gi|189029683|sp|A4SVX8|RS18_POLSQ 30S ribosomal protein S18 >gi|145047015|gb|ABP33642.1| SSU ribosomal protein S18P [Polynucleobacter sp. QLW-P1DMWA-1] (90 aa)
Score = 117, Expect = 7.3e-05, Identities = 27/65 (41%), Positives = 43/65 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +RK++C+    G E +DYKDV+ L  ++  N KI   ++T   +K+Q ++  AIKRAR +AL+PF
  S:    20 KRKRYCRFTVAGVEQIDYKDVDTLKDFIGENAKITPARLTGTKAKYQRQLDTAIKRARYLALLPF 84
>gi|29347572|ref|NP_811075.1| 30S ribosomal protein S18 [Bacteroides thetaiotaomicron VPI-5482] >gi|59798897|sp|Q8A5S6|RS18_BACTN 30S ribosomal protein S18 >gi|29339473|gb|AAO77269.1| 30S ribosomal protein S18 [Bacteroides thetaiotaomicron VPI-5482] (90 aa)
Score = 117, Expect = 7.3e-05, Identities = 27/57 (47%), Positives = 37/57 (64%)
  Q:    98 GQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           G  ++DYKD E L K+L    KI  R+IT    K Q R++ A+KRAR +AL+P+V D
  S:    31 GIRYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPYVTD 87
>gi|160916101|ref|ZP_02078308.1| hypothetical protein EUBDOL_02128 [Eubacterium dolichum DSM 3991] >gi|158431825|gb|EDP10114.1| hypothetical protein EUBDOL_02128 [Eubacterium dolichum DSM 3991] (76 aa)
Score = 117, Expect = 7.3e-05, Identities = 30/67 (44%), Positives = 45/67 (67%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           RKK C       E +DYKDVELL ++++ N KI  R++T   +K+Q  ++ AIKRAR +AL+P+V +
  S:    10 RKKVCYFTKNKIETIDYKDVELLKRFISANGKIIPRRVTGTRAKYQRMLATAIKRARQMALLPYVSE 76
>gi|158337925|ref|YP_001519101.1| 30S ribosomal protein S18 [Acaryochloris marina MBIC11017] >gi|189029665|sp|B0C2J3|RS18_ACAM1 30S ribosomal protein S18 >gi|158308166|gb|ABW29783.1| 30S ribosomal protein S18 [Acaryochloris marina MBIC11017] (71 aa)
Score = 117, Expect = 7.4e-05, Identities = 23/51 (45%), Positives = 38/51 (74%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKDV+LL +++T   KI  R+IT   ++ Q  ++ AIK+AR++AL+PF+
  S:    17 IDYKDVDLLRRFITERGKILPRRITGLTARQQRDLTRAIKQARVLALLPFI 67
>gi|167754091|ref|ZP_02426218.1| hypothetical protein ALIPUT_02379 [Alistipes putredinis DSM 17216] >gi|167658716|gb|EDS02846.1| hypothetical protein ALIPUT_02379 [Alistipes putredinis DSM 17216] (92 aa)
Score = 117, Expect = 7.4e-05, Identities = 27/57 (47%), Positives = 38/57 (66%)
  Q:    98 GQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           G ++VDYKD E L K+L    KI  R++T    K Q +V+ A+KRAR +A++PFV D
  S:    33 GIKYVDYKDGEFLKKFLNEQGKILPRRLTGTSQKFQKKVAQAVKRARHLAILPFVTD 89
>gi|56708146|ref|YP_170042.1| 30S ribosomal protein S18 [Francisella tularensis subsp. tularensis SCHU S4] >gi|110670617|ref|YP_667174.1| 30S ribosomal protein S18 [Francisella tularensis subsp. tularensis FSC198] >gi|118497542|ref|YP_898592.1| 30S ribosomal protein S18 [Francisella tularensis subsp. novicida U112] >gi|134301959|ref|YP_001121928.1| 30S ribosomal protein S18 [Francisella tularensis subsp. tularensis WY96-3418] >gi|187931624|ref|YP_001891608.1| 30S ribosomal protein S18 [Francisella tularensis subsp. mediasiatica FSC147] >gi|56604638|emb|CAG45694.1| 30S ribosomal protein S18 [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320950|emb|CAL09077.1| 30S ribosomal protein S18 [Francisella tularensis subsp. tularensis FSC 198] >gi|118423448|gb|ABK89838.1| 30S ribosomal protein S18 [Francisella tularensis subsp. novicida U112] >gi|134049736|gb|ABO46807.1| ribosomal protein S18 [Francisella tularensis subsp. tularensis WY96-3418] >gi|151568873|gb|EDN34527.1| hypothetical protein FTBG_00419 [Francisella tularensis subsp. tularensis FSC033] >gi|151570630|gb|EDN36284.1| 30S ribosomal protein S18 [Francisella tularensis subsp. novicida GA99-3549] >gi|151572077|gb|EDN37731.1| hypothetical protein FTDG_00524 [Francisella tularensis subsp. novicida GA99-3548] >gi|187712533|gb|ACD30830.1| 30S ribosomal protein S18 [Francisella tularensis subsp. mediasiatica FSC147] (72 aa)
Score = 117, Expect = 7.4e-05, Identities = 26/64 (40%), Positives = 42/64 (65%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           R+K C+   +G + +DYKDV  L  Y+T   KI   ++T   +K+Q +++ AIKRAR +AL+P+
  S:     3 RRKVCRFTVEGVKEIDYKDVNKLKAYITETGKIVPSRVTGTSAKYQRQLATAIKRARFLALLPY 66
>gi|167627911|ref|YP_001678411.1| 30S ribosomal protein S18 [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167597912|gb|ABZ87910.1| 30S ribosomal protein S18 [Francisella philomiragia subsp. philomiragia ATCC 25017] (72 aa)
Score = 116, Expect = 7.6e-05, Identities = 26/64 (40%), Positives = 41/64 (64%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           R+K C+    G + +DYKDV  L  Y+T   KI   ++T   +K+Q +++ AIKRAR +AL+P+
  S:     3 RRKVCRFTVDGVKEIDYKDVNKLKAYITETGKIVPSRVTGTSAKYQRQLATAIKRARFLALLPY 66
>gi|157122288|gb|EDO66428.1| 30S ribosomal protein S18 [Francisella tularensis subsp. holarctica FSC022] (72 aa)
Score = 116, Expect = 8.0e-05, Identities = 26/64 (40%), Positives = 42/64 (65%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           R+K C+   +G + +DYKDV  L  Y+T   KI   ++T   +K+Q +++ AIKRAR +AL+P+
  S:     3 RRKVCRFTVEGVKEIDYKDVNKLKAYITETGKIVPSRVTGTSAKYQRQLATAIKRARFLALLPY 66
>gi|116332690|ref|YP_794217.1| ribosomal protein S18 [Lactobacillus brevis ATCC 367] >gi|122270614|sp|Q03UD6|RS18_LACBA 30S ribosomal protein S18 >gi|116098037|gb|ABJ63186.1| SSU ribosomal protein S18P [Lactobacillus brevis ATCC 367] (78 aa)
Score = 116, Expect = 8.1e-05, Identities = 24/61 (39%), Positives = 43/61 (70%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   E++DYKD +LL ++++   KI  R++T   +K+Q +++ AIKR+RI+ L+PFV +
  S:    17 IAANHIEYIDYKDTDLLRRFISERGKILPRRVTGTSAKNQRKLTIAIKRSRIMGLMPFVSE 77
>gi|17546028|ref|NP_519430.1| 30S ribosomal protein S18 [Ralstonia solanacearum GMI1000] >gi|20978684|sp|Q8XZT6|RS18_RALSO 30S ribosomal protein S18 >gi|17428323|emb|CAD15011.1| probable 30s ribosomal protein s18. [Ralstonia solanacearum] (92 aa)
Score = 116, Expect = 8.1e-05, Identities = 33/98 (33%), Positives = 54/98 (55%)
  Q:    54 VKETKKSSDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           + + ++ + NKK F  Q+  F            +RKKFC+    G E +DYKD++ L  ++  N KI   ++T   S +Q ++  AIKRAR +AL+P+
  S:     1 MNKKQRDAKNKKRFQQQNPLF------------KRKKFCRFTVAGVEQIDYKDLDTLKDFIGENGKITPARLTGTRSHYQRQLDTAIKRARFLALMPY 86
>gi|6226085|sp|O68127|RS18_RHOCA 30S ribosomal protein S18 >gi|3128365|gb|AAC16217.1| 30S ribosomal protein S18 [Rhodobacter capsulatus] (75 aa)
Score = 116, Expect = 8.2e-05, Identities = 27/65 (41%), Positives = 39/65 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+K C         +DYKDV LL +Y++   KI   +IT   +K Q  ++ AIKRAR +AL+P+
  S:     8 RRRKVCPFSGDNAPKIDYKDVRLLQRYISERGKIVPARITAVSAKKQRELAQAIKRARFLALLPY 72
>gi|17987764|ref|NP_540398.1| 30S ribosomal protein S18 [Brucella melitensis 16M] >gi|23501355|ref|NP_697482.1| 30S ribosomal protein S18 [Brucella suis 1330] >gi|62289439|ref|YP_221232.1| 30S ribosomal protein S18 [Brucella abortus bv. 1 str. 9-941] >gi|82699365|ref|YP_413939.1| 30S ribosomal protein S18 [Brucella melitensis biovar Abortus 2308] >gi|148560401|ref|YP_001258473.1| 30S ribosomal protein S18 [Brucella ovis ATCC 25840] >gi|161618425|ref|YP_001592312.1| 30S ribosomal protein S18 [Brucella canis ATCC 23365] >gi|189023689|ref|YP_001934457.1| Ribosomal protein S18 [Brucella abortus S19] >gi|75505331|sp|Q57ER3|RS18_BRUAB 30S ribosomal protein S18 >gi|123740899|sp|Q2YMH0|RS18_BRUA2 30S ribosomal protein S18 >gi|166220928|sp|A5VP26|RS18_BRUO2 30S ribosomal protein S18 >gi|189029650|sp|A9M8X7|RS18_BRUC2 30S ribosomal protein S18 >gi|54039409|sp|P66454|RS18_BRUSU 30S ribosomal protein S18 >gi|54042144|sp|P66453|RS18_BRUME 30S ribosomal protein S18 >gi|17983486|gb|AAL52662.1| SSU ribosomal protein S18P [Brucella melitensis 16M] >gi|23347248|gb|AAN29397.1| ribosomal protein S18 [Brucella suis 1330] >gi|62195571|gb|AAX73871.1| RpsR, ribosomal protein s18 [Brucella abortus biovar 1 str. 9-941] >gi|82615466|emb|CAJ10435.1| Ribosomal protein S18 [Brucella melitensis biovar Abortus 2308] >gi|148371658|gb|ABQ61637.1| ribosomal protein S18 [Brucella ovis ATCC 25840] >gi|161335236|gb|ABX61541.1| ribosomal protein S18 [Brucella canis ATCC 23365] >gi|189019261|gb|ACD71983.1| Ribosomal protein S18 [Brucella abortus S19] (82 aa)
Score = 116, Expect = 8.6e-05, Identities = 27/66 (40%), Positives = 39/66 (59%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKDV+LL +Y++   KI   +IT    K Q  ++ AIKRAR + L+P+V
  S:    15 RRRKTCPFSGANAPKIDYKDVKLLQRYISERGKIVPSRITAVSQKKQRELAKAIKRARFLGLLPYV 80
>gi|53719096|ref|YP_108082.1| 30S ribosomal protein S18 [Burkholderia pseudomallei K96243] >gi|53723579|ref|YP_103058.1| 30S ribosomal protein S18 [Burkholderia mallei ATCC 23344] >gi|67640202|ref|ZP_00439017.1| COG0238: Ribosomal protein S18 [Burkholderia mallei GB8 horse 4] >gi|76812240|ref|YP_333809.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1710b] >gi|83719433|ref|YP_442702.1| 30S ribosomal protein S18 [Burkholderia thailandensis E264] >gi|107028949|ref|YP_626044.1| 30S ribosomal protein S18 [Burkholderia cenocepacia AU 1054] >gi|116689893|ref|YP_835516.1| 30S ribosomal protein S18 [Burkholderia cenocepacia HI2424] >gi|121598687|ref|YP_993212.1| 30S ribosomal protein S18 [Burkholderia mallei SAVP1] >gi|124384536|ref|YP_001026013.1| 30S ribosomal protein S18 [Burkholderia mallei NCTC 10229] >gi|126438832|ref|YP_001059285.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 668] >gi|126448650|ref|YP_001080720.1| 30S ribosomal protein S18 [Burkholderia mallei NCTC 10247] >gi|126454887|ref|YP_001066553.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1106a] >gi|134278013|ref|ZP_01764728.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 305] >gi|161355143|ref|ZP_02101023.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1106b] >gi|161370255|ref|ZP_02109822.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1710a] >gi|161524575|ref|YP_001579587.1| 30S ribosomal protein S18 [Burkholderia multivorans ATCC 17616] >gi|167002902|ref|ZP_02268692.1| ribosomal protein S18 [Burkholderia mallei PRL-20] >gi|167562481|ref|ZP_02355397.1| ribosomal protein S18 [Burkholderia oklahomensis EO147] >gi|167569665|ref|ZP_02362539.1| ribosomal protein S18 [Burkholderia oklahomensis C6786] >gi|167581641|ref|ZP_02374515.1| ribosomal protein S18 [Burkholderia thailandensis TXDOH] >gi|167586988|ref|ZP_02379376.1| ribosomal protein S18 [Burkholderia ubonensis Bu] >gi|167619761|ref|ZP_02388392.1| ribosomal protein S18 [Burkholderia thailandensis Bt4] >gi|167719192|ref|ZP_02402428.1| ribosomal protein S18 [Burkholderia pseudomallei DM98] >gi|167738194|ref|ZP_02410968.1| ribosomal protein S18 [Burkholderia pseudomallei 14] >gi|167815383|ref|ZP_02447063.1| ribosomal protein S18 [Burkholderia pseudomallei 91] >gi|167823791|ref|ZP_02455262.1| ribosomal protein S18 [Burkholderia pseudomallei 9] >gi|167836331|ref|ZP_02463214.1| ribosomal protein S18 [Burkholderia thailandensis MSMB43] >gi|167845334|ref|ZP_02470842.1| ribosomal protein S18 [Burkholderia pseudomallei B7210] >gi|167893876|ref|ZP_02481278.1| ribosomal protein S18 [Burkholderia pseudomallei 7894] >gi|167902330|ref|ZP_02489535.1| ribosomal protein S18 [Burkholderia pseudomallei NCTC 13177] >gi|167910568|ref|ZP_02497659.1| ribosomal protein S18 [Burkholderia pseudomallei 112] >gi|167918594|ref|ZP_02505685.1| ribosomal protein S18 [Burkholderia pseudomallei BCC215] >gi|189350669|ref|YP_001946297.1| small subunit ribosomal protein S18 [Burkholderia multivorans ATCC 17616] >gi|194314096|ref|YP_002009550.1| 30S ribosomal protein S18 [Burkholderia mallei ATCC 10399] >gi|194506011|ref|YP_002035581.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1655] >gi|194510642|ref|YP_002023172.1| 30S ribosomal protein S18 [Burkholderia pseudomallei Pasteur 52237] >gi|194514627|ref|YP_002050745.1| 30S ribosomal protein S18 [Burkholderia pseudomallei S13] >gi|194525590|ref|YP_002061120.1| 30S ribosomal protein S18 [Burkholderia mallei FMH] >gi|194529770|ref|YP_002065291.1| 30S ribosomal protein S18 [Burkholderia mallei JHU] >gi|194559002|ref|YP_002094028.1| Ribosomal protein S18 [Burkholderia cenocepacia PC184] >gi|194570891|ref|YP_002105891.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 406e] >gi|194575123|ref|YP_002110007.1| 30S ribosomal protein S18 [Burkholderia mallei 2002721280] >gi|123179948|sp|Q1BH34|RS18_BURCA 30S ribosomal protein S18 >gi|123598874|sp|Q3JRJ4|RS18_BURP1 30S ribosomal protein S18 >gi|123753784|sp|Q2SWJ7|RS18_BURTA 30S ribosomal protein S18 >gi|166220929|sp|A0K7Z6|RS18_BURCH 30S ribosomal protein S18 >gi|166220930|sp|A3MKD4|RS18_BURM7 30S ribosomal protein S18 >gi|166220931|sp|A2S244|RS18_BURM9 30S ribosomal protein S18 >gi|166220932|sp|A1V4Q9|RS18_BURMS 30S ribosomal protein S18 >gi|166220933|sp|A3NW32|RS18_BURP0 30S ribosomal protein S18 >gi|166220934|sp|A3NAB4|RS18_BURP6 30S ribosomal protein S18 >gi|59798633|sp|Q62JR1|RS18_BURMA 30S ribosomal protein S18 >gi|59798645|sp|Q63UY4|RS18_BURPS 30S ribosomal protein S18 >gi|52209510|emb|CAH35462.1| 30S ribosomal protein S18 [Burkholderia pseudomallei K96243] >gi|52427002|gb|AAU47595.1| ribosomal protein S18 [Burkholderia mallei ATCC 23344] >gi|76581693|gb|ABA51168.1| 30S ribosomal protein S18. [Burkholderia pseudomallei 1710b] >gi|83653258|gb|ABC37321.1| ribosomal protein S18 [Burkholderia thailandensis E264] >gi|105898113|gb|ABF81071.1| SSU ribosomal protein S18P [Burkholderia cenocepacia AU 1054] >gi|116647982|gb|ABK08623.1| SSU ribosomal protein S18P [Burkholderia cenocepacia HI2424] >gi|121227497|gb|ABM50015.1| 30S ribosomal protein S18 [Burkholderia mallei SAVP1] >gi|124292556|gb|ABN01825.1| 30S ribosomal protein S18 [Burkholderia mallei NCTC 10229] >gi|124872793|gb|EAY64509.1| Ribosomal protein S18 [Burkholderia cenocepacia PC184] >gi|126218325|gb|ABN81831.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 668] >gi|126228529|gb|ABN92069.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1106a] >gi|126241520|gb|ABO04613.1| 30S ribosomal protein S18 [Burkholderia mallei NCTC 10247] >gi|134251663|gb|EBA51742.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 305] >gi|147749600|gb|EDK56674.1| 30S ribosomal protein S18 [Burkholderia mallei FMH] >gi|147753780|gb|EDK60845.1| 30S ribosomal protein S18 [Burkholderia mallei JHU] >gi|148027375|gb|EDK85396.1| 30S ribosomal protein S18 [Burkholderia mallei 2002721280] >gi|157807650|gb|EDO84820.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 406e] >gi|157936795|gb|EDO92465.1| 30S ribosomal protein S18 [Burkholderia pseudomallei Pasteur 52237] >gi|160342004|gb|ABX15090.1| ribosomal protein S18 [Burkholderia multivorans ATCC 17616] >gi|160699472|gb|EDP89442.1| 30S ribosomal protein S18 [Burkholderia mallei ATCC 10399] >gi|169654235|gb|EDS86928.1| 30S ribosomal protein S18 [Burkholderia pseudomallei S13] >gi|184210032|gb|EDU07075.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1655] >gi|189334691|dbj|BAG43761.1| small subunit ribosomal protein S18 [Burkholderia multivorans ATCC 17616] (91 aa)
Score = 116, Expect = 8.9e-05, Identities = 33/83 (39%), Positives = 48/83 (57%)
  Q:    69 PQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           P  + F K  R   N   +RKKFC+  A G E +DYKD E L  ++  N KI   ++T   + +Q ++  AIKRAR +AL+P+
  S:     4 PTGKKFDK-RRQQQNPLFKRKKFCRFTAAGVEQIDYKDTETLKDFIGENGKITPARLTGTKAHYQRQLDTAIKRARFLALLPY 85
>gi|110003930|emb|CAK98270.1| 30s ribosomal protein s18 [Spiroplasma citri] (74 aa)
Score = 116, Expect = 9.0e-05, Identities = 30/68 (44%), Positives = 45/68 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           R KK C        ++DYKDVELL K+++ N +I  +++T   +K+Q  ++ AIKRAR +AL+PFV D
  S:     7 RFKKQCYFTKNKITYIDYKDVELLKKFISGNGQILPKRVTGTTAKNQRMLATAIKRARQMALLPFVID 74
>gi|16125914|ref|NP_420478.1| 30S ribosomal protein S18 [Caulobacter crescentus CB15] >gi|167646473|ref|YP_001684136.1| 30S ribosomal protein S18 [Caulobacter sp. K31] >gi|189029669|sp|B0SWL0|RS18_CAUSK 30S ribosomal protein S18 >gi|20978733|sp|Q9A7Q2|RS18_CAUCR 30S ribosomal protein S18 >gi|13423076|gb|AAK23646.1| ribosomal protein S18 [Caulobacter crescentus CB15] >gi|167348903|gb|ABZ71638.1| ribosomal protein S18 [Caulobacter sp. K31] (92 aa)
Score = 116, Expect = 9.2e-05, Identities = 28/66 (42%), Positives = 41/66 (62%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKDV+LL +Y++   KI   +IT   +K Q  ++ AIKRAR +AL+P+V
  S:    25 RRRKVCPFSGANAPKIDYKDVKLLQRYVSERGKIVPSRITAVSAKKQRELAKAIKRARFLALLPYV 90
>gi|124266721|ref|YP_001020725.1| SSU ribosomal protein S18P [Methylibium petroleiphilum PM1] >gi|166220959|sp|A2SG01|RS18_METPP 30S ribosomal protein S18 >gi|124259496|gb|ABM94490.1| SSU ribosomal protein S18P [Methylibium petroleiphilum PM1] (96 aa)
Score = 116, Expect = 9.2e-05, Identities = 31/78 (39%), Positives = 45/78 (57%)
  Q:    74 FAKYNRGYPNKQG---RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           F K  R   N Q    RRK+FC+    G   +DYKDV+ L  ++  N KI   ++T   +  Q ++S  IKRAR +AL+P+
  S:    10 FGKDKRPKRNTQSLLFRRKRFCRFTVTGVTEIDYKDVDTLRDFIAENGKITPARLTGTRAFFQRQLSTCIKRARFLALLPY 90
>gi|162447065|ref|YP_001620197.1| small subunit ribosomal protein S18 [Acholeplasma laidlawii PG-8A] >gi|161985172|gb|ABX80821.1| small subunit ribosomal protein S18 [Acholeplasma laidlawii PG-8A] (80 aa)
Score = 116, Expect = 9.3e-05, Identities = 29/68 (42%), Positives = 44/68 (64%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +RKK C        H+D+KD ELL +++T   KI  R++T   +K Q  ++ AIKRAR +AL+PFV++
  S:    13 KRKKVCFFTQNKFTHIDFKDTELLKRFITERGKILPRRVTGTSAKWQRPLAVAIKRARHMALLPFVKE 80
>gi|149184753|ref|ZP_01863071.1| 30S ribosomal protein S18 [Erythrobacter sp. SD-21] >gi|148832073|gb|EDL50506.1| 30S ribosomal protein S18 [Erythrobacter sp. SD-21] (74 aa)
Score = 116, Expect = 9.3e-05, Identities = 27/66 (40%), Positives = 40/66 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C   AK    +DYKDV LL  +++   KI   +IT   +K Q  ++ AIKRAR + L+P++
  S:     7 RRRKTCPFSAKNAPAIDYKDVRLLQGFMSERGKIVPSRITAVSAKKQRELAKAIKRARHIGLLPYI 72
>gi|148242324|ref|YP_001227481.1| 30S ribosomal protein S18 [Synechococcus sp. RCC307] >gi|166222252|sp|A5GTB9|RS18_SYNR3 30S ribosomal protein S18 >gi|147850634|emb|CAK28128.1| 30S ribosomal protein S18 [Synechococcus sp. RCC307] (73 aa)
Score = 116, Expect = 9.4e-05, Identities = 24/51 (47%), Positives = 38/51 (74%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKD +LL K++T   K+  R++T   ++ Q  ++N++KRARIVAL+PFV
  S:    19 IDYKDTDLLKKFITERGKLLPRRMTGLTARQQRDLTNSVKRARIVALLPFV 69
>gi|88803224|ref|ZP_01118750.1| ribosomal protein S18 [Polaribacter irgensii 23-P] >gi|88780790|gb|EAR11969.1| ribosomal protein S18 [Polaribacter irgensii 23-P] (98 aa)
Score = 116, Expect = 9.4e-05, Identities = 27/68 (39%), Positives = 43/68 (63%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +  K+C+   KG +++DYKD + L   +    KI  R++T    K+Q +V+ AIKRAR +AL+P+V D
  S:    28 KEAKYCRFKKKGIKYIDYKDADFLMYLVNEQGKILPRRLTGTSLKYQRKVAQAIKRARHLALMPYVGD 95
>gi|153886810|ref|ZP_02007964.1| ribosomal protein S18 [Ralstonia pickettii 12D] >gi|187928273|ref|YP_001898760.1| ribosomal protein S18 [Ralstonia pickettii 12J] >gi|151576984|gb|EDN41386.1| ribosomal protein S18 [Ralstonia pickettii 12D] >gi|187725163|gb|ACD26328.1| ribosomal protein S18 [Ralstonia pickettii 12J] (95 aa)
Score = 116, Expect = 9.7e-05, Identities = 32/98 (32%), Positives = 54/98 (55%)
  Q:    54 VKETKKSSDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           + + ++ + NKK F  Q+  F            +RKKFC+    G E +DYKD++ L  ++  N KI   ++T   + +Q ++  AIKRAR +AL+P+
  S:     4 MNKKQRDAKNKKRFQQQNPLF------------KRKKFCRFTVAGVEQIDYKDLDTLKDFIGENGKITPARLTGTRAIYQRQLDTAIKRARFLALMPY 89
>gi|7705630|ref|NP_057151.1| mitochondrial ribosomal protein S18C [Homo sapiens] >gi|55622668|ref|XP_517249.1| PREDICTED: mitochondrial ribosomal protein S18C isoform 2 [Pan troglodytes] >gi|24212202|sp|Q9Y3D5|RT18C_HUMAN 28S ribosomal protein S18c, mitochondrial precursor (MRP-S18-c) (Mrps18c) (MRP-S18-1) >gi|4929737|gb|AAD34129.1|AF151892_1 CGI-134 protein [Homo sapiens] >gi|13528768|gb|AAH05186.1| Mitochondrial ribosomal protein S18C [Homo sapiens] >gi|119626343|gb|EAX05938.1| mitochondrial ribosomal protein S18C, isoform CRA_b [Homo sapiens] >gi|119626345|gb|EAX05940.1| mitochondrial ribosomal protein S18C, isoform CRA_b [Homo sapiens] (142 aa)
Score = 115, Expect = 9.8e-05, Identities = 33/81 (40%), Positives = 48/81 (59%)
  Q:    70 QDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLK-IASRKITFACSKHQTRVSNAIKRARIVALIP 150
           +D P +  N   P K+  +K  C LC K   HVDYK+V+LL ++++P    I  R IT  C K Q  ++ AIKRA+I+  +P
  S:    48 EDLPISMEN---PYKEPLKK--CILCGK---HVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMP 121
>gi|86133511|ref|ZP_01052093.1| ribosomal protein S18 [Tenacibaculum sp. MED152] >gi|85820374|gb|EAQ41521.1| ribosomal protein S18 [Polaribacter dokdonensis MED152] (98 aa)
Score = 115, Expect = 1.0e-04, Identities = 27/68 (39%), Positives = 43/68 (63%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +  K+C+   KG +++DYKD + L   +    KI  R++T    K+Q +V+ AIKRAR +AL+P+V D
  S:    28 KEAKYCRFKKKGIKYIDYKDADFLMYLVNEQGKILPRRLTGTSLKYQRKVAQAIKRARHLALMPYVGD 95
>gi|94497409|ref|ZP_01303979.1| 30S ribosomal protein S18 [Sphingomonas sp. SKA58] >gi|94423040|gb|EAT08071.1| 30S ribosomal protein S18 [Sphingomonas sp. SKA58] (74 aa)
Score = 115, Expect = 1.0e-04, Identities = 27/66 (40%), Positives = 41/66 (62%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C   AK    +DYKDV LL  +++   KI   +IT   +K Q  +++AIKRAR + L+P++
  S:     7 RRRKSCPFAAKDAPKIDYKDVRLLQGFVSERGKIVPSRITAVSAKKQRELASAIKRARHLGLLPYI 72
>gi|118588140|ref|ZP_01545550.1| 30S ribosomal protein S18 [Stappia aggregata IAM 12614] >gi|118439762|gb|EAV46393.1| 30S ribosomal protein S18 [Stappia aggregata IAM 12614] (82 aa)
Score = 115, Expect = 1.0e-04, Identities = 25/63 (39%), Positives = 37/63 (58%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           K C         +DYKD+ LL +Y++   KI   +IT   +K Q  ++ AIKRAR++ L+PFV
  S:    18 KTCPFSGTNAPKIDYKDIRLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARLLGLLPFV 80
>gi|152983164|ref|YP_001352993.1| 30S ribosomal protein S18 [Janthinobacterium sp. Marseille] >gi|151283241|gb|ABR91651.1| small subunit ribosomal protein S18 [Janthinobacterium sp. Marseille] (94 aa)
Score = 115, Expect = 1.0e-04, Identities = 33/81 (40%), Positives = 47/81 (58%)
  Q:    71 DRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           D+   K  R   N   +RKKFC+  A   E VDYKDV+ L  ++  N KI   ++T   + +Q +V  AIKRAR +AL+P+
  S:     8 DKNKLKEKRKQQNPLFKRKKFCRFTAAHVEQVDYKDVDTLKDFVQENGKIMPARLTGTKAIYQRQVDTAIKRARYLALLPY 88
>gi|113477197|ref|YP_723258.1| 30S ribosomal protein S18 [Trichodesmium erythraeum IMS101] >gi|110168245|gb|ABG52785.1| SSU ribosomal protein S18P [Trichodesmium erythraeum IMS101] (72 aa)
Score = 115, Expect = 1.0e-04, Identities = 29/51 (56%), Positives = 38/51 (74%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKDVELL KY+T   KI  R+IT   SK Q  ++ +IKRAR+VAL+P+V
  S:    18 IDYKDVELLKKYITERGKIMPRRITGLTSKQQRDLTKSIKRARLVALLPYV 68
>gi|163755338|ref|ZP_02162458.1| 30S ribosomal protein S18 [Kordia algicida OT-1] >gi|161324758|gb|EDP96087.1| 30S ribosomal protein S18 [Kordia algicida OT-1] (98 aa)
Score = 115, Expect = 1.0e-04, Identities = 27/68 (39%), Positives = 45/68 (66%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + KK+C+    G +++DYKD + L K++    K+  R++T    K+Q +VS A+KRAR +AL+P+V D
  S:    28 KAKKYCRFKKSGIKYIDYKDPDFLLKFVNEQGKLLPRRLTGTSLKYQRKVSVAVKRARHLALMPYVGD 95
>gi|187603426|ref|ZP_02989638.1| ribosomal protein S18 [Exiguobacterium sp. AT1b] >gi|187484201|gb|EDU22193.1| ribosomal protein S18 [Exiguobacterium sp. AT1b] (76 aa)
Score = 115, Expect = 1.1e-04, Identities = 26/65 (40%), Positives = 43/65 (66%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           K C   +    H+DYKDVELL ++++   KI  R++T   +K+Q  ++ AIKR+R +AL+P+V +
  S:    12 KVCFFTSNNITHIDYKDVELLKRFVSERGKILPRRVTGTSAKYQRPLTVAIKRSRQMALLPYVAE 76
>gi|91214893|ref|ZP_01251866.1| ribosomal protein S18 [Psychroflexus torquis ATCC 700755] >gi|91187320|gb|EAS73690.1| ribosomal protein S18 [Psychroflexus torquis ATCC 700755] (98 aa)
Score = 115, Expect = 1.1e-04, Identities = 26/67 (38%), Positives = 44/67 (65%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + +FC+    G ++VDYK+ + L +++    KI  R++T    K+Q +VS AIKR+R +AL+P+V D
  S:    29 KTRFCRFKRAGIKYVDYKNADFLMEFVNEQGKILPRRLTGTSLKYQRKVSQAIKRSRHLALMPYVGD 95
>gi|115351860|ref|YP_773699.1| 30S ribosomal protein S18 [Burkholderia ambifaria AMMD] >gi|172060830|ref|YP_001808482.1| ribosomal protein S18 [Burkholderia ambifaria MC40-6] >gi|122323038|sp|Q0BEQ8|RS18_BURCM 30S ribosomal protein S18 >gi|115281848|gb|ABI87365.1| SSU ribosomal protein S18P [Burkholderia ambifaria AMMD] >gi|171993347|gb|ACB64266.1| ribosomal protein S18 [Burkholderia ambifaria MC40-6] (91 aa)
Score = 115, Expect = 1.1e-04, Identities = 32/83 (38%), Positives = 48/83 (57%)
  Q:    69 PQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           P  + F K  R   N   +RKKFC+  A G + +DYKD E L  ++  N KI   ++T   + +Q ++  AIKRAR +AL+P+
  S:     4 PTGKKFDK-RRQQQNPLFKRKKFCRFTAAGVDQIDYKDTETLKDFIGENGKITPARLTGTKAHYQRQLDTAIKRARFLALLPY 85
>gi|83311200|ref|YP_421464.1| 30S ribosomal protein S18 [Magnetospirillum magneticum AMB-1] >gi|123768010|sp|Q2W5H0|RS18_MAGMM 30S ribosomal protein S18 >gi|82946041|dbj|BAE50905.1| Ribosomal protein S18 [Magnetospirillum magneticum AMB-1] (92 aa)
Score = 115, Expect = 1.1e-04, Identities = 26/66 (39%), Positives = 42/66 (63%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C    +G   +DYKD++LL ++++   KI   +IT   +K Q  ++ AIKRAR + L+P+V
  S:    25 RRRKTCPFSGEGAPKIDYKDIKLLSRFISERGKIVPSRITAVSAKKQRELAQAIKRARFLGLLPYV 90
>gi|153007913|ref|YP_001369128.1| 30S ribosomal protein S18 [Ochrobactrum anthropi ATCC 49188] >gi|166220966|sp|A6WWE5|RS18_OCHA4 30S ribosomal protein S18 >gi|151559801|gb|ABS13299.1| ribosomal protein S18 [Ochrobactrum anthropi ATCC 49188] (82 aa)
Score = 115, Expect = 1.1e-04, Identities = 26/66 (39%), Positives = 39/66 (59%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKD++LL +Y++   KI   +IT    K Q  ++ AIKRAR + L+P+V
  S:    15 RRRKTCPFSGANAPKIDYKDIKLLQRYISERGKIVPSRITAVSQKKQRELAKAIKRARFLGLLPYV 80
>gi|163842734|ref|YP_001627138.1| 30S ribosomal protein S18 [Brucella suis ATCC 23445] >gi|189029668|sp|B0CKD8|RS18_BRUSI 30S ribosomal protein S18 >gi|163673457|gb|ABY37568.1| ribosomal protein S18 [Brucella suis ATCC 23445] (82 aa)
Score = 115, Expect = 1.1e-04, Identities = 27/66 (40%), Positives = 38/66 (57%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR K C         +DYKDV+LL +Y++   KI   +IT    K Q  ++ AIKRAR + L+P+V
  S:    15 RRHKTCPFSGANAPKIDYKDVKLLQRYISERGKIVPSRITAVSQKKQRELAKAIKRARFLGLLPYV 80
>gi|57240364|ref|ZP_00368313.1| ribosomal protein S18 [Campylobacter lari RM2100] >gi|57018705|gb|EAL55478.1| ribosomal protein S18 [Campylobacter lari RM2100] (86 aa)
Score = 115, Expect = 1.1e-04, Identities = 31/71 (43%), Positives = 41/71 (57%)
  Q:    84 KQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           K+   +K+CK      + +DYKD  LL   L+   KI  R++T    KHQ  V  AIKRAR VALIP++ D
  S:     4 KRKYSRKYCKYTEAKVDFIDYKDTALLKHALSERFKIMPRRLTGTSKKHQEMVEIAIKRARHVALIPYIVD 74
>gi|163788027|ref|ZP_02182473.1| 30S ribosomal protein S18 [Flavobacteriales bacterium ALC-1] >gi|159876347|gb|EDP70405.1| 30S ribosomal protein S18 [Flavobacteriales bacterium ALC-1] (98 aa)
Score = 115, Expect = 1.1e-04, Identities = 27/68 (39%), Positives = 44/68 (64%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + KK+C+    G ++VDYKD + L  ++    K+  R++T    K+Q +VS A+KRAR +AL+P+V D
  S:    28 KTKKYCRFKKSGIKYVDYKDADWLLGFVNEQGKLLPRRLTGTSLKYQRKVSVAVKRARHLALMPYVAD 95
>gi|138897054|ref|YP_001127507.1| ribosomal protein S18 [Geobacillus thermodenitrificans NG80-2] >gi|134268567|gb|ABO68762.1| Ribosomal protein S18 [Geobacillus thermodenitrificans NG80-2] (91 aa)
Score = 115, Expect = 1.1e-04, Identities = 28/63 (44%), Positives = 43/63 (68%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C   A    H+DYKDV+LL K+++   KI  R++T   +K+Q +++ AIKRAR +AL+P+V D
  S:    28 CYFTANNITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLPYVAD 90
>gi|159184609|ref|NP_529002.1| 30S ribosomal protein S18 [Agrobacterium tumefaciens str. C58] >gi|23822149|sp|Q8UGE8|RS18_AGRT5 30S ribosomal protein S18 >gi|17739485|gb|AAL42103.1| 30S ribosomal protein S18 [Agrobacterium tumefaciens str. C58] (82 aa)
Score = 115, Expect = 1.1e-04, Identities = 27/66 (40%), Positives = 38/66 (57%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKDV LL +Y++   KI   +IT    K Q  ++ AIKRAR + L+P+V
  S:    15 RRRKTCPFSGANAPKIDYKDVRLLQRYISERGKIVPSRITAVSQKKQRELAQAIKRARFLGLLPYV 80
>gi|88711928|ref|ZP_01106015.1| ribosomal protein S18 [Flavobacteriales bacterium HTCC2170] >gi|88709334|gb|EAR01567.1| ribosomal protein S18 [Flavobacteriales bacterium HTCC2170] (98 aa)
Score = 115, Expect = 1.1e-04, Identities = 26/67 (38%), Positives = 44/67 (65%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +KK+C+    G +++DYKD + L K +    K+  R++T    K+Q +V+ A+KRAR +AL+P+V D
  S:    29 KKKYCRFKKSGIKYIDYKDADFLMKLVNEQGKLLPRRLTGTSLKYQRKVAQAVKRARHLALMPYVGD 95
>gi|154148306|ref|YP_001405849.1| 30S ribosomal protein S18 [Campylobacter hominis ATCC BAA-381] >gi|166220939|sp|A7I008|RS18_CAMHC 30S ribosomal protein S18 >gi|153804315|gb|ABS51322.1| ribosomal protein S18 [Campylobacter hominis ATCC BAA-381] (87 aa)
Score = 115, Expect = 1.2e-04, Identities = 30/72 (41%), Positives = 41/72 (56%)
  Q:    83 NKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +K+   +K+CK      E +DYKD  LL   L+   KI  R++T    K+Q  V  AIKRAR  ALIP++ D
  S:     3 DKRKYTRKYCKFTEAKIEFIDYKDTALLKYCLSERFKIMPRRLTGTSKKYQEMVEKAIKRARQAALIPYIVD 74
>gi|37522628|ref|NP_926005.1| 30S ribosomal protein S18 [Gloeobacter violaceus PCC 7421] >gi|59798825|sp|Q7NCC0|RS18_GLOVI 30S ribosomal protein S18 >gi|35213629|dbj|BAC91000.1| 30S ribosomal protein S18 [Gloeobacter violaceus PCC 7421] (74 aa)
Score = 115, Expect = 1.2e-04, Identities = 26/54 (48%), Positives = 40/54 (74%)
  Q:    99 QEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           ++ +DYK+V+LL K++T   KI  R+IT   +K Q  ++ AIKRAR++AL+PFV
  S:    17 KDKIDYKEVDLLRKFITERGKILPRRITGLTAKQQRDLTVAIKRARLLALLPFV 70
>gi|114762812|ref|ZP_01442244.1| 30S ribosomal protein S18 [Roseovarius sp. HTCC2601] >gi|114544422|gb|EAU47429.1| 30S ribosomal protein S18 [Roseovarius sp. HTCC2601] (75 aa)
Score = 115, Expect = 1.2e-04, Identities = 27/66 (40%), Positives = 40/66 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKD +LL +Y++   KI   +IT   +K Q  ++ AIKRAR +AL+P+V
  S:     8 RRRKVCPFSGDNAPKIDYKDTKLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARFLALLPYV 73
>gi|195952827|ref|YP_002121117.1| ribosomal protein S18 [Hydrogenobaculum sp. Y04AAS1] >gi|195932439|gb|ACG57139.1| ribosomal protein S18 [Hydrogenobaculum sp. Y04AAS1] (73 aa)
Score = 115, Expect = 1.2e-04, Identities = 26/66 (39%), Positives = 47/66 (71%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           ++ K CK C + ++  +YK+   L ++++ + KI  R++TF C+KHQ +++N IKRAR +AL+P+V
  S:     7 KKAKVCKFCMEKRDP-NYKNYNELREFMSEHGKILPRRMTFVCAKHQRKLANEIKRARQLALLPYV 71
>gi|149372600|ref|ZP_01891712.1| 30S ribosomal protein S18 [unidentified eubacterium SCB49] >gi|149354643|gb|EDM43207.1| 30S ribosomal protein S18 [unidentified eubacterium SCB49] (98 aa)
Score = 115, Expect = 1.2e-04, Identities = 26/71 (36%), Positives = 47/71 (66%)
  Q:    84 KQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +  ++KK+C+    G ++VDYKD E L +++    K+  R++T    K+Q +V+ A+KR+R +AL+P+V D
  S:    25 ETAKQKKYCRFKKSGIKYVDYKDGEWLLRFVNEQGKLLPRRLTGTSLKYQRKVAVAVKRSRHLALMPYVTD 95
>gi|78777859|ref|YP_394174.1| 30S ribosomal protein S18 [Sulfurimonas denitrificans DSM 1251] >gi|123741081|sp|Q30PZ2|RS18_THIDN 30S ribosomal protein S18 >gi|78498399|gb|ABB44939.1| SSU ribosomal protein S18P [Sulfurimonas denitrificans DSM 1251] (87 aa)
Score = 114, Expect = 1.3e-04, Identities = 26/64 (40%), Positives = 39/64 (60%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +K++CK C    + +DYKDV  L   L+   KI  R++T  C +HQ  ++  IKRAR  AL+P+
  S:     8 KKRYCKYCEAKVDFMDYKDVGALRFSLSERYKIMPRRLTGNCKRHQDMIATVIKRARAAALVPY 71
>gi|163797515|ref|ZP_02191466.1| Ribosomal protein S18 [alpha proteobacterium BAL199] >gi|159177264|gb|EDP61823.1| Ribosomal protein S18 [alpha proteobacterium BAL199] (84 aa)
Score = 114, Expect = 1.3e-04, Identities = 26/66 (39%), Positives = 41/66 (62%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C     G   +DYKD +LL ++++   KI   +IT   +K Q  ++ AIKR+R +AL+P+V
  S:    17 RRRKSCPFSGTGAPIIDYKDTKLLSRFISERGKIVPSRITAVSAKKQREMARAIKRSRFLALLPYV 82
>gi|111226184|ref|YP_716978.1| 30S ribosomal protein S18 [Frankia alni ACN14a] >gi|111153716|emb|CAJ65474.1| 30S ribosomal subunit protein S18 [Frankia alni ACN14a] (73 aa)
Score = 114, Expect = 1.3e-04, Identities = 26/64 (40%), Positives = 43/64 (67%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +KK C  C    E++D+KD  LL KY++   KI +R+++  CS+HQ  V+ A+K +R +AL+P+
  S:     5 KKKVCVFCKDKVEYIDFKDTSLLRKYISDRGKIRARRVSGNCSQHQRDVATAVKNSREMALLPY 68
>gi|115314809|ref|YP_763532.1| 30S ribosomal protein S18 [Francisella tularensis subsp. holarctica OSU18] >gi|115129708|gb|ABI82895.1| ribosomal protein S18 [Francisella tularensis subsp. holarctica OSU18] (72 aa)
Score = 114, Expect = 1.3e-04, Identities = 25/64 (39%), Positives = 41/64 (64%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           R+K C+   +G + +DYKDV  L  Y+    KI   ++T   +K+Q +++ AIKRAR +AL+P+
  S:     3 RRKVCRFTVEGVKEIDYKDVNKLKAYINETGKIVPSRVTGTSAKYQRQLATAIKRARFLALLPY 66
>gi|88806418|ref|ZP_01121935.1| ribosomal protein S18 [Robiginitalea biformata HTCC2501] >gi|88783250|gb|EAR14422.1| ribosomal protein S18 [Robiginitalea biformata HTCC2501] (98 aa)
Score = 114, Expect = 1.4e-04, Identities = 27/68 (39%), Positives = 44/68 (64%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + KK+C+    G +++DYKD + L K +    KI  R++T    K+Q +V+ AIKR+R +AL+P+V D
  S:    28 KEKKYCRFKKSGIKYIDYKDPDFLMKLVNEQGKILPRRLTGTSLKYQRKVAQAIKRSRHLALMPYVGD 95
>gi|166367546|ref|YP_001659819.1| 30S ribosomal protein S18 [Microcystis aeruginosa NIES-843] >gi|189029681|sp|B0JVN4|RS18_MICAN 30S ribosomal protein S18 >gi|166089919|dbj|BAG04627.1| 30S ribosomal protein S18 [Microcystis aeruginosa NIES-843] (71 aa)
Score = 114, Expect = 1.4e-04, Identities = 27/51 (52%), Positives = 37/51 (72%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKD ELL K++T   KI  R+IT   SK Q  ++ A+KRAR++AL+PFV
  S:    17 IDYKDTELLRKFITERGKILPRRITGLTSKQQRDLTEAVKRARLMALLPFV 67
>gi|163868014|ref|YP_001609218.1| 30S ribosomal protein S18 [Bartonella tribocorum CIP 105476] >gi|189029667|sp|A9IRU1|RS18_BART1 30S ribosomal protein S18 >gi|161017665|emb|CAK01223.1| 30S ribosomal protein S18 [Bartonella tribocorum CIP 105476] (82 aa)
Score = 114, Expect = 1.4e-04, Identities = 27/66 (40%), Positives = 40/66 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKD++LL +Y++   KI   +IT    K Q  ++NAIKRAR + L+P+V
  S:    15 RRRKTCPFSGATAPKIDYKDIKLLQRYISERGKIVPSRITAVSQKKQRELANAIKRARFLGLLPYV 80
>gi|134295902|ref|YP_001119637.1| 30S ribosomal protein S18 [Burkholderia vietnamiensis G4] >gi|166220935|sp|A4JEU9|RS18_BURVG 30S ribosomal protein S18 >gi|134139059|gb|ABO54802.1| SSU ribosomal protein S18P [Burkholderia vietnamiensis G4] (91 aa)
Score = 114, Expect = 1.4e-04, Identities = 32/83 (38%), Positives = 48/83 (57%)
  Q:    69 PQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           P  + F K  R   N   +RKKFC+  A G + +DYKD E L  ++  N KI   ++T   + +Q ++  AIKRAR +AL+P+
  S:     4 PTGKKFDK-RRQQQNPLFKRKKFCRFTAAGVDQIDYKDTETLKDFIGENGKITPARLTGTKAHYQRQLDTAIKRARFLALLPY 85
>gi|86130271|ref|ZP_01048871.1| ribosomal protein S18 [Cellulophaga sp. MED134] >gi|85818946|gb|EAQ40105.1| ribosomal protein S18 [Dokdonia donghaensis MED134] (98 aa)
Score = 114, Expect = 1.4e-04, Identities = 27/68 (39%), Positives = 44/68 (64%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + KK+C+    G ++VDYKD + L  ++    K+  R++T    K+Q +VS A+KRAR +AL+P+V D
  S:    28 KAKKYCRFKKSGIKYVDYKDADWLAGFVNEQGKLLPRRLTGTSLKYQRKVSVAVKRARHLALMPYVTD 95
>gi|149913883|ref|ZP_01902415.1| 30S ribosomal protein S18 [Roseobacter sp. AzwK-3b] >gi|149812167|gb|EDM71998.1| 30S ribosomal protein S18 [Roseobacter sp. AzwK-3b] (75 aa)
Score = 114, Expect = 1.4e-04, Identities = 27/65 (41%), Positives = 39/65 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+K C         +DYKD +LL +Y++   KI   +IT   +K Q  +S AIKRAR +AL+P+
  S:     8 RRRKVCPFSGDNAPAIDYKDTKLLQRYISERGKIVPSRITAVSAKKQRELSRAIKRARFLALLPY 72
>gi|160871730|ref|ZP_02061862.1| ribosomal protein S18 [Rickettsiella grylli] >gi|159120529|gb|EDP45867.1| ribosomal protein S18 [Rickettsiella grylli] (78 aa)
Score = 114, Expect = 1.5e-04, Identities = 30/69 (43%), Positives = 44/69 (63%)
  Q:    83 NKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           N Q RR+K C++ A+G E VDYKD+ LL  +LT   KI   + T   +  Q +++ AIKRAR + L+P+
  S:     3 NYQTRRRKHCRISAEGME-VDYKDLALLKSHLTETAKIVPSRTTGTTACVQRKLTQAIKRARFLGLLPY 70
>gi|187917991|ref|YP_001883554.1| SSU ribosomal protein S18P [Borrelia hermsii DAH] >gi|119860839|gb|AAX16634.1| SSU ribosomal protein S18P [Borrelia hermsii DAH] (96 aa)
Score = 114, Expect = 1.5e-04, Identities = 31/72 (43%), Positives = 46/72 (63%)
  Q:    82 PNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVR 153
           PN +  +KK CK C   +   DYK+ + L K++T   KI  R+IT   +KHQ R++  IK+AR +AL+PFV+
  S:    25 PNFRFFKKKTCKFCDMDRVP-DYKEFDFLKKFITEQGKILPRRITGTSAKHQRRLALEIKKARYMALLPFVK 95
>gi|46579370|ref|YP_010178.1| 30S ribosomal protein S18 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120603072|ref|YP_967472.1| 30S ribosomal protein S18 [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166220950|sp|A1VF29|RS18_DESVV 30S ribosomal protein S18 >gi|59798765|sp|Q72DH2|RS18_DESVH 30S ribosomal protein S18 >gi|46448784|gb|AAS95437.1| ribosomal protein S18 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120563301|gb|ABM29045.1| SSU ribosomal protein S18P [Desulfovibrio vulgaris subsp. vulgaris DP4] (87 aa)
Score = 114, Expect = 1.5e-04, Identities = 27/72 (37%), Positives = 44/72 (61%)
  Q:    80 GYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
            +  K   R+KFC+ CA  +  +DYK  ++L  ++T   KI +R+IT  C+ HQ  ++  IKRAR +AL+ +
  S:     2 AFKKKFAPRRKFCRFCADKELPIDYKRADILRDFITERGKIIARRITGTCAHHQRVLTREIKRARQMALLIY 73
>gi|89256364|ref|YP_513726.1| 30S ribosomal protein S18 [Francisella tularensis subsp. holarctica] >gi|167010709|ref|ZP_02275640.1| 30S ribosomal protein S18 [Francisella tularensis subsp. holarctica FSC200] >gi|169656607|ref|YP_001428514.2| ribosomal protein S18 [Francisella tularensis subsp. holarctica FTNF002-00] >gi|89144195|emb|CAJ79464.1| 30S ribosomal protein S18 [Francisella tularensis subsp. holarctica LVS] >gi|134253511|gb|EBA52605.1| 30S ribosomal protein S18 [Francisella tularensis subsp. holarctica 257] >gi|164551675|gb|ABU61558.2| ribosomal protein S18 [Francisella tularensis subsp. holarctica FTNF002-00] (72 aa)
Score = 113, Expect = 1.7e-04, Identities = 25/64 (39%), Positives = 41/64 (64%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           R+K C+   +G + +DYKDV  L  Y+    KI   ++T   +K+Q +++ AIKRAR +AL+P+
  S:     3 RRKVCRFTIEGVKEIDYKDVNKLKAYINETGKIVPSRVTGTSAKYQRQLATAIKRARFLALLPY 66
>gi|118475552|ref|YP_892291.1| 30S ribosomal protein S18 [Campylobacter fetus subsp. fetus 82-40] >gi|166220938|sp|A0RQ08|RS18_CAMFF 30S ribosomal protein S18 >gi|118414778|gb|ABK83198.1| ribosomal protein S18 [Campylobacter fetus subsp. fetus 82-40] (86 aa)
Score = 113, Expect = 1.8e-04, Identities = 32/71 (45%), Positives = 41/71 (57%)
  Q:    84 KQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           K+   KK+CK      E +DYKD  LL   L+   KI  R++T    K+Q  V  AIKRAR VALIP++ D
  S:     4 KRKYSKKYCKYTEAKVEFIDYKDTTLLKYCLSERFKIMPRRLTGTSKKYQEMVEKAIKRARHVALIPYIVD 74
>gi|85708888|ref|ZP_01039954.1| 30S ribosomal protein S18 [Erythrobacter sp. NAP1] >gi|85690422|gb|EAQ30425.1| 30S ribosomal protein S18 [Erythrobacter sp. NAP1] (74 aa)
Score = 113, Expect = 1.8e-04, Identities = 26/66 (39%), Positives = 39/66 (59%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C    K    +DYKDV LL  +++   KI   +IT   +K Q  ++ AIKRAR + L+P++
  S:     7 RRRKSCPFSGKDAPKIDYKDVRLLQGFMSERGKIVPSRITAVSAKKQRELAKAIKRARHIGLLPYI 72
>gi|188997592|ref|YP_001931843.1| ribosomal protein S18 [Sulfurihydrogenibium sp. YO3AOP1] >gi|188932659|gb|ACD67289.1| ribosomal protein S18 [Sulfurihydrogenibium sp. YO3AOP1] (79 aa)
Score = 113, Expect = 1.8e-04, Identities = 30/66 (45%), Positives = 48/66 (72%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +RKK+CK CA+ +E  +YKD+E L ++++   KI   +I+  C+KHQ ++S  IK+AR +ALIP+V
  S:    13 KRKKYCKFCAEKKEP-NYKDIETLKEFISERGKITPSRISGTCAKHQRKLSVEIKKARQLALIPYV 77
>gi|11467346|ref|NP_043203.1| ribosomal protein S18 [Cyanophora paradoxa] >gi|133835|sp|P15760|RR18_CYAPA Cyanelle 30S ribosomal protein S18 >gi|11400|emb|CAA35533.1| S18 ribosomal protein [Cyanophora paradoxa] >gi|1016147|gb|AAA81234.1| ribosomal protein S18 (71 aa)
Score = 113, Expect = 1.8e-04, Identities = 26/56 (46%), Positives = 39/56 (69%)
  Q:    97 KGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           K  + +DY+DVELL  ++T   KI  R++T   +K Q  V+ AIK+AR++AL+PFV
  S:    12 KPNQVIDYQDVELLRTFITDQGKILPRRVTGLTAKQQRAVTKAIKQARVLALLPFV 67
>gi|116619041|ref|YP_819412.1| SSU ribosomal protein S18P [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122270759|sp|Q03UT3|RS18_LEUMM 30S ribosomal protein S18 >gi|116097888|gb|ABJ63039.1| SSU ribosomal protein S18P [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (94 aa)
Score = 113, Expect = 1.8e-04, Identities = 27/61 (44%), Positives = 44/61 (72%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   E++DYK+ ELL ++++   KI  R++T   +K+Q +V+ AIKRARI+AL+PFV +
  S:    33 IAANHIEYIDYKNTELLERFISERGKILPRRVTGTSAKNQRKVTTAIKRARIMALLPFVTE 93
>gi|16331711|ref|NP_442439.1| 30S ribosomal protein S18 [Synechocystis sp. PCC 6803] >gi|1350950|sp|P48946|RS18_SYNY3 30S ribosomal protein S18 >gi|1001265|dbj|BAA10509.1| 30S ribosomal protein S18 [Synechocystis sp. PCC 6803] (71 aa)
Score = 113, Expect = 1.9e-04, Identities = 26/51 (50%), Positives = 37/51 (72%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKD ELL K++T   KI  R+IT   +K Q  ++ A+KR+R+VAL+PFV
  S:    17 IDYKDTELLRKFITERGKILPRRITGLTAKQQRDLTTAVKRSRLVALLPFV 67
>gi|69933098|ref|ZP_00628300.1| Ribosomal protein S18 [Paracoccus denitrificans PD1222] >gi|119383641|ref|YP_914697.1| 30S ribosomal protein S18 [Paracoccus denitrificans PD1222] >gi|166220967|sp|A1B0F7|RS18_PARDP 30S ribosomal protein S18 >gi|119373408|gb|ABL69001.1| SSU ribosomal protein S18P [Paracoccus denitrificans PD1222] (75 aa)
Score = 113, Expect = 1.9e-04, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+K C         +DYKD  LL +Y++   KI   +IT   +K Q  ++ AIKRAR +AL+P+
  S:     8 RRRKVCPFSGDNAPAIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARFLALLPY 72
>gi|83943160|ref|ZP_00955620.1| 30S ribosomal protein S18 [Sulfitobacter sp. EE-36] >gi|83954295|ref|ZP_00963015.1| 30S ribosomal protein S18 [Sulfitobacter sp. NAS-14.1] >gi|163746685|ref|ZP_02154042.1| 30S ribosomal protein S18 [Oceanibulbus indolifex HEL-45] >gi|83841332|gb|EAP80502.1| 30S ribosomal protein S18 [Sulfitobacter sp. NAS-14.1] >gi|83846168|gb|EAP84045.1| 30S ribosomal protein S18 [Sulfitobacter sp. EE-36] >gi|161379799|gb|EDQ04211.1| 30S ribosomal protein S18 [Oceanibulbus indolifex HEL-45] (75 aa)
Score = 113, Expect = 2.0e-04, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+K C         +DYKD  LL +Y++   KI   +IT   +K Q  ++ AIKRAR +AL+P+
  S:     8 RRRKVCPFSGDNAPAIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARFLALLPY 72
>gi|33240418|ref|NP_875360.1| 30S ribosomal protein S18 [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|59798853|sp|Q7VBX4|RS18_PROMA 30S ribosomal protein S18 >gi|33237945|gb|AAQ00013.1| Ribosomal protein S18 [Prochlorococcus marinus subsp. marinus str. CCMP1375] (73 aa)
Score = 113, Expect = 2.1e-04, Identities = 26/51 (50%), Positives = 37/51 (72%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKDVE L K++T   KI  R++T   +K Q  ++ A+KRARI+AL+PFV
  S:    19 IDYKDVETLKKFITERGKILPRRLTGLTAKQQRDLTTAVKRARIIALLPFV 69
>gi|77463711|ref|YP_353215.1| 30S ribosomal protein S18 [Rhodobacter sphaeroides 2.4.1] >gi|126462540|ref|YP_001043654.1| 30S ribosomal protein S18 [Rhodobacter sphaeroides ATCC 17029] >gi|146277394|ref|YP_001167553.1| 30S ribosomal protein S18 [Rhodobacter sphaeroides ATCC 17025] >gi|123591680|sp|Q3J1M0|RS18_RHOS4 30S ribosomal protein S18 >gi|166220980|sp|A3PKL6|RS18_RHOS1 30S ribosomal protein S18 >gi|166220981|sp|A4WS84|RS18_RHOS5 30S ribosomal protein S18 >gi|77388129|gb|ABA79314.1| SSU ribosomal protein S18P [Rhodobacter sphaeroides 2.4.1] >gi|126104204|gb|ABN76882.1| SSU ribosomal protein S18P [Rhodobacter sphaeroides ATCC 17029] >gi|145555635|gb|ABP70248.1| SSU ribosomal protein S18P [Rhodobacter sphaeroides ATCC 17025] (75 aa)
Score = 113, Expect = 2.1e-04, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+K C         +DYKD  LL +Y++   KI   +IT   +K Q  ++ AIKRAR +AL+P+
  S:     8 RRRKVCPFSGDNAPAIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELAAAIKRARFLALLPY 72
>gi|27379189|ref|NP_770718.1| 30S ribosomal protein S18 [Bradyrhizobium japonicum USDA 110] >gi|59798894|sp|Q89MW4|RS18_BRAJA 30S ribosomal protein S18 >gi|27352340|dbj|BAC49343.1| 30S ribosomal protein S18 [Bradyrhizobium japonicum USDA 110] (79 aa)
Score = 113, Expect = 2.1e-04, Identities = 26/66 (39%), Positives = 39/66 (59%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKD +LL +Y++   KI   +IT   +K Q  ++ AIKRAR + L+P+V
  S:    12 RRRKSCPFTGANAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAIKRARFLGLLPYV 77
>gi|119718879|ref|YP_925844.1| 30S ribosomal protein S18 [Nocardioides sp. JS614] >gi|166220965|sp|A1SQS2|RS18_NOCSJ 30S ribosomal protein S18 >gi|119539540|gb|ABL84157.1| SSU ribosomal protein S18P [Nocardioides sp. JS614] (78 aa)
Score = 113, Expect = 2.1e-04, Identities = 28/64 (43%), Positives = 42/64 (65%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +KK C+ C +    VDYKD  LL K+++   KI +R++T  C +HQ  V+ A+K AR VAL+P+
  S:    10 KKKVCQFCKEKATGVDYKDTALLRKFISDRGKIRARRVTGNCVQHQRDVAIAVKNAREVALLPY 73
>gi|86749583|ref|YP_486079.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris HaA2] >gi|115525312|ref|YP_782223.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris BisA53] >gi|122295614|sp|Q07LE1|RS18_RHOP5 30S ribosomal protein S18 >gi|123098720|sp|Q2IX92|RS18_RHOP2 30S ribosomal protein S18 >gi|86572611|gb|ABD07168.1| SSU ribosomal protein S18P [Rhodopseudomonas palustris HaA2] >gi|115519259|gb|ABJ07243.1| SSU ribosomal protein S18P [Rhodopseudomonas palustris BisA53] (79 aa)
Score = 113, Expect = 2.1e-04, Identities = 26/66 (39%), Positives = 39/66 (59%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKD +LL +Y++   KI   +IT   +K Q  ++ AIKRAR + L+P+V
  S:    12 RRRKTCPFTGPNAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAIKRARFLGLLPYV 77
>gi|15677187|ref|NP_274340.1| 30S ribosomal protein S18 [Neisseria meningitidis MC58] >gi|15794428|ref|NP_284250.1| 30S ribosomal protein S18 [Neisseria meningitidis Z2491] >gi|59801014|ref|YP_207726.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae FA 1090] >gi|121635032|ref|YP_975277.1| 30S ribosomal protein S18 [Neisseria meningitidis FAM18] >gi|161870196|ref|YP_001599366.1| 30S ribosomal protein S18 [Neisseria meningitidis 053442] >gi|194098898|ref|YP_002001963.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae NCCP11945] >gi|75507399|sp|Q5F923|RS18_NEIG1 30S ribosomal protein S18 >gi|166220963|sp|A1KUE8|RS18_NEIMF 30S ribosomal protein S18 >gi|189029682|sp|A9LZQ1|RS18_NEIM0 30S ribosomal protein S18 >gi|60397121|sp|P0A0X6|RS18_NEIMA 30S ribosomal protein S18 >gi|60397126|sp|P0A0X7|RS18_NEIMB 30S ribosomal protein S18 >gi|60397129|sp|P0A0X8|RS18_NEIGO 30S ribosomal protein S18 >gi|2196759|gb|AAB61230.1| ribosomal protein S18 [Neisseria gonorrhoeae] >gi|7226563|gb|AAF41696.1| 30S ribosomal protein S18 [Neisseria meningitidis MC58] >gi|59717909|gb|AAW89314.1| putative 30S ribosomal protein S18 [Neisseria gonorrhoeae FA 1090] >gi|120866738|emb|CAM10491.1| 30S ribosomal protein S18 [Neisseria meningitidis FAM18] >gi|121052349|emb|CAM08681.1| 30S ribosomal protein S18 [Neisseria meningitidis Z2491] >gi|161595749|gb|ABX73409.1| 30S ribosomal protein S18 [Neisseria meningitidis 053442] >gi|193934188|gb|ACF30012.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae NCCP11945] (76 aa)
Score = 113, Expect = 2.1e-04, Identities = 26/65 (40%), Positives = 45/65 (69%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +R+KFC+  A+  + VDYK V+LL  +++ N KI   +IT   + +Q +++ A+KRAR +AL+P+
  S:     7 KRRKFCRFTAEKIQEVDYKQVDLLKDFISENGKIIPARITGTKAFYQRQLAVAVKRARFLALLPY 71
>gi|92117879|ref|YP_577608.1| 30S ribosomal protein S18 [Nitrobacter hamburgensis X14] >gi|123083638|sp|Q1QKU9|RS18_NITHX 30S ribosomal protein S18 >gi|91800773|gb|ABE63148.1| SSU ribosomal protein S18P [Nitrobacter hamburgensis X14] (79 aa)
Score = 113, Expect = 2.2e-04, Identities = 25/66 (37%), Positives = 39/66 (59%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKD +LL +Y++   KI   +IT   +K Q  ++ A+KRAR + L+P+V
  S:    12 RRRKTCPFTGANAPKIDYKDSKLLMRYISERGKIVPSRITAVSAKKQRELARAVKRARFLGLLPYV 77
>gi|114704793|ref|ZP_01437701.1| 30S ribosomal protein S18 [Fulvimarina pelagi HTCC2506] >gi|114539578|gb|EAU42698.1| 30S ribosomal protein S18 [Fulvimarina pelagi HTCC2506] (82 aa)
Score = 112, Expect = 2.2e-04, Identities = 27/66 (40%), Positives = 39/66 (59%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K           +DYKDV LL +Y++   KI   +IT    K+Q  ++ AIKRARI+ L+P+V
  S:    15 RRRKSDPFSGNDAPKIDYKDVRLLQRYISERGKIVPSRITAVSQKNQRALAKAIKRARILGLLPYV 80
>gi|161546631|ref|NP_860069.2| 30S ribosomal protein S18 [Helicobacter hepaticus ATCC 51449] (84 aa)
Score = 112, Expect = 2.3e-04, Identities = 30/71 (42%), Positives = 44/71 (61%)
  Q:    84 KQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           K+   K++C+      E++DYKDVE+L   L+   KI  R++T    + Q RV  AIKRAR +ALIP++ D
  S:     3 KKKYSKRYCRYTEAKLEYIDYKDVEMLKHSLSERYKIMPRRLTGNTKRWQERVEVAIKRARHMALIPYIVD 73
>gi|57242167|ref|ZP_00370107.1| ribosomal protein S18 [Campylobacter upsaliensis RM3195] >gi|57017359|gb|EAL54140.1| ribosomal protein S18 [Campylobacter upsaliensis RM3195] (86 aa)
Score = 112, Expect = 2.4e-04, Identities = 30/71 (42%), Positives = 41/71 (57%)
  Q:    84 KQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           K+   +K+CK      E +DYKD  +L   L+   KI  R++T    K+Q  V  AIKRAR VALIP++ D
  S:     4 KRKYSRKYCKYTEAKVEFIDYKDTAMLKHALSERFKIMPRRLTGTSKKYQEMVELAIKRARHVALIPYIVD 74
>gi|72163492|ref|YP_291149.1| 30S ribosomal protein S18 [Thermobifida fusca YX] >gi|123733431|sp|Q47K96|RS18_THEFY 30S ribosomal protein S18 >gi|71917224|gb|AAZ57126.1| SSU ribosomal protein S18P [Thermobifida fusca YX] (78 aa)
Score = 112, Expect = 2.4e-04, Identities = 25/60 (41%), Positives = 40/60 (66%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           C  C +   +VDYKD  LL K+++   KI +R++T  C++HQ  V+ A+K AR +AL+P+
  S:    14 CVFCQEKMTYVDYKDTTLLRKFISDRGKIRARRVTGNCTQHQRDVAKAVKNAREMALLPY 73
>gi|159027933|emb|CAO87096.1| unnamed protein product [Microcystis aeruginosa PCC 7806] (71 aa)
Score = 112, Expect = 2.4e-04, Identities = 26/51 (50%), Positives = 37/51 (72%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKD ELL K++T   K+  R+IT   SK Q  ++ A+KRAR++AL+PFV
  S:    17 IDYKDTELLRKFITERGKLLPRRITGLTSKQQRDLTEAVKRARLMALLPFV 67
>gi|39936141|ref|NP_948417.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris CGA009] >gi|167365544|ref|ZP_02299688.1| ribosomal protein S18 [Rhodopseudomonas palustris TIE-1] >gi|192291859|ref|YP_001992464.1| ribosomal protein S18 [Rhodopseudomonas palustris TIE-1] >gi|59798743|sp|Q6N5A3|RS18_RHOPA 30S ribosomal protein S18 (RRP-S18) >gi|39649995|emb|CAE28519.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris CGA009] >gi|192285608|gb|ACF01989.1| ribosomal protein S18 [Rhodopseudomonas palustris TIE-1] (79 aa)
Score = 112, Expect = 2.5e-04, Identities = 26/66 (39%), Positives = 39/66 (59%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKD +LL +Y++   KI   +IT   +K Q  ++ AIKRAR + L+P+V
  S:    12 RRRKTCPFTGANAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAIKRARFLGLLPYV 77
>gi|124514468|gb|EAY55981.1| Ribosomal protein S18 [Leptospirillum sp. Group II UBA] (76 aa)
Score = 112, Expect = 2.5e-04, Identities = 27/70 (38%), Positives = 42/70 (60%)
  Q:    82 PNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           P +  +RKK C+ C +  E +DYKD+  +  +LT   KI  R+++  CS+HQ  ++ AIK+ R VA   F
  S:     4 PARSFQRKKVCRFCIEKLE-IDYKDINTMKGFLTERGKIIPRRLSGTCSRHQRGLAAAIKQGRNVAFFAF 72
>gi|34558166|ref|NP_907981.1| 30S ribosomal protein S18 [Wolinella succinogenes DSM 1740] >gi|59798816|sp|Q7MQZ9|RS18_WOLSU 30S ribosomal protein S18 >gi|34483885|emb|CAE10881.1| HYPOTHETICAL PROTEIN-Ribosomal protein S18 [Wolinella succinogenes] (85 aa)
Score = 112, Expect = 2.5e-04, Identities = 31/71 (43%), Positives = 43/71 (60%)
  Q:    84 KQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           K+   K++CK      E +DYKDVE+L   L+   KI  R++T    + Q RV  AIKRAR +ALIP++ D
  S:     4 KKRYSKRYCKYTEAKIEFIDYKDVEMLKHSLSERYKIMPRRLTGNSKRWQERVEVAIKRARHMALIPYIID 74
>gi|85716345|ref|ZP_01047318.1| 30S ribosomal protein S18 [Nitrobacter sp. Nb-311A] >gi|85696861|gb|EAQ34746.1| 30S ribosomal protein S18 [Nitrobacter sp. Nb-311A] (79 aa)
Score = 112, Expect = 2.6e-04, Identities = 25/66 (37%), Positives = 39/66 (59%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKD +LL +Y++   KI   +IT   +K Q  ++ A+KRAR + L+P+V
  S:    12 RRRKTCPFTGSNAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAVKRARFLGLLPYV 77
>gi|126331100|ref|XP_001371066.1| PREDICTED: hypothetical protein [Monodelphis domestica] (171 aa)
Score = 112, Expect = 2.8e-04, Identities = 34/93 (36%), Positives = 51/93 (54%)
  Q:    58 KKSSDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLK-IASRKITFACSKHQTRVSNAIKRARIVALIP 150
           +  S  K+  + +D P    N   P K+  +K  C LC K    VDYK+V+LL ++++P    I  R IT  C K Q  ++ AIKRA+I+  +P
  S:    67 RSCSQFKQVASNEDLPVPMEN---PYKESLKK--CILCGK---RVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMP 152
>gi|75675884|ref|YP_318305.1| 30S ribosomal protein S18 [Nitrobacter winogradskyi Nb-255] >gi|123773250|sp|Q3SRY8|RS18_NITWN 30S ribosomal protein S18 >gi|74420754|gb|ABA04953.1| SSU ribosomal protein S18P [Nitrobacter winogradskyi Nb-255] (79 aa)
Score = 112, Expect = 2.8e-04, Identities = 25/66 (37%), Positives = 39/66 (59%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKD +LL +Y++   KI   +IT   +K Q  ++ A+KRAR + L+P+V
  S:    12 RRRKTCPFTGANAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAVKRARFLGLLPYV 77
>gi|15792397|ref|NP_282220.1| 30S ribosomal protein S18 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57237954|ref|YP_179203.1| 30S ribosomal protein S18 [Campylobacter jejuni RM1221] >gi|86150494|ref|ZP_01068719.1| ribosomal protein S18 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|86150979|ref|ZP_01069195.1| ribosomal protein S18 [Campylobacter jejuni subsp. jejuni 260.94] >gi|86153056|ref|ZP_01071261.1| ribosomal protein S18 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|88596231|ref|ZP_01099468.1| ribosomal protein S18 [Campylobacter jejuni subsp. jejuni 84-25] >gi|121613108|ref|YP_001000750.1| 30S ribosomal protein S18 [Campylobacter jejuni subsp. jejuni 81-176] >gi|148926025|ref|ZP_01809711.1| 30S ribosomal protein S18 [Campylobacter jejuni subsp. jejuni CG8486] >gi|153951708|ref|YP_001397812.1| 30S ribosomal protein S18 [Campylobacter jejuni subsp. doylei 269.97] >gi|157415333|ref|YP_001482589.1| 30S ribosomal protein S18 [Campylobacter jejuni subsp. jejuni 81116] >gi|167005670|ref|ZP_02271428.1| 30S ribosomal protein S18 [Campylobacter jejuni subsp. jejuni 81-176] >gi|81675575|sp|Q5HU32|RS18_CAMJR 30S ribosomal protein S18 >gi|166220940|sp|A7H2T2|RS18_CAMJD 30S ribosomal protein S18 >gi|166220941|sp|A1W059|RS18_CAMJJ 30S ribosomal protein S18 >gi|172047141|sp|A8FMC5|RS18_CAMJ8 30S ribosomal protein S18 >gi|6226083|sp|O69301|RS18_CAMJE 30S ribosomal protein S18 >gi|3114757|emb|CAA76673.1| ribosomal protein S18 [Campylobacter jejuni] >gi|57166758|gb|AAW35537.1| ribosomal protein S18 [Campylobacter jejuni RM1221] >gi|85839089|gb|EAQ56353.1| ribosomal protein S18 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85842149|gb|EAQ59395.1| ribosomal protein S18 [Campylobacter jejuni subsp. jejuni 260.94] >gi|85843941|gb|EAQ61151.1| ribosomal protein S18 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87249144|gb|EAQ72105.1| ribosomal protein S18 [Campylobacter jejuni subsp. jejuni 81-176] >gi|88191072|gb|EAQ95044.1| ribosomal protein S18 [Campylobacter jejuni subsp. jejuni 84-25] >gi|112360392|emb|CAL35189.1| 30S ribosomal protein S18 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|145845504|gb|EDK22596.1| 30S ribosomal protein S18 [Campylobacter jejuni subsp. jejuni CG8486] >gi|152939154|gb|ABS43895.1| ribosomal protein S18 [Campylobacter jejuni subsp. doylei 269.97] >gi|157386297|gb|ABV52612.1| 30S ribosomal protein S18 [Campylobacter jejuni subsp. jejuni 81116] (86 aa)
Score = 112, Expect = 2.8e-04, Identities = 30/71 (42%), Positives = 41/71 (57%)
  Q:    84 KQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           K+   +K+CK      E +DYKD  +L   L+   KI  R++T    K+Q  V  AIKRAR VALIP++ D
  S:     4 KRKYSRKYCKYTEAKVEFIDYKDTAMLKHALSERFKIMPRRLTGTSKKYQEMVEVAIKRARHVALIPYIVD 74
>gi|86138735|ref|ZP_01057307.1| 30S ribosomal protein S18 [Roseobacter sp. MED193] >gi|126739374|ref|ZP_01755067.1| 30S ribosomal protein S18 [Roseobacter sp. SK209-2-6] >gi|159044730|ref|YP_001533524.1| 30S ribosomal protein S18 [Dinoroseobacter shibae DFL 12] >gi|163736681|ref|ZP_02144100.1| 30S ribosomal protein S18 [Phaeobacter gallaeciensis BS107] >gi|163742692|ref|ZP_02150077.1| 30S ribosomal protein S18 [Phaeobacter gallaeciensis 2.10] >gi|189029676|sp|A8LQQ6|RS18_DINSH 30S ribosomal protein S18 >gi|85824382|gb|EAQ44585.1| 30S ribosomal protein S18 [Roseobacter sp. MED193] >gi|126719474|gb|EBA16183.1| 30S ribosomal protein S18 [Roseobacter sp. SK209-2-6] >gi|157912490|gb|ABV93923.1| ribosomal protein S18 [Dinoroseobacter shibae DFL 12] >gi|161383947|gb|EDQ08331.1| 30S ribosomal protein S18 [Phaeobacter gallaeciensis 2.10] >gi|161390551|gb|EDQ14901.1| 30S ribosomal protein S18 [Phaeobacter gallaeciensis BS107] (75 aa)
Score = 111, Expect = 3.1e-04, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+K C         +DYKD  LL +Y++   KI   +IT   +K Q  ++ AIKRAR +AL+P+
  S:     8 RRRKVCPFSGDNAPKIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARFLALLPY 72
>gi|91977454|ref|YP_570113.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris BisB5] >gi|123721763|sp|Q135M7|RS18_RHOPS 30S ribosomal protein S18 >gi|91683910|gb|ABE40212.1| SSU ribosomal protein S18P [Rhodopseudomonas palustris BisB5] (79 aa)
Score = 111, Expect = 3.2e-04, Identities = 26/66 (39%), Positives = 39/66 (59%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKD +LL +Y++   KI   +IT   +K Q  ++ AIKRAR + L+P+V
  S:    12 RRRKTCPFTGTNAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAIKRARFLGLLPYV 77
>gi|99080885|ref|YP_613039.1| 30S ribosomal protein S18 [Silicibacter sp. TM1040] >gi|126728811|ref|ZP_01744626.1| 30S ribosomal protein S18 [Sagittula stellata E-37] >gi|123252446|sp|Q1GHT9|RS18_SILST 30S ribosomal protein S18 >gi|99037165|gb|ABF63777.1| SSU ribosomal protein S18P [Silicibacter sp. TM1040] >gi|126710741|gb|EBA09792.1| 30S ribosomal protein S18 [Sagittula stellata E-37] (75 aa)
Score = 111, Expect = 3.2e-04, Identities = 26/65 (40%), Positives = 39/65 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+K C    +    +DYKD  LL +Y++   KI   +IT   +K Q  ++ AIKRAR +AL+P+
  S:     8 RRRKVCPFSGENAPKIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARFLALLPY 72
>gi|86743195|ref|YP_483595.1| 30S ribosomal protein S18 [Frankia sp. CcI3] >gi|123723312|sp|Q2J4C6|RS18_FRASC 30S ribosomal protein S18 >gi|86570057|gb|ABD13866.1| SSU ribosomal protein S18P [Frankia sp. CcI3] (78 aa)
Score = 111, Expect = 3.2e-04, Identities = 25/64 (39%), Positives = 43/64 (67%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +KK C  C    +++D+KD  LL KY++   KI +R+++  CS+HQ  V+ A+K +R +AL+P+
  S:    10 KKKVCVFCKDKVDYIDFKDTSLLRKYISDRGKIRARRVSGNCSQHQRDVATAVKNSREMALLPY 73
>gi|57167956|ref|ZP_00367095.1| ribosomal protein S18 [Campylobacter coli RM2228] >gi|57020330|gb|EAL56999.1| ribosomal protein S18 [Campylobacter coli RM2228] (86 aa)
Score = 111, Expect = 3.2e-04, Identities = 30/71 (42%), Positives = 41/71 (57%)
  Q:    84 KQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           K+   +K+CK      E +DYKD  +L   L+   KI  R++T    K+Q  V  AIKRAR VALIP++ D
  S:     4 KRKYSRKYCKYTEAKVEFIDYKDTAMLKHALSERFKIMPRRLTGTSKKYQEMVEVAIKRARHVALIPYIVD 74
>gi|171059509|ref|YP_001791858.1| ribosomal protein S18 [Leptothrix cholodnii SP-6] >gi|170776954|gb|ACB35093.1| ribosomal protein S18 [Leptothrix cholodnii SP-6] (94 aa)
Score = 111, Expect = 3.3e-04, Identities = 29/83 (34%), Positives = 51/83 (61%)
  Q:    69 PQDRPFAKYNRGYPNKQG---RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           P    F+K  +   N+Q    +RK+FC+    G + +DYKD+++L  ++  N KI   ++T   +  Q +++ AIKRAR +AL+P+
  S:     3 PPRGKFSKDRKTKRNQQSLLFKRKRFCRFTVTGVKEIDYKDLDVLRDFVGENGKITPARLTGTRAFFQRQLTTAIKRARFLALLPY 88
>gi|108796929|ref|YP_636229.1| ribosomal protein S18 [Pseudendoclonium akinetum] >gi|122227092|sp|Q3ZJ38|RR18_PSEAK Chloroplast 30S ribosomal protein S18 >gi|56159627|gb|AAV80651.1| ribosomal protein S18 [Pseudendoclonium akinetum] (85 aa)
Score = 111, Expect = 3.3e-04, Identities = 28/54 (51%), Positives = 36/54 (66%)
  Q:    99 QEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           Q  VDYK+V LL KY++   KI SR++T   SK Q  +S AIK ARI  L+PF+
  S:    30 QGTVDYKNVALLRKYISAEGKILSRRLTRLTSKQQRHISTAIKTARIAGLLPFI 83
>gi|83591753|ref|YP_425505.1| 30S ribosomal protein S18 [Rhodospirillum rubrum ATCC 11170] >gi|83574667|gb|ABC21218.1| SSU ribosomal protein S18P [Rhodospirillum rubrum ATCC 11170] (78 aa)
Score = 111, Expect = 3.3e-04, Identities = 24/63 (38%), Positives = 39/63 (61%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           K C     G   +DYKD++LL ++++   KI   +IT   +K Q  ++ AIKRAR ++L+P+V
  S:    14 KTCPFSGAGAPKIDYKDIKLLLRFVSERGKIVPSRITAVSAKKQRELARAIKRARFLSLLPYV 76
>gi|110680236|ref|YP_683243.1| 30S ribosomal protein S18 [Roseobacter denitrificans OCh 114] >gi|123065436|sp|Q164N6|RS18_ROSDO 30S ribosomal protein S18 >gi|109456352|gb|ABG32557.1| ribosomal protein S18 [Roseobacter denitrificans OCh 114] (75 aa)
Score = 111, Expect = 3.3e-04, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+K C         +DYKD  LL +Y++   KI   +IT   +K Q  ++ AIKRAR +AL+P+
  S:     8 RRRKVCPFSGDNAPKIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARFLALLPY 72
>gi|144899044|emb|CAM75908.1| 30S ribosomal protein S18 [Magnetospirillum gryphiswaldense MSR-1] (90 aa)
Score = 111, Expect = 3.4e-04, Identities = 29/82 (35%), Positives = 45/82 (54%)
  Q:    71 DRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +RP      G      RR+K C    +G   +DYKD +LL ++++   KI   +IT   +K Q  ++ AIKRAR + L+P+V
  S:     7 ERPRPTATAGARRPFFRRRKTCPFSGEGAPKIDYKDTKLLSRFISERGKIVPSRITAVSAKKQRELAQAIKRARFLGLLPYV 88
>gi|183221480|ref|YP_001839476.1| 30S ribosomal protein S18 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189911567|ref|YP_001963122.1| 30S Ribosomal protein S18 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167776243|gb|ABZ94544.1| 30S Ribosomal protein S18 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167779902|gb|ABZ98200.1| 30S ribosomal protein S18 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (94 aa)
Score = 111, Expect = 3.5e-04, Identities = 26/64 (40%), Positives = 41/64 (64%)
  Q:    88 RKKFCKLCAKGQ--EHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +KK CK CA       +DYK V++L +++T   KI  R+IT  C KHQ  ++  I+++R + L+PF
  S:    26 KKKVCKFCADKALLAGLDYKRVDILERFVTNRGKIIPRRITGTCGKHQRALAREIRKSRSIGLLPF 91
>gi|170016529|ref|YP_001727448.1| ribosomal protein S18 [Leuconostoc citreum KM20] >gi|169803386|gb|ACA82004.1| Ribosomal protein S18 [Leuconostoc citreum KM20] (94 aa)
Score = 111, Expect = 3.6e-04, Identities = 27/61 (44%), Positives = 43/61 (70%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   E +DYK+ ELL ++++   KI  R++T   +K+Q +V+ AIKRARI+AL+PFV +
  S:    33 IAANHIEFIDYKNTELLERFISERGKILPRRVTGTSAKNQRKVTTAIKRARIMALLPFVTE 93
>gi|111020419|ref|YP_703391.1| 30S ribosomal protein S18 [Rhodococcus sp. RHA1] >gi|110819949|gb|ABG95233.1| 30S ribosomal protein S18 [Rhodococcus sp. RHA1] (80 aa)
Score = 111, Expect = 3.6e-04, Identities = 26/64 (40%), Positives = 41/64 (64%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +KK C  C +    ++YKD  LL KY++   KI +R++T  C +HQ  V+ A+K +R VAL+P+
  S:    12 KKKICIFCKEKNTQINYKDTTLLRKYVSDRGKIRARRVTGNCVQHQRDVAIAVKNSREVALLPY 75
>gi|56697143|ref|YP_167506.1| 30S ribosomal protein S18 [Silicibacter pomeroyi DSS-3] >gi|84684848|ref|ZP_01012748.1| 30S ribosomal protein S18 [Rhodobacterales bacterium HTCC2654] >gi|81676223|sp|Q5LR49|RS18_SILPO 30S ribosomal protein S18 >gi|56678880|gb|AAV95546.1| ribosomal protein S18 [Silicibacter pomeroyi DSS-3] >gi|84667183|gb|EAQ13653.1| 30S ribosomal protein S18 [Rhodobacterales bacterium HTCC2654] (75 aa)
Score = 111, Expect = 3.6e-04, Identities = 26/65 (40%), Positives = 39/65 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+K C         +DYKD +LL +Y++   KI   +IT   +K Q  ++ AIKRAR +AL+P+
  S:     8 RRRKVCPFSGDNAPKIDYKDTKLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARFLALLPY 72
>gi|159903436|ref|YP_001550780.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9211] >gi|159888612|gb|ABX08826.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9211] (73 aa)
Score = 110, Expect = 3.7e-04, Identities = 25/51 (49%), Positives = 37/51 (72%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKDVE L K++T   KI  R++T   ++ Q  ++ A+KRARI+AL+PFV
  S:    19 IDYKDVETLKKFITERGKILPRRLTGLTAQQQRDLTVAVKRARIIALLPFV 69
>gi|83949661|ref|ZP_00958394.1| 30S ribosomal protein S18 [Roseovarius nubinhibens ISM] >gi|84503441|ref|ZP_01001501.1| 30S ribosomal protein S18 [Oceanicola batsensis HTCC2597] >gi|83837560|gb|EAP76856.1| 30S ribosomal protein S18 [Roseovarius nubinhibens ISM] >gi|84388228|gb|EAQ01180.1| 30S ribosomal protein S18 [Oceanicola batsensis HTCC2597] (75 aa)
Score = 110, Expect = 3.7e-04, Identities = 26/65 (40%), Positives = 40/65 (61%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+K C    +    +DYKD +LL +Y++   KI   +IT   +K Q  ++ AIKRAR +AL+P+
  S:     8 RRRKVCPFSGENAPKIDYKDTKLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARFLALLPY 72
>gi|33519564|ref|NP_878396.1| 30S ribosomal protein S18 [Candidatus Blochmannia floridanus] >gi|59798862|sp|Q7VQN8|RS18_BLOFL 30S ribosomal protein S18 >gi|33517227|emb|CAD83609.1| 30S ribosomal subunit protein S18 [Candidatus Blochmannia floridanus] (78 aa)
Score = 110, Expect = 3.8e-04, Identities = 25/66 (37%), Positives = 41/66 (62%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           R +KFC+  A    +VDYKD+  +   +  N KI   +IT   SK+Q +++ AIK AR ++L+P++
  S:     9 RHRKFCRFTADKCIYVDYKDLSKIQHSIIENAKIIPSRITGTRSKYQRQLARAIKIARFLSLLPYI 74
>gi|134301135|ref|YP_001114631.1| 30S ribosomal protein S18 [Desulfotomaculum reducens MI-1] >gi|134053835|gb|ABO51806.1| SSU ribosomal protein S18P [Desulfotomaculum reducens MI-1] (77 aa)
Score = 110, Expect = 3.9e-04, Identities = 25/60 (41%), Positives = 36/60 (60%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           C  C      +DYK+   L KY+T   KI  R+I+  C+ HQ  ++ AIKR+R +AL+PF
  S:    14 CSFCVDKATSIDYKETSKLRKYVTERGKILPRRISGNCAHHQRMLTTAIKRSRNIALLPF 73
>gi|158319027|ref|YP_001511535.1| 30S ribosomal protein S18 [Frankia sp. EAN1pec] >gi|158114432|gb|ABW16629.1| ribosomal protein S18 [Frankia sp. EAN1pec] (78 aa)
Score = 110, Expect = 3.9e-04, Identities = 26/64 (40%), Positives = 42/64 (65%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +KK C  C     ++DYKD  LL K+++   KI +R++T  CS+HQ  V+ A+K +R +AL+P+
  S:    10 KKKVCVFCKDKVHYIDYKDTSLLRKFISDRGKIRARRVTGNCSQHQRDVATAVKNSREMALLPY 73
>gi|120435464|ref|YP_861150.1| 30S ribosomal protein S18 [Gramella forsetii KT0803] >gi|117577614|emb|CAL66083.1| 30S ribosomal protein S18 [Gramella forsetii KT0803] (99 aa)
Score = 110, Expect = 4.1e-04, Identities = 25/68 (36%), Positives = 43/68 (63%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + KK+C+    G +++DYKD + L  ++    K+  R++T    K Q +V+ A+KRAR +AL+P+V D
  S:    29 KAKKYCRFKRSGIKYIDYKDPDFLMGFVNEQGKLLPRRLTGTSLKFQRKVATAVKRARHLALMPYVGD 96
>gi|156402582|ref|XP_001639669.1| predicted protein [Nematostella vectensis] >gi|156226799|gb|EDO47606.1| predicted protein [Nematostella vectensis] (158 aa)
Score = 110, Expect = 4.2e-04, Identities = 26/63 (41%), Positives = 42/63 (66%)
  Q:    88 RKKFCKLCAKGQE-HVDYKDVELLYKYLTPNL-KIASRKITFACSKHQTRVSNAIKRARIVALIP 150
           R   C LC K  +  +DYK+V LL ++++ +  +I +R++T  C K Q  ++NAIKRAR + L+P
  S:    79 RPTGCLLCPKRTDVTIDYKNVRLLSQFISSHSGRIYNRRVTGLCDKKQKEITNAIKRARAIGLMP 143
>gi|86142229|ref|ZP_01060739.1| ribosomal protein S18 [Flavobacterium sp. MED217] >gi|85830981|gb|EAQ49438.1| ribosomal protein S18 [Leeuwenhoekiella blandensis MED217] (99 aa)
Score = 110, Expect = 4.3e-04, Identities = 27/68 (39%), Positives = 44/68 (64%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + KK+C+    G ++VDYKD + L  ++    K+  R++T    K+Q +VS A+KRAR +AL+P+V D
  S:    29 KTKKYCRFKRSGIKYVDYKDADWLASFVNEQGKLLPRRLTGTSLKYQRKVSVAVKRARHLALMPYVTD 96
>gi|90423798|ref|YP_532168.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris BisB18] >gi|122995501|sp|Q215T7|RS18_RHOPB 30S ribosomal protein S18 >gi|90105812|gb|ABD87849.1| SSU ribosomal protein S18P [Rhodopseudomonas palustris BisB18] (79 aa)
Score = 110, Expect = 4.3e-04, Identities = 25/66 (37%), Positives = 39/66 (59%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +DYKD +LL +Y++   KI   +IT   +K Q  ++ AIKR+R + L+P+V
  S:    12 RRRKTCPFTGPNAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAIKRSRFLGLLPYV 77
>gi|163731326|ref|ZP_02138773.1| 30S ribosomal protein S18 [Roseobacter litoralis Och 149] >gi|161394780|gb|EDQ19102.1| 30S ribosomal protein S18 [Roseobacter litoralis Och 149] (75 aa)
Score = 110, Expect = 4.4e-04, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+K C         +DYKD  LL +Y++   KI   +IT   +K Q  ++ AIKRAR +AL+P+
  S:     8 RRRKVCPFSGDNAPKIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARFLALLPY 72
>gi|28376983|ref|NP_783875.1| 30S ribosomal protein S18 [Lactobacillus plantarum WCFS1] >gi|38258549|sp|Q890K0|RS18_LACPL 30S ribosomal protein S18 >gi|28269814|emb|CAD62711.1| ribosomal protein S18 [Lactobacillus plantarum WCFS1] (78 aa)
Score = 110, Expect = 4.5e-04, Identities = 24/61 (39%), Positives = 41/61 (67%)
  Q:    94 LCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           + A   E++DYKD +LL ++++   KI  R++T   +K+Q  ++ AIKRARI+ L+ FV +
  S:    17 IAANHIEYIDYKDTDLLRRFISERGKILPRRVTGTSAKNQRSLTIAIKRARIMGLLAFVSE 77
>gi|83816823|ref|YP_445490.1| ribosomal protein S18 [Salinibacter ruber DSM 13855] >gi|83758217|gb|ABC46330.1| ribosomal protein S18 [Salinibacter ruber DSM 13855] (70 aa)
Score = 110, Expect = 4.7e-04, Identities = 23/55 (41%), Positives = 38/55 (69%)
  Q:   100 EHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           E+VDYKD E L +++    KI  R++T   ++ Q +++ AIKRAR +AL+P+V +
  S:    13 EYVDYKDTEFLEQFINNQGKILPRRVTGVPARVQRQITKAIKRARHLALMPYVSE 67
>gi|41406167|ref|NP_959003.1| 30S ribosomal protein S18 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118466677|ref|YP_879375.1| 30S ribosomal protein S18 [Mycobacterium avium 104] >gi|166220960|sp|A0Q8Y7|RS18_MYCA1 30S ribosomal protein S18 >gi|59798951|sp|Q744X6|RS181_MYCPA 30S ribosomal protein S18 1 >gi|41394515|gb|AAS02386.1| RpsR [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118167964|gb|ABK68861.1| ribosomal protein S18 [Mycobacterium avium 104] (84 aa)
Score = 110, Expect = 4.7e-04, Identities = 31/73 (42%), Positives = 45/73 (61%)
  Q:    79 RGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           R  P K  + +K C  CAK  + +DYKD  LL  Y++   KI +R++T  C +HQ  ++ A+K AR VAL+PF
  S:     8 RPAPEKPVKARK-CVFCAKKDQAIDYKDTALLRTYISERGKIRARRVTGNCVQHQRDIAIAVKNAREVALLPF 79
>gi|119952915|ref|YP_945124.1| SSU ribosomal protein S18P [Borrelia turicatae 91E135] >gi|119861686|gb|AAX17454.1| SSU ribosomal protein S18P [Borrelia turicatae 91E135] (97 aa)
Score = 110, Expect = 4.8e-04, Identities = 29/72 (40%), Positives = 46/72 (63%)
  Q:    82 PNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVR 153
           PN +  +KK C+ C   +   DYK+ + L K++T   KI  R+IT   +KHQ R++  +K+AR +AL+PFV+
  S:    25 PNFRFFKKKTCRFCDMDRVP-DYKEFDFLKKFVTEQGKILPRRITGTSAKHQRRLALEVKKARYMALLPFVK 95
>gi|109900046|ref|YP_663301.1| ribosomal protein S18 [Pseudoalteromonas atlantica T6c] >gi|123064136|sp|Q15PE1|RS18_PSEA6 30S ribosomal protein S18 >gi|109702327|gb|ABG42247.1| SSU ribosomal protein S18P [Pseudoalteromonas atlantica T6c] (75 aa)
Score = 110, Expect = 4.8e-04, Identities = 25/56 (44%), Positives = 38/56 (67%)
  Q:    96 AKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           A G   +DYKD+ +L  Y+T + KI   +IT   +K+Q ++S AIKRAR +AL+P+
  S:    15 ADGVVQIDYKDIAMLKNYVTESGKIVPSRITGTSAKYQRQLSTAIKRARFLALLPY 70
>gi|85707088|ref|ZP_01038176.1| 30S ribosomal protein S18 [Roseovarius sp. 217] >gi|149203937|ref|ZP_01880905.1| 30S ribosomal protein S18 [Roseovarius sp. TM1035] >gi|85668374|gb|EAQ23247.1| 30S ribosomal protein S18 [Roseovarius sp. 217] >gi|149142379|gb|EDM30424.1| 30S ribosomal protein S18 [Roseovarius sp. TM1035] (75 aa)
Score = 109, Expect = 4.9e-04, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+K C         +DYKD  LL +Y++   KI   +IT   +K Q  ++ AIKRAR +AL+P+
  S:     8 RRRKVCPFSGDSAPKIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARFLALLPY 72
>gi|15839432|ref|NP_334469.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis CDC1551] >gi|31791232|ref|NP_853725.1| 30S ribosomal protein S18 [Mycobacterium bovis AF2122/97] >gi|57116686|ref|YP_177688.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis H37Rv] >gi|121635965|ref|YP_976188.1| 30S ribosomal protein S18 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148659815|ref|YP_001281338.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis H37Ra] >gi|148821245|ref|YP_001285999.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis F11] >gi|167970581|ref|ZP_02552858.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis H37Ra] >gi|194542505|ref|YP_002077535.1| 30S ribosomal protein S18-1 rpsR1 [Mycobacterium tuberculosis C] >gi|59800210|sp|P69230|RS181_MYCTU 30S ribosomal protein S18 1 >gi|59800211|sp|P69231|RS181_MYCBO 30S ribosomal protein S18 1 >gi|13879104|gb|AAK44283.1| ribosomal protein S18 [Mycobacterium tuberculosis CDC1551] >gi|31616817|emb|CAD92918.1| PROBABLE 30S RIBOSOMAL PROTEIN S18-1 RPSR1 [Mycobacterium bovis AF2122/97] >gi|41352727|emb|CAE55237.1| PROBABLE 30S RIBOSOMAL PROTEIN S18-1 RPSR1 [Mycobacterium tuberculosis H37Rv] >gi|121491612|emb|CAL70070.1| Probable 30s ribosomal protein s18-1 rpsR1 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124603247|gb|EAY61522.1| 30S ribosomal protein S18-1 rpsR1 [Mycobacterium tuberculosis C] >gi|134152025|gb|EBA44070.1| 30S ribosomal protein S18-1 rpsR1 [Mycobacterium tuberculosis str. Haarlem] >gi|148503967|gb|ABQ71776.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis H37Ra] >gi|148719772|gb|ABR04397.1| 30S ribosomal protein S18-1 rpsR1 [Mycobacterium tuberculosis F11] (84 aa)
Score = 109, Expect = 5.1e-04, Identities = 31/73 (42%), Positives = 45/73 (61%)
  Q:    79 RGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           R  P K  + +K C  CAK  + +DYKD  LL  Y++   KI +R++T  C +HQ  ++ A+K AR VAL+PF
  S:     8 RPAPEKPVKTRK-CVFCAKKDQAIDYKDTALLRTYISERGKIRARRVTGNCVQHQRDIALAVKNAREVALLPF 79
>gi|186899332|ref|ZP_02972295.1| ribosomal protein S18 [Cyanothece sp. PCC 7424] >gi|186693934|gb|EDU18547.1| ribosomal protein S18 [Cyanothece sp. PCC 7424] (71 aa)
Score = 109, Expect = 5.2e-04, Identities = 24/51 (47%), Positives = 38/51 (74%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           ++YKD+ELL K++T   KI  R+IT   +K Q  ++ A+K+ARI+AL+PF+
  S:    17 INYKDIELLRKFITERGKILPRRITGLTAKQQRDLTTAVKQARILALLPFI 67
>gi|108802327|ref|YP_642524.1| 30S ribosomal protein S18 [Mycobacterium sp. MCS] >gi|119871480|ref|YP_941432.1| 30S ribosomal protein S18 [Mycobacterium sp. KMS] >gi|126438307|ref|YP_001073998.1| 30S ribosomal protein S18 [Mycobacterium sp. JLS] >gi|123177801|sp|Q1B0W6|RS18_MYCSS 30S ribosomal protein S18 >gi|166220961|sp|A3Q8N0|RS18_MYCSJ 30S ribosomal protein S18 >gi|166220962|sp|A1UP84|RS18_MYCSK 30S ribosomal protein S18 >gi|108772746|gb|ABG11468.1| SSU ribosomal protein S18P [Mycobacterium sp. MCS] >gi|119697569|gb|ABL94642.1| SSU ribosomal protein S18P [Mycobacterium sp. KMS] >gi|126238107|gb|ABO01508.1| SSU ribosomal protein S18P [Mycobacterium sp. JLS] (84 aa)
Score = 109, Expect = 5.2e-04, Identities = 30/73 (41%), Positives = 45/73 (61%)
  Q:    79 RGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           R  P K  + +K C  C+K  + +DYKD  LL  Y++   KI +R++T  C +HQ  ++ A+K AR VAL+PF
  S:     8 RPAPEKPVKTRK-CVFCSKKGQDIDYKDTALLRTYISERGKIRARRVTGNCVQHQRDIAVAVKNAREVALLPF 79
>gi|39938497|ref|NP_950263.1| 30S ribosomal protein S18 [Onion yellows phytoplasma OY-M] >gi|59798755|sp|Q6YRK3|RS18_ONYPE 30S ribosomal protein S18 >gi|39721606|dbj|BAD04096.1| ribosomal protein S18 [Onion yellows phytoplasma OY-M] (79 aa)
Score = 109, Expect = 5.3e-04, Identities = 28/71 (39%), Positives = 46/71 (64%)
  Q:    83 NKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVR 153
           N   +R+K C         +D+KD+ELL +++T   +I SR++T   +K Q +++ AIKRAR +ALIPF++
  S:     8 NTFKKRRKVCFFTENKVTKIDFKDIELLQRFITDRGRILSRRVTNTSAKWQRQLAIAIKRARHMALIPFIQ 78
>gi|172038260|ref|YP_001804761.1| 30S ribosomal protein S18 [Cyanothece sp. ATCC 51142] >gi|171699714|gb|ACB52695.1| 30S ribosomal protein S18 [Cyanothece sp. ATCC 51142] (71 aa)
Score = 109, Expect = 5.5e-04, Identities = 26/54 (48%), Positives = 39/54 (72%)
  Q:    99 QEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           ++ +DYKD ELL K++T   KI  R+IT   +K Q  +++A+KRAR +AL+PFV
  S:    14 KQPIDYKDTELLRKFITERGKILPRRITGLTAKQQRALTSAVKRARFLALLPFV 67
>gi|85057285|ref|YP_456201.1| 30S ribosomal protein S18 [Aster yellows witches'-broom phytoplasma AYWB] >gi|123725354|sp|Q2NKC1|RS18_AYWBP 30S ribosomal protein S18 >gi|84789390|gb|ABC65122.1| SSU ribosomal protein S18P [Aster yellows witches'-broom phytoplasma AYWB] (79 aa)
Score = 109, Expect = 5.6e-04, Identities = 27/71 (38%), Positives = 46/71 (64%)
  Q:    83 NKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVR 153
           N   +R+K C         +D+KD+ELL +++T   +I SR++T   ++ Q +++ AIKRAR +ALIPF++
  S:     8 NTFKKRRKVCFFTENKVTKIDFKDIELLQRFITDRGRILSRRVTNTSARWQRQLAIAIKRARHMALIPFIQ 78
>gi|15828448|ref|NP_302711.1| 30S ribosomal protein S18 [Mycobacterium leprae TN] >gi|6226084|sp|O53125|RS18_MYCLE 30S ribosomal protein S18 >gi|2959410|emb|CAA17952.1| 30s ribosomal protein s18 [Mycobacterium leprae] >gi|13093878|emb|CAC32215.1| 30S ribosomal protein S18 [Mycobacterium leprae] (84 aa)
Score = 109, Expect = 5.8e-04, Identities = 31/73 (42%), Positives = 45/73 (61%)
  Q:    79 RGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           R  P K  + +K C  CAK  + +DYKD  LL  Y++   KI +R++T  C +HQ  ++ A+K AR VAL+PF
  S:     8 RPAPEKPAKARK-CVFCAKKNQQIDYKDTTLLRTYISERGKIRARRVTGNCVQHQRDIAIAVKNAREVALLPF 79
>gi|118615985|ref|YP_904317.1| 30S ribosomal protein S18 [Mycobacterium ulcerans Agy99] >gi|183980109|ref|YP_001848400.1| 30S ribosomal protein S18-1 RpsR1 [Mycobacterium marinum M] >gi|118568095|gb|ABL02846.1| 30S ribosomal protein S18-1 RpsR1 [Mycobacterium ulcerans Agy99] >gi|183173435|gb|ACC38545.1| 30S ribosomal protein S18-1 RpsR1 [Mycobacterium marinum M] (84 aa)
Score = 109, Expect = 5.9e-04, Identities = 31/73 (42%), Positives = 45/73 (61%)
  Q:    79 RGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           R  P K  + +K C  CAK  + +DYKD  LL  Y++   KI +R++T  C +HQ  ++ A+K AR VAL+PF
  S:     8 RPAPEKPVKTRK-CVFCAKKDQAIDYKDTALLRTYISERGKIRARRVTGNCVQHQRDIALAVKNAREVALLPF 79
>gi|85374300|ref|YP_458362.1| 30S ribosomal protein S18 [Erythrobacter litoralis HTCC2594] >gi|84787383|gb|ABC63565.1| ribosomal protein S18 [Erythrobacter litoralis HTCC2594] (74 aa)
Score = 109, Expect = 6.0e-04, Identities = 26/66 (39%), Positives = 39/66 (59%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C   AK    +DYKD  LL  +++   KI   +IT   +K Q  ++ AIKRAR + L+P++
  S:     7 RRRKTCPFSAKNAPKIDYKDTRLLQGFMSERGKIVPSRITAVSAKKQRELAKAIKRARHIGLLPYI 72
>gi|163783217|ref|ZP_02178211.1| ribosomal protein S18 [Hydrogenivirga sp. 128-5-R1-1] >gi|159881551|gb|EDP75061.1| ribosomal protein S18 [Hydrogenivirga sp. 128-5-R1-1] (73 aa)
Score = 109, Expect = 6.0e-04, Identities = 29/69 (42%), Positives = 45/69 (65%)
  Q:    84 KQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           K+  R++ C  C   +E  DYK+ E L +++T   +I SR+ T  C+KHQ R++  IKRAR +AL+P+V
  S:     4 KRPARRRVCYYCENKKEP-DYKNYEELRQFMTDRARIKSRRQTGLCNKHQKRLALQIKRARQLALLPYV 71
>gi|15605661|ref|NP_213036.1| ribosomal protein S18 [Aquifex aeolicus VF5] >gi|7388147|sp|O66476|RS18_AQUAE 30S ribosomal protein S18 >gi|2982823|gb|AAC06446.1| ribosomal protein S18 [Aquifex aeolicus VF5] (72 aa)
Score = 108, Expect = 6.6e-04, Identities = 29/65 (44%), Positives = 41/65 (63%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +KK C  C + +E  DYK+ E L  +LT   +I  RK T  C+KHQ R++  IKRAR + L+P+V
  S:     7 KKKVCMYCEQKREP-DYKNYEELRNFLTERGRIKDRKQTGLCAKHQRRLAVQIKRARQLGLLPYV 70
>gi|88800242|ref|ZP_01115809.1| ribosomal protein S18 [Reinekea sp. MED297] >gi|88776957|gb|EAR08165.1| ribosomal protein S18 [Reinekea sp. MED297] (75 aa)
Score = 108, Expect = 7.0e-04, Identities = 26/56 (46%), Positives = 39/56 (69%)
  Q:    96 AKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           A+G   +DYKDV+LL  Y+T   KI   +IT   +K+Q +++ AIKRAR +AL+P+
  S:    15 AEGITEIDYKDVDLLKGYITETGKIVPSRITGTSAKYQRQLATAIKRARYLALLPY 70
>gi|170789679|gb|EDT30723.1| ribosomal protein S18 [Oligotropha carboxidovorans OM5] (79 aa)
Score = 108, Expect = 7.1e-04, Identities = 24/66 (36%), Positives = 38/66 (57%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           RR+K C         +D+KD +LL +Y++   KI   +IT   +  Q  ++ AIKRAR + L+P+V
  S:    12 RRRKTCPFTGSNAPKIDFKDSKLLMRYVSERGKIVPSRITAVSALKQRELARAIKRARFLGLLPYV 77
>gi|78356456|ref|YP_387905.1| 30S ribosomal protein S18 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|123741297|sp|Q312D6|RS18_DESDG 30S ribosomal protein S18 >gi|78218861|gb|ABB38210.1| SSU ribosomal protein S18P [Desulfovibrio desulfuricans G20] (87 aa)
Score = 108, Expect = 7.1e-04, Identities = 25/62 (40%), Positives = 40/62 (64%)
  Q:    88 RKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALI 149
           R+KFC+ CA     ++YK  ++L  ++T   KI +R+IT  C+ HQ  ++  IKRAR +AL+
  S:    10 RRKFCRFCADKDLPINYKRPDILRDFVTERGKIIARRITGTCAHHQRLLTTEIKRARQMALL 71
>gi|182437465|ref|YP_001825184.1| putative 30S ribosomal protein S18 [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178465981|dbj|BAG20501.1| putative 30S ribosomal protein S18 [Streptomyces griseus subsp. griseus NBRC 13350] (78 aa)
Score = 108, Expect = 7.3e-04, Identities = 23/60 (38%), Positives = 40/60 (66%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           C  C    ++VDYKD  +L K+++   KI +R++T  C++HQ  V+ A+K +R +AL+P+
  S:    14 CAFCKDKTQYVDYKDTNMLRKFISDRGKIRARRVTGNCTQHQRDVATAVKNSREMALLPY 73
>gi|154253799|ref|YP_001414623.1| ribosomal protein S18 [Parvibaculum lavamentivorans DS-1] >gi|154157749|gb|ABS64966.1| ribosomal protein S18 [Parvibaculum lavamentivorans DS-1] (81 aa)
Score = 108, Expect = 7.4e-04, Identities = 27/63 (42%), Positives = 38/63 (60%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           K C         +DYKDV+LL +Y++   KI   +IT   +K Q  ++ AIKRAR +ALIP+V
  S:    17 KTCPFSGANAPKIDYKDVKLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARFLALIPYV 79
>gi|119488089|ref|ZP_01621533.1| 30S ribosomal protein S18 [Lyngbya sp. PCC 8106] >gi|119455378|gb|EAW36517.1| 30S ribosomal protein S18 [Lyngbya sp. PCC 8106] (71 aa)
Score = 108, Expect = 7.4e-04, Identities = 25/51 (49%), Positives = 37/51 (72%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYK++ELL K++T   KI  R+IT    K Q  ++ AIK+ARI+A++PFV
  S:    17 IDYKNIELLRKFVTERGKILPRRITGLTCKQQRDLTKAIKQARILAMLPFV 67
>gi|11467816|ref|NP_050867.1| ribosomal protein S18 [Nephroselmis olivacea] >gi|20978742|sp|Q9TKX8|RR18_NEPOL Chloroplast 30S ribosomal protein S18 >gi|5880745|gb|AAD54838.1|AF137379_61 ribosomal protein S18 [Nephroselmis olivacea] (73 aa)
Score = 108, Expect = 7.4e-04, Identities = 27/65 (41%), Positives = 45/65 (69%)
  Q:    88 RKKFCKLC-AKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           R++  KL  A+  + +DYK+V+LL ++LT   KI  R++T   +K Q  ++ AIK+ARI+AL+ F+
  S:     6 RRRLAKLANAQIDDRIDYKNVDLLRQFLTEEGKILPRRVTGLTAKQQRGMTRAIKQARIMALLEFI 71
>gi|118411132|ref|YP_874526.1| 30S ribosomal protein S18 [Thalassiosira pseudonana] >gi|125987698|sp|A0T0R4|RR18_THAPS Chloroplast 30S ribosomal protein S18 >gi|116739879|gb|ABK20749.1| 30S ribosomal protein S18 [Thalassiosira pseudonana] (72 aa)
Score = 108, Expect = 7.7e-04, Identities = 23/53 (43%), Positives = 37/53 (69%)
  Q:   100 EHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           + +DYKD++LL  ++T   KI  R+ T    + Q +++ AIKRARI++L+PFV
  S:    15 QKIDYKDIDLLKLFITEQGKILPRRATGVTVQQQRQLAKAIKRARILSLLPFV 67
>gi|71083407|ref|YP_266126.1| ribosomal protein S18 [Candidatus Pelagibacter ubique HTCC1062] >gi|91762170|ref|ZP_01264135.1| ribosomal protein S18 [Candidatus Pelagibacter ubique HTCC1002] >gi|71062520|gb|AAZ21523.1| ribosomal protein S18 [Candidatus Pelagibacter ubique HTCC1062] >gi|91717972|gb|EAS84622.1| ribosomal protein S18 [Candidatus Pelagibacter ubique HTCC1002] (92 aa)
Score = 108, Expect = 7.8e-04, Identities = 42/93 (45%), Positives = 57/93 (61%)
  Q:    57 TKKSSDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALI 149
           +KK + NKK+ +  +  FAK +   PNK  + KK C L AKG   VDYK++ LL KY++ N KI   +IT    K Q  +S +IKRAR +ALI
  S:     3 SKKRAGNKKKGSQSN--FAKLSIFQPNKY-KFKKTCPLSAKGAPEVDYKNIRLLKKYMSENGKILPSRITNVSQKKQRELSLSIKRARNLALI 92
>gi|15829080|ref|NP_326440.1| 30S ribosomal protein S18 [Mycoplasma pulmonis UAB CTIP] >gi|20978725|sp|Q98PW0|RS18_MYCPU 30S ribosomal protein S18 >gi|14090024|emb|CAC13782.1| 30S RIBOSOMAL PROTEIN S18 [Mycoplasma pulmonis] (105 aa)
Score = 108, Expect = 7.8e-04, Identities = 27/58 (46%), Positives = 40/58 (68%)
  Q:    97 KGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +G  ++DYKDVELL K++  + KI   KIT   +K Q  ++ AIKRAR +AL+PF ++
  S:    23 QGINYIDYKDVELLSKFINSHGKILPSKITDVSAKRQRMLTRAIKRARNMALLPFTQE 80
>gi|177668225|ref|ZP_02943499.1| ribosomal protein S18 [Cyanothece sp. PCC 8801] >gi|196245394|ref|ZP_03144118.1| ribosomal protein S18 [Cyanothece sp. PCC 8802] >gi|172073197|gb|EDT58632.1| ribosomal protein S18 [Cyanothece sp. PCC 8801] >gi|196206923|gb|EDY01718.1| ribosomal protein S18 [Cyanothece sp. PCC 8802] (71 aa)
Score = 107, Expect = 8.6e-04, Identities = 25/51 (49%), Positives = 36/51 (70%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYKD ELL K++T   K+  R+IT   +K Q  ++ A+KRAR +AL+PFV
  S:    17 IDYKDTELLRKFITERGKLLPRRITGLTAKQQRDLTKAVKRARFLALLPFV 67
>gi|126660661|ref|ZP_01731762.1| 30S ribosomal protein S18 [Cyanothece sp. CCY0110] >gi|126618054|gb|EAZ88822.1| 30S ribosomal protein S18 [Cyanothece sp. CCY0110] (71 aa)
Score = 107, Expect = 8.6e-04, Identities = 26/54 (48%), Positives = 38/54 (70%)
  Q:    99 QEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           ++ +DYKD ELL K++T   KI  R+IT   +K Q  ++ A+KRAR +AL+PFV
  S:    14 KQPIDYKDTELLRKFITERGKILPRRITGLTAKQQRALTAAVKRARFLALLPFV 67
>gi|114768974|ref|ZP_01446600.1| 30S ribosomal protein S18 [alpha proteobacterium HTCC2255] >gi|114549891|gb|EAU52772.1| 30S ribosomal protein S18 [alpha proteobacterium HTCC2255] (75 aa)
Score = 107, Expect = 8.7e-04, Identities = 26/65 (40%), Positives = 39/65 (60%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+K C         +DYKD +LL +Y++   KI   +IT   +K Q  ++ AIKRAR +AL+P+
  S:     8 RRRKSCPFLGDNAPKIDYKDTKLLQRYVSERGKIVPSRITAVSAKKQRELAKAIKRARFLALLPY 72
>gi|108773338|ref|YP_635893.1| ribosomal protein S18 [Oltmannsiellopsis viridis] >gi|122238313|sp|Q20EV2|RR18_OLTVI Chloroplast 30S ribosomal protein S18 >gi|82541920|gb|ABB81961.1| ribosomal protein S18 [Oltmannsiellopsis viridis] (78 aa)
Score = 107, Expect = 9.4e-04, Identities = 26/54 (48%), Positives = 36/54 (66%)
  Q:    99 QEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           Q  VDYK++ LL KY++   KI  R+IT   +K Q  V+ AIK AR+V L+PF+
  S:    20 QGTVDYKNIALLRKYISTEGKILPRRITGLTAKQQRAVAKAIKNARMVGLLPFI 73
>gi|118411014|ref|YP_874409.1| 30S ribosomal protein S18 [Phaeodactylum tricornutum] >gi|125987696|sp|A0T0D4|RR18_PHATR Chloroplast 30S ribosomal protein S18 >gi|116739761|gb|ABK20632.1| 30S ribosomal protein S18 [Phaeodactylum tricornutum] (72 aa)
Score = 107, Expect = 9.9e-04, Identities = 23/53 (43%), Positives = 37/53 (69%)
  Q:   100 EHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +++DYKD++LL  ++T   KI  R+ T    + Q R++ AIKRAR+++L PFV
  S:    15 QNIDYKDIDLLTLFVTEQGKILPRRATGVTVQQQRRLAKAIKRARVLSLFPFV 67
>gi|170751790|ref|YP_001758050.1| ribosomal protein S18 [Methylobacterium radiotolerans JCM 2831] >gi|170658312|gb|ACB27367.1| ribosomal protein S18 [Methylobacterium radiotolerans JCM 2831] (83 aa)
Score = 107, Expect = 1.0e-03, Identities = 25/63 (39%), Positives = 37/63 (58%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           K C         +DYKDV+LL +Y++   KI   +IT   +K Q  ++ AIKRAR + L+P+V
  S:    19 KTCPFSGANAPKIDYKDVKLLSRYVSERGKIVPSRITAVSAKKQRELAQAIKRARFLGLLPYV 81
>gi|108796846|ref|YP_636439.1| ribosomal protein S18 [Staurastrum punctulatum] >gi|122245549|sp|Q32RT7|RR18_STAPU Chloroplast 30S ribosomal protein S18 >gi|61393614|gb|AAX45755.1| ribosomal protein S18 [Staurastrum punctulatum] (80 aa)
Score = 107, Expect = 1.0e-03, Identities = 27/58 (46%), Positives = 41/58 (70%)
  Q:    97 KGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           K  E++DYK+V LL K+++   KI S++IT   SK Q  ++ AIK ARI+AL+PF+ +
  S:    21 KPGENIDYKNVGLLRKFISEQGKILSKRITRLTSKQQRAMTKAIKSARILALLPFINN 78
>gi|22711969|ref|NP_683799.1| ribosomal protein S18 [Chaetosphaeridium globosum] >gi|25009146|sp|Q8M9Y7|RR18_CHAGL Chloroplast 30S ribosomal protein S18 >gi|22416973|gb|AAM96573.1| ribosomal protein S18 [Chaetosphaeridium globosum] (79 aa)
Score = 107, Expect = 1.1e-03, Identities = 24/58 (41%), Positives = 40/58 (68%)
  Q:    97 KGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           +  E +DYK+V LL ++++   KI SR++    +K Q  ++ AIKRARI+AL+PF+ +
  S:    20 RAGESIDYKNVGLLRRFISEQGKILSRRVNRLTAKQQRNMTKAIKRARILALLPFLNN 77
>gi|58584758|ref|YP_198331.1| 30S ribosomal protein S18 [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|75507965|sp|Q5GSD5|RS18_WOLTR 30S ribosomal protein S18 >gi|58419074|gb|AAW71089.1| Ribosomal protein S18 [Wolbachia endosymbiont strain TRS of Brugia malayi] (91 aa)
Score = 106, Expect = 1.1e-03, Identities = 24/65 (36%), Positives = 40/65 (61%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +R K C L     E +DYK+ +LL ++ +   +I  R++T  C+K Q ++  AI RAR +AL+P+
  S:    22 KRSKVCPLATSQDEDIDYKNTDLLSRFTSDYGRILPRRLTGVCAKKQRKLRLAIIRARFLALVPY 86
>gi|118470101|ref|YP_891095.1| 30S ribosomal protein S18 [Mycobacterium smegmatis str. MC2 155] >gi|118171388|gb|ABK72284.1| ribosomal protein S18 [Mycobacterium smegmatis str. MC2 155] (84 aa)
Score = 106, Expect = 1.1e-03, Identities = 30/73 (41%), Positives = 45/73 (61%)
  Q:    79 RGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           R  P K  + +K C  C+K  + +DYKD  LL  Y++   KI +R++T  C +HQ  ++ A+K AR VAL+PF
  S:     8 RPAPEKPVKTRK-CVFCSKKGQTIDYKDTALLRTYISERGKIRARRVTGNCVQHQRDIAVAVKNAREVALLPF 79
>gi|111219980|ref|YP_710774.1| 30S ribosomal protein S18-2 [Frankia alni ACN14a] >gi|111147512|emb|CAJ59165.1| 30S ribosomal protein S18-2 [Frankia alni ACN14a] (84 aa)
Score = 106, Expect = 1.1e-03, Identities = 29/68 (42%), Positives = 43/68 (63%)
  Q:    84 KQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           K G+RKK   L  +G  +VDYKDV LL ++++   KI +R+IT    +    V+ AIK AR +AL+P+
  S:     8 KPGQRKKPNILRERGITYVDYKDVALLRQFISDRGKIRARRITGLTPRQHREVTRAIKNAREMALLPY 75
>gi|57109098|ref|XP_535635.1| PREDICTED: similar to 28S ribosomal protein S18c, mitochondrial precursor (MRP-S18-c) (Mrps18c) (MRP-S18-1) isoform 1 [Canis familiaris] (143 aa)
Score = 106, Expect = 1.1e-03, Identities = 27/61 (44%), Positives = 38/61 (62%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLK-IASRKITFACSKHQTRVSNAIKRARIVALIP 150
           K C LC K    VDYK+V+LL ++++P    I  R IT  C K Q  ++ AIKRA+I+  +P
  S:    64 KKCILCGK---RVDYKNVQLLSQFISPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMP 122
>gi|54027548|ref|YP_121790.1| 30S ribosomal protein S18 [Nocardia farcinica IFM 10152] >gi|59798928|sp|Q5YN15|RS181_NOCFA 30S ribosomal protein S18 1 >gi|54019056|dbj|BAD60426.1| putative ribosomal protein S18 [Nocardia farcinica IFM 10152] (83 aa)
Score = 106, Expect = 1.1e-03, Identities = 27/62 (43%), Positives = 40/62 (64%)
  Q:    91 FCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           FCK    G   +DYKD  LL KY++   KI +R++T  C +HQ  ++ A+K +R VAL+P+V
  S:    18 FCKESKSGNVSIDYKDTTLLRKYVSDRGKIRARRVTGNCVQHQRDIAVAVKNSREVALLPYV 79
>gi|124112116|ref|YP_001019134.1| ribosomal protein S18 [Chlorokybus atmophyticus] >gi|124012224|gb|ABD62248.2| ribosomal protein S18 [Chlorokybus atmophyticus] (71 aa)
Score = 106, Expect = 1.1e-03, Identities = 22/56 (39%), Positives = 38/56 (67%)
  Q:    97 KGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           K  E +DYK+++LL +++T   KI  R++    +K Q  ++ AIK+AR +AL+PF+
  S:    12 KPGETIDYKNIDLLSQFITEQGKILPRRVNGISAKQQRAITKAIKQARFLALLPFL 67
>gi|144514|gb|AAA23134.1| ribosomal protein S18 homolog [Chlamydia muridarum] (77 aa)
Score = 106, Expect = 1.2e-03, Identities = 28/67 (41%), Positives = 43/67 (64%)
  Q:    83 NKQGRRKKFCKLC---AKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALI 149
           + + RRK+F K C   + G + +DYKDV  L +++T   KI  R+IT   S+ Q  ++ A+KRAR V L+
  S:     6 HNEHRRKRFAKKCPFVSAGWKTIDYKDVVTLKRFITERGKILPRRITGVSSRFQALLAQAVKRARHVGLL 75
>gi|83644550|ref|YP_432985.1| ribosomal protein S18 [Hahella chejuensis KCTC 2396] >gi|123739986|sp|Q2SLB4|RS18_HAHCH 30S ribosomal protein S18 >gi|83632593|gb|ABC28560.1| ribosomal protein S18 [Hahella chejuensis KCTC 2396] (76 aa)
Score = 106, Expect = 1.2e-03, Identities = 25/56 (44%), Positives = 40/56 (71%)
  Q:    96 AKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           A+G + +DYKDVE+L  Y+T   KI   +IT   +++Q +++ AIKRAR +AL+P+
  S:    15 AEGVKEIDYKDVEVLKGYITETGKIVPSRITGTKARYQRQLATAIKRARYLALLPY 70
>gi|54026952|ref|YP_121194.1| 30S ribosomal protein S18 [Nocardia farcinica IFM 10152] >gi|59798929|sp|Q5YPR1|RS182_NOCFA 30S ribosomal protein S18 2 >gi|54018460|dbj|BAD59830.1| putative ribosomal protein S18 [Nocardia farcinica IFM 10152] (84 aa)
Score = 106, Expect = 1.2e-03, Identities = 31/68 (45%), Positives = 43/68 (63%)
  Q:    84 KQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +Q RR K   L A G E VDYKDV LL  +++   KI SR++T    + Q +V+ A+K AR +AL+PF
  S:    14 EQARRPKKNPLIAAGIETVDYKDVNLLRTFISDRGKIRSRRVTGLTPQQQRQVAVAVKNAREMALLPF 81
>gi|7524804|ref|NP_045806.1| ribosomal protein S18 [Chlorella vulgaris] >gi|3024563|sp|P56353|RR18_CHLVU Chloroplast 30S ribosomal protein S18 >gi|2224397|dbj|BAA57881.1| 30S ribosomal protein S18 [Chlorella vulgaris] (103 aa)
Score = 106, Expect = 1.2e-03, Identities = 25/51 (49%), Positives = 37/51 (72%)
  Q:   102 VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           +DYK+ +LL K+++P  KI SR+ T   +K Q  ++NAIKRAR+  L+PFV
  S:    45 IDYKNTQLLVKFISPQGKILSRRATGLTAKQQRIMANAIKRARMGGLVPFV 95
>gi|114050735|ref|NP_001039973.1| mitochondrial ribosomal protein S18C [Bos taurus] >gi|108935898|sp|P82917|RT18C_BOVIN 28S ribosomal protein S18c, mitochondrial precursor (MRP-S18-c) (Mrps18c) (MRP-S18-1) >gi|86827491|gb|AAI12819.1| Mitochondrial ribosomal protein S18C [Bos taurus] (143 aa)
Score = 106, Expect = 1.3e-03, Identities = 34/93 (36%), Positives = 51/93 (54%)
  Q:    58 KKSSDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLK-IASRKITFACSKHQTRVSNAIKRARIVALIP 150
           +  S  K+  + +D P    N   P K+  +K  C LC K    VDYK+V+LL ++++P    I  R IT  C K Q  ++ AIKRA+I+  +P
  S:    37 RSCSQCKQVTSSEDLPIPMEN---PYKEPLKK--CILCEK---RVDYKNVQLLSQFISPFTGCIYGRHITGLCGKKQREITKAIKRAQILGFMP 122
>gi|21222315|ref|NP_628094.1| 30S ribosomal protein S18 [Streptomyces coelicolor A3(2)] >gi|29830830|ref|NP_825464.1| 30S ribosomal protein S18 [Streptomyces avermitilis MA-4680] >gi|54038990|sp|P66471|RS181_STRAW 30S ribosomal protein S18 1 >gi|54041926|sp|P66470|RS181_STRCO 30S ribosomal protein S18 1 >gi|4808404|emb|CAB42736.1| putative 30S ribosomal protein S18 [Streptomyces coelicolor A3(2)] >gi|29607943|dbj|BAC71999.1| putative ribosomal protein S18 [Streptomyces avermitilis MA-4680] (78 aa)
Score = 106, Expect = 1.3e-03, Identities = 23/60 (38%), Positives = 39/60 (65%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           C  C     +VDYKD  +L K+++   KI +R++T  C++HQ  V+ A+K +R +AL+P+
  S:    14 CAFCKDKVTYVDYKDTNMLRKFISDRGKIRARRVTGNCTQHQRDVATAVKNSREMALLPY 73
>gi|188528034|ref|YP_001910721.1| 30S ribosomal protein S18 [Helicobacter pylori Shi470] >gi|188144274|gb|ACD48691.1| 30S ribosomal protein S18 [Helicobacter pylori Shi470] (85 aa)
Score = 106, Expect = 1.3e-03, Identities = 28/66 (42%), Positives = 40/66 (60%)
  Q:    89 KKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           K++CK        +DYKD+++L   L+   KI  R++T    K Q RV  AIKRAR +ALIP++ D
  S:     8 KRYCKYTEAKISFIDYKDLDMLKHTLSERYKIMPRRLTGNSKKWQERVEVAIKRARHMALIPYIVD 73
>gi|163706033|ref|ZP_02124019.1| ribosomal protein S18 [Methylobacterium nodulans ORS 2060] >gi|162428555|gb|EDQ39204.1| ribosomal protein S18 [Methylobacterium nodulans ORS 2060] (82 aa)
Score = 106, Expect = 1.3e-03, Identities = 24/63 (38%), Positives = 36/63 (57%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           K C         +DYKDV+LL +Y++   KI   +IT   +K Q  ++ AIKRAR +  +P+V
  S:    18 KTCPFSGPNAPKIDYKDVKLLSRYVSERGKIVPSRITAVSAKKQRELAQAIKRARFLGFLPYV 80
>gi|126725407|ref|ZP_01741249.1| 30S ribosomal protein S18 [Rhodobacterales bacterium HTCC2150] >gi|126704611|gb|EBA03702.1| 30S ribosomal protein S18 [Rhodobacterales bacterium HTCC2150] (75 aa)
Score = 106, Expect = 1.4e-03, Identities = 25/65 (38%), Positives = 37/65 (56%)
  Q:    87 RRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           RR+K C         +DYKD   L +Y++   KI   +IT   +K Q  ++ AIKRAR +AL+P+
  S:     8 RRRKVCPFSGDNAPAIDYKDTRTLQRYISERGKIVPSRITAVSAKKQRELARAIKRARFLALLPY 72
>gi|114593894|ref|XP_001135728.1| PREDICTED: mitochondrial ribosomal protein S18C isoform 1 [Pan troglodytes] (125 aa)
Score = 106, Expect = 1.4e-03, Identities = 32/78 (41%), Positives = 46/78 (58%)
  Q:    70 QDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLK-IASRKITFACSKHQTRVSNAIKRARIVA 147
           +D P +  N   P K+  +K  C LC K   HVDYK+V+LL ++++P    I  R IT  C K Q  ++ AIKRA+I+ 
  S:    48 EDLPISMEN---PYKEPLKK--CILCGK---HVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMG 118
>gi|157164150|ref|YP_001467166.1| 30S ribosomal protein S18 [Campylobacter concisus 13826] >gi|166220936|sp|A7ZEF8|RS18_CAMC1 30S ribosomal protein S18 >gi|112801371|gb|EAT98715.1| ribosomal protein S18 [Campylobacter concisus 13826] (86 aa)
Score = 105, Expect = 1.4e-03, Identities = 27/71 (38%), Positives = 40/71 (56%)
  Q:    84 KQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           K+   +K+CK      + +DYKD  LL   L+   KI  R++T    ++Q  V  AIKRAR  A+IP++ D
  S:     4 KRKYSRKYCKFTEAKIDFIDYKDTSLLKYCLSERFKIMPRRLTGTSKRYQEMVEKAIKRARHAAIIPYIVD 74
>gi|111022580|ref|YP_705552.1| 30S ribosomal protein S18 [Rhodococcus sp. RHA1] >gi|110822110|gb|ABG97394.1| 30S ribosomal protein S18 [Rhodococcus sp. RHA1] (84 aa)
Score = 105, Expect = 1.5e-03, Identities = 29/67 (43%), Positives = 43/67 (64%)
  Q:    85 QGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +GR+ K   L A   EHVDYKD+ LL  +++   KI SR++T    + Q +V+ A+K AR +AL+PF
  S:    15 EGRKPKKNPLFAAKIEHVDYKDINLLRTFISDRGKIRSRRVTGLTPQQQRQVAVAVKNAREMALLPF 81
>gi|71894545|ref|YP_278653.1| 30S ribosomal protein S18 [Mycoplasma synoviae 53] >gi|71851333|gb|AAZ43942.1| 30S ribosomal protein S18 [Mycoplasma synoviae 53] (111 aa)
Score = 105, Expect = 1.6e-03, Identities = 32/78 (41%), Positives = 47/78 (60%)
  Q:    74 FAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           + K  +GY NK    K+ C  C     +VDYK+VE L K++     I  +  T  C+KHQ +V+ A+KRAR++AL+PF
  S:     3 YNKRKKGYHNK----KRTCHFCDNKLTYVDYKNVEDLKKFVNAVGSIKPKVATGNCAKHQRKVTLAVKRARLMALLPF 76
>gi|94501371|ref|ZP_01307891.1| ribosomal protein S18 [Oceanobacter sp. RED65] >gi|94426484|gb|EAT11472.1| ribosomal protein S18 [Oceanobacter sp. RED65] (75 aa)
Score = 105, Expect = 1.7e-03, Identities = 26/56 (46%), Positives = 40/56 (71%)
  Q:    96 AKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           A+G + +DYKD++ L  Y+T   KI   +IT   +K+Q ++S+AIKRAR VAL+P+
  S:    15 AEGVDQIDYKDLDTLKGYITETGKIVPSRITGTKAKYQRQLSSAIKRARYVALLPY 70
>gi|134103769|ref|YP_001109430.1| 30S ribosomal protein S18 [Saccharopolyspora erythraea NRRL 2338] >gi|133916392|emb|CAM06505.1| 30S ribosomal subunit protein S18 [Saccharopolyspora erythraea NRRL 2338] (79 aa)
Score = 105, Expect = 1.7e-03, Identities = 29/64 (45%), Positives = 43/64 (67%)
  Q:    88 RKKFCKLCA-KGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPF 151
           +KK C  C  K  + +DYKD  LL KY++   KI +R++T  CS+HQ  V+ A+K AR +AL+P+
  S:    10 KKKVCVFCKDKAAQSIDYKDTTLLRKYISDRGKIRARRVTGNCSQHQRDVAIAVKNAREMALLPY 74
>gi|170740809|ref|YP_001769464.1| ribosomal protein S18 [Methylobacterium sp. 4-46] >gi|168195083|gb|ACA17030.1| ribosomal protein S18 [Methylobacterium sp. 4-46] (83 aa)
Score = 105, Expect = 1.7e-03, Identities = 24/63 (38%), Positives = 36/63 (57%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           K C         +DYKDV+LL +Y++   KI   +IT   +K Q  ++ AIKRAR +  +P+V
  S:    19 KTCPFSGPNAPKIDYKDVKLLSRYVSERGKIVPSRITAVSAKKQRELAQAIKRARFLGFLPYV 81
>gi|156448851|ref|ZP_02055235.1| ribosomal protein S18 [Methylobacterium chloromethanicum CM4] >gi|163853340|ref|YP_001641383.1| ribosomal protein S18 [Methylobacterium extorquens PA1] >gi|188583606|ref|YP_001927051.1| ribosomal protein S18 [Methylobacterium populi BJ001] >gi|156192367|gb|EDO24552.1| ribosomal protein S18 [Methylobacterium chloromethanicum CM4] >gi|163664945|gb|ABY32312.1| ribosomal protein S18 [Methylobacterium extorquens PA1] >gi|179347104|gb|ACB82516.1| ribosomal protein S18 [Methylobacterium populi BJ001] (84 aa)
Score = 105, Expect = 1.8e-03, Identities = 24/63 (38%), Positives = 38/63 (60%)
  Q:    90 KFCKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           K C    +    +DYKDV+LL +Y++   KI   +IT   +K Q  ++ AIKR+R + L+P+V
  S:    20 KSCPFSGENAPKIDYKDVKLLSRYVSERGKIVPSRITAVSAKKQRELAQAIKRSRFLGLLPYV 82
>gi|114688759|ref|XP_001146698.1| PREDICTED: similar to CGI-134 protein [Pan troglodytes] (141 aa)
Score = 105, Expect = 1.8e-03, Identities = 27/69 (39%), Positives = 42/69 (60%)
  Q:    82 PNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLK-IASRKITFACSKHQTRVSNAIKRARIVALIP 150
           P K+  +K  C LC K   HV+YK+ +LL ++++P    I  R +T  C K Q  ++ AIKRA+I+  +P
  S:    56 PYKESLKK--CVLCGK---HVNYKNAQLLSQFVSPFTGCIYGRHVTGLCGKKQKEITKAIKRAQIMGFMP 120
>gi|11467563|ref|NP_043709.1| ribosomal protein S18 [Odontella sinensis] >gi|1350880|sp|P49505|RR18_ODOSI Chloroplast 30S ribosomal protein S18 >gi|1185258|emb|CAA91741.1| 30S ribosomal protein S18 [Odontella sinensis] (72 aa)
Score = 105, Expect = 1.8e-03, Identities = 22/53 (41%), Positives = 37/53 (69%)
  Q:   100 EHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFV 152
           + +DYKD++LL  ++T   KI  R+ T    + Q +++ AIKRAR+++L+PFV
  S:    15 QKIDYKDIDLLKLFITEQGKILPRRATGVTVQQQRQIAKAIKRARVLSLLPFV 67
>gi|109074224|ref|XP_001104605.1| PREDICTED: mitochondrial ribosomal protein S18C [Macaca mulatta] (144 aa)
Score = 104, Expect = 1.9e-03, Identities = 39/123 (31%), Positives = 59/123 (47%)
  Q:    28 KETKKTTTTKTSTAKKATTASVEKTEVKETKKSSDNKKEFNPQDRPFAKYNRGYPNKQGRRKKFCKLCAKGQEHVDYKDVELLYKYLTPNLK-IASRKITFACSKHQTRVSNAIKRARIVALIP 150
           K+  +  T   S     T   + +    + K+ S N      +D P    N   P K+  +K  C LC K    VDYK+V+LL ++++P    I  R IT  C K Q  ++ AIKRA+I+  +P
  S:    14 KKLTRLVTAAVSLTHLGTQTVLWRRGCSQYKQVSSN------EDLPITMEN---PYKEPLKK--CILCGK---RVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQILGFMP 123
>gi|110746771|gb|ABG89277.1| ribosomal protein S18 [Paenibacillus larvae] (75 aa)
Score = 104, Expect = 1.9e-03, Identities = 25/63 (39%), Positives = 41/63 (65%)
  Q:    92 CKLCAKGQEHVDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIVALIPFVRD 154
           C   A   +H+DYKD++ L K+++   KI  R++T   +K+Q  ++ AIKRAR VAL+P+  +
  S:    13 CYFTANKIKHIDYKDIDTLKKFISERGKILPRRVTGTSAKYQRMLTIAIKRARQVALLPYTTE 75