>gi|26553572|ref|NP_757506.1| hypothetical protein MYPE1180 [Mycoplasma penetrans HF-2] >gi|26453578|dbj|BAC43910.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (183 aa)
Score = 932, Expect = 3.3e-99, Identities = 183/183 (100%), Positives = 183/183 (100%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGKE 183
           MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGKE
  S:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGKE 183
>gi|31544365|ref|NP_852943.1| hypothetical protein MGA_0902 [Mycoplasma gallisepticum R] >gi|31541209|gb|AAP56511.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (191 aa)
Score = 580, Expect = 2.1e-58, Identities = 105/181 (58%), Positives = 141/181 (77%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMG 181
           +KLL LT+ +FQD+E+V+  SI  AS KF +ID+YSPE  + V GQF++A+IKTIK+FNVNDYD +Y+PGG GA  LR ++KG+A V EF+  +KWVIAICD+PNAL+++ ++  + KYISWS G +    RIKDFN  + RSNKLITGRC + TL+LAFY+LEV+F K+FS+ L+ KL G
  S:     9 LKLLVLTIKEFQDIELVSFASILTASGKFSKIDYYSPEEKDSVVGQFNVAHIKTIKSFNVNDYDAIYVPGGMGAIHLRTNQKGLAAVHEFVKANKWVIAICDSPNALSENKILNPEDKYISWSDGTMNHPNRIKDFNVQLNRSNKLITGRCSLTTLELAFYTLEVLFSKEFSEELRAKLTG 189
>gi|47459424|ref|YP_016286.1| putative intracellular protease/amidase and/or 4-methyl-5 (b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Mycoplasma mobile 163K] >gi|47458754|gb|AAT28075.1| putative intracellular protease/amidase and/or 4-methyl-5 (b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Mycoplasma mobile 163K] (182 aa)
Score = 282, Expect = 7.8e-24, Identities = 65/181 (35%), Positives = 104/181 (57%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMG 181
           MKLL L + +FQD+E++ + +  +     E+ DFY+P N ++VTGQF+IAN+ TI   N NDYD ++IPGG  A  LR+  K +  ++ FI  +K +I ICDAPNA+ + NL+K+D  + S+    I   K I+    +V       + +    +++L    +EV+  K  S+ +   L G
  S:     1 MKLLTLVLDEFQDIELINVNATLQRGNFLEKNDFYNPHNKKVVTGQFNIANVNTITQINENDYDAIFIPGGKAAQHLRKDSKSLNLIESFIKKNKIIIMICDAPNAIYESNLLKKDIIFTSYPVESILKLKPIQRNEDNVVYYKNFFSAKSAAFSIELGLKVIEVLKSKQESERVSKNLWG 181
>gi|71894041|ref|YP_278149.1| hypothetical protein MS53_0016 [Mycoplasma synoviae 53] >gi|71850829|gb|AAZ43438.1| conserved hypothetical protein [Mycoplasma synoviae 53] (181 aa)
Score = 272, Expect = 9.1e-23, Identities = 65/169 (38%), Positives = 100/169 (59%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIK-NFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDF-NTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGK 169
           M LL +  + FQD+E+  ++SI K SQ+F +I FY+P + +  TGQF+I     ++ + N+ DY  +++PGG      + +K+ I  ++ F D DKWV AICDAPNAL  +NLIKE Q Y S+ S    + +   ++ N  V    KLIT +    +  LAF  +  +FG+
  S:     1 MNLLVIVDNNFQDVELTTVVSILKRSQQFNKIAFYNPCSRK-ATGQFEIVKFNNLETSVNLKDYQAVFVPGGKACFSFKDNKEIIKKIRHFFDKDKWVFAICDAPNALRYNNLIKE-QNYTSFPSAWSKELRSNSNYQNKGVVVFEKLITAKSSYYSQHLAFEIIRTLFGE 169
>gi|148377366|ref|YP_001256242.1| hypothetical protein MAG0980 [Mycoplasma agalactiae PG2] >gi|148291412|emb|CAL58796.1| Conserved hypothetical protein [Mycoplasma agalactiae PG2] (156 aa)
Score = 254, Expect = 1.3e-20, Identities = 49/130 (37%), Positives = 85/130 (65%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDS 130
           MKLL +  +KF D+E+V++LS+ K S++ E I +++P + +  TGQ  I  +  +   + +DYD ++IPGG GA  LR+ K+ +  ++ F   DK+V AICDAPNAL ++ +I +++ Y S+   +I ++
  S:     1 MKLLVVVHNKFNDMELVSVLSVLKRSKQIEEITYFNP-SYKSATGQHGIVTLNLVSEVDESDYDAIFIPGGAGAKELREDKESLEIIRNFKKLDKYVFAICDAPNALYENGIITDNEVYSSFPIENINNT 129
>gi|54020354|ref|YP_115641.1| hypothetical protein mhp127 [Mycoplasma hyopneumoniae 232] >gi|53987527|gb|AAV27728.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] >gi|144227532|gb|AAZ44335.2| conserved hypothetical protein [Mycoplasma hyopneumoniae J] >gi|144575345|gb|AAZ53626.2| conserved hypothetical protein [Mycoplasma hyopneumoniae 7448] (178 aa)
Score = 247, Expect = 8.6e-20, Identities = 55/175 (31%), Positives = 102/175 (58%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLK 176
           KLL + + KFQD+E+   +S+ K ++ F  I+F++P+N ++V GQF + +I+   ++  +D+D ++IPGG+ A L R+  K I  V EF   +K + AICDAPNA+ +  L  E+ ++ S+ +   +  +  +D    + R+   I+ R    + D AF  +E +  K+ +  ++
  S:     3 KLLVILLDKFQDIELTTFISLIKKAEIFTDIEFFNPKN-KLVIGQFGVVSIQAHNHWKSDDFDAVFIPGGFAAQLFRKDSKSIQLVSEFFAQNKHIFAICDAPNAIFELKL-AENYQFSSYPNQHNSKIRLRQDSLVTIDRN--YISARNAASSADFAFVVIEKLGSKELAQKIR 173
>gi|71893600|ref|YP_279046.1| hypothetical protein MHJ_0244 [Mycoplasma hyopneumoniae J] >gi|72080591|ref|YP_287649.1| hypothetical protein MHP7448_0252 [Mycoplasma hyopneumoniae 7448] (189 aa)
Score = 246, Expect = 9.6e-20, Identities = 55/175 (31%), Positives = 102/175 (58%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLK 176
           KLL + + KFQD+E+   +S+ K ++ F  I+F++P+N ++V GQF + +I+   ++  +D+D ++IPGG+ A L R+  K I  V EF   +K + AICDAPNA+ +  L  E+ ++ S+ +   +  +  +D    + R+   I+ R    + D AF  +E +  K+ +  ++
  S:    14 KLLVILLDKFQDIELTTFISLIKKAEIFTDIEFFNPKN-KLVIGQFGVVSIQAHNHWKSDDFDAVFIPGGFAAQLFRKDSKSIQLVSEFFAQNKHIFAICDAPNAIFELKL-AENYQFSSYPNQHNSKIRLRQDSLVTIDRN--YISARNAASSADFAFVVIEKLGSKELAQKIR 184
>gi|15828946|ref|NP_326306.1| hypothetical protein MYPU_4750 [Mycoplasma pulmonis UAB CTIP] >gi|14089889|emb|CAC13648.1| conserved hypothetical protein [Mycoplasma pulmonis] (186 aa)
Score = 175, Expect = 1.8e-11, Identities = 47/160 (29%), Positives = 84/160 (52%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIA----NIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTH--VYRSNKLITGRCPVVTLDLAF 160
           MKLL +   ++QD+E   ++SI   S+ F+ +D Y+P+  + + GQ   +    ++K +   +  DYD ++I GG     L   +K +  +K+F  + K +  +C A N L D  +I E +KY+ +    + + KR K+F     + R   L TG     + +L F
  S:     1 MKLLTILHDQYQDIEYSVVMSILDISKTFDTMDVYNPDGQDRIYGQHKTSYADVSVKDLSKVSHKDYDAIFILGGKNVRRLADDQKTLKFIKDFYTSGKDLFVLCFASNVLFDSGIINE-EKYVGYP---LQNQKRGKNFTETIGIVRDKNLFTGAGAFSSFELGF 162
>gi|12044879|ref|NP_072689.1| DJ-1/PfpI family protein [Mycoplasma genitalium G37] >gi|1722956|sp|P47275|Y029_MYCGE Uncharacterized protein MG029 >gi|3844639|gb|AAC71245.1| DJ-1/PfpI family protein [Mycoplasma genitalium G37] >gi|166078930|gb|ABY79548.1| DJ-1/PfpI family protein [synthetic Mycoplasma genitalium JCVI-1.0] (186 aa)
Score = 166, Expect = 2.1e-10, Identities = 45/158 (28%), Positives = 83/158 (52%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKN-FNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLA 159
           K+L +   +  D+E   ++ +F   +  +   ++   +L+ +T    +  +  I N  N++++D +YIPGG GAT  L + +K +  +  F  N+ ++ AICD PN L  H +I +D+ Y S+ + ++  S+        V  +NKLIT R     L+ A
  S:     3 KILVIVYPEMNDVEYTNVMVVFSFIKTIQTTCYH--HSLKKITASNGVVEVNNIVNTINLSEFDAVYIPGGIGATKHLDKDEKLLKTINYFKVNNLYLFAICDTPNVLFKHGIITKDEIYSSFPNPNLVMSENRS--TAKVTVANKLITARSAGCALEFA 158
>gi|66879841|ref|ZP_00404831.1| COG0693: Putative intracellular protease/amidase [Mycoplasma genitalium G-37] (191 aa)
Score = 165, Expect = 2.5e-10, Identities = 45/158 (28%), Positives = 83/158 (52%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKN-FNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLA 159
           K+L +   +  D+E   ++ +F   +  +   ++   +L+ +T    +  +  I N  N++++D +YIPGG GAT  L + +K +  +  F  N+ ++ AICD PN L  H +I +D+ Y S+ + ++  S+        V  +NKLIT R     L+ A
  S:     8 KILVIVYPEMNDVEYTNVMVVFSFIKTIQTTCYH--HSLKKITASNGVVEVNNIVNTINLSEFDAVYIPGGIGATKHLDKDEKLLKTINYFKVNNLYLFAICDTPNVLFKHGIITKDEIYSSFPNPNLVMSENRS--TAKVTVANKLITARSAGCALEFA 163
>gi|148380727|ref|YP_001255268.1| DJ-1 family protein [Clostridium botulinum A str. ATCC 3502] >gi|153932262|ref|YP_001385011.1| DJ-1 family protein [Clostridium botulinum A str. ATCC 19397] >gi|153935560|ref|YP_001388481.1| DJ-1 family protein [Clostridium botulinum A str. Hall] >gi|148290211|emb|CAL84330.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Clostridium botulinum A str. ATCC 3502] >gi|152928306|gb|ABS33806.1| DJ-1 family protein [Clostridium botulinum A str. ATCC 19397] >gi|152931474|gb|ABS36973.1| DJ-1 family protein [Clostridium botulinum A str. Hall] (183 aa)
Score = 152, Expect = 7.6e-09, Identities = 57/179 (31%), Positives = 89/179 (49%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDI-ANI-KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           K+L      F+++E + ++ + + +    R D  S  + + V G  +I  N+ KT++    NDY  L IPGG  GA  LR + K I  VKEF  ++K + AIC  P  L+  N+IK   K ++   G   D K        V +   +IT R P   +  AF  LE +  KD + G+K  ++
  S:     3 KVLVFIAEGFEEIEALTVVDVLRRANI--RCDMCSITSNKEVKGAHNILVNVDKTLEEIKTNDYSSLVIPGGMPGAANLRDNNKVINLVKEFNRDEKLIAAICAGPIVLSKANIIK--GKEVTSYPGFEEDLKEGIYKEDLVVQDGNIITSRGPSAAMYFAFKILENL-KKDSAKGIKEDML 179
>gi|153939756|ref|YP_001392047.1| DJ-1 family protein [Clostridium botulinum F str. Langeland] >gi|152935652|gb|ABS41150.1| DJ-1 family protein [Clostridium botulinum F str. Langeland] (183 aa)
Score = 152, Expect = 7.9e-09, Identities = 57/179 (31%), Positives = 89/179 (49%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDI-ANI-KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           K+L      F+++E + ++ + + +    R D  S  + + V G  +I  N+ KT++    NDY+ L IPGG  GA  LR + K I  VKEF  ++K + AIC  P  L+  N+IK   K ++   G   D K        V +   +IT R P   +  AF  LE  F KD +  +K  ++
  S:     3 KVLVFIAEGFEEIEALTVVDVLRRANI--RCDMCSITSNKEVKGAHNILVNVDKTLEEIKTNDYNSLVIPGGMPGAANLRDNNKVINLVKEFNRDEKLIAAICAGPIVLSKANIIK--GKEVTSYPGFEEDLKECIYKEDLVVQDGNIITSRGPSAAMYFAFKILEN-FKKDSAKEIKEDML 179
>gi|168180824|ref|ZP_02615488.1| DJ-1 family protein [Clostridium botulinum NCTC 2916] >gi|182668186|gb|EDT80165.1| DJ-1 family protein [Clostridium botulinum NCTC 2916] (183 aa)
Score = 151, Expect = 1.0e-08, Identities = 57/179 (31%), Positives = 91/179 (50%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDI-ANI-KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           K+L      F+++E + ++ + + +    + D  S  + + VTG  +I  N+ KT++    N+Y+ L IPGG  GAT LR + K I  VKEF  ++K + AIC  P  L+  N+IK   K ++   G   D K        V +   +IT R P   +  AF  LE  F KD +  +K  ++
  S:     3 KVLVFIAEGFEEIEALTVVDVLRRANI--QCDMCSITSNKEVTGAHNILVNVDKTLEEIKTNEYNSLVIPGGMPGATNLRDNNKVIDLVKEFNRDEKLIAAICAGPIVLSKANIIK--GKEVTSYPGFEEDLKEGIYKEDLVVQDGNIITSRGPSAAMYFAFKILEN-FKKDSAKEIKEDML 179
>gi|168183166|ref|ZP_02617830.1| DJ-1 family protein [Clostridium botulinum Bf] >gi|182673680|gb|EDT85641.1| DJ-1 family protein [Clostridium botulinum Bf] (183 aa)
Score = 147, Expect = 3.2e-08, Identities = 53/163 (32%), Positives = 85/163 (52%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDI-ANI-KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLI--KEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLE 164
           K+L      F+++E + ++ + + +    + D  S  + + V G  +I  N+ KT++    N+Y+ L IPGG  GAT LR + K I  VKEF  ++K + AIC  P  L+  N+I  KE   Y  +   D+ +S   +D    V +   +IT R P   +  AF  LE
  S:     3 KVLVFIAEGFEEIEALTVIDVLRRANI--QCDMCSITSDKEVKGAHNILVNVDKTLEEIKTNEYNSLVIPGGMPGATNLRDNNKVINLVKEFNRDEKLIAAICAGPIVLSKANIIKGKEVTSYPGFEE-DLKESIYKEDL---VVQDGNIITSRGPSAAMYFAFKILE 164
>gi|170755120|ref|YP_001782375.1| DJ-1 family protein [Clostridium botulinum B1 str. Okra] >gi|169120332|gb|ACA44168.1| DJ-1 family protein [Clostridium botulinum B1 str. Okra] (183 aa)
Score = 147, Expect = 3.3e-08, Identities = 57/179 (31%), Positives = 88/179 (49%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDI-ANI-KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           K+L      F+++E + ++ + + +    R D  S  + + V G  +I  N+ KT++    NDY  L IPGG  GA  LR + K I  VKEF  ++K + AIC  P  L+  N+IK   K ++   G   D K        V +   +IT R P   +  AF  LE  F KD +  +K  ++
  S:     3 KVLIFIAEGFEEIEALTVVDVLRRANI--RCDMCSIASNKEVKGAHNILVNVDKTLEEIKTNDYSSLVIPGGMPGAANLRDNNKVINLVKEFNRDEKLIAAICAGPIVLSKANIIK--GKEVTSYPGFEEDLKEGIYKEDLVVQDGNIITSRGPSAAMYFAFKILEN-FKKDSAKEIKEDML 179
>gi|85057864|ref|YP_456780.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789969|gb|ABC65701.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Aster yellows witches'-broom phytoplasma AYWB] (180 aa)
Score = 144, Expect = 6.9e-08, Identities = 43/130 (33%), Positives = 65/130 (50%)
  Q:    50 ANIKTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKL 179
           AN+ TI   N  +YD L IPGG Y A ++ +    +  ++ F D +K + AIC AP  L   +L+K        S  +  +   + D    +  S+K +T R P+   D AF  +EV+ GKDF+   K  L
  S:    53 ANLATI---NPLEYDFLVIPGGPYVAQIIEKETFLLQLIQIFFDANKVIGAICAAPMFLGKLDLLKNHPFTCFPSCNNFIEGTYLPDKKAVI--SDKFVTSRSPITVFDFAFALVEVLKGKDFALAFKNSL 178
>gi|169335731|ref|ZP_02862924.1| hypothetical protein ANASTE_02151 [Anaerofustis stercorihominis DSM 17244] >gi|169258469|gb|EDS72435.1| hypothetical protein ANASTE_02151 [Anaerofustis stercorihominis DSM 17244] (177 aa)
Score = 143, Expect = 9.2e-08, Identities = 47/168 (27%), Positives = 79/168 (47%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIA--NIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDF-----NTHVYRSNKLITGRCPVVTLDLAFYSLEVIFG 168
           MK+  +    F+++E +   +I +       +D YS  + +  TG+F I   N+K        DY+ L +PGG     +  S K    +K F   DK++ AIC  P  L     +K ++ Y  ++S +       +DF     + +V    K+ITGR    T+D  F  L+ + G
  S:     1 MKVCMIITDGFEEIEAIGTFAILRRGSV--DVDVYSLLDKD-ATGRFGITCTNLKPFSQIKEEDYEALILPGGPEYVAIEASTKVQNLIKSFSKKDKYMCAICAGPTILGRAGYLK-NKNYTCFTSMN-------EDFGGTYIDKYVVTDGKIITGRSAAATIDFGFAILKELMG 164
>gi|160915371|ref|ZP_02077583.1| hypothetical protein EUBDOL_01379 [Eubacterium dolichum DSM 3991] >gi|158432762|gb|EDP11051.1| hypothetical protein EUBDOL_01379 [Eubacterium dolichum DSM 3991] (177 aa)
Score = 142, Expect = 1.4e-07, Identities = 49/176 (27%), Positives = 87/176 (49%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDF-YSPENLEMVTGQFDIA--NIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDF-NTHVYR----SNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLK 176
           M +L +    F++LE V  +++ + +     ID      +   V+G+F++    +K +K  +   YD L++PGG     L      +  +  +I ++K V AIC AP  L     +K ++ Y  ++S +       +DF  T+V R       +ITGR     +D AF  +E + GK+  D +K
  S:     1 MNVLCIMKDGFEELEAVGTIALLRRAG----IDVDVCTSDANKVSGRFNLTLQPVKDLKEVDPTSYDALFLPGGPHYQTLESDAYIMEILSSYIHSNKVVAAICAAPTILGRAGYLK-NKNYTCFTSMN-------EDFGGTYVDRYAVIDGNIITGRSAAAVIDFAFALIEKLLGKESCDKVK 172
>gi|187778657|ref|ZP_02995130.1| hypothetical protein CLOSPO_02252 [Clostridium sporogenes ATCC 15579] >gi|187772282|gb|EDU36084.1| hypothetical protein CLOSPO_02252 [Clostridium sporogenes ATCC 15579] (183 aa)
Score = 140, Expect = 2.0e-07, Identities = 54/169 (31%), Positives = 84/169 (49%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDI-ANI-KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKD 170
           K+L      F+++E + ++ + + +    + D  S  + + + G  +I  N+ KT++    N+Y+ L IPGG  GAT LR + K I  VKEF  + K + AIC  P  L+  N+IK   K ++   G   D K        V +   +IT R P   +  AF  LE  F KD
  S:     3 KILVFIAEGFEEIEALTVVDVLRRANI--QCDMCSITSNKEIKGAHNILVNVDKTLEEIKSNEYNALVIPGGMPGATNLRDNNKLINLVKEFNRDKKLIAAICAGPIVLSKANIIK--GKEVTSYPGFEEDLKEGLYKEDLVVQDGNIITSRGPSAAMYFAFKILEN-FKKD 169
>gi|169350564|ref|ZP_02867502.1| hypothetical protein CLOSPI_01332 [Clostridium spiroforme DSM 1552] >gi|169292884|gb|EDS75017.1| hypothetical protein CLOSPI_01332 [Clostridium spiroforme DSM 1552] (190 aa)
Score = 140, Expect = 2.1e-07, Identities = 43/122 (35%), Positives = 65/122 (53%)
  Q:    59 NVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEV--IFGKDFSDGLKIKLM 180
           N+  YD L IPGG  GAT LR  K+ I  V++F + +K V AIC  P  L    +IK D+K   +   +   +  I   +T VY+   +ITGR P  +L  ++  LE   I   +  +G++ K +
  S:    64 NIETYDALVIPGGLPGATNLRDDKRVIDLVQKFNNANKIVAAICAGPIVLEKAGVIK-DKKVTCFPGFEKELNSAIYQ-DTLVYQDGNIITGRGPAASLAFSYCILEALGIDSSNIQEGMQYKFL 186
>gi|15894907|ref|NP_348256.1| intracellular protease/amidase [Clostridium acetobutylicum ATCC 824] >gi|15024587|gb|AAK79596.1|AE007672_3 Putative intracellular protease/amidase, ThiJ family [Clostridium acetobutylicum ATCC 824] (188 aa)
Score = 140, Expect = 2.2e-07, Identities = 49/182 (26%), Positives = 85/182 (46%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTG-QFDIANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGK 182
           MK++      F+++E + ++ I + +      D  S E  E+V   +  +   KTI++ ++ +YD L +PGG  GA  LR S+  I  VK+F    K V AIC AP  L    +++          GD  +            +   ++T R P   +      +E++ GK+ ++GLK  +M K
  S:     1 MKIVLFLAEGFEEVEALTVVDILRRADII--CDMCSLEAKEVVGAHKIKVCADKTIEDIDIAEYDGLVLPGGMPGAENLRNSEFVINAVKKFNKEKKIVAAICAAPIVLGKAEVLEGRDATSYPGYGD--EMGNCNYLEKITVKDGNILTSRGPATAIYFGLRLVEILKGKEVANGLKDGMMLK 180
>gi|170759632|ref|YP_001788085.1| DJ-1 family protein [Clostridium botulinum A3 str. Loch Maree] >gi|169406621|gb|ACA55032.1| DJ-1 family protein [Clostridium botulinum A3 str. Loch Maree] (183 aa)
Score = 139, Expect = 2.9e-07, Identities = 50/163 (30%), Positives = 81/163 (49%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDI-ANI-KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLE 164
           K+L      F+++E + ++ + + +    + D     + + V G  +I  N+ KT++    N+Y+ L IPGG  GAT LR + K I  +KEF  ++K + AIC  P  L+  N+IK   K ++   G   D K        V +   +IT R P   +  AF  LE
  S:     3 KVLVFIAEGFEEIEALTVIDVLRRANI--QCDMCGITSNKEVKGAHNILVNVDKTLEEIKTNEYNSLVIPGGMPGATNLRDNNKVINLIKEFNRDEKLIAAICAGPIVLSKANIIK--GKEVTSYPGFEEDLKEGIYKEDLVVQDGNIITSRGPSAAMYFAFKILE 164
>gi|13507771|ref|NP_109720.1| hydrolase [Mycoplasma pneumoniae M129] >gi|2496268|sp|P75082|Y032_MYCPN Uncharacterized protein MG029 homolog >gi|1673781|gb|AAB95770.1| hydrolase [Mycoplasma pneumoniae M129] (108 aa)
Score = 138, Expect = 3.8e-07, Identities = 35/106 (33%), Positives = 59/106 (55%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKN-FNVNDYDVLYIPGGYGAT-LLRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           KLL +      D+E    + +F   ++ + +  Y P NL  V G   +  +  I +  N+ ++D ++IPGG GAT +L   ++ +  ++ F D+DK+V AICD PN L
  S:     3 KLLVIVYPDMNDVEYTNTMVVFGFVKELQTV-IYHP-NLSTVKGSNGVTLVNQITSKVNLEEFDGVFIPGGMGATKVLDHDQQLLDTIRYFKDHDKYVFAICDTPNVL 108
>gi|39938623|ref|NP_950389.1| hypothetical protein PAM137 [Onion yellows phytoplasma OY-M] >gi|39721732|dbj|BAD04222.1| conserved hypothetical protein [Onion yellows phytoplasma OY-M] (180 aa)
Score = 137, Expect = 4.5e-07, Identities = 41/130 (31%), Positives = 64/130 (49%)
  Q:    50 ANIKTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKL 179
           AN+ TI   N  +YD L IPGG Y A ++ +    +  +++F+D +K + AIC AP  L   +L+K        S     +   + D    +  S+K +T R P+   D  F  +EV+ GK F+   K  L
  S:    53 ANLATI---NPLEYDFLVIPGGPYVAQIIEKETFLLKLIQKFVDANKVIGAICAAPMFLGKLDLLKNHPFTCFPSCNHFIEGTYLPDQKAVI--SDKFVTSRSPITVFDFVFALVEVLKGKAFAFAFKNSL 178
>gi|50812271|ref|NP_390580.2| hypothetical protein BSU27020 [Bacillus subtilis subsp. subtilis str. 168] >gi|37999917|sp|O06006|YRAA_BACSU Uncharacterized protein yraA >gi|32468798|emb|CAB14644.2| yraA [Bacillus subtilis subsp. subtilis str. 168] (169 aa)
Score = 134, Expect = 9.8e-07, Identities = 44/151 (29%), Positives = 71/151 (47%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLI--KEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           K+  L   +F+D+E  + +  ++ A      ID  + + +    G+  +   K I + + +D+D L IPGG+   LLR   +     K F++N K V AIC  P  L D +L+  K+   Y S     I      KD    V  S+ ++T R P
  S:     4 KIAVLVTDQFEDIEYTSPVKAYEEAGYSVVAIDLEAGKEVTGKHGE-KVKIDKAISDVDASDFDALLIPGGFSPDLLRADDRPGEFAKAFVENKKPVFAICHGPQVLIDTDLLKGKDITGYRSIRKDLINAGANYKD--AEVVVSHNIVTSRTP 154
>gi|148263520|ref|YP_001230226.1| PfpI family intracellular peptidase [Geobacter uraniireducens Rf4] >gi|146397020|gb|ABQ25653.1| intracellular protease, PfpI family [Geobacter uraniireducens Rf4] (167 aa)
Score = 131, Expect = 2.5e-06, Identities = 41/152 (26%), Positives = 74/152 (48%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFD--IANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS-SGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           MK L ++   F+D E+  L+  ++  +    +D  S ++   + G+ D  +A  KT+   N +DY +L +PGG     +R+  K +   + F  ++K V AIC  P  L    L+K        S +G++ D+  + + +  V     L+T R P
  S:     1 MKALIISADNFEDSEL--LVPYYRLKEAGMAVDVASMKS-GSIRGKHDYEVAVAKTLDEINPDDYAILILPGGKAPEKIRKETKALEIARSFFAHNKPVAAICHGPQTLISAGLVKGRHATCYRSVAGELKDAGALYE-DREVVVDGNLVTSREP 151
>gi|19704420|ref|NP_603982.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19714680|gb|AAL95281.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (182 aa)
Score = 130, Expect = 2.7e-06, Identities = 50/170 (29%), Positives = 83/170 (48%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKT-IKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSG--DITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKD 170
           MK        F+ LE  A + + K     E +   + ++L + + Q +I      + + +    D++ IPGGY G   LR++K+ +  VK F+DNDK+V +IC  P   + +NL     K    SS   +++ +    D  TH+ R  K+ITG      ++ AF   E  F K+
  S:     1 MKTYVFLADGFEILETFAPVDVLKRCGA-EVVTVSTEKDLFVASSQKNIVKADAMLSDIDYKTADLIIIPGGYPGYVNLRENKEVVDIVKYFLDNDKYVASICGGPTIFSYNNL-ANGTKLTGHSSTKEELSKNHIYVDVPTHIDR--KIITGVGAGQAINFAFKIAEQFFDKE 170
>gi|2108267|emb|CAA63466.1| yraA [Bacillus subtilis] (154 aa)
Score = 129, Expect = 4.1e-06, Identities = 34/113 (30%), Positives = 57/113 (50%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L   +F+D+E  + +  ++ A      ID  + + +    G+  +   K I + + +D+D L IPGG+   LLR   +     K F++N K V AIC  P  L D +L+K
  S:     4 KIAVLVTDQFEDIEYTSPVKAYEEAGYSVVAIDLEAGKEVTGKHGE-KVKIDKAISDVDASDFDALLIPGGFSPDLLRADDRPGEFAKAFVENKKPVFAICHGPQVLIDTDLLK 116
>gi|50365079|ref|YP_053504.1| putative intracellular protease/amidase [Mesoplasma florum L1] >gi|50363635|gb|AAT75620.1| putative intracellular protease/amidase [Mesoplasma florum L1] (181 aa)
Score = 129, Expect = 4.2e-06, Identities = 49/180 (27%), Positives = 92/180 (51%)
  Q:     1 MKLLALTMSK-FQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKT---IKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           MK +A+ + K F++ E +  + I + S+    +D Y+ EN +   G  +I  +KT   I++ N  +YD + IPGG G   L  ++  +  +K+F D +K V AIC AP  L    +I +D K + + + +    K +      +   N ++TG      +  A   +E + GK+  + ++ +L+
  S:     1 MKKVAIILHKNFEESEAIVTIDILRRSEII--VDIYNIENKDFQVGSHNII-VKTEYNIQSLNSQNYDGIVIPGGPGVNELFDNEILLNLIKDFNDKNKMVSAICAAPQILGLAGII-DDIKIVKFPTSNKYLEKALVQEKDSIIDKN-IVTGSSIGTVVPFALNIIEYLQGKEQKEKIRQQLV 179
>gi|34763039|ref|ZP_00144014.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887299|gb|EAA24395.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (182 aa)
Score = 129, Expect = 4.2e-06, Identities = 48/170 (28%), Positives = 83/170 (48%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKT-IKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKD 170
           MK        F+ LE  A + + K     E +   + ++L + + Q +I      + + +    D++ IPGGY G   LR++K+ +  VK F+DNDK+V +IC  P   + +NL     K    S+   +++++    D  TH+    K+ITG      ++ AF   E  F K+
  S:     1 MKTYVFLADGFEILETFAPVDVLKRCGA-EVVTVSTEKDLFVASSQKNIVKADVMLSDIDYKTADLVVIPGGYPGYINLRENKEVVGIVKYFLDNDKYVASICGGPTIFSYNNL-ANGTKLTGHSAVKEELSENHIYVDVPTHI--DGKIITGVGAGQAINFAFKIAEQFFDKE 170
>gi|154687100|ref|YP_001422261.1| YraA [Bacillus amyloliquefaciens FZB42] >gi|154352951|gb|ABS75030.1| YraA [Bacillus amyloliquefaciens FZB42] (169 aa)
Score = 127, Expect = 6.6e-06, Identities = 48/151 (31%), Positives = 72/151 (47%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQF--DIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRI-KDF--------NTHVYRSNKLITGRCP 152
           K+  L   +F+D+E  +    FK A      ID    E  + VTG+    +   + I + +  ++D L IPGG+   LLR   +     K F++N K V AIC  P  L D +L+K           DIT  + I KD         +  V  S+ ++T R P
  S:     4 KIAVLMTDQFEDIEYTSPAEAFKEAGHSVVTIDL---EAGKEVTGKHGEKVKIDQAISDADAKEFDALLIPGGFSPDLLRGDDRPGEFTKAFVENQKPVFAICHGPQLLIDTDLLK---------GKDITGFRSIRKDLINAGAHYKDEEVVVSHNIVTSRTP 154
>gi|167939053|ref|ZP_02526128.1| protease I, ThiJ/PfpI family protein [Bacillus cereus AH1134] >gi|168138035|ref|ZP_02581264.1| protease I, ThiJ/PfpI family protein [Bacillus cereus B4264] (171 aa)
Score = 125, Expect = 1.1e-05, Identities = 39/151 (25%), Positives = 71/151 (47%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKAS-QKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTH--VYRSNKLITGRCP 152
           K+  L    F+D E    +  FK    +F  I+    + +    G+ ++   K+I + +  ++D L+IPGG+   +LR  ++ +   K F+D +K V AIC  P  L     + E +    + S ++       +F+    V   N+L+T R P
  S:     4 KIAILITDYFEDTEYTEPVEAFKQKGYEFTTIEMEKGKTVHGKQGKSEVVIDKSIDDVSPENFDALFIPGGFSPDILRADERFVRFSKAFMDAEKPVFAICHGPQLLITAQTL-EGRDVTGYKSIEVDLKNAGGNFHDKEVVVCQNQLVTSRQP 156
>gi|28211406|ref|NP_782350.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Clostridium tetani E88] >gi|28203847|gb|AAO36287.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Clostridium tetani E88] (188 aa)
Score = 125, Expect = 1.3e-05, Identities = 48/179 (26%), Positives = 87/179 (48%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDI--ANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           K++ +    F+++E + ++ I +      +    + E  +MV G  +I   +   +K+F    +  + +PGG  GAT LR +K+ I  +KEF D +K + AIC AP  L + +++  + K I+   G   + K        V +   +IT R P   +D  F  LE I  +   + LK  ++
  S:     9 KIVVMLAKGFEEIEALTVVDILRRVGVDCKTCSITEE--KMVKGAHNIYVKSDTLLKDFKEYGFSGIVLPGGMPGATNLRDNKEVIGIIKEFNDENKLIAAICAAPIVLKEADIV--ENKNITSYPGFEEELKGSNYKEDKVVQHGNIITSRGPSTAIDFTFKILENIIDEKELEELKKSML 186
>gi|149183509|ref|ZP_01861936.1| general stress protein 18 [Bacillus sp. SG-1] >gi|148848781|gb|EDL63004.1| general stress protein 18 [Bacillus sp. SG-1] (163 aa)
Score = 122, Expect = 2.3e-05, Identities = 30/97 (30%), Positives = 50/97 (51%)
  Q:    11 FQDLEMVALLSIFKAS-QKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           F+D+E       FK        I+  S + +E   G+  +   K I N N +++D L++PGG+    LR  ++ +   K F+D++K V+AIC  P  L
  S:     2 FEDVEYTKPADAFKEEGHTVVTIEKESGKTVEGKQGEAKVTIDKGIDNVNPDEFDALFLPGGFSPDQLRADERFVQFTKSFMDSEKPVMAICHGPQLL 99
>gi|152972077|ref|YP_001337223.1| intracellular proteinase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150956926|gb|ABR78956.1| putative intracellular proteinase with catalase domain [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (178 aa)
Score = 121, Expect = 3.1e-05, Identities = 29/113 (25%), Positives = 56/113 (49%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L    F+D E  +    FK A  +   I+  + + ++   G+ ++A  + I +    ++D L +PGGY    LR  ++ +   ++F++  K V AIC  P  L   ++I+
  S:     4 KIAVLITDDFEDSEFTSPAEAFKLAGHQVITIEKQAGKTVKGKQGEAEVAIDRAIDDVTPGEFDALLLPGGYSPDQLRGDERFVTFTRDFVNGGKPVFAICHGPQLLISADVIR 117
>gi|167761294|ref|ZP_02433421.1| hypothetical protein CLOSCI_03699 [Clostridium scindens ATCC 35704] >gi|167660960|gb|EDS05090.1| hypothetical protein CLOSCI_03699 [Clostridium scindens ATCC 35704] (187 aa)
Score = 121, Expect = 3.7e-05, Identities = 47/170 (27%), Positives = 83/170 (48%)
  Q:     1 MKLLALTMSK-FQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKT---IKNFNVNDYDVLYIPGGYGATLLRQSKKGIA-CVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKD 170
           MK +++ ++  F+++E +  + + + +Q +  +D  S      V G   I N++T    +  N  + D++ +PGG   TL   +  G+   VK+F +  K++ AIC  P  LA+  L+K   K I+       D +        V   N +ITGR     +D A   +EV+ G D
  S:     4 MKKVSVILADGFEEIEALTAVDLLRRAQIY--VDTVSITEEYTVHGAHGI-NVQTEDLFEEVNFVESDMIVLPGGMPGTLNLDAHSGVRRVVKDFFEEGKYIGAICAGPTVLANLGLLK--GKRITCHPTVEQDIQGAVITKVPVTVDNNVITGRGAGAAVDFALKLIEVLAGSD 173
>gi|116331015|ref|YP_800733.1| DJ-1/PfpI family intracellular protease [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116124704|gb|ABJ75975.1| Transcription regulator, DJ-1/PfpI family intracellular protease [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (178 aa)
Score = 120, Expect = 4.2e-05, Identities = 32/125 (25%), Positives = 66/125 (52%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIA-CVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIK 178
           T+   N+ D+D++ +PGG G T +  +   IA  ++E    +KW+ AIC AP+ L   N++  + ++ ++  G ++D+         +  S K++T   P    + +   ++++ GK+    LK+K
  S:    51 TLDAVNLKDFDMIVLPGGAGGTKVLGADPKIADFLQEAKKENKWIGAICAAPSILVHQNILTSEDRFTAF-PGIVSDTSGYTGSRLEI--SGKIVTSIGPGSAFEFSLELVKILCGKE--SMLKVK 171
>gi|89097339|ref|ZP_01170229.1| hypothetical protein B14911_17210 [Bacillus sp. NRRL B-14911] >gi|89088162|gb|EAR67273.1| hypothetical protein B14911_17210 [Bacillus sp. NRRL B-14911] (174 aa)
Score = 119, Expect = 5.1e-05, Identities = 31/106 (29%), Positives = 53/106 (50%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           K+  L    F+D+E       FK A  +   I+  + ++++   G   +   K I + N +D+D L++PGG+    LR   + +   K F+D+ K V+AIC  P  L
  S:     6 KIACLITEMFEDVEYTDPAKAFKEAGHEITAIEKEAGKSVKGKQGDATVQIDKGIDDVNPSDFDALFLPGGFSPDQLRADDRFVQFTKSFMDDMKPVLAICHGPQLL 112
>gi|30019017|ref|NP_830648.1| protease I [Bacillus cereus ATCC 14579] >gi|29894559|gb|AAP07849.1| Protease I [Bacillus cereus ATCC 14579] (171 aa)
Score = 119, Expect = 5.4e-05, Identities = 37/151 (24%), Positives = 71/151 (47%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQ-KFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTH--VYRSNKLITGRCP 152
           K+  L    F+D E    ++ F   + +   I+    + +    G+ ++   K+I + +  ++D L+IPGG+   +LR  ++ +   K F+D +K V AIC  P  L     + E +    + S ++       +F+    V   N+L+T R P
  S:     4 KIAILITDYFEDTEYTEPVAAFNQKEYELTTIEMEKGKTVHGKQGKSEVVIDKSIDDVSPENFDALFIPGGFSPDILRADERFVRFSKAFMDAEKPVFAICHGPQLLITAQTL-EGRDVTGYKSIEVDLKNAGGNFHDKEVVVCQNQLVTSRQP 156
>gi|154685258|ref|YP_001420419.1| YfkM [Bacillus amyloliquefaciens FZB42] >gi|154351109|gb|ABS73188.1| YfkM [Bacillus amyloliquefaciens FZB42] (171 aa)
Score = 119, Expect = 6.1e-05, Identities = 30/106 (28%), Positives = 51/106 (48%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           K+  +    F+D+E       FK A  +   I+    + ++   G+ ++    +I + N  D+D L IPGG+   +LR   + +   K F+D+ K V AIC  P  L
  S:     4 KIAVVLTDYFEDVEYTEPAKAFKDAGHELTVIEQEKGKTVKGKQGEAEVKVDASIDDVNPKDFDALLIPGGFSPDMLRADDRFVQFAKAFMDDKKPVFAICHGPQLL 110
>gi|83941938|ref|ZP_00954400.1| putative intracellular protease, PfpI family protein [Sulfitobacter sp. EE-36] >gi|83847758|gb|EAP85633.1| putative intracellular protease, PfpI family protein [Sulfitobacter sp. EE-36] (186 aa)
Score = 119, Expect = 6.1e-05, Identities = 37/113 (32%), Positives = 60/113 (53%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFD-----IANIKTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+L L+ + F+  E+   L+  KA  K   +   +P+  ++     D     +A  K + +  V+DYD + +PGG     LLR +K  ++ +K F D  K V AIC AP  L +  +IK
  S:     8 KILILSTNGFEQSELERPLNDLKA--KGATVHVATPDGKDIKGWDKDDWGNIVAADKALSDVTVDDYDAIVLPGGQINPDLLRANKDAVSLIKSFADAGKTVAAICHAPWLLIEAGIIK 124
>gi|82702499|ref|YP_412065.1| ThiJ/PfpI [Nitrosospira multiformis ATCC 25196] >gi|82410564|gb|ABB74673.1| ThiJ/PfpI [Nitrosospira multiformis ATCC 25196] (229 aa)
Score = 118, Expect = 6.7e-05, Identities = 29/84 (34%), Positives = 52/84 (61%)
  Q:    37 PENLEMVTGQF--------DIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYI 120
           PEN   +T +F        ++A+ K +   +  DYD ++ PGG+G    +  ++  I+ ++EFI+ DK + A+C AP AL   N+  +D +Y+
  S:    60 PENQTHLTRRFRTDGAAQAELAHTKELTYISAADYDAVFYPGGHGPMWDMPDNRISISLLEEFIEADKPIAAVCHAPAALV--NVRGKDGEYL 150
>gi|148323263|gb|EDK88513.1| possible transcriptional regulator [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (184 aa)
Score = 118, Expect = 7.4e-05, Identities = 38/107 (35%), Positives = 58/107 (54%)
  Q:    64 DVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKD 170
           D++ IPGGY G   LR++K+ +  VK F+DNDK+V +IC  P   + +NL     K  + S+   +I  +    D  TH+    K+ITG      ++ AF   E  F K+
  S:    66 DLVIIPGGYPGYVNLRENKEVVDIVKYFLDNDKYVASICGGPTIFSYNNL-ANGTKLTAHSAVREEIEKNHIYVDVPTHI--DGKIITGIGAGQAINFAFKIAEQFFDKE 172
>gi|146313225|ref|YP_001178299.1| PfpI family intracellular peptidase [Enterobacter sp. 638] >gi|145320101|gb|ABP62248.1| intracellular protease, PfpI family [Enterobacter sp. 638] (172 aa)
Score = 118, Expect = 7.8e-05, Identities = 28/113 (24%), Positives = 56/113 (49%)
  Q:     2 KLLALTMSKFQDLEMVALLSIF-KASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L   +F+D E  +    F KA  +   ID  + + ++   G+ ++   K+I +    ++D L +PGG+    LR  ++ +   ++F+ + K V AIC  P  L    +++
  S:     4 KIAVLITDEFEDSEFTSPAEAFRKAGHEVVTIDTQAGKTVKGHKGEANVTIDKSIDDVTAAEFDALLLPGGHSPDTLRGDERFVTFTRDFVASGKPVFAICHGPQLLISAEVVR 117
>gi|116329183|ref|YP_798903.1| ThiJ/PfpI family transcriptional regulator protein [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116121927|gb|ABJ79970.1| Transcriptional regulator, ThiJ/PfpI family protein [Leptospira borgpetersenii serovar Hardjo-bovis L550] (236 aa)
Score = 118, Expect = 7.9e-05, Identities = 31/122 (25%), Positives = 57/122 (46%)
  Q:    59 NVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           N  D+D+L +PGG G TLL +  + +  +K   +N K++ ++C     LA   L+   +    W S D+     ++       +    ITG      +D A +    +FG + ++  +I+LM
  S:    62 NCPDFDILLVPGGAGTTLLMEEFEVLNFLKTKTENSKFITSVCTGSLILAAAGLLDGYKATTHWLSLDVLKLFPVQISGERFVKDRNRITGGGVTAGIDFALFLTAELFGTELAE--EIQLM 181
>gi|126650647|ref|ZP_01722870.1| YfkM [Bacillus sp. B14905] >gi|126592803|gb|EAZ86802.1| YfkM [Bacillus sp. B14905] (171 aa)
Score = 118, Expect = 8.0e-05, Identities = 23/55 (41%), Positives = 31/55 (56%)
  Q:    53 KTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           K I     ND+D L+IPGG+   +LR   + +A VK F+D+ K   AIC  P  L
  S:    54 KGIDEVKANDFDALFIPGGFSPDILRADDRVVAFVKSFMDDMKPTFAICHGPQLL 108
>gi|149375477|ref|ZP_01893247.1| NonF-related protein [Marinobacter algicola DG893] >gi|149360182|gb|EDM48636.1| NonF-related protein [Marinobacter algicola DG893] (227 aa)
Score = 118, Expect = 8.1e-05, Identities = 38/104 (36%), Positives = 59/104 (56%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALAD------HNLI-----------KED-----------------QKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           +A+ K + + ++NDYD L+ PGG+G    L    K +A +K   + DK + A+C AP    D       NL+           +ED                 +K  +++ GD        DF  H+    KLITG+ P
  S:    80 LASTKKLADVDMNDYDALFYPGGHGPLWDLVNDDKSVALIKAAYEQDKVIGAVCHAPAVFRDVEIKPGQNLVGGRNVTGFSNSEEDTVGLTNVVPFLLEDMLKEKTATYTCGD--------DFTPHIVVDGKLITGQNP 210
>gi|164688437|ref|ZP_02212465.1| hypothetical protein CLOBAR_02082 [Clostridium bartlettii DSM 16795] >gi|164602850|gb|EDQ96315.1| hypothetical protein CLOBAR_02082 [Clostridium bartlettii DSM 16795] (188 aa)
Score = 117, Expect = 8.9e-05, Identities = 52/179 (29%), Positives = 93/179 (51%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDI--ANIKTIKNFNVNDYDVLYIPGGY-GA-TLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNK-LITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           K+L      F+++E ++++ + + +    + D  S ++ E V G  +I   +   I N + ++YD + +PGG  GA  LL +  K IA   +F D  K V AIC AP  L    ++ +D+K  S+  G I   +++      +   +K +IT R P   L+ AF  LE +  KD ++ +K  ++
  S:     3 KVLVFLADGFEEIEALSVVDVLRRASL--KCDLCSIKD-EFVRGTHNIIIQSDCIIDNIDQDEYDAIVLPGGLPGADNLLDKRVKDIAI--KFNDEGKIVAAICAAPQTLEQFGIL-DDKKCTSY-PGFIKGREKVNYLENQIVVVDKNIITSRGPATALEFAFKILEELGYKDKAEEIKKDML 179
>gi|52079249|ref|YP_078040.1| general stress protein YfkM [Bacillus licheniformis ATCC 14580] >gi|52784614|ref|YP_090443.1| YfkM [Bacillus licheniformis ATCC 14580] >gi|52002460|gb|AAU22402.1| general stress protein YfkM [Bacillus licheniformis ATCC 14580] >gi|52347116|gb|AAU39750.1| YfkM [Bacillus licheniformis DSM 13] (171 aa)
Score = 117, Expect = 9.1e-05, Identities = 30/106 (28%), Positives = 50/106 (47%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           K+  +    F+D E       FK A  +   I+    + L+   G+  +    +I   +  D+D L IPGG+   +LR  ++ ++  K F+D+ K V AIC  P  L
  S:     4 KIAVVLTDYFEDSEYTEPAKAFKDAGHQLTVIEKEKGKTLKGKQGEAQVETDASIDEVSPADFDALLIPGGFSPDILRADQRFVSFAKSFMDDKKPVFAICHGPQLL 110
>gi|52144479|ref|YP_082350.1| protease I, ThiJ/PfpI family protein [Bacillus cereus E33L] >gi|51977948|gb|AAU19498.1| protease I, ThiJ/PfpI family protein [Bacillus cereus E33L] (171 aa)
Score = 117, Expect = 9.7e-05, Identities = 38/151 (25%), Positives = 68/151 (45%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKAS-QKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTH--VYRSNKLITGRCP 152
           K+  L    F+D E       FK    +   I+    + +    G+ ++   K I + +  ++D L+IPGG+   +LR  ++ +   K F+D +K V AIC  P  L     + E +    + S ++       +F+    V   N+L+T R P
  S:     4 KIATLITDYFEDTEYTEPAEAFKQKGYELTTIEMEKGKTVHGKQGKSEVVIDKGIDDVSPENFDALFIPGGFSPDILRADERFVRFSKAFMDAEKPVFAICHGPQLLITAQTL-EGRDVTGYKSIEVDLKNAGGNFHNKEVVVCQNQLVTSRQP 156
>gi|49480254|ref|YP_035095.1| protease I, ThiJ/PfpI family protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|166994640|ref|ZP_02261100.1| protease I, ThiJ/PfpI family protein [Bacillus cereus AH820] >gi|196035150|ref|ZP_03102556.1| thiJ/pfpI family protein [Bacillus cereus W] >gi|196037310|ref|ZP_03104621.1| thiJ/pfpI family protein [Bacillus cereus NVH0597-99] >gi|49331810|gb|AAT62456.1| protease I, ThiJ/PfpI family protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|195992214|gb|EDX56176.1| thiJ/pfpI family protein [Bacillus cereus W] >gi|196031552|gb|EDX70148.1| thiJ/pfpI family protein [Bacillus cereus NVH0597-99] (171 aa)
Score = 117, Expect = 1.0e-04, Identities = 39/151 (25%), Positives = 68/151 (45%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKAS-QKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTH--VYRSNKLITGRCP 152
           K+  L    F+D E       FK    +   I+    + +    G+ ++   K I N +  ++D L+IPGG+   +LR  ++ +   K F+D +K V AIC  P  L     + E +    + S ++       +F+    V   N+L+T R P
  S:     4 KIAILITDYFEDTEYTEPAEAFKQKGYELTTIEAEKGKTVHGKQGKSEVVIDKGIDNVSPENFDALFIPGGFSPDILRADERFVRFSKAFMDAEKPVFAICHGPQLLITAQTL-EGRDVTGYKSIEVDLKNAGGNFHDKEVVVCQNQLVTSRQP 156
>gi|24214952|ref|NP_712433.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Leptospira interrogans serovar Lai str. 56601] >gi|45657551|ref|YP_001637.1| hypothetical protein LIC11685 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|24195989|gb|AAN49451.1|AE011396_3 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Leptospira interrogans serovar Lai str. 56601] >gi|45600790|gb|AAS70274.1| conserved hypothetical protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (181 aa)
Score = 116, Expect = 1.1e-04, Identities = 33/125 (26%), Positives = 63/125 (50%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGAT-LLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIK 178
           T+   N  D+D++ +PGG G T +L    K    +K   + +KW+ AIC AP+ L   N++    ++ ++  G I+++         +  S K+IT   P    + A   ++++ G++    LK+K
  S:    54 TLDEINFEDFDMIVLPGGGGGTKVLSAEPKVSELLKNAKEKNKWIAAICAAPSILVHQNILTSKDRFTAF-PGIISNNSGYTGSRLEI--SGKIITSIGPGSAFEFALELVKILSGEE--SMLKVK 174
>gi|23097478|ref|NP_690944.1| general stress protein 18 [Oceanobacillus iheyensis HTE831] >gi|22775701|dbj|BAC11979.1| general stress protein 18 (GSP18) [Oceanobacillus iheyensis HTE831] (172 aa)
Score = 116, Expect = 1.2e-04, Identities = 28/97 (28%), Positives = 49/97 (50%)
  Q:    11 FQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           F+D+E    +  FK A  +   I+    + ++  +    +   ++I N N  ++D L+IPGG+   +LR   + +   K F+D  K V+AIC  P  L
  S:    13 FEDVEFTDPVQSFKEAGHEVITIEKEKGKTIKGKSNDTSVTIDESIDNVNPENFDALFIPGGFSPDILRGDDRFVTFAKHFMDEKKPVMAICHGPQLL 110
>gi|157691517|ref|YP_001485979.1| C56 family peptidase [Bacillus pumilus SAFR-032] >gi|157680275|gb|ABV61419.1| C56 family peptidase [Bacillus pumilus SAFR-032] (172 aa)
Score = 116, Expect = 1.2e-04, Identities = 30/106 (28%), Positives = 49/106 (46%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           K+  +    F+D+E       FK A  +   I+    + ++   G+ ++    +I N    D+D L IPGG+   +LR   + +   K F+D  K V AIC  P  L
  S:     4 KIAVVLTDYFEDVEFTEPAKAFKDAGHEITVIENEKGKTVKGKQGEAEVRVDASIDNVKPEDFDALLIPGGFSPDILRADDRYVQFTKAFMDEKKPVFAICHGPQLL 110
>gi|83855414|ref|ZP_00948944.1| putative intracellular protease, PfpI family protein [Sulfitobacter sp. NAS-14.1] >gi|83843257|gb|EAP82424.1| putative intracellular protease, PfpI family protein [Sulfitobacter sp. NAS-14.1] (186 aa)
Score = 116, Expect = 1.3e-04, Identities = 36/113 (31%), Positives = 60/113 (53%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFD-----IANIKTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+L L+ + F+  E+   L+  KA  K   +   +P+  ++     D     +A  + + +  V+DYD + +PGG     LLR +K  ++ +K F D  K V AIC AP  L +  +IK
  S:     8 KILILSTNGFEQSELERPLNDLKA--KGATVHVATPDGEDIKGWDKDDWGNTVAADQALSDVTVDDYDAIVLPGGQINPDLLRANKDAVSLIKSFADAGKTVAAICHAPWLLIEAGIIK 124
>gi|194016003|ref|ZP_03054618.1| intracellular protease 1 (Intracellular protease I) [Bacillus pumilus ATCC 7061] >gi|194012358|gb|EDW21925.1| intracellular protease 1 (Intracellular protease I) [Bacillus pumilus ATCC 7061] (172 aa)
Score = 116, Expect = 1.3e-04, Identities = 30/106 (28%), Positives = 49/106 (46%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           K+  +    F+D+E       FK A  +   I+    + ++   G+ ++    +I N    D+D L IPGG+   +LR   + +   K F+D  K V AIC  P  L
  S:     4 KIAVVLTDYFEDVEFTEPAKAFKDAGHEITVIENEKGKTVKGKQGEAEVRVDASIDNVKPEDFDALLIPGGFSPDILRADDRYVQFTKAFMDEKKPVFAICHGPQLL 110
>gi|116330209|ref|YP_799927.1| ThiJ/PfpI family transcriptional regulator protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116123898|gb|ABJ75169.1| Transcriptional regulator, ThiJ/PfpI family protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (236 aa)
Score = 116, Expect = 1.3e-04, Identities = 31/122 (25%), Positives = 57/122 (46%)
  Q:    59 NVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           N  D+D+L +PGG G TLL +  + +  +K   +N K++ ++C     LA   L+   +    W S D+     ++       +    ITG      +D A +    +FG + ++  +I+LM
  S:    62 NCPDFDMLLVPGGAGTTLLMEEFEVLNFLKTKTENSKFITSVCTGSLILAAAGLLDGYKATTHWLSLDVLKLFPVQISGERFVKDRNRITGGGVTAGIDFALFLTAELFGTELAE--EIQLM 181
>gi|89067963|ref|ZP_01155407.1| hypothetical protein OG2516_05898 [Oceanicola granulosus HTCC2516] >gi|89046561|gb|EAR52617.1| hypothetical protein OG2516_05898 [Oceanicola granulosus HTCC2516] (186 aa)
Score = 115, Expect = 1.5e-04, Identities = 33/99 (33%), Positives = 56/99 (56%)
  Q:    54 TIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCP 152
           ++++  V+DY  L +PGG     +LR + K +  VK+F+ NDK V AIC  P  L +  ++ E ++  S+ S   D+ ++   +  +  V  SN +IT R P
  S:    63 SLEDVKVDDYIALVLPGGQINPDILRTNDKAVQLVKDFVSNDKIVAAICHGPWMLVEAGVV-EGREMTSYPSIRTDLQNAG-AQVVDKEVAISNGIITSRNP 162
>gi|124520577|ref|ZP_01695707.1| intracellular protease, PfpI family [Bacillus coagulans 36D1] >gi|124497533|gb|EAY45091.1| intracellular protease, PfpI family [Bacillus coagulans 36D1] (171 aa)
Score = 115, Expect = 1.7e-04, Identities = 28/69 (40%), Positives = 40/69 (57%)
  Q:    39 NLEMVTGQF-------DIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           N+EM  G+        +I   K I + +V D+D L IPGG+    LR   + +  VK+F+D+ K V AIC  P  L
  S:    34 NIEMEAGKTVKGKHGTEIHIDKGIDDVSVGDFDALLIPGGFSPDQLRADDRFVQFVKQFMDSKKPVFAICHGPQLL 109
>gi|194466994|ref|ZP_03072981.1| ThiJ/PfpI domain protein [Lactobacillus reuteri 100-23] >gi|194454030|gb|EDX42927.1| ThiJ/PfpI domain protein [Lactobacillus reuteri 100-23] (170 aa)
Score = 115, Expect = 1.8e-04, Identities = 36/105 (34%), Positives = 55/105 (52%)
  Q:    62 DYDVLYIPGGYG-ATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKY-----ISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           DYDV+  PGG G A  LR + K +  +++    +KW  A+C AP ALA + L+ ++  Y     I+     +  +   +D  T V    K+IT R P   L  A+   EV+
  S:    41 DYDVVAFPGGRGGAQKLRDNDKLMKLMQKRNAENKWDAAMCAAPIALARYGLL-DNHNYTCFPGINEEIAKVAPTANFEDDITVVDNDGKIITSRGPATALAFAYQIAEVL 150
>gi|11498880|ref|NP_070109.1| intracellular protease (pfpI) [Archaeoglobus fulgidus DSM 4304] >gi|6136633|sp|O28987|Y1281_ARCFU Uncharacterized protein AF_1281 >gi|2649300|gb|AAB89965.1| intracellular protease (pfpI) [Archaeoglobus fulgidus DSM 4304] (168 aa)
Score = 115, Expect = 1.8e-04, Identities = 34/122 (27%), Positives = 64/122 (52%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISW 122
           M++L L  ++F+DLE+     +++  ++   +   S  +LE+  G+  + +    T ++  V DY  L IPGG     +R +++ +  VK+F++  K V AIC  P  L     +K  ++  SW
  S:     1 MRVLILAENEFEDLEL--FYPLYRLREEGLEVKVAS-SSLEVRVGKKGYQVRPDLTYEDVKVEDYAGLVIPGGKSPERVRINERAVEIVKDFLELGKPVAAICHGPQLLISAMAVK-GRRMTSW 120
>gi|50843589|ref|YP_056816.1| putative intracellular protease / general stress protein 18 [Propionibacterium acnes KPA171202] >gi|50841191|gb|AAT83858.1| putative intracellular protease / general stress protein 18 [Propionibacterium acnes KPA171202] (222 aa)
Score = 115, Expect = 1.9e-04, Identities = 39/112 (34%), Positives = 58/112 (51%)
  Q:     3 LLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANI----KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           L+A+T    ++ E+V  L+  K +     +   S E+++ VTG  D A+       + +   +DYD+L IPGG   A  LR  + G   VKEF    K V AIC  P  L D ++ K
  S:    49 LIAVTDFGVEEAELVEPLNALKKAGIEVTVASNSGESIQTVTGDKDWASKVNADSRLADAKASDYDLLVIPGGTVNADTLRIDEDGRRLVKEFATAGKPVGAICHGPWVLIDADVAK 165
>gi|114799641|ref|YP_759796.1| PfpI family intracellular peptidase [Hyphomonas neptunium ATCC 15444] >gi|114739815|gb|ABI77940.1| intracellular protease, PfpI family [Hyphomonas neptunium ATCC 15444] (208 aa)
Score = 114, Expect = 2.1e-04, Identities = 44/128 (34%), Positives = 63/128 (49%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS---------GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFS 172
           GQ+D+  +      +V+D+D L IPGG  G+  LR S   +A V  F    K V AIC  P  + +    K  +K  S+SS         GD  D + + D        N LIT R P    DL  ++  +I  ++FS
  S:    86 GQYDVDAV--FSQVHVDDFDALIIPGGTVGSDKLRASLDAVAFVSAFFRQSKPVAAICHGPWLIVEAGAAK-GRKLTSYSSLRTDIQNAGGDWVDEEVVVD--------NGLITSRSPD---DLPAFTARII--EEFS 207
>gi|170289951|ref|YP_001736767.1| PfpI family intracellular peptidase [Candidatus Korarchaeum cryptofilum OPF8] >gi|170174031|gb|ACB07084.1| intracellular protease, PfpI family [Candidatus Korarchaeum cryptofilum OPF8] (172 aa)
Score = 114, Expect = 2.2e-04, Identities = 22/52 (42%), Positives = 32/52 (61%)
  Q:    63 YDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           YDV++IPGGY    LR+SKK +  V+  ++  K V A+C AP  L    ++K
  S:    62 YDVIWIPGGYAPDRLRRSKKIVEMVRRAVERGKIVAAVCHAPWVLISAGVVK 113
>gi|152996952|ref|YP_001341787.1| PfpI family intracellular peptidase [Marinomonas sp. MWYL1] >gi|150837876|gb|ABR71852.1| intracellular protease, PfpI family [Marinomonas sp. MWYL1] (189 aa)
Score = 114, Expect = 2.2e-04, Identities = 24/55 (43%), Positives = 29/55 (52%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           T  +  V DYD L IPGG     LR +K  +A VK F D +K V A+C     LA
  S:    72 TFADIKVEDYDALVIPGGRAPEYLRLNKTVVAMVKHFFDTNKPVAAVCHGAQLLA 126
>gi|187603680|ref|ZP_02989892.1| intracellular protease, PfpI family [Exiguobacterium sp. AT1b] >gi|187484455|gb|EDU22447.1| intracellular protease, PfpI family [Exiguobacterium sp. AT1b] (170 aa)
Score = 114, Expect = 2.3e-04, Identities = 29/106 (27%), Positives = 52/106 (49%)
  Q:     2 KLLALTMSKFQDLEMVALL-SIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           K+  L    F+D+E      ++  A      I+  +   +E   G+  +   ++I + +  D+D L +PGG+   LLR+ ++ ++  K F+D  K V AIC  P  L
  S:     3 KVATLITDMFEDVEFTGPRDALVDAGHDVVTIEKKAGNTVEGKQGEAKVNIDQSIDDVSPEDFDALLLPGGFSPDLLREDERFVSFAKAFMDAKKPVFAICHGPQLL 109
>gi|83857205|ref|ZP_00950733.1| proteinase [Croceibacter atlanticus HTCC2559] >gi|83848572|gb|EAP86441.1| proteinase [Croceibacter atlanticus HTCC2559] (193 aa)
Score = 113, Expect = 2.6e-04, Identities = 27/72 (37%), Positives = 44/72 (61%)
  Q:    53 KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           KT+ N + +DY+ L +PGG     +LR+  K I+ +K+F    K V AIC AP  L + +++K  +K  S++S
  S:    69 KTLDNVSASDYNALMLPGGVINPDILRRDDKAISFIKDFFKQSKPVAAICHAPQLLIEADVVK-GRKLTSFNS 140
>gi|118474065|ref|YP_892402.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Campylobacter fetus subsp. fetus 82-40] >gi|118413291|gb|ABK81711.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Campylobacter fetus subsp. fetus 82-40] (179 aa)
Score = 113, Expect = 2.8e-04, Identities = 40/170 (23%), Positives = 83/170 (48%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERID-FYSPENLEMVTGQFDIA--NIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKD 170
           MK+  + +  F+++E   ++ + + +     ID  +   N +   G  +I+        + N +++D++ +PGG  GA  L +S+K    +K+F + DK++ AIC AP AL+  N++ +           +     + D N  V     +IT + P   ++ A   ++V+ G +
  S:     1 MKVAVMLVDGFEEIEATTIIDVLRRAG----IDAVFVGLNSDTAIGAHNISMKADTAFDDINFDNFDMIVLPGGLPGAEYLAKSEKLQKVLKDFDEKDKFIGAICAAPWALSTSNVLGDSYTCYPGFEKVVAKGGYVSDKN--VVIDGNIITSKGPATAMEFALELVKVLQGNE 168
>gi|118476497|ref|YP_893648.1| protease I, ThiJ/PfpI family protein [Bacillus thuringiensis str. Al Hakam] >gi|118415722|gb|ABK84141.1| protease I, ThiJ/PfpI family protein [Bacillus thuringiensis str. Al Hakam] (171 aa)
Score = 113, Expect = 2.8e-04, Identities = 39/151 (25%), Positives = 68/151 (45%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKAS-QKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTH--VYRSNKLITGRCP 152
           K+  L    F+D E       FK    +   I+    + +    G+ +I   K I + +  ++D L+IPGG+   +LR  ++ +   K F+D +K V AIC  P  L     + E +    + S ++       +F+    V   N+L+T R P
  S:     4 KIAILITDYFEDTEYTEPAEAFKQKGYELTTIEAEKGKTVHGKQGKSEIVIDKGIDDVSPENFDALFIPGGFSPDILRADERFVHFSKAFMDAEKPVFAICHGPQLLITAQTL-EGRDVTGYKSIEVDLKNAGGNFHDKEVVVCQNQLVTSRQP 156
>gi|169829982|ref|YP_001700140.1| general stress protein 18 (GSP18) [Lysinibacillus sphaericus C3-41] >gi|168994470|gb|ACA42010.1| General stress protein 18 (GSP18) [Lysinibacillus sphaericus C3-41] (173 aa)
Score = 113, Expect = 2.8e-04, Identities = 22/55 (40%), Positives = 31/55 (56%)
  Q:    53 KTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           K I +    D+D L+IPGG+   +LR   + +A VK F+D+ K   AIC  P  L
  S:    56 KGIDDVKATDFDALFIPGGFSPDILRADDRVVAFVKSFMDDMKPTFAICHGPQLL 110
>gi|42780011|ref|NP_977258.1| thiJ/pfpI family protein [Bacillus cereus ATCC 10987] >gi|42735929|gb|AAS39866.1| thiJ/pfpI family protein [Bacillus cereus ATCC 10987] (171 aa)
Score = 113, Expect = 2.8e-04, Identities = 38/151 (25%), Positives = 67/151 (44%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKAS-QKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTH--VYRSNKLITGRCP 152
           K+  L    F+D E       FK    +   I+    + +    G+ ++   K I + +  ++D L+IPGG+   +LR  ++ +   K F+D  K V AIC  P  L     + E +    + S ++       +F+    V   N+L+T R P
  S:     4 KIATLITDYFEDTEYTEPAEAFKQKGYELTTIEAKKGKTVHGKQGKSEVVIDKGIDDVSPENFDALFIPGGFSPDILRADERFVRFSKSFMDTKKPVFAICHGPQLLITAQTL-EGRDVTGYKSIEVDLKNAGGNFHDKEVVVCQNQLVTSRQP 156
>gi|196046974|ref|ZP_03114194.1| thiJ/pfpI family protein [Bacillus cereus 03BB108] >gi|196022203|gb|EDX60890.1| thiJ/pfpI family protein [Bacillus cereus 03BB108] (171 aa)
Score = 113, Expect = 2.9e-04, Identities = 38/151 (25%), Positives = 67/151 (44%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKAS-QKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTH--VYRSNKLITGRCP 152
           K+  L    F+D E       FK    +   I+    + +    G+ ++   K I + +  ++D L+IPGG+   +LR  ++ +   K F+D  K V AIC  P  L     + E +    + S ++       +F+    V   N+L+T R P
  S:     4 KIATLITDYFEDTEYTEPAEAFKQKGYELTTIEMEKGKTVHGKQGKSEVVIDKGIDDVSPENFDALFIPGGFSPDILRADERFVRFSKAFMDAKKPVFAICHGPQLLITAQTL-EGRDVTGYKSIEVDLKNAGGNFHDKEVVVCQNQLVTSRQP 156
>gi|91212571|ref|YP_542557.1| hypothetical protein UTI89_C3580 [Escherichia coli UTI89] >gi|91074145|gb|ABE09026.1| conserved hypothetical protein [Escherichia coli UTI89] (186 aa)
Score = 112, Expect = 3.3e-04, Identities = 29/112 (25%), Positives = 55/112 (49%)
  Q:     2 KLLALTMSKFQDLEMVALLSIF-KASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLI 113
           K+  L   +F+D E  +    F KA  +   I+  + + ++   G+  +A  K+I      ++D L +PGG+    LR   + +   ++F+++ K V AIC  P  L   ++I
  S:    18 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVAIDKSIDEVTPAEFDALLLPGGHSPDYLRGDNRFVTFTRDFVNSGKPVFAICHGPQLLISADVI 130
>gi|170683857|ref|YP_001745426.1| PfpI family intracellular peptidase [Escherichia coli SMS-3-5] >gi|170521575|gb|ACB19753.1| intracellular peptidase, PfpI family [Escherichia coli SMS-3-5] (172 aa)
Score = 112, Expect = 3.4e-04, Identities = 29/113 (25%), Positives = 56/113 (49%)
  Q:     2 KLLALTMSKFQDLEMVALLSIF-KASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L   +F+D E  +    F KA  +   I+  + + ++   G+  +A  K+I      ++D L +PGG+    LR   + +   ++F+++ K V AIC  P  L   ++I+
  S:     4 KIAVLISDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVAIDKSIDEVTPAEFDALLLPGGHSPDYLRGDNRFVTFTRDFVNSGKPVFAICHGPQLLISADVIR 117
>gi|150403493|ref|YP_001330787.1| PfpI family intracellular peptidase [Methanococcus maripaludis C7] >gi|150034523|gb|ABR66636.1| intracellular protease, PfpI family [Methanococcus maripaludis C7] (171 aa)
Score = 112, Expect = 3.5e-04, Identities = 42/150 (28%), Positives = 69/150 (46%)
  Q:     3 LLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGA-TLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLI--KEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           ++ +   KF+D E+   L +F++     ++        + V G+  +   KTI+  N ND+D + I GG G+   L  ++K +  +KEF    K   AIC +P  LA   L+  K+   Y    S  +         +  V    K+ITGR P
  S:     4 VMVIAPEKFRDEELFEPLQVFQSKNIATQVVSTKIGQHKGVMGKV-MTTTKTIEEINPNDFDAIVIVGGGGSRDFLWNNEKLLELLKEFNKQGKITAAICISPAVLAQAGLLTGKKATVYPDDESISVLQQNGAIYLDEAVIVDGKVITGRNP 155
>gi|168160878|ref|ZP_02596111.1| protease I, ThiJ/PfpI family protein [Bacillus cereus H3081.97] (171 aa)
Score = 112, Expect = 3.9e-04, Identities = 38/151 (25%), Positives = 68/151 (45%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKAS-QKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTH--VYRSNKLITGRCP 152
           K+  L    F+D E       FK    +   I+    + +    G+ ++   K I + +  ++D L+IPGG+   +LR  ++ +   K F+D +K V AIC  P  L     + E +    + S ++       +F+    V   N+L+T R P
  S:     4 KIAILITDYFEDTEYTEPAEAFKQKGYELTTIEAEKGKTVHGKQGKSEVVIDKGIDDVSPENFDALFIPGGFSPDILRADERFVRFSKAFMDAEKPVFAICHGPQLLITAQTL-EGRDVTGYKSIEVDLKNAGGNFHDKEVVVCQNQLVTSRQP 156
>gi|114561985|ref|YP_749498.1| ThiJ/PfpI domain-containing protein [Shewanella frigidimarina NCIMB 400] >gi|114333278|gb|ABI70660.1| ThiJ/PfpI domain protein [Shewanella frigidimarina NCIMB 400] (225 aa)
Score = 112, Expect = 3.9e-04, Identities = 25/64 (39%), Positives = 36/64 (56%)
  Q:    44 TGQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           T Q  I+N  T+ + NV DYD ++ PGG+G    L   K  IA +++    DK +  +C AP AL
  S:    75 TAQALISNTHTLASVNVADYDAVFYPGGHGPLWDLTNDKDSIALIEQCYKTDKLLGLVCHAPAAL 139
>gi|89054358|ref|YP_509809.1| peptidase C56, PfpI [Jannaschia sp. CCS1] >gi|88863907|gb|ABD54784.1| Peptidase C56 PfpI [Jannaschia sp. CCS1] (186 aa)
Score = 112, Expect = 4.0e-04, Identities = 31/98 (31%), Positives = 51/98 (52%)
  Q:    55 IKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLI--KEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           + + N  DYD L +PGG     +LR  +  +  ++ F+D+ + V AIC AP  L +  ++  +E   Y S  +  I    + +D  + V  SN +IT R P
  S:    64 LSDVNAYDYDALVLPGGQINPDILRTHEGAVDIIRTFVDSGRIVAAICHAPWLLIEAGVVEGREMTSYPSIKTDMINAGAKWED--SEVAISNGIITSRNP 162
>gi|116328289|ref|YP_798009.1| DJ-1/PfpI family intracellular protease [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116121033|gb|ABJ79076.1| Transcription regulator, DJ-1/PfpI family intracellular protease [Leptospira borgpetersenii serovar Hardjo-bovis L550] (178 aa)
Score = 111, Expect = 4.2e-04, Identities = 31/125 (24%), Positives = 65/125 (52%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIA-CVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIK 178
           T+   N+ D+D++ +PG  G T +  +   IA  ++E    +KW+ AIC AP+ L   N++  + ++ ++  G ++D+         +  S K++T   P    + +   ++++ GK+    LK+K
  S:    51 TLDAVNLKDFDMIVLPGRAGGTKVLGADPKIADFLQEAKKENKWIGAICAAPSILVHQNILTSEDRFTAF-PGIVSDTSGYTGSRLEI--SGKIVTSIGPGSAFEFSLELVKILCGKE--SMLKVK 171
>gi|149185899|ref|ZP_01864214.1| protease [Erythrobacter sp. SD-21] >gi|148830460|gb|EDL48896.1| protease [Erythrobacter sp. SD-21] (185 aa)
Score = 111, Expect = 4.3e-04, Identities = 35/90 (38%), Positives = 50/90 (55%)
  Q:    63 YDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS---------GDITDSKRIKDFNTHVYRSNKLITGRCP 152
           YD L +PGG     +LR +++ IA V+EF    K + AIC AP  LA+ +LIK D+   +W S          ++ D + + D N        LIT R P
  S:    69 YDALLLPGGQMNPDILRMNERAIAIVREFNMAGKPIAAICHAPWLLAEADLIK-DKTVTAWPSIRTDLKNAGANVVDKEAVVDGN--------LITSRNP 159
>gi|148985843|ref|ZP_01818937.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP3-BS71] >gi|148992474|ref|ZP_01822169.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP9-BS68] >gi|168489812|ref|ZP_02714011.1| DJ-1 family protein [Streptococcus pneumoniae SP195] >gi|168492963|ref|ZP_02717106.1| DJ-1 family protein [Streptococcus pneumoniae CDC3059-06] >gi|147921989|gb|EDK73113.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP3-BS71] >gi|147928791|gb|EDK79804.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP9-BS68] >gi|183571779|gb|EDT92307.1| DJ-1 family protein [Streptococcus pneumoniae SP195] >gi|183576962|gb|EDT97490.1| DJ-1 family protein [Streptococcus pneumoniae CDC3059-06] (184 aa)
Score = 111, Expect = 4.4e-04, Identities = 44/168 (26%), Positives = 83/168 (49%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDI-ANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFG 168
           +K+  +    F+++E + ++ + + A+   + + F      E VTG   I      + + N++DYD++ +PGG  G+  LR ++  I  ++ F    K + AIC AP AL    ++K +++Y  +      I D   +K+    V    +L T R P   L  A+  +E + G
  S:     2 VKVAVMLAQGFEEIEALTVVDVLRRANITCDMVGFE-----EQVTGSHAIQVRADHVFDGNLSDYDMIVLPGGMPGSAHLRDNQTLIQELQSFEQEGKKLAAICAAPIALNQAEILK-NKRYTCYDGVQEQILDGHYVKE---TVVVDGQLTTSRGPSTALAFAYELVEQLGG 165
>gi|163729510|ref|ZP_02136990.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio fischeri MJ11] >gi|161397326|gb|EDQ21615.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio fischeri MJ11] (196 aa)
Score = 111, Expect = 4.7e-04, Identities = 37/119 (31%), Positives = 60/119 (50%)
  Q:    62 DYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQK---YISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           ++D + +PGG  G+   R S   I  +K+   ++KWV AIC AP  +  H+ +  D     Y S+       ++RIK   T V   N LIT + P  +L+ A   +  + GK+ +  L   L+
  S:    66 EFDCIVLPGGLKGSENFRDSTLLIEMLKQQKYDEKWVAAICAAPAIVLQHHNLYPDALMTCYPSFMEAIPEKNRRIKRVFTDVL--NHLITSQGPGSSLEFAMEIVTTLAGKELTAKLAADLV 186
>gi|120406738|ref|YP_956567.1| PfpI family intracellular peptidase [Mycobacterium vanbaalenii PYR-1] >gi|119959556|gb|ABM16561.1| intracellular protease, PfpI family [Mycobacterium vanbaalenii PYR-1] (185 aa)
Score = 111, Expect = 4.7e-04, Identities = 43/137 (31%), Positives = 70/137 (51%)
  Q:    23 FKASQKFERIDFYSPEN-----------LEMVTGQFDIAN-----------IKTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS---------GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLA 159
           F A+   E+++   P             L + TG+ D  N            + +++  V +YD L +PGG      LR S+  +A V +F+ + K V AIC  P AL + +++K D+   S+ S           + D +   D N    RS K +   C  +T   A
  S:    12 FLAADGVEKVELEQPRAAVLDAGGDVDLLSVQTGEIDARNHDLEPAGTFTVDRAVEDARVEEYDALVLPGGTVNGDKLRLSEAAVAFVGDFVRSGKPVAAICHGPWALVEADVVK-DRTLTSYPSLRTDLRNAGATVVDQQVCIDGNLITSRSPKDLDAFCQAITDQFA 179
>gi|117625449|ref|YP_858772.1| hypothetical protein APECO1_3277 [Escherichia coli APEC O1] >gi|115514573|gb|ABJ02648.1| conserved hypothetical protein [Escherichia coli APEC O1] (172 aa)
Score = 111, Expect = 4.9e-04, Identities = 29/112 (25%), Positives = 55/112 (49%)
  Q:     2 KLLALTMSKFQDLEMVALLSIF-KASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLI 113
           K+  L   +F+D E  +    F KA  +   I+  + + ++   G+  +A  K+I      ++D L +PGG+    LR   + +   ++F+++ K V AIC  P  L   ++I
  S:     4 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVAIDKSIDEVTPAEFDALLLPGGHSPDYLRGDNRFVTFTRDFVNSGKPVFAICHGPQLLISADVI 116
>gi|53715247|ref|YP_101239.1| ThiJ family intracellular protease [Bacteroides fragilis YCH46] >gi|60683181|ref|YP_213325.1| putative thiamine biosynthesis related protein [Bacteroides fragilis NCTC 9343] >gi|52218112|dbj|BAD50705.1| putative ThiJ family intracellular protease [Bacteroides fragilis YCH46] >gi|60494615|emb|CAH09416.1| putative thiamine biosynthesis related protein [Bacteroides fragilis NCTC 9343] (183 aa)
Score = 111, Expect = 5.0e-04, Identities = 40/160 (25%), Positives = 74/160 (46%)
  Q:    11 FQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANI--KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKD 170
           F+++E +  +   + +     I   +P+  E+V G  D++ +  K  +N +  D ++L++PGG  GA  L + +     +  F + +K + AIC AP  L    L+K  +     S     D       N  V R   +ITG  P   ++ A   ++ + GK+
  S:    12 FEEIEALTTIDTLRRAGLDVEIVSVTPD--EIVVGAHDVSVLCDKNFENCDFFDAELLFLPGGMPGAATLDKHEGLRKLILSFAEKNKPIAAICAAPMVLGKLGLLKGRRVTCYPSFEQYLDGADCT--NEPVVRDGNIITGMGPGAAMEFALTIVDTLLGKE 170
>gi|75761741|ref|ZP_00741681.1| PROTEASE I [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|168141344|ref|ZP_02584573.1| protease I, ThiJ/PfpI family protein [Bacillus cereus G9842] >gi|74490772|gb|EAO54048.1| PROTEASE I [Bacillus thuringiensis serovar israelensis ATCC 35646] (171 aa)
Score = 111, Expect = 5.1e-04, Identities = 41/151 (27%), Positives = 69/151 (45%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANI---KTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTH--VYRSNKLITGRCP 152
           K+  L    F+D E    +  FK  QK   +     E  + V G+ + + +   K I   +  ++D L+IPGG+   +LR  ++ +   K F+D  K V AIC  P  L     + E +    + S ++       +F+    V   N+L+T R P
  S:     4 KIAILITDYFEDTEYTEPVEAFK--QKGYELTTIEMEKGKTVHGKQEKSEVVIDKNIDGVSPENFDALFIPGGFSPDILRADERFVRFSKAFMDAKKPVFAICHGPQLLITAQTL-EGRDVTGYKSIEVDLKNAGGNFHDTEVVVCQNQLVTSRQP 156
>gi|85859675|ref|YP_461877.1| protease I [Syntrophus aciditrophicus SB] >gi|85722766|gb|ABC77709.1| protease I [Syntrophus aciditrophicus SB] (189 aa)
Score = 111, Expect = 5.1e-04, Identities = 31/114 (27%), Positives = 57/114 (50%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPEN--LEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           MK L L+  KF+D E+  L   ++  +    +   S     ++ + G +++   KT+   + +DY +L +PGG    LLR+ +K +   + F   +K + AIC  P  L    L++
  S:    23 MKALILSADKFEDSEL--LFPYYRLKEVGVEVVVASLRRGAIKGIHG-YEVVADKTLDEVDPSDYAILVLPGGKAPALLRKEQKALEIARYFSARNKPIAAICHGPQILISAGLLE 135
>gi|171315741|ref|ZP_02904974.1| intracellular protease, PfpI family [Burkholderia ambifaria MEX-5] >gi|171099153|gb|EDT43929.1| intracellular protease, PfpI family [Burkholderia ambifaria MEX-5] (193 aa)
Score = 111, Expect = 5.2e-04, Identities = 22/70 (31%), Positives = 34/70 (48%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS 123
           T    + + YD L +PGG     LR     +A V+ F D +K V ++C  P  LA  +++K  Q    W+
  S:    72 TFNKIDASQYDALVVPGGRSPEYLRLDANVVAMVRHFFDENKPVASVCHGPQLLAGADVLKGRQCAAYWA 141
>gi|82778467|ref|YP_404816.1| hypothetical protein SDY_3332 [Shigella dysenteriae Sd197] >gi|81242615|gb|ABB63325.1| conserved hypothetical protein [Shigella dysenteriae Sd197] (186 aa)
Score = 111, Expect = 5.3e-04, Identities = 28/113 (24%), Positives = 55/113 (48%)
  Q:     2 KLLALTMSKFQDLEMVALLSIF-KASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L   +F+D E  +    F KA  +   I+  + + ++   G+  +   K+I      ++D L +PGG+    LR   + +   ++F+++ K V AIC  P  L   ++I+
  S:    18 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGDNRFVTFTRDFVNSGKPVFAICHGPQLLISADVIR 131
>gi|15803695|ref|NP_289729.1| hypothetical protein Z4512 [Escherichia coli O157:H7 EDL933] >gi|15833288|ref|NP_312061.1| hypothetical protein ECs4034 [Escherichia coli O157:H7 str. Sakai] >gi|12517761|gb|AAG58289.1|AE005544_3 orf, hypothetical protein [Escherichia coli O157:H7 EDL933] >gi|606093|gb|AAA57956.1| ORF_o186 [Escherichia coli] >gi|13363507|dbj|BAB37457.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] (186 aa)
Score = 111, Expect = 5.3e-04, Identities = 28/113 (24%), Positives = 55/113 (48%)
  Q:     2 KLLALTMSKFQDLEMVALLSIF-KASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L   +F+D E  +    F KA  +   I+  + + ++   G+  +   K+I      ++D L +PGG+    LR   + +   ++F+++ K V AIC  P  L   ++I+
  S:    18 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGDNRFVTFTRDFVNSGKPVFAICHGPQLLISADVIR 131
>gi|47564792|ref|ZP_00235836.1| protease PfpI [Bacillus cereus G9241] >gi|47558165|gb|EAL16489.1| protease PfpI [Bacillus cereus G9241] (171 aa)
Score = 111, Expect = 5.4e-04, Identities = 29/106 (27%), Positives = 49/106 (46%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKAS-QKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           K+  L    F+D E       FK    +   I+    + +    G+ ++   K I + +  ++D L+IPGG+   +LR  ++ +   K F+D  K V AIC  P  L
  S:     4 KIATLITDYFEDTEYTEPAEAFKQKGYELTTIETEKGKTVHGKQGKSEVVIDKGIDDVSPENFDALFIPGGFSPDILRADERFVRFSKAFMDTKKPVFAICHGPQLL 110
>gi|24114444|ref|NP_708954.1| hypothetical protein SF3194 [Shigella flexneri 2a str. 301] >gi|30064493|ref|NP_838664.1| hypothetical protein S3411 [Shigella flexneri 2a str. 2457T] >gi|24053623|gb|AAN44661.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] >gi|30042752|gb|AAP18475.1| hypothetical protein S3411 [Shigella flexneri 2a str. 2457T] (186 aa)
Score = 110, Expect = 5.6e-04, Identities = 28/113 (24%), Positives = 55/113 (48%)
  Q:     2 KLLALTMSKFQDLEMVALLSIF-KASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L   +F+D E  +    F KA  +   I+  + + ++   G+  +   K+I      ++D L +PGG+    LR   + +   ++F+++ K V AIC  P  L   ++I+
  S:    18 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGDNRFVTFTRDFVNSGKPVFAICHGPQLLISADVIR 131
>gi|182413651|ref|YP_001818717.1| ThiJ/PfpI domain-containing protein [Opitutus terrae PB90-1] >gi|177840865|gb|ACB75117.1| ThiJ/PfpI domain protein [Opitutus terrae PB90-1] (178 aa)
Score = 110, Expect = 5.6e-04, Identities = 40/151 (26%), Positives = 77/151 (50%)
  Q:     2 KLLALTMS--KFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTI--KNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           K++AL ++  +F+D E +   ++F+  Q   R    S   LE VTG        T+  K+   +++D +   GG GA  L    + +   ++ + ++K V AIC APN LA   ++K +++  +W+  ++  ++ +      V R  ++IT   P
  S:     8 KIIALVIAPGEFRDEEYIEPKTLFE--QHGARTVTIS-TTLEPVTGMLGATVQATLLLKDAQADNFDAVVFVGGMGARRLYHEPEALRLARQAVAHNKVVGAICLAPNILAQAGVLK-NRRATAWAF-EVPAAEAVNQVGESVVRDGRIITANGP 157
>gi|126730860|ref|ZP_01746669.1| Peptidase C56, PfpI [Sagittula stellata E-37] >gi|126708576|gb|EBA07633.1| Peptidase C56, PfpI [Sagittula stellata E-37] (186 aa)
Score = 110, Expect = 5.6e-04, Identities = 34/103 (33%), Positives = 52/103 (50%)
  Q:    50 ANIKTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           A++K I++ N +DYD L IPGG     LLR  +  +A V+ F D  K V A+C AP  L +  ++   +     S     ++   K  +T V   N ++T R P
  S:    60 ADLK-IEDANPHDYDALVIPGGQINPDLLRVEEPVLALVRTFHDQGKVVAAVCHAPWVLIEAGIVAGRRMTCYTSIRTDLENAGAKVMDTSVVADNGIVTSRQP 162
>gi|126180070|ref|YP_001048035.1| PfpI family intracellular peptidase [Methanoculleus marisnigri JR1] >gi|125862864|gb|ABN58053.1| intracellular protease, PfpI family [Methanoculleus marisnigri JR1] (184 aa)
Score = 110, Expect = 5.6e-04, Identities = 28/123 (22%), Positives = 57/123 (46%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           ++  L    F+D+E     + F+ A      +   + E +     +  +   +   + + +D+D L+IPGGY    LR     +  V+ F+++ K V++IC AP  +    +++  +K   W S
  S:     3 RIAVLITDMFEDVEYTKPAASFREAGHDLIHVGLSAGETVHGKADRTPVTIDRAASDVSPDDFDGLFIPGGYSPDKLRAHDAPVEFVRRFVESGKPVLSICHAPQLMITAQVLR-GRKVAGWKS 125
>gi|168334168|ref|ZP_02692375.1| putative thiamine biosynthesis related protein [Epulopiscium sp. 'N.t. morphotype B'] (177 aa)
Score = 110, Expect = 5.7e-04, Identities = 37/127 (29%), Positives = 63/127 (49%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFI-DNDKWVIAICDAPNALADHNLIKEDQ----KYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           T+++ N +D+D++ +PGG GA      +K    +  F+ +N+K+V AIC APN L    L+          I  +  DI   K + D N        LITG  P  +++  +  L  +  ++    LK K++
  S:    53 TVESVNFDDFDMIVMPGGAGAENYLPCEKLKNAIAAFLGNNNKFVGAICAAPNILGRWGLLNHRSVTVYPTIEVAGADIRRQKVVVDGN--------LITGAGPGASMEFGYALLSKMADEETVKILKEKMI 176
>gi|126736099|ref|ZP_01751842.1| Peptidase C56, PfpI [Roseobacter sp. CCS2] >gi|126714265|gb|EBA11133.1| Peptidase C56, PfpI [Roseobacter sp. CCS2] (186 aa)
Score = 110, Expect = 5.7e-04, Identities = 49/151 (32%), Positives = 80/151 (52%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTG--------QFDIANIKTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKR--IKDFNTHVYRSNKLITGRCP 152
           K+L ++ + F+  E++  L   K+  K   +   +P+  E +TG          D A++K I + NV+DY  L +PGG     +LR  +  +  V++F+  +K V AIC AP  L +   + E ++  S+ S   TD K    K  +  V  SN +IT R P
  S:     8 KILIMSTNGFEQSELMEPLQQLKS--KGATVHVATPDG-EKITGWDQNNWGDSVD-ADLK-IADVNVDDYIALVLPGGQINPDILRADETAVETVRKFVTGNKIVAAICHAPWLLIEAG-VAEGREMTSYGSIR-TDLKNAGAKVVDQDVAISNGIITSRSP 162
>gi|163938757|ref|YP_001643641.1| PfpI family intracellular peptidase [Bacillus weihenstephanensis KBAB4] >gi|163860954|gb|ABY42013.1| intracellular protease, PfpI family [Bacillus weihenstephanensis KBAB4] (171 aa)
Score = 110, Expect = 6.2e-04, Identities = 28/106 (26%), Positives = 51/106 (48%)
  Q:     2 KLLALTMSKFQDLEMVALLSIF-KASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           K+  L    F+D E    +  F +   +   I+    + +    G+ ++   K+I + +  ++D L+IPGG+   +LR  ++ +   K F+D  K V AIC  P  L
  S:     4 KIAILITDYFEDTEYTEPVEAFNQKGYELTTIEMEKGKTVHGKQGKSEVVIDKSIDDVSPENFDALFIPGGFSPDILRADERFVRFSKAFMDVKKPVFAICHGPQLL 110
>gi|126665321|ref|ZP_01736303.1| DJ-1/PfpI family protein [Marinobacter sp. ELB17] >gi|126629949|gb|EBA00565.1| DJ-1/PfpI family protein [Marinobacter sp. ELB17] (227 aa)
Score = 110, Expect = 6.3e-04, Identities = 21/65 (32%), Positives = 37/65 (56%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALAD 109
           G+  +A+ + + + ++NDYD ++ PGG+G    L   K  IA +K   + DK + A+C AP    +
  S:    76 GKESLASTRKLADVDMNDYDAIFYPGGHGPLWDLANDKHSIALIKRAYEQDKVISAVCHAPGVFKN 141
>gi|85373271|ref|YP_457333.1| protease [Erythrobacter litoralis HTCC2594] >gi|84786354|gb|ABC62536.1| protease [Erythrobacter litoralis HTCC2594] (179 aa)
Score = 110, Expect = 6.4e-04, Identities = 34/99 (34%), Positives = 52/99 (52%)
  Q:    54 TIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS---------GDITDSKRIKDFNTHVYRSNKLITGRCP 152
           T++  + +DY  L +PGG      LR +   I  ++EF + +K + AIC AP  LA+ N+I+ D+    W S          ++ DS+   D N        LIT R P
  S:    58 TVEEVSADDYGALLLPGGQINPDALRMNDTVIGLIREFNEANKPIAAICHAPWLLAEANIIR-DRTVTGWPSIRTDLSNAGANVIDSEAAVDGN--------LITARNP 157
>gi|196124882|ref|ZP_03116631.1| putative protease [Clostridium difficile ATCC 43255] (194 aa)
Score = 110, Expect = 6.7e-04, Identities = 45/179 (25%), Positives = 86/179 (48%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQK--FERIDFYSPENLEMVTGQFDIANI--KTIKNFNVNDYDVLYIPGG---YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRS-----NKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKL 179
           MK+L      F+ +E    + I   ++      ID  +    + V   F+I  +  KTI+   V+DYD L IPGG   +G          +  ++EF   +K + +IC A   +    ++K ++K  ++   +    +++ +F+ +V          +IT  CP     +AF  LE++  K+  D +K+ +
  S:     1 MKVLVFLAKGFETMEFSVFVDIMGWARNDYGHDIDVVTCGFKKQVMSTFNIQVLVDKTIEEVCVDDYDALAIPGGFEEFGFYDEAYDSSFLNLIREFNSKEKIIASICVAALPVGKSGVLK-NRKATTYHLKNGKRQRQLSEFDVNVVNEPIVVDKNIITSYCPETAPHVAFKLLEMLTSKEQMDEVKLAM 190
>gi|82545607|ref|YP_409554.1| hypothetical protein SBO_3229 [Shigella boydii Sb227] >gi|81247018|gb|ABB67726.1| conserved hypothetical protein [Shigella boydii Sb227] (186 aa)
Score = 110, Expect = 6.7e-04, Identities = 28/113 (24%), Positives = 55/113 (48%)
  Q:     2 KLLALTMSKFQDLEMVALLSIF-KASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L   +F+D E  +    F KA  +   I+  + + ++   G+  +   K+I      ++D L +PGG+    LR   + +   ++F+++ K V AIC  P  L   ++I+
  S:    18 KIAVLISDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGDNRFVTFTRDFVNSGKPVFAICHGPQLLISADVIR 131
>gi|150024857|ref|YP_001295683.1| ThiJ/PfpI family protein [Flavobacterium psychrophilum JIP02/86] >gi|149771398|emb|CAL42867.1| ThiJ/PfpI family protein [Flavobacterium psychrophilum JIP02/86] (228 aa)
Score = 110, Expect = 6.8e-04, Identities = 24/61 (39%), Positives = 34/61 (55%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALAD 109
           + N K + N N  DYD ++ PGG+G    L + KK IA ++ F  N K V  +C AP  L +
  S:    81 LKNTKKLANVNQADYDAVFYPGGHGPLWDLVEDKKSIALIESFYTNKKPVAFVCHAPAVLKN 142
>gi|59711324|ref|YP_204100.1| hypothetical protein VF_0717 [Vibrio fischeri ES114] >gi|59479425|gb|AAW85212.1| conserved protein [Vibrio fischeri ES114] (196 aa)
Score = 110, Expect = 6.8e-04, Identities = 37/119 (31%), Positives = 59/119 (49%)
  Q:    62 DYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQK---YISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           ++D + +PGG  G+   R S   I  +K+   ++KWV AIC AP  +  H+ +  D     Y S+       ++RIK   T V   N LIT + P   L+ A   +  + GK+ +  L   L+
  S:    66 EFDCIVLPGGLKGSENFRDSTLLIEMLKQQKYDEKWVAAICAAPAIVLQHHNLYPDALMTCYPSFMEAIPEKNRRIKRVFTDVL--NHLITSQGPGSALEFAMEIVTTLAGKELTAKLAADLV 186
>gi|89210012|ref|ZP_01188405.1| DJ-1 [Halothermothrix orenii H 168] >gi|89160352|gb|EAR80007.1| DJ-1 [Halothermothrix orenii H 168] (181 aa)
Score = 110, Expect = 6.8e-04, Identities = 48/180 (26%), Positives = 84/180 (46%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANI--KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNK------LITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           MK+L      F+++E +  + + + +   E I     E+ E V G  D+      T+   +V++ D + +PGG  G+  L+   + I  +K        + AIC AP  L    +IKE ++  S+   D       K+  T  Y+ N+      +ITGR P V ++ A   +  +  +D    L  K+M
  S:     1 MKILIPLAEGFEEIEAITSIDVLRRA-GIEVITSSLTESTE-VMGSHDVKVTADTTLDKVSVDNLDGILLPGGMPGSANLKDDIRIIKLIKRLNKKSGLIAAICAAPIVLEKAGVIKE-KRATSYPGFD-------KEMKTCNYQENRVVVDGNIITGRGPGVAMEFALTVVNYLTSEDMVKELSEKMM 179
>gi|57641219|ref|YP_183697.1| intracellular protease I [Thermococcus kodakarensis KOD1] >gi|74504631|sp|Q5JGM7|PFPI_PYRKO Intracellular protease 1 (Intracellular protease I) >gi|57159543|dbj|BAD85473.1| intracellular protease I [Thermococcus kodakarensis KOD1] (166 aa)
Score = 110, Expect = 6.9e-04, Identities = 32/114 (28%), Positives = 53/114 (46%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVN-----------DYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           MK+L L+   F+DLE++  L   K             E  E+    F    I     + VN           ++D L +PGG    ++R ++K +A  K+  ++ K V +IC  P  L    ++K
  S:     1 MKVLILSADGFEDLELIYPLHRIKE------------EGHEVYVASFQRGKITGKHGYTVNVDLAFDEVDPDEFDALVLPGGRAPEIVRLNEKAVAITKKMFEDGKPVASICHGPQILISAGVLK 113
>gi|20091359|ref|NP_617434.1| intracellular protease I [Methanosarcina acetivorans C2A] >gi|19916492|gb|AAM05914.1| intracellular protease I [Methanosarcina acetivorans C2A] (166 aa)
Score = 110, Expect = 7.1e-04, Identities = 25/72 (34%), Positives = 38/72 (52%)
  Q:    43 VTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           +TG+  ++I      K+ N  DYD++ I GG G   +R  K  +  VK F   +K V +IC  P  L   ++IK
  S:    40 ITGKHGYEITADIAFKDVNSADYDIIVISGGKGPEKMRLDKDALEIVKNFFKKNKPVASICHGPQVLVSADVIK 113
>gi|194246632|ref|YP_002004271.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Candidatus Phytoplasma mali] >gi|193806989|emb|CAP18424.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Candidatus Phytoplasma mali] (170 aa)
Score = 109, Expect = 7.3e-04, Identities = 45/160 (28%), Positives = 84/160 (52%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTG-QFDIANIKTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFID----NDKWVIAICDAPNALADHNLIKEDQKYISWSSGDI-TDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAF 160
           MK L +  + F+D E +   +I K +  F+     + +NL + +  + ++     ++N N +DY+ L IPGG Y  +++ ++   +  + + I+    N+K + AIC AP  L    L+K+  K+  +   +I  + +   + +T V  S+ LIT R P    D AF
  S:     1 MKGLLILYNGFEDCEALVTRAILKKND-FDITTVTNNKNLNVFSATRLNLKADCYLENINYDDYNFLIIPGGPYVKSVINKNDYALTKILDIINYFNKNNKIIGAICAAPIFLGKLGLLKK-HKFSCYPGCEILIEGEYCPNISTVV--SDNLITSRSPETVFDFAF 163
>gi|167755272|ref|ZP_02427399.1| hypothetical protein CLORAM_00777 [Clostridium ramosum DSM 1402] >gi|167705322|gb|EDS19901.1| hypothetical protein CLORAM_00777 [Clostridium ramosum DSM 1402] (186 aa)
Score = 109, Expect = 7.4e-04, Identities = 38/130 (29%), Positives = 64/130 (49%)
  Q:    43 VTGQFDI-ANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFN---THVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFS 172
           V G  DI     ++ N  V DYD++ +PGGY GA  LR + + I  +      +K++ AIC AP  L    L+K  + Y ++    +   ++IK  N     V    K++T R P      A+  ++++ G   +
  S:    40 VAGAHDIIVKCDSVLNDEVIDYDMIILPGGYPGAANLRDNTRLIEILNIMAQKNKYICAICAAPIVLEKAGLLK-GKNYTAY----VGYEQKIKQGNYLHDKVVIDGKIVTSRGPATVYAFAYKLVDLLGGNSLA 169
>gi|148544735|ref|YP_001272105.1| DJ-1 family protein [Lactobacillus reuteri F275] >gi|184154087|ref|YP_001842428.1| putative 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Lactobacillus reuteri F275] >gi|148531769|gb|ABQ83768.1| DJ-1 family protein [Lactobacillus reuteri F275] >gi|183225431|dbj|BAG25948.1| putative 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Lactobacillus reuteri F275] (190 aa)
Score = 109, Expect = 7.4e-04, Identities = 34/105 (32%), Positives = 55/105 (52%)
  Q:    62 DYDVLYIPGGYG-ATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKY-----ISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           DYDV+  PGG G A  LR + + +  +++    +KW  A+C AP ALA + L+ ++  Y     I+     +  +   ++  T V    K+IT R P   L  A+   EV+
  S:    61 DYDVVAFPGGRGGAQKLRDNDRLMKLMQKRNAENKWDAAMCAAPIALARYGLL-DNHNYTCFPGINEEIAKVAPTANFEEDITVVDNDGKIITSRGPATALAFAYQIAEVL 170
>gi|21229186|ref|NP_635108.1| protease I [Methanosarcina mazei Go1] >gi|20907753|gb|AAM32780.1| Protease I [Methanosarcina mazei Go1] (144 aa)
Score = 109, Expect = 7.5e-04, Identities = 26/69 (37%), Positives = 34/69 (49%)
  Q:    46 QFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           + DIA     K+ N  DYD+L I GG G   +R  K  +   K F + +K V AIC  P  L    +IK
  S:    27 EVDIA----FKDVNPEDYDILVISGGKGPEKMRLDKDALEITKHFFEKNKPVAAICHGPQVLVSAGVIK 91
>gi|111115451|ref|YP_710069.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Borrelia afzelii PKo] >gi|167942340|ref|ZP_02529414.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Borrelia afzelii ACA-1] >gi|110890725|gb|ABH01893.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Borrelia afzelii PKo] (184 aa)
Score = 109, Expect = 7.6e-04, Identities = 40/166 (24%), Positives = 77/166 (46%)
  Q:    11 FQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLK 176
           F+D+E +  + I +      ++   +  N+   +          I N N N +D++ +PGG  GAT L  SK+    +K+     K++ AIC +P  +     +    K+  +     ++ D + +   + +V RSN  IT +    + + AF  LE++ GK   + +K
  S:    11 FEDIEAIVPIDILRRGNVNIQVISINDNNVVTSSKGVSFLTDDIISNCNENRFDLIILPGGMPGATNLFNSKELDLILKDMNAKGKFIAAICASPVVVLAAKGLLGFNKFTCYPGMEENVVDGEFV---DKNVVRSNNFITSKGVGTSFEFAFTLLEIVKGKQIMENVK 176
>gi|148652901|ref|YP_001279994.1| ThiJ/PfpI domain-containing protein [Psychrobacter sp. PRwf-1] >gi|148571985|gb|ABQ94044.1| ThiJ/PfpI domain protein [Psychrobacter sp. PRwf-1] (225 aa)
Score = 109, Expect = 8.0e-04, Identities = 38/115 (33%), Positives = 62/115 (53%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL----ADHNLIKEDQKYISWSSGD-----ITDS----------------KRIKDFNTHVYRSNKLITGRCPVVTLDLA 159
            Q  +A    + + N  DYD ++ PGG+G    L      IA ++EF+  DK V  +C AP AL     D   + +D+K   +S+ +     +TD                 ++  D+ ++V     LITG+ P  + D A
  S:    76 AQAYLATTHKLADINAADYDAVFYPGGHGPMWDLAVDLTSIALIEEFVKLDKPVAFVCHAPAALKNVKVDGEYLVKDKKVTGFSNTEEAAVGLTDVVPFLLEDALQANGAHYQKGADWQSYVVEDGLLITGQNPASSEDAA 216
>gi|168786036|ref|ZP_02811043.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC869] >gi|189374094|gb|EDU92510.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC869] (172 aa)
Score = 109, Expect = 8.4e-04, Identities = 28/113 (24%), Positives = 55/113 (48%)
  Q:     2 KLLALTMSKFQDLEMVALLSIF-KASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L   +F+D E  +    F KA  +   I+  + + ++   G+  +   K+I      ++D L +PGG+    LR   + +   ++F+++ K V AIC  P  L   ++I+
  S:     4 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGDNRFVTFTRDFVNSGKPVFAICHGPQLLISADVIR 117
>gi|110807022|ref|YP_690542.1| hypothetical protein SFV_3183 [Shigella flexneri 5 str. 8401] >gi|110616570|gb|ABF05237.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] (172 aa)
Score = 109, Expect = 8.4e-04, Identities = 28/113 (24%), Positives = 55/113 (48%)
  Q:     2 KLLALTMSKFQDLEMVALLSIF-KASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L   +F+D E  +    F KA  +   I+  + + ++   G+  +   K+I      ++D L +PGG+    LR   + +   ++F+++ K V AIC  P  L   ++I+
  S:     4 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGDNRFVTFTRDFVNSGKPVFAICHGPQLLISADVIR 117
>gi|89109918|ref|AP_003698.1| predicted intracellular protease [Escherichia coli W3110] >gi|90111548|ref|NP_417622.2| predicted intracellular protease [Escherichia coli str. K-12 substr. MG1655] >gi|110643394|ref|YP_671124.1| hypothetical protein ECP_3241 [Escherichia coli 536] >gi|157155250|ref|YP_001464627.1| PfpI family intracellular peptidase [Escherichia coli E24377A] >gi|157162638|ref|YP_001459956.1| PfpI family intracellular peptidase [Escherichia coli HS] >gi|168708727|ref|ZP_02741004.1| hypothetical protein EschericoliO157_13849 [Escherichia coli O157:H7 str. EC4045] >gi|168718123|ref|ZP_02750400.1| hypothetical protein EschericcoliO157_10272 [Escherichia coli O157:H7 str. EC4206] >gi|168734687|ref|ZP_02766964.1| hypothetical protein EschecoliO157_06520 [Escherichia coli O157:H7 str. EC4115] >gi|168749253|ref|ZP_02774275.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4113] >gi|168754132|ref|ZP_02779139.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4401] >gi|168762117|ref|ZP_02787124.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4501] >gi|168769569|ref|ZP_02794576.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4486] >gi|168773182|ref|ZP_02798189.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4196] >gi|168781295|ref|ZP_02806302.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4076] >gi|168791527|ref|ZP_02816534.1| hypothetical protein EschercoliO157_03580 [Escherichia coli O157:H7 str. EC4042] >gi|168797752|ref|ZP_02822759.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC508] >gi|170018595|ref|YP_001723549.1| PfpI family intracellular peptidase [Escherichia coli ATCC 8739] >gi|170082690|ref|YP_001732010.1| intracellular protease [Escherichia coli str. K12 substr. DH10B] >gi|188495363|ref|ZP_03002633.1| intracellular peptidase, PfpI family [Escherichia coli 53638] >gi|191168042|ref|ZP_03029842.1| intracellular peptidase, PfpI family [Escherichia coli B7A] >gi|191172173|ref|ZP_03033716.1| intracellular peptidase, PfpI family [Escherichia coli F11] >gi|193062094|ref|ZP_03043190.1| intracellular peptidase, PfpI family [Escherichia coli E22] >gi|193067397|ref|ZP_03048365.1| intracellular peptidase, PfpI family [Escherichia coli E110019] >gi|194427724|ref|ZP_03060271.1| intracellular peptidase, PfpI family [Escherichia coli B171] >gi|194433787|ref|ZP_03066062.1| intracellular peptidase, PfpI family [Shigella dysenteriae 1012] >gi|194438809|ref|ZP_03070895.1| intracellular peptidase, PfpI family [Escherichia coli 101-1] >gi|195938373|ref|ZP_03083755.1| intracellular protease [Escherichia coli O157:H7 str. EC4024] >gi|6686354|sp|P45470|YHBO_ECOLI Protein yhbO >gi|85675949|dbj|BAE77199.1| predicted intracellular protease [Escherichia coli W3110] >gi|87082219|gb|AAC76187.2| predicted intracellular protease [Escherichia coli str. K-12 substr. MG1655] >gi|110344986|gb|ABG71223.1| hypothetical protein YhbO (hypothetical protease) [Escherichia coli 536] >gi|157068318|gb|ABV07573.1| intracellular peptidase, PfpI family [Escherichia coli HS] >gi|157077280|gb|ABV16988.1| intracellular peptidase, PfpI family [Escherichia coli E24377A] >gi|169753523|gb|ACA76222.1| intracellular protease, PfpI family [Escherichia coli ATCC 8739] >gi|169890525|gb|ACB04232.1| predicted intracellular protease [Escherichia coli str. K12 substr. DH10B] >gi|187770819|gb|EDU34663.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4196] >gi|188016331|gb|EDU54453.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4113] >gi|188490562|gb|EDU65665.1| intracellular peptidase, PfpI family [Escherichia coli 53638] >gi|189001020|gb|EDU70006.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4076] >gi|189358500|gb|EDU76919.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4401] >gi|189361449|gb|EDU79868.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4486] >gi|189367569|gb|EDU85985.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4501] >gi|189379723|gb|EDU98139.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC508] >gi|190901911|gb|EDV61660.1| intracellular peptidase, PfpI family [Escherichia coli B7A] >gi|190907483|gb|EDV67079.1| intracellular peptidase, PfpI family [Escherichia coli F11] >gi|192932314|gb|EDV84912.1| intracellular peptidase, PfpI family [Escherichia coli E22] >gi|192959354|gb|EDV89789.1| intracellular peptidase, PfpI family [Escherichia coli E110019] >gi|194414232|gb|EDX30507.1| intracellular peptidase, PfpI family [Escherichia coli B171] >gi|194418050|gb|EDX34144.1| intracellular peptidase, PfpI family [Shigella dysenteriae 1012] >gi|194422281|gb|EDX38282.1| intracellular peptidase, PfpI family [Escherichia coli 101-1] (172 aa)
Score = 109, Expect = 8.4e-04, Identities = 28/113 (24%), Positives = 55/113 (48%)
  Q:     2 KLLALTMSKFQDLEMVALLSIF-KASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L   +F+D E  +    F KA  +   I+  + + ++   G+  +   K+I      ++D L +PGG+    LR   + +   ++F+++ K V AIC  P  L   ++I+
  S:     4 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGDNRFVTFTRDFVNSGKPVFAICHGPQLLISADVIR 117
>gi|157754002|ref|XP_001680713.1| Hypothetical protein CBG07016 [Caenorhabditis briggsae AF16] >gi|187033693|emb|CAP27328.1| C. briggsae CBR-DJR-1.1 protein [Caenorhabditis briggsae] (187 aa)
Score = 109, Expect = 8.6e-04, Identities = 36/114 (31%), Positives = 60/114 (52%)
  Q:    62 DYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTH----VYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGL 175
           +YD++ +PGG  G+  L ++ K    +K+  D  KW+ AIC AP AL  H +  E    +  S   + D + +K   T+    V  S K+IT R P    + A   +E++ G + ++ L
  S:    66 EYDIVILPGGQPGSNTLAETPKVGDLLKKQADAGKWIGAICAAPIALLSHGIKTE----VLTSHPSVKD-QLVKGGYTYSEDRVVVSGKVITSRGPGTAFEFALKIVELLEGTEKANSL 179
>gi|119946956|ref|YP_944636.1| ThiJ/PfpI domain-containing protein [Psychromonas ingrahamii 37] >gi|119865560|gb|ABM05037.1| ThiJ/PfpI domain protein [Psychromonas ingrahamii 37] (231 aa)
Score = 109, Expect = 8.8e-04, Identities = 22/63 (34%), Positives = 36/63 (57%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           GQ  + N K + + N  DYD ++ PGG+G    L ++   I+ ++ F+  +K V A+C A  AL
  S:    79 GQLQLKNTKVLADINAADYDTVFYPGGHGPLWDLTENADSISLIESFLTANKPVAAVCHATAAL 142
>gi|33357755|pdb|1OI4|A Chain A, Crystal Structure Of Yhbo From Escherichia Coli >gi|33357756|pdb|1OI4|B Chain B, Crystal Structure Of Yhbo From Escherichia Coli (193 aa)
Score = 109, Expect = 8.8e-04, Identities = 28/113 (24%), Positives = 55/113 (48%)
  Q:     2 KLLALTMSKFQDLEMVALLSIF-KASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L   +F+D E  +    F KA  +   I+  + + ++   G+  +   K+I      ++D L +PGG+    LR   + +   ++F+++ K V AIC  P  L   ++I+
  S:    25 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGDNRFVTFTRDFVNSGKPVFAICHGPQLLISADVIR 138
>gi|159186167|ref|NP_356213.2| hypothetical protein Atu4442 [Agrobacterium tumefaciens str. C58] >gi|159141301|gb|AAK88998.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58] (182 aa)
Score = 109, Expect = 8.9e-04, Identities = 24/61 (39%), Positives = 31/61 (50%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           T  +  V DYD L IPGG     LR +   +A VK F + DK V A+C     LA   ++K
  S:    65 TFADIKVADYDALVIPGGRAPEYLRLNADVLAAVKHFFEADKPVAAVCHGAQLLAAAGVLK 125
>gi|167368166|ref|ZP_02302306.1| intracellular protease, PfpI family [Rhodopseudomonas palustris TIE-1] >gi|192289899|ref|YP_001990504.1| intracellular protease, PfpI family [Rhodopseudomonas palustris TIE-1] >gi|192283648|gb|ACF00029.1| intracellular protease, PfpI family [Rhodopseudomonas palustris TIE-1] (187 aa)
Score = 109, Expect = 9.1e-04, Identities = 44/136 (32%), Positives = 73/136 (53%)
  Q:    31 RIDFYSPENLEMV--TGQFDIANI----KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           ++D  SPE  E+   +G+ D  ++    K +     +DYD + +PGG     LLR ++  +  +K F D  K V A+C AP  L D  + K  +K  S++S   D+ ++   K  ++ V   N +IT R P    DL  +S ++I
  S:    36 QVDIVSPEQGEIRGWSGK-DWGHLVKVDKQLSAVKADDYDAIVLPGGQINPDLLRVNQDALKLIKSFFDAGKTVAAVCHAPWLLIDTGIAK-GRKMTSYNSIKQDVINAG-AKWEDSAVVTDNGVITSRNPG---DLEAFSAKII 174
>gi|157347768|emb|CAO22224.1| unnamed protein product [Vitis vinifera] (386 aa)
Score = 108, Expect = 9.4e-04, Identities = 25/67 (37%), Positives = 35/67 (52%)
  Q:    48 DIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           D     T ++ N+  YD L IPGG     L  ++K IA VKEF++  K V +IC     LA   ++K
  S:   258 DFTLTATFEDLNIPSYDALVIPGGRAPEYLALNEKVIALVKEFMEAGKPVASICHGQQILAAAGVLK 324
>gi|168716228|ref|ZP_02748505.1| putative protease [Clostridium difficile QCD-63q42] (194 aa)
Score = 108, Expect = 9.6e-04, Identities = 44/179 (24%), Positives = 86/179 (48%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQK--FERIDFYSPENLEMVTGQFDIANI--KTIKNFNVNDYDVLYIPGG---YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRS-----NKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKL 179
           MK+L      F+ +E    + +   ++      ID  +    + V   F+I  +  KTI+   V+DYD L IPGG   +G          +  ++EF   +K + +IC A   +    ++K ++K  ++   +    +++ +F+ +V          +IT  CP     +AF  LE++  K+  D +K+ +
  S:     1 MKVLVFLAKGFETMEFSVFVDVMGWARNDYGHDIDVVTCGFKKQVMSTFNIQVLVDKTIEEVCVDDYDALAIPGGFEEFGFYDEAYDSSFLNLIREFNSKEKIIASICVAALPVGKSGVLK-NRKATTYHLKNGKRQRQLSEFDVNVVNEPIVVDKNIITSYCPETAPHVAFKLLEMLTSKEQMDEVKLAM 190
>gi|152992160|ref|YP_001357881.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein [Sulfurovum sp. NBC37-1] >gi|151424021|dbj|BAF71524.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein [Sulfurovum sp. NBC37-1] (186 aa)
Score = 108, Expect = 9.7e-04, Identities = 37/127 (29%), Positives = 68/127 (53%)
  Q:    11 FQDLEMVALLSIFKASQKFERIDFYSPE---NLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS--------GDITDSKRIKDFN 137
           F++LE VAL+ + +      R+ +   E   +L +      +    +IKN   +D+D++ +PGG+G T  L ++ +    ++EF    K V A+C AP AL    ++ E  +Y ++          G + D K ++D N
  S:    12 FEELEAVALIDVMRRGGIEVRVAYLEDEMQSDLVLGANGITVKADTSIKNVISDDFDMMVLPGGWGGTYALAENTRVQELLREF-KAKKIVGAMCAAPFALKQAGVLGE--RYTAYPGAVEEIDHPGYVADEKVVEDGN 147
>gi|74313690|ref|YP_312109.1| hypothetical protein SSON_3299 [Shigella sonnei Ss046] >gi|187730021|ref|YP_001881930.1| intracellular peptidase, PfpI family [Shigella boydii CDC 3083-94] >gi|73857167|gb|AAZ89874.1| conserved hypothetical protein [Shigella sonnei Ss046] >gi|187427013|gb|ACD06287.1| intracellular peptidase, PfpI family [Shigella boydii CDC 3083-94] (172 aa)
Score = 108, Expect = 1.0e-03, Identities = 28/113 (24%), Positives = 55/113 (48%)
  Q:     2 KLLALTMSKFQDLEMVALLSIF-KASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L   +F+D E  +    F KA  +   I+  + + ++   G+  +   K+I      ++D L +PGG+    LR   + +   ++F+++ K V AIC  P  L   ++I+
  S:     4 KIAVLISDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGDNRFVTFTRDFVNSGKPVFAICHGPQLLISADVIR 117
>gi|170033746|ref|XP_001844737.1| dj-1 protein [Culex quinquefasciatus] >gi|167874814|gb|EDS38197.1| dj-1 protein [Culex quinquefasciatus] (138 aa)
Score = 108, Expect = 1.1e-03, Identities = 38/120 (31%), Positives = 55/120 (45%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGAT-LLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLI--KEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFG 168
           I+ +  +K     D+D + +PGG G +  + +S K    +K F  N K + AIC AP  L  H++   K    Y S+        K I D  T V   N L+T R P    D A    E++ G
  S:     3 ISQLNILKILLQEDFDAIALPGGLGGSKAMSESSKLGEVLKSFESNGKLIAAICAAPTVLLTHSIALGKSLTSYPSFKDQLSGKYKYIDD-KTVVVDGN-LVTSRGPATAFDFALKLGEILVG 123
>gi|120553265|ref|YP_957616.1| ThiJ/PfpI domain-containing protein [Marinobacter aquaeolei VT8] >gi|120323114|gb|ABM17429.1| ThiJ/PfpI domain protein [Marinobacter aquaeolei VT8] (227 aa)
Score = 108, Expect = 1.1e-03, Identities = 24/72 (33%), Positives = 42/72 (58%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYI 120
           +A+ + + + ++N YD ++ PGG+G    L +  K IA +K   + DK + A+C AP A+  +  IK DQ  +
  S:    80 LASTRKLADVDMNQYDAIFYPGGHGPLWDLAEDDKSIALIKTAYEQDKVIGAVCHAP-AVFKNVFIKPDQNIV 151
>gi|84494436|ref|ZP_00993555.1| putative intracellular protease/amidase [Janibacter sp. HTCC2649] >gi|84383929|gb|EAP99809.1| putative intracellular protease/amidase [Janibacter sp. HTCC2649] (174 aa)
Score = 108, Expect = 1.1e-03, Identities = 26/70 (37%), Positives = 39/70 (55%)
  Q:    55 IKNFNVNDYDVLYIPGGYG-ATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           +K  +V+DYD L +PGG      LR     +A VK F+++ K V AIC AP  L +  ++ + +   SW S
  S:    61 VKEASVDDYDALVLPGGVANPDALRGDADAVAFVKAFVESGKPVAAICHAPWTLIEAGVV-QGRTLASWPS 130
>gi|67484652|ref|XP_657546.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative [Entamoeba histolytica HM-1:IMSS] >gi|56474843|gb|EAL52199.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative [Entamoeba histolytica HM-1:IMSS] (184 aa)
Score = 108, Expect = 1.1e-03, Identities = 49/166 (29%), Positives = 79/166 (47%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ-FDIANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           MK L +  +  ++LE V ++ I  A  K +        NLE    +   I   K +   N   YDV+ IPGG  GA  L  S+  I  +KE +  +++V AIC +P  + + N I E +K  ++ S     + +    +  V   N LIT + P   ++   +SLE+I
  S:     1 MKALVVIANGSEELEAVTIIDIL-ARAKIQVTTATINSNLETACSRGVKIMADKFLSECN-EQYDVIAIPGGLPGADNLAGSQLLIQKIKEQLAANRFVAAICASPAIVLEGNGIIEGRKCTAYPSFQPKLANQ-SAVHQRVVVDNHLITSQAPGSAIE---FSLEII 162
>gi|16762036|ref|NP_457653.1| hypothetical protein STY3452 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16766567|ref|NP_462182.1| putative intracellular proteinase [Salmonella typhimurium LT2] >gi|29143525|ref|NP_806867.1| hypothetical protein t3189 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56415204|ref|YP_152279.1| hypothetical protein SPA3138 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62181780|ref|YP_218197.1| hypothetical protein SC3210 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161616275|ref|YP_001590240.1| hypothetical protein SPAB_04080 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167544125|ref|ZP_02339697.1| hypothetical protein Sentent_12658 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167552081|ref|ZP_02345834.1| hypothetical protein Sentente_16442 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167558136|ref|ZP_02351146.1| hypothetical protein Sententeri_15017 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167990166|ref|ZP_02571266.1| hypothetical protein Sententer_01000002_0100001900 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168221400|ref|ZP_02646632.1| hypothetical protein Senterenterica_13476 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168227783|ref|ZP_02653014.1| hypothetical protein Sententeric_18562 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168231878|ref|ZP_02656936.1| hypothetical protein Sententerica_12910 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168237972|ref|ZP_02663030.1| hypothetical protein Senteenterica_17418 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168243105|ref|ZP_02668037.1| hypothetical protein Senterienterica_15792 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168262718|ref|ZP_02684691.1| hypothetical protein Salmentericaenterica_16665 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168463506|ref|ZP_02697423.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168477370|ref|ZP_02706393.1| hypothetical protein Salmoentericaenterica_22174 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168819660|ref|ZP_02831660.1| hypothetical protein Salentericaenterica_09753 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194442389|ref|YP_002042529.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194448703|ref|YP_002047301.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194472814|ref|ZP_03078798.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194736340|ref|YP_002116221.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|25322928|pir||AI0899 conserved hypothetical protein STY3452 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16421827|gb|AAL22141.1| putative intracellular proteinase [Salmonella typhimurium LT2] >gi|16504339|emb|CAD07791.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139159|gb|AAO70727.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56129461|gb|AAV78967.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62129413|gb|AAX67116.1| putative intracellular proteinase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161365639|gb|ABX69407.1| hypothetical protein SPAB_04080 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194401052|gb|ACF61274.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194407007|gb|ACF67226.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194459178|gb|EDX48017.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194711842|gb|ACF91063.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195633257|gb|EDX51671.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Newport str. SL317] (172 aa)
Score = 108, Expect = 1.1e-03, Identities = 27/113 (23%), Positives = 57/113 (50%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L   +F+D E  +  + F+ A  +   I+  + + ++   G+  +   K I +   +++D L +PGG+    LR   + +   ++F+++ K V AIC  P  L   ++I+
  S:     4 KIAVLITDEFEDSEFTSPAAEFRQAGHEVITIEKEAGKTVKGKKGEASVTIDKAIDDVRPDEFDALLLPGGHSPDYLRGDSRFVDFTRDFVNSGKPVFAICHGPQLLISADVIR 117
>gi|104774510|ref|YP_619490.1| putative 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116514623|ref|YP_813529.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103423591|emb|CAI98521.1| Putative 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093938|gb|ABJ59091.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme, amidase family [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (193 aa)
Score = 108, Expect = 1.2e-03, Identities = 45/140 (32%), Positives = 68/140 (48%)
  Q:    33 DFYSPENLEMVTGQFDIA-NIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSN----------------KLITGRCPVVTLDLAFYSLEVIFGKDFS 172
           D  + +NL  +TG  DI      + + ++ DYD++  PGG   A  LR S+K    +K+     KW  A+C +P AL+ +  +KE +    W+S          DF   V   N                KL+T R P  +   A Y+L  + G D S
  S:    32 DMVALDNL-TITGGHDIRFTCDKLVDESLLDYDLVAFPGGAPNAKHLRASEKLAGLMKQRFAAGKWNAAMCASPIALSKYGFLKEAK----WTSH--------PDFKEQVASENPASTYVDTPAVIDEDHKLVTSRGPATSWAFA-YALAQVLGVDTS 175
>gi|56964374|ref|YP_176105.1| general stress protein GSP18 [Bacillus clausii KSM-K16] >gi|56910617|dbj|BAD65144.1| general stress protein GSP18 [Bacillus clausii KSM-K16] (172 aa)
Score = 107, Expect = 1.3e-03, Identities = 37/151 (24%), Positives = 69/151 (45%)
  Q:     2 KLLALTMSKFQDLEMV-ALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK-EDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           K+  L    F+D+E      S+ +A  +   I+  + + +    G   +   K+I + +V+D+D L +PGG+    LR   + +   K F    K ++AIC  P  L + +++K      +     D+ ++  I      V  +N L+T R P
  S:     4 KVAVLITDLFEDVEYTDPKESLTEAGHELVTIEKEAGKTVTGKQGNAKVTIDKSIDDVHVDDFDALLLPGGFSPDQLRADDRFVEFTKAFAQAGKPIMAICHGPQLLINADVLKGRTVTGVKPIVPDLKNAGAIFKDEEVVVCNNNLVTSRTP 156
>gi|42560993|ref|NP_975444.1| ThiJ/PfpI family protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492490|emb|CAE77086.1| ThiJ/PfpI family protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] (183 aa)
Score = 107, Expect = 1.3e-03, Identities = 39/121 (32%), Positives = 64/121 (52%)
  Q:     1 MKLLALTMSK-FQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDI---ANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYIS 121
           MK +AL ++  F+++E V +  + K +     +D  S  +   V G  +I   AN K  K+ N+N YD + +PGG G T L  ++  I  + EF   +K + +IC AP  +    L+  D K I+
  S:     1 MKKIALYLNPGFEEIEAVTVCDVLKRAGIL--VDMVSTIDSLEVKGAHNIVIKAN-KLWKDLNINYYDGMVLPGGSGVTSLFDNQTLIDNILEFNKQNKLIASICAAPQVIGQTKLL--DNKTIT 120
>gi|126700977|ref|YP_001089874.1| putative protease [Clostridium difficile 630] >gi|115252414|emb|CAJ70256.1| putative protease [Clostridium difficile 630] (194 aa)
Score = 107, Expect = 1.3e-03, Identities = 46/181 (25%), Positives = 88/181 (48%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQK--FERIDFYSPENLEMVTGQFDIANI--KTIKNFNVNDYDVLYIPGG---YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRS-----NKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMG 181
           MK+L      F+ +E    + +   ++      ID  +    + V   F+I  +  KTI+   V+DYD L IPGG   +G          +  ++EF   +K + +IC A   +    ++K ++K  ++   +    +++ +F+ +V          +IT  CP     +AF  LE++  K+  D +K+ +MG
  S:     1 MKVLVFLAKGFETMEFSVFVDVMGWARNDYGHDIDVVTCGFKKQVMSTFNIQVLVDKTIEEVCVDDYDALAIPGGFEEFGFYDEAYDSSFLNLIREFNSKEKIIASICVAALPVGKSGVLK-NRKATTYHLKNGKRQRQLSEFDVNVVNEPIVVDKNIITSYCPETAPHVAFKLLEMLTSKEQMDEVKL-VMG 191
>gi|189463787|ref|ZP_03012572.1| hypothetical protein BACINT_00120 [Bacteroides intestinalis DSM 17393] >gi|189438737|gb|EDV07722.1| hypothetical protein BACINT_00120 [Bacteroides intestinalis DSM 17393] (182 aa)
Score = 107, Expect = 1.4e-03, Identities = 37/136 (27%), Positives = 63/136 (46%)
  Q:    41 EMVTGQFDIANI--KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLK 176
           E+VTG  D+  +  K + N +  D D++ +PGG  GA  L +  +    V +F + +K + AIC AP  L    L+K  +           +          V R   +ITG+ P   ++ A   ++++ GK+    LK
  S:    40 EIVTGAHDVPVLCDKNVVNCDFYDADLVLLPGGMPGAATLEKCPELRKLVLDFAEKNKPIAAICAAPMMLGKLGLLKGRKATCYPGFEQYLEGAECT--GAPVERDGNIITGKGPGAAMEFALTVVDMMLGKEKVQELK 176
>gi|55377370|ref|YP_135220.1| putative intracellular protease [Haloarcula marismortui ATCC 43049] >gi|55230095|gb|AAV45514.1| putative intracellular protease [Haloarcula marismortui ATCC 43049] (196 aa)
Score = 107, Expect = 1.4e-03, Identities = 21/60 (35%), Positives = 33/60 (55%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLI 113
           T+ + N +DYD L +PGG     LR   + +  V+ F + DK V A+C  P  LA  +++
  S:    71 TMADVNPSDYDALVVPGGRAPEYLRTYDEVLDAVQHFFEEDKPVAALCHGPQILAAADVL 130
>gi|187735447|ref|YP_001877559.1| DJ-1 family protein [Akkermansia muciniphila ATCC BAA-835] >gi|187425499|gb|ACD04778.1| DJ-1 family protein [Akkermansia muciniphila ATCC BAA-835] (187 aa)
Score = 107, Expect = 1.5e-03, Identities = 32/146 (21%), Positives = 70/146 (47%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLI 147
           K+  L    F+++E++A L I +       +     + + + T +  ++    +   + +  D L +PGG G+ +LR + + I  VK+  +  K V AIC AP  LA   L++ D+   ++ + D+   + + +   H+ +   ++
  S:     3 KVAILAAPGFEEIELMAPLDILRRLNMDVVLAGVQSDKV-VSTHEVTVSTDTMLDKLHADKLDALILPGGAGSWVLRDTPEVIHLVKKMHEAGKLVAAICAAPIVLAKAGLVR-DRNVTAYPAQDVY--RELNEAGAHIVKDENVV 144
>gi|83319368|ref|YP_424483.1| DJ-1 family protein [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283254|gb|ABC01186.1| DJ-1 family protein [Mycoplasma capricolum subsp. capricolum ATCC 27343] (182 aa)
Score = 107, Expect = 1.5e-03, Identities = 40/121 (33%), Positives = 65/121 (53%)
  Q:     1 MKLLALTMSK-FQDLEMVALLSIFKASQKFERIDFYSP-ENLEMVTGQFDIA--NIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYIS 121
           MK +AL ++  F+++E V    + K +     +D  S  +NLE V G  +I     K  K+ N+N YD + +PGG G T L +++  I  + EF   +K + +IC AP  +    L+  D K I+
  S:     1 MKKIALYLNPGFEEIEAVTPCDVLKRAGIL--VDMISTTDNLE-VKGSHNITIKADKLWKDLNINYYDGMILPGGSGVTSLFKNQTLIDNILEFNKQNKLIASICAAPQVIGQTRLL--DNKTIT 120
>gi|149003439|ref|ZP_01828328.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP14-BS69] >gi|149010563|ref|ZP_01831934.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP19-BS75] >gi|168484463|ref|ZP_02709415.1| DJ-1 family protein [Streptococcus pneumoniae CDC1873-00] >gi|147758622|gb|EDK65620.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP14-BS69] >gi|147765044|gb|EDK71973.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP19-BS75] >gi|172042335|gb|EDT50381.1| DJ-1 family protein [Streptococcus pneumoniae CDC1873-00] (184 aa)
Score = 107, Expect = 1.5e-03, Identities = 43/168 (25%), Positives = 83/168 (49%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDI-ANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFG 168
           +K+  +    F+++E + ++ + + A+   + + F      E VTG   I      + + +++DYD++ +PGG  G+  LR ++  I  ++ F    K + AIC AP AL    ++K +++Y  +      I D   +K+    V    +L T R P   L  A+  +E + G
  S:     2 VKVAVMLAQGFEEIEALTVVDVLRRANITCDMVGFE-----EQVTGSHAIQVRADHVFDGDLSDYDMIVLPGGMPGSAHLRDNQTLIQELQSFEQEGKKLAAICAAPIALNQAEILK-NKRYTCYDGVQEQILDGHYVKE---TVVVDGQLTTSRGPSTALAFAYELVEQLGG 165
>gi|15902757|ref|NP_358307.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae R6] >gi|116516953|ref|YP_816201.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae D39] >gi|148990417|ref|ZP_01821583.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP6-BS73] >gi|149021674|ref|ZP_01835705.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP23-BS72] >gi|168486182|ref|ZP_02710690.1| DJ-1 family protein [Streptococcus pneumoniae CDC1087-00] >gi|168490901|ref|ZP_02715044.1| DJ-1 family protein [Streptococcus pneumoniae CDC0288-04] >gi|169833282|ref|YP_001694267.1| 4-methyl-5 [Streptococcus pneumoniae Hungary19A-6] >gi|182683723|ref|YP_001835470.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae CGSP14] >gi|15458304|gb|AAK99517.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Streptococcus pneumoniae R6] >gi|116077529|gb|ABJ55249.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae D39] >gi|147924322|gb|EDK75415.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP6-BS73] >gi|147930135|gb|EDK81121.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP23-BS72] >gi|168995784|gb|ACA36396.1| 4-methyl-5 [Streptococcus pneumoniae Hungary19A-6] >gi|182629057|gb|ACB90005.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae CGSP14] >gi|183570770|gb|EDT91298.1| DJ-1 family protein [Streptococcus pneumoniae CDC1087-00] >gi|183574600|gb|EDT95128.1| DJ-1 family protein [Streptococcus pneumoniae CDC0288-04] (184 aa)
Score = 107, Expect = 1.6e-03, Identities = 43/168 (25%), Positives = 83/168 (49%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDI-ANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFG 168
           +K+  +    F+++E + ++ + + A+   + + F      E VTG   I      + + +++DYD++ +PGG  G+  LR ++  I  ++ F    K + AIC AP AL    ++K +++Y  +      I D   +K+    V    +L T R P   L  A+  +E + G
  S:     2 VKVAVMLAQGFEEIEALTVVDVLRRANITCDMVGFE-----EQVTGSHAIQVRADHVFDGDLSDYDMIVLPGGMPGSAHLRDNQTLIQELQSFEQEGKKLAAICAAPIALNQAEILK-NKRYTCYDGVQEQILDGHYVKE---TVVVDGQLTTSRGPSTALAFAYELVEQLGG 165
>gi|30260982|ref|NP_843359.1| thiJ/pfpI family protein [Bacillus anthracis str. Ames] >gi|47526132|ref|YP_017481.1| thiJ/pfpI family protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183826|ref|YP_027078.1| thiJ/pfpI family protein [Bacillus anthracis str. Sterne] >gi|65318257|ref|ZP_00391216.1| COG0693: Putative intracellular protease/amidase [Bacillus anthracis str. A2012] >gi|165871906|ref|ZP_02216548.1| thiJ/pfpI family protein [Bacillus anthracis str. A0488] >gi|167635928|ref|ZP_02394236.1| thiJ/pfpI family protein [Bacillus anthracis str. A0442] >gi|167639015|ref|ZP_02397289.1| thiJ/pfpI family protein [Bacillus anthracis str. A0193] >gi|170687565|ref|ZP_02878781.1| thiJ/pfpI family protein [Bacillus anthracis str. A0465] >gi|170708282|ref|ZP_02898727.1| thiJ/pfpI family protein [Bacillus anthracis str. A0389] >gi|177653870|ref|ZP_02935942.1| thiJ/pfpI family protein [Bacillus anthracis str. A0174] >gi|190566756|ref|ZP_03019673.1| thiJ/pfpI family protein [Bacillus anthracis Tsiankovskii-I] >gi|30254431|gb|AAP24845.1| thiJ/pfpI family protein [Bacillus anthracis str. Ames] >gi|47501280|gb|AAT29956.1| thiJ/pfpI family protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49177753|gb|AAT53129.1| thiJ/pfpI family protein [Bacillus anthracis str. Sterne] >gi|164712337|gb|EDR17872.1| thiJ/pfpI family protein [Bacillus anthracis str. A0488] >gi|167513145|gb|EDR88517.1| thiJ/pfpI family protein [Bacillus anthracis str. A0193] >gi|167528745|gb|EDR91504.1| thiJ/pfpI family protein [Bacillus anthracis str. A0442] >gi|170126803|gb|EDS95685.1| thiJ/pfpI family protein [Bacillus anthracis str. A0389] >gi|170668378|gb|EDT19125.1| thiJ/pfpI family protein [Bacillus anthracis str. A0465] >gi|172081098|gb|EDT66175.1| thiJ/pfpI family protein [Bacillus anthracis str. A0174] >gi|190562308|gb|EDV16276.1| thiJ/pfpI family protein [Bacillus anthracis Tsiankovskii-I] (171 aa)
Score = 107, Expect = 1.6e-03, Identities = 37/151 (24%), Positives = 67/151 (44%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKAS-QKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTH--VYRSNKLITGRCP 152
           K+  L    F+D E       FK    +   I+    + +    G+ ++     I + +  ++D L+IPGG+   +LR  ++ +   K F+D +K V AIC  P  L     + E +    + S ++       +F+    V   N+L+T R P
  S:     4 KIAILITDYFEDTEYTEPAEAFKQKGYELTTIEAEKGKTVHGKQGKSEVVIDTGIDDVSPENFDALFIPGGFSPDILRADERFVRFSKAFMDAEKPVFAICHGPQLLITAQTL-EGRDVTGYKSIEVDLKNAGGNFHDKEVVVCQNQLVTSRQP 156
>gi|156935677|ref|YP_001439593.1| hypothetical protein ESA_03543 [Enterobacter sakazakii ATCC BAA-894] >gi|156533931|gb|ABU78757.1| hypothetical protein ESA_03543 [Enterobacter sakazakii ATCC BAA-894] (172 aa)
Score = 106, Expect = 1.6e-03, Identities = 28/113 (24%), Positives = 54/113 (47%)
  Q:     2 KLLALTMSKFQDLEMVALLSIF-KASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L   +F+D E  +  + + KA  +   I+  + + +    G+  +   K I   +  D+D L +PGG+    LR   + +   ++F++  K V AIC  P  L   ++I+
  S:     4 KIAVLITDEFEDSEFTSPAAEYRKAGHEVITIEKEAGKTVTGKQGEAKVTIDKAIDEVSPADFDALLLPGGHSPDSLRGDDRFVTFTRDFVNTGKPVFAICHGPQLLISADVIR 117
>gi|161506162|ref|YP_001573274.1| hypothetical protein SARI_04353 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160867509|gb|ABX24132.1| hypothetical protein SARI_04353 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (172 aa)
Score = 106, Expect = 1.7e-03, Identities = 27/113 (23%), Positives = 57/113 (50%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L   +F+D E  +  + F+ A  +   I+  + + ++   G+  +   K I +   +++D L +PGG+    LR   + +   ++F+++ K V AIC  P  L   ++I+
  S:     4 KIAVLITDEFEDSEFTSPAAEFRQAGHEVITIEKEAGKTVKGKKGEASVTIDKAIDDVRPDEFDALLLPGGHSPDHLRGDSRFVDFTRDFVNSGKPVFAICHGPQLLISADVIR 117
>gi|145953864|ref|ZP_01802872.1| hypothetical protein CdifQ_04003881 [Clostridium difficile QCD-32g58] >gi|168697543|ref|ZP_02729820.1| putative protease [Clostridium difficile QCD-37x79] >gi|168724299|ref|ZP_02756576.1| putative protease [Clostridium difficile QCD-76w55] >gi|168731641|ref|ZP_02763918.1| putative protease [Clostridium difficile QCD-97b34] >gi|196159520|ref|ZP_03120081.1| putative protease [Clostridium difficile CIP 107932] (194 aa)
Score = 106, Expect = 1.7e-03, Identities = 43/179 (24%), Positives = 86/179 (48%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQK--FERIDFYSPENLEMVTGQFDIANI--KTIKNFNVNDYDVLYIPGG---YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRS-----NKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKL 179
           MK+L      F+ +E    + +   ++      ID  +    + V   F+I  +  KTI+   V+DYD L IPGG   +G          +  ++EF   +K + +IC A   +    ++K ++K  ++   +    +++ +F+ +V          +IT  CP     +AF  LE++  ++  D +K+ +
  S:     1 MKVLVFLAKGFETMEFSVFVDVMGWARNDYGHDIDVVTCGFKKQVMSTFNIQVLVDKTIEEVCVDDYDALAIPGGFEEFGFYDEAYDSSFLNLIREFNSKEKIIASICVAALPVGKSGVLK-NRKATTYHLKNGKRQRQLSEFDVNVVNEPIVVDKNIITSYCPETAPHVAFKLLEMLTSREQMDEVKLAM 190
>gi|148997116|ref|ZP_01824770.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP11-BS70] >gi|149007690|ref|ZP_01831307.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP18-BS74] >gi|168575467|ref|ZP_02721403.1| DJ-1 family protein [Streptococcus pneumoniae MLV-016] >gi|147756816|gb|EDK63856.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP11-BS70] >gi|147760845|gb|EDK67816.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP18-BS74] >gi|183578608|gb|EDT99136.1| DJ-1 family protein [Streptococcus pneumoniae MLV-016] (184 aa)
Score = 106, Expect = 1.7e-03, Identities = 43/168 (25%), Positives = 83/168 (49%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDI-ANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFG 168
           +K+  +    F+++E + ++ + + A+   + + F      E VTG   I      + + +++DYD++ +PGG  G+  LR ++  I  ++ F    K + AIC AP AL    ++K +++Y  +      I D   +K+    V    +L T R P   L  A+  +E + G
  S:     2 VKVAVILAQGFEEIEALTVVDVLRRANITCDMVGFE-----EQVTGSHAIQVRADHVFDGDLSDYDMIVLPGGMPGSAHLRDNQTLIQELQSFEQEGKKLAAICAAPIALNQAEILK-NKRYTCYDGVQEQILDGHYVKE---TVVVDGQLTTSRGPSTALAFAYELVEQLGG 165
>gi|23098158|ref|NP_691624.1| hypothetical protein OB0703 [Oceanobacillus iheyensis HTE831] >gi|22776383|dbj|BAC12659.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] (170 aa)
Score = 106, Expect = 1.8e-03, Identities = 28/83 (33%), Positives = 43/83 (51%)
  Q:    32 IDFYSPENLEMVTGQF--DIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           +D  S E  + + G+    I   K I + + + YD L +PGG+   LLR   K     K F+ ++K V AIC  P  L + +L+K
  S:    32 VDIISNEGNKTINGKNGDKIEADKGINDVDPSAYDALLVPGGFSPDLLRIDPKNGEFAKAFMKDNKPVFAICHGPQFLVETDLLK 116
>gi|194398431|ref|YP_002037449.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae G54] >gi|194358098|gb|ACF56546.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae G54] (184 aa)
Score = 106, Expect = 1.8e-03, Identities = 43/168 (25%), Positives = 83/168 (49%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDI-ANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFG 168
           +K+  +    F+++E + ++ + + A+   + + F      E VTG   I      + + +++DYD++ +PGG  G+  LR ++  I  ++ F    K + AIC AP AL    ++K +++Y  +      I D   +K+    V    +L T R P   L  A+  +E + G
  S:     2 VKVAVMLAQGFEEIEALTVVDVLRRANITCDMVGFE-----EQVTGSHAIQVRADHVFDGDLSDYDMIVLPGGMPGSAHLRDNQTLIQELQSFEQEGKKLAAICAAPIALNQAEILK-NKRYTCYDGVQEQILDGXYVKE---TVVVDGQLTTSRGPSTALAFAYELVEQLGG 165
>gi|186460344|ref|ZP_02970644.1| intracellular protease, PfpI family [bacterium Ellin514] >gi|184203106|gb|EDU00165.1| intracellular protease, PfpI family [bacterium Ellin514] (236 aa)
Score = 106, Expect = 1.8e-03, Identities = 38/114 (33%), Positives = 54/114 (47%)
  Q:    53 KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKD---------FNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           +TI   N ++YD L IPGG+     LRQS   +  V+EF   +K +  IC  P  L    ++K ++   SW          IKD          N    R    I+ R P   LDL  ++ E+I
  S:    64 RTIFRANPDNYDALLIPGGHINPDFLRQSDSVLQFVREFDAANKPIAVICHGPWVLVSAGVVK-NRTLTSWPG--------IKDDVINAGGNWVNNAAVRDGNWISSRSP---LDLIQFNREMI 175
>gi|15900697|ref|NP_345301.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae TIGR4] >gi|111658145|ref|ZP_01408842.1| hypothetical protein SpneT_02000670 [Streptococcus pneumoniae TIGR4] >gi|14972281|gb|AAK74941.1| putative 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Streptococcus pneumoniae TIGR4] (184 aa)
Score = 106, Expect = 1.8e-03, Identities = 43/168 (25%), Positives = 83/168 (49%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDI-ANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFG 168
           +K+  +    F+++E + ++ + + A+   + + F      E VTG   I      + + +++DYD++ +PGG  G+  LR ++  I  ++ F    K + AIC AP AL    ++K +++Y  +      I D   +K+    V    +L T R P   L  A+  +E + G
  S:     2 VKVAVILAQGFEEIEALTVVDVLRRANITCDMVGFE-----EQVTGSHAIQVRADHVFDGDLSDYDMIVLPGGMPGSAHLRDNQTLIQELQSFEQEGKKLAAICAAPIALNQAEILK-NKRYTCYDGVQEQILDGHYVKE---TVVVDGQLTTSRGPSTALAFAYELVEQLGG 165
>gi|170751659|ref|YP_001757919.1| PfpI family intracellular peptidase [Methylobacterium radiotolerans JCM 2831] >gi|170658181|gb|ACB27236.1| intracellular protease, PfpI family [Methylobacterium radiotolerans JCM 2831] (189 aa)
Score = 106, Expect = 1.9e-03, Identities = 30/74 (40%), Positives = 41/74 (55%)
  Q:    41 EMVTGQFDIANI----KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           E V    D AN     +TI+  +  DYD L +PGG  GA  LR SK  +A V++F    K V  IC  P  L + +++K
  S:    47 ETVNNDLDPANRYKVDRTIEGASAADYDGLVVPGGCVGADKLRASKDVVAFVRDFFAAGKPVGVICHGPWTLIEADVVK 125
>gi|90418768|ref|ZP_01226679.1| putative intracellular protease/amidase [Aurantimonas sp. SI85-9A1] >gi|90336848|gb|EAS50553.1| putative intracellular protease/amidase [Aurantimonas sp. SI85-9A1] (187 aa)
Score = 106, Expect = 1.9e-03, Identities = 23/62 (37%), Positives = 37/62 (59%)
  Q:    53 KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           KT+    V DYD L +PGG     +LR   K ++ V+EF ++ K + AIC AP  L + ++++
  S:    62 KTLSEVRVTDYDALVLPGGQINPDVLRADPKVVSFVREFFNSKKPLAAICHAPWLLIEADVVR 124
>gi|192813062|ref|ZP_03041727.1| intracellular protease, PfpI family [Geobacillus sp. Y412MC10] >gi|192797983|gb|EDV74498.1| intracellular protease, PfpI family [Geobacillus sp. Y412MC10] (176 aa)
Score = 106, Expect = 2.0e-03, Identities = 27/102 (26%), Positives = 52/102 (50%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIK--TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDA 103
           K++AL   +F+DLE+     +++  ++   +     E  +  TG++ +      + +  N  DYD + +PGG+    LR+  K +  VKE  ++ K +  IC A
  S:     7 KVIALVDEEFEDLEL--WYPVYRVREEGAEVHLAGLEKGKTYTGKYGVPAQAEYSFEELNSKDYDGILVPGGWAPDKLRRYDKVLQLVKEMNEDQKPIGQICHA 108
>gi|159904725|ref|YP_001548387.1| ThiJ/PfpI domain-containing protein [Methanococcus maripaludis C6] >gi|159886218|gb|ABX01155.1| ThiJ/PfpI domain protein [Methanococcus maripaludis C6] (183 aa)
Score = 105, Expect = 2.1e-03, Identities = 41/150 (27%), Positives = 69/150 (46%)
  Q:     3 LLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGA-TLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLI--KEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           ++ +   +F+D E+   L +F++     ++        + V G+  +   KTI+  N ND+D + I GG G+   L  ++K I  +KEF    K   AIC +P  LA   L+  K+   +    S  +         +  V    K+ITGR P
  S:    16 VMVIAPERFRDEELFEPLQVFQSKNIATQVVSTVIGQHKGVMGKV-MTTTKTIEEVNPNDFDAILIVGGGGSRDFLWNNEKLIELLKEFNKQGKVTAAICISPAVLAQAGLLNGKKATVFPDDESIAVLQQNGAIYLDEAVIVDGKVITGRNP 167
>gi|86751228|ref|YP_487724.1| peptidase C56, PfpI [Rhodopseudomonas palustris HaA2] >gi|86574256|gb|ABD08813.1| Peptidase C56, PfpI [Rhodopseudomonas palustris HaA2] (187 aa)
Score = 105, Expect = 2.1e-03, Identities = 37/114 (32%), Positives = 59/114 (51%)
  Q:    53 KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           K + +   +DYD + +PGG     LLR +   +  +K F D  K V A+C AP  L D  + K  +K  S++S   D+ ++   K  ++ V   N +IT R P    DL  +S ++I
  S:    63 KALGSAKADDYDAIVLPGGQINPDLLRVNADALKLIKSFFDAGKTVAAVCHAPWLLIDTGIAK-GRKMTSYNSIKQDVINAG-AKWEDSAVVTDNGVITSRNPG---DLEAFSAKII 174
>gi|195959291|ref|ZP_03095500.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia sp. SV1] (184 aa)
Score = 105, Expect = 2.2e-03, Identities = 41/166 (24%), Positives = 78/166 (46%)
  Q:    11 FQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLK 176
           F+D+E +  + I +      +I   +  N+ + +          I N   N +D++ +PGG  GAT L  SK+    +K+     K++ AIC +P  +     +    K+  + S   ++ D + + +   +V RSN  IT +    + + AF  LE++ GK   + +K
  S:    11 FEDIEAIIPIDILRRGNVNIQIISANDSNVVISSKGVSFLADDIISNCKENCFDLIILPGGMPGATNLFNSKELDLILKDMNSKGKYIAAICASPVVVLAAKGLLGFNKFTCYPSLEKNVLDGEFVDE---NVVRSNNFITSKGVGTSFEFAFTLLEMVKGKQIMEDVK 176
>gi|119896310|ref|YP_931523.1| ThiJ/PfpI family protein [Azoarcus sp. BH72] >gi|119668723|emb|CAL92636.1| ThiJ/PfpI family protein [Azoarcus sp. BH72] (193 aa)
Score = 105, Expect = 2.2e-03, Identities = 24/58 (41%), Positives = 29/58 (50%)
  Q:    57 NFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           +    DYD L IPGG     LR + K IA V+ F   DK V AIC     LA   ++K
  S:    75 SLRAEDYDALVIPGGRAPEYLRLNPKVIAAVQHFFAADKPVAAICHGAQVLAAAGVLK 132
>gi|94495326|ref|ZP_01301907.1| protease I [Sphingomonas sp. SKA58] >gi|94425592|gb|EAT10612.1| protease I [Sphingomonas sp. SKA58] (189 aa)
Score = 105, Expect = 2.2e-03, Identities = 33/100 (33%), Positives = 50/100 (50%)
  Q:    53 KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNT-HVYRSNKLITGRCP 152
           KT      +D+D L +PGG  GA  LR S + IA ++ F +  K V AIC AP  L +  ++ E +   S+S+  +        + +  V   N L+T R P
  S:    63 KTFSEVKADDFDGLVVPGGTVGADKLRGSVEAIAFIRAFFNQKKPVAAICHAPWTLIEAGVL-EGRTLTSYSTLKVDIENAGGAWTSEEVVVDNGLVTSRDP 163
>gi|70728738|ref|YP_258487.1| ThiJ/PfpI family protein [Pseudomonas fluorescens Pf-5] >gi|68343037|gb|AAY90643.1| ThiJ/PfpI family protein [Pseudomonas fluorescens Pf-5] (193 aa)
Score = 105, Expect = 2.3e-03, Identities = 28/88 (31%), Positives = 41/88 (46%)
  Q:    21 SIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           ++  A   FE    YS +   +    FD A +K+      +DYD L IPGG     LR ++K +  V+EF    K + A+C     LA
  S:    45 TVRTAIHDFEGDQTYSEKPGHLFALNFDFAQVKS------SDYDALLIPGGRAPEYLRLNEKVLQLVREFDQAGKPIAAVCHGAQLLA 126
>gi|167756491|ref|ZP_02428618.1| hypothetical protein CLORAM_02024 [Clostridium ramosum DSM 1402] >gi|167703899|gb|EDS18478.1| hypothetical protein CLORAM_02024 [Clostridium ramosum DSM 1402] (183 aa)
Score = 105, Expect = 2.4e-03, Identities = 34/107 (31%), Positives = 52/107 (48%)
  Q:    60 VNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           +++YD + IPGG  GA+ LR   + I  VK+F  + K + AIC  P  L + ++IK   K ++   G            T V R   +ITG+ P   L   +  LE +
  S:    58 LDNYDAVVIPGGMPGASNLRDDSRVIDLVKQFNHDGKIIGAICAGPIVLQEADVIK--GKTVTCYPGFEEQLIGSNYQETLVQRDENIITGKGPAAALAFGYTLLEAL 163
>gi|169343644|ref|ZP_02864643.1| DJ-1 family protein [Clostridium perfringens C str. JGS1495] >gi|169298204|gb|EDS80294.1| DJ-1 family protein [Clostridium perfringens C str. JGS1495] (191 aa)
Score = 105, Expect = 2.4e-03, Identities = 39/114 (34%), Positives = 61/114 (53%)
  Q:    53 KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS-GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           K I + ++  YD + +PGG  GAT LR ++K  + +K++   +K V AIC AP ALA   +I E +K  S+    D   +    + +T V   N +IT R P   L    + LE++
  S:    54 KLISDDDLETYDAIVLPGGMPGATNLRDNEKVQSLIKKYNKENKIVAAICAAPIALAKAGVI-EGKKVTSYPGFKDELGNVNYVEEDTVVVDGN-IITSRGPATAL---VFGLEIL 164
>gi|160896447|ref|YP_001562029.1| PfpI family intracellular peptidase [Delftia acidovorans SPH-1] >gi|160362031|gb|ABX33644.1| intracellular protease, PfpI family [Delftia acidovorans SPH-1] (194 aa)
Score = 105, Expect = 2.4e-03, Identities = 39/108 (36%), Positives = 47/108 (43%)
  Q:     7 TMSKFQDLEMV------------ALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           TM  FQ L+ V            A   I  A   FE    YS +     T     A+IK         YD L IPGG G   LR      A V+ F DN+K V A+C     LA   ++K
  S:    19 TMVPFQALQAVGHTVHAVCPDKKAGEHIKTAIHDFEGAQTYSEKPGHNFTLNASFADIKP------EQYDALVIPGGRGPEYLRNYDAVRAAVRHFFDNNKPVAAVCHGAQLLAGAGVLK 132
>gi|150400176|ref|YP_001323943.1| PfpI family intracellular peptidase [Methanococcus vannielii SB] >gi|150012879|gb|ABR55331.1| intracellular protease, PfpI family [Methanococcus vannielii SB] (171 aa)
Score = 105, Expect = 2.5e-03, Identities = 40/150 (26%), Positives = 71/150 (47%)
  Q:     3 LLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFD------IANIKTIKNFNVNDYDVLYIPGGYGA-TLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKD--FNTHVYRSNKLITGRCP 152
           L+ +   KF+D E+   L +F++     ++       + + TGQ        I   KT+     +D+D + I GG G+   L  + K I  +KEF +  K   AIC +P  LA   L+K  +  +      I + ++      + +V    K++TG+ P
  S:     4 LMVIAPEKFRDEELFEPLQVFQSKNIGTQV-------VSLTTGQHTGVLGKRITTTKTLDEVKTSDFDAIVIVGGSGSRKYLWNNNKLIDLLKEFNNEGKITAAICISPAILAQAGLLKNKKATVFLDDEAILELQKNGAIYIDENVIIDGKVVTGKNP 155
>gi|24213238|ref|NP_710719.1| ThiJ/PfpI family protein [Leptospira interrogans serovar Lai str. 56601] >gi|45658853|ref|YP_002939.1| ThiJ/PfpI family protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|24193965|gb|AAN47737.1|AE011240_2 ThiJ/PfpI family protein [Leptospira interrogans serovar Lai str. 56601] >gi|45602098|gb|AAS71576.1| ThiJ/PfpI family protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (234 aa)
Score = 105, Expect = 2.5e-03, Identities = 32/131 (24%), Positives = 60/131 (45%)
  Q:    50 ANIKTIKNFNVND---YDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           + +K I +F+  D    D+L +PGG G TLL +    +  +K    N +++ ++C     LA   L+   +    W S D+     ++  +    +    ITG      +D A +     FG + ++  +I+LM
  S:    50 SGMKLIPDFDFADCPDLDILLVPGGPGTTLLMEEFTVLDFLKRKTVNSRFITSVCTGSLVLASAGLLDGYKATTHWMSLDVLKLFPVQISSERFVKDRNRITGGGVTAGIDFALFLTAEFFGSELAE--EIQLM 181
>gi|15606052|ref|NP_213429.1| protease I [Aquifex aeolicus VF5] >gi|2983230|gb|AAC06827.1| protease I [Aquifex aeolicus VF5] (167 aa)
Score = 105, Expect = 2.5e-03, Identities = 22/62 (35%), Positives = 35/62 (56%)
  Q:    53 KTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           KTIK+    ++D ++IPGGY    LR+  + +  VK+  D+ K V A+C  P  L    ++K
  S:    53 KTIKDVYHQEFDCVFIPGGYAPDRLRRYPEVLHIVKKHYDSGKLVCAVCHGPWVLISAKVVK 114
>gi|73670754|ref|YP_306769.1| intracellular protease [Methanosarcina barkeri str. Fusaro] >gi|72397916|gb|AAZ72189.1| intracellular protease [Methanosarcina barkeri str. Fusaro] (180 aa)
Score = 105, Expect = 2.6e-03, Identities = 46/150 (30%), Positives = 73/150 (48%)
  Q:     3 LLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTG---QFDIANIKTIKNFNVNDYDVLYIPGGYGA-TLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKD--FNTHVYRSNKLITGRCP 152
           LL +   +F+D E      +F+AS     +   S +  + + G   + DIA    I +  ++DYD + I GG G+   L  SK   A VKE  D  K + AIC +P  LA   ++K+ +  +  S   + + K       +  V  S ++ITGR P
  S:    12 LLVIAQEQFRDEECFVPKQLFEASGVKVTVAAESKKTAKGMLGGTIKPDIA----ISDARIDDYDAIVISGGSGSRKYLWDSKALQALVKEADDLKKVISAICISPVVLARTGILKDKESTVFKSPDTVRELKEHGAIYLDREVVVSGRVITGRDP 163
>gi|134046082|ref|YP_001097568.1| ThiJ/PfpI domain-containing protein [Methanococcus maripaludis C5] >gi|132663707|gb|ABO35353.1| ThiJ/PfpI domain protein [Methanococcus maripaludis C5] (171 aa)
Score = 105, Expect = 2.6e-03, Identities = 42/150 (28%), Positives = 74/150 (49%)
  Q:     3 LLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGA-TLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSN------KLITGRCP 152
           ++ +   +F+D E+   L +F++     ++   +    + V G+  +   KTI+  N ND+D + I GG G+   L  ++K +  +KEF    K   AIC +P  LA   L+  + K ++    D  +S  +   N  +Y         K+ITGR P
  S:     4 VMVIAPERFRDEELFEPLQVFQSKNIATQVVSTTIGQHKGVMGKV-MTTTKTIEEVNSNDFDAIVIVGGGGSRDFLWNNEKLLELLKEFNKQGKVTAAICISPAVLAQAGLL--NGKKVTVFPDD--ESIAVLQQNGAIYLDEAVIVDGKVITGRNP 155
>gi|70607987|ref|YP_256857.1| intracellular proteinase [Sulfolobus acidocaldarius DSM 639] >gi|68568635|gb|AAY81564.1| intracellular proteinase [Sulfolobus acidocaldarius DSM 639] (175 aa)
Score = 105, Expect = 2.6e-03, Identities = 45/145 (31%), Positives = 70/145 (48%)
  Q:    22 IFKASQKFERIDFYSP----------------ENLEMVTGQFDIANIKTI--KNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS-GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           +F   ++FE I+F  P                E    VTG+   + I  +  K+    DY  L IPGG G   +R S++     + F D  K V AIC  P  L   N++K  +K  S+ S  D   +   +  +  V   + LI+ R P    DL +++  +I
  S:     7 LFVIGEEFEDIEFLYPYYRVIEEGFKPVVAWKEAKAKVTGKHGYSVISDVAFKDVRPEDYLALVIPGGRGPENIRNSEELKVLTRRFFDLKKPVAAICHGPQVLISANVVK-GRKLTSYGSIKDDVIAAGGQYLDEAVVVDDNLISSRHPG---DLPYFAASLI 166
>gi|188159341|ref|ZP_02998717.1| ThiJ/PfpI family protein [Mycoplasma mycoides subsp. mycoides LC str. GM12] (183 aa)
Score = 105, Expect = 2.7e-03, Identities = 39/121 (32%), Positives = 62/121 (51%)
  Q:     1 MKLLALTMSK-FQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDI---ANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYIS 121
           MK +AL ++  F+++E V    + K +     +D  S  +   V G  +I   AN K  K  N+N YD + +PGG G T L  ++  I  + EF   +K + +IC AP  +    L+  D K I+
  S:     1 MKKIALYLNPGFEEIEAVTACDVLKRAGIL--VDMVSTIDSLEVKGAHNIVIKAN-KLWKELNINYYDGMVLPGGSGVTSLFDNQTLIDNILEFNKQNKLIASICAAPQVIGQTKLL--DNKTIT 120
>gi|62752059|ref|NP_001015851.1| MGC108042 protein [Xenopus tropicalis] >gi|62859573|ref|NP_001017109.1| Parkinson disease (autosomal recessive, early onset) 7 [Xenopus tropicalis] >gi|60422832|gb|AAH90355.1| MGC108042 protein [Xenopus tropicalis] >gi|89270947|emb|CAJ81253.1| Parkinson disease (autosomal recessive [Xenopus tropicalis] (189 aa)
Score = 105, Expect = 2.7e-03, Identities = 34/121 (28%), Positives = 55/121 (45%)
  Q:    63 YDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNL-IKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGKE 183
           YDV+ +PGG  GA  L +S      +KE    +  + AIC  P AL  H + I +       +   I ++   K     V +    IT R P  + + A   +  + GK+ +D +K  L+ K+
  S:    67 YDVVVLPGGNLGAQNLSESPVVKEVLKEQEAKNGLIAAICAGPTALTVHGVGIGKTITTHPLAKDKIVNADHYKYSEERVVKDGNFITSRGPGTSFEFALMIVSTLVGKEVADQVKSPLLLKD 189
>gi|146308294|ref|YP_001188759.1| PfpI family intracellular peptidase [Pseudomonas mendocina ymp] >gi|145576495|gb|ABP86027.1| intracellular protease, PfpI family [Pseudomonas mendocina ymp] (193 aa)
Score = 104, Expect = 2.7e-03, Identities = 35/102 (34%), Positives = 45/102 (44%)
  Q:     7 TMSKFQDLEMVALL------------SIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           TM  FQ L+MV               ++  A   FE    YS +        FD A +      +  DYD L IPGG     LR +   +A VK F   DK + A+C     LA
  S:    19 TMVPFQALQMVGHTVHAVCPDKVTGQTVRTAIHDFEGDQTYSEKPGHNFALNFDFAKV------SAEDYDALVIPGGRAPEYLRLNGDVVALVKAFAKADKPIAAVCHGAQLLA 126
>gi|94265240|ref|ZP_01289000.1| Peptidase C56, PfpI [delta proteobacterium MLMS-1] >gi|93454274|gb|EAT04587.1| Peptidase C56, PfpI [delta proteobacterium MLMS-1] (172 aa)
Score = 104, Expect = 2.8e-03, Identities = 33/91 (36%), Positives = 43/91 (47%)
  Q:    62 DYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTH---------VYRSNKLITGRCP 152
           D+D L IPGGY    +R+ K  +  V++    DK V AIC A   LA   ++         S   +T    IKD   H         V   +KLIT R P
  S:    67 DFDGLVIPGGYAPDFMRRHKAMVNLVRDMTQQDKVVAAICHAGWMLASAKVL---------SGRTVTSFFAIKDDLIHAGANWVDQEVAEDHKLITSRTP 157
>gi|29347781|ref|NP_811284.1| putative protease/amidase [Bacteroides thetaiotaomicron VPI-5482] >gi|29339682|gb|AAO77478.1| putative protease/amidase [Bacteroides thetaiotaomicron VPI-5482] (192 aa)
Score = 104, Expect = 2.9e-03, Identities = 43/164 (26%), Positives = 76/164 (46%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANI----------KTIKNFNVNDYDVLYIPGG---YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRS-----NKLITGRCPVVTLDLAFYSLE 164
           MKLL      F+ +E    + +      + + DF    ++E+VTG F+   I          KTI   +V++YD L IPGG   +G       +K +  +++F    KW+  +C     +    ++K D+K  ++  G     K ++ F   +        + +IT   P     +A   LE
  S:     1 MKLLVFLAKGFETIEFSGFIDVMG----WAKTDFGC--DVEVVTGGFNEKVISSFNIPVLVDKTIDEISVDEYDALAIPGGFEVFGFYEEAYEEKLLNLIRQFDARKKWIATVCVGALPVGKSGVLK-DRKATTYHLGGAVKQKVLQSFGAIIVHEPIVVDDNIITSYGPQTASGVALLLLE 175
>gi|163789927|ref|ZP_02184363.1| predicted intracellular protease [Carnobacterium sp. AT7] >gi|159874867|gb|EDP68935.1| predicted intracellular protease [Carnobacterium sp. AT7] (174 aa)
Score = 104, Expect = 3.0e-03, Identities = 29/113 (25%), Positives = 52/113 (46%)
  Q:     2 KLLALTMSKFQDLEMVALL-SIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  +  + F+D+E  +   ++  A  +   I+  +   +    G   I   K I + +  D+D L IPGG+    LR   + +A  K F D  K + +IC  P  L +  ++K
  S:     4 KIATVVTNLFEDVEFTSPKEALINAGHQVITIENKAGNTVTGKKGDVAITIDKGIDDVSPEDFDALLIPGGFSPDQLRSDDRFLAFTKAFADAKKPIFSICHGPQLLINAEVVK 117
>gi|172057044|ref|YP_001813504.1| PfpI family intracellular peptidase [Exiguobacterium sibiricum 255-15] >gi|171989565|gb|ACB60487.1| intracellular protease, PfpI family [Exiguobacterium sibiricum 255-15] (176 aa)
Score = 104, Expect = 3.1e-03, Identities = 29/113 (25%), Positives = 54/113 (47%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFD--IANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K++ L  + F+DLE+     + +  ++   +D    +  E   G++   I + KT    N  DYD + +PGG+   LLR+    +  V+ F +  + +  IC A   L    ++K
  S:     8 KIIQLVSNDFEDLEL--WYPVHRLREEGATVDIVGEKAGEKYIGKYGVPIVSDKTFDEINPADYDAILVPGGWSPDLLRRFDSVLTMVRHFNETKQPIGQICHAGWVLISAGVLK 120
>gi|188586351|ref|YP_001917896.1| intracellular protease, PfpI family [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179351038|gb|ACB85308.1| intracellular protease, PfpI family [Natranaerobius thermophilus JW/NM-WN-LF] (170 aa)
Score = 104, Expect = 3.2e-03, Identities = 25/100 (25%), Positives = 44/100 (44%)
  Q:    53 KTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           K I   N  + D + IPGG+    LR++++ +  +K+  +N   + AIC  P  L   ++I        W+  D   +      +  V R   ++T R P
  S:    55 KQISQINAEEVDAVIIPGGFAPDSLRRNQQILNVIKKVNNNGGLIAAICHGPWLLVSADIISGKHITCFWAIIDDVKNAGAHYEDREVIRDGNIVTSRIP 154
>gi|159042680|ref|YP_001531474.1| PfpI family intracellular peptidase [Dinoroseobacter shibae DFL 12] >gi|157910440|gb|ABV91873.1| intracellular protease, PfpI family [Dinoroseobacter shibae DFL 12] (194 aa)
Score = 104, Expect = 3.2e-03, Identities = 33/98 (33%), Positives = 50/98 (51%)
  Q:    55 IKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCP 152
           I++ +   YD L +PGG     +LR     IA ++ F D D+ V AIC AP  L +  L+   ++  SW S   D+ ++   +  +  V R   LIT R P
  S:    72 IEDADSTQYDALVLPGGQINPDILRLDPAAIALIQAFRDRDRPVAAICHAPWLLIEAGLVA-GREVTSWPSLRTDLANAG-AQVVDVPVARDRGLITSRNP 170
>gi|153004129|ref|YP_001378454.1| PfpI family intracellular peptidase [Anaeromyxobacter sp. Fw109-5] >gi|152027702|gb|ABS25470.1| intracellular protease, PfpI family [Anaeromyxobacter sp. Fw109-5] (195 aa)
Score = 104, Expect = 3.3e-03, Identities = 22/61 (36%), Positives = 30/61 (49%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           T +     DYD L +PGG     LR   + I  V+ F  +DK + AIC  P  LA   ++K
  S:    72 TFEEIRPGDYDALVVPGGRAPEYLRLDPRVIELVQTFARDDKPIAAICHGPQILAAAGILK 132
>gi|146302026|ref|YP_001196617.1| PfpI family intracellular peptidase [Flavobacterium johnsoniae UW101] >gi|146156444|gb|ABQ07298.1| intracellular protease, PfpI family [Flavobacterium johnsoniae UW101] (182 aa)
Score = 104, Expect = 3.4e-03, Identities = 44/128 (34%), Positives = 71/128 (55%)
  Q:    25 ASQKFERIDFYSPEN-LEMVTGQFDIANIKT-----------IKNFNVN---------DYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCP 152
           A+  FE  +  SP+  LE      DI ++K+            K +NV+         DYD L +PGG     LLR+ +  +  V+ F ++ K V AIC  P  L D +++ E +K  S+ S   D+ ++    + ++ V   N L+T R P
  S:     9 ATNGFEESELASPKAYLEEQGWNADIVSLKSGTIKSWKDGNWSKEYNVDVVLDQANEADYDALVLPGGVINPDLLRREETAVNFVRSFFESKKPVAAICHGPQILVDADVL-EGRKVTSFFSVKNDLKNAGAQWE-DSEVVVDNGLVTSRNP 158
>gi|157164576|ref|YP_001467321.1| DJ-1 family protein [Campylobacter concisus 13826] >gi|112801887|gb|EAT99231.1| protein ThiJ [Campylobacter concisus 13826] (183 aa)
Score = 104, Expect = 3.4e-03, Identities = 31/120 (25%), Positives = 57/120 (47%)
  Q:    63 YDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGK 182
           YD + +PGG  GA  L    K    ++EF    K + AIC AP  L    ++K+          ++   KR    + +V +   +ITG+ P  +++ A + ++ + G++    +K  L+ K
  S:    63 YDAIVLPGGLPGAENLANDAKLREILQEFDKKGKLICAICAAPMVLERARVLKDSFVCYPGFEENVRSDKRGYVSDKNVLKDQNIITGKGPAFSMEFALFIVKNLLGEEAYHKVKNDLLYK 183
>gi|15669157|ref|NP_247962.1| intracellular protease (pfpI) [Methanocaldococcus jannaschii DSM 2661] >gi|3024948|sp|Q58377|Y967_METJA Uncharacterized protein MJ0967 >gi|1499805|gb|AAB98972.1| intracellular protease (pfpI) [Methanocaldococcus jannaschii DSM 2661] (205 aa)
Score = 104, Expect = 3.5e-03, Identities = 34/112 (30%), Positives = 60/112 (53%)
  Q:     3 LLALTMSKFQDLEMVALLSIFKASQ-KFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGAT-LLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           L+ +    F+D E+   +++F+++  K + +     E + M+  +  +   KTI + N +DY  + I GG G+   L  + K I  VKEF + +K V AIC +P  LA   ++K
  S:    35 LMVIAPKDFRDEELFEPMAVFESNGLKVDVVSTTKGECVGMLGNKITVE--KTIYDVNPDDYVAIVIVGGIGSKEYLWNNTKLIELVKEFYNKNKVVSAICLSPVVLARAGILK 146
>gi|110801657|ref|YP_699347.1| DJ-1 family protein [Clostridium perfringens SM101] >gi|110682158|gb|ABG85528.1| DJ-1 family protein [Clostridium perfringens SM101] (191 aa)
Score = 104, Expect = 3.5e-03, Identities = 27/70 (38%), Positives = 44/70 (62%)
  Q:    53 KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISW 122
           K I + ++  YD + +PGG  G+T LR ++K  + +K++ + +K V AIC AP ALA   +I E +K  S+
  S:    54 KLISDNDLETYDAIVLPGGMPGSTNLRDNEKVQSLIKKYNEENKIVAAICAAPIALAKAGVI-EGKKVTSY 123
>gi|191162794|ref|ZP_03024673.1| ThiJ/PfpI domain protein [Geobacter sp. M21] >gi|190996348|gb|EDV71797.1| ThiJ/PfpI domain protein [Geobacter sp. M21] (233 aa)
Score = 103, Expect = 3.6e-03, Identities = 30/103 (29%), Positives = 52/103 (50%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLI 147
            Q ++AN  ++   +  +YD ++ PGG+G    L  +   I+ +++F  + K V A+C AP  LAD  +  ED +Y       +  +KR+  F     R+  LI
  S:    76 AQAELANSISLSAVSAEEYDAVFYPGGHGPLWDLAVNPTSISLIEKFARSGKPVAAVCHAPAVLAD--VRGEDGEY-------LVKNKRVTGFTNSEERAVGLI 170
>gi|153863963|ref|ZP_01996998.1| protease [Beggiatoa sp. SS] >gi|152146534|gb|EDN72994.1| protease [Beggiatoa sp. SS] (188 aa)
Score = 103, Expect = 3.7e-03, Identities = 31/118 (26%), Positives = 58/118 (49%)
  Q:    63 YDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKD---FNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           +D++ +PGG  GA  L    +    +K+     K+  AIC AP  LA+  L+  ++K  S+    + D   +      +  V +  ++ITGR P   +D     +E + G++  D ++  L+
  S:    67 FDMIVLPGGLPGADHLDNDPRIHQLLKDMYQQGKYTAAICAAPKVLANAGLLA-NKKATSYPG--VLDKMSVPHQHFVDAPVIKDGQVITGRGPGTAMDFTLELIETLVGREIRDQVEAGLV 185
>gi|118477154|ref|YP_894305.1| thiJ/PfpI family protein [Bacillus thuringiensis str. Al Hakam] >gi|118416379|gb|ABK84798.1| thiJ/PfpI family protein [Bacillus thuringiensis str. Al Hakam] (224 aa)
Score = 103, Expect = 3.8e-03, Identities = 40/154 (25%), Positives = 76/154 (49%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVT 155
           K L      F + E V + S+F  S++FE I   +  + + VTG+  F       I++  V DY+V  +PGG+    L +++K ++ V E    +KW+  IC   + L    ++ + +    +S+   +D K++   +   Y+ NK +T    ++T
  S:    33 KALIFLFEGFAEFE-VNIASLFLISKEFEIIT--ATVDGKTVTGEGGFLCQPHVAIEHMEVADYEVFIVPGGHIFDHL-ENEKLLSIVNELHKQNKWIAGICAGTSLLHAAGVLNKKK----FSTSLTSDEKQLAHLHEWEYKQNKDVTVDGKIIT 180
>gi|167040018|ref|YP_001663003.1| PfpI family intracellular peptidase [Thermoanaerobacter sp. X514] >gi|166854258|gb|ABY92667.1| intracellular protease, PfpI family [Thermoanaerobacter sp. X514] (168 aa)
Score = 103, Expect = 3.8e-03, Identities = 37/151 (24%), Positives = 66/151 (43%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           K+  L  + +++ E+  L   ++  ++   +    PE  ++ TG+  + + +    K+    DYD + IPGGY    +R+    I  VKE     K + AIC  P  +A    +K  +    +S  D   +   +  +  V     LIT R P
  S:     3 KIAILIENMYEEPEL--LYPYYRLKEEGYEVHLIGPEKDKVYTGKHGYPMKSTHASKDVKAEDYDAVIIPGGYSPDHMRRCNDTINFVKEMDKLQKTIAAICHGPWIMASACNLKGKKVTSFFSIKDDLINAGAQYVDEEVVVDGNLITSRTP 153
>gi|114707002|ref|ZP_01439901.1| proteinase [Fulvimarina pelagi HTCC2506] >gi|114537552|gb|EAU40677.1| proteinase [Fulvimarina pelagi HTCC2506] (258 aa)
Score = 103, Expect = 4.0e-03, Identities = 32/100 (32%), Positives = 49/100 (49%)
  Q:    53 KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKD---------FNTHVYRSNKLITGRCP 152
           K +    V DYD L +PGG     +LR   K ++ V+EF ++ K + AIC AP  L + ++++           D+T  K I+           +  V     LIT R P
  S:   133 KQLSEIRVTDYDALVLPGGQINPDVLRADPKVVSFVREFFNSKKPLAAICHAPWLLIEADVVR---------GRDVTSYKSIRTDIVNAGGNWLDQEVVCHEALITSRNP 233
>gi|42781363|ref|NP_978610.1| DJ-1/PfpI family protein [Bacillus cereus ATCC 10987] >gi|42737285|gb|AAS41218.1| DJ-1/PfpI family [Bacillus cereus ATCC 10987] (193 aa)
Score = 103, Expect = 4.0e-03, Identities = 41/138 (29%), Positives = 69/138 (50%)
  Q:    44 TGQFDIANIKTIKNFNVNDYDVLYIPGGY-GATLLRQ--SKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDF-----NTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMG 181
           T  F I   KT+ N  ++++D L IPGG+  A   R   SK+ +  ++ F    K + +IC A  AL    ++   +K  ++S       +++K+F     N  + +   +IT   P    D+AF  LE +  K  +  +K  LMG
  S:    49 TWNFTIIPEKTVDNIQLDEFDALAIPGGFEEAGFYRDAYSKEFLHVIQHFHVKQKPIASICVASLALGKSGILI-GKKATTYSHPTSERKEQLKNFGAKVQNDLIVQDGNIITSSNPGTAFDVAFLLLEKLTSKQNAKHVK-DLMG 192
>gi|191163449|ref|ZP_03025323.1| intracellular protease, PfpI family [Geobacter sp. M21] >gi|190995394|gb|EDV70848.1| intracellular protease, PfpI family [Geobacter sp. M21] (169 aa)
Score = 103, Expect = 4.1e-03, Identities = 32/114 (28%), Positives = 52/114 (45%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           MK L L+   F+D E+  L+ +++  +    +D  S E    + G+  +++   K        DY VL +PGG     +R S       + F+ + K V AIC  P  L    L+K
  S:     1 MKALILSADNFEDTEL--LVPLYRLREAGYTVDVAS-EKAGSIHGKHGYEVPVNKLFNEVTPADYAVLVLPGGKAPAAIRNSPAVHEIARAFMSSSKPVAAICHGPQILISAGLLK 113
>gi|114328518|ref|YP_745675.1| AraC family transcriptional regulator [Granulibacter bethesdensis CGDNIH1] >gi|114316692|gb|ABI62752.1| transcriptional regulator, AraC family [Granulibacter bethesdensis CGDNIH1] (228 aa)
Score = 103, Expect = 4.1e-03, Identities = 25/116 (21%), Positives = 55/116 (47%)
  Q:    64 DVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKL 179
           DV+ IPGG G   L + ++ ++ + +  +  ++V ++C     L    L++  +    W++ D   +   +     V R  KL+TG      LDLA   +  + G+  +  +++++
  S:    64 DVICIPGGRGINALLEDREVLSWLVKQAETARFVCSVCTGALVLGAAGLLRGKKATTYWAAHDFLAAFGAEPVQARVVRDGKLLTGGGVTAGLDLALSVIAAMSGEALAQSVQLQM 179
>gi|163745206|ref|ZP_02152566.1| Peptidase C56, PfpI [Oceanibulbus indolifex HEL-45] >gi|161382024|gb|EDQ06433.1| Peptidase C56, PfpI [Oceanibulbus indolifex HEL-45] (186 aa)
Score = 103, Expect = 4.2e-03, Identities = 24/60 (40%), Positives = 37/60 (61%)
  Q:    55 IKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           +K+  V+DY  + +PGG     LLR +K  +A +++F D+ K V AIC AP  L +  +IK
  S:    64 LKDVVVDDYHGIVLPGGQINPDLLRANKDAVALIRKFHDSGKTVAAICHAPWLLIEAGIIK 124
>gi|152994717|ref|YP_001339552.1| ThiJ/PfpI domain-containing protein [Marinomonas sp. MWYL1] >gi|150835641|gb|ABR69617.1| ThiJ/PfpI domain protein [Marinomonas sp. MWYL1] (229 aa)
Score = 103, Expect = 4.2e-03, Identities = 22/71 (30%), Positives = 43/71 (60%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKY 119
           IAN + + +   +D+D ++ PGG+G    L ++++ IA ++ FI  +K + ++C AP+A    N+   D +Y
  S:    83 IANTQKLSDVKQDDFDAIFYPGGHGPLWDLTENEESIALIESFIAANKPISSVCHAPSAFL--NIKDADGEY 152
>gi|170789555|gb|EDT30599.1| intracellular protease 1 [Oligotropha carboxidovorans OM5] (186 aa)
Score = 103, Expect = 4.2e-03, Identities = 35/100 (35%), Positives = 50/100 (50%)
  Q:    53 KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS---------GDITDSKRIKDFNTHVYRSNKLITGRCP 152
           KT+   +  DYD L +PGG     LLR   K +A +K+  +  K + A+C AP  L +  +IK  +K  S+ S         G   DS+ + D          LIT R P
  S:    61 KTLDQVSAADYDALVLPGGQINPDLLRVEPKALAFIKDIYNQKKVLAAVCHAPWLLIETGIIK-GKKATSYKSIKTDVMNAGGKWEDSEVVNDLG--------LITSRNP 161
>gi|31544415|ref|NP_852993.1| hypothetical protein MGA_0998 [Mycoplasma gallisepticum R] >gi|31541259|gb|AAP56561.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (193 aa)
Score = 103, Expect = 4.2e-03, Identities = 42/175 (24%), Positives = 85/175 (48%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVT--GQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDND----KWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGL 175
           +++ A+  +   DLE++    +++ ++    +D+ S E    VT      I    TI   N+  Y+ +Y+PGG G+      +K    + +F + D    ++++AI ++P  L +  L++  +   S    D   S    D  T+V  S+ +IT R     +D A  +++++  K  +D L
  S:     9 IRIAAIVATGVDDLELIIPTDLWRRARFI--VDYISIEKKNSVTLAQGTSIKCGLTIDKSNLMQYNAIYLPGGLGSKRFGDDQKLTHYLSKFNEKDQTTPRYILAINESPIILKNLGLLEGKKVVASKEHKDAIGSNF--DSKTNVLLSDNIITARATGHAIDFAIETVKILASKKEADDL 185
>gi|32475721|ref|NP_868715.1| putative intracellular proteinase [Rhodopirellula baltica SH 1] >gi|32446264|emb|CAD76092.1| conserved hypothetical protein-putative intracellular proteinase [Rhodopirellula baltica SH 1] (190 aa)
Score = 103, Expect = 4.2e-03, Identities = 30/94 (31%), Positives = 44/94 (46%)
  Q:    21 SIFKASQKFERIDFYS--PENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           S+  A   FE    YS  P +   +T  FD    +T        +D L IPGG     LR ++K +  V+ F D +K + A+C  P  LA   ++K
  S:    43 SVATAIHDFEGHQTYSEKPGHRFAITADFDGLQPET--------FDALVIPGGRAPEYLRLNEKVLDIVRHFADQNKPIAAVCHGPQVLAAAGVLK 130
>gi|167037371|ref|YP_001664949.1| PfpI family intracellular peptidase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856205|gb|ABY94613.1| intracellular protease, PfpI family [Thermoanaerobacter pseudethanolicus ATCC 33223] (168 aa)
Score = 103, Expect = 4.2e-03, Identities = 37/151 (24%), Positives = 65/151 (43%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           K   L  + +++ E+  L   ++  ++   +    PE  ++ TG+  + + +    K+    DYD + IPGGY    +R+    I  VKE     K + AIC  P  +A    +K  +    +S  D   +   +  +  V     LIT R P
  S:     3 KFAILIENMYEEPEL--LYPYYRLKEEGYEVHLIGPEKDKVYTGKHGYPMKSTHASKDIKAEDYDAVIIPGGYSPDYMRRCNDTINFVKEMDKLQKPIAAICHGPWIMASACNLKGKRVTSFFSIKDDLINAGAQYVDEEVVVDGNLITSRTP 153
>gi|16077852|ref|NP_388666.1| hypothetical protein BSU07850 [Bacillus subtilis subsp. subtilis str. 168] >gi|6016158|sp|P80876|GS18_BACSU General stress protein 18 (GSP18) >gi|2626825|dbj|BAA23403.1| YfkM [Bacillus subtilis] >gi|2633109|emb|CAB12614.1| yfkM [Bacillus subtilis subsp. subtilis str. 168] (172 aa)
Score = 103, Expect = 4.4e-03, Identities = 28/97 (28%), Positives = 45/97 (46%)
  Q:    11 FQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           F+D E       FK A  +   I+    + ++   G  ++    +I + N +D+D L IPGG+    LR   + +   K F+ + K V AIC  P  L
  S:    13 FEDSEYTEPAKAFKEAGHELTVIEKEKGKTVKGKQGTAEVTVDASIDDVNSSDFDALLIPGGFSPDQLRADDRFVQFTKAFMTDKKPVFAICHGPQLL 110
>gi|154151074|ref|YP_001404692.1| PfpI family intracellular peptidase [Candidatus Methanoregula boonei 6A8] >gi|153999626|gb|ABS56049.1| intracellular protease, PfpI family [Candidatus Methanoregula boonei 6A8] (168 aa)
Score = 103, Expect = 4.4e-03, Identities = 22/72 (30%), Positives = 34/72 (47%)
  Q:    53 KTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           K  ++   +D+D L+IPGGY    LR     +    +F +  K V AIC A   L    ++K  ++   W S
  S:    54 KAARDVTADDFDALFIPGGYSPDRLRADANAVRFAADFFEKKKPVFAICHAAQLLITAQVLK-GRRVTGWMS 124
>gi|54026332|ref|YP_120574.1| putative protease [Nocardia farcinica IFM 10152] >gi|54017840|dbj|BAD59210.1| putative protease [Nocardia farcinica IFM 10152] (185 aa)
Score = 103, Expect = 4.4e-03, Identities = 29/94 (30%), Positives = 51/94 (54%)
  Q:    31 RIDFYSPENLEMVTGQFDIANIKTIK------NFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           R+   +P+  ++ T Q D+   + ++        + +D+DVL +PGG   A  LR   + +A  K+F    K + AIC  P  LA+ +L+  D+   S+ S
  S:    36 RVTHAAPKPEQVQTFQHDLDPAQAVEPDSALDGVDADDFDVLVVPGGTVNADKLRLEDRAVALAKDFAGAGKPIAAICHGPWLLAEADLV-SDKTLTSYPS 135
>gi|78223612|ref|YP_385359.1| peptidase C56, PfpI [Geobacter metallireducens GS-15] >gi|78194867|gb|ABB32634.1| Peptidase C56, PfpI [Geobacter metallireducens GS-15] (167 aa)
Score = 103, Expect = 4.6e-03, Identities = 36/152 (23%), Positives = 67/152 (44%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           MK L +++ +F+D E++A    ++  ++   +D  S      +TG+  +++   K++   N   Y +L +PGG     +R+    +   + F  ++K V AIC  P  L    L+   +     S  D          ++ V     LIT R P
  S:     1 MKALIISVDQFEDSELLA--PYYRLLEEGIPVDIASIHR-GTITGKHGYEVQADKSLAEVNPEGYALLVLPGGKAPAAVRKEPAALEICRSFFAHNKPVAAICHGPQILISAGLLSGRRATCYQSVADEMRGAGALYEDSEVVVDGNLITSRQP 151
>gi|91978428|ref|YP_571087.1| peptidase C56, PfpI [Rhodopseudomonas palustris BisB5] >gi|91684884|gb|ABE41186.1| Peptidase C56, PfpI [Rhodopseudomonas palustris BisB5] (187 aa)
Score = 102, Expect = 4.7e-03, Identities = 47/165 (28%), Positives = 79/165 (47%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFD-----IANIKTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           ++L L    F+  E+       KA+    ++D  SPE  E+   +       +   K +     +DYD + +PGG     LLR +   +  +K F D  K V A+C AP  L +  + K  +K  S++S   D+ ++   K  ++ V   N +IT R P    DL  +S ++I
  S:     9 RVLILATHGFEQSELEVPRDRLKAAGA--QVDIVSPEQGEIKGWEGKDWGRPVKVDKALSAVKADDYDAIVLPGGQINPDLLRVNADALKLIKSFFDAGKTVAAVCHAPWLLIEAGIAK-GRKMTSYNSIKQDVINAG-AKWEDSAVVTDNGVITSRNPG---DLEAFSDKII 174
>gi|168208769|ref|ZP_02634394.1| DJ-1 family protein [Clostridium perfringens B str. ATCC 3626] >gi|170713222|gb|EDT25404.1| DJ-1 family protein [Clostridium perfringens B str. ATCC 3626] (191 aa)
Score = 102, Expect = 4.7e-03, Identities = 37/114 (32%), Positives = 64/114 (56%)
  Q:    53 KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           K I + ++  YD + +PGG  GAT LR +++  + +K++   +K V AIC AP ALA   +I E +K  S+     ++ +   +++ +T V   N +IT R P   L    + LE++
  S:    54 KLISDNDLETYDAIVLPGGMPGATNLRDNERVQSLIKKYNKENKIVAAICAAPIALAKAGVI-EGKKVTSYPGFKEELGNVNYVEE-DTVVVDGN-IITSRGPATAL---VFGLEIL 164
>gi|168215694|ref|ZP_02641319.1| DJ-1 family protein [Clostridium perfringens NCTC 8239] >gi|182381974|gb|EDT79453.1| DJ-1 family protein [Clostridium perfringens NCTC 8239] (191 aa)
Score = 102, Expect = 4.8e-03, Identities = 38/114 (33%), Positives = 61/114 (53%)
  Q:    53 KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS-GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           K I + ++  YD + +PGG  G+T LR ++K  + +K++   +K V AIC AP ALA   +I E +K  S+    D   +    + +T V   N +IT R P   L    + LE++
  S:    54 KLISDNDLETYDAIVLPGGMPGSTNLRDNEKVQSLIKKYNKENKIVAAICAAPIALAKAGVI-EGKKVTSYPGFKDELGNVNYVEEDTVVVDGN-IITSRGPATAL---VFGLEIL 164
>gi|195962357|ref|ZP_03098562.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia spielmanii A14S] (184 aa)
Score = 102, Expect = 4.8e-03, Identities = 38/166 (22%), Positives = 77/166 (46%)
  Q:    11 FQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLK 176
           F+D+E +  + I +      ++   +  N+   +     +    I N   N +D++ +PGG  GAT L  SK+    +K+     K++ AIC +P  +     +    K+  +     ++ D + +   + +V RSN  IT +    + + AF  LE++ G+   + +K
  S:    11 FEDIEAIIPIDILRRGNVNVQVISVNDSNVVTSSKGVSFSTDDVISNCKENCFDLIILPGGMPGATNLFNSKELDLILKDMNAKGKFIAAICASPVVVLAAKGLLGLNKFTCYPGLEKNVLDGEFV---DKNVVRSNNFITSKGVGTSFEFAFTLLEIVKGRQIMENVK 176
>gi|166031011|ref|ZP_02233840.1| hypothetical protein DORFOR_00692 [Dorea formicigenerans ATCC 27755] >gi|166029278|gb|EDR48035.1| hypothetical protein DORFOR_00692 [Dorea formicigenerans ATCC 27755] (187 aa)
Score = 102, Expect = 5.0e-03, Identities = 32/113 (28%), Positives = 61/113 (53%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKT---IKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L    F+++E + ++ + + ++ +  +D  S  +   V G   I  ++T   I   +  + D++ +PGG  G T L++ +     V+E  D+ ++V AIC AP  LAD  L+K
  S:     7 KVTVLLADGFEEIEALTVVDLLRRAKVY--VDTVSITDDYTVRGAHGIP-VQTEDLITEIDFKESDMIVLPGGMPGTTNLKEDENVRKAVQEAYDDGRYVAAICAAPTILADMGLLK 120
>gi|39934376|ref|NP_946652.1| intracellular protease [Rhodopseudomonas palustris CGA009] >gi|39648225|emb|CAE26744.1| putative intracellular protease, PfpI family [Rhodopseudomonas palustris CGA009] (187 aa)
Score = 102, Expect = 5.0e-03, Identities = 43/136 (31%), Positives = 72/136 (52%)
  Q:    31 RIDFYSPENLEMV--TGQFDIANI----KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           ++D  SPE  E+   +G+ D  ++    K +     +DYD + +PGG     LLR ++  +  +K   D  K V A+C AP  L D  + K  +K  S++S   D+ ++   K  ++ V   N +IT R P    DL  +S ++I
  S:    36 QVDIVSPEQGEIRGWSGK-DWGHLVKVDKLLSAVKADDYDAIVLPGGQINPDLLRVNQDALKLIKSLFDAGKTVAAVCHAPWLLIDTGIAK-GRKMTSYNSIKQDVINAG-AKWEDSAVVTDNGVITSRNPG---DLEAFSAKII 174
>gi|18311049|ref|NP_562983.1| DJ-1 family protein [Clostridium perfringens str. 13] >gi|18145731|dbj|BAB81773.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein [Clostridium perfringens str. 13] (193 aa)
Score = 102, Expect = 5.1e-03, Identities = 37/114 (32%), Positives = 64/114 (56%)
  Q:    53 KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           K I + ++  YD + +PGG  GAT LR +++  + +K++   +K V AIC AP ALA   +I E +K  S+     ++ +   +++ +T V   N +IT R P   L    + LE++
  S:    56 KLISDNDLETYDAIILPGGMPGATNLRDNERVQSLIKKYNKENKIVAAICAAPIALAKAGVI-EGKKVTSYPGFKEELGNVNYVEE-DTVVVDGN-IITSRGPATAL---VFGLEIL 166
>gi|86135177|ref|ZP_01053759.1| proteinase [Tenacibaculum sp. MED152] >gi|85822040|gb|EAQ43187.1| proteinase [Polaribacter dokdonensis MED152] (186 aa)
Score = 102, Expect = 5.1e-03, Identities = 34/100 (34%), Positives = 53/100 (53%)
  Q:    53 KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCP 152
           KT+   +  DY+ L +PGG     +LR+ +  I  ++ F  N K V AIC AP  LA+  ++ E ++  S+SS   DI ++  I   +  V     L+T R P
  S:    62 KTLNEVSQEDYNALVLPGGVINPDVLRREESAIDFIRSFFKNHKPVAAICHAPWLLAETGVL-EGREVTSFSSIKTDIINAGAIWS-DKEVVVDAGLVTSRNP 162
>gi|53716956|ref|YP_106014.1| DJ-1/PfpI family protein [Burkholderia mallei ATCC 23344] >gi|53721748|ref|YP_110733.1| peptidase [Burkholderia pseudomallei K96243] >gi|67643338|ref|ZP_00442085.1| COG0693: Putative intracellular protease/amidase [Burkholderia mallei GB8 horse 4] >gi|76819780|ref|YP_337446.1| peptidase [Burkholderia pseudomallei 1710b] >gi|121596827|ref|YP_990134.1| DJ-1/PfpI family protein [Burkholderia mallei SAVP1] >gi|124381237|ref|YP_001023949.1| DJ-1/PfpI family protein [Burkholderia mallei NCTC 10229] >gi|126444635|ref|YP_001062060.1| DJ-1/PfpI family protein [Burkholderia pseudomallei 668] >gi|126446290|ref|YP_001078675.1| DJ-1/PfpI family protein [Burkholderia mallei NCTC 10247] >gi|126455707|ref|YP_001075012.1| DJ-1/PfpI family protein [Burkholderia pseudomallei 1106a] >gi|134278992|ref|ZP_01765705.1| DJ-1/PfpI family protein [Burkholderia pseudomallei 305] >gi|161354083|ref|ZP_02099964.1| DJ-1/PfpI family protein [Burkholderia pseudomallei 1106b] >gi|161368752|ref|ZP_02108322.1| DJ-1/PfpI family protein [Burkholderia pseudomallei 1710a] >gi|167001463|ref|ZP_02267260.1| DJ-1/PfpI family protein [Burkholderia mallei PRL-20] >gi|167722942|ref|ZP_02406178.1| DJ-1/PfpI family protein [Burkholderia pseudomallei DM98] >gi|167741926|ref|ZP_02414700.1| DJ-1/PfpI family protein [Burkholderia pseudomallei 14] >gi|167819106|ref|ZP_02450786.1| DJ-1/PfpI family protein [Burkholderia pseudomallei 91] >gi|167827487|ref|ZP_02458958.1| DJ-1/PfpI family protein [Burkholderia pseudomallei 9] >gi|167848961|ref|ZP_02474469.1| DJ-1/PfpI family protein [Burkholderia pseudomallei B7210] >gi|167897564|ref|ZP_02484966.1| DJ-1/PfpI family protein [Burkholderia pseudomallei 7894] >gi|167905917|ref|ZP_02493122.1| DJ-1/PfpI family protein [Burkholderia pseudomallei NCTC 13177] >gi|167914225|ref|ZP_02501316.1| DJ-1/PfpI family protein [Burkholderia pseudomallei 112] >gi|167922137|ref|ZP_02509228.1| DJ-1/PfpI family protein [Burkholderia pseudomallei BCC215] >gi|194317417|ref|YP_002013166.1| DJ-1/PfpI family protein [Burkholderia mallei ATCC 10399] >gi|194502383|ref|YP_002031960.1| DJ-1/PfpI family protein [Burkholderia pseudomallei 1655] >gi|194508912|ref|YP_002021444.1| DJ-1/PfpI family protein [Burkholderia pseudomallei Pasteur 52237] >gi|194519919|ref|YP_002055168.1| DJ-1/PfpI family protein [Burkholderia pseudomallei S13] >gi|194524469|ref|YP_002060000.1| DJ-1/PfpI family protein [Burkholderia mallei FMH] >gi|194530409|ref|YP_002065929.1| DJ-1/PfpI family protein [Burkholderia mallei JHU] >gi|194568052|ref|YP_002103059.1| DJ-1/PfpI family protein [Burkholderia pseudomallei 406e] >gi|194576491|ref|YP_002111373.1| DJ-1/PfpI family protein [Burkholderia mallei 2002721280] >gi|52212162|emb|CAH38179.1| family C56 unassigned peptidase [Burkholderia pseudomallei K96243] >gi|52422926|gb|AAU46496.1| DJ-1/PfpI family protein [Burkholderia mallei ATCC 23344] >gi|76584253|gb|ABA53727.1| family C56 unassigned peptidase [Burkholderia pseudomallei 1710b] >gi|121224625|gb|ABM48156.1| DJ-1/PfpI family protein [Burkholderia mallei SAVP1] >gi|124289257|gb|ABM98526.1| DJ-1/PfpI family protein [Burkholderia mallei NCTC 10229] >gi|126224126|gb|ABN87631.1| DJ-1/PfpI family protein [Burkholderia pseudomallei 668] >gi|126229475|gb|ABN92888.1| DJ-1/PfpI family protein [Burkholderia pseudomallei 1106a] >gi|126239144|gb|ABO02256.1| DJ-1/PfpI family protein [Burkholderia mallei NCTC 10247] >gi|134249411|gb|EBA49492.1| DJ-1/PfpI family protein [Burkholderia pseudomallei 305] >gi|147748479|gb|EDK55554.1| DJ-1/PfpI family protein [Burkholderia mallei FMH] >gi|147754419|gb|EDK61483.1| DJ-1/PfpI family protein [Burkholderia mallei JHU] >gi|148025624|gb|EDK83747.1| DJ-1/PfpI family protein [Burkholderia mallei 2002721280] >gi|157810229|gb|EDO87399.1| DJ-1/PfpI family protein [Burkholderia pseudomallei 406e] >gi|157937433|gb|EDO93103.1| DJ-1/PfpI family protein [Burkholderia pseudomallei Pasteur 52237] >gi|160695310|gb|EDP85280.1| DJ-1/PfpI family protein [Burkholderia mallei ATCC 10399] >gi|169649942|gb|EDS82635.1| DJ-1/PfpI family protein [Burkholderia pseudomallei S13] >gi|184213622|gb|EDU10665.1| DJ-1/PfpI family protein [Burkholderia pseudomallei 1655] (226 aa)
Score = 102, Expect = 5.5e-03, Identities = 20/63 (31%), Positives = 37/63 (58%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
            Q  +A+ + + + +++DYD ++ PGG+G    L + +  IA ++  I  +K V A+C AP  L
  S:    76 AQAALASTRKLADVSIDDYDAVFYPGGHGPLWDLAEDRHSIALIERAIATNKPVAAVCHAPGVL 139
>gi|110799272|ref|YP_696747.1| DJ-1 family protein [Clostridium perfringens ATCC 13124] >gi|168212896|ref|ZP_02638521.1| DJ-1 family protein [Clostridium perfringens CPE str. F4969] >gi|110673919|gb|ABG82906.1| DJ-1 family protein [Clostridium perfringens ATCC 13124] >gi|170715639|gb|EDT27821.1| DJ-1 family protein [Clostridium perfringens CPE str. F4969] (191 aa)
Score = 102, Expect = 5.7e-03, Identities = 37/114 (32%), Positives = 64/114 (56%)
  Q:    53 KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           K I + ++  YD + +PGG  G+T LR ++K  + +K++   +K V AIC AP ALA   +I E +K  S+     ++ +   +++ +T V   N +IT R P   L    + LE++
  S:    54 KLISDNDLETYDAIVLPGGMPGSTNLRDNEKVQSLIKKYNKENKIVAAICAAPIALAKAGVI-EGKKVTSYPGFKEELGNVNYVEE-DTVVVDGN-IITSRGPATAL---VFGLEIL 164
>gi|194883232|ref|XP_001975707.1| GG22458 [Drosophila erecta] >gi|190658894|gb|EDV56107.1| GG22458 [Drosophila erecta] (217 aa)
Score = 102, Expect = 5.8e-03, Identities = 38/111 (34%), Positives = 53/111 (47%)
  Q:    62 DYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVI-AICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDF-----NTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFS 172
           DYDVL +PGG        S   +  V    D+   +I AIC AP ALA H + +   K I+ S  D+    ++KD      +  V +   LIT R P  T D A    E + G + +
  S:    93 DYDVLVLPGGLAGNKALMSSSAVGEVLRCQDSKGGLIAAICAAPTALAKHGIGR--GKSIT-SHPDM--KPQLKDLYCYIDDKTVVQDGNLITSRGPGTTFDFALKITEQLVGAEVA 204
>gi|145596702|ref|YP_001160999.1| PfpI family intracellular peptidase [Salinispora tropica CNB-440] >gi|145306039|gb|ABP56621.1| intracellular protease, PfpI family [Salinispora tropica CNB-440] (187 aa)
Score = 102, Expect = 5.8e-03, Identities = 30/91 (32%), Positives = 46/91 (50%)
  Q:    62 DYDVLYIPGGYG-ATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCP 152
           DYD L +PGG      LR     +  V+ F+++ K V AIC  P  L + N+++  +   SW S   D+ ++      +  V+  N LIT R P
  S:    72 DYDALVLPGGVANPDFLRADANVVRFVRTFVESGKPVAAICHGPWTLVEANVVR-GRTLTSWPSLRTDLVNAGATW-VDQEVFVDNGLITSRRP 163
>gi|121606754|ref|YP_984083.1| PfpI family intracellular peptidase [Polaromonas naphthalenivorans CJ2] >gi|120595723|gb|ABM39162.1| intracellular protease, PfpI family [Polaromonas naphthalenivorans CJ2] (193 aa)
Score = 102, Expect = 6.0e-03, Identities = 21/62 (33%), Positives = 31/62 (50%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKE 115
           +  +  V  YD L +PGG G   LR     +A V+ F + +K V A+C     LA   ++KE
  S:    72 SFADIQVESYDALVVPGGRGPEYLRTYPAVVAMVRHFFEANKPVAAVCHGAQLLAGAGVLKE 133
>gi|167578411|ref|ZP_02371285.1| DJ-1/PfpI family protein [Burkholderia thailandensis TXDOH] >gi|167616550|ref|ZP_02385181.1| DJ-1/PfpI family protein [Burkholderia thailandensis Bt4] (227 aa)
Score = 101, Expect = 6.1e-03, Identities = 20/63 (31%), Positives = 37/63 (58%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
            Q  +A+ + + + +++DYD ++ PGG+G    L + +  IA ++  I  +K V A+C AP  L
  S:    76 AQAALASTRKLADVSIDDYDAVFYPGGHGPLWDLAEDRHSIALIERAIARNKPVAAVCHAPGVL 139
>gi|83718124|ref|YP_439894.1| DJ-1/PfpI family protein [Burkholderia thailandensis E264] >gi|83651949|gb|ABC36013.1| DJ-1/PfpI family protein [Burkholderia thailandensis E264] (227 aa)
Score = 101, Expect = 6.1e-03, Identities = 20/63 (31%), Positives = 37/63 (58%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
            Q  +A+ + + + +++DYD ++ PGG+G    L + +  IA ++  I  +K V A+C AP  L
  S:    76 AQAALASTRKLADVSIDDYDAVFYPGGHGPLWDLAEDRHSIALIERAIARNKPVAAVCHAPGVL 139
>gi|20807466|ref|NP_622637.1| putative intracellular protease/amidase [Thermoanaerobacter tengcongensis MB4] >gi|20515992|gb|AAM24241.1| putative intracellular protease/amidase [Thermoanaerobacter tengcongensis MB4] (168 aa)
Score = 101, Expect = 6.1e-03, Identities = 36/152 (23%), Positives = 65/152 (42%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFD--IANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           MK +A+ +    + E   L   ++  ++   +     E  ++ TG++   + +    K    +DYD + IPGGY    +R+ +  +  VKE     K + AIC  P  +A    +K  +    +S  D   +   +  +  V     LIT R P
  S:     1 MKRVAILIENLYE-EPELLYPYYRLKEEGYEVHLVGTEKDKVYTGKYGYPMKSTHASKEVKADDYDAVVIPGGYSPDHMRRCQDTVNFVKEMCQQQKIIAAICHGPWMMASSCDLKGKRVTSFFSIKDDLINAGAQYVDEEVVIDGNLITSRTP 153
>gi|167932754|ref|ZP_02519841.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi 156a] (184 aa)
Score = 101, Expect = 6.4e-03, Identities = 40/166 (24%), Positives = 77/166 (46%)
  Q:    11 FQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLK 176
           F+D+E +  + I +      +I   +  N+ + +          I N   N +D++ +PGG  GAT L  SK+    +K+     K++ AIC +P  +     +    K+  +     ++ D + + +   +V RSN  IT +    + + AF  LE++ GK   + +K
  S:    11 FEDIEAIVPIDILRRGNVNIQIISTNDSNVVISSKGVSFLADDIISNCKENCFDLIILPGGMPGATNLFNSKELDLILKDMNSKGKFIAAICASPVVVLAAKGLLGFNKFTCYPGLEKNVLDGEFVDE---NVVRSNNFITSKGVGTSFEFAFTLLEMVKGKQIMEDVK 176
>gi|172056574|ref|YP_001813034.1| PfpI family intracellular peptidase [Exiguobacterium sibiricum 255-15] >gi|171989095|gb|ACB60017.1| intracellular protease, PfpI family [Exiguobacterium sibiricum 255-15] (170 aa)
Score = 101, Expect = 6.5e-03, Identities = 19/61 (31%), Positives = 34/61 (55%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           TI   + +D+D L IPGG+   LLR+  + +   +EF  + K + +IC  P  + +  ++K
  S:    57 TIDETSSSDFDALLIPGGFSPDLLREDDRFVTFTEEFDTSKKPIFSICHGPQLMINAKIVK 117
>gi|62424798|ref|ZP_00379939.1| COG0693: Putative intracellular protease/amidase [Brevibacterium linens BL2] (177 aa)
Score = 101, Expect = 6.5e-03, Identities = 34/94 (36%), Positives = 47/94 (50%)
  Q:    59 NVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQ--KYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           +V+D+D L +PGG   +  LR ++  +  VK F   DK V AIC AP  LA+  + K  +   +IS  +  I       D  T V     LIT R P
  S:    68 SVDDFDALVLPGGTLNSDALRLNEDAVNLVKAFFAADKPVAAICHAPWILAEAGVAKGRKLTSFISTKTDLINAGADWAD--TEVVVDGNLITSRSP 162
>gi|182623906|ref|ZP_02951694.1| DJ-1 family protein [Clostridium perfringens D str. JGS1721] >gi|177910799|gb|EDT73153.1| DJ-1 family protein [Clostridium perfringens D str. JGS1721] (191 aa)
Score = 101, Expect = 6.6e-03, Identities = 37/114 (32%), Positives = 64/114 (56%)
  Q:    53 KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           K I + ++  YD + +PGG  G+T LR ++K  + +K++   +K V AIC AP ALA   +I E +K  S+     ++ +   +++ +T V   N +IT R P   L    + LE++
  S:    54 KLISDDDLETYDAIVLPGGMPGSTNLRDNEKVQSLIKKYNKENKIVAAICAAPIALAKAGVI-EGKKVTSYPGFKEELGNVNYVEE-DTVVVDGN-IITSRGPATAL---VFGLEIL 164
>gi|192811860|ref|ZP_03040529.1| intracellular protease, PfpI family [Geobacillus sp. Y412MC10] >gi|192799007|gb|EDV75518.1| intracellular protease, PfpI family [Geobacillus sp. Y412MC10] (168 aa)
Score = 101, Expect = 7.0e-03, Identities = 32/113 (28%), Positives = 49/113 (43%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFK-ASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L   +F+D EM       K A  + + I     + ++   G+      K I + N+NDYD + IPGG     LR     +  V       K + +IC  P  LA  +L+K
  S:     3 KVAFLLADQFEDSEMKTPYDAVKEAGHQADIIGLKQGQEVKGKQGKASYTTDKAIADVNINDYDAVVIPGGSSPENLRLDSHILQFVAAADKAGKPIASICHGPQILASADLLK 116
>gi|154147989|ref|YP_001407156.1| protein ThiJ [Campylobacter hominis ATCC BAA-381] >gi|153803998|gb|ABS51005.1| protein ThiJ [Campylobacter hominis ATCC BAA-381] (182 aa)
Score = 101, Expect = 7.0e-03, Identities = 32/125 (25%), Positives = 61/125 (48%)
  Q:    58 FNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGK 182
           F V+D+D++ +PGG+    +L +S+K    ++EF D    + AIC AP  L    ++K            I  +    D  ++V R   ++T R P   ++ A   ++ + G++  + +K  L+ K
  S:    58 FKVSDFDMILLPGGFKNNEILSKSEKFHKILREFDDKKLKIGAICAAPWVLGSAGVLKNSYTCYPGFEKKINLAGFAGD-KSNVVRDENVMTSRGPATAMEFALAIVKDLAGENVYNEVKAGLLFK 182
>gi|188535162|ref|YP_001908959.1| Heat shock protein (Hsp) 31, subunit of Hsp31 homodimer [Erwinia tasmaniensis] >gi|188030204|emb|CAO98090.1| Heat shock protein (Hsp) 31, subunit of Hsp31 homodimer [Erwinia tasmaniensis] (282 aa)
Score = 101, Expect = 7.0e-03, Identities = 29/80 (36%), Positives = 51/80 (63%)
  Q:    28 KFERIDFYSPENLEMVTGQFD--IANIK-------TIKNFNVN-DYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           KFE   +  P + + +TG FD  +A+ +        +KN   + DY  ++IPGG+GA + L +S+   A ++  +D DK++I++C  P A 
  S:   103 KFEH--WAMPVDDKAITGLFDDYLASFRQPLKLSDVVKNLGADGDYAGVFIPGGHGALIGLPESEDVAAAIRWTLDQDKYLISLCHGPAAF 191
>gi|51892528|ref|YP_075219.1| hypothetical protein STH1390 [Symbiobacterium thermophilum IAM 14863] >gi|51856217|dbj|BAD40375.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM 14863] (193 aa)
Score = 101, Expect = 7.0e-03, Identities = 22/56 (39%), Positives = 31/56 (55%)
  Q:    59 NVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           N  DYD L IPGG     LR + K +A V+ F + +K + AIC     LA  +++K
  S:    77 NPEDYDALVIPGGRAPEYLRLNDKVVAMVRHFGEANKPIAAICHGAQLLAAADVLK 132
>gi|167572522|ref|ZP_02365396.1| DJ-1/PfpI family protein [Burkholderia oklahomensis C6786] (226 aa)
Score = 101, Expect = 7.1e-03, Identities = 23/83 (27%), Positives = 46/83 (55%)
  Q:    25 ASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           A+++F++     PE       Q  +A+ + + + +++DYD ++ PGG+G    L + +  IA ++  +  +K V A+C AP  L
  S:    66 ATRRFDK----DPE------AQSALASTRKLADVSIDDYDAVFYPGGHGPLWDLAEDRHSIALIERAVATNKPVAAVCHAPGVL 139
>gi|152998815|ref|YP_001364496.1| ThiJ/PfpI domain-containing protein [Shewanella baltica OS185] >gi|151363433|gb|ABS06433.1| ThiJ/PfpI domain protein [Shewanella baltica OS185] (230 aa)
Score = 101, Expect = 7.3e-03, Identities = 21/59 (35%), Positives = 33/59 (55%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           +AN   +   N  DYD ++ PGG+G    L + K  IA +++F   +K +  +C AP AL
  S:    82 LANTTRLSEINAADYDAVFYPGGHGPLWDLAEDKHSIALIEQFYQANKPLGLVCHAPAAL 141
>gi|126172523|ref|YP_001048672.1| ThiJ/PfpI domain-containing protein [Shewanella baltica OS155] >gi|125995728|gb|ABN59803.1| ThiJ/PfpI domain protein [Shewanella baltica OS155] (232 aa)
Score = 101, Expect = 7.3e-03, Identities = 21/59 (35%), Positives = 33/59 (55%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           +AN   +   N  DYD ++ PGG+G    L + K  IA +++F   +K +  +C AP AL
  S:    84 LANTTRLSEINAADYDAVFYPGGHGPLWDLAEDKHSIALIEQFYQANKPLGLVCHAPAAL 143
>gi|186456133|ref|ZP_02966446.1| intracellular protease, PfpI family [bacterium Ellin514] >gi|184206906|gb|EDU03952.1| intracellular protease, PfpI family [bacterium Ellin514] (198 aa)
Score = 101, Expect = 7.6e-03, Identities = 35/116 (30%), Positives = 60/116 (51%)
  Q:    59 NVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKD--FNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDG 174
           N +DYD L +PGG      LR +++ +  VK F++  K + AIC  P  L +  +++  ++  S+ S   TD K       +  V   N LIT R P    D+  ++ ++I  ++F +G
  S:    69 NADDYDALLLPGGVMNPDKLRMNQQAVEFVKNFVNAGKPIAAICHGPWTLIETGMVR-GRRMTSYPSVQ-TDLKNAGAEWVDEEVVVDNGLITSRQPS---DIPAFNNKII--EEFGEG 180
>gi|90962573|ref|YP_536489.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Lactobacillus salivarius UCC118] >gi|90821767|gb|ABE00406.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Lactobacillus salivarius UCC118] (189 aa)
Score = 101, Expect = 7.7e-03, Identities = 33/99 (33%), Positives = 51/99 (51%)
  Q:    68 IPGGYG-ATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK-EDQKYISWSSGDITDSK-RIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           +PGG G AT LR S+K  A + +  +  KW  A+C AP ALA + L+K  D         +  D++ R  +    V  + +L+T R P   +  +F   EV+
  S:    68 LPGGMGGATRLRDSEKLQALMVKRAEQGKWNAAMCAAPMALAKYGLLKGHDYTMFPGMHQEHGDAEGRFHEDMVVVDEAARLVTSRGPATAMPYSFKLAEVL 169
>gi|145619103|ref|ZP_01775156.1| intracellular protease, PfpI family [Geobacter bemidjiensis Bem] >gi|144944596|gb|EDJ79668.1| intracellular protease, PfpI family [Geobacter bemidjiensis Bem] >gi|197089770|gb|ACH41041.1| intracellular protease, PfpI family [Geobacter bemidjiensis Bem] (169 aa)
Score = 101, Expect = 7.9e-03, Identities = 39/152 (25%), Positives = 62/152 (40%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           MK L L+   F+D E+  L+ +++  +    +D  S E    + G+  +++   K        DY VL +PGG     +R S       + F+   K V AIC  P  L    L+K  +     S        + +  +  V     LIT R P
  S:     1 MKALILSADNFEDTEL--LVPLYRLREAGYAVDVAS-EKAGSIHGKHGYEVPVNKLFNEVTPADYAVLVLPGGKAPAAIRNSPAVHEIARAFMSASKPVAAICHGPQILISAGLLKGRKATCYESVAPELRDAQAQYQDVEVIVDGNLITSRKP 151
>gi|168205875|ref|ZP_02631880.1| DJ-1 family protein [Clostridium perfringens E str. JGS1987] >gi|170662622|gb|EDT15305.1| DJ-1 family protein [Clostridium perfringens E str. JGS1987] (191 aa)
Score = 100, Expect = 8.0e-03, Identities = 37/114 (32%), Positives = 64/114 (56%)
  Q:    53 KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           K I + ++  YD + +PGG  G+T LR ++K  + +K++   +K V AIC AP ALA   +I E +K  S+     ++ +   +++ +T V   N +IT R P   L    + LE++
  S:    54 KLISDDDLETYDAIVLPGGMPGSTNLRDNEKVQSLIKKYNKENKIVAAICAAPIALAKAGVI-EGKKVTSYPGFKEELGNVNYVEE-DTVVVDGN-IITSRGPATAL---VFGLEIL 164
>gi|17987076|ref|NP_539710.1| protease I [Brucella melitensis 16M] >gi|17982734|gb|AAL51974.1| PROTEASE I [Brucella melitensis 16M] (214 aa)
Score = 100, Expect = 8.0e-03, Identities = 23/55 (41%), Positives = 28/55 (50%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           T  +    +YD L IPGG G   LR  +K IA VK F   +K V A+C     LA
  S:    92 TFADVKPENYDALVIPGGRGPEYLRLDEKVIAVVKHFFAANKPVAAVCHGAQLLA 146
>gi|23502074|ref|NP_698201.1| ThiJ/PfpI family protein [Brucella suis 1330] >gi|148560561|ref|YP_001259116.1| ThiJ/PfpI family protein [Brucella ovis ATCC 25840] >gi|23348032|gb|AAN30116.1| ThiJ/PfpI family protein [Brucella suis 1330] >gi|148371818|gb|ABQ61797.1| ThiJ/PfpI family protein [Brucella ovis ATCC 25840] (194 aa)
Score = 100, Expect = 8.0e-03, Identities = 23/55 (41%), Positives = 28/55 (50%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           T  +    +YD L IPGG G   LR  +K IA VK F   +K V A+C     LA
  S:    72 TFADVKPENYDALVIPGGRGPEYLRLDEKVIAVVKHFFAANKPVAAVCHGAQLLA 126
>gi|62290108|ref|YP_221901.1| ThiJ/PfpI family protein [Brucella abortus bv. 1 str. 9-941] >gi|82700031|ref|YP_414605.1| hypothetical protein BAB1_1219 [Brucella melitensis biovar Abortus 2308] >gi|189024346|ref|YP_001935114.1| Intracellular protease PfpI [Brucella abortus S19] >gi|62196240|gb|AAX74540.1| ThiJ/PfpI family protein [Brucella abortus biovar 1 str. 9-941] >gi|82616132|emb|CAJ11175.1| Family of unknown function ThiJ/PfpI:Intracellular protease PfpI [Brucella melitensis biovar Abortus 2308] >gi|189019918|gb|ACD72640.1| Intracellular protease PfpI [Brucella abortus S19] (194 aa)
Score = 100, Expect = 8.0e-03, Identities = 23/55 (41%), Positives = 28/55 (50%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           T  +    +YD L IPGG G   LR  +K IA VK F   +K V A+C     LA
  S:    72 TFADVKPENYDALVIPGGRGPEYLRLDEKVIAVVKHFFAANKPVAAVCHGAQLLA 126
>gi|119469330|ref|ZP_01612269.1| proteinase [Alteromonadales bacterium TW-7] >gi|119447194|gb|EAW28463.1| proteinase [Alteromonadales bacterium TW-7] (192 aa)
Score = 100, Expect = 8.4e-03, Identities = 44/128 (34%), Positives = 68/128 (53%)
  Q:    25 ASQKFERIDFYSPENLEMVTG-QFDIANIKT--------------------IKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFI--DNDKWVIAICDAPNALADHNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCP 152
           A+  FE+ + +SP +  +  G + +I +IK                     + N N  DYD L +PGG +    LRQ K   A +  F   + +K V AIC AP  LA+ N ++ D+   S+ S   D+ ++      N  V     L+T R P
  S:    19 ATDGFEQSELFSPRDALLNAGAEIEIVSIKEGQITGWNEDKWGEKVSVDKLVTNTNSADYDALMLPGGLFNPDSLRQDKHAKAFIDGFFGAEKNKPVAAICHAPWLLAEINKLR-DRTITSFPSIKSDLMNAG-ANWVNEEVCVDRGLVTSRSP 170
>gi|15890833|ref|NP_356505.1| proteinase [Agrobacterium tumefaciens str. C58] >gi|15159124|gb|AAK89290.1| proteinase [Agrobacterium tumefaciens str. C58] (186 aa)
Score = 100, Expect = 8.4e-03, Identities = 23/70 (32%), Positives = 37/70 (52%)
  Q:    54 TIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS 123
           + K   VND+D L +PGG     +LR  +  +  V++F+ + K V AIC AP  L + + ++       WS
  S:    63 SAKTVKVNDFDALVLPGGQINPDILRHDEDAMRVVRDFVKSGKVVAAICHAPWLLIEADALRGRDATSYWS 133
>gi|94267724|ref|ZP_01290974.1| Peptidase C56, PfpI [delta proteobacterium MLMS-1] >gi|93451886|gb|EAT02619.1| Peptidase C56, PfpI [delta proteobacterium MLMS-1] (172 aa)
Score = 100, Expect = 8.4e-03, Identities = 32/91 (35%), Positives = 43/91 (47%)
  Q:    62 DYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTH---------VYRSNKLITGRCP 152
           D+D L IPGGY    +R+ +  +  V++    DK V AIC A   LA   ++         S   +T    IKD   H         V   +KLIT R P
  S:    67 DFDGLVIPGGYAPDFMRRHEAMVNLVRDMTQQDKVVAAICHAGWMLASAKVL---------SGRTVTSFFAIKDDLIHAGANWVDQEVAEDHKLITSRTP 157
>gi|27467973|ref|NP_764610.1| hypothetical protein SE1055 [Staphylococcus epidermidis ATCC 12228] >gi|27315518|gb|AAO04652.1|AE016747_149 conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] (223 aa)
Score = 100, Expect = 8.5e-03, Identities = 31/106 (29%), Positives = 65/106 (61%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL-----ADHNLIKEDQKYISWSSGD------------ITDSKRIK---------DFNTHVYRSNKLITGRCPVVTLDLA 159
           +I+N N ++YD +Y+PGG+G       ++K    + +F +++K + ++C  P+A      A+++ + +  K  S++  +            +T SK  +         DF +HV +  + ITG+ P  + D+ 
  S:    83 SIENVNADEYDAIYLPGGHGTVYDFANNEKLADILLQFKNSNKIISSVCHGPSAFVGVKDANNHYLVDGVKITSFTDSEEKAMGFENKVPFLTQSKLEEQGANFVVKDDFTSHVEKDGQFITGQNPQSSEDIG 215
>gi|116620003|ref|YP_822159.1| PfpI family intracellular peptidase [Solibacter usitatus Ellin6076] >gi|116223165|gb|ABJ81874.1| intracellular protease, PfpI family [Solibacter usitatus Ellin6076] (237 aa)
Score = 100, Expect = 8.6e-03, Identities = 36/121 (29%), Positives = 60/121 (49%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPE--NLEMVTGQFDIANI---KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISW 122
           ++ AL    F+ +E+V  +   +A+    ++D  S    N+  V      + +   KTI   N +DYD L +PGG+    LLRQS +    V+ F    K + ++C  P  LA   L+ + +   SW
  S:     9 RIAALAADGFEKVELVIPMKALQAAGA--KVDVISLRHGNIRGVNLHEPASRVHVNKTIAEANPDDYDGLLLPGGFINPDLLRQSAEAREFVRAFDRAGKPIASLCHGPWVLASAGLL-QGRTLTSW 132
>gi|177671929|ref|ZP_02944851.1| intracellular protease, PfpI family [Micrococcus luteus NCTC 2665] >gi|172071185|gb|EDT57230.1| intracellular protease, PfpI family [Micrococcus luteus NCTC 2665] (194 aa)
Score = 100, Expect = 8.9e-03, Identities = 41/128 (32%), Positives = 65/128 (50%)
  Q:    47 FDIANIKTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKR--IKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDG 174
           FD+    T+K+    D+D L +PGG   A  +R +K   A V+ F +  K V AIC AP  L +  ++ E ++  S+ S   TD K    +  +  V   N L T R P    DL  ++ +V+  ++ S+G
  S:    66 FDVNT--TVKDAKAEDFDGLVMPGGTLNADAMRVNKDAQAFVRAFFEQHKPVAAICHAPWTLIEAGVV-EGRRLTSYPSLK-TDLKNAGAQWVDEEVVVDNGLTTSRSPD---DLDAFNAKVV--EELSEG 187
>gi|15594966|ref|NP_212755.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi B31] >gi|167943553|ref|ZP_02530627.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi Bol26] >gi|168692407|ref|ZP_02725199.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi 94a] >gi|195941441|ref|ZP_03086823.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi 80a] >gi|195951060|ref|ZP_03092157.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi 29805] >gi|195955617|ref|ZP_03094310.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi CA-11.2a] >gi|195960361|ref|ZP_03096566.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi 64b] >gi|2688544|gb|AAC66975.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi B31] (184 aa)
Score = 100, Expect = 8.9e-03, Identities = 40/166 (24%), Positives = 77/166 (46%)
  Q:    11 FQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLK 176
           F+D+E +  + I +      +I   +  N+ + +          I N   N +D++ +PGG  GAT L  SK+    +K+     K++ AIC +P  +     +    K+  +     ++ D + + +   +V RSN  IT +    + + AF  LE++ GK   + +K
  S:    11 FEDIEAIIPIDILRRGNVNIQIISTNDSNVVISSKGVSFLADDIISNCKENCFDLIILPGGMPGATNLFNSKELDLILKDMNSKGKFIAAICASPVVVLAAKGLLGFNKFTCYPGLEKNVLDGEFVDE---NVVRSNNFITSKGVGTSFEFAFTLLEMVKGKQIMEDVK 176
>gi|16127189|ref|NP_421753.1| ThiJ/PfpI family protein [Caulobacter crescentus CB15] >gi|13424589|gb|AAK24921.1| ThiJ/PfpI family protein [Caulobacter crescentus CB15] (258 aa)
Score = 100, Expect = 9.0e-03, Identities = 30/121 (24%), Positives = 54/121 (44%)
  Q:    59 NVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS-------SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKL 179
           ++   DVL +PGG+G T        IA ++   D  ++V ++C     LA   L+K  +    W+        G + D+ R       V R  + ITG      +D A   +  + G   + G+++ +
  S:    92 DIETCDVLIVPGGFGTTQAMGDPDFIAEIRRLADGARYVCSVCTGSLVLAAAGLLKGKRAACHWAWRDQLALFGAVPDAAR-------VARDGRYITGGGVTAGIDFALTLIAELAGDAVAQGIQLAV 212
>gi|189200318|ref|XP_001936496.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] >gi|187983595|gb|EDU49083.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] (197 aa)
Score = 100, Expect = 9.4e-03, Identities = 37/122 (30%), Positives = 57/122 (46%)
  Q:    62 DYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL--------------ADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGKE 183
           D+DVL +PGG  GA     S   +  + +F    KWV AIC A  AL                H  + E+ K   W   + ++ + + D        +K++T R P   +  A   +E I GK+  D +   +M  E
  S:    70 DFDVLILPGGAPGAKAFCGSDAVLELISKFQKAGKWVAAICAATTALVASTKKFEGAKTTVTSHPSVAEEIKQAGW---EYSEDRIVVD--------DKIVTSRGPGTAILFALTIVEAICGKEKRDEIGGPMMLAE 195
>gi|45358122|ref|NP_987679.1| hypothetical protein MMP0559 [Methanococcus maripaludis S2] >gi|44920879|emb|CAF30115.1| Family of unknown function ThiJ/PfpI [Methanococcus maripaludis S2] (172 aa)
Score = 100, Expect = 9.5e-03, Identities = 31/111 (27%), Positives = 56/111 (50%)
  Q:     3 LLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGA-TLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLI 113
           ++ +   KF+D E+   L +F++     ++   +    + V G+  +   KTI+  N +D+D + I GG G+   L  ++K +  +KEF    K   AIC +P  LA   L+
  S:     5 VMVIAPEKFRDEELFEPLQVFQSKNIATQVVSTTTGQHKGVLGRV-MTTTKTIEGVNPDDFDAIVIVGGGGSRDYLWNNEKLLELLKEFNSMGKITAAICISPAVLAQAGLL 115
>gi|163799546|ref|ZP_02193453.1| intracellular protease, PfpI family [Methanococcus voltae A3] >gi|158973553|gb|EDP41021.1| intracellular protease, PfpI family [Methanococcus voltae A3] (172 aa)
Score = 100, Expect = 1.0e-02, Identities = 44/164 (26%), Positives = 75/164 (45%)
  Q:     3 LLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQF--DIANIKTIKNFNVNDYDVLYIPGGYGA-TLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKR--IKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           L+ +    F+D E+   L + +++ K       S E  E  TG     I   KTI+    +DYD + + GG G+   L  ++  +  V EF D+ K V AIC +P  LA   ++K+    +   +  I + K+  +   +  V     +IT + P    +     LE+I
  S:     4 LVVIAPKDFRDEELFEPLQVIQSTNKIA-TQVVSTEIGEH-TGMLGRKITTNKTIEQVKSSDYDSIIVVGGSGSRDYLWNNETLLKLVNEFNDDKKVVSAICISPVVLAHAGVLKDKNATVFEDAESIEEMKKAGVNLLDDGVVVDGNIITAKGPQFAKEFGMKVLELI 170
>gi|167839246|ref|ZP_02465973.1| DJ-1/PfpI family protein [Burkholderia thailandensis MSMB43] (226 aa)
Score = 100, Expect = 1.0e-02, Identities = 20/63 (31%), Positives = 36/63 (57%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
            Q  +A+ + +   +++DYD ++ PGG+G    L + +  IA ++  I  +K V A+C AP  L
  S:    76 AQAALASTRRLAGVSIDDYDAVFYPGGHGPLWDLAEDRHSIALIERAIATNKPVAAVCHAPGVL 139
>gi|89092195|ref|ZP_01165149.1| hypothetical protein MED92_05268 [Oceanospirillum sp. MED92] >gi|89083283|gb|EAR62501.1| hypothetical protein MED92_05268 [Oceanospirillum sp. MED92] (188 aa)
Score = 100, Expect = 1.0e-02, Identities = 22/54 (40%), Positives = 27/54 (50%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           T  + NV DYD L IPGG     LR + + +  V+ F   DK V AIC     L
  S:    72 TFSDINVADYDALVIPGGRAPEYLRLNDEVLTMVRHFFIEDKPVAAICHGAQLL 125
>gi|195949256|ref|ZP_03090356.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi WI91-23] (184 aa)
Score = 100, Expect = 1.0e-02, Identities = 40/166 (24%), Positives = 77/166 (46%)
  Q:    11 FQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLK 176
           F+D+E +  + I +      +I   +  N+ + +          I N   N +D++ +PGG  GAT L  SK+    +K+     K++ AIC +P  +     +    K+  +     ++ D + + +   +V RSN  IT +    + + AF  LE++ GK   + +K
  S:    11 FEDIEAIIPIDILRRGNVNIQIISTNDSNVVISSKGVSFLADDIISNCKENCFDLIILPGGMPGATNLFNSKELDLILKDMNSKGKFIAAICASPVVVLAAKDLLGFNKFTCYPGLEKNVIDGEFVDE---NVVRSNNFITSKGVGTSFEFAFTLLEMVKGKQIMEDVK 176
>gi|146281261|ref|YP_001171414.1| ThiJ/PfpI family protein [Pseudomonas stutzeri A1501] >gi|145569466|gb|ABP78572.1| ThiJ/PfpI family protein [Pseudomonas stutzeri A1501] (227 aa)
Score = 99, Expect = 1.0e-02, Identities = 21/61 (34%), Positives = 34/61 (55%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALAD 109
           +AN   +   +  D+D ++ PGG+G    L  +   IA ++ F+  DK V A+C AP AL +
  S:    80 LANTYRLDQVSAEDFDAVFYPGGHGPLWDLVNNPTSIALIESFVKADKPVGAVCHAPAALTE 141
>gi|120597058|ref|YP_961632.1| ThiJ/PfpI domain-containing protein [Shewanella sp. W3-18-1] >gi|124545881|ref|ZP_01705031.1| ThiJ/PfpI [Shewanella putrefaciens 200] >gi|120557151|gb|ABM23078.1| ThiJ/PfpI domain protein [Shewanella sp. W3-18-1] >gi|124510484|gb|EAY54553.1| ThiJ/PfpI [Shewanella putrefaciens 200] (230 aa)
Score = 99, Expect = 1.0e-02, Identities = 21/59 (35%), Positives = 33/59 (55%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           +AN   +   N  DYD ++ PGG+G    L + K  IA +++F   +K +  +C AP AL
  S:    82 LANTTRLSAINAADYDAVFYPGGHGPLWDLAEDKHSIALIEQFYQANKPLGLVCHAPAAL 141
>gi|146291483|ref|YP_001181907.1| ThiJ/PfpI domain-containing protein [Shewanella putrefaciens CN-32] >gi|145563173|gb|ABP74108.1| ThiJ/PfpI domain protein [Shewanella putrefaciens CN-32] (230 aa)
Score = 99, Expect = 1.0e-02, Identities = 21/59 (35%), Positives = 33/59 (55%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           +AN   +   N  DYD ++ PGG+G    L + K  IA +++F   +K +  +C AP AL
  S:    82 LANTTRLSAINAADYDAVFYPGGHGPLWDLAEDKHSIALIEQFYQANKPLGLVCHAPAAL 141
>gi|107103688|ref|ZP_01367606.1| hypothetical protein PaerPA_01004759 [Pseudomonas aeruginosa PACS2] >gi|116052213|ref|YP_788943.1| putative protease [Pseudomonas aeruginosa UCBPP-PA14] >gi|194548036|ref|YP_002083064.1| hypothetical protein PACG_03083 [Pseudomonas aeruginosa C3719] >gi|194553840|ref|YP_002088867.1| hypothetical protein PA2G_03622 [Pseudomonas aeruginosa 2192] >gi|115587434|gb|ABJ13449.1| putative protease [Pseudomonas aeruginosa UCBPP-PA14] >gi|126168982|gb|EAZ54493.1| hypothetical protein PACG_03083 [Pseudomonas aeruginosa C3719] >gi|126196233|gb|EAZ60296.1| hypothetical protein PA2G_03622 [Pseudomonas aeruginosa 2192] (187 aa)
Score = 99, Expect = 1.0e-02, Identities = 23/55 (41%), Positives = 29/55 (52%)
  Q:    55 IKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALAD 109
           ++     DYD+L +PGG   A  LRQ  +    V+EF D  K V AIC  P  L D
  S:    67 LQGLRAEDYDLLLVPGGTVNADTLRQDSEARRLVREFSDAGKTVAAICHGPWLLID 122
>gi|52842194|ref|YP_095993.1| ThiJ/PfpI family intracellular protease [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52629305|gb|AAU28046.1| intracellular protease, ThiJ/PfpI family [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (198 aa)
Score = 99, Expect = 1.1e-02, Identities = 23/59 (38%), Positives = 33/59 (55%)
  Q:    60 VNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQK 118
           + DYD L IPGG  A   R +K  +A ++ F D DK +  IC     LA+  ++ ED+K
  S:    85 LKDYDALIIPGGRAAEYQRLNKDILAIIRHFHDADKPIACICHGIQILAEAGIL-EDKK 142
>gi|50086589|ref|YP_048099.1| putative protease [Acinetobacter sp. ADP1] >gi|49532563|emb|CAG70277.1| putative protease [Acinetobacter sp. ADP1] (181 aa)
Score = 99, Expect = 1.1e-02, Identities = 26/71 (36%), Positives = 39/71 (54%)
  Q:    54 TIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           ++ + + NDYD+L I GG   A LLR     +  ++ F D+ K + AIC AP  L +   IK D+   S+ S
  S:    61 SLAHVDPNDYDLLVIAGGTVNADLLRLDPHAVKIIQHFTDHAKPIAAICHAPWVLINAERIK-DKNLTSYKS 131
>gi|163756371|ref|ZP_02163485.1| ThiJ/PfpI [Kordia algicida OT-1] >gi|161323723|gb|EDP95058.1| ThiJ/PfpI [Kordia algicida OT-1] (242 aa)
Score = 99, Expect = 1.1e-02, Identities = 34/116 (29%), Positives = 61/116 (52%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALA-----DHNLIKEDQKYISWSSGD-------------ITDS--------KRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLE 164
           +AN   +   N  DYD ++ PGG+G    L +    I  ++ F +N+K V ++C AP  L      D   + + +    +S+ +             + D          ++ D+N+H  +   LITG+ P  +  +A   LE
  S:    97 LANTLKLATVNEADYDAIFYPGGHGPLWDLSEDPNSIKLIEAFYNNNKPVASVCHAPAVLKNTKNLDGTPLVKGKNVTGFSNSEEEAVGLTAIVPFLVEDMLKKNQGIYSKVDDWNSHAVKDGLLITGQNPASSEKVAELLLE 239
>gi|177666637|ref|ZP_02942429.1| intracellular protease, PfpI family [Cyanothece sp. PCC 8801] >gi|172074356|gb|EDT59775.1| intracellular protease, PfpI family [Cyanothece sp. PCC 8801] (200 aa)
Score = 99, Expect = 1.1e-02, Identities = 20/61 (32%), Positives = 32/61 (52%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           T  +    DY+ L IPGG     +R ++  I  V+ F +N+K + AIC     LA  N+++
  S:    72 TFDHIKAEDYEALVIPGGRAPEYIRLNQAVIQIVQHFANNNKPIAAICHGAQVLAAANVLQ 132
>gi|154175067|ref|YP_001407863.1| DJ-1 family protein [Campylobacter curvus 525.92] >gi|112803406|gb|EAU00750.1| DJ-1 family protein [Campylobacter curvus 525.92] (185 aa)
Score = 99, Expect = 1.1e-02, Identities = 36/105 (34%), Positives = 53/105 (50%)
  Q:    62 DYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKE--------DQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           + D + +PGG  GA  L  SK+    ++ F DN K + AIC AP ALA   ++K         +    S  +G I+D   I D N        +IT R P   ++ A   LE++
  S:    62 ELDAIVLPGGLPGAQNLADSKELGEILRRFDDNGKLICAICAAPMALAKAGVLKGAFTCYPGFETNVRSDKNGYISDKNVICDHN--------IITSRGPATAMEFA---LEIV 164
>gi|168526004|ref|ZP_02719643.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi 118a] >gi|168579661|ref|ZP_02723657.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi 72a] (184 aa)
Score = 99, Expect = 1.2e-02, Identities = 40/166 (24%), Positives = 77/166 (46%)
  Q:    11 FQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLK 176
           F+D+E +  + I +      +I   +  N+ + +          I N   N +D++ +PGG  GAT L  SK+    +K+     K++ AIC +P  +     +    K+  +     ++ D + + +   +V RSN  IT +    + + AF  LE++ GK   + +K
  S:    11 FEDIEAIIPIDILRRGNVNIQIISTNDSNVVISSKGVSFLADDIISNCKENCFDLIILPGGMPGATNLFNSKELDLILKDMNSKGKFIAAICASPVVVLAAKDLLGFNKFTCYPGLEKNVLDGEFVDE---NVVRSNNFITSKGVGTSFEFAFTLLEMVKGKQIMEDVK 176
>gi|168135348|ref|ZP_02578577.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus cereus B4264] (190 aa)
Score = 99, Expect = 1.2e-02, Identities = 31/114 (27%), Positives = 51/114 (44%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKE 115
           K+L      F + E+    ++ K   KFE I     + L +      +     +    V++Y+ + IPGG    L   +K   + +++F + +K V AIC  P ALA   L KE
  S:     3 KILLFVYPTFAEFEITVATALLK--NKFEIITAGLTKELIISETGLQVQPHIEVSEVRVDEYEGILIPGGEEVQL-EDAKPLFSIIRQFHEQEKLVAAICAGPYALAKAGLFKE 113
>gi|149631877|ref|XP_001505364.1| PREDICTED: similar to DJ-1 [Ornithorhynchus anatinus] (189 aa)
Score = 99, Expect = 1.3e-02, Identities = 31/121 (25%), Positives = 56/121 (46%)
  Q:    63 YDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGD-ITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGKE 183
           YDV+ +PGG  GA  L +S    A +K+  +    + AIC  P AL  H +    +      + D + +    K     V +   ++T R P  + +     +E + GK+ +D ++  L+ K+
  S:    67 YDVVVLPGGNLGAQNLSESSTVKAVLKDQENRKGLIAAICAGPTALLAHGIGFGSKVTTHPGAKDKMMNGDHYKYSENRVEKDGMILTSRGPGTSFEFGLAIVETLMGKEVADQVRAPLILKD 189
>gi|89901540|ref|YP_524011.1| peptidase C56, PfpI [Rhodoferax ferrireducens T118] >gi|89346277|gb|ABD70480.1| Peptidase C56, PfpI [Rhodoferax ferrireducens T118] (193 aa)
Score = 99, Expect = 1.3e-02, Identities = 20/52 (38%), Positives = 28/52 (53%)
  Q:    57 NFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           + N  +YD L IPGG G   LR + + ++  KEF D  K + A+C     LA
  S:    74 DVNTANYDALLIPGGRGPEYLRLNARVLSITKEFADAGKPIAAVCHGAQLLA 125
>gi|90412855|ref|ZP_01220855.1| putative ThiJ/PfpI family protein [Photobacterium profundum 3TCK] >gi|90326214|gb|EAS42641.1| putative ThiJ/PfpI family protein [Photobacterium profundum 3TCK] (226 aa)
Score = 99, Expect = 1.3e-02, Identities = 31/100 (31%), Positives = 45/100 (45%)
  Q:    21 SIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYI 120
           S  + SQ    + F   E  + V     +AN + + + N  DYD ++ PGG+G    L      IA ++ F    K V A+C AP  L   N    D +YI
  S:    57 SELEQSQTEATVRFNRDEQAQAV-----LANTRKLSDVNEQDYDAIFYPGGHGPLWDLVSDSDSIALIEAFWQAGKPVSAVCHAPAVLL--NAKTADGEYI 150
>gi|55820988|ref|YP_139430.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Streptococcus thermophilus LMG 18311] >gi|116627760|ref|YP_820379.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Streptococcus thermophilus LMD-9] >gi|55736973|gb|AAV60615.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Streptococcus thermophilus LMG 18311] >gi|116101037|gb|ABJ66183.1| Putative intracellular protease/amidase [Streptococcus thermophilus LMD-9] (182 aa)
Score = 98, Expect = 1.4e-02, Identities = 41/128 (32%), Positives = 65/128 (50%)
  Q:    43 VTGQFDI-ANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISW-------SSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKD 170
           VTG   I   +  + + N+++YD++ +PGG  G+T LR  +  IA ++E     K+V AIC AP  L    L+ E +K+  +       +SGD      + D N        ++T R     L  A Y+L  + G D
  S:    41 VTGSHGIQVTMDGVFDGNLDEYDLVVLPGGMPGSTKLRDHQALIASLQEVAKAGKYVAAICAAPIVLERAGLL-EGRKFTCFPGVEEQIASGDHQTDLVVVDDN--------IVTSRGAGTALAFA-YALVDLLGGD 167
>gi|196234444|ref|ZP_03133270.1| intracellular protease, PfpI family [Chthoniobacter flavus Ellin428] >gi|196221500|gb|EDY16044.1| intracellular protease, PfpI family [Chthoniobacter flavus Ellin428] (188 aa)
Score = 98, Expect = 1.5e-02, Identities = 35/116 (30%), Positives = 59/116 (50%)
  Q:    59 NVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDG 174
           + +D+D L IPGG      LR +   +   K F +  K + AIC  P  L +  L+K  ++  SW +   DI ++   K  +  V   N L+T R P    D+  ++ +VI  ++F++G
  S:    70 DCDDFDALLIPGGLMNPDELRSTPAAVEFAKSFAEAGKPIAAICHGPWVLIEAGLVK-GRRLTSWPAIQSDIKNAGG-KWVDEEVVVDNGLVTSRKPD---DIPAFNAKVI--EEFAEG 181
>gi|86130142|ref|ZP_01048742.1| proteinase [Cellulophaga sp. MED134] >gi|85818817|gb|EAQ39976.1| proteinase [Dokdonia donghaensis MED134] (182 aa)
Score = 98, Expect = 1.5e-02, Identities = 21/70 (30%), Positives = 40/70 (57%)
  Q:    44 TGQFDIANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLI 113
           +G++D+ +  T+ N +  DY+ L +PGG      LR++   +  +++F    K V AIC AP  L + +++
  S:    51 SGEYDVTD--TVDNVSAKDYNALMLPGGVINPDKLRRNDDALIFIRDFFKQSKPVAAICHAPQLLIEADVV 119
>gi|196246573|ref|ZP_03145291.1| intracellular protease, PfpI family [Cyanothece sp. PCC 8802] >gi|196205484|gb|EDY00285.1| intracellular protease, PfpI family [Cyanothece sp. PCC 8802] (200 aa)
Score = 98, Expect = 1.5e-02, Identities = 20/61 (32%), Positives = 32/61 (52%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           T  +    DY+ L IPGG     +R ++  I  V+ F +N+K + AIC     LA  N+++
  S:    72 TFDHIKAEDYEALVIPGGRAPEYIRLNQAVIQIVQHFANNNKPIAAICHEAQVLAAANVLQ 132
>gi|190571776|ref|YP_001966455.1| ORF22 [Lactococcus lactis] >gi|108736175|gb|ABG00304.1| ORF22 [Lactococcus lactis] (167 aa)
Score = 98, Expect = 1.5e-02, Identities = 28/100 (28%), Positives = 45/100 (45%)
  Q:    53 KTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLI--KEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           K+I   +  D+D L+IPGG+    LR  ++ +   K F+  +K   +IC  P  +    L+  +    Y++          RI+D    V     LIT R P
  S:    54 KSIDEVSPQDFDALFIPGGFSPDQLRADQRFVEFTKFFLATNKLTASICHGPQLMIQTGLVHGRTMTAYLTVQPDLYYAGARIED--KDVVIDGNLITSREP 153
>gi|104781942|ref|YP_608440.1| chaperone protein HchA [Pseudomonas entomophila L48] >gi|95110929|emb|CAK15647.1| conserved hypothetical protein [Pseudomonas entomophila L48] (284 aa)
Score = 98, Expect = 1.5e-02, Identities = 31/93 (33%), Positives = 56/93 (60%)
  Q:    61 NDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQK--------------------YISWSSGDITDSKRIKDFNT----HVYRSNKLITGRCPV 153
           +DY  ++IPGG+GA + L +SK+    ++   DNDK+VI +C  P AL     + +  K                    +++W  G+   ++ ++  N      V++  KL+TG  P+
  S:   147 SDYLGVFIPGGHGALIGLPESKEVGQVLQWAADNDKFVITLCHGPAALLASGRLYDGYKICAFPDELDAKTPDIGYMPGHLAWKFGERLQAQGVEIINQGISGAVHQDRKLLTGDSPL 264
>gi|146281529|ref|YP_001171682.1| ThiJ/PfpI family protein [Pseudomonas stutzeri A1501] >gi|145569734|gb|ABP78840.1| ThiJ/PfpI family protein [Pseudomonas stutzeri A1501] (228 aa)
Score = 98, Expect = 1.6e-02, Identities = 34/108 (31%), Positives = 50/108 (46%)
  Q:     7 TMSKFQDLEMV------------ALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           TM  FQ L+MV            A  ++  A   FE    YS +        FD   ++        DYD L IPGG     LR +++ +A V+ F +  K + A+C     LA   ++K
  S:    54 TMVPFQALQMVGHRVHAVCPDKKAGDTVRTAIHDFEGDQTYSEKPGHNFALNFDFTAVRA------EDYDALVIPGGRAPEYLRLNEQVLALVRAFDEAGKPIAAVCHGAQLLAAAGVLK 167
>gi|55822910|ref|YP_141351.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Streptococcus thermophilus CNRZ1066] >gi|55738895|gb|AAV62536.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Streptococcus thermophilus CNRZ1066] (182 aa)
Score = 98, Expect = 1.6e-02, Identities = 37/112 (33%), Positives = 58/112 (51%)
  Q:    59 NVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISW-------SSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKD 170
           N+++YD++ +PGG  G+T LR  +  IA ++E     K+V AIC AP  L    L+ E +K+  +       +SGD      + D N        ++T R     L  A Y+L  + G D
  S:    58 NLDEYDLVVLPGGMPGSTKLRDHQALIASLQEVAKAGKYVAAICAAPIVLERAGLL-EGRKFTCFPGVEEQIASGDHQTDLVVVDDN--------IVTSRGAGTALAFA-YALVDLLGGD 167
>gi|154248187|ref|YP_001419145.1| PfpI family intracellular peptidase [Xanthobacter autotrophicus Py2] >gi|154162272|gb|ABS69488.1| intracellular protease, PfpI family [Xanthobacter autotrophicus Py2] (193 aa)
Score = 98, Expect = 1.6e-02, Identities = 23/61 (37%), Positives = 29/61 (47%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           T    +V  YD L +PGG     LR   + IA V+ F D  K V AIC     LA   ++K
  S:    72 TFAEVDVASYDALLVPGGRAPEYLRLYPEVIAAVRHFFDAGKPVAAICHGAQMLAAAGVLK 132
>gi|110633837|ref|YP_674045.1| PfpI family intracellular peptidase [Mesorhizobium sp. BNC1] >gi|110284821|gb|ABG62880.1| intracellular protease, PfpI family [Mesorhizobium sp. BNC1] (186 aa)
Score = 98, Expect = 1.6e-02, Identities = 31/100 (31%), Positives = 48/100 (48%)
  Q:    53 KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQ--KYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           KT+      DYD L +PGG     LLR  K  +  +K F ++ K + A+C AP  L +  ++K  +   Y S  +  I    + +D  + V     L+T R P
  S:    62 KTLDEARPEDYDALVLPGGQINPDLLRVEKAALDFIKSFWNDSKVIGAVCHAPWLLVETGILKGRRVTSYHSIKTDVINAGGKWED--SQVVTDQGLVTSRNP 162
>gi|62751849|ref|NP_001015572.1| Parkinson disease (autosomal recessive, early onset) 7 [Bos taurus] >gi|75040204|sp|Q5E946|PARK7_BOVIN Protein DJ-1 (Parkinson disease protein 7 homolog) >gi|59858513|gb|AAX09091.1| DJ-1 protein [Bos taurus] (189 aa)
Score = 98, Expect = 1.7e-02, Identities = 34/121 (28%), Positives = 59/121 (48%)
  Q:    63 YDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNK------LITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGKE 183
           YDV+ +PGG  GA  L +S      +KE       + AIC  P AL  H +      + S  +       ++ + + + Y  N+      ++T R P  + + A   +EV+ GK+ +D +K  L+ K+
  S:    67 YDVVVLPGGNLGAQNLSESAAVKEILKEQEKRKGLIAAICAGPTALLAHEI-----GFGSKVTTHPLAKDKMMNGSHYSYSENRVEKDGLILTSRGPGTSFEFALKIVEVLVGKEVADQVKAPLVLKD 189
>gi|124004448|ref|ZP_01689293.1| ThiJ/PfpI [Microscilla marina ATCC 23134] >gi|123990020|gb|EAY29534.1| ThiJ/PfpI [Microscilla marina ATCC 23134] (226 aa)
Score = 98, Expect = 1.7e-02, Identities = 22/52 (42%), Positives = 34/52 (65%)
  Q:    53 KTIK--NFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAP 104
           KT+K  + N + YD ++ PGG+G    L + K  IA +++F  N+K V A+C AP
  S:    83 KTLKLADINQDGYDAVFYPGGHGPLWDLAEDKDSIALIEKFYQNNKPVAAVCHAP 137
>gi|183212531|gb|ACC54928.1| Parkinson disease 7 protein [Xenopus borealis] (161 aa)
Score = 98, Expect = 1.7e-02, Identities = 33/118 (27%), Positives = 53/118 (44%)
  Q:    63 YDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNL-IKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           YDV+ +PGG  GA  L +S      +KE       + AIC  P AL  H + I +       +   I +  + K     V +   LIT R P  + + A   +  + GK+ ++ +K  L+
  S:    41 YDVVVLPGGNLGAQNLSESPVVKEVLKEQEAKKGLIAAICAGPTALTVHGVGIGKTITTHPLAKDKIVNPDKYKYSEDRVVKDENLITSRGPGTSFEFALEIVCTLLGKEVAEQVKTPLL 160
>gi|186476516|ref|YP_001857986.1| PfpI family intracellular peptidase [Burkholderia phymatum STM815] >gi|184192975|gb|ACC70940.1| intracellular protease, PfpI family [Burkholderia phymatum STM815] (193 aa)
Score = 98, Expect = 1.7e-02, Identities = 34/108 (31%), Positives = 53/108 (49%)
  Q:     7 TMSKFQDLEMV--ALLSIFKASQKFERI-----DFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           TM  FQ L+ V  A+ ++    +  ER+     DF   +      G     N  T    + + YD L I GG     LR + K I  V++F +++K + AIC A   LA  ++I+
  S:    19 TMVPFQALQAVGHAVDAVCPGKRAGERVKTAIHDFEGDQTYTEKPGHLFALN-ATFDEIDPSRYDALAIAGGRAPEYLRLNPKVIDVVRQFAESNKPIAAICHAAQLLAAADVIR 132
>gi|85707861|ref|ZP_01038927.1| DJ-1/PfpI family protein [Erythrobacter sp. NAP1] >gi|85689395|gb|EAQ29398.1| DJ-1/PfpI family protein [Erythrobacter sp. NAP1] (184 aa)
Score = 98, Expect = 1.7e-02, Identities = 35/99 (35%), Positives = 52/99 (52%)
  Q:    54 TIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYIS-WSS---------GDITDSKRIKDFNTHVYRSNKLITGRCP 152
           TI   +V DY  L +PGG     +LR  +  I  +KEF +  K + AIC AP  L + +L+  D K ++ W S         G++ D++   D N        +IT R P
  S:    58 TIDEVSVGDYHALLLPGGQMNPDILRMEESVINLIKEFDNAGKPIAAICHAPWLLIEADLV--DGKTVTGWPSIRTDLENAGGEVIDTRVAFDGN--------IITSRNP 157
>gi|118579813|ref|YP_901063.1| PfpI family intracellular peptidase [Pelobacter propionicus DSM 2379] >gi|118502523|gb|ABK99005.1| intracellular protease, PfpI family [Pelobacter propionicus DSM 2379] (193 aa)
Score = 98, Expect = 1.7e-02, Identities = 21/53 (39%), Positives = 29/53 (54%)
  Q:    62 DYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           +YD L IPGG     LR +++ I  V+ F +  K V AIC  P  LA   ++K
  S:    80 EYDALVIPGGRAPEYLRLNQEVIDMVRHFAETGKPVAAICHGPQLLAAAGMLK 132
>gi|86171677|ref|XP_966258.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Plasmodium falciparum 3D7] >gi|46361227|emb|CAG25088.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Plasmodium falciparum 3D7] (189 aa)
Score = 98, Expect = 1.8e-02, Identities = 24/71 (33%), Positives = 39/71 (54%)
  Q:    54 TIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           TI     N YDVL IPGG  G+  + +  + I  +KE   N++   AIC AP  + D + + +D + +++ S
  S:    58 TISKVRNNIYDVLVIPGGMKGSNTISECSEFIDMLKEQKANNRLYAAICAAPETVLDRHSLIDDVEAVAYPS 129
>gi|148323539|gb|EDK88789.1| possible intracellular protease/amidase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (200 aa)
Score = 97, Expect = 1.8e-02, Identities = 37/103 (35%), Positives = 57/103 (55%)
  Q:    62 DYDVLYIPGGYG-ATLLRQSKKGI--ACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKR----IKDFNT-----HVYRSNKLITGRCPVVTLDLAFYSLE 164
           DYDVL IPGG+G A   +     I    +K F +N+K ++AIC A   L +   I+  +K  ++    + D+KR    +K++N       +   N L T   P   L+L+F  LE
  S:    73 DYDVLIIPGGFGKANFFKDKNNKIFKKLIKYFFENNKIIVAICSAVINLLESTYIR-GKKVTTY----LLDNKRYFNQLKNYNVIPIEEEIVEDNNLFTCSGPGNALELSFRLLE 182
>gi|160873396|ref|YP_001552712.1| ThiJ/PfpI domain-containing protein [Shewanella baltica OS195] >gi|160858918|gb|ABX47452.1| ThiJ/PfpI domain protein [Shewanella baltica OS195] (230 aa)
Score = 97, Expect = 1.8e-02, Identities = 20/59 (33%), Positives = 33/59 (55%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           +AN   +   N  DYD ++ PGG+G    L + +  IA +++F   +K +  +C AP AL
  S:    82 LANTTRLSEINTADYDAVFYPGGHGPLWDLAEDQHSIALIEQFYQANKPLGLVCHAPAAL 141
>gi|14591468|ref|NP_143548.1| intracellular proteinase [Pyrococcus horikoshii OT3] >gi|6093703|sp|O59413|PFPI_PYRHO Intracellular protease 1 (Intracellular protease I) >gi|3258135|dbj|BAA30818.1| 166aa long hypothetical intracellular proteinase [Pyrococcus horikoshii OT3] (166 aa)
Score = 97, Expect = 1.8e-02, Identities = 29/114 (25%), Positives = 54/114 (47%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKAS------QKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           MK+L LT ++F+D+E++      K          FER           +TG+  + +    T    N  ++D L +PGG     +R ++K ++  ++     K V +IC  P  L    +++
  S:     1 MKVLFLTANEFEDVELIYPYHRLKEEGHEVYIASFER---------GTITGKHGYSVKVDLTFDKVNPEEFDALVLPGGRAPERVRLNEKAVSIARKMFSEGKPVASICHGPQILISAGVLR 113
>gi|190893572|ref|YP_001980114.1| putative intracellular protease protein, PfpI family [Rhizobium etli CIAT 652] >gi|190698851|gb|ACE92936.1| putative intracellular protease protein, PfpI family [Rhizobium etli CIAT 652] (198 aa)
Score = 97, Expect = 1.9e-02, Identities = 22/61 (36%), Positives = 29/61 (47%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           T ++    DYD L IPGG     LR +   I  ++ F D  K V AIC     LA   ++K
  S:    72 TFESVRAEDYDALVIPGGRAPEYLRLNADVIKSIRHFFDAGKPVAAICHGAQLLAAAGVLK 132
>gi|159117119|ref|XP_001708780.1| 4-methyl-5-thiazole monophosphate biosynthesis enzyme [Giardia lamblia ATCC 50803] >gi|157436893|gb|EDO81106.1| 4-methyl-5-thiazole monophosphate biosynthesis enzyme [Giardia lamblia ATCC 50803] (186 aa)
Score = 97, Expect = 2.0e-02, Identities = 31/104 (29%), Positives = 52/104 (50%)
  Q:    63 YDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNA-LADHNLIKEDQK--YISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           YD + +PGG G   ++ +    A  +    + KWV+AIC AP+A LA   L+K+ +   Y +   G + +  +  D    V    K +T + P   L  A  +LE++
  S:    62 YDAIVLPGGPGWKEMQTNGVIKALTENHSRHGKWVMAICAAPSASLASWGLLKDKRATCYPAMKDGLVANGAQFVD--EPVVVDGKFLTSQGPATALLFAVKALELL 166
>gi|171911857|ref|ZP_02927327.1| proteinase I [Verrucomicrobium spinosum DSM 4136] (193 aa)
Score = 97, Expect = 2.0e-02, Identities = 30/99 (30%), Positives = 49/99 (49%)
  Q:    54 TIKNFNVNDYDVLYIPGGYG-ATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISW---------SSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           T+ + N +D+D L +PGG      LR ++  +  V++F +  K + AIC AP  L +  L+   +   SW         + G+  D   + D        N L+T R P
  S:    64 TLDSVNASDFDALVLPGGLANPDTLRSTRDAVNFVRDFAEAGKPICAICHAPWILIEAGLVA-GRTLTSWPAIQSDVHNAGGNWVDQPVVVD--------NGLVTSRKP 163
>gi|19705181|ref|NP_602676.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713122|gb|AAL93975.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (200 aa)
Score = 97, Expect = 2.0e-02, Identities = 38/112 (33%), Positives = 62/112 (55%)
  Q:    59 NVNDYDVLYIPGGYG-ATLLRQSKKGI--ACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKR----IKDFNT-----HVYRSNKLITGRCPVVTLDLAFYSLEVIFGKD 170
           N  +YD L IPGG+G A   + +   I    +K F +N+K ++AIC A   L +   I+ D+K  ++    + D+KR    +K++N       +   N L T   P   L+L+F  LE +  K+
  S:    70 NFYEYDALVIPGGFGKANFFKDNDNEIFKKLIKYFSENNKVIVAICSAVINLLETTYIR-DKKVTTY----LLDNKRYFNQLKNYNIIPVEEEIVIDNNLFTCSGPGNALELSFRVLEKLTSKE 188
>gi|116618027|ref|YP_818398.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096874|gb|ABJ62025.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme, amidase family [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (168 aa)
Score = 97, Expect = 2.0e-02, Identities = 31/112 (27%), Positives = 52/112 (46%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKAS-QKFERIDFYSPENLEMVTGQF--DIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLI 113
           K+  L     +D+E    +   K S      I F +    E VTG+    I   K+I +   +D+D L+IPGG+    LR  ++ +   K F+  +K + +IC  P  +    L+
  S:     4 KVAVLVTDLVEDIEFTDPVKALKESGASVTTISFST----EAVTGKHGTKIDIDKSIGDVAPSDFDALFIPGGFSPDQLRADERFVNFTKHFLATNKSLFSICHGPQLMIPTGLV 114
>gi|188997020|ref|YP_001931271.1| DJ-1 family protein [Sulfurihydrogenibium sp. YO3AOP1] >gi|188932087|gb|ACD66717.1| DJ-1 family protein [Sulfurihydrogenibium sp. YO3AOP1] (182 aa)
Score = 97, Expect = 2.1e-02, Identities = 34/127 (26%), Positives = 63/127 (49%)
  Q:    54 TIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFN---THVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           TI      D+D++ +PGG  G   L   ++    +++F +  K   AIC AP  LA+  ++ E +K  S+     T  +++ + N     V   + ++T R P      AF  ++ + GK+ +D LK  ++
  S:    54 TIDTIKAEDFDMIVLPGGQPGTDNLNADERVKKLIQDFYNKGKLTGAICAAPYVLANAGVL-EGKKATSYP----TYKEKLGNVNYLEDTVVEDSNVLTSRGPGTAACFAFKIVKKLAGKEKADQLKQAML 179
>gi|171853867|emb|CAM11829.1| Putative intracellular protease/amidase [Candidatus Phytoplasma australiense] (180 aa)
Score = 97, Expect = 2.1e-02, Identities = 33/109 (30%), Positives = 56/109 (51%)
  Q:    61 NDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKED--------QKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGK 169
           ++YD L IPGG Y A ++ +    +  +++F+ ++K + AIC AP  L   +L+KE         Q +I  S   + D K +         S   +T R P+   D  F  +E + G+
  S:    61 SNYDFLVIPGGPYVAQIIEKETFLLELIQKFVFSNKIIGAICAAPMFLGKLDLLKEHSFTCFPNCQHFILGSY--LPDKKAVI--------SGNFVTSRSPITVFDFVFTLVEKLKGE 168
>gi|62319084|dbj|BAD94229.1| hypothetical protein [Arabidopsis thaliana] (147 aa)
Score = 97, Expect = 2.1e-02, Identities = 33/110 (30%), Positives = 59/110 (53%)
  Q:    61 NDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALAD-HNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKD 170
           N YD++ +PGG  GA     S+K +  +K+  +++K   AIC +P  + + H L+K  +K  ++ +    +TD   I+     V     LIT R P  +L+ A   +E  +G++
  S:    27 NSYDLIVLPGGLGGAEAFASSEKLVNMLKKQAESNKPYGAICASPALVFEPHGLLK-GKKATAFPAMCSKLTDQSHIEH---RVLVDGNLITSRGPGTSLEFALAIVEKFYGRE 136
>gi|18404397|ref|NP_564626.1| DJ-1 family protein [Arabidopsis thaliana] >gi|7769869|gb|AAF69547.1|AC008007_22 F12M16.18 [Arabidopsis thaliana] >gi|15810459|gb|AAL07117.1| unknown protein [Arabidopsis thaliana] >gi|20259561|gb|AAM14123.1| unknown protein [Arabidopsis thaliana] (438 aa)
Score = 97, Expect = 2.1e-02, Identities = 33/110 (30%), Positives = 59/110 (53%)
  Q:    61 NDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALAD-HNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKD 170
           N YD++ +PGG  GA     S+K +  +K+  +++K   AIC +P  + + H L+K  +K  ++ +    +TD   I+     V     LIT R P  +L+ A   +E  +G++
  S:   318 NSYDLIVLPGGLGGAEAFASSEKLVNMLKKQAESNKPYGAICASPALVFEPHGLLK-GKKATAFPAMCSKLTDQSHIEH---RVLVDGNLITSRGPGTSLEFALAIVEKFYGRE 427
>gi|71065908|ref|YP_264635.1| ThiJ/PfpI family protein [Psychrobacter arcticus 273-4] >gi|71038893|gb|AAZ19201.1| ThiJ/PfpI family protein [Psychrobacter arcticus 273-4] (225 aa)
Score = 97, Expect = 2.1e-02, Identities = 24/76 (31%), Positives = 39/76 (51%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYI 120
            Q  +A  K + +    D+D ++ PGG+G    L   K  I  ++ FI  DK V  +C +P AL +   +K D +Y+
  S:    76 AQEHLATTKKLADMKAEDFDSVFYPGGHGPMWDLAVDKNSIELIETFIKQDKPVAFVCHSPAALKN---VKIDGEYL 149
>gi|124027868|ref|YP_001013188.1| protease I [Hyperthermus butylicus DSM 5456] >gi|123978562|gb|ABM80843.1| protease I [Hyperthermus butylicus DSM 5456] (194 aa)
Score = 97, Expect = 2.2e-02, Identities = 19/55 (34%), Positives = 30/55 (54%)
  Q:    60 VNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           ++ YDVL IPGG      RQ ++ +   +   +  K +IAIC  P  LA  ++I+
  S:    80 LDSYDVLVIPGGRSPERARQHREAVEIARRMAEKGKPIIAICHGPLLLASASVIR 134
>gi|77979405|ref|ZP_00834824.1| COG0693: Putative intracellular protease/amidase [Yersinia intermedia ATCC 29909] (198 aa)
Score = 97, Expect = 2.2e-02, Identities = 33/118 (27%), Positives = 56/118 (47%)
  Q:    63 YDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPN-ALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           +DV+ +PGG  GA   R S   IA V++  +  + V AIC AP   L  HNL          +  D  D+ +  D      R   L+T + P   +D A   + ++ G++ ++ +  +L+
  S:    67 FDVVVLPGGIKGAECFRDSPLLIATVRQTHNEGRLVAAICAAPALVLEHHNLFPVGNMTGFPALKDKIDATKWMDQRVVYDRRVNLVTSQGPGTAIDFALKIVFLLLGREKAEEIAWQLV 186
>gi|52141881|ref|YP_084942.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus cereus E33L] >gi|51975350|gb|AAU16900.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus cereus E33L] (186 aa)
Score = 97, Expect = 2.2e-02, Identities = 29/114 (25%), Positives = 53/114 (46%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKE 115
           K+L      F + E+    ++ K   K+E I     + L +      +     +    V +Y+ + IPGG  A  ++ +++  + +++F + +K V AIC  P ALA   L KE
  S:     3 KILLFVYPTFAEFEITVATALLK--NKYEIITASLTKELIISETGLQVQPHIELSEVRVEEYEGIIIPGG-DAIHMKDAEELFSVIRQFHEQEKLVAAICAGPYALAKAGLFKE 113
>gi|146306678|ref|YP_001187143.1| PfpI family intracellular peptidase [Pseudomonas mendocina ymp] >gi|145574879|gb|ABP84411.1| intracellular protease, PfpI family [Pseudomonas mendocina ymp] (186 aa)
Score = 97, Expect = 2.3e-02, Identities = 32/93 (34%), Positives = 44/93 (47%)
  Q:    21 SIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLI 113
           S+  AS K    + +  ++ + VT Q D      +K  +  DYD+L IPGG   A  LRQ       V+EF    K V AIC  P  L D  ++
  S:    37 SVTHASVKGGEAETWLKDSEKDVTVQSD----TQLKGLSAADYDLLVIPGGTVNADTLRQDSDAQRLVQEFRQASKTVAAICHGPWLLIDAGVV 126
>gi|24372956|ref|NP_716998.1| ThiJ/PfpI family protein [Shewanella oneidensis MR-1] >gi|24347099|gb|AAN54443.1|AE015581_10 ThiJ/PfpI family protein [Shewanella oneidensis MR-1] (186 aa)
Score = 97, Expect = 2.3e-02, Identities = 36/107 (33%), Positives = 51/107 (47%)
  Q:     8 MSKFQDLEMV------------ALLSIFKASQKFERIDFYS--PENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           M  FQ L+MV            A  +I  A   FE    Y+  P +L  + G F  AN         +D+D L +PGG     LR +   IA V +F   DK + AIC     L   ++++
  S:    18 MVPFQALQMVGHSVTVVCPDKVAGQTIKTAIHDFEGDQTYTEKPGHLFALNGNFAGAN--------ASDFDALLLPGGRAPEYLRLNPAVIALVADFSAQDKPIAAICHGAQLLTAADVVR 130
>gi|30021754|ref|NP_833385.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus cereus ATCC 14579] >gi|29897309|gb|AAP10586.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus cereus ATCC 14579] (190 aa)
Score = 97, Expect = 2.3e-02, Identities = 30/113 (26%), Positives = 51/113 (45%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+L      F + E+    ++ K   KFE I     + L +      +     +    V++Y+ + IPGG    L + +K   + +++F + +K V AIC  P ALA   L K
  S:     3 KILLFVYPTFAEFEITVATALLK--NKFEIITAGLTKELIISETGLQVQPHIEVSEVRVDEYEGVLIPGGEEVQL-KDAKSLFSVIRQFHEQEKLVAAICAGPYALAKAGLFK 112
>gi|118588865|ref|ZP_01546273.1| hypothetical protein SIAM614_19204 [Stappia aggregata IAM 12614] >gi|118438851|gb|EAV45484.1| hypothetical protein SIAM614_19204 [Stappia aggregata IAM 12614] (197 aa)
Score = 96, Expect = 2.3e-02, Identities = 23/61 (37%), Positives = 28/61 (45%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           T    +V  YD L IPGG     LR     +  VK F+D DK V AIC     L    +I+
  S:    72 TFAEVDVASYDALVIPGGRAPEYLRLDAAVLDAVKHFMDADKPVAAICHGAQILTAAKVIE 132
>gi|119509804|ref|ZP_01628948.1| Peptidase C56, PfpI [Nodularia spumigena CCY9414] >gi|119465539|gb|EAW46432.1| Peptidase C56, PfpI [Nodularia spumigena CCY9414] (365 aa)
Score = 96, Expect = 2.3e-02, Identities = 17/52 (32%), Positives = 29/52 (55%)
  Q:    63 YDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           +D + IPGG     +R++   +  V+E +   KWV A+C  P  L + +L+K
  S:    74 FDAVVIPGGMAPDKMRRNPNTVRFVQEAMQQGKWVAAVCHGPQLLIEGDLLK 125
>gi|94495902|ref|ZP_01302481.1| proteinase I [Sphingomonas sp. SKA58] >gi|94424594|gb|EAT09616.1| proteinase I [Sphingomonas sp. SKA58] (184 aa)
Score = 96, Expect = 2.4e-02, Identities = 22/71 (30%), Positives = 40/71 (56%)
  Q:    54 TIKNFNVNDYDVLYIPGGYG-ATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           T+++  + DYD L +PGG      LR +++ +  V++F+ + K V AIC  P  L + + + + +   SW S
  S:    63 TLESVKIEDYDGLVLPGGVANPDTLRTNERAVRIVRDFVASGKPVAAICHGPWLLVEADSV-DGKTVTSWPS 133
>gi|118051485|ref|ZP_01520033.1| intracellular protease, PfpI family [Comamonas testosteroni KF-1] >gi|118000828|gb|EAV14984.1| intracellular protease, PfpI family [Comamonas testosteroni KF-1] (193 aa)
Score = 96, Expect = 2.5e-02, Identities = 22/61 (36%), Positives = 29/61 (47%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           T  +     YD L IPGG G   LR  +   A V+ F D +K V A+C     LA   ++K
  S:    72 TFADVKPEQYDALVIPGGRGPEYLRGYESVRAAVRHFFDTNKPVAAVCHGAQLLAGAGVLK 132
>gi|57866901|ref|YP_188522.1| ThiJ/PfpI family protein [Staphylococcus epidermidis RP62A] >gi|57637559|gb|AAW54347.1| ThiJ/PfpI family protein [Staphylococcus epidermidis RP62A] (219 aa)
Score = 96, Expect = 2.5e-02, Identities = 30/106 (28%), Positives = 64/106 (60%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL-----ADHNLIKEDQKYISWSSGD------------ITDSKRIK---------DFNTHVYRSNKLITGRCPVVTLDLA 159
           +I+N N ++YD +Y+PGG+G       ++K    + +F +++K + ++C  P+       A+++ + +  K  S++  +            +T SK  +         DF +HV +  + ITG+ P  + D+ 
  S:    79 SIENVNADEYDAIYLPGGHGTVYDFANNEKLADILLQFKNSNKIISSVCHGPSVFVGVKDANNHYLVDGVKITSFTDSEEKAMGFENKVPFLTQSKLEEQGANFVVKDDFTSHVEKDGQFITGQNPQSSEDIG 211
>gi|47567939|ref|ZP_00238646.1| protease I, putative [Bacillus cereus G9241] >gi|47555417|gb|EAL13761.1| protease I, putative [Bacillus cereus G9241] (190 aa)
Score = 96, Expect = 2.5e-02, Identities = 29/114 (25%), Positives = 52/114 (45%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKE 115
           K+L      F + E+    ++ K   K+E I     + L        +     ++   V +Y+ + IPGG  A  +++ +   + +++F + +K V AIC  P ALA   L KE
  S:     3 KILLFVYPTFAEFEITVATAMLK--NKYEIITVSLTKELIRSETGLQVQPHIELREVRVEEYEGIIIPGG-DAIHMKEDEGLFSVIRQFHEQEKLVAAICAGPYALARAGLFKE 113
>gi|34557642|ref|NP_907457.1| monophosphate synthesisprotein [Wolinella succinogenes DSM 1740] >gi|34483359|emb|CAE10357.1| MONOPHOSPHATE SYNTHESISPROTEIN [Wolinella succinogenes] (185 aa)
Score = 96, Expect = 2.5e-02, Identities = 43/172 (25%), Positives = 88/172 (51%)
  Q:     2 KLLALTMSK-FQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDI-----ANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGI-ACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSD 173
           K++ + ++K F++LE V ++ + + +    R+     ++ ++V  Q  I     + ++ I+  N+   D++ +PGG+G T+   S   + + V+      K + AIC AP AL++  +I  + +Y  +  G     +R +   + V  S+ + T + P   L  A   +E +FGK   D
  S:     4 KVVLVPLAKGFEELEAVTIIDVLRRAGA--RVVVAGLDSTDLVQSQGGIFIRPDSKMELIEPQNI---DMIVLPGGWGGTVALASHPLVRSMVEALHKRQKPIGAICAAPYALSEIGVI--EGQYTCY-PGIQEKIQRGEFVESLVVESDHIFTSQGPATALPFALALVEKLFGKAQRD 174
>gi|16081584|ref|NP_393943.1| intracellular proteinase I [Thermoplasma acidophilum DSM 1728] >gi|10639635|emb|CAC11607.1| probable intracellular proteinase I [Thermoplasma acidophilum] (186 aa)
Score = 96, Expect = 2.5e-02, Identities = 36/114 (31%), Positives = 58/114 (50%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPEN--LEMVTGQFD-------------IANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           +++L LT    + LE++  L   K  + FE +D  +PE   +++V   F+             +      K+ + + YD L IPGG     +R  K  I  VK F +    V  +C AP ALA   ++K
  S:     2 VRVLILTGDAGESLEVMYPLQRMK-EEGFE-VDVAAPEKKKIQLVVHDFEEGFDTYTEKPGYKLQADLAFKDVDPSKYDALIIPGGRAPEYIRNDKDFIRIVKYFFEKHSPVAELCHAPLALAAAGVLK 128
>gi|145619157|ref|ZP_01775209.1| ThiJ/PfpI domain protein [Geobacter bemidjiensis Bem] >gi|144944440|gb|EDJ79513.1| ThiJ/PfpI domain protein [Geobacter bemidjiensis Bem] >gi|197086770|gb|ACH38041.1| ThiJ/PfpI domain protein [Geobacter bemidjiensis Bem] (226 aa)
Score = 96, Expect = 2.5e-02, Identities = 21/65 (32%), Positives = 37/65 (56%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALAD 109
            Q ++AN  ++   +  +YD ++ PGG+G    L  +   I+ +++F  + K V A+C AP  LAD
  S:    76 AQAELANSISLSAVSAEEYDAVFYPGGHGPLWDLAVNPTSISLIEKFARSGKPVAAVCHAPAVLAD 141
>gi|167041485|gb|ABZ06235.1| putative DJ-1/PfpI family protein [uncultured marine microorganism HF4000_007I05] (175 aa)
Score = 96, Expect = 2.6e-02, Identities = 24/63 (38%), Positives = 32/63 (50%)
  Q:    52 IKTIKNFNVNDYDVLYIPGGYGA-TLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           +K I    VNDYD+L +PGG  A    RQ K+ I  + +F   DK +  IC     L    +IK
  S:    57 VKDINQVKVNDYDLLVLPGGVKALEKTRQDKRFIKFIADFHKADKVIACICSGVQLLISAKIIK 120
>gi|77920535|ref|YP_358350.1| isoprenoid biosynthesis protein [Pelobacter carbinolicus DSM 2380] >gi|77546618|gb|ABA90180.1| sigma cross-reacting protein 27A (SCRP-27A) [Pelobacter carbinolicus DSM 2380] (218 aa)
Score = 96, Expect = 2.6e-02, Identities = 27/47 (57%), Positives = 30/47 (63%)
  Q:    62 DYDVLYIPGGYGA--TLLRQSKKGIAC---------VKEFIDNDKWVIAICDAPNALA 108
           D D L IPGGYGA   L   ++KG AC         V+  ID  K V AIC AP  LA
  S:    86 DIDALVIPGGYGAAKNLCDFAEKGAACTVLPEVEQLVRTMIDKGKPVAAICIAPALLA 143
>gi|93005839|ref|YP_580276.1| ThiJ/PfpI [Psychrobacter cryohalolentis K5] >gi|92393517|gb|ABE74792.1| ThiJ/PfpI [Psychrobacter cryohalolentis K5] (225 aa)
Score = 96, Expect = 2.6e-02, Identities = 24/76 (31%), Positives = 39/76 (51%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYI 120
            Q  +A  K + +    D+D ++ PGG+G    L   K  I  ++ FI  DK V  +C +P AL +   +K D +Y+
  S:    76 AQERLATTKKLADMKAEDFDSVFYPGGHGPMWDLAVDKNSIELIETFIKQDKPVAFVCHSPAALKN---VKIDGEYL 149
>gi|156934739|ref|YP_001438655.1| hypothetical protein ESA_02574 [Enterobacter sakazakii ATCC BAA-894] >gi|156532993|gb|ABU77819.1| hypothetical protein ESA_02574 [Enterobacter sakazakii ATCC BAA-894] (226 aa)
Score = 96, Expect = 2.6e-02, Identities = 32/108 (29%), Positives = 57/108 (52%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL-----ADHNLIKEDQKYISWSSGD-------------ITDS--------KRIKDFNTHVYRSNKLITGRCP 152
            Q  +AN   +   N ++YD L+ PGG+G    L      IA ++ +  + K V A+C AP  L      D + + E ++   +++ +             + D+        +R  D+  HV     L+TG+ P
  S:    76 AQATLANTARLDEINADEYDALFYPGGHGPLWDLADHPISIALIEHYWGSGKPVAAVCHAPGVLRHVKKPDGSPLVEGKRVTGFTNSEEEAVGLTHVVPFLVEDALKEAGGQFERTDDWGVHVVVDGHLVTGQNP 210
>gi|57086915|ref|XP_536733.1| PREDICTED: similar to DJ-1 protein isoform 1 [Canis familiaris] >gi|73956704|ref|XP_858995.1| PREDICTED: similar to DJ-1 protein isoform 5 [Canis familiaris] >gi|73956706|ref|XP_859031.1| PREDICTED: similar to DJ-1 protein isoform 6 [Canis familiaris] (189 aa)
Score = 96, Expect = 2.7e-02, Identities = 39/121 (32%), Positives = 64/121 (52%)
  Q:    63 YDVLYIPGG-YGATLLRQSKKGIACVKEFI---DNDKWVIA-ICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNK------LITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGKE 183
           YDV+ +PGG  GA  L +S    A VKE +   +N K +IA IC  P AL  H +      + S  +       ++ + + + Y  N+      ++T R P  + + A   +E + GKD +D +K  L+ K+
  S:    67 YDVVILPGGNLGAQNLCES----AAVKEILKEQENRKGLIAAICAGPTALLAHEI-----GFGSKVTTHPLAKDKMMNGSHYSYSENRVEKDGLILTSRGPGTSFEFALAIVEALSGKDVADQVKAPLVLKD 189
>gi|166981177|ref|ZP_02252644.1| hypothetical protein BcerAH_03105 [Bacillus cereus AH187] >gi|168159938|ref|ZP_02595171.1| hypothetical protein BcerH_07437 [Bacillus cereus H3081.97] (194 aa)
Score = 96, Expect = 2.8e-02, Identities = 37/154 (24%), Positives = 76/154 (49%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVT 155
           K L      F + E V + S+F  S++FE I   +  + + VTG+  F      +I+   + DY+V  +PGG+    L ++++ ++ V +    +KW+  IC   + L    ++ + +    +S+   +D K++   +   Y+ NK +T    ++T
  S:     3 KALIFLFDGFAEFE-VNIASLFLISKQFEIIT--ATVDGKTVTGEGGFLCQPHVSIEQIKIEDYEVFIVPGGHIFGHL-ENEQLLSIVNKLHKQNKWIAGICAGTSLLHAAGVLNKKK----FSTSLTSDEKQLAHLHEWEYKQNKDVTVDGKIIT 150
>gi|47566098|ref|ZP_00237136.1| ThiJ/PfpI family protein, putative [Bacillus cereus G9241] >gi|47557015|gb|EAL15345.1| ThiJ/PfpI family protein, putative [Bacillus cereus G9241] (194 aa)
Score = 96, Expect = 2.8e-02, Identities = 37/154 (24%), Positives = 76/154 (49%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVT 155
           K L      F + E V + S+F  S++FE I   +  + + VTG+  F      +I+   + DY+V  +PGG+    L ++++ ++ V +    +KW+  IC   + L    ++ + +    +S+   +D K++   +   Y+ NK +T    ++T
  S:     3 KALIFLFDGFAEFE-VNIASLFLISKQFEIIT--ATVDGKTVTGEGGFLCQPHVSIEQIKIEDYEVFIVPGGHIFDHL-ENEQLLSIVNKLHKQNKWIAGICAGTSLLHAAGVLNKKK----FSTSLTSDEKQLAHLHEWEYKQNKDVTVDGKIIT 150
>gi|154482812|ref|ZP_02025260.1| hypothetical protein EUBVEN_00489 [Eubacterium ventriosum ATCC 27560] >gi|149736407|gb|EDM52293.1| hypothetical protein EUBVEN_00489 [Eubacterium ventriosum ATCC 27560] (185 aa)
Score = 96, Expect = 2.8e-02, Identities = 40/162 (24%), Positives = 76/162 (46%)
  Q:     5 ALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYD-----VLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           A      +++E + ++ + + ++K   +     + L + +      NIK   + N+N+ D      +++PGG  G T L   +K    + E+ +  K + AIC AP   ++  L+K D+   S+ S    D     ++   V R    ITG+   V L++    LE+I
  S:     6 AFLADGMEEVEALMVIDLLRRTKKLNVVTVSIKDELLVKSSH----NIKLYADKNINEIDFSSGDCIFLPGGMPGTTNLGACEKLADEIVEYNNQGKLLAAICAAPTVFSNLGLLK-DKNATSYPS--FEDQMECNNYGGGVVRDGNFITGKGLGVALEMG---LEII 163
>gi|116052370|ref|YP_792681.1| hypothetical protein PA14_56370 [Pseudomonas aeruginosa UCBPP-PA14] >gi|115587591|gb|ABJ13606.1| putative amidase/protease [Pseudomonas aeruginosa UCBPP-PA14] (194 aa)
Score = 96, Expect = 2.9e-02, Identities = 35/102 (34%), Positives = 47/102 (46%)
  Q:     7 TMSKFQDLEMV------------ALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           TM  FQ L+MV            A  S+  A   FE    YS +     T   D A  +        DYD L IPGG     LR +++ +A V++F    K + A+C     LA
  S:    20 TMVPFQALQMVGHQVHAVCPDKRAGQSVRTAIHDFEGDQTYSEKPGHNFTLNADFAQARA------EDYDALLIPGGRAPEYLRLNEQVLALVRDFDAARKPIAAVCHGAQLLA 127
>gi|49082600|gb|AAT50700.1| PA4336 [synthetic construct] (195 aa)
Score = 96, Expect = 2.9e-02, Identities = 35/102 (34%), Positives = 47/102 (46%)
  Q:     7 TMSKFQDLEMV------------ALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           TM  FQ L+MV            A  S+  A   FE    YS +     T   D A  +        DYD L IPGG     LR +++ +A V++F    K + A+C     LA
  S:    20 TMVPFQALQMVGHQVHAVCPDKRAGQSVRTAIHDFEGDQTYSEKPGHNFTLNADFAQARA------EDYDALLIPGGRAPEYLRLNEQVLALVRDFDAARKPIAAVCHGAQLLA 127
>gi|15599532|ref|NP_253026.1| hypothetical protein PA4336 [Pseudomonas aeruginosa PAO1] >gi|194549983|ref|YP_002085011.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] >gi|194555839|ref|YP_002090866.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] >gi|9950562|gb|AAG07724.1|AE004850_2 conserved hypothetical protein [Pseudomonas aeruginosa PAO1] >gi|126170929|gb|EAZ56440.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] >gi|126198232|gb|EAZ62295.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] (194 aa)
Score = 96, Expect = 2.9e-02, Identities = 35/102 (34%), Positives = 47/102 (46%)
  Q:     7 TMSKFQDLEMV------------ALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           TM  FQ L+MV            A  S+  A   FE    YS +     T   D A  +        DYD L IPGG     LR +++ +A V++F    K + A+C     LA
  S:    20 TMVPFQALQMVGHQVHAVCPDKRAGQSVRTAIHDFEGDQTYSEKPGHNFTLNADFAQARA------EDYDALLIPGGRAPEYLRLNEQVLALVRDFDAARKPIAAVCHGAQLLA 127
>gi|107100081|ref|ZP_01363999.1| hypothetical protein PaerPA_01001102 [Pseudomonas aeruginosa PACS2] (196 aa)
Score = 96, Expect = 2.9e-02, Identities = 35/102 (34%), Positives = 47/102 (46%)
  Q:     7 TMSKFQDLEMV------------ALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           TM  FQ L+MV            A  S+  A   FE    YS +     T   D A  +        DYD L IPGG     LR +++ +A V++F    K + A+C     LA
  S:    22 TMVPFQALQMVGHQVHAVCPDKRAGQSVRTAIHDFEGDQTYSEKPGHNFTLNADFAQARA------EDYDALLIPGGRAPEYLRLNEQVLALVRDFDAARKPIAAVCHGAQLLA 129
>gi|125975475|ref|YP_001039385.1| PfpI family intracellular peptidase [Clostridium thermocellum ATCC 27405] >gi|196252114|ref|ZP_03150777.1| intracellular protease, PfpI family [Clostridium thermocellum DSM 4150] >gi|125715700|gb|ABN54192.1| intracellular protease, PfpI family [Clostridium thermocellum ATCC 27405] >gi|196198537|gb|EDX93371.1| intracellular protease, PfpI family [Clostridium thermocellum DSM 4150] (192 aa)
Score = 96, Expect = 2.9e-02, Identities = 19/54 (35%), Positives = 28/54 (51%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           T    +  +YD L IPGG     +R +K+ +  VK F + +K + AIC  P  L
  S:    71 TFDEVDEKNYDALVIPGGRAPEYIRLNKRVLEIVKHFANENKPIAAICHGPQVL 124
>gi|167565419|ref|ZP_02358335.1| DJ-1/PfpI family protein [Burkholderia oklahomensis EO147] (226 aa)
Score = 96, Expect = 2.9e-02, Identities = 22/83 (26%), Positives = 46/83 (55%)
  Q:    25 ASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           A+++F++     PE       Q  +A+ + + + +++D+D ++ PGG+G    L + +  IA ++  +  +K V A+C AP  L
  S:    66 ATRRFDK----DPE------AQSALASTRKLADVSIDDHDAVFYPGGHGPLWDLAEDRHSIALIERAVATNKPVAAVCHAPGVL 139
>gi|149695427|ref|XP_001495448.1| PREDICTED: similar to Parkinson disease protein 7 [Equus caballus] (189 aa)
Score = 96, Expect = 2.9e-02, Identities = 36/121 (29%), Positives = 59/121 (48%)
  Q:    63 YDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSK---RIKDFNTHVYRSNK------LITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGKE 183
           YDV+ +PGG  GA  L +S      +KE       + AIC  P AL  H         I + S   T  +   +I + + + Y  N+      ++T R P  + + A   +E + GK+ +D +K  L+ K+
  S:    67 YDVVVLPGGNLGAQNLSESAAVKEILKEQEKRKGLIAAICAGPTALLAHE--------IGFGSKVTTHPQAKDKIMNGSHYSYSENRVEKDGLILTSRGPGTSFEFALAIVEALSGKEVADQVKAPLVLKD 189
>gi|166983486|ref|ZP_02254892.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus cereus AH187] >gi|168161353|ref|ZP_02596586.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus cereus H3081.97] (190 aa)
Score = 95, Expect = 3.0e-02, Identities = 29/115 (25%), Positives = 53/115 (46%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKED 116
           K+L      F + E+    ++ K   K+E I     + L +      +     +    V +Y+ + IPGG  A  ++ ++   + +++F + +K V AIC  P ALA   L KE+
  S:     3 KILLFVYPTFAEFEITVATALLK--NKYEIITAGLTKELIISETGLQVQPHIELSEVRVEEYEGIIIPGG-DAIHMKDAEGLFSVIRQFHEQEKLVAAICAGPYALAKAGLFKEN 114
>gi|147900143|ref|NP_001083896.1| SP22 [Xenopus laevis] >gi|46329781|gb|AAH68860.1| Park7 protein [Xenopus laevis] (189 aa)
Score = 95, Expect = 3.1e-02, Identities = 33/121 (27%), Positives = 54/121 (44%)
  Q:    63 YDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNL-IKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGKE 183
           YDV+ +PGG  GA  L +S      +KE       + AIC  P AL  H + I +       +   I +  + K     V +    IT R P  + + A   +  + GK+ ++ +K  L+ K+
  S:    67 YDVVVLPGGNLGAQNLSESPVVKEVLKEQEAKKGLIAAICAGPTALTVHGVGIGKTITTHPLAKDKIVNPDQYKYSEERVVKDENFITSRGPGTSFEFALEIVCTLLGKEVAEQVKTPLLLKD 189
>gi|160947210|ref|ZP_02094377.1| hypothetical protein PEPMIC_01143 [Peptostreptococcus micros ATCC 33270] >gi|158446344|gb|EDP23339.1| hypothetical protein PEPMIC_01143 [Peptostreptococcus micros ATCC 33270] (196 aa)
Score = 95, Expect = 3.1e-02, Identities = 37/157 (23%), Positives = 77/157 (49%)
  Q:    13 DLEMVALLSIFKASQKFERIDFYSPENLEM----VTGQFDIANIK--------TIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGK 169
           D  ++ L   F+  +   ++D+    ++++    +TG+  + + +         I+N N+ +Y  + IPGG  A   +R+ K+ +  +K+F +  K + AIC  P+ LA   ++      I     D      +K+    +   + +IT R   +  +LA+  +  I GK
  S:     2 DRYILILTDTFEEVEALTQVDYLRRADIKVDMISITGKLQVTSNRGITVLADDLIENINLKEYAGIIIPGGLPAAFDIREDKRVLEIIKKFDEEHKLISAICAGPSVLAKAGVLSGRNAVIYPGMEDELLDANVKE--DAICIDDNIITARGAGLAGELAYTLIRKIKGK 169
>gi|152986851|ref|YP_001346308.1| putative protease [Pseudomonas aeruginosa PA7] >gi|150962009|gb|ABR84034.1| probable protease [Pseudomonas aeruginosa PA7] (187 aa)
Score = 95, Expect = 3.1e-02, Identities = 23/48 (47%), Positives = 27/48 (56%)
  Q:    62 DYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALAD 109
           DYD+L +PGG   A  LRQ  +    VKEF +  K V AIC  P  L D
  S:    74 DYDLLLVPGGTVNADTLRQDSEARRLVKEFSEAGKTVAAICHGPWLLID 122
>gi|121997998|ref|YP_001002785.1| DJ-1 family protein [Halorhodospira halophila SL1] >gi|121589403|gb|ABM61983.1| DJ-1 family protein [Halorhodospira halophila SL1] (188 aa)
Score = 95, Expect = 3.2e-02, Identities = 30/108 (27%), Positives = 57/108 (52%)
  Q:    63 YDVLYIPGGYGATLLRQSKKGIACVKEFIDNDK--WVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKR--IKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKD 170
           +D++ +PGG G     +    IA + +   N++  W+ AIC AP  LA+  +++  +     ++   T  +R  I+  ++ V   + LIT R P   +D A   +EV++G +
  S:    65 FDLIVLPGGLGGAERLEGDARIARMLQ-AQNERGGWIAAICAAPRVLAEVGVLQGRR-----ATAFPTQLERHGIEPEDSAVVIDDNLITSRGPGTAMDFALRLIEVVYGDE 170
>gi|118387757|ref|XP_001026981.1| DJ-1/PfpI family protein [Tetrahymena thermophila SB210] >gi|89308751|gb|EAS06739.1| DJ-1/PfpI family protein [Tetrahymena thermophila SB210] (501 aa)
Score = 95, Expect = 3.2e-02, Identities = 29/83 (34%), Positives = 42/83 (50%)
  Q:    33 DFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDN----DKWVIAICDAPNALADHNLIKE 115
           DFY P     +  QF +     I   N NDYDV+YIPGG   ++ LR ++  I  +K F +N    +K VI +C          +I +
  S:   104 DFYKPS--YRIPKQFTM----DINKVNFNDYDVIYIPGGLPSSSALRNNQLFIQNLKSFYENKQNQEKLVIFMCSGTEVFIQSGIISD 185
>gi|29349330|ref|NP_812833.1| ThiJ family intracellular protease/amidase [Bacteroides thetaiotaomicron VPI-5482] >gi|29341238|gb|AAO79027.1| putative ThiJ family intracellular protease/amidase [Bacteroides thetaiotaomicron VPI-5482] (183 aa)
Score = 95, Expect = 3.2e-02, Identities = 42/165 (25%), Positives = 73/165 (44%)
  Q:    11 FQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIK--NFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGL 175
           F+++E    +   + +     I   +P+  E+V G  D++ +  I   N +  D D+L +PGG  GA  L + +     + +F    K + AIC AP  L    L+K  +     S     +       +  V R   +ITG  P   ++ A   ++++ GKD  D L
  S:    12 FEEIEAFTAVDTLRRAGLNVEIVSVTPD--EIVMGAHDVSLLCDINFDNCDFFDADLLLLPGGMPGAATLDKHEGLRKLLLDFAAKGKPIAAICAAPMVLGKLGLLKGRKATCYPSFEQYLEGAEC--VSEPVVRDGNIITGMGPGAAMEFALAIVDLLVGKDKVDEL 175
>gi|196039018|ref|ZP_03106325.1| thiJ/pfpI family protein [Bacillus cereus NVH0597-99] >gi|196030163|gb|EDX68763.1| thiJ/pfpI family protein [Bacillus cereus NVH0597-99] (194 aa)
Score = 95, Expect = 3.2e-02, Identities = 37/154 (24%), Positives = 77/154 (50%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVT 155
           K L      F + E V + S+F  S++FE I   +  + + VTG+  F      ++++  V DY+V  +PGG+    L ++ + ++ V +  + +KW+  IC   + L    ++ + +    +S+   +D K++   +   Y+ NK +T    ++T
  S:     3 KALIFLFDGFAEFE-VNIASLFLISKQFEIIT--ATVDGKTVTGEGGFLCQPHVSMEHIEVADYEVFIVPGGHIFDHL-ENNQLLSIVNKLHEQNKWIAGICAGTSLLHAAGVLNKKK----FSTSLTSDEKQLAHLHEWEYKQNKDVTVDGKIIT 150
>gi|89891505|ref|ZP_01203010.1| ThiJ/PfpI family protein [Flavobacteria bacterium BBFL7] >gi|89516279|gb|EAS18941.1| ThiJ/PfpI family protein [Flavobacteria bacterium BBFL7] (266 aa)
Score = 95, Expect = 3.2e-02, Identities = 42/125 (33%), Positives = 70/125 (56%)
  Q:    28 KFERIDFYSPENLEMVTGQFDIANI-KTIKNFNVN--DYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL-----ADHNLIKEDQKYISWSSGD-----ITD-----------------SKRIKDFNTHVYRSNKLITGRCP 152
           K E+ DF +P        Q     + KT+K   V+  DYD ++ PGG+G    L + +  I  ++ F +N+K V A+C AP        AD + + + +K   +++G+     +TD                 SK+  D+N +      LITG+ P
  S:    97 KSEQPDFQTPSTERYYKDQETQDKVSKTMKLSEVSHADYDAVFYPGGHGPLWDLAEDENSIKLIESFYNNNKTVAAVCHAPAIFKNTKNADGSPLVQGKKVTGFTNGEEDAVQLTDVVPFLVEDMLISNGGIYSKK-DDWNPYAVEDGLLITGQNP 251
>gi|169196026|ref|ZP_02855398.1| intracellular protease, PfpI family [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169092618|gb|EDS71327.1| intracellular protease, PfpI family [Rhizobium leguminosarum bv. trifolii WSM2304] (198 aa)
Score = 95, Expect = 3.3e-02, Identities = 23/61 (37%), Positives = 28/61 (45%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           T  +    DYD L IPGG     LR +   I  V+ F D  K V AIC     LA   ++K
  S:    72 TFDSVRPEDYDALVIPGGRAPEYLRLNADVIKAVRHFFDAGKPVAAICHGAQLLAAAGVLK 132
>gi|117921434|ref|YP_870626.1| PfpI family intracellular peptidase [Shewanella sp. ANA-3] >gi|117613766|gb|ABK49220.1| intracellular protease, PfpI family [Shewanella sp. ANA-3] (186 aa)
Score = 95, Expect = 3.3e-02, Identities = 35/107 (32%), Positives = 50/107 (46%)
  Q:     8 MSKFQDLEMV------------ALLSIFKASQKFERIDFYS--PENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           M  FQ L+MV            A  +I  A   FE    Y+  P +L  + G F           N +D+D L +PGG     LR +   IA V +F   DK + AIC     L   ++++
  S:    18 MVPFQALQMVGHSVTVVCPDKVAGQTIKTAIHDFEGDQTYTEKPGHLFALNGNF--------AGTNASDFDALLLPGGRAPEYLRLNPAVIALVMDFAAQDKPIAAICHGAQLLTAADVVR 130
>gi|167933376|ref|ZP_02520451.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi ZS7] (134 aa)
Score = 95, Expect = 3.5e-02, Identities = 34/122 (27%), Positives = 61/122 (50%)
  Q:    55 IKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLK 176
           I N   N +D++ +PGG  GAT L  SK+    +K+     K++ AIC +P  +     +    K+  +     ++ D + + +   +V RSN  IT +    + + AF  LE++ GK   + +K
  S:     5 ISNCKENCFDLIILPGGMPGATNLFNSKELDLILKDMNSKGKFIAAICASPVVVLAAKGLLGFNKFTCYPGLEKNVLDGEFVDE---NVVRSNNFITSKGVGTSFEFAFTLLEMVKGKQIMEDVK 126
>gi|88704400|ref|ZP_01102114.1| ThiJ/PfpI family protein [gamma proteobacterium KT 71] >gi|88701451|gb|EAQ98556.1| ThiJ/PfpI family protein [Congregibacter litoralis KT71] (224 aa)
Score = 95, Expect = 3.5e-02, Identities = 27/109 (24%), Positives = 45/109 (41%)
  Q:    64 DVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFS 172
           D+L +PGG G   L      +  V+E   +  +V ++C     L    L++       W+S    +S         V    +LITG      +D AF  L+ + G+D +
  S:    61 DILCVPGGGGVNPLLTDTATLNFVRETAASAIYVTSVCTGSLILGAAGLLRGKHATTHWASHHFLESFGAIPVKERVVVDGRLITGGGVTAGVDFAFTVLDEVLGRDVA 169
>gi|186686270|ref|YP_001869466.1| PfpI family intracellular peptidase [Nostoc punctiforme PCC 73102] >gi|186468722|gb|ACC84523.1| intracellular protease, PfpI family [Nostoc punctiforme PCC 73102] (365 aa)
Score = 95, Expect = 3.5e-02, Identities = 29/90 (32%), Positives = 44/90 (48%)
  Q:    63 YDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRI-----KDFNTHVYRSNKLITGRCP 152
           +D + IPGG     +R++   +  V+E I   K V A+C  P  L + NL+K  Q     ++G I  +K +     K  +  V     LIT R P
  S:    74 FDAVIIPGGMAPDRMRRNINTVRFVQEAIQQGKLVAAVCHGPQVLIEGNLLKGKQ-----ATGFIAIAKDMINAGAKYLDEPVVVDGNLITSREP 163
>gi|126652384|ref|ZP_01724557.1| DJ-1/PfpI family protein [Bacillus sp. B14905] >gi|126590805|gb|EAZ84919.1| DJ-1/PfpI family protein [Bacillus sp. B14905] (194 aa)
Score = 95, Expect = 3.6e-02, Identities = 33/123 (26%), Positives = 59/123 (47%)
  Q:    44 TGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQ---SKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDF--------NTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           T  F +A  K + + ++ D+D L IPGG+      +   S++  A V+ F +  K +  IC A   L    ++   Q     ++ +   SKR+           N  + +++ +IT   P    D+AF  LE +
  S:    49 TWNFKVAPEKLLHDIDLADFDALAIPGGFEEADFYEDAFSEEFQAVVRHFHEQQKPIATICVASLILGHSGILHNRQA----TTYNHPTSKRLAQLESYGAIIVNGRIVQTDHIITSSNPGTAFDVAFRLLETL 178
>gi|15599366|ref|NP_252860.1| putative protease [Pseudomonas aeruginosa PAO1] >gi|9950379|gb|AAG07558.1|AE004833_9 probable protease [Pseudomonas aeruginosa PAO1] (187 aa)
Score = 95, Expect = 3.6e-02, Identities = 22/55 (40%), Positives = 29/55 (52%)
  Q:    55 IKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALAD 109
           ++     DYD+L +PGG   A  LRQ  +    V+EF +  K V AIC  P  L D
  S:    67 LQGLRAEDYDLLLVPGGTVNADTLRQDSEARRLVREFSEAGKTVAAICHGPWLLID 122
>gi|186471497|ref|YP_001862815.1| ThiJ/PfpI domain-containing protein [Burkholderia phymatum STM815] >gi|184197806|gb|ACC75769.1| ThiJ/PfpI domain protein [Burkholderia phymatum STM815] (230 aa)
Score = 95, Expect = 3.7e-02, Identities = 23/72 (31%), Positives = 39/72 (54%)
  Q:    36 SPENLEMVTGQFD--------IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           +PE    +T +F         +AN   +     +DYD ++ PGG+G    L + ++ IA ++ F +  K V  +C AP  L
  S:    59 TPEGKTELTERFKNDPAAQKVLANTVKLDTVKADDYDAVFYPGGHGPMWDLAEDRRSIALIESFYNAGKPVAFVCHAPGVL 139
>gi|18978091|ref|NP_579448.1| intracellular protease [Pyrococcus furiosus DSM 3638] >gi|3024389|sp|Q51732|PFPI_PYRFU Intracellular protease 1 (Intracellular protease I) >gi|1373331|gb|AAB04694.1| protease I >gi|18893884|gb|AAL81843.1| intracellular protease; (PfpI) [Pyrococcus furiosus DSM 3638] (166 aa)
Score = 95, Expect = 3.7e-02, Identities = 27/114 (23%), Positives = 56/114 (49%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           MK+L L+ ++F+D+E++      +  ++   +   S E   ++TG+  + +    T    N +++D L +PGG     +R ++K +   ++     K V  IC  P  L    ++K
  S:     1 MKILFLSANEFEDVELI--YPYHRLKEEGHEVYIASFEK-GVITGKHGYSVKVDLTFDEVNPDEFDALVLPGGRAPERVRLNEKAVEIARKMFTEGKPVATICHGPQILISAGVLK 113
>gi|163737124|ref|ZP_02144542.1| Peptidase C56, PfpI [Phaeobacter gallaeciensis BS107] >gi|161389728|gb|EDQ14079.1| Peptidase C56, PfpI [Phaeobacter gallaeciensis BS107] (183 aa)
Score = 95, Expect = 3.8e-02, Identities = 24/55 (43%), Positives = 30/55 (54%)
  Q:    60 VNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           V+DYD L +PGG     LLR +   I  +  F D  K V AIC AP  L +  L+K
  S:    69 VDDYDALVLPGGQINPDLLRINDDVIELINAFYDQGKVVAAICHAPWLLIEAGLVK 124
>gi|147905238|ref|NP_001086295.1| MGC84701 protein [Xenopus laevis] >gi|49522782|gb|AAH74440.1| MGC84701 protein [Xenopus laevis] (189 aa)
Score = 95, Expect = 3.8e-02, Identities = 33/120 (27%), Positives = 53/120 (44%)
  Q:    63 YDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNL-IKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGK 182
           YDV+ +PGG  GA  L +S      +KE       + AIC  P AL  H + I +       +   I +  + K     V +    IT R P  + + A   +  + GK+ ++ +K  L+ K
  S:    67 YDVVVLPGGNLGAQNLSESPVVKEVLKEQEAKKGLIAAICAGPTALTVHGVGIGKSITTHPLAKDKIVNPDQYKYSEERVVKDENFITSRGPGTSFEFALEIVCTLLGKEVAEQVKTPLLLK 188
>gi|145221628|ref|YP_001132306.1| PfpI family intracellular peptidase [Mycobacterium gilvum PYR-GCK] >gi|145214114|gb|ABP43518.1| intracellular protease, PfpI family [Mycobacterium gilvum PYR-GCK] (182 aa)
Score = 95, Expect = 3.8e-02, Identities = 28/79 (35%), Positives = 41/79 (51%)
  Q:    31 RIDFYSPENLEMVTGQFDIANIKT------IKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALAD 109
           R+D  S  + E+     D+    T      +    V++YD L +PGG   A  LR  +  +A V EF+ + K V AIC  P AL +
  S:    40 RVDLLSVNDGEIAARNHDLEPAGTFTVDRVVAEATVDEYDGLVLPGGTVNADKLRLEEAAVAFVGEFVRSGKPVAAICHGPWALVE 125
>gi|69936791|ref|ZP_00631546.1| Peptidase C56, PfpI [Paracoccus denitrificans PD1222] >gi|119383893|ref|YP_914949.1| PfpI family intracellular peptidase [Paracoccus denitrificans PD1222] >gi|119373660|gb|ABL69253.1| intracellular protease, PfpI family [Paracoccus denitrificans PD1222] (185 aa)
Score = 95, Expect = 3.8e-02, Identities = 20/53 (37%), Positives = 29/53 (54%)
  Q:    62 DYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           +YD L +PGG     LR ++  +A V+ F + DK V AIC     LA   ++K
  S:    78 EYDALVVPGGRAPEYLRMNEAVLAKVRHFFEADKPVAAICHGAQLLAAAGVLK 130
>gi|158422181|ref|YP_001523473.1| proteinase I [Azorhizobium caulinodans ORS 571] >gi|158329070|dbj|BAF86555.1| proteinase I [Azorhizobium caulinodans ORS 571] (190 aa)
Score = 95, Expect = 3.8e-02, Identities = 31/94 (32%), Positives = 44/94 (46%)
  Q:    59 NVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDI---TDSKRIKDFNTHVYRSNKLITGRCP 152
           N  D+D L +PGG      LR + K IA  + F +  K V AIC  P  L    L+K  +K   +S+  +       ++ D  T V     L+T R P
  S:    69 NAGDFDALLLPGGVMNPDTLRINDKAIAFTRAFFEAGKPVAAICHGPQLLISAGLVK-GRKMTGYSAIQVDLANAGAQVSD--TEVIVDQGLVTSRNP 163
>gi|168039141|ref|XP_001772057.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162676658|gb|EDQ63138.1| predicted protein [Physcomitrella patens subsp. patens] (388 aa)
Score = 95, Expect = 3.9e-02, Identities = 22/67 (32%), Positives = 32/67 (47%)
  Q:    48 DIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           + A   T     V DYD L +PGG     L  ++K +  V+EF D  K + +IC     LA   ++K
  S:   260 NFALTATFSEVKVQDYDALVVPGGRAPEYLSLNEKVLDLVREFDDAKKPIASICHGQQILAAAGVLK 326
>gi|89275119|gb|ABD66014.1| SP22 [Xenopus laevis] (163 aa)
Score = 95, Expect = 3.9e-02, Identities = 33/121 (27%), Positives = 54/121 (44%)
  Q:    63 YDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNL-IKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGKE 183
           YDV+ +PGG  GA  L +S      +KE       + AIC  P AL  H + I +       +   I +  + K     V +    IT R P  + + A   +  + GK+ ++ +K  L+ K+
  S:    41 YDVVVLPGGNLGAQNLSESPVVKEVLKEQEAKKGLIAAICAGPTALTVHGVGIGKSITTHPLAKDKIVNPDQYKYSEERVVKDENFITSRGPGTSFEFALEIVCTLLGKEVAEQVKSPLLLKD 163
>gi|83945250|ref|ZP_00957599.1| ThiJ/PfpI [Oceanicaulis alexandrii HTCC2633] >gi|83851420|gb|EAP89276.1| ThiJ/PfpI [Oceanicaulis alexandrii HTCC2633] (227 aa)
Score = 95, Expect = 3.9e-02, Identities = 23/70 (32%), Positives = 37/70 (52%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALAD------HNLIK 114
            Q  +AN   +   N  D+D ++ PGG+G    L   +  +A ++ F   DK + A+C AP  L +      H L+K
  S:    76 AQKALANTVKLDTVNSEDFDAVFYPGGHGPLWDLTNDEHSVALIESFWKADKPIGAVCHAPTVLLNVKDEHGHALVK 152
>gi|116628998|ref|YP_814170.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Lactobacillus gasseri ATCC 33323] >gi|116094580|gb|ABJ59732.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme, amidase family [Lactobacillus gasseri ATCC 33323] (194 aa)
Score = 95, Expect = 3.9e-02, Identities = 38/112 (33%), Positives = 58/112 (51%)
  Q:    62 DYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKD------FNTHVY---RSNKLITGRCPVVTLDLAFYSLEVIFGKDFSD 173
           DYD++  PGG  GA  LR +KK    + +     KW  A+C AP AL  + L+ E   Y  +   +    K+I++      F+T +    + +K+IT R P      A Y++    G D SD
  S:    61 DYDLVAFPGGRTGALNLRNNKKLADLMIQRNKAGKWDAAMCAAPIALGHYGLL-EGANYTCYPGFE----KQIEEECPNGHFSTDITVVDKEHKIITSRGPATAWAYA-YTIARTLGHDTSD 176
>gi|83953726|ref|ZP_00962447.1| ThiJ/PfpI family protein [Sulfitobacter sp. NAS-14.1] >gi|83841671|gb|EAP80840.1| ThiJ/PfpI family protein [Sulfitobacter sp. NAS-14.1] (224 aa)
Score = 94, Expect = 4.0e-02, Identities = 22/77 (28%), Positives = 43/77 (55%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYIS 121
            Q ++AN + + + + + +D ++ PGG+G    L + K  I  ++ F  +D+ V A+C AP A+  H    +D+  +S
  S:    76 AQKELANTEVLSSVSADGFDAIFYPGGHGPLWDLAEDKASINLIESFAASDRPVGAVCHAP-AVFKHTKGTDDKPLVS 152
>gi|83942506|ref|ZP_00954967.1| ThiJ/PfpI family protein [Sulfitobacter sp. EE-36] >gi|83846599|gb|EAP84475.1| ThiJ/PfpI family protein [Sulfitobacter sp. EE-36] (224 aa)
Score = 94, Expect = 4.0e-02, Identities = 22/77 (28%), Positives = 43/77 (55%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYIS 121
            Q ++AN + + + + + +D ++ PGG+G    L + K  I  ++ F  +D+ V A+C AP A+  H    +D+  +S
  S:    76 AQKELANTEVLSSVSADGFDAIFYPGGHGPLWDLAEDKASINLIESFAASDRPVGAVCHAP-AVFKHTKGTDDKPLVS 152
>gi|167381204|ref|XP_001735619.1| protein DJ-1, putative [Entamoeba dispar SAW760] >gi|165902312|gb|EDR28169.1| protein DJ-1, putative [Entamoeba dispar SAW760] (147 aa)
Score = 94, Expect = 4.0e-02, Identities = 33/104 (31%), Positives = 55/104 (52%)
  Q:    63 YDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           YDV+ IPGG  GA  L  S+  I  +KE +  +++V AIC +P  + + N I + +K  ++ S     + +    +  V   N LIT + P   ++   +SLE+I
  S:    25 YDVIAIPGGLPGADNLAGSQLLIQKIKEQLAANRFVAAICASPAIVLEGNGIIQGRKCTAYPSFQPKLANQ-SAVHQRVVVDNHLITSQAPGSAIE---FSLEII 125
>gi|149191651|ref|ZP_01869894.1| ThiJ/PfpI [Vibrio shilonii AK1] >gi|148834492|gb|EDL51486.1| ThiJ/PfpI [Vibrio shilonii AK1] (223 aa)
Score = 94, Expect = 4.0e-02, Identities = 31/100 (31%), Positives = 46/100 (46%)
  Q:    39 NLEMVTG---QFDIANIKTIKNFNVNDYDVLYIPGGYG-ATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNT 138
           N E++T    Q  I N   +   N+NDYD ++ PGG+G  + L  ++   A      +    + A+C  P AL    L   D+   S S    T  + I DF T
  S:    65 NTEILTDEAFQNRINNTIPVSQININDYDAIFYPGGFGLLSDLSSNEDFAALAATHYEQGGVIAAVCHGPGALLPITLSNGDKLLASKSVTGFTREEEI-DFGT 167
>gi|108799848|ref|YP_640045.1| peptidase C56, PfpI [Mycobacterium sp. MCS] >gi|119868958|ref|YP_938910.1| PfpI family intracellular peptidase [Mycobacterium sp. KMS] >gi|126435491|ref|YP_001071182.1| PfpI family intracellular peptidase [Mycobacterium sp. JLS] >gi|108770267|gb|ABG08989.1| Peptidase C56, PfpI [Mycobacterium sp. MCS] >gi|119695047|gb|ABL92120.1| intracellular protease, PfpI family [Mycobacterium sp. KMS] >gi|126235291|gb|ABN98691.1| intracellular protease, PfpI family [Mycobacterium sp. JLS] (185 aa)
Score = 94, Expect = 4.0e-02, Identities = 30/100 (30%), Positives = 50/100 (50%)
  Q:    60 VNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS---------GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLA 159
           V ++D L +PGG      LR  +  +A V++F+ + K V AIC  P  L + ++++ D+   S+ S           + D +   D N    RS K +   C  +T   A
  S:    71 VEEFDALVLPGGTVNPDKLRLDESAVAFVRDFVRSGKPVAAICHGPWTLVEADVVR-DRTLTSYPSIRTDLRNAGATVVDQQVCIDGNLITSRSPKDLPAFCQAITDQFA 179
>gi|83814260|ref|YP_444573.1| PfpI family intracellular peptidase [Salinibacter ruber DSM 13855] >gi|83755654|gb|ABC43767.1| intracellular protease, PfpI family [Salinibacter ruber DSM 13855] (198 aa)
Score = 94, Expect = 4.0e-02, Identities = 21/60 (35%), Positives = 30/60 (50%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLI 113
           T +  +  DYD L +PGG     LR + + I   + F   DK V AIC A   LA  +++
  S:    71 TFEEVDAADYDALCLPGGRAPEYLRLNDRVIEMTRHFFAADKPVAAICHAAQTLAAADVL 130
>gi|110835281|ref|YP_694140.1| ThiJ/PfpI family protein [Alcanivorax borkumensis SK2] >gi|110648392|emb|CAL17868.1| ThiJ/PfpI family protein [Alcanivorax borkumensis SK2] (229 aa)
Score = 94, Expect = 4.0e-02, Identities = 36/115 (31%), Positives = 63/115 (54%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL--ADHN---LIKEDQKYISWSSGD-------------ITDS--------KRIKDFNTHVYRSNKLITGRCPVVTLDLA 159
            Q  +AN +T+   + + +D ++ PGG+G    L +    IA V+ F D  K V A+C AP       HN   L+K  +    +++G+             + D         K+ +D+ +HV     ++TG+ P  + D A
  S:    76 AQAALANTRTLAEIHADAFDAVFYPGGHGPLWDLAEDATSIALVESFNDAGKPVGAVCHAPAIFRHTRHNGQPLVK-GRTVTGFTNGEEEGVQLTHVVPFLVEDMLKANGGLYKKGEDWASHVVTDGNVVTGQNPASSADSA 216
>gi|147668899|ref|YP_001213717.1| DJ-1 family protein [Dehalococcoides sp. BAV1] >gi|146269847|gb|ABQ16839.1| DJ-1 family protein [Dehalococcoides sp. BAV1] (180 aa)
Score = 94, Expect = 4.1e-02, Identities = 32/115 (27%), Positives = 54/115 (46%)
  Q:    55 IKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGK 169
           I +    DY+VL +PGG  G   + + ++ +  ++     +K++ AIC  P  L+   +I  D K ++   G     K     +  V    +LITGR P   +D A  +L  +F K
  S:    55 IDDLKTTDYEVLVLPGGNPGFINMGKDQRVLELIRTAHAENKYLAAICAGPAVLSRAGVI--DGKEVAIYPGVKHLLKNCTACDLRVKVEGRLITGRSPQAAMDFAL-TLMDMFAK 167
>gi|167364214|ref|ZP_02298431.1| intracellular protease, PfpI family [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167068932|gb|EDR73191.1| intracellular protease, PfpI family [Rhizobium leguminosarum bv. trifolii WSM1325] (198 aa)
Score = 94, Expect = 4.2e-02, Identities = 22/61 (36%), Positives = 29/61 (47%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           T ++    DYD L IPGG     LR +   +  V+ F D  K V AIC     LA   ++K
  S:    72 TFESVRAEDYDALVIPGGRAPEYLRLNADVLKFVRHFFDAGKPVAAICHGAQLLAAAGVLK 132
>gi|71279077|ref|YP_267682.1| ThiJ/PfpI family protein [Colwellia psychrerythraea 34H] >gi|71144817|gb|AAZ25290.1| ThiJ/PfpI family protein [Colwellia psychrerythraea 34H] (229 aa)
Score = 94, Expect = 4.2e-02, Identities = 21/59 (35%), Positives = 32/59 (54%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           IAN + +   N  D+D ++ PGG+G    L  +   I  +++FI   K V A+C A  AL
  S:    83 IANTQVLAQINSEDFDAVFYPGGHGPLWDLTDNTNSIQLIEQFIAASKPVAAVCHATAAL 142
>gi|73748071|ref|YP_307310.1| DJ-1 family protein [Dehalococcoides sp. CBDB1] >gi|73659787|emb|CAI82394.1| DJ-1 family protein [Dehalococcoides sp. CBDB1] (180 aa)
Score = 94, Expect = 4.2e-02, Identities = 32/115 (27%), Positives = 54/115 (46%)
  Q:    55 IKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGK 169
           I +    DY+VL +PGG  G   + + ++ +  ++     +K++ AIC  P  L+   +I  D K ++   G     K     +  V    +LITGR P   +D A  +L  +F K
  S:    55 IDDLKTTDYEVLVLPGGNPGFINMGKDQRVLELIRTAHAENKYLAAICAGPAVLSRAGVI--DGKEVAIYPGVKHLLKNCTACDLRVKVEGRLITGRSPQAAMDFAL-TLMDMFAK 167
>gi|153894343|ref|ZP_02014927.1| intracellular protease, PfpI family [Halorubrum lacusprofundi ATCC 49239] >gi|151586941|gb|EDN50364.1| intracellular protease, PfpI family [Halorubrum lacusprofundi ATCC 49239] (197 aa)
Score = 94, Expect = 4.2e-02, Identities = 19/47 (40%), Positives = 25/47 (53%)
  Q:    62 DYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           DYD L +PGG     LR   + +  V+ F + DK V +IC  P  LA
  S:    80 DYDALVVPGGRAPEYLRGYDEVLDTVRHFFEADKPVASICHGPQILA 126
>gi|47568298|ref|ZP_00239000.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus cereus G9241] >gi|47554991|gb|EAL13340.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus cereus G9241] (193 aa)
Score = 94, Expect = 4.2e-02, Identities = 37/138 (26%), Positives = 68/138 (49%)
  Q:    44 TGQFDIANIKTIKNFNVNDYDVLYIPGGY-GATLLRQ--SKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDF-----NTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMG 181
           T  F +   KT+ +  ++++D L IPGG+  A   R   S++    ++ F    K + +IC A   L    ++   +K  ++S       +++K+F     N  + +   +IT   P    D+AF  LE +  K  ++ +K  LMG
  S:    49 TWNFTVIPEKTVDDIQLDEFDALAIPGGFEEAGFYRDAYSREFSHVIQHFYAKQKPIASICVASLTLGKSGILT-GKKATTYSHPTSKRKEQLKNFGAIIQNDLIVQDGNIITSSNPGTAFDVAFLLLEKLTSKKNAEHVK-DLMG 192
>gi|163843462|ref|YP_001627866.1| PfpI family intracellular peptidase [Brucella suis ATCC 23445] >gi|163674185|gb|ABY38296.1| intracellular protease, PfpI family [Brucella suis ATCC 23445] (194 aa)
Score = 94, Expect = 4.3e-02, Identities = 22/55 (40%), Positives = 27/55 (49%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           T  +    +YD L IPGG G   L   +K IA VK F   +K V A+C     LA
  S:    72 TFADVKPENYDALVIPGGRGPEYLHLDEKVIAVVKHFFAANKPVAAVCHGAQLLA 126
>gi|52081611|ref|YP_080402.1| intracellular protease [Bacillus licheniformis ATCC 14580] >gi|52786992|ref|YP_092821.1| YraA [Bacillus licheniformis ATCC 14580] >gi|52004822|gb|AAU24764.1| probable intracellular protease [Bacillus licheniformis ATCC 14580] >gi|52349494|gb|AAU42128.1| YraA [Bacillus licheniformis DSM 13] (174 aa)
Score = 94, Expect = 4.4e-02, Identities = 23/102 (22%), Positives = 52/102 (50%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIK--TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDA 103
           K++AL   +F+DLE+     + +  ++   + F   +      G++ +  +    +K+ N+ +YD + +PGG+    LR+  + +  ++ F +  K +  IC A
  S:     7 KVIALVSDEFEDLEL--WYPVLRLKEEGAIVHFIGEKADHEYKGKYGVPAVSDYELKSVNIEEYDAVLVPGGWAPDKLRRYPEVLEMIRWFNERKKPIGQICHA 108
>gi|120537237|ref|YP_957294.1| ThiJ/PfpI domain-containing protein [Marinobacter aquaeolei VT8] >gi|120327072|gb|ABM21379.1| ThiJ/PfpI domain protein [Marinobacter aquaeolei VT8] (227 aa)
Score = 94, Expect = 4.4e-02, Identities = 22/63 (34%), Positives = 31/63 (49%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
            Q D+AN   +    V D+D ++ PGG+G    L      I  V++F    K V A+C AP  L
  S:    77 AQRDLANTALLSEMKVEDFDAIFYPGGHGPLWDLTNDTDSIRLVEQFHAAGKPVSAVCHAPAVL 140
>gi|126737335|ref|ZP_01753070.1| Predicted intracellular protease/amidase, ThiJ/PfpL family protein [Roseobacter sp. SK209-2-6] >gi|126721920|gb|EBA18623.1| Predicted intracellular protease/amidase, ThiJ/PfpL family protein [Roseobacter sp. SK209-2-6] (233 aa)
Score = 94, Expect = 4.4e-02, Identities = 20/66 (30%), Positives = 34/66 (51%)
  Q:    47 FDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNL 112
           F   N + ++  + + +D L++PGGYG    L      I  +K+F ++ + V  +C AP  L D  L
  S:    85 FAAQNTRKLREIDYSTFDALFVPGGYGLIWDLASDSYTIKMIKDFYESGRPVAMVCHAPAILRDIKL 151
>gi|169629669|ref|YP_001703318.1| AraC family transcriptional regulator [Mycobacterium abscessus] >gi|169241636|emb|CAM62664.1| Putative transcription regulator, AraC family [Mycobacterium abscessus] (239 aa)
Score = 94, Expect = 4.4e-02, Identities = 28/105 (26%), Positives = 46/105 (43%)
  Q:    64 DVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDI---TDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFG 168
           DVL +PGG G   L    + IA +++  +  + V ++C     LA    +K  +    WS+ D     DS  I D N+        +T       +D+A Y +  + G
  S:   113 DVLLVPGGKGWRTLVDQPESIAKIQKLTERVELVASVCTGALLLAKAGFLKNRRATTHWSALDTLTQLDSTIIVDRNSRYVDGGNYVTSSGVSAGVDMALYVVSKLGG 220
>gi|86142409|ref|ZP_01060919.1| ThiJ/PfpI [Flavobacterium sp. MED217] >gi|85831161|gb|EAQ49618.1| ThiJ/PfpI [Leeuwenhoekiella blandensis MED217] (268 aa)
Score = 94, Expect = 4.5e-02, Identities = 19/50 (38%), Positives = 31/50 (62%)
  Q:    55 IKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAP 104
           ++  N  D+D ++ PGG+G    L + K  IA +++F  N+K V A+C AP
  S:   129 LETANQADFDAVFYPGGHGPLWDLAEDKNSIALIEDFYKNNKPVAAVCHAP 179
>gi|16303786|gb|AAL16803.1|AF394958_1 SP22 [Xenopus laevis] (189 aa)
Score = 94, Expect = 4.5e-02, Identities = 33/121 (27%), Positives = 54/121 (44%)
  Q:    63 YDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNL-IKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGKE 183
           YDV+ +PGG  GA  L +S      +KE       + AIC  P AL  H + I +       +   I +  + K     V +    IT R P  + + A   +  + GK+ ++ +K  L+ K+
  S:    67 YDVVVLPGGNLGAQNLSESPVVKEVLKEQEAKKGLIAAICAGPTALTVHGVGIGKTITTHPLAKDKIVNPDQYKYSEERVVKDENFITSRGPGTSFEFALEIVCTLLGKEVAEQVKTPLVLKD 189
>gi|74212240|dbj|BAE40278.1| unnamed protein product [Mus musculus] (189 aa)
Score = 94, Expect = 4.5e-02, Identities = 37/121 (30%), Positives = 59/121 (48%)
  Q:    63 YDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL-----------ADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGKE 183
           YDV+ +PGG  GA  L +S      +KE       + AIC  P AL             H L K+  K ++ S    ++S+  KD          ++T R P  + + A   +E + GKD ++ +K  L+ K+
  S:    67 YDVVVLPGGNLGAQNLSESPMVKEILKEQESRKGLIAAICAGPTALLAHEVGFGCKVTTHTLAKD--KMMNGSHYSYSESRVEKD--------GLILTSRGPGTSFEFALAIVEALVGKDMANQVKAPLVLKD 189
>gi|167938244|ref|ZP_02525319.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus cereus AH1134] (190 aa)
Score = 94, Expect = 4.5e-02, Identities = 30/113 (26%), Positives = 51/113 (45%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+L    S F + E+    ++ K   K+E I     + L +      +     +    V++Y+ + IPGG    L   +K   + +++F + +K V AIC  P ALA   L K
  S:     3 KILLFVYSTFAEFEITVATALLK--NKYEIITAGLTKELVISETGLQVQPHIEVSEVCVDEYEGILIPGGEEGQL-EDAKPLFSIIRQFHEQEKLVAAICAGPYALAKAGLFK 112
>gi|153009324|ref|YP_001370539.1| PfpI family intracellular peptidase [Ochrobactrum anthropi ATCC 49188] >gi|151561212|gb|ABS14710.1| intracellular protease, PfpI family [Ochrobactrum anthropi ATCC 49188] (194 aa)
Score = 94, Expect = 4.5e-02, Identities = 22/55 (40%), Positives = 25/55 (45%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           T        YD L IPGG     LR   K IA VK F + +K V A+C     LA
  S:    72 TFAEIKPESYDALVIPGGRAPEYLRLDDKVIAVVKHFFEANKPVAAVCHGAQLLA 126
>gi|170745368|ref|YP_001766825.1| PfpI family intracellular peptidase [Methylobacterium radiotolerans JCM 2831] >gi|170658969|gb|ACB28023.1| intracellular protease, PfpI family [Methylobacterium radiotolerans JCM 2831] (189 aa)
Score = 94, Expect = 4.6e-02, Identities = 23/62 (37%), Positives = 34/62 (54%)
  Q:    53 KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K I   + +D+D L IPGG  GA  LR S+  +  V++F    K V  IC  P  L + +++K
  S:    63 KVIDGVSASDFDGLIIPGGSVGADKLRGSEAVVGFVRDFFQQAKPVGVICHGPWTLVEADVVK 125
>gi|196044580|ref|ZP_03111815.1| thiJ/pfpI family protein [Bacillus cereus 03BB108] >gi|196024615|gb|EDX63287.1| thiJ/pfpI family protein [Bacillus cereus 03BB108] (190 aa)
Score = 94, Expect = 4.6e-02, Identities = 29/114 (25%), Positives = 51/114 (44%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKE 115
           K+L      F + E+    ++ K   K+E I       L +      +     ++   V +Y+ + IPGG  A  ++ +    + +++F + +K V AIC  P ALA   L KE
  S:     3 KILLFVYPTFAEFEITVATALLK--NKYEIITAGLTNELIISETGLQVQPHIELREVRVEEYEGIIIPGG-DAIHMKDAAGLFSVIRQFHEQEKLVAAICAGPYALAKAGLFKE 113
>gi|163740463|ref|ZP_02147857.1| Peptidase C56, PfpI [Phaeobacter gallaeciensis 2.10] >gi|161386321|gb|EDQ10696.1| Peptidase C56, PfpI [Phaeobacter gallaeciensis 2.10] (183 aa)
Score = 94, Expect = 4.6e-02, Identities = 23/55 (41%), Positives = 31/55 (56%)
  Q:    60 VNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           V+DYD L +PGG     LLR +   I  +  F D+ K V AIC AP  + +  L+K
  S:    69 VDDYDALVLPGGQINPDLLRINDDVIELINAFYDHGKVVAAICHAPWLMIEAGLVK 124
>gi|196479535|gb|ACG79063.1| putative intracellular protease/amidase [Phenylobacterium zucineum HLK1] (203 aa)
Score = 94, Expect = 4.7e-02, Identities = 23/72 (31%), Positives = 36/72 (50%)
  Q:    53 KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           + +   +  DYD L +PGG      LR  +K I  ++ F+  +K + AIC  P  L D   + + +K  SW S
  S:    64 RELSQASAQDYDGLVLPGGVINPDQLRLEEKAIDFIRHFVREEKPIAAICHGPWTLIDAGAV-DGRKMTSWPS 135
>gi|118478891|ref|YP_896042.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus thuringiensis str. Al Hakam] >gi|118418116|gb|ABK86535.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus thuringiensis str. Al Hakam] (197 aa)
Score = 94, Expect = 4.8e-02, Identities = 29/114 (25%), Positives = 51/114 (44%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKE 115
           K+L      F + E+    ++ K   K+E I       L +      +     ++   V +Y+ + IPGG  A  ++ +    + +++F + +K V AIC  P ALA   L KE
  S:    10 KILLFVYPTFAEFEITVATALLK--NKYEIITAGLTNELIISETGLQVQPHIELREVRVEEYEGIIIPGG-DAIHMKDAAGLFSVIRQFHEQEKLVAAICAGPYALAKAGLFKE 120
>gi|67156286|ref|ZP_00417879.1| Peptidase C56, PfpI [Azotobacter vinelandii AvOP] >gi|67086045|gb|EAM05515.1| Peptidase C56, PfpI [Azotobacter vinelandii AvOP] (195 aa)
Score = 94, Expect = 4.8e-02, Identities = 32/102 (31%), Positives = 44/102 (43%)
  Q:     7 TMSKFQDLEMVALL------------SIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           TM  FQ L MV               S+  A   FE    YS +        FD A ++        DYD L +PGG     LR  ++ +  V+ F   +K + A+C     LA
  S:    19 TMVPFQALLMVGHTVHAVCPGKQTGQSVRTAIHDFEGDQTYSEKPGHNFALNFDFAQVRA------EDYDALLVPGGRAPEYLRLDERVLELVRNFATANKPIAAVCHGAQLLA 126
>gi|23321215|gb|AAN23110.1| thiJ-like protein [Brassica rapa subsp. pekinensis] (127 aa)
Score = 94, Expect = 4.9e-02, Identities = 25/108 (23%), Positives = 54/108 (50%)
  Q:    63 YDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKD 170
           +D++ +PGG GA      +K +  + +  + +K    IC +P  + +HN + +D+K  +    S +++D   I   +  V     +IT R P   ++ +   +E  +G++
  S:    10 FDLIVLPGGNGAQRFASCEKLVNMLNKQAEANKPYGGICKSPVYVFEHNGLLKDKKATTHPRVSNELSDQSHI---DHRVVVDGNVITSRAPGTAMEFSLAIVEKFYGRE 116
>gi|152966279|ref|YP_001362063.1| ThiJ/PfpI domain-containing protein [Kineococcus radiotolerans SRS30216] >gi|151360796|gb|ABS03799.1| ThiJ/PfpI domain protein [Kineococcus radiotolerans SRS30216] (232 aa)
Score = 94, Expect = 4.9e-02, Identities = 21/61 (34%), Positives = 30/61 (49%)
  Q:    62 DYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISW 122
           DYD+L+IPGG     LR+  + IA V+        + A+C  P  L D  L+   +   SW
  S:   122 DYDLLFIPGGLAPGELRRDPRAIAFVQAVAGWGTTIGAVCHGPQVLVDAGLVA-GRSMTSW 181
>gi|15897935|ref|NP_342540.1| intracellular proteinase [Sulfolobus solfataricus P2] >gi|13814256|gb|AAK41330.1| Intracellular proteinase [Sulfolobus solfataricus P2] (173 aa)
Score = 93, Expect = 5.4e-02, Identities = 33/113 (29%), Positives = 58/113 (51%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQK-FERIDFYSPENLEMVT--GQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+L L   +F+D+E+  L   ++  ++ F+ +  +   N +++   G   I++I   K+    DY  L IPGG G   +R  ++     ++F +  K V AIC  P  L   NL+K
  S:     5 KVLFLVGEEFEDIEL--LYPFYRVMEEGFKPVIAWKEANSKVIGKHGYTVISDI-AFKDVRPEDYIALVIPGGRGPEHIRTLEEVKNITRKFFELKKPVAAICHGPQILISANLVK 117
>gi|21536528|gb|AAM60860.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Arabidopsis thaliana] (438 aa)
Score = 93, Expect = 5.5e-02, Identities = 33/110 (30%), Positives = 59/110 (53%)
  Q:    61 NDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALAD-HNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKD 170
           N YD++ +PGG  GA     S+K +  +K+  +++K   AIC +P  + + H L+K  +K  ++ +    +TD   I+     V     LIT R P  +L+ A   +E  +G++
  S:   318 NLYDLIVLPGGLGGAEAFASSEKLVNMLKKQAESNKPYGAICASPALVFEPHGLLK-GKKATAFPAMCSKLTDQSHIEH---RVLVDGNLITSRGPGTSLEFALAIVEKFYGRE 427
>gi|16924002|ref|NP_476484.1| Parkinson disease protein 7 [Rattus norvegicus] >gi|56404680|sp|O88767|PARK7_RAT Protein DJ-1 (Parkinson disease protein 7 homolog) (Contraception-associated protein 1) (Protein CAP1) (Fertility protein SP22) >gi|5478755|gb|AAD43956.1|AF157511_1 fertility protein SP22 [Rattus norvegicus] >gi|5478757|gb|AAD43957.1|AF157512_1 fertility protein SP22 [Rattus norvegicus] >gi|3250916|emb|CAA07434.1| CAP1 [Rattus norvegicus] >gi|149024696|gb|EDL81193.1| rCG30883, isoform CRA_a [Rattus norvegicus] >gi|149024697|gb|EDL81194.1| rCG30883, isoform CRA_a [Rattus norvegicus] >gi|149024698|gb|EDL81195.1| rCG30883, isoform CRA_a [Rattus norvegicus] (189 aa)
Score = 93, Expect = 5.5e-02, Identities = 41/121 (33%), Positives = 66/121 (54%)
  Q:    63 YDVLYIPGG-YGATLLRQSKKGIACVKEFI---DNDKWVIA-ICDAPNALADHNL----------IKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGKE 183
           YDV+ +PGG  GA  L +S    A VKE +   +N K +IA IC  P AL  H +          + +D K ++ S    ++S+  KD          ++T R P  + + A   +E + GKD ++ +K  L+ K+
  S:    67 YDVVVLPGGNLGAQNLSES----ALVKEILKEQENRKGLIAAICAGPTALLAHEVGFGCKVTSHPLAKD-KMMNGSHYSYSESRVEKD--------GLILTSRGPGTSFEFALAIVEALSGKDMANQVKAPLVLKD 189
>gi|50085333|ref|YP_046843.1| putative intracellular proteinase [Acinetobacter sp. ADP1] >gi|49531309|emb|CAG69021.1| conserved hypothetical protein; putative intracellular proteinase [Acinetobacter sp. ADP1] (183 aa)
Score = 93, Expect = 5.6e-02, Identities = 19/60 (31%), Positives = 36/60 (60%)
  Q:    55 IKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           I N  ++D+D L+I GG   T L   ++ IA V++F +  K + + CD P+ L + ++++
  S:    69 IHNSCIHDFDALFIAGGISPTSLSCYERFIAFVQKFANAQKPIFSSCDDPSLLIEASIVR 128
>gi|125550179|gb|EAY96001.1| hypothetical protein OsI_017234 [Oryza sativa (indica cultivar-group)] (423 aa)
Score = 93, Expect = 5.6e-02, Identities = 22/61 (36%), Positives = 30/61 (49%)
  Q:    48 DIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           D A   +  N + + YD L IPGG     L  + K I+ VK F+D  K V +IC     L+
  S:   295 DFALTASFDNVDASSYDALVIPGGRAPEYLALNDKVISLVKGFMDKAKPVASICHGQQILS 355
Score = 85, Expect = 5.3e-01, Identities = 18/56 (32%), Positives = 30/56 (53%)
  Q:    59 NVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           N+N+YD L IPGG     L   +K +  V++F D  K + ++C     LA   +++
  S:   113 NINEYDGLVIPGGRAPEYLAMDEKVLDLVRKFSDAKKPIASVCHGQLILAAAGVVQ 168
>gi|115461240|ref|NP_001054220.1| Os04g0671700 [Oryza sativa (japonica cultivar-group)] >gi|70663940|emb|CAE03602.2| OSJNBb0004A17.4 [Oryza sativa (japonica cultivar-group)] >gi|90265250|emb|CAH67703.1| H0624F09.11 [Oryza sativa (indica cultivar-group)] >gi|113565791|dbj|BAF16134.1| Os04g0671700 [Oryza sativa (japonica cultivar-group)] >gi|125592020|gb|EAZ32370.1| hypothetical protein OsJ_015853 [Oryza sativa (japonica cultivar-group)] (387 aa)
Score = 93, Expect = 5.6e-02, Identities = 22/61 (36%), Positives = 30/61 (49%)
  Q:    48 DIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           D A   +  N + + YD L IPGG     L  + K I+ VK F+D  K V +IC     L+
  S:   259 DFALTASFDNVDASSYDALVIPGGRAPEYLALNDKVISLVKGFMDKAKPVASICHGQQILS 319
Score = 85, Expect = 5.3e-01, Identities = 18/56 (32%), Positives = 30/56 (53%)
  Q:    59 NVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           N+N+YD L IPGG     L   +K +  V++F D  K + ++C     LA   +++
  S:    77 NINEYDGLVIPGGRAPEYLAMDEKVLDLVRKFSDAKKPIASVCHGQLILAAAGVVQ 132
>gi|85681821|gb|ABC73064.1| unknown [Oryza rufipogon] (352 aa)
Score = 93, Expect = 5.6e-02, Identities = 22/61 (36%), Positives = 30/61 (49%)
  Q:    48 DIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           D A   +  N + + YD L IPGG     L  + K I+ VK F+D  K V +IC     L+
  S:   224 DFALTASFDNVDASSYDALVIPGGRAPEYLALNDKVISLVKGFMDKAKPVASICHGQQILS 284
>gi|90422501|ref|YP_530871.1| peptidase C56, PfpI [Rhodopseudomonas palustris BisB18] >gi|90104515|gb|ABD86552.1| Peptidase C56, PfpI [Rhodopseudomonas palustris BisB18] (187 aa)
Score = 93, Expect = 5.6e-02, Identities = 22/62 (35%), Positives = 32/62 (51%)
  Q:    53 KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K +     +DYD L +PGG     LLR + + +  +K F D  K V A+C AP  L +  + K
  S:    63 KALSAAKADDYDALVLPGGQINPDLLRVNAEALKLIKAFYDGGKVVAAVCHAPWLLIETGIAK 125
>gi|152965997|ref|YP_001361781.1| PfpI family intracellular peptidase [Kineococcus radiotolerans SRS30216] >gi|151360514|gb|ABS03517.1| intracellular protease, PfpI family [Kineococcus radiotolerans SRS30216] (245 aa)
Score = 93, Expect = 5.6e-02, Identities = 30/99 (30%), Positives = 46/99 (46%)
  Q:    54 TIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS--GDITDSKRIKDFNTHVYRSNKLITGRCP 152
           T+   +  +YD L +PGG+    LLRQS      V+ F   ++ V+ +C  P  LA   L+ E +   SW     D+ ++      +  V R   L T R P
  S:    66 TVGEADPGEYDGLLLPGGFINPDLLRQSAAAREFVRGFAAGNRPVVTLCHGPWVLASAGLL-EGRTLTSWPGIRDDVVNAGATW-LDQEVVRDGNLTTSRGP 165
>gi|152990421|ref|YP_001356143.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein [Nitratiruptor sp. SB155-2] >gi|151422282|dbj|BAF69786.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein [Nitratiruptor sp. SB155-2] (185 aa)
Score = 93, Expect = 5.7e-02, Identities = 37/171 (21%), Positives = 80/171 (46%)
  Q:    11 FQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISW--------SSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMG 181
           F+++E +A++ +   +     +       +E       +     +K+  ++ YD++ +PGG  GA  L +S+     +++  +  K+V AIC AP AL +  ++ E +K+ ++          G + D K + D N        ++T R P   +      + ++ G++    LK  L+ 
  S:    12 FEEIEAMAIIDVLSRAGNNVTVAGLFDNEVEGANTGLKVLVHTLLKDVEIDTYDLMVLPGGLPGAEHLAKSELVQEMIRKMNEKGKYVGAICAAPWALKEAGVL-EGKKHTNYPGFEEKTGEEGYVADQKVVIDGN--------VVTSRGPGTAICFGLELVRLLNGEETYKQLKAGLLA 182
>gi|29833773|ref|NP_828407.1| intracellular protease/amidase [Streptomyces avermitilis MA-4680] >gi|29610897|dbj|BAC74942.1| putative intracellular protease/amidase [Streptomyces avermitilis MA-4680] (218 aa)
Score = 93, Expect = 5.7e-02, Identities = 26/84 (30%), Positives = 45/84 (53%)
  Q:    41 EMVTGQFDIANIKT------IKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           E+   QFD+    T      + + +V+DY  L +PGG      LR  +  +  VK+F+ + K V +IC  P  L + + ++  ++  SW S
  S:    77 EIQARQFDLNAAGTFPVDRLVADASVDDYHALLLPGGTMNPDQLRMDRDAVQFVKDFMASGKPVASICHGPWTLVEADAVR-GRRLTSWPS 166
>gi|83855625|ref|ZP_00949154.1| Conserved secreted Zn-dependent enzyme from deacylase/carboxypeptidase superfamily protein [Croceibacter atlanticus HTCC2559] >gi|83849425|gb|EAP87293.1| Conserved secreted Zn-dependent enzyme from deacylase/carboxypeptidase superfamily protein [Croceibacter atlanticus HTCC2559] (823 aa)
Score = 93, Expect = 5.7e-02, Identities = 22/68 (32%), Positives = 35/68 (51%)
  Q:    51 NIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQK 118
           N       ++ DYDVL IP GY  +   +SK  +  +KEF+ N   +IA+ +A    +D++     QK
  S:   618 NTNNFSGIHLGDYDVLIIPDGYYGSYFDESK--LDTLKEFVKNGGKIIALANALQIFSDNDSFSLKQK 683
>gi|187466257|emb|CAQ52056.1| Parkinson disease (autosomal recessive, early onset) 7 [Mus musculus] (188 aa)
Score = 93, Expect = 5.8e-02, Identities = 36/121 (29%), Positives = 60/121 (49%)
  Q:    63 YDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNL----------IKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGKE 183
           YDV+ +PGG  GA  L +S      +KE       + AIC  P AL  H +          + +D K ++ S    ++S+  KD          ++T R P  + + A   +E + GKD ++ +K  L+ K+
  S:    66 YDVVVLPGGNLGAQNLSESPMVKEILKEQESRKGLIAAICAGPTALLAHEVGFGCKVTTHPLAKD-KMMNGSHYSYSESRVEKD--------GLILTSRGPGTSFEFALAIVEALVGKDMANQVKAPLVLKD 188
>gi|157104409|ref|XP_001648396.1| dj-1 protein (park7) [Aedes aegypti] >gi|108880380|gb|EAT44605.1| dj-1 protein (park7) [Aedes aegypti] (186 aa)
Score = 93, Expect = 5.8e-02, Identities = 35/109 (32%), Positives = 49/109 (44%)
  Q:    62 DYDVLYIPGGYGAT-LLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHN--LIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKD 170
           D+D + +PGG G +  +  S K    +K F    K + AIC AP  L  H+  L K    Y S+          ++D  T V   N L+T R P    D A    E++ G D
  S:    63 DFDAIALPGGLGGSKAMSGSTKLGEVLKSFESKGKLITAICAAPTVLLTHSVALGKTLTSYPSFKDEFAGKYTYVED-KTVVVDGN-LVTSRGPGTAFDFALKLGEILVGLD 172
>gi|55741460|ref|NP_065594.2| Parkinson disease protein 7 [Mus musculus] >gi|56404944|sp|Q99LX0|PARK7_MOUSE Protein DJ-1 (Parkinson disease protein 7 homolog) >gi|12805429|gb|AAH02187.1| Parkinson disease (autosomal recessive, early onset) 7 [Mus musculus] >gi|54792586|dbj|BAA29063.2| DJ-1 [Mus musculus] >gi|74150475|dbj|BAE32271.1| unnamed protein product [Mus musculus] >gi|74226952|dbj|BAE27118.1| unnamed protein product [Mus musculus] >gi|123246552|emb|CAM19230.1| Parkinson disease (autosomal recessive, early onset) 7 [Mus musculus] >gi|148682949|gb|EDL14896.1| Parkinson disease (autosomal recessive, early onset) 7, isoform CRA_a [Mus musculus] >gi|148682950|gb|EDL14897.1| Parkinson disease (autosomal recessive, early onset) 7, isoform CRA_a [Mus musculus] (189 aa)
Score = 93, Expect = 5.8e-02, Identities = 36/121 (29%), Positives = 60/121 (49%)
  Q:    63 YDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNL----------IKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGKE 183
           YDV+ +PGG  GA  L +S      +KE       + AIC  P AL  H +          + +D K ++ S    ++S+  KD          ++T R P  + + A   +E + GKD ++ +K  L+ K+
  S:    67 YDVVVLPGGNLGAQNLSESPMVKEILKEQESRKGLIAAICAGPTALLAHEVGFGCKVTTHPLAKD-KMMNGSHYSYSESRVEKD--------GLILTSRGPGTSFEFALAIVEALVGKDMANQVKAPLVLKD 189
>gi|15921126|ref|NP_376795.1| protease I [Sulfolobus tokodaii str. 7] >gi|15621911|dbj|BAB65904.1| 173aa long hypothetical protease I [Sulfolobus tokodaii str. 7] (173 aa)
Score = 93, Expect = 5.9e-02, Identities = 41/152 (26%), Positives = 70/152 (46%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTI--KNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS---------GDITDSKRIKDFNTHVYRSNKLITGRCP 152
           MK+L +   +++D+E+  L   ++  ++  +      E    + G+   + +  I  K+  V DY  L IPGG G   +R   +     + F  + K V AIC  P  L    +IK  +K  S +S         G+  D+  ++D N        LI+ R P
  S:     1 MKVLFIVGDEYEDIEL--LYPFYRVIEEGYQPVIAGKEAGAKIVGKHGYSVVADIAFKDVKVEDYLALVIPGGRGPERIRTLPEVKELTRRFFIDKKPVAAICHGPQVLISAGVIK-GRKVTSVASIKDDIVAAGGEYVDAPLVEDEN--------LISSRHP 152
>gi|161619152|ref|YP_001593039.1| PfpI family intracellular peptidase [Brucella canis ATCC 23365] >gi|161335963|gb|ABX62268.1| intracellular protease, PfpI family [Brucella canis ATCC 23365] (194 aa)
Score = 93, Expect = 5.9e-02, Identities = 22/55 (40%), Positives = 27/55 (49%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           T  +    +YD L IPGG     LR  +K IA VK F   +K V A+C     LA
  S:    72 TFADVKPENYDALVIPGGRDPEYLRLDEKVIAVVKHFFAANKPVAAVCHGAQLLA 126
>gi|188579591|ref|YP_001923036.1| intracellular protease, PfpI family [Methylobacterium populi BJ001] >gi|179343089|gb|ACB78501.1| intracellular protease, PfpI family [Methylobacterium populi BJ001] (189 aa)
Score = 93, Expect = 6.2e-02, Identities = 23/62 (37%), Positives = 34/62 (54%)
  Q:    53 KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K I   + +D+D L IPGG  GA  LR S+  +  V++F    K V  IC  P  L + +++K
  S:    63 KAIDGVSASDFDGLVIPGGSVGADKLRGSEPVVKFVRDFFQQAKPVGVICHGPWTLVEADVVK 125
>gi|163812004|ref|ZP_02203684.1| DJ-1 family protein [Dehalococcoides sp. VS] >gi|157404351|gb|EDO70391.1| DJ-1 family protein [Dehalococcoides sp. VS] (180 aa)
Score = 93, Expect = 6.3e-02, Identities = 32/115 (27%), Positives = 54/115 (46%)
  Q:    55 IKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGK 169
           I +    DY+VL +PGG  G   + + ++ +  ++     +K++ AIC  P  L+   +I  + K ++   G     K     +  V    KLITGR P   +D A  +L  +F K
  S:    55 IDDLKTTDYEVLVLPGGNPGFINMGKDQRVLELIRTAHTENKYLAAICAGPAVLSRAGVI--NGKEVAIYPGVKHLLKNCTACDLRVKVEGKLITGRSPQAAMDFAL-TLMDMFAK 167
>gi|17558714|ref|NP_504132.1| DJ-1 (mammalian transcriptional regulator) Related family member (djr-1.2) [Caenorhabditis elegans] >gi|13324922|gb|AAK18904.1| Dj-1 (mammalian transcriptional regulator) related protein 1.2 [Caenorhabditis elegans] (186 aa)
Score = 93, Expect = 6.3e-02, Identities = 31/128 (24%), Positives = 60/128 (46%)
  Q:    48 DIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGL 175
           D+A +K +KN     +D++ IPGG G + L +       +K  + +   + AIC  P  L  H ++ E +    ++  D       K  + +V  S+++IT + P    + A   +E + G + ++ L
  S:    56 DVA-LKDVKN---KTFDIIIIPGGPGCSKLAECPVIGELLKTQVKSGGLIGAICAGPTVLLAHGIVAE-RVTCHYTVKDKMTEGGYKYLDDNVVISDRVITSKGPGTAFEFALKIVETLEGPEKTNSL 178
>gi|83857147|ref|ZP_00950675.1| ThiJ/PfpI [Croceibacter atlanticus HTCC2559] >gi|83848514|gb|EAP86383.1| ThiJ/PfpI [Croceibacter atlanticus HTCC2559] (267 aa)
Score = 93, Expect = 6.3e-02, Identities = 20/61 (32%), Positives = 32/61 (52%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALAD 109
           IAN K +   N  D+D ++ PGG+G    L   +  I  ++ F   +K +  +C AP AL +
  S:   122 IANTKVLSTVNAEDFDAVFYPGGHGPLWDLATDETSIKLIETFNSQNKPIAFVCHAPAALKN 183
>gi|196045098|ref|ZP_03112331.1| thiJ/pfpI family protein [Bacillus cereus 03BB108] >gi|196024100|gb|EDX62774.1| thiJ/pfpI family protein [Bacillus cereus 03BB108] (212 aa)
Score = 93, Expect = 6.4e-02, Identities = 37/154 (24%), Positives = 76/154 (49%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVT 155
           K L      F + E V + S+F  S++FE I   +  + + VTG+  F      ++++  V DY+V  +PGG+    L ++ + ++ V +    +KW+  IC   + L    ++ + +    +S+   +D K++   +   Y+ NK +T    ++T
  S:    21 KALIFLFDGFAEFE-VNIASLFLVSKQFEIIT--ATVDGKAVTGEGGFLCQPHVSMEHIEVADYEVFIVPGGHIFDHL-ENDQLLSIVNKLHKQNKWIAGICAGTSLLHAAGVLNKKK----FSTSLTSDEKQLAHLHEWEYKQNKDVTVDGKIIT 168
>gi|86143389|ref|ZP_01061791.1| proteinase [Flavobacterium sp. MED217] >gi|85830294|gb|EAQ48754.1| proteinase [Leeuwenhoekiella blandensis MED217] (181 aa)
Score = 93, Expect = 6.4e-02, Identities = 23/72 (31%), Positives = 39/72 (54%)
  Q:    53 KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           KT+   +  DY+ L +PGG      LR+++  +  +++F    K V AIC AP  L   +++ E +   S+SS
  S:    57 KTLDEVSAKDYNALVLPGGVINPDQLRRNENALVFIRDFFKQHKPVAAICHAPQVLISADVV-EGRTLTSFSS 128
>gi|188495561|ref|ZP_03002831.1| chaperone protein HchA [Escherichia coli 53638] >gi|193071332|ref|ZP_03052250.1| chaperone protein HchA [Escherichia coli E110019] >gi|188490760|gb|EDU65863.1| chaperone protein HchA [Escherichia coli 53638] >gi|192955374|gb|EDV85859.1| chaperone protein HchA [Escherichia coli E110019] (283 aa)
Score = 93, Expect = 6.4e-02, Identities = 17/47 (36%), Positives = 33/47 (70%)
  Q:    61 NDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           ++Y  +++PGG+GA + L +S+   A ++  I ND++VI++C  P+A 
  S:   144 SEYAAIFVPGGHGALIGLPESQDVAAALQWAIKNDRFVISLCHGPSAF 191
>gi|149194370|ref|ZP_01871467.1| DJ-1 [Caminibacter mediatlanticus TB-2] >gi|149135545|gb|EDM24024.1| DJ-1 [Caminibacter mediatlanticus TB-2] (183 aa)
Score = 93, Expect = 6.4e-02, Identities = 29/83 (34%), Positives = 47/83 (56%)
  Q:    55 IKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKED-QKYISWS-----SGDITDSKRIKDFN 137
           I+  NV++ D++ +PGG  GA  L + +     +KE     K+V AIC AP AL +  ++K+    Y  W       G + D+K ++D N
  S:    55 IELVNVDELDLVVLPGGLPGAINLAKDEYVQNLLKEMDKKGKYVGAICAAPYALKEAGVLKDKYTAYPGWEENIKKEGYVADAKVVEDKN 144
>gi|18404881|ref|NP_030434.1| YLS5 (yellow-leaf-specific gene 5) [Arabidopsis thaliana] >gi|20197441|gb|AAC79625.2| expressed protein [Arabidopsis thaliana] >gi|21536875|gb|AAM61207.1| unknown [Arabidopsis thaliana] (389 aa)
Score = 93, Expect = 6.4e-02, Identities = 21/55 (38%), Positives = 30/55 (54%)
  Q:    60 VNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           V+DYD + +PGG    LL  ++K +A VK F + DK   AI      LA   ++K
  S:   276 VDDYDCVVVPGGRSPELLVMNEKAVALVKSFAEKDKVFAAIGQGKLLLAATGVLK 330
>gi|118483416|gb|ABK93608.1| unknown [Populus trichocarpa] (386 aa)
Score = 93, Expect = 6.5e-02, Identities = 21/61 (34%), Positives = 32/61 (52%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           + +  + ++YD L IPGG     L   +  IA VKEF+ + K V +IC     LA   ++K
  S:   264 SFEGLDASNYDALVIPGGRAPEYLALDETVIALVKEFMHSKKPVASICHGQQILAAAGVLK 324
>gi|123443358|ref|YP_001007332.1| hypothetical protein YE3150 [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122090319|emb|CAL13185.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Yersinia enterocolitica subsp. enterocolitica 8081] (198 aa)
Score = 93, Expect = 6.6e-02, Identities = 30/118 (25%), Positives = 58/118 (49%)
  Q:    63 YDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS-GDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           +DV+ +PGG  GA   R S   +A V++     + V AIC AP  + +H+ +        + +  D  DS +  D      R   L+T + P  ++D A   + ++ G++ ++ +  +L+
  S:    67 FDVVVLPGGIKGAECFRDSPLLVATVEQTHKEGRLVAAICAAPALVLEHHKLFPVGNMTGFPALKDKIDSTKWMDQRVVYDRRVNLVTSQGPGTSIDFALKIVFLLLGREKAEEIAWQLV 186
>gi|194292935|ref|YP_002008842.1| Putative peptidase C56 family protein [Cupriavidus taiwanensis] >gi|193226839|emb|CAQ72790.1| Putative peptidase C56 family protein [Cupriavidus taiwanensis] (225 aa)
Score = 93, Expect = 6.6e-02, Identities = 38/108 (35%), Positives = 61/108 (56%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL-----AD-HNLIK-----------ED------------QKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
            Q  +A+  T+      D+D ++ PGG+G    L + K+ IA +++F    K V A+C AP  L     AD   L+K           ED            +  +  S G  T   R +D+ +HV  + +L+TG+ P
  S:    76 AQQALASTLTLDQVRAEDFDAVFYPGGHGPLWDLAEDKRSIALIEQFDRLGKPVGAVCHAPGVLRHVKGADGQPLVKGKEVTGFTNSEEDAVQLTEVVPFLVEDVLKASGGRFT---RGEDWASHVAVAGRLVTGQNP 210
>gi|75910693|ref|YP_324989.1| peptidase C56, PfpI [Anabaena variabilis ATCC 29413] >gi|75704418|gb|ABA24094.1| Peptidase C56, PfpI [Anabaena variabilis ATCC 29413] (364 aa)
Score = 93, Expect = 6.6e-02, Identities = 28/106 (26%), Positives = 54/106 (50%)
  Q:    61 NDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKD-----FNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           +++D + IPGG     +R++   +  V+E ++  K V A+C  P  L + +L++  Q     ++G I  SK + +      +  +     LIT R P    DLA ++  ++
  S:    71 SEFDAVVIPGGMAPDKMRRNPNTVRFVQEAMEQGKLVAAVCHGPQVLIEGDLLRGKQ-----ATGFIAISKDMMNAGADYLDEALVVDGNLITSREPG---DLAIFTTAIL 173
>gi|30687679|ref|NP_850303.1| YLS5 (yellow-leaf-specific gene 5) [Arabidopsis thaliana] >gi|13122288|dbj|BAB32885.1| proteaseI (pfpI)-like protein [Arabidopsis thaliana] >gi|15081759|gb|AAK82534.1| At2g38860/T7F6.3 [Arabidopsis thaliana] >gi|19699347|gb|AAL91283.1| At2g38860/T7F6.3 [Arabidopsis thaliana] (398 aa)
Score = 93, Expect = 6.7e-02, Identities = 21/55 (38%), Positives = 30/55 (54%)
  Q:    60 VNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           V+DYD + +PGG    LL  ++K +A VK F + DK   AI      LA   ++K
  S:   285 VDDYDCVVVPGGRSPELLVMNEKAVALVKSFAEKDKVFAAIGQGKLLLAATGVLK 339
>gi|66046548|ref|YP_236389.1| ThiJ/PfpI [Pseudomonas syringae pv. syringae B728a] >gi|63257255|gb|AAY38351.1| ThiJ/PfpI [Pseudomonas syringae pv. syringae B728a] (227 aa)
Score = 92, Expect = 6.7e-02, Identities = 21/63 (33%), Positives = 31/63 (49%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
            Q  +AN   +   N  D+D ++ PGG+G    L + K  IA ++ F   DK    +C AP  L
  S:    78 AQKALANTGLLSGVNAADFDAVFYPGGHGPLWDLAEDKHSIALIEAFAKADKPHAMVCHAPGVL 141
>gi|37523322|ref|NP_926699.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein [Gloeobacter violaceus PCC 7421] >gi|35214326|dbj|BAC91694.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein [Gloeobacter violaceus PCC 7421] (182 aa)
Score = 92, Expect = 6.8e-02, Identities = 25/113 (22%), Positives = 53/113 (46%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLI 113
           +K+L      F+++E V ++ + + +     +   +   ++   G   +A+ + +   N   +D + +PGG G   LR  ++    + E    ++W  AIC AP  L+D  L+
  S:     2 IKVLVPLAEGFEEIEAVTIIDVLRRADIEVTVAALADLAVQGSHGITLVADTR-LDEINPLTFDAVVLPGGPGVARLRADERVRKLLLEMRAAERWTAAICAAPTVLSDAGLL 113
>gi|21244216|ref|NP_643798.1| NonF-related protein [Xanthomonas axonopodis pv. citri str. 306] >gi|21109856|gb|AAM38334.1| NonF-related protein [Xanthomonas axonopodis pv. citri str. 306] (226 aa)
Score = 92, Expect = 6.8e-02, Identities = 25/83 (30%), Positives = 43/83 (51%)
  Q:    25 ASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           A+++F++     PE  + +     +A++K        D+DVL+ PGG+G    L +    IA ++ F + DK    +C AP AL
  S:    66 ATKRFKQ----DPEAQQALASTHRLADVKA------EDFDVLFYPGGHGPLWDLAEDADSIALIEAFAEADKPHGLVCHAPGAL 139
>gi|17228388|ref|NP_484936.1| hypothetical protein alr0893 [Nostoc sp. PCC 7120] >gi|17130239|dbj|BAB72850.1| alr0893 [Nostoc sp. PCC 7120] (364 aa)
Score = 92, Expect = 6.8e-02, Identities = 30/106 (28%), Positives = 52/106 (49%)
  Q:    61 NDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQK--YISWS------SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVI 166
           +++D + IPGG     +R++   +  V+E +   K V A+C  P  L + +L++  Q   +I+ S        D  D   + D N        LIT R P    DLA ++  ++
  S:    71 SEFDAVVIPGGMAPDKMRRNPNTVRFVQEAMQQGKLVAAVCHGPQVLIESDLLRGKQATGFIAISRDMINAGADYVDEALVVDGN--------LITSREPG---DLAIFTTAIL 173
>gi|183219940|ref|YP_001837936.1| ThiJ/PfpI family peptidase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189910064|ref|YP_001961619.1| Transcription regulator, DJ-1/PfpI family intracellular protease [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167774740|gb|ABZ93041.1| Transcription regulator, DJ-1/PfpI family intracellular protease [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167778362|gb|ABZ96660.1| Putative peptidase, ThiJ/PfpI family [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (188 aa)
Score = 92, Expect = 6.9e-02, Identities = 31/123 (25%), Positives = 55/123 (44%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKE-FIDNDKWVIAICDAPNALADHNLIKEDQKYISW-SSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLK 176
           T    NV+++D + +PGG   T    +   I  +   F  + K + AIC AP  L   ++I  +  Y ++ S+ D+   K  +     +   + + T   P      A Y LE+  GK+  + +K
  S:    55 TFSEINVDEFDAIVLPGGMNGTKNLMADTEIQKILSIFHSSKKHIGAICAAPAVLRKWDIISGNDPYTAFPSTDDLAKGKGGRYTGNRIESFHHIHTSVGPGSAFAFALYLLELFEGKEVMERVK 179
>gi|86359315|ref|YP_471207.1| hypothetical protein RHE_CH03725 [Rhizobium etli CFN 42] >gi|86283417|gb|ABC92480.1| hypothetical conserved protein [Rhizobium etli CFN 42] (198 aa)
Score = 92, Expect = 7.0e-02, Identities = 22/61 (36%), Positives = 28/61 (45%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           T  +    DYD L IPGG     LR +   I  V+ F +  K V AIC     LA   ++K
  S:    72 TFDSVRAEDYDALVIPGGRAPEYLRLNADVIKSVRHFFEAGKPVAAICHGAQLLAAAGVLK 132
>gi|157754004|ref|XP_001680714.1| Hypothetical protein CBG07015 [Caenorhabditis briggsae AF16] >gi|187033694|emb|CAP27329.1| C. briggsae CBR-DJR-1.2 protein [Caenorhabditis briggsae] (192 aa)
Score = 92, Expect = 7.0e-02, Identities = 30/117 (25%), Positives = 57/117 (48%)
  Q:    63 YDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKD-----FNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKL 179
           YD++ IPGG G++ L ++    + +K+   +   + AIC  P  L  H ++ ++       +G  T   ++ D         V  S K+IT + P    + A   +E++ G + ++ LK  L
  S:    73 YDIVIIPGGPGSSKLAENSCVGSLLKDQFKSGGLIGAICAGPTVLLSHGIMVDE------VTGHYTVKDKLVDGGYKFSEDRVVVSGKVITSQGPGTAFEFALKIVEIMQGAEKAESLKKPL 188
>gi|91211184|ref|YP_541170.1| chaperone protein HchA [Escherichia coli UTI89] >gi|117624103|ref|YP_853016.1| chaperone protein HchA [Escherichia coli APEC O1] >gi|122423413|sp|Q1RAH5|HCHA_ECOUT Chaperone protein hchA (Hsp31) >gi|167008780|sp|A1ACB2|HCHA_ECOK1 Chaperone protein hchA (Hsp31) >gi|91072758|gb|ABE07639.1| heat shock protein (Hsp) 31, subunit of Hsp31 homodimer [Escherichia coli UTI89] >gi|115513227|gb|ABJ01302.1| heat shock protein (Hsp) 31, subunit of Hsp31 homodimer [Escherichia coli APEC O1] (283 aa)
Score = 92, Expect = 7.1e-02, Identities = 17/47 (36%), Positives = 33/47 (70%)
  Q:    61 NDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           ++Y  +++PGG+GA + L +S+   A ++  I+ND++VI++C  P A 
  S:   144 SEYAAIFVPGGHGALIGLPESEDVAAALQWAIENDRFVISLCHGPAAF 191
>gi|160883178|ref|ZP_02064181.1| hypothetical protein BACOVA_01147 [Bacteroides ovatus ATCC 8483] >gi|156111403|gb|EDO13148.1| hypothetical protein BACOVA_01147 [Bacteroides ovatus ATCC 8483] (183 aa)
Score = 92, Expect = 7.1e-02, Identities = 43/165 (26%), Positives = 75/165 (45%)
  Q:    11 FQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTI--KNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGL 175
           F+++E    +   + +     I   +P+  E+V G  D++ +  I  +N +  D ++L +PGG  GA  L + +     + +F    K + AIC AP  L    L+K  +     S     D       N HV R   +ITG  P   ++ A   ++++ GK+  D L
  S:    12 FEEIEAFTAIDTLRRAGLNVEIVSVTPD--EIVVGAHDVSVLCDINFENCDFFDAELLLLPGGMPGAATLDKHEGLRKLILDFAAKGKPIAAICAAPMVLGKLGLLKGKKATCYPSFEQYLDGAEC--VNAHVVRDGNIITGMGPGAAMEFALTIVDLLVGKEKVDEL 175
>gi|126657553|ref|ZP_01728709.1| proteinase I [Cyanothece sp. CCY0110] >gi|126621257|gb|EAZ91970.1| proteinase I [Cyanothece sp. CCY0110] (184 aa)
Score = 92, Expect = 7.1e-02, Identities = 24/66 (36%), Positives = 33/66 (50%)
  Q:    59 NVNDYDVLYIPGGYG-ATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           N +DYD L +PGG      LR +   +  +K F   DK V AIC  P  L +   + + +K  SW S
  S:    69 NPDDYDALLLPGGVANPDQLRTNPSVVEFIKAFFTADKPVAAICHGPWTLVEAEAV-QGRKITSWPS 134
>gi|118470441|ref|YP_887673.1| isonitrile hydratase, putative [Mycobacterium smegmatis str. MC2 155] >gi|118171728|gb|ABK72624.1| isonitrile hydratase, putative [Mycobacterium smegmatis str. MC2 155] (231 aa)
Score = 92, Expect = 7.2e-02, Identities = 30/118 (25%), Positives = 58/118 (49%)
  Q:    62 DYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISW-------SSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKL 179
           +YDV++IPGG+G +++ Q  + +  V+      +++ ++C     LA   L++  +    W       + G I D +R+      V   N++ TG      LD A     V+  + F+  L++ L
  S:    68 EYDVVFIPGGHGTSVMVQDDETLDFVRTVAGKARYLSSVCTGSLILAAAGLLEGYRAASHWAFREFLSAYGAIPDDRRV------VMDRNRM-TGGGVTAGLDFALQLAAVLTDETFARTLQLVL 185
>gi|88857151|ref|ZP_01131794.1| ThiJ/PfpI family protein [Pseudoalteromonas tunicata D2] >gi|88820348|gb|EAR30160.1| ThiJ/PfpI family protein [Pseudoalteromonas tunicata D2] (231 aa)
Score = 92, Expect = 7.3e-02, Identities = 21/59 (35%), Positives = 33/59 (55%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           +AN   + + N  DYD ++ PGG+G    L  +   IA ++ F+  +K V A+C A  AL
  S:    86 LANTLVLADLNAGDYDGVFYPGGHGPLWDLTDNAASIALIEAFLAANKPVAAVCHATAAL 145
>gi|119477199|ref|ZP_01617435.1| hypothetical protein GP2143_02714 [marine gamma proteobacterium HTCC2143] >gi|119449562|gb|EAW30800.1| hypothetical protein GP2143_02714 [marine gamma proteobacterium HTCC2143] (185 aa)
Score = 92, Expect = 7.4e-02, Identities = 16/53 (30%), Positives = 30/53 (56%)
  Q:    62 DYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           +YD LY+PGG     LR +++ I  +++F  + K + ++C  P  L    +I+
  S:    78 NYDALYLPGGRSPEYLRLNRRVIEIIQQFSQSGKPIASVCHGPQLLTAAGVIR 130
>gi|170769450|ref|ZP_02903903.1| chaperone protein HchA [Escherichia albertii TW07627] >gi|170121774|gb|EDS90705.1| chaperone protein HchA [Escherichia albertii TW07627] (283 aa)
Score = 92, Expect = 7.4e-02, Identities = 17/47 (36%), Positives = 33/47 (70%)
  Q:    61 NDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           ++Y  +++PGG+GA + L +S+   A ++  I+ND++VI++C  P A 
  S:   144 SEYAAIFVPGGHGALIGLPESEDVAAALQWAIENDRFVISLCHGPAAF 191
>gi|77457530|ref|YP_347035.1| peptidase C56, PfpI [Pseudomonas fluorescens PfO-1] >gi|77381533|gb|ABA73046.1| Peptidase C56, PfpI [Pseudomonas fluorescens PfO-1] (193 aa)
Score = 92, Expect = 7.4e-02, Identities = 32/101 (31%), Positives = 45/101 (44%)
  Q:     8 MSKFQDLEMV------------ALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           M  FQ L+MV            A  ++  A   FE    YS +        FD A +      +  DYD L +PGG     LR ++K +  V+ F    K + A+C     LA
  S:    20 MVPFQALQMVGHTVHAVCPDKAAGKTVRTAIHDFEGDQTYSEKPGHQFALNFDFAKV------DAKDYDALLVPGGRAPEYLRLNEKVLELVRAFDKAGKPIAAVCHGAQLLA 126
>gi|170290529|ref|YP_001737345.1| PfpI family intracellular peptidase [Candidatus Korarchaeum cryptofilum OPF8] >gi|170174609|gb|ACB07662.1| intracellular protease, PfpI family [Candidatus Korarchaeum cryptofilum OPF8] (187 aa)
Score = 92, Expect = 7.8e-02, Identities = 22/72 (30%), Positives = 34/72 (47%)
  Q:    53 KTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           K  K     DYD L IPGG     +R ++     V+ F++  K + AIC  P  L  + LI+      S+++
  S:    69 KEFKEVKPEDYDGLVIPGGRAPEYIRLNEDLERIVRHFMEKRKPLAAICHGPLVLTGYKLIEPGMNVTSYAA 140
>gi|187604130|ref|ZP_02990340.1| ThiJ/PfpI domain protein [Exiguobacterium sp. AT1b] >gi|187483679|gb|EDU21673.1| ThiJ/PfpI domain protein [Exiguobacterium sp. AT1b] (220 aa)
Score = 92, Expect = 7.8e-02, Identities = 21/65 (32%), Positives = 34/65 (52%)
  Q:    48 DIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNL 112
           D  ++KTI NF+   +D +++PGG+G    L QS+     ++   +  K V A+C  P  L    L
  S:    76 DTIDLKTITNFD--QFDAIFMPGGHGTMFDLPQSEALNVAIRSLFEAGKTVAAVCHGPAGLVGATL 139
>gi|152969874|ref|YP_001334983.1| putative intracellular protease/amidase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150954723|gb|ABR76753.1| putative intracellular protease/amidase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (182 aa)
Score = 92, Expect = 7.9e-02, Identities = 33/108 (30%), Positives = 49/108 (45%)
  Q:     7 TMSKFQDLEMV------------ALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           TM  FQ L+M+            A   +  A   F+    YS +     T   D A +K        +YD L IPGG     LR +++ I  V+ F    K + A+C  P  LA   +++
  S:    12 TMVPFQALQMIGHQVDAVCPDKAAGDYVMTAIHDFDGAQTYSEKPGHRFTLNADFAAVKA------ENYDALVIPGGRAPEYLRLNEEVIKLVQAFDAARKPIAAVCHGPQLLAAAGILQ 125
>gi|72161582|ref|YP_289239.1| peptidase C56, PfpI [Thermobifida fusca YX] >gi|71915314|gb|AAZ55216.1| peptidase C56, PfpI [Thermobifida fusca YX] (189 aa)
Score = 92, Expect = 7.9e-02, Identities = 19/50 (38%), Positives = 28/50 (56%)
  Q:    54 TIKNFNVNDYDVLYIPGGYG-ATLLRQSKKGIACVKEFIDNDKWVIAICDA 103
           T+     +D+D L +PGG      LR  ++ +A V+EF D  + V AIC A
  S:    66 TVHQVTAHDFDALLLPGGVANPDYLRTHERAVAFVREFFDTGRPVAAICHA 116
>gi|168142314|ref|ZP_02585543.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus cereus G9842] (190 aa)
Score = 92, Expect = 8.0e-02, Identities = 28/113 (24%), Positives = 52/113 (46%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+L      F + E+    ++ K  +K++ I     + L +      +     +    V++Y+ + IPGG    L + +K   + +++F + +K V AIC  P ALA   L K
  S:     3 KILLFVYPTFAEFEITVATALLK--KKYDIITVGLTKELVISETGLQVQPHIEVSEVRVDEYEGILIPGGEEVQL-KDAKTLFSIIRQFHEQEKLVAAICAGPYALAKAGLFK 112
>gi|75762068|ref|ZP_00741976.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74490441|gb|EAO53749.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus thuringiensis serovar israelensis ATCC 35646] (201 aa)
Score = 92, Expect = 8.0e-02, Identities = 28/113 (24%), Positives = 52/113 (46%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+L      F + E+    ++ K  +K++ I     + L +      +     +    V++Y+ + IPGG    L + +K   + +++F + +K V AIC  P ALA   L K
  S:    10 KILLFVYPTFAEFEITVATALLK--KKYDIITVGLTKELVISETGLQVQPHIEVSEVRVDEYEGILIPGGEEVQL-KDAKTLFSIIRQFHEQEKLVAAICAGPYALAKAGLFK 119
>gi|126650641|ref|ZP_01722864.1| putative 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus sp. B14905] >gi|126592797|gb|EAZ86796.1| putative 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus sp. B14905] (218 aa)
Score = 92, Expect = 8.0e-02, Identities = 28/121 (23%), Positives = 51/121 (42%)
  Q:    59 NVNDYDVLYIPGGYGATLLR--QSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKL 179
           ++   D+L +PG            +  +  ++      KW  ++C+    L+   L+K  +    W S DI  S      +  V R NK++T       +D+A   +   FG D S G+++ L
  S:    58 DITSADILIVPGCSPPNFKNPMNDETTLNWIRNIHQTTKWTTSVCNGSLILSAAGLLKGMKATSHWGSFDILQSLGTIPTDERVVRQNKMVTAAGVSSGIDMALQLVAWEFGDDLSMGVQLIL 180
>gi|116254006|ref|YP_769844.1| putative ThiJ/PfpI family protein [Rhizobium leguminosarum bv. viciae 3841] >gi|115258654|emb|CAK09758.1| putative ThiJ/PfpI family protein [Rhizobium leguminosarum bv. viciae 3841] (198 aa)
Score = 92, Expect = 8.2e-02, Identities = 22/61 (36%), Positives = 28/61 (45%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           T  +    DYD L IPGG     LR +   +  V+ F D  K V AIC     LA   ++K
  S:    72 TFGSVRAEDYDALVIPGGRAPEYLRLNADVLKFVRHFFDAGKPVAAICHGAQLLAAAGVLK 132
>gi|30261718|ref|NP_844095.1| thiJ/pfpI family protein [Bacillus anthracis str. Ames] >gi|47526934|ref|YP_018283.1| thiJ/pfpI family protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49184544|ref|YP_027796.1| thiJ/pfpI family protein [Bacillus anthracis str. Sterne] >gi|165869255|ref|ZP_02213914.1| thiJ/pfpI family protein [Bacillus anthracis str. A0488] >gi|167633416|ref|ZP_02391741.1| thiJ/pfpI family protein [Bacillus anthracis str. A0442] >gi|167639184|ref|ZP_02397457.1| thiJ/pfpI family protein [Bacillus anthracis str. A0193] >gi|170686112|ref|ZP_02877334.1| thiJ/pfpI family protein [Bacillus anthracis str. A0465] >gi|170706573|ref|ZP_02897033.1| thiJ/pfpI family protein [Bacillus anthracis str. A0389] >gi|177650637|ref|ZP_02933604.1| thiJ/pfpI family protein [Bacillus anthracis str. A0174] >gi|190566379|ref|ZP_03019297.1| thiJ/pfpI family protein [Bacillus anthracis Tsiankovskii-I] >gi|196033676|ref|ZP_03101088.1| thiJ/pfpI family protein [Bacillus cereus W] >gi|30255946|gb|AAP25581.1| thiJ/pfpI family protein [Bacillus anthracis str. Ames] >gi|47502082|gb|AAT30758.1| thiJ/pfpI family protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49178471|gb|AAT53847.1| thiJ/pfpI family protein [Bacillus anthracis str. Sterne] >gi|164714695|gb|EDR20213.1| thiJ/pfpI family protein [Bacillus anthracis str. A0488] >gi|167512974|gb|EDR88347.1| thiJ/pfpI family protein [Bacillus anthracis str. A0193] >gi|167531454|gb|EDR94132.1| thiJ/pfpI family protein [Bacillus anthracis str. A0442] >gi|170128671|gb|EDS97538.1| thiJ/pfpI family protein [Bacillus anthracis str. A0389] >gi|170669809|gb|EDT20550.1| thiJ/pfpI family protein [Bacillus anthracis str. A0465] >gi|172083781|gb|EDT68841.1| thiJ/pfpI family protein [Bacillus anthracis str. A0174] >gi|190562514|gb|EDV16481.1| thiJ/pfpI family protein [Bacillus anthracis Tsiankovskii-I] >gi|195994110|gb|EDX58066.1| thiJ/pfpI family protein [Bacillus cereus W] (194 aa)
Score = 92, Expect = 8.2e-02, Identities = 36/154 (23%), Positives = 77/154 (50%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVT 155
           K L      F + E V + S+F  S++FE I   +  + + VTG+  F      ++++  V DY++  +PGG+    L ++ + ++ V +  + +KW+  IC   + L    ++ + +    +S+   +D K++   +   Y+ NK +T    ++T
  S:     3 KALIFLFDGFAEFE-VNIASLFLISKQFEIIT--ATVDGKTVTGEGGFLCQPHVSMEHIEVADYELFIVPGGHIFDHL-ENDQLLSIVNKLHEQNKWIAGICAGTSLLHAAGVLNKKK----FSTSLTSDEKQLAHLHEWEYKQNKDVTVDGKIIT 150
>gi|49477299|ref|YP_035833.1| thiJ/PfpI family protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49328855|gb|AAT59501.1| thiJ/PfpI family protein [Bacillus thuringiensis serovar konkukian str. 97-27] (194 aa)
Score = 92, Expect = 8.2e-02, Identities = 36/154 (23%), Positives = 76/154 (49%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVT 155
           K L      F + E V + S+F  S++FE I   +  + + VTG+  F      ++++  V DY++  +PGG+    L ++ + ++ V +  + +KW+  IC   + L    ++   +    +S+   +D K++   +   Y+ NK +T    ++T
  S:     3 KALIFLFDGFAEFE-VNIASLFLISKQFEIIT--ATVDGKTVTGEGGFLCQPHVSMEHIEVADYELFIVPGGHIFDHL-ENDQLLSIVNKLHEQNKWIAGICAGTSLLHAAGVVNNKK----FSTSLTSDEKQLAHLHEWEYKQNKDVTVDGKIIT 150
>gi|77962952|ref|ZP_00826767.1| COG0693: Putative intracellular protease/amidase [Yersinia mollaretii ATCC 43969] (196 aa)
Score = 92, Expect = 8.2e-02, Identities = 31/118 (26%), Positives = 57/118 (48%)
  Q:    63 YDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPN-ALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           +DV+ +PGG  GA   R S   +A V++  +  + V AIC AP   L  HNL          +  D  ++ +  D      R   L+T + P  ++D A   + ++ G++ ++ +  +L+
  S:    67 FDVVVLPGGIKGAECFRDSPLLVATVRQTHNEGRLVAAICAAPALVLEHHNLFPVGNMTGFPALKDKINATKWMDQRVVYDRRVNLVTSQGPGTSIDFALKIVFLLLGREKAEEIAWQLV 186
>gi|196196141|gb|EDX91100.1| DJ-1/PfpI family [Alcanivorax sp. DG881] (224 aa)
Score = 92, Expect = 8.5e-02, Identities = 22/69 (31%), Positives = 39/69 (56%)
  Q:    36 SPENLEMVTGQFD--------IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAP 104
           SPE     TG+F+        +AN + +   +   +D ++ PGG+G    L +    IA ++ F ++ K + A+C AP
  S:    59 SPEAQTAATGRFNQDDDAKAALANTRPLAQVDTQAFDAVFYPGGHGPLWDLAEDAHSIALIEAFNNSGKPIGAVCHAP 136
>gi|196244000|ref|ZP_03142728.1| ThiJ/PfpI domain protein [Cyanothece sp. PCC 8802] >gi|196208132|gb|EDY02923.1| ThiJ/PfpI domain protein [Cyanothece sp. PCC 8802] (230 aa)
Score = 92, Expect = 8.6e-02, Identities = 22/64 (34%), Positives = 31/64 (48%)
  Q:    44 TGQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           T Q    N   +   N  DYD +++PGG+G    L Q +K    V+EF    K + A+C  P  L
  S:    76 TAQERFKNTVPLGQVNAADYDAIFLPGGHGPMWDLCQEQKLAQLVEEFDRAGKIIAAVCHGPAGL 140
>gi|177665304|ref|ZP_02941104.1| ThiJ/PfpI domain protein [Cyanothece sp. PCC 8801] >gi|172075726|gb|EDT61140.1| ThiJ/PfpI domain protein [Cyanothece sp. PCC 8801] (230 aa)
Score = 92, Expect = 8.6e-02, Identities = 22/64 (34%), Positives = 31/64 (48%)
  Q:    44 TGQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           T Q    N   +   N  DYD +++PGG+G    L Q +K    V+EF    K + A+C  P  L
  S:    76 TAQERFKNTVPLGQVNAADYDAIFLPGGHGPMWDLCQEQKLAQLVEEFDRAGKIIAAVCHGPAGL 140
>gi|37678338|ref|NP_932947.1| hypothetical protein VV0154 [Vibrio vulnificus YJ016] >gi|37197077|dbj|BAC92918.1| hypothetical protein [Vibrio vulnificus YJ016] (261 aa)
Score = 92, Expect = 8.6e-02, Identities = 26/100 (26%), Positives = 48/100 (48%)
  Q:    53 KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           K I   + +D+D L +PGG +    LR   +    V+E ++++K +  IC  P  L +  L+K+ +    W+     ++   K ++  V     LI+ R P
  S:   144 KYIDEVSFDDFDGLVLPGGAWNPDFLRTDVEAQNLVREIVNSNKPLATICHGPLVLINSGLVKDRKITGYWAIMKDLENAGAKVYDQPVVIDGNLISSRFP 244
>gi|157373426|ref|YP_001472026.1| ThiJ/PfpI domain-containing protein [Shewanella sediminis HAW-EB3] >gi|157315800|gb|ABV34898.1| ThiJ/PfpI domain protein [Shewanella sediminis HAW-EB3] (225 aa)
Score = 92, Expect = 8.7e-02, Identities = 21/64 (32%), Positives = 32/64 (50%)
  Q:    46 QFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALAD 109
           Q  +A   T+ +    DYD ++ PGG+G    L      IA ++ F   +K V  +C AP AL +
  S:    77 QQQLATTLTLASIKAEDYDAIFYPGGHGPLWDLTNDAHSIALIQAFYQANKPVGLVCHAPGALKN 141
>gi|160933043|ref|ZP_02080432.1| hypothetical protein CLOLEP_01885 [Clostridium leptum DSM 753] >gi|156868117|gb|EDO61489.1| hypothetical protein CLOLEP_01885 [Clostridium leptum DSM 753] (179 aa)
Score = 91, Expect = 8.8e-02, Identities = 30/124 (24%), Positives = 59/124 (47%)
  Q:    56 KNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKL 179
           K  + ++ + + +PGG   TL L +S     C++   +ND ++ AIC AP+ L    L     + ++   G   +     + +  V    K+ITG+ P V +D A   +  + G+  S  +++ +
  S:    54 KEVSTDELEAVVLPGGMPGTLNLEKSPIVRTCIRYCCENDLYLCAICAAPSILGHMGLAA--GREVTCFPGFENELTGAVETDRSVVTDGKMITGKGPGVAVDFALEIVARLCGQVESSKIRMAM 176
>gi|15232554|ref|NP_191023.1| DJ-1 family protein [Arabidopsis thaliana] >gi|7258363|emb|CAB77580.1| putative protein [Arabidopsis thaliana] >gi|20466235|gb|AAM20435.1| putative protein [Arabidopsis thaliana] >gi|30725650|gb|AAP37847.1| At3g54600 [Arabidopsis thaliana] (399 aa)
Score = 91, Expect = 8.9e-02, Identities = 24/76 (31%), Positives = 44/76 (57%)
  Q:    57 NFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS--------GDITDSKR 132
           + +V+DYD + +PGG    LL  + K +  V++F++  K+V AI      LA    +K+ +   S+ +        G+I +S+R
  S:   283 DVSVDDYDCIVVPGGRSPELLVMNPKAVELVRKFVEKGKFVAAIGMGNWLLAATGALKKKRCASSYGTKVAVKVAGGEIVESER 366
>gi|77361113|ref|YP_340688.1| ThiJ/PfpI protein [Pseudoalteromonas haloplanktis TAC125] >gi|76876024|emb|CAI87246.1| putative ThiJ/PfpI family protein [Pseudoalteromonas haloplanktis TAC125] (227 aa)
Score = 91, Expect = 8.9e-02, Identities = 19/55 (34%), Positives = 31/55 (56%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDA 103
           +AN K +   N  D+D ++ PGG+G    L ++   I+ ++ FI   K V A+C A
  S:    82 MANTKVLSEVNSTDFDAVFYPGGHGPLWDLVENTDSISLIESFIKEQKPVAAVCHA 137
>gi|71734729|ref|YP_275399.1| ThiJ/PfpI family protein [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555282|gb|AAZ34493.1| ThiJ/PfpI family protein [Pseudomonas syringae pv. phaseolicola 1448A] (225 aa)
Score = 91, Expect = 9.1e-02, Identities = 32/115 (27%), Positives = 58/115 (50%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL-----ADHNLIKEDQKYISWSSGDIT---------------------DSKRIKDFNTHVYRSNKLITGRCPVVTLDLA 159
            Q  +AN   +   N  D+D ++ PGG+G    L + K  IA ++ F   DK    +C AP  L     +D   + + ++   +++G+                       D  + +D+  +V    KL+TG+ P  +   A
  S:    76 AQKALANTGLLSGVNAADFDAVFYPGGHGPLWDLAEDKDSIALIEAFAKADKPHGMVCHAPGVLRHVKASDGQPLVKGRRVTGFTNGEEEAVGLTNVVPFLVEDTLKELGGDYSKGEDWGVYVLTDGKLVTGQNPASSAQAA 217
>gi|188989442|ref|YP_001901452.1| chaperone-like protein [Xanthomonas campestris pv. campestris] >gi|167731202|emb|CAP49374.1| chaperone-like protein [Xanthomonas campestris pv. campestris] (225 aa)
Score = 91, Expect = 9.2e-02, Identities = 18/59 (30%), Positives = 34/59 (57%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGI-ACVKEFIDNDKWVIAICDAPNAL 107
           +A+ + +   +V DYD +++PGG G  +     + + A +K+  + D  V A+C  P+AL
  S:    78 MAHSRKLSEVDVRDYDAVFVPGGLGPMVDVSGNRDVQALIKQAWEADMLVAAVCHGPSAL 137
>gi|21229520|ref|NP_635437.1| NonF-related protein [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66766392|ref|YP_241154.1| NonF-related protein [Xanthomonas campestris pv. campestris str. 8004] >gi|21110984|gb|AAM39361.1| NonF-related protein [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66571724|gb|AAY47134.1| NonF-related protein [Xanthomonas campestris pv. campestris str. 8004] (225 aa)
Score = 91, Expect = 9.2e-02, Identities = 18/59 (30%), Positives = 34/59 (57%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGI-ACVKEFIDNDKWVIAICDAPNAL 107
           +A+ + +   +V DYD +++PGG G  +     + + A +K+  + D  V A+C  P+AL
  S:    78 MAHSRKLSEVDVRDYDAVFVPGGLGPMVDVSGNRDVQALIKQAWEADMLVAAVCHGPSAL 137
>gi|110601832|ref|ZP_01389998.1| Peptidase C56, PfpI [Geobacter sp. FRC-32] >gi|110547449|gb|EAT60709.1| Peptidase C56, PfpI [Geobacter sp. FRC-32] (166 aa)
Score = 91, Expect = 9.4e-02, Identities = 34/152 (22%), Positives = 65/152 (42%)
  Q:     1 MKLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCP 152
           MK L ++   F+D E+  L+  ++  +    +   S +   ++ G+  +++    T+      DY +L +PGG     +R+  K     + F + +K V AIC  P  L    L++  +     +  D       +  +T V     L+T R P
  S:     1 MKALFISADNFEDSEL--LVPYYRLKEAGVDVVLASVKT-GLIKGKHGYEVPVDMTLGEVKPADYTILVLPGGKAPETVRKEAKAQEIARFFFEQNKPVAAICHGPQTLISAGLLRGRKATCYNTVVDELKEAGARYEDTEVVVDGNLVTSREP 151
>gi|170699664|ref|ZP_02890701.1| intracellular protease, PfpI family [Burkholderia ambifaria IOP40-10] >gi|170135420|gb|EDT03711.1| intracellular protease, PfpI family [Burkholderia ambifaria IOP40-10] (193 aa)
Score = 91, Expect = 9.5e-02, Identities = 22/61 (36%), Positives = 31/61 (50%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           T  + + + YD L I GG     LR   K IA V+ F +  K + AIC A   LA  ++I+
  S:    72 TFDDVDASGYDALAIAGGRAPEYLRLDSKVIALVRAFAEAGKPIAAICHAAQLLAAADVIR 132
>gi|194562407|ref|YP_002097430.1| hypothetical protein BDAG_00607 [Burkholderia dolosa AUO158] >gi|124894031|gb|EAY67911.1| hypothetical protein BDAG_00607 [Burkholderia dolosa AUO158] (193 aa)
Score = 91, Expect = 9.5e-02, Identities = 22/61 (36%), Positives = 31/61 (50%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           T  + + + YD L I GG     LR   K IA V+ F +  K + AIC A   LA  ++I+
  S:    72 TFDDVDASGYDALAIAGGRAPEYLRLDSKVIALVRAFAEAGKPIAAICHAAQLLAAADVIR 132
>gi|115352844|ref|YP_774683.1| PfpI family intracellular peptidase [Burkholderia ambifaria AMMD] >gi|171319376|ref|ZP_02908485.1| intracellular protease, PfpI family [Burkholderia ambifaria MEX-5] >gi|172061701|ref|YP_001809353.1| PfpI family intracellular peptidase [Burkholderia ambifaria MC40-6] >gi|115282832|gb|ABI88349.1| intracellular protease, PfpI family [Burkholderia ambifaria AMMD] >gi|171095412|gb|EDT40385.1| intracellular protease, PfpI family [Burkholderia ambifaria MEX-5] >gi|171994218|gb|ACB65137.1| intracellular protease, PfpI family [Burkholderia ambifaria MC40-6] (193 aa)
Score = 91, Expect = 9.5e-02, Identities = 22/61 (36%), Positives = 31/61 (50%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           T  + + + YD L I GG     LR   K IA V+ F +  K + AIC A   LA  ++I+
  S:    72 TFDDVDASGYDALAIAGGRAPEYLRLDSKVIALVRAFAEAGKPIAAICHAAQLLAAADVIR 132
>gi|149277636|ref|ZP_01883777.1| proteinase I [Pedobacter sp. BAL39] >gi|149231869|gb|EDM37247.1| proteinase I [Pedobacter sp. BAL39] (187 aa)
Score = 91, Expect = 9.6e-02, Identities = 21/62 (33%), Positives = 32/62 (51%)
  Q:    53 KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           +T+   N  DYD L IPGG      LR+++  +  V++F    K V AIC  P  L    +++
  S:    63 RTLAEVNAEDYDGLLIPGGVLNPDSLRKNEDALKFVRDFFAAGKPVAAICHGPQVLISAEVVE 125
>gi|186902814|ref|ZP_02975755.1| intracellular protease, PfpI family [Cyanothece sp. PCC 7424] >gi|186690190|gb|EDU14825.1| intracellular protease, PfpI family [Cyanothece sp. PCC 7424] (189 aa)
Score = 91, Expect = 9.6e-02, Identities = 39/123 (31%), Positives = 58/123 (47%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFE----RIDFYSPENLEMVTG--------QFDIANIKTIKNFNVNDYDVLYIPGGYG-ATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           K+  L    F+ +EM       K  Q  E    + D  SP+  + V G        QF +  +  +   + N+YD L +PGG      LR  +K +  V+ F +  K V AIC     L D N+I+  +   SW S
  S:     9 KVAILVAEGFEQVEMT------KPRQALEQAGAKTDLISPKG-DKVQGWNHFDKGDQFSVDVV--LDEADSNNYDALLLPGGVANPDQLRTQEKAVRFVRSFFEAGKPVAAICHGLWTLIDANVIQA-RTVTSWPS 134
>gi|77974317|ref|ZP_00829858.1| COG0693: Putative intracellular protease/amidase [Yersinia frederiksenii ATCC 33641] (196 aa)
Score = 91, Expect = 9.6e-02, Identities = 36/118 (30%), Positives = 62/118 (52%)
  Q:    63 YDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPN-ALADHNLIKEDQKYISWSSGDITDSKRIKDFNTH--------VY-RSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLM 180
           +DV+ +PGG  GA   R S   +A V++  +  + V AIC AP   L  HNL         +  G++T    +KD  T         VY R   L+T + P  ++D A   + ++ G++ ++ +  +L+
  S:    67 FDVVVLPGGIKGAECFRDSPLLVATVQQTHNEGRLVAAICAAPALVLEHHNL---------FPVGNMTGFPALKDKITATKWMDQRVVYDRRVNLVTSQGPGTSIDFALKIVFLLLGREKAEEIAWQLV 186
>gi|65318984|ref|ZP_00391943.1| COG0693: Putative intracellular protease/amidase [Bacillus anthracis str. A2012] (212 aa)
Score = 91, Expect = 9.6e-02, Identities = 36/154 (23%), Positives = 77/154 (50%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVT 155
           K L      F + E V + S+F  S++FE I   +  + + VTG+  F      ++++  V DY++  +PGG+    L ++ + ++ V +  + +KW+  IC   + L    ++ + +    +S+   +D K++   +   Y+ NK +T    ++T
  S:    21 KALIFLFDGFAEFE-VNIASLFLISKQFEIIT--ATVDGKTVTGEGGFLCQPHVSMEHIEVADYELFIVPGGHIFDHL-ENDQLLSIVNKLHEQNKWIAGICAGTSLLHAAGVLNKKK----FSTSLTSDEKQLAHLHEWEYKQNKDVTVDGKIIT 168
>gi|111022470|ref|YP_705442.1| hypothetical protein RHA1_ro05504 [Rhodococcus sp. RHA1] >gi|110822000|gb|ABG97284.1| conserved hypothetical protein [Rhodococcus sp. RHA1] (187 aa)
Score = 91, Expect = 9.7e-02, Identities = 27/113 (23%), Positives = 54/113 (47%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANI----KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+  L     +++E+V      + +    R+   SP  ++ +    + A        + + +V D+D L +PGG      LR     +A V++F+D+ K V  IC  P  L + ++++
  S:    11 KVAILATDGVEEVELVEPRKAVEDAGAEVRLISLSPGKIQAMNSDVNAAGTYAVDAAVGDVSVADFDALILPGGTTNPDHLRMDASAVAFVRDFVDSGKPVGVICHGPWTLVEADVVR 128
>gi|84702710|ref|ZP_01017285.1| proteinase [Parvularcula bermudensis HTCC2503] >gi|84691956|gb|EAQ17796.1| proteinase [Parvularcula bermudensis HTCC2503] (188 aa)
Score = 91, Expect = 9.7e-02, Identities = 30/93 (32%), Positives = 48/93 (51%)
  Q:    22 IFKASQKFER----IDFYSPENLEMVTGQFD-----IANIKTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           +F   Q+ E     +   SPE  E+     D     IA  + + +  V  YD L +PGG     LLR +   +  V++F ++ K + AIC AP  L +  ++K
  S:    22 LFVPKQRLEEAGATVHIISPETGEIKAWDEDDWGDTIAVDRPLGDAKVAHYDALVLPGGQINPDLLRVNDDAVTFVRDFFNSKKPLAAICHAPWLLIEAEVVK 124
>gi|167622286|ref|YP_001672580.1| ThiJ/PfpI domain-containing protein [Shewanella halifaxensis HAW-EB4] >gi|167352308|gb|ABZ74921.1| ThiJ/PfpI domain protein [Shewanella halifaxensis HAW-EB4] (225 aa)
Score = 91, Expect = 9.9e-02, Identities = 21/61 (34%), Positives = 30/61 (49%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALAD 109
           +A  K +   N  DYD ++ PGG+G    L      IA ++ F    K V  +C AP AL +
  S:    80 LATTKVLAEINQADYDAVFYPGGHGPLWDLTNDAHSIALIEAFYQAKKPVGLVCHAPGALKN 141
>gi|32473078|ref|NP_866072.1| proteinase I [Rhodopirellula baltica SH 1] >gi|32397757|emb|CAD73758.1| proteinase I [Rhodopirellula baltica SH 1] (188 aa)
Score = 91, Expect = 9.9e-02, Identities = 20/72 (27%), Positives = 38/72 (52%)
  Q:    53 KTIKNFNVNDYDVLYIPGGYG-ATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           + + N +  D+D L +PGG      LR  +  ++ +++F    K V AIC  P  L + ++++  ++  SW S
  S:    64 QNVANVSAEDFDGLVLPGGVANPDTLRTCETSVSFIRDFFKQHKPVAAICHGPWTLIEADVVR-GRRVTSWPS 135
>gi|184156037|ref|YP_001844377.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Lactobacillus fermentum IFO 3956] >gi|183227381|dbj|BAG27897.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Lactobacillus fermentum IFO 3956] (194 aa)
Score = 91, Expect = 1.0e-01, Identities = 30/98 (30%), Positives = 46/98 (46%)
  Q:    63 YDVLYIPGGYG-ATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKY-----ISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAF 160
           +D +  PGG G A  LR   + +  ++      +W  A+C AP A A + L+ +   Y     I  ++  +  S R  +  T V    KLIT R P   L  A+
  S:    65 FDCVVFPGGSGGAKALRDDDRLMQLMQRRQQAGEWNAAMCAAPIAFARYGLL-DGHDYTCFPGIEQTTTQVAPSGRFHEDITVVDEKGKLITSRGPATALAFAY 167
>gi|170759401|ref|YP_001786417.1| DJ-1/PfpI family protein [Clostridium botulinum A3 str. Loch Maree] >gi|169406390|gb|ACA54801.1| DJ-1/PfpI family protein [Clostridium botulinum A3 str. Loch Maree] (194 aa)
Score = 91, Expect = 1.0e-01, Identities = 34/138 (24%), Positives = 66/138 (47%)
  Q:    44 TGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQ---SKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYR------SNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMG 181
           T  F +     +   N++++D L IPGG+      +   S+  +  +KEF    K + +IC     +    ++  D+   +++ G+    K++ +F  +V R         +IT   P     +AF  LE++  K+    +K +LMG
  S:    49 TFNFTVTPEMHVSEVNIDEFDALAIPGGFEEAGFYEDAYSEDFLNIIKEFDKAGKTIASICVGALPIGKSGVLV-DRNATTYNLGNGRRQKQLSEFGANVLRDEPVVVDKNIITSYNPSTAFHVAFKLLELLTSKENCVNIK-RLMG 193
>gi|52143742|ref|YP_083086.1| intracellular protease/amidase [Bacillus cereus E33L] >gi|51977211|gb|AAU18761.1| conserved hypothetical protein; possible intracellular protease/amidase [Bacillus cereus E33L] (194 aa)
Score = 91, Expect = 1.1e-01, Identities = 36/154 (23%), Positives = 77/154 (50%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVT 155
           K+L      F + E V + S+F  S++FE I   +  + + VTG+  F      ++++  V DY++  +PGG+    L ++ + ++ V +    +KW+  IC   + L    ++ + +    +S+   +D K++   +   Y+ NK +T    ++T
  S:     3 KVLIFLFDGFAEFE-VNIASLFLISKQFEIIT--ATVDGKTVTGEGGFLCQPHVSMEHIEVADYELFIVPGGHIFDHL-ENDQLLSIVNKLHKQNKWIAGICAGTSLLHAAGVLNKKK----FSTSLTSDEKQLAHLHEWEYKQNKDVTVDGKIIT 150
>gi|157963737|ref|YP_001503771.1| ThiJ/PfpI domain-containing protein [Shewanella pealeana ATCC 700345] >gi|157848737|gb|ABV89236.1| ThiJ/PfpI domain protein [Shewanella pealeana ATCC 700345] (225 aa)
Score = 91, Expect = 1.1e-01, Identities = 21/61 (34%), Positives = 30/61 (49%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNALAD 109
           +A  K +   N  DYD ++ PGG+G    L      IA ++ F    K V  +C AP AL +
  S:    80 LATTKVLAEINQADYDAIFYPGGHGPLWDLTNDVHSIALIEAFYQAQKPVGLVCHAPGALKN 141
>gi|146340883|ref|YP_001205931.1| putative intracellular proteinase [Bradyrhizobium sp. ORS278] >gi|146193689|emb|CAL77706.1| putative intracellular proteinase [Bradyrhizobium sp. ORS278] (186 aa)
Score = 91, Expect = 1.1e-01, Identities = 24/72 (33%), Positives = 37/72 (51%)
  Q:    53 KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           KT+     +DYD + +PGG     LLR   K +  +K+  +  K V A+C AP  L +  + K  +K  S+ S
  S:    61 KTLDQAQASDYDAIVLPGGQINPDLLRLEPKALQFIKDIFNAKKIVAAVCHAPWLLIETGIAK-GRKMTSYKS 132
>gi|73662681|ref|YP_301462.1| putative intracellular protease amidase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72495196|dbj|BAE18517.1| putative intracellular protease amidase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (218 aa)
Score = 91, Expect = 1.1e-01, Identities = 17/59 (28%), Positives = 35/59 (59%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIA-CVKEFIDNDKWVIAICDAPNAL 107
           +  + +I+N +V+ YD +Y+PGG+GA       + +A  + +F +  K + ++C  P+A 
  S:    74 LKQVPSIENIDVSQYDAVYLPGGHGAVFDFAHNQQLADILADFKEEKKIISSVCHGPSAF 133
>gi|148359551|ref|YP_001250758.1| intracellular protease [Legionella pneumophila str. Corby] >gi|148281324|gb|ABQ55412.1| intracellular protease [Legionella pneumophila str. Corby] (194 aa)
Score = 90, Expect = 1.1e-01, Identities = 19/58 (32%), Positives = 31/58 (53%)
  Q:    60 VNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQ 117
           + DYD L IPGG  A   R SK  +A ++ F + +K +  IC     LA+  +++  +
  S:    81 LKDYDALIIPGGRAAEYQRLSKDILAIIRHFHETNKPIACICHGIQILAEAGILENKK 138
>gi|153883993|ref|ZP_02005152.1| ThiJ/PfpI domain protein [Ralstonia pickettii 12D] >gi|187926081|ref|YP_001892426.1| ThiJ/PfpI domain protein [Ralstonia pickettii 12J] >gi|151579026|gb|EDN43423.1| ThiJ/PfpI domain protein [Ralstonia pickettii 12D] >gi|187727835|gb|ACD28999.1| ThiJ/PfpI domain protein [Ralstonia pickettii 12J] (228 aa)
Score = 90, Expect = 1.1e-01, Identities = 25/133 (18%), Positives = 58/133 (43%)
  Q:    45 GQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKI 177
           G   I+N++ + +  +   D++ +PGG+G     +  + +  V+   D  ++V ++C     L    L++  +    W+  ++  +         V R   LITG      +D+A   +  I G + +  +++
  S:    50 GGLTISNVQRLAD--IPHADLICVPGGFGVIEAMEDAEFVRQVRRLADGARYVTSVCSGSLVLGAAGLLQGKRAACHWAWRNLLPAFGATVDEARVVRDGNLITGGGVTAGIDMALTVMADIAGAEHAQAVQL 180
>gi|92113058|ref|YP_572986.1| peptidase C56, PfpI [Chromohalobacter salexigens DSM 3043] >gi|91796148|gb|ABE58287.1| Peptidase C56, PfpI [Chromohalobacter salexigens DSM 3043] (185 aa)
Score = 90, Expect = 1.1e-01, Identities = 19/55 (34%), Positives = 28/55 (50%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALA 108
           +  +   + YD L IPGG     LR  ++ +A V+ F++ DK V  IC     LA
  S:    70 SFADIEASRYDALVIPGGRAPEYLRLDERVLALVRHFMEADKPVAVICHGAQLLA 124
>gi|15802400|ref|NP_288426.1| chaperone protein HchA [Escherichia coli O157:H7 EDL933] >gi|12516075|gb|AAG56980.1|AE005418_8 hypothetical protein Z3059 [Escherichia coli O157:H7 EDL933] (283 aa)
Score = 90, Expect = 1.2e-01, Identities = 17/47 (36%), Positives = 32/47 (68%)
  Q:    61 NDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           ++Y  +++PGG+GA + L +S+   A ++  I ND++VI++C  P A 
  S:   144 SEYAAIFVPGGHGALIGLPESQDVAAALQWAIKNDRFVISLCHGPAAF 191
>gi|168721655|ref|ZP_02753932.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC4206] (245 aa)
Score = 90, Expect = 1.2e-01, Identities = 17/47 (36%), Positives = 32/47 (68%)
  Q:    61 NDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           ++Y  +++PGG+GA + L +S+   A ++  I ND++VI++C  P A 
  S:   106 SEYAAIFVPGGHGALIGLPESQDVAAALQWAIKNDRFVISLCHGPAAF 153
>gi|194535810|ref|YP_002070977.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae RC385] >gi|150420604|gb|EDN12895.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae RC385] (205 aa)
Score = 90, Expect = 1.2e-01, Identities = 32/120 (26%), Positives = 54/120 (45%)
  Q:    53 KTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSG------DITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFS 172
           +T+   +  D+D L +PGG  GA     S   +A +  F    K V AIC  P AL    +  + QK++           D   S+R+       Y +  L+T + P   L+ A   + ++ G + +
  S:    59 QTLDALSAEDFDALALPGGVGGAQAFADSTPLLALIDAFSQQGKLVAAICATP-AL----VFAKQQKFVGARMTCHPNFFDHIPSERLSRQRVCYYATQHLLTSQGPSTALEFALAMIALLAGAELA 180
>gi|81865403|sp|Q7TQ35|PARK7_MESAU Protein DJ-1 (Parkinson disease protein 7 homolog) (Contraception-associated protein 1) >gi|32452351|emb|CAD24072.2| CAP1 protein [Mesocricetus auratus] (189 aa)
Score = 90, Expect = 1.2e-01, Identities = 32/121 (26%), Positives = 55/121 (45%)
  Q:    63 YDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGD-ITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMGKE 183
           YDV+ +PGG  GA  L +S      +KE       + AIC  P AL  H +    +      + D + +        + V +   ++T R P  + + A   +E + GK+ +D +K  L+ K+
  S:    67 YDVVVLPGGNLGAQNLSESPVVKEILKEQESRKGLIAAICAGPTALLAHEIGFGSKVTTHPGAKDKMMNGSHYSYSESRVEKDGLILTSRGPGTSFEFALAIVEALSGKEAADQVKAPLVLKD 189
>gi|30063405|ref|NP_837576.1| chaperone protein HchA [Shigella flexneri 2a str. 2457T] >gi|30041657|gb|AAP17385.1| hypothetical protein S2111 [Shigella flexneri 2a str. 2457T] (290 aa)
Score = 90, Expect = 1.2e-01, Identities = 17/47 (36%), Positives = 32/47 (68%)
  Q:    61 NDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           ++Y  +++PGG+GA + L +S+   A ++  I ND++VI++C  P A 
  S:   144 SEYAAIFVPGGHGALIGLPESQDVAAALQWAIKNDRFVISLCHGPAAF 191
>gi|42543236|pdb|1ONS|A Chain A, Crystal Structure Of Escherichia Coli Heat Shock Protein Yedu (282 aa)
Score = 90, Expect = 1.2e-01, Identities = 17/47 (36%), Positives = 32/47 (68%)
  Q:    61 NDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           ++Y  +++PGG+GA + L +S+   A ++  I ND++VI++C  P A 
  S:   143 SEYAAIFVPGGHGALIGLPESQDVAAALQWAIKNDRFVISLCHGPAAF 190
>gi|15831959|ref|NP_310732.1| chaperone protein HchA [Escherichia coli O157:H7 str. Sakai] >gi|168710868|ref|ZP_02743145.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC4045] >gi|168738507|ref|ZP_02770784.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC4115] >gi|168752200|ref|ZP_02777222.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC4113] >gi|168757598|ref|ZP_02782605.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC4401] >gi|168763918|ref|ZP_02788925.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC4501] >gi|168771622|ref|ZP_02796629.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC4486] >gi|168777724|ref|ZP_02802731.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC4196] >gi|168783366|ref|ZP_02808373.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC4076] >gi|168789329|ref|ZP_02814336.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC869] >gi|168796650|ref|ZP_02821657.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC4042] >gi|168801744|ref|ZP_02826751.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC508] >gi|195939272|ref|ZP_03084654.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC4024] >gi|28558111|sp|Q8XB78|HCHA_ECO57 Chaperone protein hchA (Hsp31) >gi|38492413|pdb|1IZY|A Chain A, Crystal Structure Of Hsp31 >gi|38492414|pdb|1IZY|B Chain B, Crystal Structure Of Hsp31 >gi|13362173|dbj|BAB36128.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] >gi|187767088|gb|EDU30932.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC4196] >gi|188013897|gb|EDU52019.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC4113] >gi|188999309|gb|EDU68295.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC4076] >gi|189355439|gb|EDU73858.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC4401] >gi|189359658|gb|EDU78077.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC4486] >gi|189366017|gb|EDU84433.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC4501] >gi|189370993|gb|EDU89409.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC869] >gi|189376130|gb|EDU94546.1| chaperone protein HchA [Escherichia coli O157:H7 str. EC508] (283 aa)
Score = 90, Expect = 1.2e-01, Identities = 17/47 (36%), Positives = 32/47 (68%)
  Q:    61 NDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           ++Y  +++PGG+GA + L +S+   A ++  I ND++VI++C  P A 
  S:   144 SEYAAIFVPGGHGALIGLPESQDVAAALQWAIKNDRFVISLCHGPAAF 191
>gi|29726554|pdb|1N57|A Chain A, Crystal Structure Of Chaperone Hsp31 (291 aa)
Score = 90, Expect = 1.2e-01, Identities = 17/47 (36%), Positives = 32/47 (68%)
  Q:    61 NDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           ++Y  +++PGG+GA + L +S+   A ++  I ND++VI++C  P A 
  S:   144 SEYAAIFVPGGHGALIGLPESQDVAAALQWAIKNDRFVISLCHGPAAF 191
>gi|27383155|ref|NP_774684.1| proteinase [Bradyrhizobium japonicum USDA 110] >gi|27356329|dbj|BAC53309.1| proteinase [Bradyrhizobium japonicum USDA 110] (186 aa)
Score = 90, Expect = 1.2e-01, Identities = 20/52 (38%), Positives = 28/52 (53%)
  Q:    53 KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAP 104
           KT+   +  DYD + +PGG     LLR   K +  +K+  D  K V A+C AP
  S:    61 KTLDEASAADYDAIVLPGGQINPDLLRVEPKALKFIKDIFDAKKVVAAVCHAP 113
>gi|157155671|ref|YP_001463267.1| chaperone protein HchA [Escherichia coli E24377A] >gi|167008778|sp|A7ZN88|HCHA_ECO24 Chaperone protein hchA (Hsp31) >gi|157077701|gb|ABV17409.1| chaperone protein HchA [Escherichia coli E24377A] (283 aa)
Score = 90, Expect = 1.2e-01, Identities = 17/47 (36%), Positives = 32/47 (68%)
  Q:    61 NDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           ++Y  +++PGG+GA + L +S+   A ++  I ND++VI++C  P A 
  S:   144 SEYAAIFVPGGHGALIGLPESQDVAAALQWAIKNDRFVISLCHGPAAF 191
>gi|157161435|ref|YP_001458753.1| chaperone protein HchA [Escherichia coli HS] >gi|170019703|ref|YP_001724657.1| ThiJ/PfpI domain-containing protein [Escherichia coli ATCC 8739] >gi|170684248|ref|YP_001743279.1| chaperone protein HchA [Escherichia coli SMS-3-5] >gi|187732593|ref|YP_001879604.1| chaperone protein HchA [Shigella boydii CDC 3083-94] >gi|191169239|ref|ZP_03030992.1| chaperone protein HchA [Escherichia coli B7A] >gi|193066638|ref|ZP_03047673.1| chaperone protein HchA [Escherichia coli E22] >gi|167008779|sp|A8A1G6|HCHA_ECOHS Chaperone protein hchA (Hsp31) >gi|189042471|sp|B1IZU5|HCHA_ECOLC Chaperone protein hchA (Hsp31) >gi|157067115|gb|ABV06370.1| chaperone protein HchA [Escherichia coli HS] >gi|169754631|gb|ACA77330.1| ThiJ/PfpI domain protein [Escherichia coli ATCC 8739] >gi|170521966|gb|ACB20144.1| chaperone protein HchA [Escherichia coli SMS-3-5] >gi|187429585|gb|ACD08859.1| chaperone protein HchA [Shigella boydii CDC 3083-94] >gi|190900717|gb|EDV60513.1| chaperone protein HchA [Escherichia coli B7A] >gi|192925713|gb|EDV80372.1| chaperone protein HchA [Escherichia coli E22] (283 aa)
Score = 90, Expect = 1.2e-01, Identities = 17/47 (36%), Positives = 32/47 (68%)
  Q:    61 NDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           ++Y  +++PGG+GA + L +S+   A ++  I ND++VI++C  P A 
  S:   144 SEYAAIFVPGGHGALIGLPESQDVAAALQWAIKNDRFVISLCHGPAAF 191
>gi|46203096|ref|ZP_00052085.2| COG0693: Putative intracellular protease/amidase [Magnetospirillum magnetotacticum MS-1] (192 aa)
Score = 90, Expect = 1.2e-01, Identities = 23/67 (34%), Positives = 34/67 (50%)
  Q:    48 DIANIKTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           D+A    +++ N  DYD L +PGG      LR   K I  ++ F+ + K V AIC  P  L +   +K
  S:    61 DVAVDLDLESVNPADYDALVLPGGQINPDKLRVEAKAIEVIRSFLTSGKVVAAICHGPWLLIEAGAVK 128
>gi|16129913|ref|NP_416476.1| Hsp31 molecular chaperone [Escherichia coli str. K-12 substr. MG1655] >gi|89108795|ref|AP_002575.1| Hsp31 molecular chaperone [Escherichia coli W3110] >gi|170081607|ref|YP_001730927.1| Hsp31 molecular chaperone [Escherichia coli str. K12 substr. DH10B] >gi|194440151|ref|ZP_03072199.1| chaperone protein HchA [Escherichia coli 101-1] >gi|2506683|sp|P31658|HCHA_ECOLI Chaperone protein hchA (Hsp31) (EcHsp31) >gi|42543304|pdb|1PV2|A Chain A, Native Form 2 E.Coli Chaperone Hsp31 >gi|42543305|pdb|1PV2|B Chain B, Native Form 2 E.Coli Chaperone Hsp31 >gi|42543306|pdb|1PV2|C Chain C, Native Form 2 E.Coli Chaperone Hsp31 >gi|42543307|pdb|1PV2|D Chain D, Native Form 2 E.Coli Chaperone Hsp31 >gi|42543308|pdb|1PV2|E Chain E, Native Form 2 E.Coli Chaperone Hsp31 >gi|42543309|pdb|1PV2|F Chain F, Native Form 2 E.Coli Chaperone Hsp31 >gi|42543310|pdb|1PV2|G Chain G, Native Form 2 E.Coli Chaperone Hsp31 >gi|42543311|pdb|1PV2|H Chain H, Native Form 2 E.Coli Chaperone Hsp31 >gi|1788278|gb|AAC75033.1| Hsp31 molecular chaperone [Escherichia coli str. K-12 substr. MG1655] >gi|85675171|dbj|BAA15794.2| Hsp31 molecular chaperone [Escherichia coli W3110] >gi|169889442|gb|ACB03149.1| Hsp31 molecular chaperone [Escherichia coli str. K12 substr. DH10B] >gi|194420914|gb|EDX36953.1| chaperone protein HchA [Escherichia coli 101-1] (283 aa)
Score = 90, Expect = 1.2e-01, Identities = 17/47 (36%), Positives = 32/47 (68%)
  Q:    61 NDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           ++Y  +++PGG+GA + L +S+   A ++  I ND++VI++C  P A 
  S:   144 SEYAAIFVPGGHGALIGLPESQDVAAALQWAIKNDRFVISLCHGPAAF 191
>gi|148651976|ref|YP_001279069.1| ThiJ/PfpI domain-containing protein [Psychrobacter sp. PRwf-1] >gi|148571060|gb|ABQ93119.1| ThiJ/PfpI domain protein [Psychrobacter sp. PRwf-1] (175 aa)
Score = 90, Expect = 1.2e-01, Identities = 23/56 (41%), Positives = 31/56 (55%)
  Q:    59 NVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           +  DYD + +PGG   A  +R  K     VK+F D +K V AIC AP  L +  L+K
  S:    66 SAEDYDAVVLPGGTVNADTIRIDKSAQNFVKQFYDANKPVAAICHAPWLLVNSGLVK 122
>gi|167568801|ref|ZP_02361675.1| intracellular protease, PfpI family protein [Burkholderia oklahomensis C6786] (139 aa)
Score = 90, Expect = 1.2e-01, Identities = 22/61 (36%), Positives = 30/61 (49%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           T  + +   YD L I GG     LR   K IA V+ F +  K + AIC A   LA  ++I+
  S:    18 TFDDVDATGYDALAIAGGRAPEYLRLDPKVIALVRAFAEAKKPIAAICHAAQLLAAADVIR 78
>gi|116793831|gb|ABK26894.1| unknown [Picea sitchensis] (376 aa)
Score = 90, Expect = 1.2e-01, Identities = 39/169 (23%), Positives = 83/169 (49%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQ-FDIANIKTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYI-SWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKD 170
           ++L    ++  ++E+V ++ + + + K   +     ++LE+V  +   I   +  K+  +++YD +++PGG YGA  L  +++ I  ++E  +++K    +C A   L    L+K  +       S  ++D   +   N  V    KLIT      T++ A   +E +FG +
  S:   195 QVLVPIANRSDEMEIVVVVDVLRRA-KANVVVASVEDSLEIVAARGTKIVADRLFKDAILSNYDFIHLPGGWYGAQKLGSTEQLIDLLREHAESNKAYGVVCAAAVMLDTKGLLKGKKATTHPHYSNKLSDQSSV---NVRVVIDGKLITSFGTGSTMEYALSIVEKLFGME 362
>gi|83720628|ref|YP_441100.1| PfpI family intracellular peptidase [Burkholderia thailandensis E264] >gi|167579846|ref|ZP_02372720.1| intracellular protease, PfpI family protein [Burkholderia thailandensis TXDOH] >gi|167617920|ref|ZP_02386551.1| intracellular protease, PfpI family protein [Burkholderia thailandensis Bt4] >gi|83654453|gb|ABC38516.1| intracellular protease, PfpI family [Burkholderia thailandensis E264] (193 aa)
Score = 90, Expect = 1.2e-01, Identities = 22/61 (36%), Positives = 30/61 (49%)
  Q:    54 TIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           T  + +   YD L I GG     LR   K IA V+ F +  K + AIC A   LA  ++I+
  S:    72 TFDDVDATGYDALAIAGGRAPEYLRLDPKVIALVRAFAEAKKPIAAICHAAQLLAAADVIR 132
>gi|74312503|ref|YP_310922.1| chaperone protein HchA [Shigella sonnei Ss046] >gi|123616900|sp|Q3Z0M5|HCHA_SHISS Chaperone protein hchA (Hsp31) >gi|73855980|gb|AAZ88687.1| conserved hypothetical protein [Shigella sonnei Ss046] (283 aa)
Score = 90, Expect = 1.2e-01, Identities = 17/47 (36%), Positives = 32/47 (68%)
  Q:    61 NDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           ++Y  +++PGG+GA + L +S+   A ++  I ND++VI++C  P A 
  S:   144 SEYAAIFVPGGHGALIGLPESQDVAAALQWAIKNDRFVISLCHGPAAF 191
>gi|24113342|ref|NP_707852.1| chaperone protein HchA [Shigella flexneri 2a str. 301] >gi|110805937|ref|YP_689457.1| chaperone protein HchA [Shigella flexneri 5 str. 8401] >gi|123048122|sp|Q0T3G3|HCHA_SHIF8 Chaperone protein hchA (Hsp31) >gi|28558104|sp|P59332|HCHA_SHIFL Chaperone protein hchA (Hsp31) >gi|24052355|gb|AAN43559.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] >gi|110615485|gb|ABF04152.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] (283 aa)
Score = 90, Expect = 1.2e-01, Identities = 17/47 (36%), Positives = 32/47 (68%)
  Q:    61 NDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           ++Y  +++PGG+GA + L +S+   A ++  I ND++VI++C  P A 
  S:   144 SEYAAIFVPGGHGALIGLPESQDVAAALQWAIKNDRFVISLCHGPAAF 191
>gi|88804457|ref|ZP_01119977.1| putative intracellular protease, PfpI family protein [Robiginitalea biformata HTCC2501] >gi|88785336|gb|EAR16505.1| putative intracellular protease, PfpI family protein [Robiginitalea biformata HTCC2501] (181 aa)
Score = 90, Expect = 1.2e-01, Identities = 21/62 (33%), Positives = 33/62 (53%)
  Q:    53 KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           KT+   +  DY+ L +PGG Y    LR ++  +  V++F    K V AIC AP  L    +++
  S:    57 KTLSQVDAKDYNALVLPGGVYNPDQLRVNEDALLFVRDFFKLKKPVAAICHAPQILISAGVVE 119
>gi|148255686|ref|YP_001240271.1| putative intracellular proteinase [Bradyrhizobium sp. BTAi1] >gi|146407859|gb|ABQ36365.1| putative intracellular proteinase [Bradyrhizobium sp. BTAi1] (186 aa)
Score = 90, Expect = 1.2e-01, Identities = 24/72 (33%), Positives = 38/72 (52%)
  Q:    53 KTIKNFNVNDYDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           KT+   + +DYD + +PGG     LLR   K +  +K+  +  K V A+C AP  L +  + K  +K  S+ S
  S:    61 KTLDQASASDYDAIVLPGGQINPDLLRLEPKALKFIKDIFEAKKIVAAVCHAPWLLIETGIAK-GRKMTSYKS 132
>gi|51598874|ref|YP_073062.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Borrelia garinii PBi] >gi|51573445|gb|AAU07470.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Borrelia garinii PBi] (184 aa)
Score = 90, Expect = 1.2e-01, Identities = 37/166 (22%), Positives = 74/166 (44%)
  Q:    11 FQDLEMVALLSIFKASQKFERIDFYSPENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWS--SGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLK 176
           F+D+E +  + I +      ++   +  N+   +          I N   N +D++ +PGG  GAT L  SK+    +K+     K++ AIC +P  +     +    K+  +      + D + +   + +V  SN  IT +    + + AF  LE++ G+   + +K
  S:    11 FEDIEAIIPIDILRRGNVNIQVISLNDNNVVTSSKGVSFLTDDVILNCKENYFDLIILPGGMPGATNLFNSKELDLILKDMNSRGKFIAAICASPAVVLAAKGLLGSNKFTCYPGLEKSVLDGEFV---DKNVVISNNFITSKGVGTSFEFAFTLLEMVKGRQIMENVK 176
>gi|113971150|ref|YP_734943.1| PfpI family intracellular peptidase [Shewanella sp. MR-4] >gi|114048389|ref|YP_738939.1| PfpI family intracellular peptidase [Shewanella sp. MR-7] >gi|113885834|gb|ABI39886.1| intracellular protease, PfpI family [Shewanella sp. MR-4] >gi|113889831|gb|ABI43882.1| intracellular protease, PfpI family [Shewanella sp. MR-7] (186 aa)
Score = 90, Expect = 1.2e-01, Identities = 34/107 (31%), Positives = 49/107 (45%)
  Q:     8 MSKFQDLEMV------------ALLSIFKASQKFERIDFYS--PENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           M  FQ L+MV            A  +I  A   FE    Y+  P +L  + G F           N +D+D L +PGG     LR +   IA V  F   DK + A+C     L   ++++
  S:    18 MVPFQALQMVGHNVTVVCPDKVAGQTIKTAIHDFEGDQTYTEKPGHLFALNGNF--------AGTNASDFDALLLPGGRAPEYLRLNPAVIALVAGFAAQDKPIAAVCHGAQLLTAADVVR 130
>gi|169608628|ref|XP_001797733.1| hypothetical protein SNOG_07399 [Phaeosphaeria nodorum SN15] >gi|160701685|gb|EAT84865.2| hypothetical protein SNOG_07399 [Phaeosphaeria nodorum SN15] (236 aa)
Score = 90, Expect = 1.2e-01, Identities = 31/111 (27%), Positives = 53/111 (47%)
  Q:    63 YDVLYIPGG-YGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNAL----------ADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSD 173
           YD+L +PGG  GA     +   +  +K F+ + K+V AIC    AL            H  + ++ K   W   + ++ + + D         K++T R P   L  +   +EV+ GK+  D
  S:   114 YDILILPGGGPGAKTFSTNPSVLQLIKSFVRSGKFVAAICAGTTALVAAGIEKKIVTSHPSVMQEIKGAGW---EYSEERVVVD--------GKVVTSRGPGTALLFSLTIVEVMVGKEKRD 224
>gi|26248237|ref|NP_754277.1| chaperone protein HchA [Escherichia coli CFT073] >gi|110642072|ref|YP_669802.1| chaperone protein HchA [Escherichia coli 536] >gi|191173293|ref|ZP_03034823.1| chaperone protein HchA [Escherichia coli F11] >gi|123049114|sp|Q0TGM8|HCHA_ECOL5 Chaperone protein hchA (Hsp31) >gi|28558103|sp|P59331|HCHA_ECOL6 Chaperone protein hchA (Hsp31) >gi|26108641|gb|AAN80844.1|AE016762_97 Protein yedU [Escherichia coli CFT073] >gi|110343664|gb|ABG69901.1| chaperone protein HchA [Escherichia coli 536] >gi|190906410|gb|EDV66019.1| chaperone protein HchA [Escherichia coli F11] (283 aa)
Score = 90, Expect = 1.2e-01, Identities = 17/47 (36%), Positives = 32/47 (68%)
  Q:    61 NDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           ++Y  +++PGG+GA + L +S+   A ++  I ND++VI++C  P A 
  S:   144 SEYAAIFVPGGHGALIGLPESQDVAAALQWAIKNDRFVISLCHGPAAF 191
>gi|149116246|ref|ZP_01842975.1| ThiJ/PfpI domain protein [Shewanella baltica OS223] >gi|146863835|gb|EDK49315.1| ThiJ/PfpI domain protein [Shewanella baltica OS223] (230 aa)
Score = 90, Expect = 1.3e-01, Identities = 19/59 (32%), Positives = 31/59 (52%)
  Q:    49 IANIKTIKNFNVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           +AN   +      DYD ++ PGG+G    L + K  I  +++F   +K +  +C AP AL
  S:    82 LANTTRLSEIKAADYDAVFYPGGHGPLWDLAEDKHSITLIEQFYQANKPLGLVCHAPAAL 141
>gi|14600627|ref|NP_147144.1| protease I [Aeropyrum pernix K1] >gi|5103958|dbj|BAA79274.1| protease I [Aeropyrum pernix K1] (180 aa)
Score = 90, Expect = 1.3e-01, Identities = 19/65 (29%), Positives = 30/65 (46%)
  Q:    62 DYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGD 126
           ++DVL IPGG     +R  +  +  V+ F + +K V  IC  P  L    ++K  +    W   D
  S:    62 EFDVLVIPGGRAPERVRLHEAALNIVRHFFEKNKPVATICHGPQVLISAGVVKGRRLTSYWGVKD 126
>gi|17531319|ref|NP_493696.1| DJ-1 (mammalian transcriptional regulator) Related family member (djr-1.1) [Caenorhabditis elegans] >gi|1707138|gb|AAB37889.1| Dj-1 (mammalian transcriptional regulator) related protein 1.1 [Caenorhabditis elegans] (187 aa)
Score = 90, Expect = 1.3e-01, Identities = 35/138 (25%), Positives = 64/138 (46%)
  Q:    38 ENLEMVTGQFDIANIKTIKNFNVNDYDVLYIPGGY-GATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYRSNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGL 175
           E ++   G   + ++K +++     +D++ +PGG  G+  L +S      +K  +++   + AIC AP AL  H  +K +      S  +  +    K     V  S K+IT R P    + A   +E++ GKD +  L
  S:    43 EPVKCARGAHIVPDVK-LEDVETEKFDIVILPGGQPGSNTLAESLLVRDVLKSQVESGGLIGAICAAPIALLSHG-VKAELVTSHPSVKEKLEKGGYKYSEDRVVVSGKIITSRGPGTAFEFALKIVELLEGKDKATSL 179
>gi|11513902|pdb|1G2I|A Chain A, Crystal Structure Of A Novel Intracellular Protease From Pyrococcus Horikoshii At 2 A Resolution >gi|11513903|pdb|1G2I|B Chain B, Crystal Structure Of A Novel Intracellular Protease From Pyrococcus Horikoshii At 2 A Resolution >gi|11513904|pdb|1G2I|C Chain C, Crystal Structure Of A Novel Intracellular Protease From Pyrococcus Horikoshii At 2 A Resolution (166 aa)
Score = 90, Expect = 1.4e-01, Identities = 28/113 (24%), Positives = 53/113 (46%)
  Q:     2 KLLALTMSKFQDLEMVALLSIFKAS------QKFERIDFYSPENLEMVTGQ--FDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIK 114
           K+L LT ++F+D+E++      K          FER           +TG+  + +    T    N  ++D L +PGG     +R ++K ++  ++     K V +IC  P  L    +++
  S:     2 KVLFLTANEFEDVELIYPYHRLKEEGHEVYIASFER---------GTITGKHGYSVKVDLTFDKVNPEEFDALVLPGGRAPERVRLNEKAVSIARKXFSEGKPVASICHGPQILISAGVLR 113
>gi|58040145|ref|YP_192109.1| protease I [Gluconobacter oxydans 621H] >gi|58002559|gb|AAW61453.1| Protease I [Gluconobacter oxydans 621H] (175 aa)
Score = 90, Expect = 1.4e-01, Identities = 23/70 (32%), Positives = 36/70 (51%)
  Q:    55 IKNFNVNDYDVLYIPGGYGA-TLLRQSKKGIACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSS 124
           I +  V DYD L +PGG  +   LR +K  +A  + F+  +K + AIC     L + N +K  +   SW +
  S:    60 IADAKVEDYDALLLPGGLASPDALRMNKDVVAFARAFVKANKPIAAICHGAQTLIEVNELK-GRTVTSWPA 129
>gi|83593059|ref|YP_426811.1| ThiJ/PfpI [Rhodospirillum rubrum ATCC 11170] >gi|83575973|gb|ABC22524.1| ThiJ/PfpI [Rhodospirillum rubrum ATCC 11170] (225 aa)
Score = 90, Expect = 1.4e-01, Identities = 19/49 (38%), Positives = 28/49 (57%)
  Q:    59 NVNDYDVLYIPGGYGATL-LRQSKKGIACVKEFIDNDKWVIAICDAPNAL 107
           +  DYD ++ PGG+G    L +    IA ++ F+  DK V A+C  P AL
  S:    90 SAQDYDGVFYPGGHGPLWDLAEDPTSIALIEAFVAADKPVAAVCHGPAAL 139
>gi|168182877|ref|ZP_02617541.1| DJ-1/PfpI family protein [Clostridium botulinum Bf] >gi|182673928|gb|EDT85889.1| DJ-1/PfpI family protein [Clostridium botulinum Bf] (194 aa)
Score = 90, Expect = 1.4e-01, Identities = 33/138 (23%), Positives = 65/138 (47%)
  Q:    44 TGQFDIANIKTIKNFNVNDYDVLYIPGGYGATLLRQSKKG---IACVKEFIDNDKWVIAICDAPNALADHNLIKEDQKYISWSSGDITDSKRIKDFNTHVYR------SNKLITGRCPVVTLDLAFYSLEVIFGKDFSDGLKIKLMG 181
           T  F +     +   N++++D L IPGG+      +   G   +  ++EF    K + +IC     +    ++  ++   +++ G+    K++ +F  +V           +IT   P    D+AF  LE++  K+    +K KLMG
  S:    49 TFNFTVTPEMHVSEVNIDEFDALAIPGGFEEAGFYEDAYGEDFLNIIREFDKAGKTIASICVGALPIGKSGVLV-NRNATTYNLGNGKRQKQLSEFGANVLADKPIVIDKNIITSYNPSTAFDVAFKLLEILTSKENCVNIK-KLMG 193