>gi|26553574|ref|NP_757508.1| ferric uptake regulation protein [Mycoplasma penetrans HF-2] >gi|26453580|dbj|BAC43912.1| ferric uptake regulation protein [Mycoplasma penetrans HF-2] (144 aa)
Score = 551, Expect = 3.1e-55, Identities = 143/144 (99%), Positives = 144/144 (100%)
  Q:     1 VKRIMANQKLLEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENIKLDIYAKKKK 144
           +KRIMANQKLLEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENIKLDIYAKKKK
  S:     1 MKRIMANQKLLEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENIKLDIYAKKKK 144
>gi|31544575|ref|NP_853153.1| hypothetical protein MGA_1295 [Mycoplasma gallisepticum R] >gi|31541420|gb|AAP56721.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (171 aa)
Score = 120, Expect = 3.3e-05, Identities = 42/113 (37%), Positives = 63/113 (55%)
  Q:    13 KLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGE-KVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNK-----LDKVALPKEIEKAITDFLD 125
           K+ N    RITK R  ILECL D ++ H+I+DII H+  K + K NVSSVYN +   I+  +++         + Y  I K ++H H+Y + N K     L  + +PK I   +  + D
  S:    13 KILNKNKYRITKPRRLILECLLDDFNYHSIEDIIQHIYKKTKNKPNVSSVYNCLQTFIQLNLVDSFLNTSCDLKRYYTI-KHEVHEHIYFINNQKELKQNLSTIIIPKTINDQLKAYFD 130
>gi|87303500|ref|ZP_01086283.1| putative ferric uptake regulator, FUR family protein [Synechococcus sp. WH 5701] >gi|87281913|gb|EAQ73876.1| putative ferric uptake regulator, FUR family protein [Synechococcus sp. WH 5701] (176 aa)
Score = 113, Expect = 1.7e-04, Identities = 31/124 (25%), Positives = 63/124 (50%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLD--KVALPKEIEKAITDFLDSKNLTYENIKLDIYAKKK 143
           +R+++ R  +LE L       + +DI + LN++G  +  +SVY  +  L   G+IE ++    +   Y    + D H HL  + + +++   V LP+E+ + I D       + E+  L +Y +++
  S:    57 MRLSRQRRMVLELLWSDRRHLSARDIFERLNAQGRNIGHTSVYQNLEALQSAGVIECLDRASGRLYGY----RSDPHSHLTCLQSGEIEDLDVVLPEELVQQIEDL---TGYSIESYTLQLYGRRR 175
>gi|110004030|emb|CAK98370.1| putative ferric uptake regulation transcription regulator protein [Spiroplasma citri] (161 aa)
Score = 107, Expect = 9.5e-04, Identities = 32/85 (37%), Positives = 52/85 (61%)
  Q:    13 KLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHI 97
           +L  +KN RIT+IR+ I++ L++  H  T+ +I+  L  + + VN+ SVYNTI+ LI E I+   N+ D K+  Y+L      H+
  S:    10 QLLKSKNYRITEIRLAIIKILSEKQH-LTLTEIVTLLEKEFKNVNLMSVYNTIDLLISEHIV-FTNSFDGKQIWYDLAENPSFHM 92
>gi|158339424|ref|YP_001520601.1| ferric uptake regulation protein [Acaryochloris marina MBIC11017] >gi|158309665|gb|ABW31282.1| ferric uptake regulation protein [Acaryochloris marina MBIC11017] (154 aa)
Score = 101, Expect = 4.2e-03, Identities = 35/123 (28%), Positives = 64/123 (52%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLD-KVALPKEIEKAITDFLDSKNLTYENIKLDIYAKK 142
           +R+++ R +ILE L       + + I D LN  G+++  +SVY  +  L ++GIIE V   D +   Y  ++    HI+  D T+  +D +V LP E+   I    +   +T  + ++D +A +
  S:    31 MRLSRQRRSILELLWLAEEHLSARQIYDRLNQAGKEIGHTSVYQNLEALSQQGIIECVERSDGR--LYGNLSHSHSHINCLD-TDQIIDIQVELPPEL---IAQIEEQAGVTISDYRVDFFAYR 148
>gi|77165885|ref|YP_344410.1| ferric-uptake regulator [Nitrosococcus oceani ATCC 19707] >gi|76884199|gb|ABA58880.1| Ferric-uptake regulator [Nitrosococcus oceani ATCC 19707] (163 aa)
Score = 101, Expect = 5.1e-03, Identities = 21/71 (29%), Positives = 41/71 (57%)
  Q:    12 EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           EK   ++ +R+TK+R  +LE + D +      DI++ L  + +     +VY  ++FL++ G+I  V TL++
  S:    29 EKTCASRGLRLTKLRRRVLELIWDRHEPAKAYDILEQLRQEHQAAAPPTVYRALDFLLQTGLIHRVETLNA 99
>gi|12045091|ref|NP_072902.1| hypothetical protein MG_236 [Mycoplasma genitalium G37] >gi|66880114|ref|ZP_00405099.1| COG0735: Fe2+/Zn2+ uptake regulation proteins [Mycoplasma genitalium G-37] >gi|1351520|sp|P47478|Y236_MYCGE Uncharacterized protein MG236 >gi|3844840|gb|AAC71457.1| expressed protein of unknown function [Mycoplasma genitalium G37] >gi|166078867|gb|ABY79485.1| expressed protein of unknown function [synthetic Mycoplasma genitalium JCVI-1.0] (140 aa)
Score = 101, Expect = 5.1e-03, Identities = 33/118 (27%), Positives = 58/118 (49%)
  Q:    13 KLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLT 130
           K+    N+R+TK RI +L+CL +    H +  I  HL+   +   ++S+YN +  L +  +I I    +  E  Y L + E  HI+L+D    +   + L    +  I   L+++N T
  S:     7 KVLEQNNLRLTKPRIALLKCLIEHQDWHNLSQIKTHLDLANQPSTLASIYNNLRILAKLKLINIFVDPERFETYYCLRHAEHNHIYLFDEVKQQFFTLPL---TDGQIKTLLETQNHT 121
>gi|144899549|emb|CAM76413.1| Ferric-uptake regulator [Magnetospirillum gryphiswaldense MSR-1] (139 aa)
Score = 100, Expect = 6.6e-03, Identities = 27/97 (27%), Positives = 47/97 (48%)
  Q:    20 VRITKIRINILECLNDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEI 116
           +R T  RI IL  +  G H H T +     L  +G + ++++VYNT+N   E  ++  V   D   + Y   N  + H H YD    +++ +  P+ +
  S:    18 IRPTTPRITILRAIEQGGHRHLTPESFHQELADQGHEFSLATVYNTLNHFAEADLLRRVGCGD---RHYFCTNTREHH-HFYDARTGRIEDIPDPQPV 111
>gi|186685107|ref|YP_001868303.1| ferric uptake regulator family protein [Nostoc punctiforme PCC 73102] >gi|186467559|gb|ACC83360.1| ferric uptake regulator, Fur family [Nostoc punctiforme PCC 73102] (148 aa)
Score = 100, Expect = 6.9e-03, Identities = 33/103 (32%), Positives = 56/103 (54%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLD-KVALPKEIEKAITD 122
           +R+++ R  ILE L       + ++I D LN +G+++  +SVY  +  L  +GIIE +   D +   Y  I+    HI+  D TN  LD  V LP+++ + I +
  S:    26 MRVSRQRRFILELLWQANEHLSAREIYDRLNQEGKEIGHTSVYQNLEALSSQGIIECIERCDGR--LYGNISDSHSHINCMD-TNQILDVHVELPEDLLRKIEE 126
>gi|148242108|ref|YP_001227265.1| ferric uptake regulator family protein [Synechococcus sp. RCC307] >gi|147850418|emb|CAK27912.1| Ferric uptake regulator family protein [Synechococcus sp. RCC307] (145 aa)
Score = 99, Expect = 7.3e-03, Identities = 29/108 (26%), Positives = 55/108 (50%)
  Q:    13 KLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLD--KVALPKEIEKAI 120
           +L   + +R+++ R  +LE L       + +DI D LN+ G ++  +SVY  +  L   G+IE +     K Q     ++ D H HL  + + ++    + LP ++ +AI
  S:    19 RLCRQQGLRLSRQRRLVLEILWRSGEHLSARDIFDRLNADGRRIGHTSVYQNLESLHSNGVIECL----EKAQGRLYGHRADPHSHLTCLESGRISDLDIELPADLVEAI 124
>gi|116074755|ref|ZP_01472016.1| putative ferric uptake regulator, FUR family protein [Synechococcus sp. RS9916] >gi|116067977|gb|EAU73730.1| putative ferric uptake regulator, FUR family protein [Synechococcus sp. RS9916] (152 aa)
Score = 98, Expect = 9.3e-03, Identities = 26/103 (25%), Positives = 55/103 (53%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLD--KVALPKEIEKAITD 122
           +R+++ R  +L+ L       + +DI + LN++G ++  +SVY  +  L   G+IE ++  + +   Y    + D H HL  + + +++   V LP ++ K I +
  S:    32 MRLSRQRRMVLDLLWSEASHMSARDIFEKLNARGRRIGHTSVYQNLEALQSAGVIECLDRANGRLYGY----RSDPHSHLTCLDSGEIEDIDVELPAQLLKQIEE 132
>gi|73539870|ref|YP_294390.1| putative transcription regulator protein [Ralstonia eutropha JMP134] >gi|72117283|gb|AAZ59546.1| putative transcription regulator protein [Ralstonia eutropha JMP134] (172 aa)
Score = 98, Expect = 1.1e-02, Identities = 32/110 (29%), Positives = 56/110 (50%)
  Q:     6 ANQKLLEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIE--------IVNTLDSKEQAYELINKEDLHIHLYDVTNN-KLDKVALPKE 115
           A Q+ L +L      R+T+ R+ IL CL       T + +ID L  +GE ++  +VY  +++L+E+G+ +           +L   E A   ++++  H H         LD V LP +
  S:    20 AAQERLRRLG----ARVTQPRLCILACLIGSNEPLTHQAVIDRLPGQGEAIDRVTVYRVLDWLVEQGVAQKRAGNDRVFRFSLVEHEAARAEVHRQHSHFHCTRCDRTFCLDDVGLPAQ 134
>gi|196255940|ref|ZP_03154478.1| ferric uptake regulator, Fur family [Cyanothece sp. PCC 7822] >gi|196203120|gb|EDX97937.1| ferric uptake regulator, Fur family [Cyanothece sp. PCC 7822] (150 aa)
Score = 98, Expect = 1.1e-02, Identities = 33/101 (32%), Positives = 54/101 (53%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLD-KVALPKEIEKAI 120
           +R+++ R  ILE L       + ++I D LN +G+ +  +SVY  +  L  +GIIE V   D +   Y  I+    HI+  D TN  +D  + LP+++ K I
  S:    26 MRVSRQRRFILELLWQAQEHLSAREIYDRLNQQGKNIGHTSVYQNLEALSSQGIIECVERCDGR--LYGNISDSHSHINCID-TNQIIDLHITLPEDLLKQI 124
>gi|22297569|ref|NP_680816.1| FUR family transcriptional regulator [Thermosynechococcus elongatus BP-1] >gi|22293746|dbj|BAC07578.1| transcription regulator Fur family [Thermosynechococcus elongatus BP-1] (153 aa)
Score = 97, Expect = 1.3e-02, Identities = 35/121 (28%), Positives = 53/121 (43%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENIKLDIYA 140
           +R+++ R  ILE L D     + + I D LN  G+ +  +SVY  +  L E GIIE V   D +   Y  I+    H++  D        V LP  +   I      K + Y   ++D Y 
  S:    28 LRLSRQRRAILELLWDAKDHLSARQIYDRLNQAGKDIGHTSVYQNLEALSEHGIIECVERADGR--LYGNISDSHSHVNCLDTQKIIDVHVELPPSLVAEIEAKTGVKIVDY---RIDFYG 143
>gi|119510027|ref|ZP_01629168.1| ferric uptake regulator [Nodularia spumigena CCY9414] >gi|119465351|gb|EAW46247.1| ferric uptake regulator [Nodularia spumigena CCY9414] (149 aa)
Score = 97, Expect = 1.3e-02, Identities = 30/101 (29%), Positives = 56/101 (55%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLD-KVALPKEIEKAI 120
           +R+++ R  ILE L       + ++I D L+ +G+++  +SVY  ++ L  +GIIE +   D +   Y  I+    H++  D TN  LD  + LP+E+ + +
  S:    26 MRVSRQRRFILELLWQANEHLSAREIYDRLSQQGKEIGNTSVYQNLDALSNQGIIECIERCDGR--LYGNISDSHSHVNCID-TNQLLDVHIELPEELIRQV 124
>gi|42561217|ref|NP_975668.1| ferric uptake regulator [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|167925177|ref|ZP_02512268.1| Ferric uptake regulator [Mycoplasma mycoides subsp. mycoides LC str. GM12] >gi|42492715|emb|CAE77310.1| Ferric uptake regulator [Mycoplasma mycoides subsp. mycoides SC str. PG1] (154 aa)
Score = 97, Expect = 1.5e-02, Identities = 34/94 (36%), Positives = 59/94 (62%)
  Q:     8 QKLLEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYD 101
           ++++EKL   K +R+T IR  +++ L    H  TI+ II++L S+   +NV SVYNTI+ L++E I+   NT + K+ +YE+   + +H+   D
  S:    13 KQIVEKLKLKK-IRLTDIRSIVIKMLIVSDH-LTIQQIINNLESEINNINVMSVYNTIDLLLKEHIV-FANTFNGKDISYEIAADKSVHLKCDD 103
>gi|196241668|ref|ZP_03140429.1| ferric uptake regulator, Fur family [Cyanothece sp. PCC 7425] >gi|196214161|gb|EDY08819.1| ferric uptake regulator, Fur family [Cyanothece sp. PCC 7425] (152 aa)
Score = 96, Expect = 1.6e-02, Identities = 34/123 (27%), Positives = 59/123 (47%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLD-KVALPKEIEKAITDFLDSKNLTYENIKLDIYAKK 142
           +R+++ R  ILE L       + + I D LN +G+ +  +SVY  +  L  +GIIE V   D +   Y  ++    H++  D T   LD +V LP E+   +T       +   + ++D Y  +
  S:    31 MRLSRQRRAILELLWQAQEHLSARQIYDRLNQQGKDIGHTSVYQNLEALSAQGIIECVERSDGR--LYGNVSDSHSHVNCLD-TQQILDIQVELPPEL---LTQVEQQTGVKITDYRIDFYGYR 148
>gi|186901415|ref|ZP_02974367.1| ferric uptake regulator, Fur family [Cyanothece sp. PCC 7424] >gi|186691578|gb|EDU16202.1| ferric uptake regulator, Fur family [Cyanothece sp. PCC 7424] (151 aa)
Score = 96, Expect = 1.9e-02, Identities = 39/137 (28%), Positives = 64/137 (46%)
  Q:     6 ANQKLLEKLNNNKN------VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENIKLDIYAKK 142
           AN K +  L +  N      +R+++ R  ILE L       + ++I D LN +G+ +  +SVY  +  L  +GIIE V   D +   Y  I+    H++  D        + LP+++ K I      K   Y   ++D Y  K
  S:     5 ANYKPIRSLEDALNRCQDLGMRVSRQRKFILELLWQAQEHLSAREIYDRLNQQGKNIGHTSVYQNLEALSSQGIIECVERCDGR--LYGNISDSHSHVNCLDTEQIIDVHITLPEDLLKQIETQTGVKITDY---RIDFYGYK 142
>gi|167627152|ref|YP_001677652.1| ferric uptake regulation protein [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167597153|gb|ABZ87151.1| ferric uptake regulation protein [Francisella philomiragia subsp. philomiragia ATCC 25017] (139 aa)
Score = 96, Expect = 1.9e-02, Identities = 38/123 (30%), Positives = 62/123 (50%)
  Q:    21 RITKIRINILECLNDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENIKLDIYAKKK 143
           +IT+ R+ IL+   +    H +  D+   L S+G    +++VY  +N     GII  +  LDS +  YEL N+ D H H+  V+ NK+ +    +EIE      ++S      +  L+IY K K
  S:    14 KITQPRVEILKLFEENKDRHLSPDDVFSKLKSQGSSTGIATVYRVLNQFESAGIISRLK-LDSDQVMYEL-NQGDHHDHIICVSCNKIQEF-YSEEIEAMQKKIVESLGAEMVDHSLNIYIKCK 134
>gi|86136011|ref|ZP_01054590.1| transcriptional regulator, Fur family protein [Roseobacter sp. MED193] >gi|85826885|gb|EAQ47081.1| transcriptional regulator, Fur family protein [Roseobacter sp. MED193] (143 aa)
Score = 96, Expect = 2.0e-02, Identities = 29/88 (32%), Positives = 48/88 (54%)
  Q:    20 VRITKIRINILECL-NDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKL 107
           +R T+ R+ + E L  DG H H T + + D   +KG  V++++VYNT+    E G+++ +    SK  +Y   N  D H H Y    N++
  S:    23 LRPTRQRLALAELLVGDGKHRHVTAESLFDAAKTKGAAVSLATVYNTLRAFCEAGVLQEITVDGSK--SYFDTNTHD-HPHYYWEDGNRV 109
>gi|196188891|gb|EDX83855.1| transcriptional regulator, Fur family [Synechococcus sp. PCC 7335] (119 aa)
Score = 95, Expect = 2.2e-02, Identities = 31/97 (31%), Positives = 51/97 (52%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEI 116
           +R+++ R  ILE L +  +  + ++I D LN +G ++  +SVY  +  L E+GIIE V    S+ + Y   N    H++  D        V LP+EI
  S:     1 MRLSRQRRYILELLWEDKNHLSAREIYDRLNQQGREIGHTSVYQNLEALSEKGIIECVER--SEGRLYGHSNSSHSHVNCIDTQRIIDINVELPEEI 95
>gi|149914126|ref|ZP_01902657.1| transcriptional regulator, Fur family protein [Roseobacter sp. AzwK-3b] >gi|149811645|gb|EDM71478.1| transcriptional regulator, Fur family protein [Roseobacter sp. AzwK-3b] (139 aa)
Score = 95, Expect = 2.2e-02, Identities = 32/103 (31%), Positives = 56/103 (54%)
  Q:    17 NKNVRITKIRINILECL-NDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLY--------DVTNNKLDKVALPKEIEKA 119
           +  +R T+ R+ +   L  DG+H H T + +      +GE+V++++VYNT+    + G+I+ V    SK  +Y   N  D H H +        D  +++L    LP+  E A
  S:    15 DAGLRPTRQRMALATMLVGDGHHRHVTAESLFAEAQKRGERVSLATVYNTLRAFCDAGLIQEVTVDGSK--SYFDTNTHD-HPHFFWEDENRLTDAPSDQLQIAQLPQAPEGA 124
>gi|87124363|ref|ZP_01080212.1| putative ferric uptake regulator, FUR family protein [Synechococcus sp. RS9917] >gi|86167935|gb|EAQ69193.1| putative ferric uptake regulator, FUR family protein [Synechococcus sp. RS9917] (154 aa)
Score = 94, Expect = 2.9e-02, Identities = 24/103 (23%), Positives = 56/103 (54%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLD--KVALPKEIEKAITD 122
           +R+++ R  +L+ L       + +DI + LN++G  +  +SVY  +  L   G+IE ++  + +   Y    + D H HL  + + +++   + LP+++ ++I +
  S:    32 MRLSRQRRMVLDLLWSEASHLSARDIFEKLNARGRHIGHTSVYQNLEALQSAGVIECLDRANGRLYGY----RSDPHSHLTCLESGQIEDLDIELPEDLLRSIEE 132
>gi|113954654|ref|YP_730926.1| transcriptional regulator, Fur family protein [Synechococcus sp. CC9311] >gi|113882005|gb|ABI46963.1| transcriptional regulator, Fur family protein [Synechococcus sp. CC9311] (143 aa)
Score = 94, Expect = 3.3e-02, Identities = 26/103 (25%), Positives = 53/103 (51%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLD--KVALPKEIEKAITD 122
           +R+++ R  +L+ L       + +DI + LN +G ++  +SVY  +  L   G+IE ++    +   Y    + D H HL  + + +++   V LP E+ + I +
  S:    20 MRLSQQRRMVLDLLWTEASHLSARDIFEKLNDQGRRIGHTSVYQNLEALQRAGVIECLDRASGRLYGY----RSDPHSHLTCLESGRIEDLDVQLPDELLREIEE 120
>gi|56709226|ref|YP_165272.1| FUR family transcriptional regulator [Silicibacter pomeroyi DSS-3] >gi|56680911|gb|AAV97576.1| transcriptional regulator, Fur family [Silicibacter pomeroyi DSS-3] (139 aa)
Score = 94, Expect = 3.4e-02, Identities = 27/84 (32%), Positives = 46/84 (54%)
  Q:    17 NKNVRITKIRINILECL-NDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLY 100
           +  +R T+ R+ + E L  DG H H T + + D   SKG  V++++VYNT+    + G+++ +    SK  +Y   N  D H H +
  S:    15 DAGLRPTRQRVALAELLVGDGRHRHVTAESLFDAARSKGAAVSLATVYNTLRAFCDAGVLQEITVDGSK--SYFDTNTHD-HPHFF 97
>gi|56752299|ref|YP_173000.1| transcription regulator [Synechococcus elongatus PCC 6301] >gi|81300612|ref|YP_400820.1| ferric uptake regulator family protein [Synechococcus elongatus PCC 7942] >gi|56687258|dbj|BAD80480.1| transcription regulator [Synechococcus elongatus PCC 6301] >gi|81169493|gb|ABB57833.1| putative ferric uptake regulator, FUR family [Synechococcus elongatus PCC 7942] (143 aa)
Score = 94, Expect = 3.4e-02, Identities = 31/100 (31%), Positives = 54/100 (54%)
  Q:    17 NKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLD-KVALPKEI 116
           +K +R+++ R  ILE L D     + ++I D L+  G  +  +SVY  +  L   GI+E ++   S+ + Y  I+    HI+  D +N  +D +V LP E+
  S:    22 DKGMRVSRQRRYILELLWDVQEHLSAREIYDRLSRAGRDIGHTSVYQNLEALAANGIVECLDR--SEGRLYGNISDSHSHINCLD-SNQIIDVQVQLPAEL 119
>gi|146309916|ref|YP_001174990.1| zinc uptake transcriptional repressor [Enterobacter sp. 638] >gi|145316792|gb|ABP58939.1| zinc uptake regulator, Fur family [Enterobacter sp. 638] (186 aa)
Score = 93, Expect = 3.7e-02, Identities = 23/75 (30%), Positives = 43/75 (57%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EKL   +NVR+T  R+ +L  ++   +  +  D++D L     +    +VY  ++FL+E+G +  V + +S
  S:    22 QELLVQAEKLCAQRNVRLTPQRLEVLRLMSLQQNAISAYDLLDLLRVNEPQAKPPTVYRALDFLLEQGFVHKVESTNS 99
>gi|163739037|ref|ZP_02146450.1| transcriptional regulator, Fur family protein [Phaeobacter gallaeciensis BS107] >gi|163741722|ref|ZP_02149112.1| transcriptional regulator, Fur family protein [Phaeobacter gallaeciensis 2.10] >gi|161384895|gb|EDQ09274.1| transcriptional regulator, Fur family protein [Phaeobacter gallaeciensis 2.10] >gi|161387842|gb|EDQ12198.1| transcriptional regulator, Fur family protein [Phaeobacter gallaeciensis BS107] (138 aa)
Score = 93, Expect = 3.9e-02, Identities = 27/81 (33%), Positives = 44/81 (54%)
  Q:    20 VRITKIRINILECL-NDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLY 100
           +R T+ R+ + E L  DG H H T + + D    KG  V++++VYNT+    + G+++ +    SK  +Y   N  D H H Y
  S:    18 LRPTRQRVALAELLVGDGKHRHVTAESLFDAAKDKGAAVSLATVYNTLRAFCDAGVLQEITVDGSK--SYFDTNTHD-HPHFY 97
>gi|113866227|ref|YP_724716.1| FUR family transcriptional regulator [Ralstonia eutropha H16] >gi|113525003|emb|CAJ91348.1| transcriptional regulator, Fur-family [Ralstonia eutropha H16] (178 aa)
Score = 93, Expect = 4.2e-02, Identities = 18/55 (32%), Positives = 33/55 (60%)
  Q:    21 RITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIE 75
           R+T+ R+ IL CL       T + +ID L   GE ++  +VY  +++L+E+G+ +
  S:    36 RVTQPRLCILACLIGSEEALTHQAVIDRLPEPGETIDRVTVYRVLDWLVEQGVAQ 90
>gi|83319836|ref|YP_424612.1| FUR family transcriptional regulator [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283722|gb|ABC01654.1| transcriptional regulator, Fur family, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (155 aa)
Score = 93, Expect = 4.3e-02, Identities = 30/80 (37%), Positives = 52/80 (65%)
  Q:    18 KNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHI 97
           K +R+T IR  +++ L    H  TI++II++L S+   +NV SVYNTI+ L++E I+   NT + K+ +YE+   + +H+
  S:    22 KKIRLTDIRNIVIKMLIISDH-LTIQEIINNLESEINNINVMSVYNTIDLLLKEHIV-FANTFNGKDISYEIAADKSVHL 99
>gi|30019148|ref|NP_830779.1| PadR family transcriptional regulator [Bacillus cereus ATCC 14579] >gi|29894691|gb|AAP07980.1| Transcriptional regulator, PadR family [Bacillus cereus ATCC 14579] (110 aa)
Score = 93, Expect = 4.4e-02, Identities = 27/94 (28%), Positives = 56/94 (59%)
  Q:    14 LNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELIN--KEDLHI------HLYDVTNNKL 107
           +N +KN+ +T+ +  +L  L +  HG+ I   ++ L++   K+   ++Y  +  L+++G+IE V + D + + Y +    KE LH+      H+ +VT + L
  S:     7 MNTDKNLPLTETKYYVLLALLEPAHGYLIMQKVEELSNHQVKIAAGTLYGAVENLLKQGLIESVKSEDKRRKVYVITERGKEVLHLDFMRMQHIIEVTKSLL 108
>gi|86608793|ref|YP_477555.1| FUR family transcriptional regulator [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86557335|gb|ABD02292.1| transcriptional regulator, Fur family [Synechococcus sp. JA-2-3B'a(2-13)] (144 aa)
Score = 93, Expect = 4.4e-02, Identities = 29/98 (29%), Positives = 51/98 (52%)
  Q:    19 NVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNK-LD-KVALPKEI 116
           N+R+++ R  ILE L       + ++I D LN +G+ +  +SVY  +  L    I+E ++  D +       N+   H H+  + +N+ LD  V LP E+
  S:    19 NLRLSRQRRYILELLWQCGEHLSAREIYDRLNQQGKPIGHTSVYQNLEALASHNIVECLDRADGRRYG----NRTHPHSHVNCLDSNRILDVDVELPPEL 114
>gi|85060117|ref|YP_455819.1| zinc uptake transcriptional repressor [Sodalis glossinidius str. 'morsitans'] >gi|84780637|dbj|BAE75414.1| putative regulator [Sodalis glossinidius str. 'morsitans'] (169 aa)
Score = 92, Expect = 5.0e-02, Identities = 19/71 (26%), Positives = 38/71 (53%)
  Q:    12 EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           E+L   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  ++FL+E+G +  V + +S
  S:    14 EELCEQRNVRLTPQRLEVLRLMSQQNGAISAYDLLDLLRQSEPQAKPPTVYRALDFLLEQGFVHRVESTNS 84
>gi|157148060|ref|YP_001455380.1| zinc uptake transcriptional repressor [Citrobacter koseri ATCC BAA-895] >gi|157085265|gb|ABV14943.1| hypothetical protein CKO_03867 [Citrobacter koseri ATCC BAA-895] (171 aa)
Score = 92, Expect = 5.0e-02, Identities = 23/75 (30%), Positives = 42/75 (56%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EKL   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  ++FL+E+G +  V + +S
  S:     7 QELLAQAEKLCAQRNVRLTPQRLEVLRLMSLQEGAISAYDLLDLLRETEPQAKPPTVYRALDFLLEQGFVHKVESTNS 84
>gi|156932317|ref|YP_001436233.1| zinc uptake transcriptional repressor [Enterobacter sakazakii ATCC BAA-894] >gi|156530571|gb|ABU75397.1| hypothetical protein ESA_00092 [Enterobacter sakazakii ATCC BAA-894] (173 aa)
Score = 92, Expect = 5.0e-02, Identities = 20/71 (28%), Positives = 37/71 (52%)
  Q:    12 EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           EKL   +NVR+T  R+ +L  +       +  D++D L     +    +VY  ++FL+E+G +  V + +S
  S:    16 EKLCQQRNVRLTPQRLEVLRLMTIQPGAISAYDLLDLLRESEPQAKPPTVYRALDFLLEQGFVHKVESTNS 86
>gi|159029949|emb|CAO90328.1| unnamed protein product [Microcystis aeruginosa PCC 7806] (146 aa)
Score = 92, Expect = 5.1e-02, Identities = 34/124 (27%), Positives = 58/124 (46%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENIKLDIYAKKK 143
           +R+++ R  ILE L       + ++I D LN +G+ +  +SVY  +  L  +GIIE V   D +   Y  I+    HI+  D        + LP E+ K +     S  +   + ++D Y  K+
  S:    26 MRVSRQRRYILELLWQAQEHLSAREIYDRLNLQGKNIGHTSVYQNLEALSGQGIIESVERWDGR--LYGNISDSHSHINCLDSQEIIDVHIQLPPELIKQVE---ASTGVKITDYRIDFYGYKQ 144
>gi|49183940|ref|YP_027192.1| hypothetical protein BAS0917 [Bacillus anthracis str. Sterne] >gi|52144340|ref|YP_082488.1| PadR family transcriptional regulator [Bacillus cereus E33L] >gi|118476605|ref|YP_893756.1| PadR family transcriptional regulator [Bacillus thuringiensis str. Al Hakam] >gi|49177867|gb|AAT53243.1| conserved hypothetical protein [Bacillus anthracis str. Sterne] >gi|51977809|gb|AAU19359.1| transcriptional regulator, PadR family [Bacillus cereus E33L] >gi|118415830|gb|ABK84249.1| transcriptional regulator, PadR family [Bacillus thuringiensis str. Al Hakam] (108 aa)
Score = 92, Expect = 5.1e-02, Identities = 27/94 (28%), Positives = 56/94 (59%)
  Q:    14 LNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELIN--KEDLHI------HLYDVTNNKL 107
           +N +KN+ +T+    +L  L +  HG+ I   ++ L+++  K+   ++Y  +  L+++G+IE V + D + + Y +    KE LH+      H+ +VT + L
  S:     5 MNRDKNLPLTETTYYVLLALLEPAHGYLIMQKVEELSNQQVKIAAGTLYGAVENLLKQGLIESVKSEDKRRKVYVITERGKEVLHLDFMRMQHIIEVTKSLL 106
>gi|170769549|ref|ZP_02904002.1| zinc uptake regulation protein [Escherichia albertii TW07627] >gi|170121606|gb|EDS90537.1| zinc uptake regulation protein [Escherichia albertii TW07627] (171 aa)
Score = 92, Expect = 5.2e-02, Identities = 23/75 (30%), Positives = 42/75 (56%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EKL   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  ++FL+E+G +  V + +S
  S:     7 QELLAQAEKLCAQRNVRLTPQRLEVLRLMSLQEGAISAYDLLDLLREAEPQAKPPTVYRALDFLLEQGFVHKVESTNS 84
>gi|170749533|ref|YP_001755793.1| ferric uptake regulator family protein [Methylobacterium radiotolerans JCM 2831] >gi|170656055|gb|ACB25110.1| ferric uptake regulator, Fur family [Methylobacterium radiotolerans JCM 2831] (161 aa)
Score = 92, Expect = 5.4e-02, Identities = 18/63 (28%), Positives = 36/63 (57%)
  Q:    12 EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGII 74
           E L   + ++ T +R  +LE + +        DI + L++ G++V   SVY  ++FL+E+G++
  S:    22 EALCRERGLQFTPLRREVLEAVAEAGKAQGAYDIAERLSAPGKRVAPVSVYRALDFLMEQGLV 84
>gi|126736942|ref|ZP_01752677.1| transcriptional regulator, Fur family protein [Roseobacter sp. SK209-2-6] >gi|126721527|gb|EBA18230.1| transcriptional regulator, Fur family protein [Roseobacter sp. SK209-2-6] (143 aa)
Score = 92, Expect = 5.6e-02, Identities = 26/81 (32%), Positives = 45/81 (55%)
  Q:    20 VRITKIRINILECL-NDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLY 100
           +R T+ R+ + E L  DG H H T + + D   +KG  V++++VYNT+    + G+++ +    SK  +Y   N  D H H +
  S:    23 LRPTRQRVALAELLVGDGKHRHVTAESLFDSAKTKGAAVSLATVYNTLRAFCDAGVLQEITVDGSK--SYFDTNTHD-HPHFF 102
>gi|86606924|ref|YP_475687.1| FUR family transcriptional regulator [Synechococcus sp. JA-3-3Ab] >gi|86555466|gb|ABD00424.1| transcriptional regulator, Fur family [Synechococcus sp. JA-3-3Ab] (142 aa)
Score = 92, Expect = 6.0e-02, Identities = 30/98 (30%), Positives = 51/98 (52%)
  Q:    19 NVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNK-LD-KVALPKEI 116
           N+R+++ R  ILE L       + ++I D LN +G+ +  +SVY  +  L    IIE ++  D +       N+   H H+  + +N+ LD  V LP E+
  S:    19 NLRLSRQRRYILELLWQCGEHLSAREIYDRLNRQGKPIGHTSVYQNLEALASHNIIECLDRADGRRYG----NRTHPHSHVNCLDSNRILDVDVELPPEL 114
>gi|161505297|ref|YP_001572409.1| zinc uptake transcriptional repressor [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160866644|gb|ABX23267.1| hypothetical protein SARI_03438 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (171 aa)
Score = 91, Expect = 6.1e-02, Identities = 22/75 (29%), Positives = 42/75 (56%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EKL   +NVR+T  R+ +L  ++      +  D++D L     +    ++Y  ++FL+E+G +  V + +S
  S:     7 QELLAQAEKLCAQRNVRLTPQRLEVLRLMSLQQGAISAYDLLDLLRETEPQAKPPTIYRALDFLLEQGFVHKVESTNS 84
>gi|16767491|ref|NP_463106.1| zinc uptake transcriptional repressor [Salmonella typhimurium LT2] >gi|167552535|ref|ZP_02346288.1| zinc uptake transcriptional repressor [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167991430|ref|ZP_02572529.1| zinc uptake transcriptional repressor [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168466923|ref|ZP_02700771.1| zinc uptake regulation protein [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168476336|ref|ZP_02705359.1| zinc uptake transcriptional repressor [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|194444041|ref|YP_002043492.1| zinc uptake regulation protein [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|16422799|gb|AAL23065.1| transcriptional repressor of znuABC operon [Salmonella typhimurium LT2] >gi|194402704|gb|ACF62926.1| zinc uptake regulation protein [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|195630586|gb|EDX49198.1| zinc uptake regulation protein [Salmonella enterica subsp. enterica serovar Newport str. SL317] (171 aa)
Score = 91, Expect = 6.1e-02, Identities = 22/75 (29%), Positives = 42/75 (56%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EKL   +NVR+T  R+ +L  ++      +  D++D L     +    ++Y  ++FL+E+G +  V + +S
  S:     7 QELLAQAEKLCAQRNVRLTPQRLEVLRLMSLQQGAISAYDLLDLLRETEPQAKPPTIYRALDFLLEQGFVHKVESTNS 84
>gi|16762922|ref|NP_458539.1| zinc uptake transcriptional repressor [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29144409|ref|NP_807751.1| zinc uptake transcriptional repressor [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56416041|ref|YP_153116.1| zinc uptake transcriptional repressor [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62182690|ref|YP_219107.1| zinc uptake transcriptional repressor [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161617369|ref|YP_001591334.1| zinc uptake transcriptional repressor [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167542366|ref|ZP_02337942.1| hypothetical protein Sentent_03753 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167556369|ref|ZP_02349385.1| hypothetical protein Sententeri_05846 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|168219441|ref|ZP_02644673.1| hypothetical protein Senterenterica_03556 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168226384|ref|ZP_02651615.1| hypothetical protein Sententeric_11477 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168231237|ref|ZP_02656295.1| hypothetical protein Sententerica_09677 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168239352|ref|ZP_02664410.1| hypothetical protein Senteenterica_24474 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168243638|ref|ZP_02668570.1| hypothetical protein Senterienterica_18480 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168263438|ref|ZP_02685411.1| hypothetical protein Salmentericaenterica_20360 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168821315|ref|ZP_02833315.1| hypothetical protein Salentericaenterica_18158 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194447772|ref|YP_002048232.1| zinc uptake regulation protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194469118|ref|ZP_03075102.1| zinc uptake regulation protein [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194734694|ref|YP_002117120.1| zinc uptake regulation protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|25357240|pir||AH1015 zinc uptake regulation protein [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16505229|emb|CAD09225.1| zinc uptake regulation protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29140047|gb|AAO71611.1| zinc uptake regulation protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56130298|gb|AAV79804.1| zinc uptake regulation protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62130323|gb|AAX68026.1| transcriptional repressor of znuABC operon (Fur family) [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161366733|gb|ABX70501.1| hypothetical protein SPAB_05224 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194406076|gb|ACF66295.1| zinc uptake regulation protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194455482|gb|EDX44321.1| zinc uptake regulation protein [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194710196|gb|ACF89417.1| zinc uptake regulation protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (171 aa)
Score = 91, Expect = 6.1e-02, Identities = 22/75 (29%), Positives = 42/75 (56%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EKL   +NVR+T  R+ +L  ++      +  D++D L     +    ++Y  ++FL+E+G +  V + +S
  S:     7 QELLAQAEKLCAQRNVRLTPQRLEVLRLMSLQQGAISAYDLLDLLRETEPQAKPPTIYRALDFLLEQGFVHKVESTNS 84
>gi|13508068|ref|NP_110017.1| ferric uptake regulator [Mycoplasma pneumoniae M129] >gi|2496340|sp|P75456|Y329_MYCPN Uncharacterized protein MG236 homolog >gi|1674201|gb|AAB96155.1| ferric uptake regulator [Mycoplasma pneumoniae M129] (158 aa)
Score = 91, Expect = 6.1e-02, Identities = 25/102 (24%), Positives = 53/102 (51%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAIT 121
           +R+T+ R+ +L+CL      HT+ ++  HL    ++  ++S+YN +    +  +I I    +  E  Y L ++   HI+ +D    K   + LP + ++A++
  S:    31 MRLTQSRLMLLQCLVQHRDWHTLAELKHHLEQNQQRTTLASIYNNLKIFAKLKLINIFVDTNRFETYYCLRHENHKHIYFFDENQRKF--LTLPLQDKEALS 130
>gi|30261106|ref|NP_843483.1| hypothetical protein BA0982 [Bacillus anthracis str. Ames] >gi|47526262|ref|YP_017611.1| hypothetical protein GBAA0982 [Bacillus anthracis str. 'Ames Ancestor'] >gi|65318385|ref|ZP_00391344.1| COG1695: Predicted transcriptional regulators [Bacillus anthracis str. A2012] >gi|165871658|ref|ZP_02216303.1| conserved hypothetical protein [Bacillus anthracis str. A0488] >gi|167635514|ref|ZP_02393827.1| conserved hypothetical protein [Bacillus anthracis str. A0442] >gi|167639004|ref|ZP_02397278.1| conserved hypothetical protein [Bacillus anthracis str. A0193] >gi|170687682|ref|ZP_02878898.1| conserved hypothetical protein [Bacillus anthracis str. A0465] >gi|170707978|ref|ZP_02898427.1| conserved hypothetical protein [Bacillus anthracis str. A0389] >gi|177653591|ref|ZP_02935765.1| conserved hypothetical protein [Bacillus anthracis str. A0174] >gi|190566640|ref|ZP_03019557.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I] >gi|196037253|ref|ZP_03104564.1| conserved hypothetical protein [Bacillus cereus NVH0597-99] >gi|196044376|ref|ZP_03111612.1| conserved hypothetical protein [Bacillus cereus 03BB108] >gi|30254720|gb|AAP24969.1| conserved hypothetical protein [Bacillus anthracis str. Ames] >gi|47501410|gb|AAT30086.1| conserved hypothetical protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|164712559|gb|EDR18091.1| conserved hypothetical protein [Bacillus anthracis str. A0488] >gi|167513134|gb|EDR88506.1| conserved hypothetical protein [Bacillus anthracis str. A0193] >gi|167529132|gb|EDR91886.1| conserved hypothetical protein [Bacillus anthracis str. A0442] >gi|170127138|gb|EDS96016.1| conserved hypothetical protein [Bacillus anthracis str. A0389] >gi|170668495|gb|EDT19242.1| conserved hypothetical protein [Bacillus anthracis str. A0465] >gi|172081395|gb|EDT66469.1| conserved hypothetical protein [Bacillus anthracis str. A0174] >gi|190562192|gb|EDV16160.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I] >gi|196025015|gb|EDX63686.1| conserved hypothetical protein [Bacillus cereus 03BB108] >gi|196031495|gb|EDX70091.1| conserved hypothetical protein [Bacillus cereus NVH0597-99] (104 aa)
Score = 91, Expect = 6.4e-02, Identities = 27/94 (28%), Positives = 56/94 (59%)
  Q:    14 LNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELIN--KEDLHI------HLYDVTNNKL 107
           +N +KN+ +T+    +L  L +  HG+ I   ++ L+++  K+   ++Y  +  L+++G+IE V + D + + Y +    KE LH+      H+ +VT + L
  S:     1 MNRDKNLPLTETTYYVLLALLEPAHGYLIMQKVEELSNQQVKIAAGTLYGAVENLLKQGLIESVKSEDKRRKVYVITERGKEVLHLDFMRMQHIIEVTKSLL 102
>gi|17228452|ref|NP_485000.1| ferric uptake regulator [Nostoc sp. PCC 7120] >gi|17130303|dbj|BAB72914.1| ferric uptake regulator [Nostoc sp. PCC 7120] (149 aa)
Score = 91, Expect = 6.6e-02, Identities = 35/104 (33%), Positives = 58/104 (55%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLD-KVALP----KEIEK----AITDF 123
           +R+++ R  ILE L       + ++I D LN +G+ +  +SVY  +  L  +GIIE +   D +   Y  I+    H++  D TN  LD  + LP    +E+E+     ITD+
  S:    26 MRVSRQRRFILELLWQANEHLSAREIYDRLNQQGKDIGHTSVYQNLEALSTQGIIESIERCDGR--LYGNISDSHSHVNCLD-TNQILDVHIQLPEAFIQEVEQRTGVKITDY 135
>gi|75906759|ref|YP_321055.1| ferric uptake regulator family protein [Anabaena variabilis ATCC 29413] >gi|75700484|gb|ABA20160.1| Ferric uptake regulator (FUR) family [Anabaena variabilis ATCC 29413] (149 aa)
Score = 91, Expect = 6.6e-02, Identities = 35/104 (33%), Positives = 58/104 (55%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLD-KVALP----KEIEK----AITDF 123
           +R+++ R  ILE L       + ++I D LN +G+ +  +SVY  +  L  +GIIE +   D +   Y  I+    H++  D TN  LD  + LP    +E+E+     ITD+
  S:    26 MRVSRQRRFILELLWQANEHLSAREIYDRLNQQGKDIGHTSVYQNLEALSTQGIIESIERCDGR--LYGNISDSHSHVNCLD-TNQILDVHIQLPEAFIQEVEQRTGVKITDY 135
>gi|166365566|ref|YP_001657839.1| ferric uptake regulator [Microcystis aeruginosa NIES-843] >gi|166087939|dbj|BAG02647.1| ferric uptake regulator [Microcystis aeruginosa NIES-843] (146 aa)
Score = 91, Expect = 6.9e-02, Identities = 33/124 (26%), Positives = 58/124 (46%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENIKLDIYAKKK 143
           +R+++ R  ILE L       + ++I D LN +G+ +  +SVY  +  L  +GIIE V   D +   Y  I+    H++  D        + LP E+ K +     S  +   + ++D Y  K+
  S:    26 MRVSRQRRYILELLWQAQEHLSAREIYDRLNLQGKNIGHTSVYQNLEALSGQGIIESVERWDGR--LYGNISDSHSHVNCLDSQQIIDVHIELPPELIKQVE---ASTGVKITDYRIDFYGYKQ 144
>gi|121998508|ref|YP_001003295.1| ferric uptake regulator family protein [Halorhodospira halophila SL1] >gi|121589913|gb|ABM62493.1| ferric uptake regulator, Fur family [Halorhodospira halophila SL1] (164 aa)
Score = 91, Expect = 6.9e-02, Identities = 21/71 (29%), Positives = 44/71 (61%)
  Q:    12 EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVS--SVYNTINFLIEEGIIEIVNTLDS 82
           E +   + +R T++R  +LE + D +      +++D L  +GE+   +  +VY T++FL++EG+I  V +L++
  S:    31 EVICRRRGMRFTRLRRRVLELIWDEHRPVKAYELLDRL--RGERAGAAPPTVYRTLDFLLQEGLIHRVESLNA 101
>gi|196176454|gb|EDX71468.1| transcriptional regulator, Fur family [Microcoleus chthonoplastes PCC 7420] (150 aa)
Score = 91, Expect = 7.2e-02, Identities = 35/113 (30%), Positives = 58/113 (51%)
  Q:     8 QKLLEKLNNNK--NVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDK--VALPKEIEKAI 120
           + L E LN  +   +R+++ R  ILE L         ++I D LN +G+++  +SVY  +  L  +GIIE +   D +       N  D H H+  V  N++    V LP+E+ + I
  S:    12 RSLEEALNRCQALGMRLSRQRRLILELLWQDREHLCAREIYDRLNQQGKEIGHTSVYQNLEALSSQGIIECMERSDGRLYG----NISDAHSHVNCVDTNQIMDVYVELPEELIQHI 124
>gi|108800413|ref|YP_640610.1| zinc uptake regulator [Mycobacterium sp. MCS] >gi|119869542|ref|YP_939494.1| zinc uptake regulator [Mycobacterium sp. KMS] >gi|126436036|ref|YP_001071727.1| zinc uptake regulator [Mycobacterium sp. JLS] >gi|108770832|gb|ABG09554.1| zinc uptake regulator, Fur family [Mycobacterium sp. MCS] >gi|119695631|gb|ABL92704.1| zinc uptake regulator, Fur family [Mycobacterium sp. KMS] >gi|126235836|gb|ABN99236.1| zinc uptake regulator, Fur family [Mycobacterium sp. JLS] (131 aa)
Score = 91, Expect = 7.2e-02, Identities = 23/80 (28%), Positives = 44/80 (55%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHL 99
           VR T+ R  I + L+      + +++ D L  +GE + +++VY T+  + E G+++++ T D+ E  Y   +  D H HL
  S:     6 VRATRQRAAIADLLDGLDEFRSAQELHDALKRRGEGIGLTTVYRTLQSMAESGLVDVLRT-DTGESVYRRCSA-DHHHHL 83
>gi|172036866|ref|YP_001803367.1| ferric uptake regulator [Cyanothece sp. ATCC 51142] >gi|171698320|gb|ACB51301.1| probable ferric uptake regulator [Cyanothece sp. ATCC 51142] (151 aa)
Score = 91, Expect = 7.3e-02, Identities = 33/124 (26%), Positives = 56/124 (45%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENIKLDIYAKKK 143
           +RI++ R  ILE L       + ++I + L+  G+ V  +SVY  +  L  +GIIE +   D +   Y  I     H++  D        V LP E+ + I        +T  + ++D Y  K+
  S:    26 MRISRQRRYILELLWKSQEHLSAREIYNRLSQNGKNVGHTSVYQNLEALSSQGIIECLERCDGR--LYGTITDSHSHVNCLDTQQIIDVHVELPSELIQQIE---AQTGVTITDYRIDFYGHKE 144
>gi|172056697|ref|YP_001813157.1| ferric uptake regulator family protein [Exiguobacterium sibiricum 255-15] >gi|171989218|gb|ACB60140.1| ferric uptake regulator, Fur family [Exiguobacterium sibiricum 255-15] (144 aa)
Score = 91, Expect = 7.4e-02, Identities = 27/93 (29%), Positives = 49/93 (52%)
  Q:     5 MANQKLLEKLNN--NKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHI 97
           MAN+ L + + +     VR+T  R  ILE L  G+   T  +I   L  +   ++V++VYN +    E+GI+E +N  D+  + ++ +     H+
  S:     1 MANEMLDDAVRSLRESGVRMTPQRHAILEYLTTGHTHPTADEIYRALEHRFPNMSVATVYNNLRVFREKGIVEEMNYGDASSR-FDFVTTRHYHM 94
>gi|169333840|ref|ZP_02861033.1| hypothetical protein ANASTE_00226 [Anaerofustis stercorihominis DSM 17244] >gi|169259405|gb|EDS73371.1| hypothetical protein ANASTE_00226 [Anaerofustis stercorihominis DSM 17244] (135 aa)
Score = 91, Expect = 7.7e-02, Identities = 25/88 (28%), Positives = 46/88 (52%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKL 107
           ++ T  RI + E + +     + + I DHLNS G K ++++VYN I   +E+G+  I+   D +          D H+H+Y+   N++
  S:    15 LKATPNRIAVYEYMLNSKEHPSAEMIKDHLNSLGNKFSLATVYNIIEAFLEKGV--IIKVRDDENNMMRFDANTDFHVHIYNSETNEI 100
>gi|111018232|ref|YP_701204.1| Fe(3+) uptake regulation protein [Rhodococcus sp. RHA1] >gi|110817762|gb|ABG93046.1| Fe(3+) uptake regulation protein [Rhodococcus sp. RHA1] (141 aa)
Score = 90, Expect = 8.0e-02, Identities = 21/68 (30%), Positives = 38/68 (55%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAY 87
           VR TK R  I   L+D     + +++ D L  +GE + +++VY T+  L + G ++++ T D+ E  Y
  S:    15 VRATKQRSAISALLDDIEEFRSAQELHDELRKRGEGIGLTTVYRTLQTLADAGTVDVLRT-DTGESVY 81
>gi|92114005|ref|YP_573933.1| ferric uptake regulator family protein [Chromohalobacter salexigens DSM 3043] >gi|91797095|gb|ABE59234.1| ferric uptake regulator, Fur family [Chromohalobacter salexigens DSM 3043] (149 aa)
Score = 90, Expect = 8.1e-02, Identities = 19/71 (26%), Positives = 36/71 (50%)
  Q:    12 EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           E+    +  R T IR  +LE +     G    D++D L ++       +VY  + FLIE+G++  + +L++
  S:    12 ERQCQTRGARFTPIRRRVLEMIATAPGGLKAYDLLDRLAAEHASARPPTVYRALEFLIEQGLVHRIESLNA 82
>gi|49479822|ref|YP_035241.1| PadR family transcriptional regulator [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49331378|gb|AAT62024.1| transcriptional regulator, PadR family [Bacillus thuringiensis serovar konkukian str. 97-27] (108 aa)
Score = 90, Expect = 8.5e-02, Identities = 27/94 (28%), Positives = 55/94 (58%)
  Q:    14 LNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELIN--KEDLHI------HLYDVTNNKL 107
           +N +KN+ +T+    +L  L +  HG+ I   ++ L++   K+   ++Y  +  L+++G+IE V + D + + Y +    KE LH+      H+ +VT + L
  S:     5 MNRDKNLPLTETTYYVLLALLEPAHGYLIMQKVEELSNHQVKIAAGTLYGAVENLLKQGLIESVKSEDKRRKVYVITERGKEVLHLDFMRMQHIIEVTKSLL 106
>gi|166983885|ref|ZP_02255267.1| hypothetical protein BcerAH_16330 [Bacillus cereus AH187] >gi|168160738|ref|ZP_02595971.1| hypothetical protein BcerH_11517 [Bacillus cereus H3081.97] (107 aa)
Score = 90, Expect = 8.7e-02, Identities = 21/86 (24%), Positives = 47/86 (54%)
  Q:    14 LNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHL 99
           +N +KN+ +T+    +L  L +  HG+ I   ++ L++   K+   ++Y  +  L+++G+IE V + D + + Y +  +    +HL
  S:     1 MNRDKNLPLTETTYYVLLALLEPAHGYLIMQKVEELSNHQVKIAAGTLYGAVENLLKQGLIESVKSEDKRRKVYVITERGKEVLHL 86
>gi|157372690|ref|YP_001480679.1| zinc uptake transcriptional repressor [Serratia proteamaculans 568] >gi|157324454|gb|ABV43551.1| ferric uptake regulator, Fur family [Serratia proteamaculans 568] (170 aa)
Score = 90, Expect = 9.0e-02, Identities = 23/75 (30%), Positives = 41/75 (54%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           +KLL   E+L   +NVR+T  R+ +L  +       +  D++D L     +    +VY  ++FL+E+G I  V + +S
  S:     7 EKLLAQAEQLCQQRNVRLTPQRLEVLRLMAQQPGAISAYDLLDLLRVAEPQAKPPTVYRALDFLLEQGFIHRVESANS 84
>gi|196184542|gb|EDX79518.1| transcriptional regulator, Fur family [Brevundimonas sp. BAL3] (165 aa)
Score = 90, Expect = 9.2e-02, Identities = 31/130 (23%), Positives = 61/130 (46%)
  Q:    11 LEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENIKLDIYA 140
           +EKL  ++ +R+T+ R  I   L+       ++++    +S    +++++VY T+    E G++E  +  D + +  E    +D H HL D    ++ +     EIEK  T+  D         KL++Y 
  S:     4 IEKLCADRGMRMTEQRRVIARVLSSAEDHPDVEELYRRASSIDPHISIATVYRTVRLFEEAGVVEKHDFGDGRSRYEEA--GDDHHDHLIDTKTGEVIEF-FDAEIEKLKTEIADRLGFELIGHKLELYG 130
>gi|84515217|ref|ZP_01002579.1| transcriptional regulator, Fur family [Loktanella vestfoldensis SKA53] >gi|84510500|gb|EAQ06955.1| transcriptional regulator, Fur family [Loktanella vestfoldensis SKA53] (138 aa)
Score = 90, Expect = 9.4e-02, Identities = 27/81 (33%), Positives = 46/81 (56%)
  Q:    20 VRITKIRINILECL-NDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLY 100
           +R T+ R+ + + L  DG + H T + + D  ++ GEKV++++VYNT+    E G++  +    SK  +Y   N  D H H Y
  S:    18 LRPTRQRLTLADLLVGDGQNRHVTAESLFDAASAAGEKVSLATVYNTLRAFCEAGLMREITVDGSK--SYFDTNMTD-HPHFY 97
>gi|47564945|ref|ZP_00235989.1| transcriptional regulator, PadR family [Bacillus cereus G9241] >gi|47558318|gb|EAL16642.1| transcriptional regulator, PadR family [Bacillus cereus G9241] (104 aa)
Score = 90, Expect = 9.4e-02, Identities = 21/86 (24%), Positives = 47/86 (54%)
  Q:    14 LNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHL 99
           +N +KN+ +T+    +L  L +  HG+ I   ++ L++   K+   ++Y  +  L+++G+IE V + D + + Y +  +    +HL
  S:     1 MNRDKNLPLTETTYYVLLALLEPAHGYLIMQKVEELSNHQVKIAAGTLYGAVENLLKQGLIESVKSEDKRRKVYVITERGKEVLHL 86
>gi|118470711|ref|YP_888759.1| ferric uptake regulation protein [Mycobacterium smegmatis str. MC2 155] >gi|118171998|gb|ABK72894.1| ferric uptake regulation protein [Mycobacterium smegmatis str. MC2 155] (136 aa)
Score = 90, Expect = 1.0e-01, Identities = 23/80 (28%), Positives = 43/80 (53%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHL 99
           VR T+ R  I + LN+     + +++ D L  +GE + +++VY T+  +   G+++ + T D+ E  Y   + E  H HL
  S:     5 VRSTRQRAAIADLLNETEGFRSAQELHDELRRRGEGIGLTTVYRTLQAMATAGVVDTLRT-DTGESVYRRCS-EHHHHHL 82
>gi|158426203|ref|YP_001527495.1| putative Fe2+/Zn2+ uptake regulation protein [Azorhizobium caulinodans ORS 571] >gi|158333092|dbj|BAF90577.1| putative Fe2+/Zn2+ uptake regulation protein [Azorhizobium caulinodans ORS 571] (227 aa)
Score = 89, Expect = 1.1e-01, Identities = 17/63 (26%), Positives = 38/63 (60%)
  Q:    11 LEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGI 73
           +EK+  +K +R+T +R  +++ L + +      +I++ L  +G++    SVY  ++FL+ EG+
  S:    90 VEKICADKGLRLTPLRRGVMQVLAESHAPLGAYEIVERLGPEGDRPPPMSVYRVLDFLVSEGL 152
>gi|168141502|ref|ZP_02584731.1| hypothetical protein BcerG_13896 [Bacillus cereus G9842] (104 aa)
Score = 89, Expect = 1.1e-01, Identities = 21/86 (24%), Positives = 47/86 (54%)
  Q:    14 LNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHL 99
           +N +KN+ +T+    +L  L +  HG+ I   ++ L++   K+   ++Y  +  L+++G+IE V + D + + Y +  +    +HL
  S:     1 MNRDKNLPLTETTYYVLLALLEPAHGYLIMQKVEELSNHQVKIAAGTLYGAVENLLKQGLIESVKSEDKRRKVYVITERGKEVLHL 86
>gi|196035221|ref|ZP_03102627.1| conserved hypothetical protein [Bacillus cereus W] >gi|195992285|gb|EDX56247.1| conserved hypothetical protein [Bacillus cereus W] (104 aa)
Score = 89, Expect = 1.1e-01, Identities = 27/94 (28%), Positives = 55/94 (58%)
  Q:    14 LNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELIN--KEDLHI------HLYDVTNNKL 107
           +N +KN+ +T+    +L  L +  HG+ I   ++ L++   K+   ++Y  +  L+++G+IE V + D + + Y +    KE LH+      H+ +VT + L
  S:     1 MNRDKNLPLTETTYYVLLALLEPAHGYLIMQKVEELSNHQVKIAAGTLYGAVENLLKQGLIESVKSEDKRRKVYVITERGKEVLHLDFMRMQHIIEVTKSLL 102
>gi|152972910|ref|YP_001338056.1| zinc uptake transcriptional repressor [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150957759|gb|ABR79789.1| transcriptional repressor of Zn transport system [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (173 aa)
Score = 89, Expect = 1.1e-01, Identities = 20/71 (28%), Positives = 37/71 (52%)
  Q:    12 EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           EKL   + VR+T  R+ +L  ++      +  D++D L  K  +    +VY  + FL+E+G +  V + +S
  S:    16 EKLCAQRGVRLTPQRLEVLRLMSLQQGAISAYDLLDLLREKEPQAKPPTVYRALEFLLEQGFVHKVESTNS 86
>gi|77978795|ref|ZP_00834220.1| COG0735: Fe2+/Zn2+ uptake regulation proteins [Yersinia intermedia ATCC 29909] (172 aa)
Score = 89, Expect = 1.1e-01, Identities = 23/75 (30%), Positives = 41/75 (54%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           +KLL   E+L   +NVR+T  R+ +L  +       +  D++D L     +    +VY  ++FL+E+G I  V + +S
  S:    10 EKLLAQAEELCQQRNVRLTPQRLEVLRLMAQQPGAISAYDLLDLLRVSEPQAKPPTVYRALDFLLEQGFIHRVESANS 87
>gi|120556680|ref|YP_961031.1| ferric uptake regulator family protein [Marinobacter aquaeolei VT8] >gi|120326529|gb|ABM20844.1| ferric uptake regulator, Fur family [Marinobacter aquaeolei VT8] (163 aa)
Score = 89, Expect = 1.2e-01, Identities = 18/66 (27%), Positives = 37/66 (56%)
  Q:    17 NKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           ++N R+T IR  +LE +   +      DI+  L+S G      +VY  ++FL++ G++  + +L++
  S:    30 DENARLTPIRERVLELIWQSHKPLGAYDILAKLSSDGHNAAPPTVYRALDFLLQHGLVHRIASLNA 95
>gi|42780149|ref|NP_977396.1| hypothetical protein BCE_1073 [Bacillus cereus ATCC 10987] >gi|42736067|gb|AAS40004.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] (104 aa)
Score = 89, Expect = 1.2e-01, Identities = 21/86 (24%), Positives = 47/86 (54%)
  Q:    14 LNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHL 99
           +N +KN+ +T+    +L  L +  HG+ I   ++ L++   K+   ++Y  +  L+++G+IE V + D + + Y +  +    +HL
  S:     1 MNRDKNLPLTETTYYVLLALLEPAHGYLIMQKVEELSNHQVKIAAGTLYGAVENLLKQGLIESVKSEDKRRKVYVITERGKEVLHL 86
>gi|118602717|ref|YP_903932.1| ferric uptake regulator family protein [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567656|gb|ABL02461.1| ferric uptake regulator, Fur family [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (135 aa)
Score = 89, Expect = 1.2e-01, Identities = 30/92 (32%), Positives = 51/92 (55%)
  Q:    20 VRITKIRINILECLNDGYHGHT-IKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVA 111
           +++T  R+ ILE L    + H  ++DI   L  +GE+V V+++Y  +    E G++  +N  D+ +  +EL N  D H HL  V   K+D+ A
  S:    11 LKVTLPRLKILEILETSENHHMGVEDIYRTLIMQGEEVGVATIYRVLTQFEEAGMVNKLN-FDNGKSVFELSNV-DHHDHLVCVKCGKIDEFA 101
>gi|145600903|ref|YP_001164979.1| zinc uptake transcriptional repressor [Yersinia pestis Pestoides F] >gi|153947273|ref|YP_001402723.1| zinc uptake transcriptional repressor [Yersinia pseudotuberculosis IP 31758] >gi|170026072|ref|YP_001722577.1| ferric uptake regulator family protein [Yersinia pseudotuberculosis YPIII] >gi|186893728|ref|YP_001870840.1| ferric uptake regulator family protein [Yersinia pseudotuberculosis PB1/+] >gi|108777162|gb|ABG19681.1| zinc uptake regulator, Fur family [Yersinia pestis Nepal516] >gi|108781872|gb|ABG15930.1| zinc uptake regulator, Fur family [Yersinia pestis Antiqua] >gi|145212599|gb|ABP42006.1| zinc uptake regulator, Fur family [Yersinia pestis Pestoides F] >gi|152958768|gb|ABS46229.1| zinc uptake regulation protein [Yersinia pseudotuberculosis IP 31758] >gi|169752606|gb|ACA70124.1| ferric uptake regulator, Fur family [Yersinia pseudotuberculosis YPIII] >gi|186696754|gb|ACC87383.1| ferric uptake regulator, Fur family [Yersinia pseudotuberculosis PB1/+] (170 aa)
Score = 89, Expect = 1.3e-01, Identities = 23/75 (30%), Positives = 40/75 (53%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           +KLL   E L   +NVR+T  R+ +L  +       +  D++D L     +    +VY  ++FL+E+G I  V + +S
  S:     8 EKLLAQAESLCQQRNVRLTPQRLEVLRLMAQQPGAISAYDLLDLLRVAEPQAKPPTVYRALDFLLEQGFIHRVESANS 85
>gi|16120653|ref|NP_403966.1| zinc uptake transcriptional repressor [Yersinia pestis CO92] >gi|51594725|ref|YP_068916.1| zinc uptake transcriptional repressor [Yersinia pseudotuberculosis IP 32953] >gi|150260638|ref|ZP_01917366.1| putative regulatory protein [Yersinia pestis CA88-4125] >gi|161484885|ref|NP_667910.2| zinc uptake transcriptional repressor [Yersinia pestis KIM] >gi|161511449|ref|NP_991864.2| zinc uptake transcriptional repressor [Yersinia pestis biovar Microtus str. 91001] >gi|162100149|ref|YP_653875.2| zinc uptake transcriptional repressor [Yersinia pestis Antiqua] >gi|162139424|ref|YP_649281.2| zinc uptake transcriptional repressor [Yersinia pestis Nepal516] >gi|167467146|ref|ZP_02331850.1| zinc uptake regulation protein [Yersinia pestis FV-1] >gi|51588007|emb|CAH19611.1| putative regulatory protein [Yersinia pseudotuberculosis IP 32953] >gi|115346132|emb|CAL19000.1| putative regulatory protein [Yersinia pestis CO92] >gi|149290046|gb|EDM40123.1| putative regulatory protein [Yersinia pestis CA88-4125] (169 aa)
Score = 89, Expect = 1.3e-01, Identities = 23/75 (30%), Positives = 40/75 (53%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           +KLL   E L   +NVR+T  R+ +L  +       +  D++D L     +    +VY  ++FL+E+G I  V + +S
  S:     7 EKLLAQAESLCQQRNVRLTPQRLEVLRLMAQQPGAISAYDLLDLLRVAEPQAKPPTVYRALDFLLEQGFIHRVESANS 84
>gi|409798|gb|AAC43140.1| ORF_f191 [Escherichia coli] (191 aa)
Score = 88, Expect = 1.3e-01, Identities = 22/75 (29%), Positives = 42/75 (56%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EK+   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  ++FL+E+G +  V + +S
  S:    27 QELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREXEPQAKPPTVYRALDFLLEQGFVHKVESTNS 104
>gi|123444031|ref|YP_001008001.1| zinc uptake transcriptional repressor [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122090992|emb|CAL13875.1| putative regulatory protein [Yersinia enterocolitica subsp. enterocolitica 8081] (169 aa)
Score = 88, Expect = 1.3e-01, Identities = 23/75 (30%), Positives = 40/75 (53%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           +KLL   E L   +NVR+T  R+ +L  +       +  D++D L     +    +VY  ++FL+E+G I  V + +S
  S:     7 EKLLAQAESLCQQRNVRLTPQRLEVLRLMAQQPGAISAYDLLDLLRVSEPQAKPPTVYRALDFLLEQGFIHRVESANS 84
>gi|161949981|ref|YP_405893.2| zinc uptake transcriptional repressor [Shigella dysenteriae Sd197] >gi|170683816|ref|YP_001746436.1| zinc uptake regulation protein [Escherichia coli SMS-3-5] >gi|170521534|gb|ACB19712.1| zinc uptake regulation protein [Escherichia coli SMS-3-5] (171 aa)
Score = 88, Expect = 1.4e-01, Identities = 22/75 (29%), Positives = 42/75 (56%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EK+   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  ++FL+E+G +  V + +S
  S:     7 QELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYRALDFLLEQGFVHKVESTNS 84
>gi|81247796|gb|ABB68504.1| putative regulator [Shigella boydii Sb227] (191 aa)
Score = 88, Expect = 1.4e-01, Identities = 22/75 (29%), Positives = 42/75 (56%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EK+   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  ++FL+E+G +  V + +S
  S:    27 QELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYRALDFLLEQGFVHKVESTNS 104
>gi|81243692|gb|ABB64402.1| putative regulator [Shigella dysenteriae Sd197] (191 aa)
Score = 88, Expect = 1.4e-01, Identities = 22/75 (29%), Positives = 42/75 (56%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EK+   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  ++FL+E+G +  V + +S
  S:    27 QELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYRALDFLLEQGFVHKVESTNS 104
>gi|110807937|ref|YP_691457.1| zinc uptake transcriptional repressor [Shigella flexneri 5 str. 8401] >gi|24054671|gb|AAN45581.1| putative regulator [Shigella flexneri 2a str. 301] >gi|30042895|gb|AAP18618.1| putative regulator [Shigella flexneri 2a str. 2457T] >gi|73858017|gb|AAZ90724.1| putative regulator [Shigella sonnei Ss046] >gi|110617485|gb|ABF06152.1| putative regulator [Shigella flexneri 5 str. 8401] (191 aa)
Score = 88, Expect = 1.4e-01, Identities = 22/75 (29%), Positives = 42/75 (56%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EK+   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  ++FL+E+G +  V + +S
  S:    27 QELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYRALDFLLEQGFVHKVESTNS 104
>gi|194426891|ref|ZP_03059444.1| zinc uptake regulation protein [Escherichia coli B171] >gi|194415227|gb|EDX31496.1| zinc uptake regulation protein [Escherichia coli B171] (171 aa)
Score = 88, Expect = 1.4e-01, Identities = 22/75 (29%), Positives = 42/75 (56%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EK+   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  ++FL+E+G +  V + +S
  S:     7 QELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYRALDFLLEQGFVHKVESTNS 84
>gi|161984801|ref|YP_410332.2| zinc uptake transcriptional repressor [Shigella boydii Sb227] >gi|187731848|ref|YP_001882731.1| zinc uptake regulation protein [Shigella boydii CDC 3083-94] >gi|187428840|gb|ACD08114.1| zinc uptake regulation protein [Shigella boydii CDC 3083-94] (171 aa)
Score = 88, Expect = 1.4e-01, Identities = 22/75 (29%), Positives = 42/75 (56%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EK+   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  ++FL+E+G +  V + +S
  S:     7 QELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYRALDFLLEQGFVHKVESTNS 84
>gi|89110767|ref|AP_004547.1| DNA-binding transcriptional activator, Zn(II)-binding [Escherichia coli W3110] >gi|90111679|ref|NP_418470.4| DNA-binding transcriptional repressor, Zn(II)-binding [Escherichia coli str. K-12 substr. MG1655] >gi|157158569|ref|YP_001465547.1| zinc uptake transcriptional repressor [Escherichia coli E24377A] >gi|157163515|ref|YP_001460833.1| zinc uptake transcriptional repressor [Escherichia coli HS] >gi|161485849|ref|NP_709874.2| zinc uptake transcriptional repressor [Shigella flexneri 2a str. 301] >gi|161486420|ref|NP_838807.2| zinc uptake transcriptional repressor [Shigella flexneri 2a str. 2457T] >gi|161986390|ref|YP_312959.2| zinc uptake transcriptional repressor [Shigella sonnei Ss046] >gi|170021956|ref|YP_001726910.1| ferric uptake regulator family protein [Escherichia coli ATCC 8739] >gi|170083503|ref|YP_001732823.1| DNA-binding transcriptional repressor, Zn(II)-binding [Escherichia coli str. K12 substr. DH10B] >gi|188495281|ref|ZP_03002551.1| zinc uptake regulation protein [Escherichia coli 53638] >gi|191167453|ref|ZP_03029267.1| zinc uptake regulation protein [Escherichia coli B7A] >gi|193062992|ref|ZP_03044084.1| zinc uptake regulation protein [Escherichia coli E22] >gi|193067856|ref|ZP_03048822.1| zinc uptake regulation protein [Escherichia coli E110019] >gi|194432241|ref|ZP_03064529.1| zinc uptake regulation protein [Shigella dysenteriae 1012] >gi|194437170|ref|ZP_03069268.1| zinc uptake regulation protein [Escherichia coli 101-1] >gi|81175236|sp|P0AC51|ZUR_ECOLI Zinc uptake regulation protein (Zinc uptake regulator) >gi|81175237|sp|P0AC52|ZUR_SHIFL Zinc uptake regulation protein (Zinc uptake regulator) >gi|85676798|dbj|BAE78048.1| DNA-binding transcriptional activator, Zn(II)-binding [Escherichia coli W3110] >gi|87082363|gb|AAC77016.2| DNA-binding transcriptional repressor, Zn(II)-binding [Escherichia coli str. K-12 substr. MG1655] >gi|157069195|gb|ABV08450.1| zinc uptake regulation protein [Escherichia coli HS] >gi|157080599|gb|ABV20307.1| zinc uptake regulation protein [Escherichia coli E24377A] >gi|169756884|gb|ACA79583.1| ferric uptake regulator, Fur family [Escherichia coli ATCC 8739] >gi|169891338|gb|ACB05045.1| DNA-binding transcriptional repressor, Zn(II)-binding [Escherichia coli str. K12 substr. DH10B] >gi|188490480|gb|EDU65583.1| zinc uptake regulation protein [Escherichia coli 53638] >gi|190902495|gb|EDV62230.1| zinc uptake regulation protein [Escherichia coli B7A] >gi|192931251|gb|EDV83853.1| zinc uptake regulation protein [Escherichia coli E22] >gi|192958831|gb|EDV89268.1| zinc uptake regulation protein [Escherichia coli E110019] >gi|194419444|gb|EDX35525.1| zinc uptake regulation protein [Shigella dysenteriae 1012] >gi|194423726|gb|EDX39715.1| zinc uptake regulation protein [Escherichia coli 101-1] (171 aa)
Score = 88, Expect = 1.4e-01, Identities = 22/75 (29%), Positives = 42/75 (56%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EK+   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  ++FL+E+G +  V + +S
  S:     7 QELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYRALDFLLEQGFVHKVESTNS 84
>gi|77961097|ref|ZP_00824944.1| COG0735: Fe2+/Zn2+ uptake regulation proteins [Yersinia mollaretii ATCC 43969] (170 aa)
Score = 88, Expect = 1.4e-01, Identities = 23/75 (30%), Positives = 40/75 (53%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           +KLL   E L   +NVR+T  R+ +L  +       +  D++D L     +    +VY  ++FL+E+G I  V + +S
  S:     8 EKLLAQAESLCQQRNVRLTPQRLEVLRLMAQQPGAISAYDLLDLLRISEPQAKPPTVYRALDFLLEQGFIHRVESANS 85
>gi|77957498|ref|ZP_00821552.1| COG0735: Fe2+/Zn2+ uptake regulation proteins [Yersinia bercovieri ATCC 43970] (172 aa)
Score = 88, Expect = 1.4e-01, Identities = 23/75 (30%), Positives = 40/75 (53%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           +KLL   E L   +NVR+T  R+ +L  +       +  D++D L     +    +VY  ++FL+E+G I  V + +S
  S:    10 EKLLAQAESLCQQRNVRLTPQRLEVLRLMAQQPGAISAYDLLDLLRISEPQAKPPTVYRALDFLLEQGFIHRVESANS 87
>gi|162418217|ref|YP_001605834.1| zinc uptake transcriptional repressor [Yersinia pestis Angola] >gi|165926763|ref|ZP_02222595.1| zinc uptake regulation protein [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936506|ref|ZP_02225074.1| zinc uptake regulation protein [Yersinia pestis biovar Orientalis str. IP275] >gi|166010432|ref|ZP_02231330.1| zinc uptake regulation protein [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213915|ref|ZP_02239950.1| zinc uptake regulation protein [Yersinia pestis biovar Antiqua str. B42003004] >gi|167402463|ref|ZP_02307920.1| zinc uptake regulation protein [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167418847|ref|ZP_02310600.1| zinc uptake regulation protein [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167426189|ref|ZP_02317942.1| zinc uptake regulation protein [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|21957279|gb|AAM84161.1|AE013659_5 putative regulator [Yersinia pestis KIM] >gi|45435181|gb|AAS60741.1| putative regulator [Yersinia pestis biovar Microtus str. 91001] >gi|162351032|gb|ABX84980.1| zinc uptake regulation protein [Yersinia pestis Angola] >gi|165915622|gb|EDR34231.1| zinc uptake regulation protein [Yersinia pestis biovar Orientalis str. IP275] >gi|165921386|gb|EDR38610.1| zinc uptake regulation protein [Yersinia pestis biovar Orientalis str. F1991016] >gi|165990522|gb|EDR42823.1| zinc uptake regulation protein [Yersinia pestis biovar Antiqua str. E1979001] >gi|166204890|gb|EDR49370.1| zinc uptake regulation protein [Yersinia pestis biovar Antiqua str. B42003004] >gi|166962841|gb|EDR58862.1| zinc uptake regulation protein [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167048151|gb|EDR59559.1| zinc uptake regulation protein [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167054900|gb|EDR64702.1| zinc uptake regulation protein [Yersinia pestis biovar Mediaevalis str. K1973002] (172 aa)
Score = 88, Expect = 1.5e-01, Identities = 23/75 (30%), Positives = 40/75 (53%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           +KLL   E L   +NVR+T  R+ +L  +       +  D++D L     +    +VY  ++FL+E+G I  V + +S
  S:    10 EKLLAQAESLCQQRNVRLTPQRLEVLRLMAQQPGAISAYDLLDLLRVAEPQAKPPTVYRALDFLLEQGFIHRVESANS 87
>gi|154685336|ref|YP_001420497.1| PerR [Bacillus amyloliquefaciens FZB42] >gi|154351187|gb|ABS73266.1| PerR [Bacillus amyloliquefaciens FZB42] (145 aa)
Score = 88, Expect = 1.5e-01, Identities = 29/92 (31%), Positives = 47/92 (51%)
  Q:     5 MANQKLLEKLNNNKN--VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLH 96
           MA  +L E L+  K+  VRIT  R  ILE L D     T  DI   L  K   ++V++VYN +    E G+++ +   D+  + ++ +  +  H
  S:     1 MAAHELKEALDTLKDTGVRITPQRHAILEYLVDSMAHPTADDIYKALEGKFPNMSVATVYNNLRVFREAGLVKELTYGDASSR-FDFVTSDHYH 93
>gi|54023424|ref|YP_117666.1| putative ferric uptake regulator [Nocardia farcinica IFM 10152] >gi|54014932|dbj|BAD56302.1| putative ferric uptake regulator [Nocardia farcinica IFM 10152] (141 aa)
Score = 88, Expect = 1.6e-01, Identities = 20/68 (29%), Positives = 38/68 (55%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAY 87
           +R T+ R  I   L D     + +++ D L  +GE + +++VY T+  L + G+++++ T DS E  Y
  S:    14 IRSTRQRSAIAALLGDIDEFRSAQELHDELRKRGEGIGLTTVYRTLQSLADAGMVDVLRT-DSGESVY 80
>gi|150021080|ref|YP_001306434.1| ferric uptake regulator family protein [Thermosipho melanesiensis BI429] >gi|149793601|gb|ABR31049.1| ferric uptake regulator, Fur family [Thermosipho melanesiensis BI429] (136 aa)
Score = 88, Expect = 1.7e-01, Identities = 33/105 (31%), Positives = 53/105 (50%)
  Q:    13 KLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKV-----ALPKEIE 117
           K+     +R T  R+ IL+ + +     +  +I + L  K   ++ S+VYNT++ L E+G+IE V T  S    Y L+     H H Y +   K+  +     ALPK  E
  S:     6 KILKTHGIRPTIHRVQILKFIVESKSHPSADEIYEKLKDKIHAISRSTVYNTVSLLKEKGVIEEVVTPSSIRYDYSLVP----HNHFYCIKCKKVYDIYGALGALPKITE 111
>gi|94309073|ref|YP_582283.1| ferric uptake regulator family protein [Ralstonia metallidurans CH34] >gi|93352925|gb|ABF07014.1| putative ferric uptake regulator, FUR family [Ralstonia metallidurans CH34] (169 aa)
Score = 88, Expect = 1.7e-01, Identities = 18/55 (32%), Positives = 37/55 (67%)
  Q:    21 RITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIE 75
           R+T+ R+ IL CL +     T + +IDHL ++G+ V+  +VY  +++L+++G+ +
  S:    34 RVTQPRLAILACLIEAPEPLTHQAVIDHLPAEGD-VDRVTVYRVLDWLVDQGLAQ 87
>gi|177667584|ref|ZP_02943132.1| ferric uptake regulator, Fur family [Cyanothece sp. PCC 8801] >gi|196246254|ref|ZP_03144974.1| ferric uptake regulator, Fur family [Cyanothece sp. PCC 8802] >gi|172073665|gb|EDT59088.1| ferric uptake regulator, Fur family [Cyanothece sp. PCC 8801] >gi|196205893|gb|EDY00692.1| ferric uptake regulator, Fur family [Cyanothece sp. PCC 8802] (147 aa)
Score = 88, Expect = 1.7e-01, Identities = 30/101 (29%), Positives = 50/101 (49%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAI 120
           +R+++ R +ILE L       + K+I   LN +G+++  +SVY  +  L  +GIIE V   D +   Y  I+    H++  D        V LP E+ + I
  S:    26 MRVSRQRRSILELLWRVQEHLSAKEIYHLLNEEGKEIGHTSVYQNLEALSNQGIIECVERCDGR--LYGHISDSHSHVNCLDTQKIIDINVELPLELVETI 124
>gi|84683599|ref|ZP_01011502.1| ferric uptake regulation protein [Rhodobacterales bacterium HTCC2654] >gi|84668342|gb|EAQ14809.1| ferric uptake regulation protein [Rhodobacterales bacterium HTCC2654] (140 aa)
Score = 87, Expect = 1.8e-01, Identities = 37/138 (26%), Positives = 66/138 (47%)
  Q:     7 NQKLLEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENIKLDIYAKKKK 144
           +  LLE+ +    +RIT  R  ILE L        ++++   +++    VN+++VY T+N L E G+IE  +T +     +E     D H H  DV   ++ +  +  EIE+   D          + KL++Y ++ K
  S:     6 DDTLLER-SRRSGLRITGQRRVILEVLEGATDHPDVEELHRKVSAIEPGVNIATVYRTMNTLAEHGLIE-RHTFEDGRTRFEPA-PTDHHDHFIDVDTGEVIEF-VSDEIERLQEDIARKHGFEIVSHKLELYVRRIK 139
>gi|77972799|ref|ZP_00828356.1| COG0735: Fe2+/Zn2+ uptake regulation proteins [Yersinia frederiksenii ATCC 33641] (169 aa)
Score = 87, Expect = 1.8e-01, Identities = 23/75 (30%), Positives = 40/75 (53%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           +KLL   E L   +NVR+T  R+ +L  +       +  D++D L     +    +VY  ++FL+E+G I  V + +S
  S:     7 EKLLAQAESLCQQRNVRLTPQRLEVLRLMAQQPGAISAYDLLDLLRISEPQAKPPTVYRALDFLLEQGFIHRVESANS 84
>gi|188590934|ref|YP_001795534.1| putative transcriptional regulator, FUR family [Cupriavidus taiwanensis] >gi|170937828|emb|CAP62812.1| putative transcriptional regulator, FUR family [Cupriavidus taiwanensis] (173 aa)
Score = 87, Expect = 1.9e-01, Identities = 17/55 (30%), Positives = 33/55 (60%)
  Q:    21 RITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIE 75
           R+T+ R+ IL CL       T + +ID L   GE ++  +VY  +++L+++G+ +
  S:    36 RVTQPRLCILACLIGSDDALTHQAVIDRLPEAGETIDRVTVYRVLDWLVDQGVAQ 90
>gi|53803565|ref|YP_114738.1| transctiptional regulator, putative [Methylococcus capsulatus str. Bath] >gi|53757326|gb|AAU91617.1| putative transctiptional regulator [Methylococcus capsulatus str. Bath] (340 aa)
Score = 87, Expect = 1.9e-01, Identities = 19/71 (26%), Positives = 38/71 (53%)
  Q:    12 EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           EKL + + VR T +R  +L  + + +      D+++ L         ++VY  ++FL+E+G I  V +L++
  S:   202 EKLCSERGVRFTPLRRQVLALIWENHEAVKAYDLLELLKPFDPSAKPATVYRALDFLLEQGFIHRVESLNA 272
>gi|126731387|ref|ZP_01747194.1| ferric uptake regulator, FUR family protein [Sagittula stellata E-37] >gi|126708298|gb|EBA07357.1| ferric uptake regulator, FUR family protein [Sagittula stellata E-37] (138 aa)
Score = 87, Expect = 1.9e-01, Identities = 24/86 (27%), Positives = 47/86 (54%)
  Q:    18 KNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVT 103
           + +R+T  R  I E L D      ++++    +++   +++++VY T+    E GI+E V+  D + + YE  ++E  H HL D+T
  S:    12 QGLRMTGQRRTIAEVLEDATDHPDVEELYARASTRDPNISIATVYRTVKLFEEAGILEKVDFGDGRAR-YEDADREH-HDHLIDLT 95
>gi|110644383|ref|YP_672113.1| zinc uptake transcriptional repressor [Escherichia coli 536] >gi|110345975|gb|ABG72212.1| zinc uptake regulation protein [Escherichia coli 536] (197 aa)
Score = 87, Expect = 2.1e-01, Identities = 22/75 (29%), Positives = 41/75 (54%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EK+   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  + FL+E+G +  V + +S
  S:    33 QELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYRALEFLLEQGFVHKVESTNS 110
>gi|117626313|ref|YP_859636.1| zinc uptake transcriptional repressor [Escherichia coli APEC O1] >gi|91075143|gb|ABE10024.1| putative zinc uptake regulation protein [Escherichia coli UTI89] >gi|115515437|gb|ABJ03512.1| putative zinc uptake regulation protein [Escherichia coli APEC O1] (228 aa)
Score = 87, Expect = 2.1e-01, Identities = 22/75 (29%), Positives = 41/75 (54%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EK+   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  + FL+E+G +  V + +S
  S:    64 QELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYRALEFLLEQGFVHKVESTNS 141
>gi|26111260|gb|AAN83443.1|AE016770_243 Zinc uptake regulation protein [Escherichia coli CFT073] (228 aa)
Score = 87, Expect = 2.1e-01, Identities = 22/75 (29%), Positives = 41/75 (54%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EK+   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  + FL+E+G +  V + +S
  S:    64 QELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYRALEFLLEQGFVHKVESTNS 141
>gi|161486025|ref|NP_756869.2| zinc uptake transcriptional repressor [Escherichia coli CFT073] >gi|162138313|ref|YP_543555.2| zinc uptake transcriptional repressor [Escherichia coli UTI89] >gi|191171936|ref|ZP_03033481.1| zinc uptake regulation protein [Escherichia coli F11] >gi|190907701|gb|EDV67295.1| zinc uptake regulation protein [Escherichia coli F11] (171 aa)
Score = 87, Expect = 2.1e-01, Identities = 22/75 (29%), Positives = 41/75 (54%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   EK+   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  + FL+E+G +  V + +S
  S:     7 QELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYRALEFLLEQGFVHKVESTNS 84
>gi|163734558|ref|ZP_02141997.1| transcriptional regulator, Fur family, putative [Roseobacter litoralis Och 149] >gi|161392051|gb|EDQ16381.1| transcriptional regulator, Fur family, putative [Roseobacter litoralis Och 149] (139 aa)
Score = 86, Expect = 2.3e-01, Identities = 27/81 (33%), Positives = 44/81 (54%)
  Q:    20 VRITKIRINILECL-NDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLY 100
           +R T+ R+ +   L  DG   H T + + D   S+GE V++++VYNT+    + G+++ V    SK  +Y   N  D H H Y
  S:    18 LRPTRQRVTLAALLIGDGQDRHVTAESLFDAAKSQGEAVSLATVYNTLRAFCDVGLVQEVTVDGSK--SYFDTNTHD-HPHFY 97
>gi|15606597|ref|NP_213977.1| FUR family transcriptional regulator [Aquifex aeolicus VF5] >gi|2983817|gb|AAC07373.1| transcriptional regulator (FurR family) [Aquifex aeolicus VF5] (152 aa)
Score = 86, Expect = 2.5e-01, Identities = 36/133 (27%), Positives = 69/133 (51%)
  Q:     8 QKLLEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHL-NSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENIKLDIYA 140
           +K   K    KN+++TK R+N+++ + D      I+++++ + N K +KV+ S+VY T+  L E G ++ V   D+K   YE +     H HL      ++ +  + +EIEK   +     N    + +L+I+ 
  S:    12 KKEFTKFLKKKNMKVTKSRLNLIDLIADYNKHFEIEELVNWIANHKDKKVSRSTVYRTVKLLEEFGAVKEVIKKDNK-TIYEFVIGRSHHDHLVCTECGRIIEF-VDEEIEKLQEEICKKYNFKPAHHRLEIFG 143
>gi|78213394|ref|YP_382173.1| ferric uptake regulator family protein [Synechococcus sp. CC9605] >gi|78197853|gb|ABB35618.1| putative ferric uptake regulator, FUR family [Synechococcus sp. CC9605] (151 aa)
Score = 86, Expect = 2.7e-01, Identities = 25/101 (24%), Positives = 50/101 (49%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLD--KVALPKEIEKAI 120
           +R+++ R  +L+ L       + +DI + LN +G  +  +SVY  +  L   G+IE ++    +   Y    + D H HL  + +  ++   V LP ++ + I
  S:    30 MRLSRHRRMVLDLLWSEKSHLSARDIFEQLNLRGRSIGHTSVYQNLEALQSAGVIECLDRASGRLYGY----RSDPHSHLTCLDSGSIEDIDVVLPDDLLRQI 128
>gi|88808656|ref|ZP_01124166.1| putative ferric uptake regulator, FUR family protein [Synechococcus sp. WH 7805] >gi|88787644|gb|EAR18801.1| putative ferric uptake regulator, FUR family protein [Synechococcus sp. WH 7805] (150 aa)
Score = 86, Expect = 2.7e-01, Identities = 27/99 (27%), Positives = 55/99 (55%)
  Q:    20 VRITKIRINILECL-NDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKV------ALPKEIEK 118
           +R+++ R  +L+ L ++G H  + +DI + LN +G  +  +SVY  +  L   G+IE ++    +   Y    + D H H+  + +  ++ +      AL +EIE+
  S:    26 MRLSRQRRMVLDLLWSEGTH-LSARDIFEKLNQRGRSIGHTSVYQNLEALQSAGVIECLDRASGRLYGY----RNDPHSHITCLESGAIEDLDVELPPALLQEIEQ 126
>gi|126656218|ref|ZP_01727602.1| Ferric uptake regulator (FUR) family protein [Cyanothece sp. CCY0110] >gi|126622498|gb|EAZ93204.1| Ferric uptake regulator (FUR) family protein [Cyanothece sp. CCY0110] (157 aa)
Score = 86, Expect = 2.8e-01, Identities = 32/124 (25%), Positives = 56/124 (45%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENIKLDIYAKKK 143
           +RI++ R  ILE L       + ++I + L+  G+ V  +SVY  +  L  +GIIE +   D +   Y  I     H++  D        V LP ++ + I        +T  + ++D Y  K+
  S:    26 MRISRQRRYILELLWKTQEHLSAREIYNRLSQIGKNVGHTSVYQNLEALSSQGIIECLERCDGR--LYGTITDSHSHVNCLDTQQIIDVHVELPSDLIQQIE---AKTGITITDYRIDFYGHKQ 144
>gi|121997768|ref|YP_001002555.1| ferric uptake regulator family protein [Halorhodospira halophila SL1] >gi|121589173|gb|ABM61753.1| ferric uptake regulator, Fur family [Halorhodospira halophila SL1] (147 aa)
Score = 86, Expect = 2.8e-01, Identities = 28/93 (30%), Positives = 52/93 (55%)
  Q:    20 VRITKIRINILECLNDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVAL 112
           +R T+ R+ +   L  G   H T + + +   ++G KV++++VYNT+N   E G++  V  + S +  ++   K + H HLYD  + K++ V L
  S:    24 LRPTQQRLALAGLLFSGEDRHVTAESLYEEAAAQGVKVSLATVYNTLNQFKEAGLLREV-IVHSGKSYFD--TKTEAHHHLYDEDSGKIEDVHL 114
>gi|52079333|ref|YP_078124.1| FUR family transcriptional regulator [Bacillus licheniformis ATCC 14580] >gi|52784698|ref|YP_090527.1| PerR [Bacillus licheniformis ATCC 14580] >gi|52002544|gb|AAU22486.1| transcriptional regulator (Fur family) [Bacillus licheniformis ATCC 14580] >gi|52347200|gb|AAU39834.1| PerR [Bacillus licheniformis DSM 13] (145 aa)
Score = 85, Expect = 3.0e-01, Identities = 30/92 (32%), Positives = 44/92 (47%)
  Q:     5 MANQKLLEKLNNNKN--VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLH 96
           MA   L E L   K   VRIT  R  ILE L +     T  DI   L  K   ++V++VYN +    E G+++ +   DS  + ++ +  E  H
  S:     1 MAEHNLKEALEALKETGVRITPQRHAILEFLVNSMSHPTADDIYKALEGKFPNMSVATVYNNLRVFKESGLVKELTYGDSSSR-FDFVTSEHYH 93
>gi|154491514|ref|ZP_02031140.1| hypothetical protein PARMER_01125 [Parabacteroides merdae ATCC 43184] >gi|154088315|gb|EDN87360.1| hypothetical protein PARMER_01125 [Parabacteroides merdae ATCC 43184] (152 aa)
Score = 85, Expect = 3.2e-01, Identities = 29/98 (29%), Positives = 51/98 (52%)
  Q:     2 KRIMANQKLLEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDH-LNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHL 99
           K+    Q L  +    K +R T+ R  ILEC+   + GH    ++   L      V+ ++VYNT++ L++ G+I + + L ++   YEL    + H+HL
  S:     4 KKYTEMQDLFTRYLAEKKLRKTEERYAILECICS-FPGHFDMCLLHQKLEEMNFHVSRATVYNTVDVLVDSGLI-VRHQLTAQAVQYELRMLAETHLHL 100
>gi|56552307|ref|YP_163146.1| Fe2+/Zn2+ uptake regulation protein [Zymomonas mobilis subsp. mobilis ZM4] >gi|56543881|gb|AAV90035.1| Fe2+/Zn2+ uptake regulation protein [Zymomonas mobilis subsp. mobilis ZM4] (143 aa)
Score = 85, Expect = 3.2e-01, Identities = 27/97 (27%), Positives = 51/97 (52%)
  Q:    11 LEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKL 107
           +E L   K +RIT  R  I + L++      ++ + +  ++    +++++VY T+    E GI+E  +  D + + YE  + ED H HL DV + K+
  S:     6 IETLCAQKGLRITGQRRVIAQVLSEAEDHPDVESLYERASAIDSGISIATVYRTVRLFEEAGILERHDFGDGRAR-YE-ASPEDHHDHLIDVESGKI 100
>gi|84688008|ref|ZP_01015871.1| transcriptional regulator, Fur family protein [Rhodobacterales bacterium HTCC2654] >gi|84663989|gb|EAQ10490.1| transcriptional regulator, Fur family protein [Rhodobacterales bacterium HTCC2654] (140 aa)
Score = 85, Expect = 3.5e-01, Identities = 33/107 (30%), Positives = 54/107 (50%)
  Q:     7 NQKLLEKLNNNKNVRITKIRINILECL-NDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLY--------DVTNNKLDKVALP 113
           +Q +  K   +  +R T+ R+ I   L  DG H H T + + D     GEKV++++VYNT+    E G++  +  L +  + Y   N  + H H +        D     L+  ALP
  S:     6 SQDMGRKWLESAGLRPTRQRVAIAALLVGDGEHRHVTAESLFDATREAGEKVSLATVYNTLRSFSEVGLLREI--LVNGTKGYFDTNTTN-HPHFFWEDSGELMDAPEEDLEIAALP 119
>gi|188580242|ref|YP_001923687.1| putative ferric uptake regulator, Fur family [Methylobacterium populi BJ001] >gi|179343740|gb|ACB79152.1| putative ferric uptake regulator, Fur family [Methylobacterium populi BJ001] (184 aa)
Score = 85, Expect = 3.5e-01, Identities = 16/71 (22%), Positives = 40/71 (56%)
  Q:    12 EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           E+L   + ++ T++R ++L  +   +      DI + +++ G +V   SVY  ++FL E+G +  +++ ++
  S:    42 ERLCQTRGLQFTRLRRDVLAAVAAEHKPLGAYDIAERMSAPGRRVAAVSVYRALDFLTEQGFVHRISSRNA 112
>gi|126729164|ref|ZP_01744978.1| zinc uptake regulation protein [Sagittula stellata E-37] >gi|126710154|gb|EBA09206.1| zinc uptake regulation protein [Sagittula stellata E-37] (166 aa)
Score = 85, Expect = 3.6e-01, Identities = 17/71 (23%), Positives = 37/71 (52%)
  Q:    12 EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           E L + + +++TK+R  +LE L + +      +++DHL  +G        Y  ++FL+  G+   +  L++
  S:    23 EHLCDEQGLQLTKVRRRVLEILLEKHRAMGAYEVLDHLREEGLGSQPPVAYRALDFLVTNGLAHRIERLNA 93
>gi|114705762|ref|ZP_01438665.1| probable ferric uptake regulation protein [Fulvimarina pelagi HTCC2506] >gi|114538608|gb|EAU41729.1| probable ferric uptake regulation protein [Fulvimarina pelagi HTCC2506] (197 aa)
Score = 85, Expect = 3.6e-01, Identities = 24/95 (25%), Positives = 49/95 (51%)
  Q:    13 KLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKL 107
           +L  +  +R+T  R+ I+  L+      T ++I          ++ ++VY T++ L E G+I  + +L++    YEL + ED H H+ D+ +  +
  S:    67 ELLRDAGLRVTNQRVAIMRTLSGAEDHPTAEEITGKARELDSTISFATVYRTLSVLEELGLIRKL-SLENSPARYELCDSED-HGHIVDLDDGSI 159
>gi|161367463|ref|NP_290680.2| zinc uptake transcriptional repressor [Escherichia coli O157:H7 EDL933] (171 aa)
Score = 85, Expect = 3.7e-01, Identities = 21/75 (28%), Positives = 42/75 (56%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   +K+   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  ++FL+E+G +  V + +S
  S:     7 QELLAQADKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYRALDFLLEQGFVHKVESTNS 84
>gi|90421043|ref|ZP_01228946.1| putative ferric uptake regulation protein [Aurantimonas sp. SI85-9A1] >gi|90334678|gb|EAS48455.1| putative ferric uptake regulation protein [Aurantimonas sp. SI85-9A1] (145 aa)
Score = 85, Expect = 3.7e-01, Identities = 35/133 (26%), Positives = 67/133 (50%)
  Q:    12 EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENI--KLDIYAKKKK 144
           E++  +  VRIT+ R  IL  L DG       +I     +    +++S+VY T+  L E+G I+  +  +     +E  +  D H HL D+ + ++ +      IEK   +   ++ L YE +  +L++Y +K++
  S:    14 ERILRDAGVRITRPRRIILTILADGGDHPDALEIFRRTAAIDPSISLSTVYRTMKLLEEKGAIQ-RHVFEGGPSRFERADG-DHHDHLIDIESGEVVEFR-SDRIEKLQEEI--ARELGYEIVSHRLELYGRKRQ 143
>gi|38704227|ref|NP_313056.2| zinc uptake transcriptional repressor [Escherichia coli O157:H7 str. Sakai] >gi|168707323|ref|ZP_02739600.1| zinc uptake transcriptional repressor [Escherichia coli O157:H7 str. EC4045] >gi|168719506|ref|ZP_02751783.1| zinc uptake transcriptional repressor [Escherichia coli O157:H7 str. EC4206] >gi|168737075|ref|ZP_02769352.1| zinc uptake transcriptional repressor [Escherichia coli O157:H7 str. EC4115] >gi|168750821|ref|ZP_02775843.1| zinc uptake regulation protein [Escherichia coli O157:H7 str. EC4113] >gi|168755198|ref|ZP_02780205.1| zinc uptake regulation protein [Escherichia coli O157:H7 str. EC4401] >gi|168760893|ref|ZP_02785900.1| zinc uptake regulation protein [Escherichia coli O157:H7 str. EC4501] >gi|168766288|ref|ZP_02791295.1| zinc uptake regulation protein [Escherichia coli O157:H7 str. EC4486] >gi|168774385|ref|ZP_02799392.1| zinc uptake regulation protein [Escherichia coli O157:H7 str. EC4196] >gi|168780440|ref|ZP_02805447.1| zinc uptake regulation protein [Escherichia coli O157:H7 str. EC4076] >gi|168784643|ref|ZP_02809650.1| zinc uptake regulation protein [Escherichia coli O157:H7 str. EC869] >gi|168794468|ref|ZP_02819475.1| zinc uptake transcriptional repressor [Escherichia coli O157:H7 str. EC4042] >gi|168798309|ref|ZP_02823316.1| zinc uptake regulation protein [Escherichia coli O157:H7 str. EC508] >gi|195935813|ref|ZP_03081195.1| zinc uptake transcriptional repressor [Escherichia coli O157:H7 str. EC4024] >gi|187769961|gb|EDU33805.1| zinc uptake regulation protein [Escherichia coli O157:H7 str. EC4196] >gi|188015058|gb|EDU53180.1| zinc uptake regulation protein [Escherichia coli O157:H7 str. EC4113] >gi|189001726|gb|EDU70712.1| zinc uptake regulation protein [Escherichia coli O157:H7 str. EC4076] >gi|189357498|gb|EDU75917.1| zinc uptake regulation protein [Escherichia coli O157:H7 str. EC4401] >gi|189364147|gb|EDU82566.1| zinc uptake regulation protein [Escherichia coli O157:H7 str. EC4486] >gi|189368592|gb|EDU87008.1| zinc uptake regulation protein [Escherichia coli O157:H7 str. EC4501] >gi|189375144|gb|EDU93560.1| zinc uptake regulation protein [Escherichia coli O157:H7 str. EC869] >gi|189379077|gb|EDU97493.1| zinc uptake regulation protein [Escherichia coli O157:H7 str. EC508] (171 aa)
Score = 85, Expect = 3.7e-01, Identities = 21/75 (28%), Positives = 42/75 (56%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   +K+   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  ++FL+E+G +  V + +S
  S:     7 QELLAQADKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYRALDFLLEQGFVHKVESTNS 84
>gi|12518995|gb|AAG59245.1|AE005637_9 putative regulator [Escherichia coli O157:H7 EDL933] (191 aa)
Score = 85, Expect = 3.7e-01, Identities = 21/75 (28%), Positives = 42/75 (56%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   +K+   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  ++FL+E+G +  V + +S
  S:    27 QELLAQADKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYRALDFLLEQGFVHKVESTNS 104
>gi|13364506|dbj|BAB38452.1| putative regulator [Escherichia coli O157:H7 str. Sakai] (191 aa)
Score = 85, Expect = 3.7e-01, Identities = 21/75 (28%), Positives = 42/75 (56%)
  Q:     8 QKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           Q+LL   +K+   +NVR+T  R+ +L  ++      +  D++D L     +    +VY  ++FL+E+G +  V + +S
  S:    27 QELLAQADKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYRALDFLLEQGFVHKVESTNS 104
>gi|83854738|ref|ZP_00948268.1| transcriptional regulator, Fur family protein [Sulfitobacter sp. NAS-14.1] >gi|83941261|ref|ZP_00953723.1| transcriptional regulator, Fur family protein [Sulfitobacter sp. EE-36] >gi|83842581|gb|EAP81748.1| transcriptional regulator, Fur family protein [Sulfitobacter sp. NAS-14.1] >gi|83847081|gb|EAP84956.1| transcriptional regulator, Fur family protein [Sulfitobacter sp. EE-36] (139 aa)
Score = 85, Expect = 3.9e-01, Identities = 31/100 (31%), Positives = 53/100 (53%)
  Q:    20 VRITKIRINILECL-NDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLY--------DVTNNKLDKVALPKEIEKA 119
           +R T+ R+ +   L  DG H H T + + D    +G+ V++++VYNT+    + G+++ V    SK  +Y   N  D H H +        D  +++L    LP   E A
  S:    18 LRPTRQRMTLAHLLVGDGQHRHVTAESLFDAAKGQGDAVSLATVYNTLRAFCDAGLMQEVTVDGSK--SYFDTNTHD-HPHFFWEDEARLSDAPSDQLVIAQLPDAPEGA 124
>gi|84502854|ref|ZP_01000967.1| transcriptional regulator, Fur family protein [Oceanicola batsensis HTCC2597] >gi|84388837|gb|EAQ01707.1| transcriptional regulator, Fur family protein [Oceanicola batsensis HTCC2597] (138 aa)
Score = 84, Expect = 4.1e-01, Identities = 29/104 (27%), Positives = 53/104 (50%)
  Q:    16 NNKNVRITKIRINILECL-NDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHI------HLYDVTNNKLDKVALPKEIEKA 119
           N   +R T+ R  + E L  DG H H T + +   +   G+ V++++VYNT+    + G+++ + T+D  +  ++    +  H       HL D    +L   +LP   E A
  S:    14 NRGGLRPTRQRALLAELLIGDGQHRHVTAESLFAAVQDSGQSVSLATVYNTLRAFCDAGLMQEI-TVDGSKSYFDTNMHDHPHFFWEDTGHLTDAPAEQLKITSLPDLPEGA 124
>gi|67922577|ref|ZP_00516084.1| Ferric-uptake regulator [Crocosphaera watsonii WH 8501] >gi|67855586|gb|EAM50838.1| Ferric-uptake regulator [Crocosphaera watsonii WH 8501] (157 aa)
Score = 84, Expect = 4.2e-01, Identities = 31/124 (25%), Positives = 56/124 (45%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENIKLDIYAKKK 143
           +RI++ R  ILE L       + ++I + L+  G+ V  +SVY  +  L  +GIIE +   D +   Y  I     H++  D        V LP ++ + I        +T  + ++D Y  ++
  S:    23 MRISRQRRYILELLWKTKEHLSAREIYNRLSQNGKNVGHTSVYQNLEALSSQGIIECLERCDGR--LYGTITDSHSHVNCLDTQQIIDVHVQLPSDLIQQIE---AQTGITITDYRVDFYGHQQ 141
>gi|158319667|ref|YP_001512174.1| ferric uptake regulator family protein [Alkaliphilus oremlandii OhILAs] >gi|158139866|gb|ABW18178.1| ferric uptake regulator, Fur family [Alkaliphilus oremlandii OhILAs] (140 aa)
Score = 84, Expect = 4.6e-01, Identities = 27/89 (30%), Positives = 50/89 (56%)
  Q:     8 QKLLEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLH 96
           +KL E+L   KN+R++  R+ +LE ++      T+  I   L+     ++ +++YNT+N LI  G+I+ V T++  E  Y+ +  E  H
  S:     6 EKLSEELKK-KNIRLSHQRLKVLEYMSTHKTHPTVDQIYHDLHKDIPTLSKTTIYNTLNTLINAGLIKSV-TIEDTEVRYDSVTDEHGH 92
>gi|15887705|ref|NP_353386.1| ferric uptake regulator [Agrobacterium tumefaciens str. C58] >gi|15155264|gb|AAK86171.1| ferric uptake regulator [Agrobacterium tumefaciens str. C58] (142 aa)
Score = 84, Expect = 4.6e-01, Identities = 30/109 (27%), Positives = 57/109 (52%)
  Q:     9 KLLEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIE 117
           K LE+L   + +R+T  R  I   L +      ++++    ++   ++++S+VY T+    + GIIE  +  D + + YE +  E+ H HL D+ N+ + +   P EIE
  S:     6 KTLEELCAERGMRMTDQRRVIARVLQESADHPDVEELYRRSSAVDPRISISTVYRTVKLFEDAGIIERHDFRDGRSR-YETV-PEEHHDHLIDLKNSVVIEFHSP-EIE 111
>gi|148239498|ref|YP_001224885.1| ferric uptake regulator family protein [Synechococcus sp. WH 7803] >gi|147848037|emb|CAK23588.1| Ferric uptake regulator family protein [Synechococcus sp. WH 7803] (155 aa)
Score = 84, Expect = 4.7e-01, Identities = 28/99 (28%), Positives = 55/99 (55%)
  Q:    20 VRITKIRINILECL-NDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLD--KVALP----KEIEK 118
           +R+++ R  +L+ L ++G H  + +DI + LN +G  +  +SVY  +  L   G+IE ++    +   Y    + D H H+  + +  ++   V LP    +EIE+
  S:    31 MRLSRQRRMVLDLLWSEGTH-LSARDIFEKLNQRGRSIGHTSVYQNLEALQSAGVIECLDRASGRLYGY----RNDPHSHITCLDSGAIEDLDVELPLDLLQEIEQ 131
>gi|149190543|ref|ZP_01868813.1| zinc uptake regulation protein, putative [Vibrio shilonii AK1] >gi|148835667|gb|EDL52634.1| zinc uptake regulation protein, putative [Vibrio shilonii AK1] (150 aa)
Score = 84, Expect = 4.8e-01, Identities = 21/76 (27%), Positives = 42/76 (55%)
  Q:     7 NQKLLEKLNN---NKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           NQKL+++L +    + VR+T  R  + E + +     +  ++++ L     K    +VY  ++FL+E+G I  V + +S
  S:     2 NQKLIQQLEDICSARGVRLTPQRRTVYELICENKKASSAYELLEQLKVSEPKAKPPTVYRALDFLLEQGFIHRVESTNS 80
>gi|154245832|ref|YP_001416790.1| ferric uptake regulator family protein [Xanthobacter autotrophicus Py2] >gi|154159917|gb|ABS67133.1| ferric uptake regulator, Fur family [Xanthobacter autotrophicus Py2] (175 aa)
Score = 84, Expect = 4.8e-01, Identities = 18/63 (28%), Positives = 36/63 (57%)
  Q:    11 LEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGI 73
           +EK    K +R+T +R ++++ L + +      +I++ L + GE     SVY  ++FL+ EG+
  S:    24 MEKCCAEKGLRLTPLRRSVMKALAETHVPLGAYEIVERLAAGGEPTPPMSVYRVLDFLVAEGL 86
>gi|153006762|ref|YP_001381087.1| ferric uptake regulator family protein [Anaeromyxobacter sp. Fw109-5] >gi|152030335|gb|ABS28103.1| ferric uptake regulator, Fur family [Anaeromyxobacter sp. Fw109-5] (182 aa)
Score = 84, Expect = 5.0e-01, Identities = 24/83 (28%), Positives = 44/83 (53%)
  Q:    17 NKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHL 99
           +K++R+T+ R  I+E        + I+++I  L  +G + + ++VY T+  L E GI+E    L  + ++YE       H HL
  S:    22 SKDLRLTEARAAIVEAAMAREGHYPIEELIADLKQRGIRGSKATVYRTLPLLAEAGILEPA-ILAGETRSYETTFGRHHHDHL 103
>gi|84497052|ref|ZP_00995874.1| putative ferric uptake regulator [Janibacter sp. HTCC2649] >gi|84381940|gb|EAP97822.1| putative ferric uptake regulator [Janibacter sp. HTCC2649] (160 aa)
Score = 84, Expect = 5.0e-01, Identities = 21/79 (26%), Positives = 43/79 (54%)
  Q:    11 LEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYEL 89
           +E L    N+R+T+ R+ +L  L+D  H  T   +I+ + ++   V+  +VY+ ++ L + G++  +    S  + YEL
  S:     5 VEDLLRGANLRVTRPRVAVLNALHDSPHADT-GTVIEQVRTRHTSVSHQAVYDCLSALTDAGLVRRIQPTGSVAR-YEL 81
>gi|110681058|ref|YP_684065.1| FUR family transcriptional regulator [Roseobacter denitrificans OCh 114] >gi|109457174|gb|ABG33379.1| transcriptional regulator, Fur family, putative [Roseobacter denitrificans OCh 114] (139 aa)
Score = 83, Expect = 5.3e-01, Identities = 26/81 (32%), Positives = 44/81 (54%)
  Q:    20 VRITKIRINILECL-NDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLY 100
           +R T+ R+ +   L  DG   H T + + D   ++GE V++++VYNT+    + G+++ V    SK  +Y   N  D H H Y
  S:    18 LRPTRQRVTLAALLIGDGQDRHVTAESLFDAAKAQGEAVSLATVYNTLRAFCDVGLVQEVTVDGSK--SYFDTNTHD-HPHFY 97
>gi|81428080|ref|YP_395079.1| FUR family transcriptional regulator [Lactobacillus sakei subsp. sakei 23K] >gi|15487829|gb|AAL00963.1|AF401675_2 putative transcriptional regulator [Lactobacillus sakei] >gi|78609721|emb|CAI54767.1| Putative transcriptional regulator, Fur family [Lactobacillus sakei subsp. sakei 23K] (144 aa)
Score = 83, Expect = 5.3e-01, Identities = 25/68 (36%), Positives = 38/68 (55%)
  Q:     8 QKLLEKLNNNKNVRITKIRINILECLNDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIE 75
           ++ L KL  N NVRIT  R  +LE +  G H H T  D+   L  +   ++V+++YN +    E G+IE
  S:     7 EQTLRKLKVN-NVRITPQRQAVLEFM-IGTHMHPTADDVYQALAGRFPNMSVATIYNNLRLFTELGVIE 73
>gi|170078257|ref|YP_001734895.1| ferric uptake regulator [Synechococcus sp. PCC 7002] >gi|169885926|gb|ACA99639.1| ferric uptake regulator [Synechococcus sp. PCC 7002] (170 aa)
Score = 83, Expect = 5.4e-01, Identities = 30/91 (32%), Positives = 47/91 (51%)
  Q:    16 NNKNVRITKIRINILEC---LNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNK 106
           N K  R+T  R  IL     L  G H  + +D+ + L  +GEK+++S+VY ++  +   GI+  +  L    + YEL   +  H HL  V  NK
  S:    16 NAKGWRLTPQREKILRTFLNLPKGEH-LSAEDLHNELLEQGEKISLSTVYRSVKLMTRMGILRELE-LAEGHKHYELNQSQAHHHHLVCVQCNK 107
>gi|167465171|ref|ZP_02330260.1| PerR [Paenibacillus larvae subsp. larvae BRL-230010] (144 aa)
Score = 83, Expect = 5.9e-01, Identities = 25/67 (37%), Positives = 35/67 (52%)
  Q:     8 QKLLEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGII 74
           ++ L KL N   VR+T  R  IL  L D     T  DI   L SK   ++V++VYN +   IE G++
  S:     6 EQALSKLKNT-GVRMTPQRHAILSYLLDSKIHPTADDIYRALESKFPNMSVATVYNNLKVFIEAGLV 71
>gi|29367094|gb|AAO38755.1| ferric uptake regulation protein [Moraxella catarrhalis] (146 aa)
Score = 83, Expect = 5.9e-01, Identities = 25/80 (31%), Positives = 45/80 (56%)
  Q:    20 VRITKIRINILECLNDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHL 99
           +++T  RI ILE L +  H H + +D+   L ++GE V +++VY  +    + GI+E  N  ++    +E++  E  H HL
  S:    13 LKVTLPRIKILELLENAEHHHMSAEDVYRALAAQGEDVGLATVYRVLTQFEQAGIVERHN-FENNLSVFEIVQDEH-HDHL 91
>gi|99080024|ref|YP_612178.1| ferric uptake regulator family protein [Silicibacter sp. TM1040] >gi|99036304|gb|ABF62916.1| ferric uptake regulator, Fur family [Silicibacter sp. TM1040] (142 aa)
Score = 83, Expect = 6.0e-01, Identities = 29/95 (30%), Positives = 48/95 (50%)
  Q:     6 ANQKLLEKLNNNKNVRITKIRINILECL-NDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLY 100
           AN+ L+E       +R T+ R+ +   L  DG H H T + + D     G  V++++VYNT+    + G+++ +    SK  +Y   N  D H H Y
  S:     9 ANKWLMEA-----GLRPTRQRVTLAALLIGDGQHRHVTAESLFDAAKDDGAAVSLATVYNTLRAFCDAGVLQEITVDGSK--SYFDTNVHD-HPHYY 97
>gi|152999924|ref|YP_001365605.1| ferric uptake regulator family protein [Shewanella baltica OS185] >gi|151364542|gb|ABS07542.1| ferric uptake regulator, Fur family [Shewanella baltica OS185] (143 aa)
Score = 83, Expect = 6.1e-01, Identities = 28/103 (27%), Positives = 55/103 (53%)
  Q:    11 LEKLNNNKNVRITKIRINILECLNDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALP 113
           ++ +  +  +++T  R  +L+ L      H TI++I   LN++GE + +++VY  +    + G++ +    +S+   YEL N +  H HL  +T  KL + A P
  S:     1 MQAVLKDSGLKVTTQRCKLLKFLTQVDKQHLTIENIYQGLNAQGETMGLNTVYRIMAHFEQAGLV-VRRLFESENAMYEL-NGKPRHEHLICLTCGKLVEFADP 102
>gi|78184355|ref|YP_376790.1| ferric uptake regulator family protein [Synechococcus sp. CC9902] >gi|78168649|gb|ABB25746.1| putative ferric uptake regulator, FUR family [Synechococcus sp. CC9902] (152 aa)
Score = 83, Expect = 6.2e-01, Identities = 25/101 (24%), Positives = 52/101 (51%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLD--KVALPKEIEKAI 120
           +R+++ R  +L+ L       + +DI + LN +G  +  +SVY  +  L   G+IE ++  + +   Y    + D H HL  + +  ++   V LP+++ + I
  S:    31 MRLSRQRRMVLDLLWSEKSHLSARDIFEKLNVQGRSIGHTSVYQNLEALQSAGVIECLDRANGRLYGY----RSDPHSHLTCLDSGLIEDIDVNLPQDLLRQI 129
>gi|21220969|ref|NP_626748.1| metal uptake regulation protein [Streptomyces coelicolor A3(2)] >gi|6752351|emb|CAB69729.1| putative metal uptake regulation protein [Streptomyces coelicolor A3(2)] (139 aa)
Score = 83, Expect = 6.5e-01, Identities = 21/79 (26%), Positives = 40/79 (50%)
  Q:    21 RITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHL 99
           R T+ R  +   L +     + +++ D L  KG+ V +++VY T+  L + G ++++ T +  E  Y   +  D H HL
  S:    11 RATRQRAAVSAALQEVEEFRSAQELHDMLKHKGDAVGLTTVYRTLQSLADAGEVDVLRTAEG-ESVYRRCSTGDHHHHL 88
>gi|160874547|ref|YP_001553863.1| ferric uptake regulator family protein [Shewanella baltica OS195] >gi|160860069|gb|ABX48603.1| ferric uptake regulator, Fur family [Shewanella baltica OS195] (143 aa)
Score = 82, Expect = 6.6e-01, Identities = 28/103 (27%), Positives = 55/103 (53%)
  Q:    11 LEKLNNNKNVRITKIRINILECLNDGYHGH-TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALP 113
           ++ +  +  +++T  R  +L+ L      H TI++I   LN++GE + +++VY  +    + G++ +    +S+   YEL N +  H HL  +T  KL + A P
  S:     1 MQAVLKDSGLKVTTQRCKLLKFLTQVDKQHLTIENIYQGLNAQGETMGLNTVYRIMAHFEQAGLV-VRRFFESENAMYEL-NGKPRHEHLICLTCGKLVEFADP 102
>gi|144899558|emb|CAM76422.1| ferric uptake regulation protein [Magnetospirillum gryphiswaldense MSR-1] (143 aa)
Score = 82, Expect = 6.9e-01, Identities = 27/101 (26%), Positives = 53/101 (52%)
  Q:    17 NKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIE 117
           +K +++T  R  I + L+D      ++++     +K  ++++++VY T+    EE I+E  +  D + + YE    E  H HL DV + ++ +   P EIE
  S:    11 DKGMKMTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRAR-YEEAPSEH-HDHLIDVNSARVIEFTSP-EIE 108
>gi|90414454|ref|ZP_01222430.1| putative zinc uptake regulation protein [Photobacterium profundum 3TCK] >gi|90324459|gb|EAS41018.1| putative zinc uptake regulation protein [Photobacterium profundum 3TCK] (148 aa)
Score = 82, Expect = 6.9e-01, Identities = 21/78 (26%), Positives = 44/78 (56%)
  Q:     5 MANQKLL----EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           MANQ  L    ++L + + VR+T  R+ +LE + + +   +  +++D L     +    ++Y  ++FL+ +G I  V + +S
  S:     1 MANQTQLLNKAQQLCDQRGVRLTPQRLKVLELIIEHHSSISAYELLDLLKVTEPQAKPPTIYRALDFLLAQGFIHKVESTNS 82
>gi|152967314|ref|YP_001363098.1| ferric uptake regulator family protein [Kineococcus radiotolerans SRS30216] >gi|151361831|gb|ABS04834.1| ferric uptake regulator, Fur family [Kineococcus radiotolerans SRS30216] (167 aa)
Score = 82, Expect = 6.9e-01, Identities = 19/67 (28%), Positives = 36/67 (53%)
  Q:    21 RITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAY 87
           R TK R  +   L++     + +D+   L ++GE V +++VY  +  L E+G ++++ T D  E  Y
  S:     7 RSTKQRSAVSAVLDEADAFLSAQDLHATLRARGENVGLATVYRALQVLAEDGDVDVLRTDDGGEAVY 73
>gi|168186769|ref|ZP_02621404.1| ferric uptake regulation protein [Clostridium botulinum C str. Eklund] >gi|169295284|gb|EDS77417.1| ferric uptake regulation protein [Clostridium botulinum C str. Eklund] (140 aa)
Score = 82, Expect = 7.1e-01, Identities = 28/82 (34%), Positives = 45/82 (54%)
  Q:    17 NKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIH 98
           N N+R TK R +I++ L D       + I D    +G+KV++S+VY T++ L E+   +I+N    ++  Y  I KE  H H
  S:     9 NNNIRSTKGRQSIIKILMDRDEPVGAEYIYDKCKREGKKVDLSTVYRTLDMLEEK---DILNKFPLEDGTYNYILKEKWHKH 87
>gi|89895668|ref|YP_519155.1| hypothetical protein DSY2922 [Desulfitobacterium hafniense Y51] >gi|109645981|ref|ZP_01369901.1| ferric uptake regulator, Fur family [Desulfitobacterium hafniense DCB-2] >gi|89335116|dbj|BAE84711.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109643930|gb|EAT53483.1| ferric uptake regulator, Fur family [Desulfitobacterium hafniense DCB-2] (144 aa)
Score = 82, Expect = 7.1e-01, Identities = 25/70 (35%), Positives = 39/70 (55%)
  Q:     5 MANQKLLEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGII 74
           M   ++L++L + K VR T  R  ILE L       T ++I  H+ +K   V++ ++YNT+N L E G I
  S:     1 MTAIEILKQLKD-KGVRFTPQRQAILEFLLGTDTHPTAEEIYHHVKAKFPGVSLGTIYNTLNMLKEHGHI 69
>gi|90019708|ref|YP_525535.1| zinc uptake regulation protein, putative [Saccharophagus degradans 2-40] >gi|89949308|gb|ABD79323.1| transcriptional regulator, Fur family [Saccharophagus degradans 2-40] (162 aa)
Score = 82, Expect = 7.2e-01, Identities = 24/75 (32%), Positives = 46/75 (61%)
  Q:     8 QKLLEK---LNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHL--NSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
            K LE+   L   +  R+T++R  ILE +   +       ++D L  NS  ++V   +VY +++FL+E+G+I  V++L++
  S:    18 HKALEQAKVLCEKQGARLTRLRRQILELVWQSHKPLGAYTLMDMLADNSDRKRVAPPTVYRSLDFLLEQGLIHKVHSLNA 97
>gi|119493486|ref|ZP_01624153.1| ferric uptake regulation protein [Lyngbya sp. PCC 8106] >gi|119452669|gb|EAW33849.1| ferric uptake regulation protein [Lyngbya sp. PCC 8106] (199 aa)
Score = 82, Expect = 7.3e-01, Identities = 35/121 (28%), Positives = 67/121 (55%)
  Q:    16 NNKNVRITKIRINILECLNDGYHGH--TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLY----------DVTNNKLDKVALPKEIEKAITDFLDSK----NLTYENIKL 136
           NNK  R+T  R  IL    +   G+  + +D+ + L S+GE +++S++Y T+  +   GI+  +  L    + YE IN+   H H +          +  N+ + K+ + K+ EK+    LD +     + YE +++
  S:    28 NNKGWRLTPQRETILHVFQNLPKGNHLSAEDLYNLLKSRGEAISLSTIYRTLKLMARLGILRELE-LAEGHKHYE-INQPYPHHHHHLVCVQCNKTIEFKNDSISKIGM-KQAEKSGLHLLDCQLTIHTVCYEALRM 161
>gi|50593433|gb|AAT79464.1| putative ferric uptake regulator [Agrobacterium luteum] (140 aa)
Score = 82, Expect = 7.3e-01, Identities = 27/104 (25%), Positives = 52/104 (50%)
  Q:    11 LEKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPK 114
           LE L   K +RIT  R  I   ++D      ++ + +  ++   ++++++VY T+    E GI++  +  D + + YE +  E  H HL DV   K+ +   P+
  S:     7 LEALCAEKGLRITDQRRVIARVISDAEDHPDVETLHERASAVDSRISIATVYRTVRLFEEAGILDRHDFGDGRAR-YEAV-PESHHDHLIDVETGKVIEFVDPE 108
>gi|29832174|ref|NP_826808.1| metal uptake regulation protein [Streptomyces avermitilis MA-4680] >gi|29609292|dbj|BAC73343.1| putative ferric uptake regulation protein [Streptomyces avermitilis MA-4680] (138 aa)
Score = 82, Expect = 7.3e-01, Identities = 21/79 (26%), Positives = 41/79 (51%)
  Q:    21 RITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHL 99
           R T+ R  +   L++     + +++ D L  KG+ V +++VY T+  L + G ++++ T D  E  Y   +  + H HL
  S:    11 RSTRQRAAVAAALDEVDEFRSAQELHDMLKHKGDSVGLTTVYRTLQNLADAGEVDVLRTSDG-ESVYRRCSSGEHHHHL 88
>gi|187778103|ref|ZP_02994576.1| hypothetical protein CLOSPO_01695 [Clostridium sporogenes ATCC 15579] >gi|187775031|gb|EDU38833.1| hypothetical protein CLOSPO_01695 [Clostridium sporogenes ATCC 15579] (105 aa)
Score = 82, Expect = 7.4e-01, Identities = 21/79 (26%), Positives = 45/79 (56%)
  Q:    14 LNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINK 92
           +N NKN+ +T+    IL  L +  +G+ I + ++ L++   K+   ++Y  I  L+++ +I+ V T D++ + Y +  K
  S:     1 MNRNKNLPLTETTYYILLALLEPGYGYIIMEKVEELSNYQVKIAAGTLYGAIENLLKQKLIKFVGTEDNRRKVYVITQK 79
>gi|160939507|ref|ZP_02086857.1| hypothetical protein CLOBOL_04400 [Clostridium bolteae ATCC BAA-613] >gi|158437717|gb|EDP15479.1| hypothetical protein CLOBOL_04400 [Clostridium bolteae ATCC BAA-613] (320 aa)
Score = 82, Expect = 7.5e-01, Identities = 26/74 (35%), Positives = 40/74 (54%)
  Q:    14 LNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAY 87
           + N+ N+RI ++ +  L    D  H  T+ DII HLN KG +    +VY   N LI+ G I+IV    ++ Q +
  S:     1 MQNSTNMRILEL-LRFLYEQTDENHPATVSDIIAHLNGKGIQAVRQTVYADTNALIDAG-IDIVVVKSTQNQYF 72
>gi|119486769|ref|ZP_01620744.1| Ferric uptake regulator (FUR) family protein [Lyngbya sp. PCC 8106] >gi|119456062|gb|EAW37195.1| Ferric uptake regulator (FUR) family protein [Lyngbya sp. PCC 8106] (137 aa)
Score = 82, Expect = 8.2e-01, Identities = 26/97 (26%), Positives = 47/97 (48%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEI 116
           +R+++ R  ILE L +     + ++I D LN +G+ +  +SVY  +  L  E IIE +    S+ + Y  I+    H++  D        + LP  +
  S:     1 MRLSRQRRFILELLWEAQEHLSAREIYDRLNQQGKAIGHTSVYQNLEALSRESIIECIER--SEGRLYGHISDSHSHVNCLDTERIVDVHIELPASV 95
>gi|163938463|ref|YP_001643347.1| ferric uptake regulator family protein [Bacillus weihenstephanensis KBAB4] >gi|166983786|ref|ZP_02255170.1| ferric uptake regulator, Fur family protein [Bacillus cereus AH187] >gi|168142628|ref|ZP_02585857.1| ferric uptake regulator, Fur family protein [Bacillus cereus G9842] >gi|168159414|ref|ZP_02594647.1| ferric uptake regulator, Fur family protein [Bacillus cereus H3081.97] >gi|163860660|gb|ABY41719.1| ferric uptake regulator, Fur family [Bacillus weihenstephanensis KBAB4] (142 aa)
Score = 82, Expect = 8.2e-01, Identities = 28/93 (30%), Positives = 47/93 (50%)
  Q:     5 MANQKLLEKLNNNKN--VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHI 97
           M  ++L E L   KN  VRIT  R  ILE L +     T  DI   L  K   ++V++VYN +    E G+++ +   D+  + ++ +  +  H+
  S:     1 MVKEELKEALEMLKNTGVRITPQRHAILEYLVESMTHPTADDIYKALEGKFPNMSVATVYNNLRVFKEVGLVKELTYGDASSR-FDYVTSQHYHV 94
>gi|33865308|ref|NP_896867.1| ferric uptake regulation protein [Synechococcus sp. WH 8102] >gi|33632477|emb|CAE07289.1| Ferric uptake regulation protein [Synechococcus sp. WH 8102] (131 aa)
Score = 82, Expect = 8.3e-01, Identities = 23/97 (23%), Positives = 49/97 (50%)
  Q:    20 VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLD--KVALPKEI 116
           +R+++ R  +L+ L       + +DI + LN++G  +  +S Y  +  L   G+IE ++  + +   Y    + D H HL  +    ++   V LP+++
  S:    10 MRLSRQRRMVLDLLWSEQSHLSARDIFEKLNARGRSIGHTSAYQNLEALQSAGVIECLDRANGRLYGY----RSDPHSHLTCLDTGVIEDIDVELPEDL 104
>gi|29346900|ref|NP_810403.1| putative surface protein [Bacteroides thetaiotaomicron VPI-5482] >gi|29338798|gb|AAO76597.1| conserved hypothetical protein, putative surface protein [Bacteroides thetaiotaomicron VPI-5482] (663 aa)
Score = 81, Expect = 8.7e-01, Identities = 38/127 (29%), Positives = 62/127 (48%)
  Q:    10 LLEKLNNNKNVRITKIRINILECLNDGYH-------GHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLD---SKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENIKL 136
           L E L N  N  + +   N   C N+ +        G T  DI  + N     VNVSS    I+F   + I +I    D   S++      +K+  +I  YD T  ++D  +L  EIE+ +T   +++++  +N KL
  S:    55 LSEGLFNQNNSSLARYSFNRQRCTNNYFSANNQRGLGDTANDIAIYGNKIYVVVNVSSTVEVIDFPTGKSIRQISMLRDNGSSRQPRAIAFDKDKAYICSYDGTVARIDTTSL--EIEEIVTVGRNAEDICVQNGKL 189
>gi|37528201|ref|NP_931546.1| zinc uptake transcriptional repressor [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36787638|emb|CAE16745.1| zinc uptake regulation protein (Zinc uptake regulator) [Photorhabdus luminescens subsp. laumondii TTO1] (170 aa)
Score = 81, Expect = 9.0e-01, Identities = 19/80 (23%), Positives = 43/80 (53%)
  Q:     3 RIMANQKLLEK---LNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           +++  +KLLE+   +   + VR T  R+ +L  +++     +  D++D L     +    ++Y  + FL+E+G I  + + +S
  S:     2 KLINQKKLLEQAEVICQARGVRFTPQRLEVLRLISEQPGAISAYDLLDLLREAEPQAKPPTIYRALEFLLEQGFIHKIESTNS 84
>gi|77463054|ref|YP_352558.1| FUR family manganese uptake regulator [Rhodobacter sphaeroides 2.4.1] >gi|126461929|ref|YP_001043043.1| ferric uptake regulator family protein [Rhodobacter sphaeroides ATCC 17029] >gi|77387472|gb|ABA78657.1| manganese uptake regulator, Fur family [Rhodobacter sphaeroides 2.4.1] >gi|126103593|gb|ABN76271.1| manganese uptake regulator, Fur family [Rhodobacter sphaeroides ATCC 17029] (137 aa)
Score = 81, Expect = 9.1e-01, Identities = 26/100 (26%), Positives = 52/100 (52%)
  Q:    18 KNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIE 117
           K +R+T+ R  I   + +      ++++    ++   ++++++VY T+    E GI+E +   D + + YE   + D H HL DVT  ++ +   P EIE
  S:    12 KGLRMTEQRRTIARVIGESADHPDVEELHARASAVDPRISIATVYRTVKLFEEAGILERLEFGDGRSR-YEDAER-DHHDHLIDVTTGEVIEFVDP-EIE 108
>gi|165870685|ref|ZP_02215338.1| transcriptional regulator, Fur family [Bacillus anthracis str. A0488] >gi|166995033|ref|ZP_02261493.1| peroxide operon regulator [Bacillus cereus AH820] >gi|167634831|ref|ZP_02393150.1| transcriptional regulator, Fur family [Bacillus anthracis str. A0442] >gi|167640862|ref|ZP_02399121.1| transcriptional regulator, Fur family [Bacillus anthracis str. A0193] >gi|167935390|ref|ZP_02522465.1| peroxide operon regulator [Bacillus cereus AH1134] >gi|168136325|ref|ZP_02579554.1| peroxide operon regulator [Bacillus cereus B4264] >gi|170688555|ref|ZP_02879761.1| transcriptional regulator, Fur family [Bacillus anthracis str. A0465] >gi|177655124|ref|ZP_02936754.1| transcriptional regulator, Fur family [Bacillus anthracis str. A0174] >gi|190568210|ref|ZP_03021119.1| transcriptional regulator, Fur family [Bacillus anthracis Tsiankovskii-I] >gi|196034706|ref|ZP_03102114.1| transcriptional regulator, Fur family [Bacillus cereus W] >gi|196040229|ref|ZP_03107531.1| transcriptional regulator, Fur family [Bacillus cereus NVH0597-99] >gi|196045260|ref|ZP_03112492.1| transcriptional regulator, Fur family [Bacillus cereus 03BB108] >gi|164713519|gb|EDR19043.1| transcriptional regulator, Fur family [Bacillus anthracis str. A0488] >gi|167511256|gb|EDR86643.1| transcriptional regulator, Fur family [Bacillus anthracis str. A0193] >gi|167529905|gb|EDR92653.1| transcriptional regulator, Fur family [Bacillus anthracis str. A0442] >gi|170667415|gb|EDT18172.1| transcriptional regulator, Fur family [Bacillus anthracis str. A0465] >gi|172080273|gb|EDT65363.1| transcriptional regulator, Fur family [Bacillus anthracis str. A0174] >gi|190560702|gb|EDV14678.1| transcriptional regulator, Fur family [Bacillus anthracis Tsiankovskii-I] >gi|195992749|gb|EDX56709.1| transcriptional regulator, Fur family [Bacillus cereus W] >gi|196023844|gb|EDX62519.1| transcriptional regulator, Fur family [Bacillus cereus 03BB108] >gi|196029084|gb|EDX67689.1| transcriptional regulator, Fur family [Bacillus cereus NVH0597-99] (142 aa)
Score = 81, Expect = 9.4e-01, Identities = 28/93 (30%), Positives = 47/93 (50%)
  Q:     5 MANQKLLEKLNNNKN--VRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHI 97
           M  ++L E L   KN  VRIT  R  ILE L +     T  DI   L  K   ++V++VYN +    E G+++ +   D+  + ++ +  +  H+
  S:     1 MVKEELKEALEMLKNTGVRITPQRHAILEYLVESMTHPTADDIYKALEGKFPNMSVATVYNNLRVFKEVGLVKELTYGDASSR-FDYVTSQHYHV 94
>gi|163938880|ref|YP_001643764.1| PadR-like family transcriptional regulator [Bacillus weihenstephanensis KBAB4] >gi|163861077|gb|ABY42136.1| transcriptional regulator, PadR-like family [Bacillus weihenstephanensis KBAB4] (104 aa)
Score = 81, Expect = 9.4e-01, Identities = 20/86 (23%), Positives = 46/86 (53%)
  Q:    14 LNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHL 99
           +N +KN+ +T+    +L  L +  HG+ I   ++ L++   K+   ++Y  +  L+++ +IE V + D + + Y +  +    +HL
  S:     1 MNRDKNLPLTETTYYVLLALLEPAHGYLIMQKVEELSNHQVKIAAGTLYGAVENLLKQQLIESVKSEDKRRKVYVITERGKEVLHL 86
>gi|67155928|ref|ZP_00417555.1| zinc uptake regulation protein, putative [Azotobacter vinelandii AvOP] >gi|67086872|gb|EAM06340.1| zinc uptake regulation protein, putative [Azotobacter vinelandii AvOP] (161 aa)
Score = 81, Expect = 9.4e-01, Identities = 19/71 (26%), Positives = 41/71 (57%)
  Q:    12 EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSK-GEKVNVSSVYNTINFLIEEGIIEIVNTLDS 82
           E L + + VR+T +R  +LE +   +      DI+  L+ + G +    +VY  ++FL+E+G++  + +L++
  S:    25 ENLCSRQGVRLTALRRRVLELVWQSHRPLGAYDILAVLSEQDGRRAAPPTVYRALDFLLEQGLVHRIASLNA 96
>gi|183600459|ref|ZP_02961952.1| hypothetical protein PROSTU_04035 [Providencia stuartii ATCC 25827] >gi|188019943|gb|EDU57983.1| hypothetical protein PROSTU_04035 [Providencia stuartii ATCC 25827] (171 aa)
Score = 81, Expect = 9.6e-01, Identities = 24/95 (25%), Positives = 46/95 (48%)
  Q:     5 MANQKLL---EKLNNNKNVRITKIRINILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHL 99
           M+  KLL   EK+  ++ VR+T  R  +L  +   +   +  D++D L     +    ++Y  + FLIE+G I  + + +S    +   N   + + L
  S:     4 MSEDKLLVMAEKICQSRGVRLTPQRETVLRLIAQQHGAISAYDLLDLLREVEPQAKPPTIYRGLEFLIEQGFIHKIESTNSYVICHHFDNPSHISVML 101
>gi|196177292|gb|EDX72299.1| haemagglutination activity domain protein [Microcoleus chthonoplastes PCC 7420] (1281 aa)
Score = 81, Expect = 9.8e-01, Identities = 28/116 (24%), Positives = 60/116 (51%)
  Q:    29 ILECLNDGYHGHTIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYE-LINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENIKLDIYAKKKK 144
           +++ L D + G  I+++I  L+S    V V+++Y+   FLIE+  + ++ +L   +  YE + N E L +     T +K    A+P E+ +   D    K+   E+  ++   ++++
  S:   997 LVKPLEDEFQGQGIENLIFLLDSNLRSVPVAALYDGEQFLIEKYSVGLMPSLSLTDTRYEPVTNMEVLAMGASQFT-DKQPLPAVPVELSEITQDIWQGKSFLNESFTVNNLKQQQQ 1112
>gi|15838935|ref|NP_299623.1| FUR family transcriptional regulator [Xylella fastidiosa 9a5c] >gi|9107518|gb|AAF85143.1|AE004045_1 transcriptional regulator (Fur family) [Xylella fastidiosa 9a5c] (164 aa)
Score = 81, Expect = 9.9e-01, Identities = 39/140 (27%), Positives = 69/140 (49%)
  Q:     5 MANQKLLEK---LNNNKNV--RITKIRINILECLNDGYHGH--TIKDIIDHLNSKGEKVNVSSVYNTINFLIEEGIIEIVNTLDSKEQAYELINKEDLHIHLYDVTNNKLDKVALPKEIEKAITDFLDSKNLTYENIKLDIYAKKKK 144
           M N   +EK   LN+ + V  ++T  RI ILE L      H  + +DI   L  +G ++ +++VY  +      G++ + +  +S +  YE I++   H H+ DV   K+ +    +EIE         +    E   L +Y +KK+
  S:    19 MLNGPSIEKSMELNDLRKVGLKVTHPRIRILELLEQSSSEHHLSAEDIYRQLLEQGNEIGLATVYRVLTQFEAAGLV-LKHNFESGQAVYE-IDRGGHHDHMVDVDTGKIIEFH-NEEIELLQRSIAAERGYELEEHSLVLYVRKKR 162