>gi|26553575|ref|NP_757509.1| transporter [Mycoplasma penetrans HF-2] >gi|26453581|dbj|BAC43913.1| predicted transporter [Mycoplasma penetrans HF-2] (463 aa)
Score = 1899, Expect = 0.0e+00, Identities = 463/463 (100%), Positives = 463/463 (100%)
  Q:     1 MNNINQNTLEIIINLIIFVIVFSMSLFFIFRLKNVTKGYKIFFVSYVLFWIPLKMLREYTSVVQNNIDSSIVWLPLMVYGLIGVFIRPFVDYLSLSLKNRKIILYGAVVAGIISFIPMTITQNTVTNTIQSIGVGVGASMIGTYELMFKEQYTRNRSFLTVSIMAFPPLLADFIGAPIQSIIKVSAISSANNNSYLFYLSIMWMLAIVVFIGVFVILYTVKEDRNLVGFLGNNNKIEKTKSQMTFFVILCLVGFLIAFIKFSNSGSIATLTIEHLAANQGISNQISSIQGYIASLFSLFQLLGTICLSWFLIKKNNKMLAFTVGIILWIVFELVISFNTNPYVYFGVSALNGFAYGILYNLVLAYVLTLSFDNKKLKNGKYELRKISPMGIYQSILAIGIASSSFFTSYLKQALKTDNNYMVVNLSILAFIVALEIMYFVVYVLDKKTISKNKFVIKDAVSSK 463
           MNNINQNTLEIIINLIIFVIVFSMSLFFIFRLKNVTKGYKIFFVSYVLFWIPLKMLREYTSVVQNNIDSSIVWLPLMVYGLIGVFIRPFVDYLSLSLKNRKIILYGAVVAGIISFIPMTITQNTVTNTIQSIGVGVGASMIGTYELMFKEQYTRNRSFLTVSIMAFPPLLADFIGAPIQSIIKVSAISSANNNSYLFYLSIMWMLAIVVFIGVFVILYTVKEDRNLVGFLGNNNKIEKTKSQMTFFVILCLVGFLIAFIKFSNSGSIATLTIEHLAANQGISNQISSIQGYIASLFSLFQLLGTICLSWFLIKKNNKMLAFTVGIILWIVFELVISFNTNPYVYFGVSALNGFAYGILYNLVLAYVLTLSFDNKKLKNGKYELRKISPMGIYQSILAIGIASSSFFTSYLKQALKTDNNYMVVNLSILAFIVALEIMYFVVYVLDKKTISKNKFVIKDAVSSK
  S:     1 MNNINQNTLEIIINLIIFVIVFSMSLFFIFRLKNVTKGYKIFFVSYVLFWIPLKMLREYTSVVQNNIDSSIVWLPLMVYGLIGVFIRPFVDYLSLSLKNRKIILYGAVVAGIISFIPMTITQNTVTNTIQSIGVGVGASMIGTYELMFKEQYTRNRSFLTVSIMAFPPLLADFIGAPIQSIIKVSAISSANNNSYLFYLSIMWMLAIVVFIGVFVILYTVKEDRNLVGFLGNNNKIEKTKSQMTFFVILCLVGFLIAFIKFSNSGSIATLTIEHLAANQGISNQISSIQGYIASLFSLFQLLGTICLSWFLIKKNNKMLAFTVGIILWIVFELVISFNTNPYVYFGVSALNGFAYGILYNLVLAYVLTLSFDNKKLKNGKYELRKISPMGIYQSILAIGIASSSFFTSYLKQALKTDNNYMVVNLSILAFIVALEIMYFVVYVLDKKTISKNKFVIKDAVSSK 463
>gi|31544756|ref|NP_853334.1| permease [Mycoplasma gallisepticum R] >gi|31541602|gb|AAP56902.1| predicted permease [Mycoplasma gallisepticum R] (500 aa)
Score = 580, Expect = 1.0e-57, Identities = 145/449 (32%), Positives = 277/449 (61%)
  Q:     9 LEIIINLIIFVIVFSMSLFFIFRLKNVTKGYKIFFVSYVLFWIPLKMLREYTSVVQNNI--DSSIVWLPLMVYGLIGVFIRPFVDYLSLSLKNRKIILYGAVVAGIISFIPMTITQNTVTNTIQSIGVGVGASMIGTYELMFKEQYTRNRSFLTVSIMAFPPLLADFIGAPIQSIIKVSAISSANNNSYLFYLSIMWMLAIVVFIGVFVILYTVKEDRNLVGFLGNNNK--IEKTKSQMTFFVILCLVGFLIAFIKFSNSGSIATLTIEHLAANQGISNQISSIQGYIASLFSLFQLLGTICLSWFLIKKNNKMLAFTVGIILWIVFE----LVISFNTNPY-----VYFGVSALNGFAYGILYNLVLAYVLTLSFDNKKLKNGKYELRKISPMGIYQSILAIGIASSSFFTSYLKQALKTD--NNYMVVNLSILAFIVALEIMYFVVYVLDKKTISKNKFVIK 457
           + +IIN+++F+    +S+ F +R+K   KGYK  FV Y +FW+P+ ++R Y   + N++  D ++++LPL +YG +G+F RP  DYL +  K+RK +++ A++  + +FIP+ I  +  TN IQ+IGVG+ AS IG++ L F EQ+ + + FL +SI++ PPL+ADF+ +P+QS+++  AI++    + +     +W++ ++V +   V  + ++E+   VG   ++ K  I+ + +++  F+++ L   ++ F KF+ +  IA +T++ L  N    +  +  +GY++S+FS  QLLG + +    +K  +K +   +G I ++++     L+I+  + P      +Y G+ A++GF YGILYNL++A+ L+  F N           KI+P+GI Q++ +I I S++FFT++++  + +D      V++  ++  ++A   +YF    +D     K  F IK
  S:    46 ISLIINVVLFLFALIISIIFFWRIKFENKGYKKLFVFYSIFWLPIFLVRSYRGTLHNDLALDRNLLFLPLSLYGFVGIFFRPLFDYLGIRFKSRKKVVFAALLLQLATFIPIIIKPSFATNLIQTIGVGIAASCIGSFSLWFNEQHAKEKPFLAISILSIPPLIADFVASPVQSLVRTLAITT-QRTADVNITKYLWLIGLIVILINIVFWWFLRENPQFVGLKKHDPKDIIDGSPNKIYCFIVVILFAGIVIFTKFATADGIAQITLQQLVGN----SNSAPYEGYLSSVFSAAQLLGGVLMGVVGVKYFDKWMVALIGSIFFVLYNTSMILLINSTSVPTLTKGGIYLGIQAISGFGYGILYNLLIAHALSYGFKNN----------KITPIGINQTMASIAITSANFFTTFIRDKISSDFAKANTVISYILIGTVLAGLSLYFFNSWIDHDKKLKPIFWIK 494
>gi|160946393|ref|ZP_02093602.1| hypothetical protein PEPMIC_00353 [Peptostreptococcus micros ATCC 33270] >gi|158447509|gb|EDP24504.1| hypothetical protein PEPMIC_00353 [Peptostreptococcus micros ATCC 33270] (414 aa)
Score = 234, Expect = 1.5e-17, Identities = 99/382 (25%), Positives = 186/382 (48%)
  Q:    19 VIVFSMSLFFIFRLKNVTKGYKIFFVSYVLFWIPLKMLREY------TSVVQNNIDSSIVWLPLMV--YGLIGVFIRPFVDYLSLSLKNRKIILYGAVVAGIISFIPMTITQNTVTNTIQSIGVGVGASMIGTYELMFKEQYTRNRSFLTVSIMAFPPLLADFIGAPIQSIIKVSAISSANNNSYLFYLSIMWMLAIVVFIGVFVILYTVKEDRNLVGFLGNNNKIEKTKSQMTF--FVILCLVGFLIAFIKFSNSGSIATLTIEHLAANQGISNQISSIQGYIASLFSLFQLLGTICLSWFLIKKNNKMLAFTVGIILWIVFELVISFNTNPYVYFGVSALNGFAYGILYNLVLAYVLTLSFDNKKLKNGKYELRKISPMGIYQSILAIGI 400
           +I+  + ++FI +  ++ K  KI F  +VLFW  + ++R Y      + + +  +  S++    +   YGLI  FIR  +  LS     +KI +  A+    ++ + + +  +  T    SI +G+ ASM+  + ++F E +++ ++ ++ SI++  PLLA+FI APIQ +   S   +  N        ++W L+  + I  FV+ + V++    V +       EK K    F  ++ +CL+  L++FIKFS SG+        +A  +   N       YI  LF+  QL+ ++    +   K        +G+   +VF ++I    +    F     NGF YGI Y  +++  + + +  K+ +N          MGI+Q   A+G+
  S:     2 IILTFIIIYFISKKYDLDKNQKIIFWLFVLFWSGITVVRAYRKLYAISPMEEGGLGFSVILAAQITSAYGLISCFIRLPIFILSDIFNRKKIFIQIALFVLTLASLMVVLKPSYNTLYFSSIAMGICASMLAVFNVLFSETFSKEKAAISASILSIAPLLAEFIAAPIQYL---STYGTYKN------FKLLWALSASISIVAFVLTFFVRD----VSYSAKRFSFEKVKKVFEFKGYLYICLIAILVSFIKFSTSGA------NMIAYAKVNLNMPPIFLAYIDVLFAFPQLIASVLAGTYFANKIGIEKTLVLGLGSNLVFYIIILLTNSYLPAFLGYVFNGFGYGIAYTCLIS--MAMQYFEKEDRN--------VSMGIFQLFFAMGV 364
>gi|188159577|ref|ZP_02998751.1| hypothetical protein Mmycm_02961 [Mycoplasma mycoides subsp. mycoides LC str. GM12] (496 aa)
Score = 98, Expect = 8.1e-02, Identities = 54/199 (27%), Positives = 107/199 (53%)
  Q:    17 IFVIVFSMSLFFIFRLKNVTKGYKIFFVSYVLFWIPLKMLREYTSVVQNNIDSSI----------VWLPLMVYGLIGVFIRPFVDYLSLSLKNRKIILYGAVVAGIISFIPMTITQNTVTNTI-QSIGVGVGASMIGTYELMFKEQYTRNRSFLTVSIMA-FPPLLADFIGAPIQSIIKVSAISSANN--NSYLFYLSIMWMLAIVVFIGVFV 215
           + ++++ +   ++F   +++K   +F++    FWI +  L     ++ N IDS I          + L L  Y L    + PF  +L+L L++R+I ++ ++ +  +S +   ++   +T+ I  S+ + VG S    Y L F EQ+      +  SI A F    A FI   + S++ ++ IS+ NN  N  +F LS++ ++ I + + +FV
  S:    12 LLIVIWLIVASYLFYKNSISKQKGLFYLEISSFWIVINFL---IQIITNYIDSPILKSFSSSTLTILLFLSSYFLYATILNPFALWLTLKLQSRRIWIWISLFSCFLSVMIAFLSNVNITSIIFISLFLAVGISAQIIYFLFFNEQFNERLFPVFSSIKAGFVISFATFISYEVYSLLNLNLISNHNNYTNWIIFSLSLVCLI-ICLVVSIFV 220
>gi|110004342|emb|CAK98680.1| hypothetical transmembrane protein [Spiroplasma citri] (507 aa)
Score = 94, Expect = 2.2e-01, Identities = 51/236 (21%), Positives = 93/236 (39%)
  Q:   129 IQSIGVGVGASMIGTYELMFKEQYTRNR-SFLTVSIMAFPPLLADFIGAPIQSIIKVSAISSANNNSYLFYLSIMWMLAIVVFIGVFVILYTVKEDRNLVGFLGNNNKIEKTKSQMTFFVILCLVGFLIAFIKFSNSGSIATLTIEHLAANQGISNQISSIQGYIASLFSLFQLLGTICLSWFLIKKNNKMLAFTVGIILWIVFELVISFNTNPYVYFGVSALNGFAYGILYNLVLA 364
           I +I +G G     +Y L + E Y R    F T+S++A     A   G+   +I  V  I S   N     +  +  +  +    +   L++ KE  +   F     K+ +        +I  +   +I   + S S     L  +H         +++        LF + Q  G       L  K      F +G++LW +F  + +FN +P  Y  +  +NG A+ + +N++ A
  S:   140 IAAIFLGFGIITKASYFLSYNEAYGRKFFPFKTISLVAPLMTFALIFGSEFNNI--VITIGSNLTNHLQIGIIGIGAIVAIAGANILYALFSHKEFTS-TSFTVEQQKMFEPFKWGKVLIIFFMAILIIILKEVSQSNIYIWLLGQHTWEKYHDVWKVNQFVRLNEQLFLIPQFFGAYLACHLLYNKIGVKYCFGLGLLLWFIFFSITAFNHSPEAYLALQVINGLAFAMCFNILFA 373
>gi|83320008|ref|YP_424572.1| hypothetical protein MCAP_0604 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283894|gb|ABC01826.1| membrane protein, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (499 aa)
Score = 93, Expect = 3.2e-01, Identities = 57/240 (23%), Positives = 114/240 (47%)
  Q:    17 IFVIVFSMSLFFIFRLKNVTKGYKIFFVSYVLFWIPLKMLREYTSVVQNNIDSSI----------VWLPLMVYGLIGVFIRPFVDYLSLSLKNRKIILYGAVVAGIIS-FIPMTITQNTVTNTIQSIGVGVGASMIGTYELMFKEQYTRNRSFLTVSIMA-FPPLLADFIGAPIQSIIKVSAISSANNNSYLFYLSIMWMLAIVVFIGVFVILYTVKEDRNLVGFLGNNNKIEKTKSQMTFFVILCLVGFLI 256
           + +I++ +   ++F   +++K   +F++    FWI +  L     +V N++DS I          V L L  Y L    + P   +L+L L++R+I ++  + +  IS  I    + N       ++ +GVG S    Y L F EQ+      +  SI A F    A F+   I S++ ++ +SS  +    F    +++L+++  +   V+   +KE +  V    ++   +  +      + L ++ FLI
  S:    15 LLIIIWLIVAIYLFYKNSISKQKGLFYLEISSFWIVINFL---IQIVTNSVDSPILKTLPSSILTVLLFLTSYFLYATILNPLALWLTLKLQSRRIWIWIGLFSCFISIMIAFLSSINIAALIFITLFIGVGISCQIIYFLFFNEQFNERLFPVFSSIKAGFVVSFASFVSYQIYSLLNLNLVSSQAS----FTTWPIFVLSLICLLTCLVVSIFIKERKTKVVKYKDDIVEQLQRYDYKVLIGLIVISFLI 259
>gi|42560923|ref|NP_975374.1| hypothetical protein MSC_0383 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492420|emb|CAE77016.1| hypothetical transmembrane protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] (500 aa)
Score = 93, Expect = 3.4e-01, Identities = 60/213 (28%), Positives = 110/213 (51%)
  Q:    12 IINLIIFVIVFSMSLFFIFRLKNVTKGYKIFFVSYVLFWIPLKMLREYTSVVQNNIDSSI----------VWLPLMVYGLIGVFIRPFVDYLSLSLKNRKIILYGAVVAGIISFIPMTITQNTVTNTI-QSIGVGVGASMIGTYELMFKEQYTRNRSFLTVSIMA-FPPLLADFIGAPIQSIIKVSAISSANNNSYLFYLSIMWMLAIVVFIGVFVILYTVKEDR 224
           IIN ++ VI   ++ +  ++  +++K   +F++    FWI +  L     ++ N IDS I          + L L  Y L    + P   +L+L L++R+I ++ ++ +  +S +   ++   +T+ I  S+ + VG S    Y L F EQ+      +  SI A F    A FI   I S++ ++ I   N+NSY  +  I++ L++V  I   V+   VKE +
  S:    12 IINPLLIVIWLVVASYLFYK-NSISKQKGLFYLEISSFWIVINFL---IQIITNYIDSPILKSFSSSTLTILLFLSSYFLYATILNPLALWLTLKLQSRRIWIWISLFSCFLSIMIAFLSNVNITSIIFISLFLAVGISAQIIYFLFFNEQFNERLFPVFSSIKAWFVVSFATFISYEIYSLLNLNLI--FNHNSYTNW--IIFSLSLVCLIICLVVSIFVKERK 228
>gi|119871652|ref|YP_929659.1| major facilitator superfamily permease [Pyrobaculum islandicum DSM 4184] >gi|119673060|gb|ABL87316.1| permease (major facilitator superfamily) [Pyrobaculum islandicum DSM 4184] (261 aa)
Score = 90, Expect = 7.0e-01, Identities = 29/75 (38%), Positives = 48/75 (64%)
  Q:   295 LFSLFQLLGTICLSWFLIKKNNKMLAFTVGIILWIVFELVISFN-TNPYVYFGVSALNGFAYGILYNLVLAYVLTL 369
           LF++F LLG I  S F+ +K   ++  T+GIIL+I+  L+I+   +N  ++F V+ L G A+GI+Y    A++  L
  S:   123 LFAVFDLLGIIA-SGFVAEKVGNVVPITLGIILFIIGALLINQALSNVPMFFAVAILTGLAHGIVYTPEAAFLAEL 197
>gi|195573777|ref|XP_002104868.1| GD21187 [Drosophila simulans] >gi|194200795|gb|EDX14371.1| GD21187 [Drosophila simulans] (360 aa)
Score = 90, Expect = 7.8e-01, Identities = 36/162 (22%), Positives = 75/162 (46%)
  Q:    76 LMVYGLIGVFIRPFV-DYLSLSLKNRKIILYGAVVAGIISFIPMTITQNTVTNTIQ-SIGVGVGASMIGTYELMFKEQYTRNRSFLTVSIMAFPPLLADFIGAPIQSIIKVSAISSANNNSYLFYLSIMWMLAIVVFIGVFVILYTVKEDRNLVGFLGNNNKIE 237
           +M   + G+F+  ++  Y+S  +  R+++LYG   +  + FI M +T   + N I   +G+ VGA     Y  + +    R+R+        F  + A ++ A    ++  +   S  +  +  +  ++ +  +  FIG  ++LY  +  + L+    NN  IE
  S:    72 MMAASVTGIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFILMFVTSVWLFNIINLLVGISVGAVSAALYAYLSEFNIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSSNWAISIGDFVFRPWRLLLLVSLLPGFIGGLILLYYPESPKLLLSQEKNNEAIE 235
>gi|158522289|ref|YP_001530159.1| transport protein, putative [Desulfococcus oleovorans Hxd3] >gi|158511115|gb|ABW68082.1| transport protein, putative [Desulfococcus oleovorans Hxd3] (835 aa)
Score = 89, Expect = 9.8e-01, Identities = 30/106 (28%), Positives = 54/106 (50%)
  Q:    55 MLREYTSVVQNNIDSSIVWLPLMVYGLIGVFIRPFVDYLSLSLKNRKIILYGAVVAGIISFIPMTITQNTVTNTIQSIGVGVGASMIGTYELMFKEQYTRNRSFLT 160
           ML  Y +++Q+  DS I+ L L++  L+G+F+  F  +    +     +L  AVV G++ ++   +   T+T  I SI VG+       Y   F+E++    S+ T
  S:   660 MLVLYNNMLQSLFDSQILTLGLVLIALMGMFLVLFRSFKVSVIAIVPNLLSIAVVLGVMGWLGFPLDMMTIT--IASISVGIAVDDTIHYIHRFREEFAATGSYYT 763