>gi|26553464|ref|NP_757398.1| hypothetical protein MYPE120 [Mycoplasma penetrans HF-2] >gi|26453470|dbj|BAC43802.1| hypothetical protein [Mycoplasma penetrans HF-2] (152 aa)
Score = 550, Expect = 4.4e-55, Identities = 134/134 (100%), Positives = 134/134 (100%)
  Q:    19 YSEKEFIEMIKGCKFIDVDNFFISLSSYEDQKTGDIIETSVFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRELAQLN 152
           YSEKEFIEMIKGCKFIDVDNFFISLSSYEDQKTGDIIETSVFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRELAQLN
  S:    19 YSEKEFIEMIKGCKFIDVDNFFISLSSYEDQKTGDIIETSVFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRELAQLN 152
>gi|26554204|ref|NP_758138.1| hypothetical protein MYPE7480 [Mycoplasma penetrans HF-2] >gi|26454213|dbj|BAC44542.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (169 aa)
Score = 332, Expect = 7.6e-30, Identities = 85/138 (61%), Positives = 111/138 (80%)
  Q:    14 PFKGKYSEKEFIEMIKGCKFIDVDNFFISLSSYEDQKTGDIIETSVFEGNMKASKTKKYQKP-------KDPKDP---------IWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRELAQL 151
           PF G+YSEKEF  +IKGCKF+DV NF +S  SYED+KTGDIIETSVFEGNMK  KTK+++KP        D K P         I + LG IL  ++ ++ DI  LK+DV++LK DV+VLK+D+  +K D+ +LK+D+SKIK+CPTI +ELAQL
  S:    16 PFTGRYSEKEFTSIIKGCKFVDVKNFNVSFDSYEDEKTGDIIETSVFEGNMKIYKTKRHRKPIEVPPPGDDDKKPTDLSNEIKFIKDTLGIILSDMKEMKKDINYLKDDVSILKNDVSVLKDDMVEVKSDIKILKDDVSKIKQCPTIAKELAQL 169
>gi|26553463|ref|NP_757397.1| hypothetical protein MYPE110 [Mycoplasma penetrans HF-2] >gi|26453469|dbj|BAC43801.1| hypothetical protein [Mycoplasma penetrans HF-2] (80 aa)
Score = 283, Expect = 3.6e-24, Identities = 74/94 (78%), Positives = 79/94 (84%)
  Q:    59 VFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRELAQLN 152
           +FEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLE+IESDIR+LK+DVTVLKEDVAVLKEDV              SKIKRCPTI RELAQL+
  S:     1 MFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLELIESDIRVLKKDVTVLKEDVAVLKEDV--------------SKIKRCPTIARELAQLH 80
>gi|26554205|ref|NP_758139.1| hypothetical protein MYPE7490 [Mycoplasma penetrans HF-2] >gi|26454214|dbj|BAC44543.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (187 aa)
Score = 275, Expect = 3.1e-23, Identities = 72/124 (58%), Positives = 95/124 (76%)
  Q:    14 PFKGKYSEKEFIEMIKGCKFIDVDNFFISLSSYEDQKTGDIIETSVFEGNMKASKTKKYQKP-------KDPKDP---------IWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSK 137
           PF G+YSEKEF  +IKGCKF+DV NF +S  SYED KTGDIIETSVFEGNMK  KTK++ KP        D K P         I + LG IL  ++ ++ DI +LK+D+  +K D+ +LKE V VL+ DV++LK+D+S+
  S:    16 PFTGRYSEKEFASIIKGCKFVDVKNFNVSFDSYEDDKTGDIIETSVFEGNMKIYKTKRHPKPIEVPPPSDDDKKPTDLSNEIKFIKDTLGIILSDMKEMKHDISVLKDDMVEVKSDIKILKEKVTVLENDVSILKKDVSE 155
>gi|26554206|ref|NP_758140.1| hypothetical protein MYPE7500 [Mycoplasma penetrans HF-2] >gi|26454215|dbj|BAC44544.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (180 aa)
Score = 274, Expect = 4.7e-23, Identities = 73/129 (56%), Positives = 98/129 (75%)
  Q:    12 NKPFKGKYSEKEFIEMIKGCKFIDVDNFFISLSSYEDQKTGDIIETSVFEGNMKASKTKKYQKP-------KDPKDP---------IWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           +KPF G+Y+EKEF  ++KGCKF+DV NF +S  SYED+KTGDIIETSVFEGNMK  KTK+++KP        D K P         I + LG IL  ++ ++ DI  LKE VTVL+ D+  +K D+ +LKE V VL+ D+S +K+
  S:    14 SKPFTGRYTEKEFTNIVKGCKFVDVKNFNVSFDSYEDEKTGDIIETSVFEGNMKIYKTKRHRKPIEVPPPGDDDKKPTDLSNEIKFIKDTLGIILSDMKEMKQDINYLKEKVTVLETDMVEVKSDIKILKEKVTVLENDVSILKK 158
>gi|26554207|ref|NP_758141.1| hypothetical protein MYPE7510 [Mycoplasma penetrans HF-2] >gi|26454216|dbj|BAC44545.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (180 aa)
Score = 264, Expect = 5.3e-22, Identities = 70/124 (56%), Positives = 94/124 (75%)
  Q:    14 PFKGKYSEKEFIEMIKGCKFIDVDNFFISLSSYEDQKTGDIIETSVFEGNMKASKTKKYQKP-------KDPKDP---------IWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSK 137
           PF  +YSEKEF  +IKGCKF+DV NF +S  SYED+KTGDIIETSVFEGNMK  KTK++ KP        D K P         I + LG IL  ++ ++ DI +LK+D+  +K D+ +LKE V V + DV++LK+D+S+
  S:    16 PFTDRYSEKEFTSIIKGCKFVDVKNFNVSFDSYEDEKTGDIIETSVFEGNMKIYKTKRHPKPIEVPPPSDDDKKPTDLSNEIKFIKDTLGIILSDMKEMKHDISVLKDDMVEVKSDIKILKEKVTVFENDVSILKKDVSE 155
>gi|26554208|ref|NP_758142.1| hypothetical protein MYPE7520 [Mycoplasma penetrans HF-2] >gi|26454217|dbj|BAC44546.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (152 aa)
Score = 263, Expect = 7.8e-22, Identities = 67/116 (57%), Positives = 85/116 (73%)
  Q:    14 PFKGKYSEKEFIEMIKGCKFIDVDNFFISLSSYEDQKTGDIIETSVFEGNMKASKTKKYQKPKDPKDP---------IWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVA 129
           PF G+YSEKEF  +IKGCKF+DV NF +S  SYED+KTGDIIETSVFEGNMK  KTK+  KP D   P         +   +  I D L +I SD++ +K+D+  LKE V VL+ DV++LK DV+
  S:    16 PFTGRYSEKEFTNIIKGCKFVDVKNFNVSFDSYEDEKTGDIIETSVFEGNMKIYKTKRQPKPIDIPPPGDDDKKTTDLSNEIKFIKDSLGIILSDMKEMKQDINYLKEKVTVLENDVSILKTDVS 140
>gi|26553951|ref|NP_757885.1| hypothetical protein MYPE4990 [Mycoplasma penetrans HF-2] >gi|26453959|dbj|BAC44289.1| hypothetical protein [Mycoplasma penetrans HF-2] (141 aa)
Score = 227, Expect = 1.3e-17, Identities = 62/145 (42%), Positives = 88/145 (60%)
  Q:     8 KNNKNKPFKGKYSEKEFIEMIKGCKFIDVDNFFISLSSYEDQKTGDIIETSVFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRELAQLN 152
           KNN  + F G   EK+FI +IKGCK ++V N      +Y D++ GD+ +T   +  M+ +  KK  KP     PI           + +   ++IL  +V  +KE++ V+KED+  LKEDVAVLKED+SKIKRCPTI RELA+L+
  S:     5 KNNMPESFTGSMKEKDFISIIKGCKTVNVKNLTKIFETYVDEQNGDVFDTIGVKCYMEFTTIKKRPKPSIDLPPIVPT--------DDVREMLKILITEVRGIKEEIVVIKEDIKTLKEDVAVLKEDVSKIKRCPTIARELAELD 141
>gi|26554093|ref|NP_758027.1| hypothetical protein MYPE6410 [Mycoplasma penetrans HF-2] >gi|26454101|dbj|BAC44431.1| hypothetical protein [Mycoplasma penetrans HF-2] (179 aa)
Score = 222, Expect = 4.3e-17, Identities = 63/136 (46%), Positives = 93/136 (68%)
  Q:     4 NKNIKNNKNKPFKGKYSEKEFIEMIKGCKFIDVDNFFISLSSYEDQKTGDIIETSVFEGNMKASKTKKYQKP----------------KDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           N    N+ +  F G   EK+F+  IKGCK ++V +F  S + YE++   +I ET+  +G ++   ++KYQKP                 D  D I + L  ++D+++ ++ DI+ILKEDV VLKEDVAVLKEDVAVLKEDV +LKE +S ++
  S:     7 NNQKINSDSGSFTGPLKEKDFVRKIKGCKIVNVRDFEESFNVYENESENEITETTYIKGYVEMVVSRKYQKPIILGPTDGRGGGTICGGDAHDEINKKLDYLIDEMKEMKQDIKILKEDVAVLKEDVAVLKEDVAVLKEDVTILKEKVSVLE 158
>gi|26554020|ref|NP_757954.1| hypothetical protein MYPE5680 [Mycoplasma penetrans HF-2] >gi|26454028|dbj|BAC44358.1| hypothetical protein [Mycoplasma penetrans HF-2] (171 aa)
Score = 212, Expect = 6.7e-16, Identities = 61/127 (48%), Positives = 85/127 (66%)
  Q:    14 PFKGKYSEKEFIEMIKGCKFIDVDNFFISLSSYEDQKTGDIIETSVFEGNMKASKTKKYQ-------KPKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           PFKG++SEKEFI +IKGCK ++VD+F    + + D K    I T+  +  M+  KTKK +        PKD    I  +LGKILDK+EVIE D++ LKEDV  LK D+  +K DVA LK D+  +K D++ +K+
  S:    11 PFKGQFSEKEFISVIKGCKIVNVDHFITDSNVFVDDKNNVRIITTRAKCYMEIIKTKKEKLINEVIPPPKDKDSSIEVILGKILDKMEVIELDLKTLKEDVAQLKTDMVEVKSDVAQLKTDMVEVKSDVALLKQ 144
>gi|26553925|ref|NP_757859.1| hypothetical protein MYPE4740 [Mycoplasma penetrans HF-2] >gi|26453933|dbj|BAC44263.1| hypothetical protein [Mycoplasma penetrans HF-2] (150 aa)
Score = 186, Expect = 7.4e-13, Identities = 55/119 (46%), Positives = 77/119 (64%)
  Q:    14 PFKGKYSEKEFIEMIKGCKFIDVDNFFISLSSYEDQKTGDIIETSVFEGNMKASKTKKYQ-------KPKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLK 132
           P KGK SEKEF+ M+KGCK ++V++  I    + D K    I TS  +  M+ +K KK +        PKD    I  +LGKILDK++VIE D++ LKEDV  LK D+  +K D+A+LK D+  +K
  S:    11 PIKGKLSEKEFVSMVKGCKIVEVEDLIIDSEVFVDDKNNVRIITSKAKCYMEFTKIKKEKIIQEVIPPPKDIDGSIEGMLGKILDKMDVIELDLKTLKEDVAQLKTDMVEVKSDIAILKADMIDVK 136
>gi|26554072|ref|NP_758006.1| hypothetical protein MYPE6200 [Mycoplasma penetrans HF-2] >gi|26454080|dbj|BAC44410.1| hypothetical protein [Mycoplasma penetrans HF-2] (180 aa)
Score = 175, Expect = 1.2e-11, Identities = 50/138 (36%), Positives = 85/138 (61%)
  Q:     2 KENKNIK-NNKNKPFKGKYSEKEFIEMIKGCKFIDVDNFFISLSSYEDQKTGDIIETSVFEGNMKASKTKKYQKP---------KDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           K N N K N+ +  F G   EK+F+  IKGCK I+V +F  S + YE++   +I ET+  +G ++   ++KYQKP                 +   +I  KL+ +  +I+ +K+D+  LK+D+  +K+D+ +LKE V+VL+ DM+ +K
  S:    19 KHNNNQKINSDSGSFTGPLKEKDFVRKIKGCKIINVRDFEESFNVYENESENEITETTYIKGYVEMVVSRKYQKPIILGPTDGRGGGTICGGDAHAEINKKLDYLIDEIKEMKQDINYLKQDMIEVKQDIKILKEKVSVLETDMADVK 166
>gi|26553952|ref|NP_757886.1| hypothetical protein MYPE5000 [Mycoplasma penetrans HF-2] >gi|26453960|dbj|BAC44290.1| hypothetical protein [Mycoplasma penetrans HF-2] (86 aa)
Score = 137, Expect = 3.2e-07, Identities = 33/57 (57%), Positives = 46/57 (80%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRELAQLN 152
           I   ++IL  DV  +KE++ V+KED+ +LKEDV VLK+D++KIKRCPTI RELA+L+
  S:    30 IREMLKILITDVRGIKEEIVVIKEDIKILKEDVEVLKKDVAKIKRCPTIARELAELD 86
>gi|26553926|ref|NP_757860.1| hypothetical protein MYPE4750 [Mycoplasma penetrans HF-2] >gi|26453934|dbj|BAC44264.1| hypothetical protein [Mycoplasma penetrans HF-2] (156 aa)
Score = 136, Expect = 4.7e-07, Identities = 36/65 (55%), Positives = 46/65 (70%)
  Q:    75 PKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           PKD    I  +L KILDK++VIE D++ LKEDVT+LK DV  LK D+  +K DVA LK DM ++K
  S:    64 PKDIDGSIEGMLRKILDKMDVIELDLKTLKEDVTILKSDVTQLKTDMVEVKSDVAQLKTDMVEVK 128
>gi|26553927|ref|NP_757861.1| hypothetical protein MYPE4760 [Mycoplasma penetrans HF-2] >gi|26453935|dbj|BAC44265.1| hypothetical protein [Mycoplasma penetrans HF-2] (149 aa)
Score = 132, Expect = 1.1e-06, Identities = 34/64 (53%), Positives = 47/64 (73%)
  Q:    76 KDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           KD    I  +LGKILDK++VIE D++ LKEDV +LK DV  LK D+  +K DVA+LK+D++ +K
  S:    65 KDIDGSIEGMLGKILDKMDVIELDLKTLKEDVAILKLDVTQLKTDMVEVKSDVALLKQDVAILK 128
>gi|26554301|ref|NP_758235.1| hypothetical protein MYPE8470 [Mycoplasma penetrans HF-2] >gi|26454310|dbj|BAC44639.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (148 aa)
Score = 128, Expect = 3.1e-06, Identities = 47/138 (34%), Positives = 82/138 (59%)
  Q:    15 FKGKYSEKEFIEMIKGCKFIDVDNFFIS-LSSYEDQKTGDIIETSVFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKED-------VAVLKEDVAVLKEDMSKIKRCPTITRELAQLN 152
           F G      FI  I+  + +++ ++    + SY DQ+T + ++T  F+     +K+ +        +P  ++L +IL +L+ I SD+  LK D+  +K DVA LK D       +  LK DV+ L++D+S+I +CPTI RELA+++
  S:     8 FSGNMKTSVFISRIRDSETVNLKDYSEKVIDSYIDQETNERVKTVKFK-----AKSIEGNIMIRENNPSPDILEEILKQLKTISSDVAQLKTDMVEVKADVAQLKTDMVEVKADIVELKTDVSQLEKDVSRIMKCPTIIRELAEID 148
>gi|26553798|ref|NP_757732.1| hypothetical protein MYPE3430 [Mycoplasma penetrans HF-2] >gi|26453805|dbj|BAC44136.1| hypothetical protein [Mycoplasma penetrans HF-2] (90 aa)
Score = 128, Expect = 3.7e-06, Identities = 32/73 (43%), Positives = 51/73 (69%)
  Q:    80 DPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRELAQLN 152
           +P  ++L +IL +L+ I  D+  LK DV  LK D+  +K D+  LK DV+ LK+D+S+I +CPT+ RELA+++
  S:    18 NPSPDILEEILKQLKTISGDVSELKTDVAQLKTDMVEVKADILELKTDVSQLKKDVSRIMKCPTVVRELAEID 90
>gi|26554191|ref|NP_758125.1| hypothetical protein MYPE7350 [Mycoplasma penetrans HF-2] >gi|26454200|dbj|BAC44529.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (113 aa)
Score = 128, Expect = 4.0e-06, Identities = 44/107 (41%), Positives = 67/107 (62%)
  Q:    46 YEDQKTGDIIETSVFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKED-------VAVLKEDMSKIKRCPTITRELAQLN 152
           Y DQ+T + +ET  F+     +KT +        +P  ++L +IL +L+ I SD+  LK D+  +K D+  LK DVA LK D       +  LK+D+S+I +CPTI RELAQ++
  S:     5 YIDQETNERVETVKFK-----AKTIEGNIMIRENNPSPDILEEILKQLKTISSDVAQLKTDMVQVKADIVELKTDVAQLKTDMVEVKADITQLKKDVSRIMKCPTIVRELAQID 113
>gi|162455471|ref|YP_001617838.1| putative exported alanine/arginine/valine-rich protein [Sorangium cellulosum 'So ce 56'] >gi|161166053|emb|CAN97358.1| putative exported alanine/arginine/valine-rich protein [Sorangium cellulosum 'So ce 56'] (762 aa)
Score = 126, Expect = 5.8e-06, Identities = 25/57 (43%), Positives = 39/57 (68%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           D + V   D+   +EDV V +EDVAV++EDVAV +EDVAV++ED++  +    + R+
  S:   680 DDVAVAREDVAAAREDVAVAREDVAVVREDVAVAREDVAVVREDVAVAREDVAVVRD 736
Score = 121, Expect = 2.2e-05, Identities = 22/45 (48%), Positives = 36/45 (80%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDM 135
           + + V   D+ +++EDV V +EDVAV++EDVAV +EDVAV+++D+
  S:   694 EDVAVAREDVAVVREDVAVAREDVAVVREDVAVAREDVAVVRDDV 738
Score = 108, Expect = 8.0e-04, Identities = 21/44 (47%), Positives = 32/44 (72%)
  Q:   104 KEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           ++DV V +EDVA  +EDVAV +EDVAV++ED++  +    + RE
  S:   679 RDDVAVAREDVAAAREDVAVAREDVAVVREDVAVAREDVAVVRE 722
Score = 107, Expect = 8.8e-04, Identities = 20/43 (46%), Positives = 32/43 (74%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKE 133
           + + V+  D+ + +EDV V++EDVAV +EDVAV+++DV V  E
  S:   701 EDVAVVREDVAVAREDVAVVREDVAVAREDVAVVRDDVGVPPE 743
>gi|26554302|ref|NP_758236.1| hypothetical protein MYPE8480 [Mycoplasma penetrans HF-2] >gi|26454311|dbj|BAC44640.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (181 aa)
Score = 122, Expect = 1.7e-05, Identities = 52/145 (35%), Positives = 86/145 (59%)
  Q:     8 KNNKN---KPFKGKYSEKEFIEMIKGCKFIDVDNFFIS-LSSYEDQKTGDIIETSVFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKED--------------VAVLKEDMSKIKRCPTITRELAQLN 152
           K NKN     F G      FI  I+  + +++ ++    + SY DQ+T + ++T  F+     +K+ +        +P  ++L +IL +L+ I SD+  LK D+  +K D+  LK DVA LK D              V+ LK+D+S+I +CPTI RELA+++
  S:    24 KTNKNLFYDSFSGNMKTSVFISRIRDSETVNLKDYSEKVIDSYIDQETNERVKTVKFK-----AKSIEGNIMIRENNPSPDILEEILKQLKTISSDVSQLKTDMVQVKADIVELKTDVAQLKTDMVEVKADIVELKTDVSQLKKDVSRIMKCPTIVRELAEID 181
>gi|26553797|ref|NP_757731.1| hypothetical protein MYPE3420 [Mycoplasma penetrans HF-2] >gi|26453804|dbj|BAC44135.1| hypothetical protein [Mycoplasma penetrans HF-2] (146 aa)
Score = 120, Expect = 3.3e-05, Identities = 44/138 (31%), Positives = 77/138 (55%)
  Q:    15 FKGKYSEKEFIEMIKGCKFIDVDNFFIS-LSSYEDQKTGDIIETSVFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRELAQLN 152
           F G      FI  I+  + +++ ++    + SY DQ+T + ++T  F+     +K+ +        +P  ++L +IL +L+ I SD       V+ LK DVA LK D+  +K DV  LK+D+S+I +CPTI  EL++++
  S:    20 FNGNMKTSVFINRIRDSETVNLKDYSEKVIDSYIDQETNERVKTVKFK-----AKSIEGNIMIRENNPSPDILEEILKQLKTISSD-------VSELKTDVAQLKTDMVEVKADVTQLKKDVSRIMKCPTIVSELSEID 146
>gi|26554019|ref|NP_757953.1| hypothetical protein MYPE5670 [Mycoplasma penetrans HF-2] >gi|26454027|dbj|BAC44357.1| hypothetical protein [Mycoplasma penetrans HF-2] (118 aa)
Score = 117, Expect = 6.9e-05, Identities = 31/65 (47%), Positives = 46/65 (70%)
  Q:    75 PKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           PKD    I  +LGKILDK++VIE D++ LKEDV  LK D+  +K D+  +K+D+  LK D++++K
  S:    19 PKDKDSSIEVILGKILDKMDVIELDLKTLKEDVAQLKTDMVQVKADIVEMKKDIVELKTDVAQLK 83
>gi|158321323|ref|YP_001513830.1| hypothetical protein Clos_2301 [Alkaliphilus oremlandii OhILAs] >gi|158141522|gb|ABW19834.1| conserved hypothetical protein [Alkaliphilus oremlandii OhILAs] (238 aa)
Score = 115, Expect = 1.1e-04, Identities = 31/72 (43%), Positives = 50/72 (69%)
  Q:    76 KDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           KD    + E +  + + + V++ D+ +LKEDV++LK DV++LKEDVA LK DV++LKED+S +K   +  +E
  S:    32 KDDVSLLKEDVAFLKEDVSVLKGDVSLLKEDVSLLKGDVSLLKEDVAFLKGDVSLLKEDVSLLKEDVSFLKE 103
Score = 115, Expect = 1.3e-04, Identities = 31/66 (46%), Positives = 46/66 (69%)
  Q:    82 IWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + E LG +      +  D+  LK+DV++LKEDVA LKEDV+VLK DV++LKED+S +K   ++ +E
  S:    10 VLEKLGNLEVGQNQLRQDVAFLKDDVSLLKEDVAFLKEDVSVLKGDVSLLKEDVSLLKGDVSLLKE 75
Score = 114, Expect = 1.7e-04, Identities = 28/55 (50%), Positives = 43/55 (78%)
  Q:    93 LEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + +++ D+  LK DV++LKEDV++LKEDV+ LKEDVA LKED+S +K   ++ +E
  S:    70 VSLLKEDVAFLKGDVSLLKEDVSLLKEDVSFLKEDVAFLKEDVSLLKGDVSLLKE 124
Score = 113, Expect = 2.1e-04, Identities = 27/55 (49%), Positives = 44/55 (80%)
  Q:    93 LEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + +++ D+ +LKEDV+ LKEDVA LKEDV++LK DV++LKED++ +K   ++ +E
  S:    84 VSLLKEDVSLLKEDVSFLKEDVAFLKEDVSLLKGDVSLLKEDVAFLKGDVSLLKE 138
Score = 110, Expect = 4.0e-04, Identities = 27/44 (61%), Positives = 37/44 (84%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           ++ D+ +LKEDV++LKEDVA LK DV +LKEDV++LK DMS +K
  S:   129 LKGDVSLLKEDVSLLKEDVAFLKGDVFLLKEDVSLLKGDMSLLK 172
Score = 109, Expect = 5.1e-04, Identities = 27/57 (47%), Positives = 42/57 (73%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + + +++ D+  LKEDV  LKEDV++LK DV++LKEDVA LK D+S +K   ++ +E
  S:    89 EDVSLLKEDVSFLKEDVAFLKEDVSLLKGDVSLLKEDVAFLKGDVSLLKEDVSLLKE 145
Score = 109, Expect = 5.7e-04, Identities = 25/49 (51%), Positives = 40/49 (81%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           + + +++ D+ +LKEDV  LK DV++LKEDV++LKEDV+ LKED++ +K
  S:    61 EDVSLLKGDVSLLKEDVAFLKGDVSLLKEDVSLLKEDVSFLKEDVAFLK 109
Score = 106, Expect = 1.2e-03, Identities = 25/44 (56%), Positives = 38/44 (86%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           ++ D+ +LK DV++LKEDVA LK DV++LKEDV++LKED++ +K
  S:   108 LKEDVSLLKGDVSLLKEDVAFLKGDVSLLKEDVSLLKEDVAFLK 151
Score = 106, Expect = 1.3e-03, Identities = 27/55 (49%), Positives = 42/55 (76%)
  Q:    93 LEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + +++ D+  LK DV++LKEDV++LKEDVA LK DV +LKED+S +K   ++ +E
  S:   119 VSLLKEDVAFLKGDVSLLKEDVSLLKEDVAFLKGDVFLLKEDVSLLKGDMSLLKE 173
Score = 103, Expect = 2.9e-03, Identities = 25/49 (51%), Positives = 38/49 (77%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           + + +++ D+ +LKEDV  LK DV++LKEDV++LKEDVA LK D+  +K
  S:   110 EDVSLLKGDVSLLKEDVAFLKGDVSLLKEDVSLLKEDVAFLKGDVFLLK 158
Score = 101, Expect = 5.2e-03, Identities = 23/47 (48%), Positives = 38/47 (80%)
  Q:    93 LEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           + +++ D+ +LKEDV  LK DV +LKEDV++LK D+++LKED+ ++K
  S:   133 VSLLKEDVSLLKEDVAFLKGDVFLLKEDVSLLKGDMSLLKEDVGQLK 179
Score = 83, Expect = 5.3e-01, Identities = 21/48 (43%), Positives = 34/48 (70%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKI 138
           + + +++ D+  LK DV +LKEDV++LK D+++LKEDV  LK    +I
  S:   138 EDVSLLKEDVAFLKGDVFLLKEDVSLLKGDMSLLKEDVGQLKISQKQI 185
>gi|26553796|ref|NP_757730.1| hypothetical protein MYPE3410 [Mycoplasma penetrans HF-2] >gi|26453803|dbj|BAC44134.1| hypothetical protein [Mycoplasma penetrans HF-2] (180 aa)
Score = 113, Expect = 1.9e-04, Identities = 50/145 (34%), Positives = 81/145 (55%)
  Q:     8 KNNKNKPFKGKYSEKEFIEMIKGCKFIDVDNFFIS-LSSYEDQKTGDIIETSVFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDM---------------------SKIKRCPTITRELAQLN 152
           KN     F G      FI  I+  + +++ ++    +  Y DQ+T + ++T  F+     +K+ +        +P  ++L +IL +L+ I SD+  LK DV  LK D+  +K D+  LK DVA LK DM                     S+I +CPTI RELA+++
  S:    19 KNLYYDSFNGNMKTSVFINRIRDSQTVNLKDYSEKVIDYYIDQETNERVKTVKFK-----AKSIEGNIMIRENNPSPDILEEILKQLKTISSDVSELKTDVAQLKTDMVEVKADIVELKTDVAQLKTDMVEVKADIVELKTDVSQLKKDVSRIMKCPTIVRELAEID 180
>gi|26554192|ref|NP_758126.1| hypothetical protein MYPE7360 [Mycoplasma penetrans HF-2] >gi|26454201|dbj|BAC44530.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (153 aa)
Score = 107, Expect = 1.0e-03, Identities = 46/145 (31%), Positives = 77/145 (53%)
  Q:     8 KNNKN---KPFKGKYSEKEFIEMIKGCKFIDVDNFFIS-LSSYEDQKTGDIIETSVFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRELAQLN 152
           K NKN     F G      FI  I+  + +++ ++    + SY DQ+T + ++T  F+     +K+ +        +P  ++L +IL +L+ I SD              VA LK D+  +K D+  LK+D+S+I +CPTI RELA++N
  S:    24 KTNKNLFYDSFSGNMKTSAFISRIRDSETVNLKDYSEKVIDSYIDQETNERVKTVKFK-----AKSIEGNIMIRENNPSPDILEEILKQLKTISSD--------------VAQLKTDMVEVKADITQLKKDVSRIMKCPTIVRELAEIN 153
>gi|89896985|ref|YP_520472.1| hypothetical protein DSY4239 [Desulfitobacterium hafniense Y51] >gi|89336433|dbj|BAE86028.1| hypothetical protein [Desulfitobacterium hafniense Y51] (231 aa)
Score = 106, Expect = 1.4e-03, Identities = 21/56 (37%), Positives = 41/56 (73%)
  Q:    84 EVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           E+L KIL     +  +I +L++DV+ +K D+++L++DV  +K D++VL++D+S +K
  S:     7 EILNKILHGQTAMSENIGLLQKDVSSMKSDISILQQDVGSMKGDISVLQQDVSSMK 62
Score = 100, Expect = 6.1e-03, Identities = 21/56 (37%), Positives = 41/56 (73%)
  Q:    84 EVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           E +G +   +  ++SDI IL++DV  +K D++VL++DV+ +K D++ L++D+S +K
  S:    21 ENIGLLQKDVSSMKSDISILQQDVGSMKGDISVLQQDVSSMKGDISALQQDVSSMK 76
Score = 95, Expect = 2.3e-02, Identities = 18/44 (40%), Positives = 36/44 (81%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           ++ DI +L++DV  +K D++VL++DV+ +K D++VL++D+S +K
  S:    75 MKGDISVLQQDVGSMKGDISVLQQDVSSMKGDISVLQQDVSSMK 118
Score = 94, Expect = 2.9e-02, Identities = 17/44 (38%), Positives = 36/44 (81%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           ++ DI +L++DV+ +K D++VL++DV+ +K D++ L++D+S +K
  S:    89 MKGDISVLQQDVSSMKGDISVLQQDVSSMKGDISTLQQDVSSMK 132
Score = 93, Expect = 3.7e-02, Identities = 18/44 (40%), Positives = 35/44 (79%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           ++ DI  L++DV+ +K D++VL++DV  +K D++VL++D+S +K
  S:    61 MKGDISALQQDVSSMKGDISVLQQDVGSMKGDISVLQQDVSSMK 104
Score = 93, Expect = 4.5e-02, Identities = 17/48 (35%), Positives = 38/48 (79%)
  Q:    93 LEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           + V++ D+  +K D++VL++DV+ +K D++VL++DV+ +K D+S +++
  S:    79 ISVLQQDVGSMKGDISVLQQDVSSMKGDISVLQQDVSSMKGDISTLQQ 126
Score = 91, Expect = 7.6e-02, Identities = 17/54 (31%), Positives = 39/54 (72%)
  Q:    86 LGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           +G +   + V++ D+  +K D++VL++DV+ +K D++ L++DV+ +K D+S ++
  S:    86 VGSMKGDISVLQQDVSSMKGDISVLQQDVSSMKGDISTLQQDVSSMKGDISVLQ 139
Score = 91, Expect = 7.8e-02, Identities = 17/55 (30%), Positives = 39/55 (70%)
  Q:    86 LGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           +G +   + V++ D+  +K D++ L++DV+ +K D++VL++DV  +K D+S +++
  S:    44 VGSMKGDISVLQQDVSSMKGDISALQQDVSSMKGDISVLQQDVGSMKGDISVLQQ 98
Score = 88, Expect = 1.6e-01, Identities = 16/48 (33%), Positives = 36/48 (75%)
  Q:    93 LEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           +  ++ D+  +K D++VL++DV  +K D++VL++DV+ +K D+S +++
  S:    65 ISALQQDVSSMKGDISVLQQDVGSMKGDISVLQQDVSSMKGDISVLQQ 112
Score = 86, Expect = 2.5e-01, Identities = 15/48 (31%), Positives = 37/48 (77%)
  Q:    93 LEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           + +++ D+  +K D++VL++DV+ +K D++ L++DV+ +K D+S +++
  S:    37 ISILQQDVGSMKGDISVLQQDVSSMKGDISALQQDVSSMKGDISVLQQ 84
Score = 82, Expect = 6.8e-01, Identities = 15/42 (35%), Positives = 33/42 (78%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSK 137
           ++ DI +L++DV+ +K D++ L++DV+ +K D++VL+  ++K
  S:   103 MKGDISVLQQDVSSMKGDISTLQQDVSSMKGDISVLQTQVAK 144
>gi|26554282|ref|NP_758216.1| hypothetical protein MYPE8280 [Mycoplasma penetrans HF-2] >gi|26454291|dbj|BAC44620.1| hypothetical protein [Mycoplasma penetrans HF-2] (129 aa)
Score = 105, Expect = 1.6e-03, Identities = 30/53 (56%), Positives = 37/53 (69%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITREL 148
           +++D+  LK DV  LK DVA LK DV  LK DVA LK D++ IK CPTI +EL
  S:    73 LKTDVAQLKVDVAELKTDVAQLKVDVTELKTDVAQLKVDVAAIKACPTIQKEL 125
>gi|160932467|ref|ZP_02079857.1| hypothetical protein CLOLEP_01305 [Clostridium leptum DSM 753] >gi|156868426|gb|EDO61798.1| hypothetical protein CLOLEP_01305 [Clostridium leptum DSM 753] (152 aa)
Score = 103, Expect = 2.9e-03, Identities = 27/51 (52%), Positives = 37/51 (72%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITR 146
           +++D+  LK DV+ LKED A LK DVA+LK DV+ LKED + +K   +ITR
  S:    77 LKTDVATLKTDVSGLKEDTAALKTDVAILKTDVSSLKEDTAILKEESSITR 127
Score = 102, Expect = 3.5e-03, Identities = 27/64 (42%), Positives = 41/64 (64%)
  Q:    76 KDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           K+  +P+ E +  + +    +++D+  LK DV+ LKED A LK DVA LK DV+ LKED + +K
  S:    15 KEELEPVKEDISSLKEDTAALKTDVAALKTDVSGLKEDTAALKTDVATLKTDVSSLKEDTAALK 78
Score = 94, Expect = 2.9e-02, Identities = 26/52 (50%), Positives = 33/52 (63%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           ++ D   LK DV  LK DV+ LKED A LK DVA+LK D+S +K    I +E
  S:    70 LKEDTAALKTDVATLKTDVSGLKEDTAALKTDVAILKTDVSSLKEDTAILKE 121
>gi|196245892|ref|ZP_03144614.1| hypothetical protein Cyan8802DRAFT_3011 [Cyanothece sp. PCC 8802] >gi|196206396|gb|EDY01193.1| hypothetical protein Cyan8802DRAFT_3011 [Cyanothece sp. PCC 8802] (252 aa)
Score = 102, Expect = 3.9e-03, Identities = 27/54 (50%), Positives = 39/54 (72%)
  Q:    86 LGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           +G + + +  +++D+ +LKEDV  LK DV VLKEDV  LK DV VLKED+ ++K
  S:    93 VGVLKEDVRELKTDVGVLKEDVRELKTDVGVLKEDVRELKTDVGVLKEDVRELK 146
Score = 100, Expect = 6.3e-03, Identities = 27/54 (50%), Positives = 38/54 (70%)
  Q:    86 LGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           L  + + +  +++D+ +LKEDV  LK DV VLKEDV  LK DV VLKED+ ++K
  S:    79 LNGLKEDVRELKTDVGVLKEDVRELKTDVGVLKEDVRELKTDVGVLKEDVRELK 132
Score = 98, Expect = 1.0e-02, Identities = 29/54 (53%), Positives = 35/54 (64%)
  Q:    95 VIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITREL 148
           V++ D+R LK DV VLKEDV  LK DV VLKEDV  LK D+ ++       REL
  S:   109 VLKEDVRELKTDVGVLKEDVRELKTDVGVLKEDVRELKTDVKELNGLKEDVREL 162
Score = 82, Expect = 8.1e-01, Identities = 26/54 (48%), Positives = 38/54 (70%)
  Q:    86 LGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAV---LKEDMSKIK 139
           +G + + +  +++D+ +LKEDV  LK DV VLKEDV  LK DV     LKED+ ++K
  S:   107 VGVLKEDVRELKTDVGVLKEDVRELKTDVGVLKEDVRELKTDVKELNGLKEDVRELK 163
>gi|26554281|ref|NP_758215.1| hypothetical protein MYPE8270 [Mycoplasma penetrans HF-2] >gi|26454290|dbj|BAC44619.1| hypothetical protein [Mycoplasma penetrans HF-2] (135 aa)
Score = 101, Expect = 4.2e-03, Identities = 27/46 (58%), Positives = 33/46 (71%)
  Q:   103 LKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITREL 148
            + D++ LK DVA LK DVA LK DVA LK D++ IK CPTI +EL
  S:    86 FRTDISELKTDVAQLKVDVAELKTDVAQLKVDVAAIKACPTIQKEL 131
>gi|124522141|ref|ZP_01696862.1| hypothetical protein BcoaDRAFT_1271 [Bacillus coagulans 36D1] >gi|124496282|gb|EAY43889.1| hypothetical protein BcoaDRAFT_1271 [Bacillus coagulans 36D1] (153 aa)
Score = 99, Expect = 7.4e-03, Identities = 25/45 (55%), Positives = 37/45 (82%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           ++ D+  LK+DV VLK+DVA LK+DVAVLK+DVA LK + +++K+
  S:    65 VKQDVAGLKQDVAVLKQDVAELKQDVAVLKQDVASLKSERAEVKQ 109
Score = 94, Expect = 3.2e-02, Identities = 22/45 (48%), Positives = 38/45 (84%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           ++ D+ +LK+DV  LK ++A +K+DVA LK+DVAVLK+D++++K+
  S:    44 LKQDVTVLKQDVASLKSEMAEVKQDVAGLKQDVAVLKQDVAELKQ 88
Score = 92, Expect = 5.2e-02, Identities = 22/45 (48%), Positives = 37/45 (82%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           ++++++ +K D+  LKEDVA LK+DV VLK+DVA LK +M+++K+
  S:    23 MKAEMKEMKADIAGLKEDVAELKQDVTVLKQDVASLKSEMAEVKQ 67
Score = 91, Expect = 7.3e-02, Identities = 24/57 (42%), Positives = 42/57 (73%)
  Q:    84 EVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           E + ++   + V++ D+  LK ++  +K+DVA LK+DVAVLK+DVA LK+D++ +K+
  S:    39 EDVAELKQDVTVLKQDVASLKSEMAEVKQDVAGLKQDVAVLKQDVAELKQDVAVLKQ 95
Score = 91, Expect = 7.6e-02, Identities = 22/45 (48%), Positives = 36/45 (80%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           ++ D+ +LK+DV  LK+DVAVLK+DVA LK + A +K+D++ +K+
  S:    72 LKQDVAVLKQDVAELKQDVAVLKQDVASLKSERAEVKQDIAGMKK 116
>gi|109648643|ref|ZP_01372542.1| hypothetical protein Dhaf_0379 [Desulfitobacterium hafniense DCB-2] >gi|109639940|gb|EAT49496.1| hypothetical protein Dhaf_0379 [Desulfitobacterium hafniense DCB-2] (196 aa)
Score = 99, Expect = 7.9e-03, Identities = 20/57 (35%), Positives = 40/57 (70%)
  Q:    84 EVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           E+L KIL     +  +I +L++DV+ +K D+++L++DV  L++DV  +K D+S +++
  S:     7 EILNKILHGQTAMSENIGLLQKDVSSMKSDISILQKDVGSLQQDVGSMKGDISALQQ 63
Score = 91, Expect = 6.6e-02, Identities = 20/57 (35%), Positives = 39/57 (68%)
  Q:    84 EVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           E +G +   +  ++SDI IL++DV  L++DV  +K D++ L++DV  +K D+S +++
  S:    21 ENIGLLQKDVSSMKSDISILQKDVGSLQQDVGSMKGDISALQQDVGSMKGDISVLQQ 77
Score = 89, Expect = 1.1e-01, Identities = 16/47 (34%), Positives = 35/47 (74%)
  Q:    93 LEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           + +++ D+  L++DV  +K D++ L++DV  +K D++VL++D+S +K
  S:    37 ISILQKDVGSLQQDVGSMKGDISALQQDVGSMKGDISVLQQDVSSMK 83
Score = 87, Expect = 2.1e-01, Identities = 16/54 (29%), Positives = 37/54 (68%)
  Q:    86 LGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           +G +   +  ++ D+  +K D++VL++DV+ +K D++ L++DV  +K D+S ++
  S:    51 VGSMKGDISALQQDVGSMKGDISVLQQDVSSMKGDISALQQDVGSMKGDISALQ 104
Score = 86, Expect = 2.5e-01, Identities = 17/54 (31%), Positives = 37/54 (68%)
  Q:    86 LGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           +G +   +  ++ DI  L++DV  +K D++VL++DV+ +K D++ L++D+  +K
  S:    44 VGSLQQDVGSMKGDISALQQDVGSMKGDISVLQQDVSSMKGDISALQQDVGSMK 97
Score = 84, Expect = 4.5e-01, Identities = 15/45 (33%), Positives = 34/45 (75%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           ++ D+  +K D++ L++DV  +K D++VL++DV+ +K D+S +++
  S:    47 LQQDVGSMKGDISALQQDVGSMKGDISVLQQDVSSMKGDISALQQ 91
>gi|26554283|ref|NP_758217.1| hypothetical protein MYPE8290 [Mycoplasma penetrans HF-2] >gi|26454292|dbj|BAC44621.1| hypothetical protein [Mycoplasma penetrans HF-2] (115 aa)
Score = 99, Expect = 8.3e-03, Identities = 27/46 (58%), Positives = 33/46 (71%)
  Q:   103 LKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITREL 148
            + D++ LK DVA LK DVA LK DVA LK D++ IK CPTI +EL
  S:    66 FRTDISELKTDVAQLKVDVAELKTDVAQLKVDVAAIKACPTIQKEL 111
>gi|26554434|ref|NP_758368.1| hypothetical protein MYPE9860 [Mycoplasma penetrans HF-2] >gi|26454444|dbj|BAC44772.1| hypothetical protein [Mycoplasma penetrans HF-2] (113 aa)
Score = 95, Expect = 2.4e-02, Identities = 23/56 (41%), Positives = 39/56 (69%)
  Q:    93 LEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITREL 148
           L ++  +++ ++ D++ LK DV+ LK D+  +K D+A LK D++ IK CPTI +EL
  S:    54 LALVYKELKEMRTDISELKTDVSHLKTDMVEVKADIAELKTDVAAIKACPTIQKEL 109
>gi|188534520|ref|YP_001908317.1| hypothetical protein ETA_23930 [Erwinia tasmaniensis] >gi|188029562|emb|CAO97439.1| Hypothetical protein [Erwinia tasmaniensis] (118 aa)
Score = 94, Expect = 2.9e-02, Identities = 24/54 (44%), Positives = 36/54 (66%)
  Q:    86 LGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           LG +   + ++++D+  LK DV  LK+DV  LK+DV  LK+DV +LK D+  IK
  S:    12 LGLLQTDVGMLKTDVGGLKIDVDRLKDDVGTLKDDVGKLKDDVGILKIDLGVIK 65
Score = 92, Expect = 4.8e-02, Identities = 25/50 (50%), Positives = 37/50 (74%)
  Q:    90 LDKLE----VIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           +DKLE    ++++D+ +LK DV  LK DV  LK+DV  LK+DV  LK+D+  +K
  S:     5 MDKLEGHLGLLQTDVGMLKTDVGGLKIDVDRLKDDVGTLKDDVGKLKDDVGILK 58
Score = 88, Expect = 1.5e-01, Identities = 21/48 (43%), Positives = 33/48 (68%)
  Q:    92 KLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           +++ +E  + +L+ DV +LK DV  LK DV  LK+DV  LK+D+ K+K
  S:     4 RMDKLEGHLGLLQTDVGMLKTDVGGLKIDVDRLKDDVGTLKDDVGKLK 51
>gi|109648376|ref|ZP_01372279.1| conserved hypothetical protein [Desulfitobacterium hafniense DCB-2] >gi|109641466|gb|EAT51021.1| conserved hypothetical protein [Desulfitobacterium hafniense DCB-2] (132 aa)
Score = 94, Expect = 3.4e-02, Identities = 17/54 (31%), Positives = 38/54 (70%)
  Q:    85 VLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKI 138
           ++G     LE ++ D+ ++K+D+ V+K D+ V+K+D+ V+K+D+  +K+D  ++
  S:    47 IVGNTNGMLEEVQQDVNVMKQDIGVMKRDIDVMKQDIDVMKQDINGIKQDQKRM 100
Score = 86, Expect = 2.6e-01, Identities = 16/38 (42%), Positives = 32/38 (84%)
  Q:   103 LKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           +++DV V+K+D+ V+K D+ V+K+D+ V+K+D++ IK+
  S:    58 VQQDVNVMKQDIGVMKRDIDVMKQDIDVMKQDINGIKQ 95
>gi|26554284|ref|NP_758218.1| hypothetical protein MYPE8300 [Mycoplasma penetrans HF-2] >gi|26454293|dbj|BAC44622.1| hypothetical protein [Mycoplasma penetrans HF-2] (115 aa)
Score = 93, Expect = 3.9e-02, Identities = 33/95 (34%), Positives = 52/95 (54%)
  Q:    54 IIETSVFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITREL 148
           I  +S+ E     S   K++  +D  + I   L  +  +L+ + ++ R    D++ LK DVA LK DV  LK D+  +K D++ IK CPTI +EL
  S:    22 IWRSSINEDKKAGSVFVKFELEQDMSEKI--TLALVYKELKEMRTEFRT---DISELKADVAQLKVDVTQLKTDMVEVKADIAAIKACPTIQKEL 111
>gi|47222502|emb|CAG02867.1| unnamed protein product [Tetraodon nigroviridis] (1219 aa)
Score = 93, Expect = 3.9e-02, Identities = 31/108 (28%), Positives = 56/108 (51%)
  Q:    45 SYEDQKTGDIIETSVFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKED-MSKIKRCPTITRELAQLN 152
           S ED+K GD  +     G+   SK K  ++   P        G + +K+  +E+ ++ L++D+   KED AVL+ +V  L+++   L+E+  S + R   +T  L  +N
  S:  1120 SREDRKAGDPTQA----GDQTDSKLKDSKESDSP--------GNLEEKVSQLEAMLKKLQDDLQKEKEDKAVLQAEVQSLRQNNQRLQEESQSTVARLIKVTELLCNVN 1216
>gi|168715240|ref|ZP_02747517.1| hypothetical protein CdifQCD-6_16008 [Clostridium difficile QCD-63q42] (345 aa)
Score = 90, Expect = 8.4e-02, Identities = 22/59 (37%), Positives = 46/59 (77%)
  Q:    89 ILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           I + +  ++ +I +LKED++ +K+++ V+KED++ +K+++ VLKEDMS++K+  T+ +E
  S:    19 IKNDMSEVKQEINVLKEDMSEVKQEMTVMKEDMSEVKQEINVLKEDMSEMKQEMTVMKE 77
Score = 87, Expect = 1.8e-01, Identities = 23/60 (38%), Positives = 44/60 (73%)
  Q:    88 KILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           KIL+ L  I  D+  +K D++ +K+++ VLKED++ +K+++ V+KEDMS++K+   + +E
  S:     4 KILELLYTINEDVVSIKNDMSEVKQEINVLKEDMSEVKQEMTVMKEDMSEVKQEINVLKE 63
Score = 82, Expect = 8.0e-01, Identities = 19/57 (33%), Positives = 43/57 (75%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + +  ++ +I +LKED++ +K+++ V+KED++ +K+++ VLK DMS++K+   + +E
  S:    49 EDMSEVKQEINVLKEDMSEMKQEMTVMKEDMSEVKQEINVLKGDMSEVKQEMIVMKE 105
Score = 81, Expect = 8.9e-01, Identities = 17/50 (34%), Positives = 41/50 (82%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           + +  ++ ++ ++KED++ +K+++ VLKED++ +K+++ V+KEDMS++K+
  S:    35 EDMSEVKQEMTVMKEDMSEVKQEINVLKEDMSEMKQEMTVMKEDMSEVKQ 84
Score = 81, Expect = 8.9e-01, Identities = 17/72 (23%), Positives = 50/72 (69%)
  Q:    76 KDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           K+    + + +  + + +  +  ++ ++KED++ +K+++ VLKED++ +++++ ++KEDMS++++  T+ +E
  S:   118 KEDMSEVRQEINTMKEDMSEVRQEMTVMKEDMSEVKQEINVLKEDMSEVRQEINIMKEDMSEVRQEMTVMKE 189
>gi|160939610|ref|ZP_02086958.1| hypothetical protein CLOBOL_04502 [Clostridium bolteae ATCC BAA-613] >gi|158437401|gb|EDP15165.1| hypothetical protein CLOBOL_04502 [Clostridium bolteae ATCC BAA-613] (125 aa)
Score = 90, Expect = 8.6e-02, Identities = 24/60 (40%), Positives = 35/60 (58%)
  Q:    80 DPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           D I + LG I   L  +  D+R L+ D+  +K DV  +K DV  LKEDV  LK+ ++ I+
  S:     7 DLILQKLGGIEGGLASVREDVRSLQGDMQTIKGDVQTIKGDVQTLKEDVQTLKDRVTNIE 66
>gi|56419969|ref|YP_147287.1| hypothetical protein GK1434 [Geobacillus kaustophilus HTA426] >gi|56379811|dbj|BAD75719.1| hypothetical protein [Geobacillus kaustophilus HTA426] (304 aa)
Score = 90, Expect = 8.6e-02, Identities = 21/53 (39%), Positives = 32/53 (60%)
  Q:    87 GKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
            ++  +L  +E D+R LK D+ ++K DV  LK D+  +K DV  LK DM  +K
  S:    68 ARLEQRLHRVEEDVRTLKADMDMVKGDVQTLKADMDAVKGDVQTLKADMDAVK 120
>gi|196125340|ref|ZP_03117089.1| hypothetical protein CdifA_07170 [Clostridium difficile ATCC 43255] (359 aa)
Score = 89, Expect = 1.0e-01, Identities = 22/59 (37%), Positives = 46/59 (77%)
  Q:    89 ILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           I + +  ++ +I +LKED++ +K+++ V+KED++ +K+++ VLKEDMS++K+  T+ +E
  S:    19 IKNDMSEVKQEINVLKEDMSEVKQEMTVMKEDMSEVKQEINVLKEDMSEMKQEMTVMKE 77
Score = 87, Expect = 2.1e-01, Identities = 23/60 (38%), Positives = 44/60 (73%)
  Q:    88 KILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           KIL+ L  I  D+  +K D++ +K+++ VLKED++ +K+++ V+KEDMS++K+   + +E
  S:     4 KILELLYTINEDVVSIKNDMSEVKQEINVLKEDMSEVKQEMTVMKEDMSEVKQEINVLKE 63
Score = 86, Expect = 2.5e-01, Identities = 19/57 (33%), Positives = 45/57 (78%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + +  ++ ++ ++KED++ +K+++ VLKED++ +K+++ V+KEDMS++K+  T+ +E
  S:    35 EDMSEVKQEMTVMKEDMSEVKQEINVLKEDMSEMKQEMTVMKEDMSEVKQEITVMKE 91
Score = 86, Expect = 2.8e-01, Identities = 25/92 (27%), Positives = 59/92 (64%)
  Q:    56 ETSVFEGNMKASKTKKYQKPKDPKDPIWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           E +V +G+M   K +     +D  + + + +  + + +  +  +I I+KED++ +++++ V+KED++ +K+++ VLKEDMS++++   I +E
  S:    99 EINVLKGDMSEVKQEMIVMKEDMSE-VRQEINIMKEDMSEVRQEINIMKEDISEVRQEMTVMKEDMSEVKQEINVLKEDMSEVRQEINIMKE 189
Score = 85, Expect = 3.8e-01, Identities = 18/50 (36%), Positives = 41/50 (82%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           + +  ++ +I +LKED++ +K+++ V+KED++ +K+++ V+KEDMS++K+
  S:    49 EDMSEVKQEINVLKEDMSEMKQEMTVMKEDMSEVKQEITVMKEDMSEVKQ 98
>gi|126699693|ref|YP_001088590.1| hypothetical protein CD2076 [Clostridium difficile 630] >gi|115251130|emb|CAJ68961.1| conserved hypothetical protein [Clostridium difficile 630] (363 aa)
Score = 89, Expect = 1.0e-01, Identities = 22/59 (37%), Positives = 46/59 (77%)
  Q:    89 ILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           I + +  ++ +I +LKED++ +K+++ V+KED++ +K+++ VLKEDMS++K+  T+ +E
  S:    23 IKNDMSEVKQEINVLKEDMSEVKQEMTVMKEDMSEVKQEINVLKEDMSEMKQEMTVMKE 81
Score = 89, Expect = 1.3e-01, Identities = 24/66 (36%), Positives = 47/66 (71%)
  Q:    82 IWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + +V  KIL+ L  I  D+  +K D++ +K+++ VLKED++ +K+++ V+KEDMS++K+   + +E
  S:     2 VMQVQEKILELLYTINEDVVSIKNDMSEVKQEINVLKEDMSEVKQEMTVMKEDMSEVKQEINVLKE 67
Score = 86, Expect = 2.5e-01, Identities = 19/57 (33%), Positives = 45/57 (78%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + +  ++ ++ ++KED++ +K+++ VLKED++ +K+++ V+KEDMS++K+  T+ +E
  S:    39 EDMSEVKQEMTVMKEDMSEVKQEINVLKEDMSEMKQEMTVMKEDMSEVKQEITVMKE 95
Score = 85, Expect = 3.8e-01, Identities = 18/50 (36%), Positives = 41/50 (82%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           + +  ++ +I +LKED++ +K+++ V+KED++ +K+++ V+KEDMS++K+
  S:    53 EDMSEVKQEINVLKEDMSEMKQEMTVMKEDMSEVKQEITVMKEDMSEVKQ 102
>gi|196164098|ref|ZP_03124629.1| hypothetical protein CdifQCD-2_07199 [Clostridium difficile QCD-23m63] (345 aa)
Score = 89, Expect = 1.2e-01, Identities = 20/57 (35%), Positives = 46/57 (80%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + +  ++ +I +LKED++ +++++AV+KED++ +K+++ VLKEDMS++++  T+ +E
  S:   147 EDMSEVKQEINVLKEDMSEVRQEMAVMKEDMSEVKQEINVLKEDMSEVRQEMTVMKE 203
Score = 86, Expect = 2.4e-01, Identities = 23/60 (38%), Positives = 44/60 (73%)
  Q:    88 KILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           KIL+ L  I  D+  +K D++ +K+++ VLKED++ +++++ V+KEDMS++K+   I +E
  S:     4 KILELLYTINEDVVSIKNDMSEVKQEINVLKEDMSEVRQEMTVMKEDMSEVKQEINIMKE 63
Score = 84, Expect = 4.4e-01, Identities = 19/57 (33%), Positives = 44/57 (77%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + +  ++ +I I+KED++ +++++ V+KED++ +K+++ VLKEDMS++++  T  +E
  S:    91 EDMSEVKQEINIMKEDMSEVRQEMTVMKEDISEVKQEINVLKEDMSEVRQEMTAMKE 147
Score = 84, Expect = 4.9e-01, Identities = 19/57 (33%), Positives = 43/57 (75%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + +  ++ +I I+KEDV+ +++++ +LKED+  +K+++ ++KEDMS++K+   I +E
  S:    49 EDMSEVKQEINIMKEDVSEVRQEINILKEDMLEVKQEINIMKEDMSEVKQEINIMKE 105
Score = 83, Expect = 5.8e-01, Identities = 18/52 (34%), Positives = 41/52 (78%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           +  +I ILKED+  +K+++ ++KED++ +K+++ ++KEDMS++++  T+ +E
  S:    68 VRQEINILKEDMLEVKQEINIMKEDMSEVKQEINIMKEDMSEVRQEMTVMKE 119
>gi|168731528|ref|ZP_02763805.1| hypothetical protein CdifQCD-_09508 [Clostridium difficile QCD-97b34] (293 aa)
Score = 87, Expect = 2.1e-01, Identities = 20/57 (35%), Positives = 45/57 (78%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + +  ++ +I +LKED++ +K+++ V+KED++ +K+++ V+KEDMS++K+  T+ +E
  S:    11 EDMSEVKQEINVLKEDMSEVKQEMIVMKEDMSEVKQEMTVMKEDMSEVKQEMTVMKE 67
Score = 84, Expect = 4.1e-01, Identities = 19/52 (36%), Positives = 43/52 (82%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           ++ ++ ++KED++ +K+++ VLKED++ +K+++ V+KEDMS++K+  T+ +E
  S:     2 VKQEMTVMKEDMSEVKQEINVLKEDMSEVKQEMIVMKEDMSEVKQEMTVMKE 53
Score = 84, Expect = 4.7e-01, Identities = 19/57 (33%), Positives = 43/57 (75%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + +  +  +I I+KED++ +++++ V+KED++ +K+++ VLKEDMS++++   I +E
  S:    67 EDMSEVRQEINIMKEDISEVRQEMTVMKEDMSEVKQEINVLKEDMSEVRQEINIMKE 123
>gi|168696706|ref|ZP_02728983.1| hypothetical protein CdifQCD_14783 [Clostridium difficile QCD-37x79] >gi|168725726|ref|ZP_02758003.1| hypothetical protein CdifQCD-7_15152 [Clostridium difficile QCD-76w55] >gi|196160186|ref|ZP_03120747.1| hypothetical protein CdifC_05893 [Clostridium difficile CIP 107932] (359 aa)
Score = 87, Expect = 2.1e-01, Identities = 20/57 (35%), Positives = 45/57 (78%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + +  ++ +I +LKED++ +K+++ V+KED++ +K+++ V+KEDMS++K+  T+ +E
  S:    77 EDMSEVKQEINVLKEDMSEVKQEMIVMKEDMSEVKQEMTVMKEDMSEVKQEMTVMKE 133
Score = 85, Expect = 3.5e-01, Identities = 21/53 (39%), Positives = 41/53 (77%)
  Q:    88 KILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           KIL+ L  I  D+  +K D++ +K+++ V+KED++ +K+++ V+KEDMS++K+
  S:     4 KILELLYTINEDVVSIKNDMSEVKQEMTVMKEDISEVKQEMTVMKEDMSEVKQ 56
Score = 84, Expect = 4.1e-01, Identities = 19/52 (36%), Positives = 43/52 (82%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           ++ ++ ++KED++ +K+++ VLKED++ +K+++ V+KEDMS++K+  T+ +E
  S:    68 VKQEMTVMKEDMSEVKQEINVLKEDMSEVKQEMIVMKEDMSEVKQEMTVMKE 119
Score = 84, Expect = 4.8e-01, Identities = 19/57 (33%), Positives = 43/57 (75%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + +  +  +I I+KED++ +++++ V+KED++ +K+++ VLKEDMS++++   I +E
  S:   133 EDMSEVRQEINIMKEDISEVRQEMTVMKEDMSEVKQEINVLKEDMSEVRQEINIMKE 189
Score = 82, Expect = 6.7e-01, Identities = 19/59 (32%), Positives = 45/59 (76%)
  Q:    89 ILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           I + +  ++ ++ ++KED++ +K+++ V+KED++ +K+++ VLK DMS++K+  T+ +E
  S:    19 IKNDMSEVKQEMTVMKEDISEVKQEMTVMKEDMSEVKQEINVLKGDMSEVKQEMTVMKE 77
>gi|145954089|ref|ZP_01803096.1| hypothetical protein CdifQ_04002390 [Clostridium difficile QCD-32g58] (363 aa)
Score = 87, Expect = 2.1e-01, Identities = 20/57 (35%), Positives = 45/57 (78%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + +  ++ +I +LKED++ +K+++ V+KED++ +K+++ V+KEDMS++K+  T+ +E
  S:    81 EDMSEVKQEINVLKEDMSEVKQEMIVMKEDMSEVKQEMTVMKEDMSEVKQEMTVMKE 137
Score = 87, Expect = 2.1e-01, Identities = 22/59 (37%), Positives = 44/59 (74%)
  Q:    82 IWEVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           + +V  KIL+ L  I  D+  +K D++ +K+++ V+KED++ +K+++ V+KEDMS++K+
  S:     2 VMQVQEKILELLYTINEDVVSIKNDMSEVKQEMTVMKEDISEVKQEMTVMKEDMSEVKQ 60
Score = 84, Expect = 4.1e-01, Identities = 19/52 (36%), Positives = 43/52 (82%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           ++ ++ ++KED++ +K+++ VLKED++ +K+++ V+KEDMS++K+  T+ +E
  S:    72 VKQEMTVMKEDMSEVKQEINVLKEDMSEVKQEMIVMKEDMSEVKQEMTVMKE 123
Score = 84, Expect = 4.7e-01, Identities = 19/57 (33%), Positives = 43/57 (75%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           + +  +  +I I+KED++ +++++ V+KED++ +K+++ VLKEDMS++++   I +E
  S:   137 EDMSEVRQEINIMKEDISEVRQEMTVMKEDMSEVKQEINVLKEDMSEVRQEINIMKE 193
Score = 82, Expect = 6.7e-01, Identities = 19/59 (32%), Positives = 45/59 (76%)
  Q:    89 ILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKRCPTITRE 147
           I + +  ++ ++ ++KED++ +K+++ V+KED++ +K+++ VLK DMS++K+  T+ +E
  S:    23 IKNDMSEVKQEMTVMKEDISEVKQEMTVMKEDMSEVKQEINVLKGDMSEVKQEMTVMKE 81
>gi|56962747|ref|YP_174473.1| hypothetical protein ABC0973 [Bacillus clausii KSM-K16] >gi|56908985|dbj|BAD63512.1| hypothetical protein [Bacillus clausii KSM-K16] (90 aa)
Score = 84, Expect = 4.1e-01, Identities = 20/49 (40%), Positives = 34/49 (69%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           D+ + + +  R +   +  +K DVA LK+DVA+LK DV++LK+DM++ K
  S:     4 DQFKQVMTAFREVNSQLREIKGDVATLKDDVAILKSDVSILKKDMAEQK 52
Score = 83, Expect = 5.9e-01, Identities = 19/53 (35%), Positives = 36/53 (67%)
  Q:    88 KILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           +++     + S +R +K DV  LK+DVA+LK DV++LK+D+A  K   +++++
  S:     8 QVMTAFREVNSQLREIKGDVATLKDDVAILKSDVSILKKDMAEQKVITAQLQK 60
>gi|123438867|ref|XP_001310211.1| fimbriae-associated protein, putative [Trichomonas vaginalis G3] >gi|121891971|gb|EAX97281.1| fimbriae-associated protein, putative [Trichomonas vaginalis G3] (989 aa)
Score = 83, Expect = 5.4e-01, Identities = 23/32 (71%), Positives = 28/32 (87%)
  Q:   105 EDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMS 136
           EDV+VL EDV+VL EDV+VL EDV+VL ED+S
  S:    39 EDVSVLDEDVSVLDEDVSVLDEDVSVLDEDVS 70
>gi|16303221|gb|AAK13547.1| BgMFREP7 [Biomphalaria glabrata] (670 aa)
Score = 83, Expect = 5.7e-01, Identities = 15/51 (29%), Positives = 37/51 (72%)
  Q:    90 LDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           L+ L+ I+ D+ I + ++  +KED+A+ +++++ +K DVAV +E++  +++
  S:   366 LESLQSIKEDLNIQQRNIISVKEDIAINQQNISSIKTDVAVNEENLINLQK 416
>gi|18389119|gb|AAK28657.1| fibrinogen-related protein 7-1 precursor [Biomphalaria glabrata] (689 aa)
Score = 83, Expect = 5.8e-01, Identities = 15/51 (29%), Positives = 37/51 (72%)
  Q:    90 LDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIKR 140
           L+ L+ I+ D+ I + ++  +KED+A+ +++++ +K DVAV +E++  +++
  S:   385 LESLQSIKEDLNIQQRNIISVKEDIAINQQNISSIKTDVAVNEENLINLQK 435
>gi|109497542|ref|XP_001080588.1| PREDICTED: hypothetical protein [Rattus norvegicus] (262 aa)
Score = 82, Expect = 6.7e-01, Identities = 20/66 (30%), Positives = 42/66 (63%)
  Q:    84 EVLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKI-KRCPTITRELA 149
           E +  + +++  +  ++  L E+V+ L E+V+ L E+V+ L E+V+ L ED+S + +   T+T E++
  S:   143 EGVSTLTEEVSTLTEEVSTLTEEVSTLTEEVSTLTEEVSTLTEEVSTLTEDVSTLTEEVSTLTEEVS 209
>gi|78042748|ref|YP_359687.1| hypothetical protein CHY_0834 [Carboxydothermus hydrogenoformans Z-2901] >gi|77994863|gb|ABB13762.1| conserved hypothetical protein [Carboxydothermus hydrogenoformans Z-2901] (175 aa)
Score = 82, Expect = 8.4e-01, Identities = 24/44 (54%), Positives = 30/44 (68%)
  Q:    96 IESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           ++SDI  LK DV+ LK DV  LK DV+ LK DV  LK D+S +K
  S:    72 LKSDINELKSDVSNLKSDVNELKSDVSNLKSDVNELKSDVSNLK 115
>gi|89896022|ref|YP_519509.1| hypothetical protein DSY3276 [Desulfitobacterium hafniense Y51] >gi|89335470|dbj|BAE85065.1| hypothetical protein [Desulfitobacterium hafniense Y51] (125 aa)
Score = 81, Expect = 9.0e-01, Identities = 15/43 (34%), Positives = 31/43 (72%)
  Q:    85 VLGKILDKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKED 127
           ++G     LE ++ D+ ++K+D+ V+K D+ V+K+D+ V+K+D
  S:    47 IVGNTNGMLEEVQQDVNVMKQDIDVMKRDIDVMKQDINVIKQD 89
>gi|158334325|ref|YP_001515497.1| hypothetical protein AM1_1145 [Acaryochloris marina MBIC11017] >gi|158304566|gb|ABW26183.1| conserved hypothetical protein [Acaryochloris marina MBIC11017] (103 aa)
Score = 81, Expect = 9.3e-01, Identities = 18/47 (38%), Positives = 32/47 (68%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSK 137
           D+L+ IES +  L +D+  +K D++ +K D++ LKED++ L E  +K
  S:    15 DRLDRIESLLSTLGKDMQTVKADISTVKGDISELKEDISELNEKTTK 61
>gi|188996836|ref|YP_001931087.1| putative protein [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931903|gb|ACD66533.1| putative protein [Sulfurihydrogenibium sp. YO3AOP1] (451 aa)
Score = 81, Expect = 9.4e-01, Identities = 18/49 (36%), Positives = 35/49 (71%)
  Q:    91 DKLEVIESDIRILKEDVTVLKEDVAVLKEDVAVLKEDVAVLKEDMSKIK 139
           DK++++E  I++L+E+V  LK++ A +KE    +KE+   +KE++ K+K
  S:    22 DKIKILEDQIKLLQEEVQKLKQEQASVKE----VKEENESIKEELRKLK 66