>gi|26553576|ref|NP_757510.1| bifunctional GMP synthase/glutamine amidotransferase protein [Mycoplasma penetrans HF-2] >gi|44887963|sp|Q8EWS9|GUAA_MYCPE GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|26453582|dbj|BAC43914.1| GMP synthase [Mycoplasma penetrans HF-2] (511 aa)
Score = 2693, Expect = 0.0e+00, Identities = 511/511 (100%), Positives = 511/511 (100%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE
  S:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
>gi|15895957|ref|NP_349306.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium acetobutylicum ATCC 824] >gi|24211761|sp|Q97FM9|GUAA_CLOAB GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|15025732|gb|AAK80646.1|AE007767_11 GMP synthase [Clostridium acetobutylicum ATCC 824] (510 aa)
Score = 1538, Expect = 9.1e-169, Identities = 296/511 (57%), Positives = 377/511 (73%)
  Q:     1 MDK--ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           MDK  +L++DFGGQY QLIARR+R+ NVY EIV Y  SI++I +K P  +I +GG +SVYG+ S + +K I+DL +P+LGICYG Q++    GG+V    +  EYG TD+ L +  ELFE I+++N+CWMSH+D V  +P+GFKV+  TN C VA+  N EKK YGVQFHPEV  T FG QL  NF++ IC +  DW   +   EKI+EIK IV D  VLCA+SGGVDS VAAVL  +AIG +L CVFVDHGLLRK+E  +V ++ +K    N+  V+ K  FL KLKG+ DPE+KRKIIG+ FI VFE+ ANK+     +L+QGTIYPD+VESG+  S TIKSHHNVGGLPE +QFEL+EPL+ LFKDEVR +G  L IP++ V+RQPFPGPGL +RVLGE+TE+KLEIVREAD +FR  I       E K WQYF  L N  SVGV+GD R+Y  T+ALRAV S DAM++ W +IP E L+K+S  I N+VK ++R+VYD+T+KPP TIEWE
  S:     1 MDKQLVLVIDFGGQYNQLIARRVREHNVYCEIVPYTYSIDKIKEKKPSAVIFTGGQNSVYGEDSPRMDKEIFDLGVPVLGICYGHQLITYTLGGEVMG-SEIREYGKTDVTLDSVCELFEGIDIENSCWMSHTDRVAKVPEGFKVVGHTNVCPVAAMANTEKKIYGVQFHPEVLHTPFGEQLFSNFLFKICGLKEDWSMSSFAKEKIQEIKDIVGDKKVLCALSGGVDSSVAAVLVHKAIGKQLTCVFVDHGLLRKDEGDQVESIFRKQFDMNLIRVNAKDRFLGKLKGISDPERKRKIIGEEFIRVFEEEANKLG-QIDFLVQGTIYPDVVESGTDTSATIKSHHNVGGLPEDMQFELIEPLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLGIRVLGEVTEEKLEIVREADAIFREEIAN--AGLEEKIWQYFACLPNIHSVGVMGDGRTYCETIALRAVTSSDAMTSDWARIPYEVLDKVSRRIVNEVKGVNRIVYDVTSKPPATIEWE 510
>gi|168186048|ref|ZP_02620683.1| GMP synthase [Clostridium botulinum C str. Eklund] >gi|169296037|gb|EDS78170.1| GMP synthase [Clostridium botulinum C str. Eklund] (512 aa)
Score = 1508, Expect = 2.8e-165, Identities = 288/508 (56%), Positives = 375/508 (73%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFGGQY QLIARR+R+ NVY EI+ Y  S+E+I KKNPK II +GG +SVYG+ + +  K I++L +P+LGICYG Q+     GG+VE+  D  EYG T++++  N  LF+ I+  +  WMSH+D V  +P+GFK+IA+T++C VA+  N EKK YGVQFHPEV  T FG ++L NF++ I D+  DW   +   EKI+ IK +V D  VLCA+SGGVDS VAAVL  +AIG +L CVFVDHGLLRK+E  +V  + KK    N+  V+  + FL KLKGV DPE+KRKIIG+ FI VFE+ ANK+     +L+QGTIYPD+VESG+  S TIKSHHNVGGLPE +QF L+EPL+ LFKDEVR +G  L IP++ V+RQPFPGPGLA+RVLGEIT++KLEI READ +FR  I       E K WQYF  L N +SVGV+GD R+Y +T+ALRAV S DAM++ W +IP E L+K+S  I N+VK ++R+VYD+T+KPP TIEWE
  S:     8 VLVVDFGGQYNQLIARRVREHNVYCEIIPYTTSVEDIKKKNPKAIIFTGGPNSVYGEGTPRVEKEIFELGVPVLGICYGHQLTAYTLGGKVES-PDIREYGKTEVKIDNNSPLFDGIKEADQSWMSHTDYVSEIPEGFKIIATTDQCPVAAMANEEKKIYGVQFHPEVEHTLFGQKMLGNFLFKIADLKADWSMASFAEEKIKAIKELVGDKKVLCALSGGVDSSVAAVLVHKAIGKQLTCVFVDHGLLRKDEGDQVETIFKKQFDMNLIRVNAGERFLGKLKGVSDPEKKRKIIGEEFIRVFEEEANKLG-QIDFLVQGTIYPDVVESGTNTSATIKSHHNVGGLPEDMQFSLIEPLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEITDEKLEITREADAIFREEI--ALAGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLDKVSRRIVNEVKGVNRIVYDVTSKPPATIEWE 512
>gi|28211997|ref|NP_782941.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium tetani E88] >gi|44887955|sp|Q891G7|GUAA_CLOTE GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|28204440|gb|AAO36878.1| GMP synthase (glutamine-hydrolyzing) [Clostridium tetani E88] (510 aa)
Score = 1499, Expect = 3.8e-164, Identities = 286/508 (56%), Positives = 379/508 (74%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + I+DFGGQY+QLIARR+R+ NVY EI+ Y  SIE+I +KNPKGII SGG +SVYG+ S + +K I+++++P+LGICYG Q+     GG+VE+ K   EYG T + L     LFE I+    CWMSH+D V  +P GF ++A T+ C VA+  N +KK YGVQFHPEV  T FG ++L+NF+++IC++ GDW   +   EKI+EI+ +V D  V+CA+SGGVDS VAAV+  +AIGD+L C+FVDHGLLRK+E  +V ++ K+    N+  V+ +  FL KLKGV +PE+KRKIIG+ FI VFE+ ANK+     YL+QGTIYPD+VESG+  S TIKSHHNVGGLPE ++FEL+EPL+ LFKDEVR++G  L IP++ V+RQPFPGPGL +RVLGE+TE+KLEIVREAD +FR  I       + K WQYF  L N +SVGV+GD R+Y +T+ LRAV+S D M++ W KIP E L+K+S  I N+VK ++R+VYDIT+KPP TIEWE
  S:     6 VFIIDFGGQYSQLIARRVRENNVYCEIIPYSTSIEKIKEKNPKGIIFSGGPNSVYGENSPRISKEIFEIDVPVLGICYGQQLASFILGGKVESAK-VREYGKTAVNLDNKCALFEGIDKVQECWMSHTDYVSEIPSGFNIVAYTDGCKVAAMANEDKKIYGVQFHPEVEHTPFGKKMLKNFLFNICELKGDWSVTSFAEEKIKEIRELVGDKKVICALSGGVDSSVAAVIVHKAIGDQLTCIFVDHGLLRKDEGDQVESIFKEKFQMNLIRVNAQDRFLGKLKGVTEPERKRKIIGEEFIRVFEEEANKLG-KIDYLVQGTIYPDVVESGTDTSATIKSHHNVGGLPEDIEFELIEPLRELFKDEVRRVGEELGIPHKLVWRQPFPGPGLGIRVLGEVTEEKLEIVREADAIFREEIAN--AGLDEKIWQYFACLPNIRSVGVMGDERTYSHTIGLRAVNSSDGMTSDWAKIPYEVLDKVSIRIVNEVKGVNRIVYDITSKPPSTIEWE 510
>gi|118443777|ref|YP_878930.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium novyi NT] >gi|118134233|gb|ABK61277.1| GMP synthase [Clostridium novyi NT] (512 aa)
Score = 1496, Expect = 6.8e-164, Identities = 286/508 (56%), Positives = 373/508 (73%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFGGQY QLIARR+R+ NVY EI+ Y  S+E+I KKNPK II +GG +SVYG+ + +  K I++L +P+LGICYG Q+     GG+VE+  D  EYG T++++   + LF+ I+  +  WMSH+D V  +P+GFK+IA+T++C VA+  N EKK YGVQFHPEV  T FG ++L NF++ +  +  DW   +   EKI+ IK +V D  VLCA+SGGVDS VAAVL  +AIG +L CVFVDHGLLRK+E  +V A+ KK    N+  V+  + FL KLKGV DPE KRKIIG+ FI VFE+ A K+     +L+QGTIYPD+VESG+  S TIKSHHNVGGLPE +QF L+EPL+ LFKDEVR +G  L IP++ V+RQPFPGPGLA+RVLGEITE+KLEI READ +FR  I       E K WQYF  L N +SVGV+GD R+Y +T+ALRAV S DAM++ W +IP E L+K+S  I N+VK ++R+VYD+T+KPP TIEWE
  S:     8 VLVVDFGGQYNQLIARRVREHNVYCEIIPYTTSVEDIKKKNPKAIIFTGGPNSVYGEGTPRVEKEIFELGVPVLGICYGHQLTAYTLGGKVES-PDIREYGKTEVKIDNKSPLFDGIKEADQSWMSHTDYVSEIPEGFKIIATTDQCPVAAMANEEKKIYGVQFHPEVEHTLFGQKMLGNFLFKVAGLKADWSMASFAEEKIKAIKELVGDKKVLCALSGGVDSSVAAVLVHKAIGKQLTCVFVDHGLLRKDEGDQVEAIFKKQFDMNLIRVNAGERFLGKLKGVSDPETKRKIIGEEFIRVFEEEAGKLG-QIDFLVQGTIYPDVVESGTNTSATIKSHHNVGGLPEDMQFSLIEPLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEITEEKLEITREADAIFREEI--ALAGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLDKVSRRIVNEVKGVNRIVYDVTSKPPATIEWE 512
>gi|182625513|ref|ZP_02953284.1| GMP synthase [Clostridium perfringens D str. JGS1721] >gi|177909201|gb|EDT71666.1| GMP synthase [Clostridium perfringens D str. JGS1721] (509 aa)
Score = 1490, Expect = 4.1e-163, Identities = 280/510 (54%), Positives = 371/510 (72%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D +L++DFGGQY QLIARR+R+  VY EI+ Y  SIE+I +KNPKGII +GG +SVYG+ +   +K I++LN+P+LGICYG Q+M    GG+V+      EYG T++ L  +++LF  IE D  CWMSH+D +   P+GFK+IA T+ C VA+  N E++ YGVQFHPEV  T FG  +++NF+Y+IC +   W   +   EKI EIK+IV D  ++CA+SGGVDS VAAV+  +A+G +L C+FVDHGLLRK+E  +V  + K+    N+  V+ +  FL KLKGV DPE KRKIIG+ FI VFE+ A K+    K+L+QGTIYPD+VESG+  S  IKSHHNVGGLPE ++F L+EPL+ LFKDEVR +G  L IP+  V+RQPFPGPGLA+RVLGE+TEDKLE+VREAD +FR  I       E + WQYF VL N +SVGV+GD R+Y +T+ LRAV S D M++ W  IP E ++K+S  I N+VK ++R+VYD+T+KPP TIEWE
  S:     3 DLVLVVDFGGQYNQLIARRVRECGVYCEIIPYTYSIEKIKEKNPKGIIFTGGPNSVYGENTPTLDKEIFNLNVPVLGICYGDQLMAHLLGGKVDT-APVREYGKTNVTLDNSSKLFAGIEADETCWMSHTDYIAEAPEGFKIIAHTDVCPVAAMENEERRLYGVQFHPEVEHTPFGQNMMRNFLYNICGLENSWSMASFAEEKIAEIKNIVGDKKLICALSGGVDSSVAAVMVHKAVGKQLTCIFVDHGLLRKDEGDQVEKIFKEGFDMNLIRVNAQDRFLGKLKGVSDPETKRKIIGEEFIRVFEEEAGKLG-DIKFLVQGTIYPDVVESGTDTSAVIKSHHNVGGLPEDMEFSLIEPLRELFKDEVRAVGEELGIPHHLVWRQPFPGPGLAIRVLGEVTEDKLEVVREADAIFREEI--ALAGLESEIWQYFAVLPNIQSVGVMGDERTYCHTVGLRAVTSSDGMTSNWAHIPYEVIDKVSRRIVNEVKGVNRIVYDVTSKPPATIEWE 509
>gi|18311257|ref|NP_563191.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium perfringens str. 13] >gi|110800712|ref|YP_696947.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium perfringens ATCC 13124] >gi|168205103|ref|ZP_02631108.1| GMP synthase [Clostridium perfringens E str. JGS1987] >gi|168211656|ref|ZP_02637281.1| GMP synthase [Clostridium perfringens B str. ATCC 3626] >gi|168213184|ref|ZP_02638809.1| GMP synthase [Clostridium perfringens CPE str. F4969] >gi|168216761|ref|ZP_02642386.1| GMP synthase [Clostridium perfringens NCTC 8239] >gi|24211752|sp|Q8XI46|GUAA_CLOPE GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|18145940|dbj|BAB81981.1| GMP synthetase [Clostridium perfringens str. 13] >gi|110675359|gb|ABG84346.1| GMP synthase [Clostridium perfringens ATCC 13124] >gi|170663325|gb|EDT16008.1| GMP synthase [Clostridium perfringens E str. JGS1987] >gi|170710386|gb|EDT22568.1| GMP synthase [Clostridium perfringens B str. ATCC 3626] >gi|170715290|gb|EDT27472.1| GMP synthase [Clostridium perfringens CPE str. F4969] >gi|182381223|gb|EDT78702.1| GMP synthase [Clostridium perfringens NCTC 8239] (509 aa)
Score = 1489, Expect = 5.2e-163, Identities = 280/510 (54%), Positives = 370/510 (72%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D +L++DFGGQY QLIARR+R+  VY EI+ Y  SIE+I +KNPKGII +GG +SVYG+ +   +K I++LN+P+LGICYG Q+M    GG+V+      EYG T++ L  +++LF  IE D  CWMSH+D +   P+GFK+IA T+ C VA+  N E++ YGVQFHPEV  T FG  +++NF+Y+IC +   W   +   EKI EIK IV D  ++CA+SGGVDS VAAV+  +A+G +L C+FVDHGLLRK+E  +V  + K+    N+  V+ +  FL KLKGV DPE KRKIIG+ FI VFE+ A K+    K+L+QGTIYPD+VESG+  S  IKSHHNVGGLPE ++F L+EPL+ LFKDEVR +G  L IP+  V+RQPFPGPGLA+RVLGE+TEDKLE+VREAD +FR  I       E + WQYF VL N +SVGV+GD R+Y +T+ LRAV S D M++ W  IP E ++K+S  I N+VK ++R+VYD+T+KPP TIEWE
  S:     3 DLVLVVDFGGQYNQLIARRVRECGVYCEIIPYTYSIEKIKEKNPKGIIFTGGPNSVYGENTPTLDKEIFNLNVPVLGICYGDQLMAHLLGGKVDT-APVREYGKTNVTLDNSSKLFAGIEADETCWMSHTDYIAEAPEGFKIIAHTDVCPVAAMENEERRLYGVQFHPEVEHTPFGQNMMRNFLYNICGLENSWSMASFAEEKIAEIKKIVGDKKLICALSGGVDSSVAAVMVHKAVGKQLTCIFVDHGLLRKDEGDQVEKIFKEGFDMNLIRVNAQDRFLGKLKGVSDPETKRKIIGEEFIRVFEEEAGKLG-DIKFLVQGTIYPDVVESGTDTSAVIKSHHNVGGLPEDMEFSLIEPLRELFKDEVRAVGEELGIPHHLVWRQPFPGPGLAIRVLGEVTEDKLEVVREADAIFREEI--ALAGLESEIWQYFAVLPNIQSVGVMGDERTYCHTVGLRAVTSSDGMTSNWAHIPYEVIDKVSRRIVNEVKGVNRIVYDVTSKPPATIEWE 509
>gi|110802816|ref|YP_699536.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium perfringens SM101] >gi|110683317|gb|ABG86687.1| GMP synthase [Clostridium perfringens SM101] (509 aa)
Score = 1488, Expect = 5.9e-163, Identities = 281/510 (55%), Positives = 369/510 (72%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D +L++DFGGQY QLIARR+R+  VY EI+ Y  SIE+I +KNPKGII +GG +SVYG+ +   +K I++LN+PILGICYG Q+M    GG+V       EYG T++ L  +++LF  IE D  CWMSH+D +   P+GFK+IA T+ C VA+  N E++ YGVQFHPEV  T FG  +++NF+Y+IC +   W   +   EKI EIK IV D  ++CA+SGGVDS VAAV+  +A+G +L C+FVDHGLLRK+E  +V  + K+    N+  V+ +  FL KLKGV DPE KRKIIG+ FI VFE+ A K+    K+L+QGTIYPD+VESG+  S  IKSHHNVGGLPE ++F L+EPL+ LFKDEVR +G  L IP+  V+RQPFPGPGLA+RVLGE+TEDKLE+VREAD +FR  I       E + WQYF VL N +SVGV+GD R+Y +T+ LRAV S D M++ W  IP E ++K+S  I N+VK ++R+VYD+T+KPP TIEWE
  S:     3 DLVLVVDFGGQYNQLIARRVRECGVYCEIIPYTYSIEKIKEKNPKGIIFTGGPNSVYGENTPTLDKEIFNLNVPILGICYGDQLMAHLLGGKVAT-APVREYGKTNVTLDNSSKLFAGIEADETCWMSHTDYIAEAPEGFKIIAHTDVCPVAAMENEERRLYGVQFHPEVEHTPFGQNMMRNFLYNICGLENSWSMASFAEEKIAEIKKIVGDKKLICALSGGVDSSVAAVMVHKAVGKQLTCIFVDHGLLRKDEGDQVEKIFKEGFDMNLIRVNAQDRFLGKLKGVSDPETKRKIIGEEFIRVFEEEAGKLG-DIKFLVQGTIYPDVVESGTDTSAVIKSHHNVGGLPEDMEFSLIEPLRELFKDEVRAVGEELGIPHHLVWRQPFPGPGLAIRVLGEVTEDKLEVVREADAIFREEI--ALAGLESEIWQYFAVLPNIQSVGVMGDERTYCHTVGLRAVTSSDGMTSNWAHIPYEVIDKVSRRIVNEVKGVNRIVYDVTSKPPATIEWE 509
>gi|150015222|ref|YP_001307476.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium beijerinckii NCIMB 8052] >gi|149901687|gb|ABR32520.1| GMP synthase, large subunit [Clostridium beijerinckii NCIMB 8052] (510 aa)
Score = 1487, Expect = 8.6e-163, Identities = 289/510 (56%), Positives = 370/510 (72%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D +L++DFGGQY QLIARR+R+  VY EI+ YD +IE+I  KNPKGII +GG +SVYG+ +    K +++L +P+LGICYG Q+M    GG+V       EYG T++++  +++LFE IE D   WMSH+D +   PKGFKVIA+T  C VA+  N EK+ YGVQFH EV  T FG ++L+NF+++IC +   W   +   EKI+EIK +V D  VLCA+SGGVDS VAA++  +AIG  L C+FVDHGLLRK+E   V  + KK    NI  V+    FL KL GV DPE KRKIIG+ FI VFE+ A K+     YL+QGTIYPDIVESG+K S TIKSHHNVGGLPE +QFEL+EPL+ LFKDEVR +G  L IP++ V+RQPFPGPGLA+RVLGEITE+KLEIVREAD +FR  I     N +   WQYF  L N +SVGV+GD R+Y +T+ALRAV S DAM+++W +IP E L+ +S  I N+VK ++R+VYDIT+KPP TIEWE
  S:     4 DLVLVVDFGGQYNQLIARRVRECGVYCEIIPYDYTIEKIKAKNPKGIIFTGGPNSVYGEDTPTVEKEVFELGVPVLGICYGDQLMAHLLGGKVAT-APVREYGKTNVKVDKSSKLFEGIETDGIAWMSHTDYIEEAPKGFKVIATTEVCPVAAMENEEKRLYGVQFHAEVEHTQFGQKMLENFIHNICGLENSWSMGSFAEEKIKEIKELVGDKKVLCALSGGVDSSVAAMIVHKAIGHNLTCIFVDHGLLRKDEGDTVERVFKKEFDMNIKRVNVADRFLGKLAGVSDPETKRKIIGEEFIRVFEEEAKKVG-QIDYLVQGTIYPDIVESGTKTSATIKSHHNVGGLPEDMQFELIEPLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEITEEKLEIVREADAIFREEIAN--ANLDESIWQYFACLPNIRSVGVMGDERTYSHTIALRAVTSSDAMTSEWARIPYEILDLVSRRIVNEVKGVNRIVYDITSKPPATIEWE 510
>gi|169347058|ref|ZP_02866000.1| GMP synthase [Clostridium perfringens C str. JGS1495] >gi|169296741|gb|EDS78870.1| GMP synthase [Clostridium perfringens C str. JGS1495] (509 aa)
Score = 1487, Expect = 9.0e-163, Identities = 279/510 (54%), Positives = 370/510 (72%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D +L++DFGGQY QLIARR+R+  VY EI+ Y  SIE+I ++NPKGII +GG +SVYG+ +   +K I++LN+P+LGICYG Q+M    GG+V+      EYG T++ L  +++LF  IE D  CWMSH+D +   P+GFK+IA T+ C VA+  N E++ YGVQFHPEV  T FG  +++NF+Y+IC +   W   +   EKI EIK IV D  ++CA+SGGVDS VAAV+  +A+G +L C+FVDHGLLRK+E  +V  + K+    N+  V+ +  FL KLKGV DPE KRKIIG+ FI VFE+ A K+    K+L+QGTIYPD+VESG+  S  IKSHHNVGGLPE ++F L+EPL+ LFKDEVR +G  L IP+  V+RQPFPGPGLA+RVLGE+TEDKLE+VREAD +FR  I       E + WQYF VL N +SVGV+GD R+Y +T+ LRAV S D M++ W  IP E ++K+S  I N+VK ++R+VYD+T+KPP TIEWE
  S:     3 DLVLVVDFGGQYNQLIARRVRECGVYCEIIPYTYSIEKIKERNPKGIIFTGGPNSVYGENTPTLDKEIFNLNVPVLGICYGDQLMAHLLGGKVDT-APVREYGKTNVTLDNSSKLFAGIEADETCWMSHTDYIAEAPEGFKIIAHTDVCPVAAMENEERRLYGVQFHPEVEHTPFGQNMMRNFLYNICGLENSWSMASFAEEKIAEIKKIVGDKKLICALSGGVDSSVAAVMVHKAVGKQLTCIFVDHGLLRKDEGDQVEKIFKEGFDMNLIRVNAQDRFLGKLKGVSDPETKRKIIGEEFIRVFEEEAGKLG-DIKFLVQGTIYPDVVESGTDTSAVIKSHHNVGGLPEDMEFSLIEPLRELFKDEVRAVGEELGIPHHLVWRQPFPGPGLAIRVLGEVTEDKLEVVREADAIFREEI--ALAGLESEIWQYFAVLPNIQSVGVMGDERTYCHTVGLRAVTSSDGMTSNWAHIPYEVIDKVSRRIVNEVKGVNRIVYDVTSKPPATIEWE 509
>gi|187776788|ref|ZP_02993261.1| hypothetical protein CLOSPO_00304 [Clostridium sporogenes ATCC 15579] >gi|187775447|gb|EDU39249.1| hypothetical protein CLOSPO_00304 [Clostridium sporogenes ATCC 15579] (510 aa)
Score = 1483, Expect = 2.5e-162, Identities = 283/508 (55%), Positives = 375/508 (73%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNEL-FENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFGGQY QLIARR+R+  VY EI+ Y  SIE+I +K PKGII +GG +SVYG+ + +  K ++DL+IP+LGICYG Q+M     G+V +  +  EYG T++ L  + L F+NI+  + CWMSH+D +  +PKGFK IA+T++C  A+  N EKK YGVQFHPEV  T FG Q+L+NF+++ICD+ GDW   +   E+I+ IK  V D  V+CA+SGGVDS VAAV+  +AIG +L C+FVDHGLLRK+E  +V  + K     N+  V+ +  FL KLKGV DPE+KRKIIG+ FI VFE+ A K+     +L+QGTIYPDIVESG+  S TIKSHHNVGGLPE ++F+L+EPL+ LFKDEVR +G  L IP++ V+RQPFPGPGLA+RVLGE+TE+KL I READ +FR  I +     E K WQYF  L N +SVGV+GD R+Y +T+ALRAV S DAM++ W +IP E L+K+S  I N+VK ++R+VYD+T+KPP TIEWE
  S:     6 VLVVDFGGQYNQLIARRVRENRVYCEIIPYTTSIEKIKEKAPKGIIFTGGPNSVYGENAPRVEKELFDLDIPVLGICYGDQLMAHSLDGEVTS-PEKREYGKTEVNLDNSSLLFKNIKEKDQCWMSHTDYISKVPKGFKTIATTDECPCAAMENGEKKLYGVQFHPEVEHTLFGKQMLKNFLFNICDLKGDWTMSSFAEEQIKAIKEKVGDKKVICALSGGVDSSVAAVIVHKAIGKQLTCIFVDHGLLRKDEGDQVEKIFKDQFDMNLIRVNAQDRFLGKLKGVSDPERKRKIIGEEFIRVFEEEAKKLG-DISFLVQGTIYPDIVESGTNTSATIKSHHNVGGLPEDMEFKLIEPLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEVTEEKLAITREADAIFREEIAK--AGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLDKVSRRIVNEVKEVNRIVYDVTSKPPATIEWE 510
>gi|78044956|ref|YP_359914.1| bifunctional GMP synthase/glutamine amidotransferase protein [Carboxydothermus hydrogenoformans Z-2901] >gi|91206799|sp|Q3AD70|GUAA_CARHZ GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|77997071|gb|ABB15970.1| GMP synthase [Carboxydothermus hydrogenoformans Z-2901] (509 aa)
Score = 1475, Expect = 2.0e-161, Identities = 284/509 (55%), Positives = 368/509 (72%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIR-LTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           K+++LDFGGQY+QLIARRIR+L VY E++ Y+  +E+I+++NP GI+ SGG  SVYG+ +   +  I+ LNIPILGICYG Q+M  + GG V    +  EYG T +  L  + LF  +     CWMSH D V   P+GF V A T    +A+  NRE+  Y VQFHPEV  T  G ++L+NF+Y IC +  DW  ++   + I EIK  V ++ V+CA+SGGVDS VAAVL  +AIGD L C+FVDHGLLRK E++EV    K+    N+  VD K+ FL+KLKGV DPEQKRKIIG  FI VFE+ A K+    ++L+QGT+YPD+VESG+  + TIKSHHNVGGLPE ++F+L+EPLK+LFKDEVR+LGL L +P   V+R PFPGPGLAVRVLGEITE+KL I+READ++F   ID+L K+  + K WQ F VL N +SVGV+GD R+Y YT+ALRAV S D M+A W ++P E LEKIS+ I  +VK ++RVVYDIT+KPP TIEWE
  S:     4 KVIVLDFGGQYSQLIARRIRELKVYCEMLPYNTPLEKIVQENPGGIVFSGGPSSVYGEGAPTVDPEIYRLNIPILGICYGMQLMAHQLGGIVR-PAEGREYGKTPLFILNRDRLFAGLNETEICWMSHGDFVAKAPEGFLVTAKTEYTPIAAMENRERNLYAVQFHPEVVHTPKGKEILKNFLYEICGLTPDWTMESFAQKAIREIKEQVGEEKVVCALSGGVDSSVAAVLVHKAIGDNLTCIFVDHGLLRKGEAEEVVRTFKEQFQMNLVFVDAKEQFLAKLKGVRDPEQKRKIIGHEFIRVFEEEAAKLG-DIRFLVQGTLYPDVVESGTATAATIKSHHNVGGLPEDMKFQLIEPLKWLFKDEVRELGLELGLPESIVWRHPFPGPGLAVRVLGEITEEKLAILREADYIF---IDELKKSGWYRKTWQAFAVLPNLQSVGVMGDERTYAYTIALRAVTSEDGMTADWVRLPYELLEKISARIVGEVKGVNRVVYDITSKPPATIEWE 509
>gi|148381238|ref|YP_001255779.1| GMP synthase [Clostridium botulinum A str. ATCC 3502] >gi|153933266|ref|YP_001385613.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium botulinum A str. ATCC 19397] >gi|153935009|ref|YP_001389019.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium botulinum A str. Hall] >gi|148290722|emb|CAL84853.1| GMP synthase [glutamine-hydrolyzing] [Clostridium botulinum A str. ATCC 3502] >gi|152929310|gb|ABS34810.1| GMP synthase [Clostridium botulinum A str. ATCC 19397] >gi|152930923|gb|ABS36422.1| GMP synthase [Clostridium botulinum A str. Hall] (510 aa)
Score = 1473, Expect = 3.2e-161, Identities = 280/508 (55%), Positives = 375/508 (73%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNEL-FENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFGGQY QLIARR+R+  VY EIV Y  SIE+I +K PKGII +GG +SVYG+ + +  K ++DL IP+LGICYG Q+M     G+V +  +  EYG TD+ L  + L F++++  + CWMSH+D +  +PKGFK+IA+T++C  A+  N EKK YGVQFHPEV  T FG ++L+NF++++C++ GDW   +   ++I+ IK  V D  V+CA+SGGVDS VAAV+  +AIG +L CVFVDHGLLRK+E  +V  + K     N+  V+ +  FL KLKGV DPE+KRKIIG+ FI VFE+ A K+     +L+QGTIYPDIVESG+  S TIKSHHNVGGLPE ++F+L+EPL+ LFKDEVR +G  L IP++ V+RQPFPGPGLA+RVLGE+TE+KL I READ +FR  I +     E K WQYF  L N +SVGV+GD R+Y +T+ALRAV S DAM++ W +IP E L+K+S  I N+VK ++R+VYD+T+KPP TIEWE
  S:     6 VLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRVQKELFDLGIPVLGICYGDQLMAHSLEGEVTS-PEKREYGKTDVNLDNSSLLFKDMKEKDQCWMSHTDYISKVPKGFKIIATTDECPCAAMENAEKKLYGVQFHPEVEHTLFGKKMLKNFLFNVCNLKGDWSMSSFAEQQIKAIKEKVGDKKVICALSGGVDSSVAAVIVHKAIGKQLTCVFVDHGLLRKDEGDQVERIFKDQFDMNLIRVNAQDRFLGKLKGVSDPERKRKIIGEEFIRVFEEEAKKLG-DISFLVQGTIYPDIVESGTNTSATIKSHHNVGGLPEDMEFKLIEPLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEVTEEKLAITREADAIFREEIAK--AGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLDKVSRRIVNEVKEVNRIVYDVTSKPPATIEWE 510
>gi|153940088|ref|YP_001392640.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium botulinum F str. Langeland] >gi|170756813|ref|YP_001782918.1| GMP synthase [Clostridium botulinum B1 str. Okra] >gi|152935984|gb|ABS41482.1| GMP synthase [Clostridium botulinum F str. Langeland] >gi|169122025|gb|ACA45861.1| GMP synthase [Clostridium botulinum B1 str. Okra] (510 aa)
Score = 1471, Expect = 5.3e-161, Identities = 279/508 (54%), Positives = 375/508 (73%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNEL-FENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFGGQY QLIARR+R+  VY EIV Y  SIE+I +K PKGII +GG +SVYG+ + +  K ++DL IP+LGICYG Q+M     G+V +  +  EYG TD+ L  + L F++++  + CWMSH+D +  +PKGFK+IA+T++C  A+  N EKK YGVQFHPEV  T FG ++L+NF++++C++ GDW   +   ++I+ IK  V D  V+CA+SGGVDS VAAV+  +AIG +L C+FVDHGLLRK+E  +V  + K     N+  V+ +  FL KLKGV DPE+KRKIIG+ FI VFE+ A K+     +L+QGTIYPDIVESG+  S TIKSHHNVGGLPE ++F+L+EPL+ LFKDEVR +G  L IP++ V+RQPFPGPGLA+RVLGE+TE+KL I READ +FR  I +     E K WQYF  L N +SVGV+GD R+Y +T+ALRAV S DAM++ W +IP E L+K+S  I N+VK ++R+VYD+T+KPP TIEWE
  S:     6 VLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRVQKELFDLGIPVLGICYGDQLMAHSLEGEVTS-PEKREYGKTDVNLDNSSLLFKDMKEKDQCWMSHTDYISKVPKGFKIIATTDECPCAAMENAEKKLYGVQFHPEVEHTLFGKKMLKNFLFNVCNLKGDWSMSSFAEQQIKAIKEKVGDKKVICALSGGVDSSVAAVIVHKAIGKQLTCIFVDHGLLRKDEGDQVEKIFKDQFDMNLIRVNAQDRFLGKLKGVSDPERKRKIIGEEFIRVFEEEAKKLG-DISFLVQGTIYPDIVESGTNTSATIKSHHNVGGLPEDMEFKLIEPLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEVTEEKLAITREADAIFREEIAK--AGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLDKVSRRIVNEVKEVNRIVYDVTSKPPATIEWE 510
>gi|168179058|ref|ZP_02613722.1| GMP synthase [Clostridium botulinum NCTC 2916] >gi|182670215|gb|EDT82191.1| GMP synthase [Clostridium botulinum NCTC 2916] (510 aa)
Score = 1471, Expect = 5.7e-161, Identities = 279/508 (54%), Positives = 374/508 (73%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNEL-FENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFGGQY QLIARR+R+  VY EIV Y  SIE+I +K PKGII +GG +SVYG+ + +  K ++DL IP+LGICYG Q+M     G+V +  +  EYG TD+ L  + L F +++  + CWMSH+D +  +PKGFK+IA+T++C  A+  N EKK YGVQFHPEV  T FG ++L+NF++++C++ GDW   +   ++I+ IK  V D  V+CA+SGGVDS VAAV+  +AIG +L C+FVDHGLLRK+E  +V  + K     N+  V+ +  FL KLKGV DPE+KRKIIG+ FI VFE+ A K+     +L+QGTIYPDIVESG+  S TIKSHHNVGGLPE ++F+L+EPL+ LFKDEVR +G  L IP++ V+RQPFPGPGLA+RVLGE+TE+KL I READ +FR  I +     E K WQYF  L N +SVGV+GD R+Y +T+ALRAV S DAM++ W +IP E L+K+S  I N+VK ++R+VYD+T+KPP TIEWE
  S:     6 VLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRVQKELFDLGIPVLGICYGDQLMAHSLEGEVTS-PEKREYGKTDVNLDNSSLLFRDMKEKDQCWMSHTDYISKVPKGFKIIATTDECPCAAMENAEKKLYGVQFHPEVEHTLFGKKMLKNFLFNVCNLKGDWSMSSFAEQQIKAIKEKVGDKKVICALSGGVDSSVAAVIVHKAIGKQLTCIFVDHGLLRKDEGDQVEKIFKDQFDMNLIRVNAQDRFLGKLKGVSDPERKRKIIGEEFIRVFEEEAKKLG-DISFLVQGTIYPDIVESGTNTSATIKSHHNVGGLPEDMEFKLIEPLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEVTEEKLAITREADAIFREEIAK--AGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLDKVSRRIVNEVKEVNRIVYDVTSKPPATIEWE 510
>gi|170761419|ref|YP_001788611.1| GMP synthase [Clostridium botulinum A3 str. Loch Maree] >gi|169408408|gb|ACA56819.1| GMP synthase [Clostridium botulinum A3 str. Loch Maree] (510 aa)
Score = 1471, Expect = 6.5e-161, Identities = 279/508 (54%), Positives = 375/508 (73%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNEL-FENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFGGQY QLIARR+R+  VY EIV Y  SIE+I +K PKGII +GG +SVYG+ + +  K ++DL IP+LGICYG Q+M     G+V +  +  EYG TD+ L  + L F++++  + CWMSH+D +  +PKGFK+IA+T++C  A+  N EKK YGVQFHPEV  T FG ++L+NF++++C++ GDW   +   ++I+ IK  V D  V+CA+SGGVDS VAAV+  +AIG +L C+FVDHGLLRK+E  +V  + K     N+  V+ +  FL KLKGV DPE+KRKIIG+ FI VFE+ A K+     +L+QGTIYPDIVESG+  S TIKSHHNVGGLPE ++F+L+EPL+ LFKDEVR +G  L IP++ V+RQPFPGPGLA+RVLGE+TE+KL I READ +FR  I +     E K WQYF  L N +SVGV+GD R+Y +T+ALRAV S DAM++ W +IP E L+K+S  I N+VK ++R+VYD+T+KPP TIEWE
  S:     6 VLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRVRKELFDLGIPVLGICYGDQLMAHSLEGEVTS-PEKREYGKTDVNLDNSSLLFKDMKEKDQCWMSHTDYISKVPKGFKIIATTDECPCAAMENAEKKLYGVQFHPEVEHTLFGKKMLKNFLFNVCNLKGDWSMSSFAEQQIKAIKEKVGDKKVICALSGGVDSSVAAVIVHKAIGKQLTCIFVDHGLLRKDEGDQVEKIFKDQFEMNLIRVNAQDRFLGKLKGVSDPERKRKIIGEEFIRVFEEEAKKLG-DISFLVQGTIYPDIVESGTNTSATIKSHHNVGGLPEDMEFKLIEPLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEVTEEKLAITREADAIFREEIAK--AGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLDKVSRRIVNEVKEVNRIVYDVTSKPPATIEWE 510
>gi|168182080|ref|ZP_02616744.1| GMP synthase [Clostridium botulinum Bf] >gi|182674773|gb|EDT86734.1| GMP synthase [Clostridium botulinum Bf] (510 aa)
Score = 1466, Expect = 2.1e-160, Identities = 278/508 (54%), Positives = 375/508 (73%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNEL-FENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFGGQY QLIARR+R+  VY EIV Y  SIE+I +K PKGII +GG +SVYG+ + +  K ++DL IP+LGICYG Q+M     G+V +  +  EYG TD+ L  + L F++++  + CWMSH+D +  +PKGFK+IA+T++C  A+  N EKK YGVQFHPEV  T FG ++L+NF++++C++ GDW   +   ++I+ IK  V +  V+CA+SGGVDS VAAV+  +AIG +L C+FVDHGLLRK+E  +V  + K     N+  V+ +  FL KLKGV DPE+KRKIIG+ FI VFE+ A K+     +L+QGTIYPDIVESG+  S TIKSHHNVGGLPE ++F+L+EPL+ LFKDEVR +G  L IP++ V+RQPFPGPGLA+RVLGE+TE+KL I READ +FR  I +     E K WQYF  L N +SVGV+GD R+Y +T+ALRAV S DAM++ W +IP E L+K+S  I N+VK ++R+VYD+T+KPP TIEWE
  S:     6 VLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRVQKELFDLGIPVLGICYGDQLMAHSLEGEVTS-PEKREYGKTDVNLDNSSLLFKDMKEKDQCWMSHTDYISKVPKGFKIIATTDECPCAAMENAEKKLYGVQFHPEVEHTLFGKKMLKNFLFNVCNLKGDWTMSSFAEQQIKAIKEKVGNKKVICALSGGVDSSVAAVIVHKAIGKQLTCIFVDHGLLRKDEGDQVEKIFKDQFDMNLIRVNAQDRFLGKLKGVSDPERKRKIIGEEFIRVFEEEAKKLG-DISFLVQGTIYPDIVESGTNTSATIKSHHNVGGLPEDMEFKLIEPLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEVTEEKLAITREADAIFREEIAK--AGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLDKVSRRIVNEVKEVNRIVYDVTSKPPATIEWE 510
>gi|150388741|ref|YP_001318790.1| bifunctional GMP synthase/glutamine amidotransferase protein [Alkaliphilus metalliredigens QYMF] >gi|149948603|gb|ABR47131.1| GMP synthase, large subunit [Alkaliphilus metalliredigens QYMF] (510 aa)
Score = 1464, Expect = 3.7e-160, Identities = 281/508 (55%), Positives = 366/508 (72%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP-WQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +LILDFGGQY QLIARR+R+ N+Y E+V Y I+ EEI  KNPKG+IL+GG  SVYG+ + +  + I+ L+IPILGICYG Q+M    GG+V   K+  EYG T +++  N +LF+ +  D+ CWMSH+D +   P GFK+  +T  C VA+  N+EK  Y VQFHPEV  T  G ++L+NF+Y +C   GDW  +N   ++IE I+++V D  VLCA+SGGVDS VAAVL  QAIGD L CVFVDHGLLRK+E   V  + +     N   V+ ++ FL KLKGV DPE KRK IG+ FI VFE+ A KI   F +L+QGT+YPDI+ESG++ +  IKSHHNVGGLPE ++F+L+EP K+LFKDEVR  GL L +P + V+RQPFPGPGLAVRVLGEITE+KL IVREAD + R   D++ K   H+  WQYF VL N  SVGV+GD R+Y +T+ +RA+ S DAM+A W +IP E LE +S  I N+V+  +R+VYDIT+KPP T+EWE
  S:     6 VLILDFGGQYNQLIARRVREHNIYCEVVPYKITAEEIKLKNPKGLILTGGPSSVYGESTPRCEEEIFQLDIPILGICYGGQLMAHTLGGKVNRAKN-REYGKTALQVDGNSKLFKEVAQDSICWMSHTDFIETAPAGFKITGTTADCPVAAMENQEKALYAVQFHPEVEHTEKGKEILKNFLYEVCHCQGDWTMENYIEKEIEAIRNLVGDRKVLCALSGGVDSSVAAVLVHQAIGDNLTCVFVDHGLLRKDEGDWVEDIFRNQFEMNFIRVNAEERFLGKLKGVTDPELKRKAIGELFIRVFEEEAQKIG-DFDFLVQGTLYPDIIESGTETAAVIKSHHNVGGLPEDMKFQLIEPFKFLFKDEVRIAGLELGVPEEIVWRQPFPGPGLAVRVLGEITEEKLHIVREADAIVR---DEIIKAGLHRQIWQYFAVLPNIMSVGVMGDERTYAHTIGIRAITSSDAMTADWARIPFEVLENMSRRIVNEVEGANRIVYDITSKPPSTVEWE 510
>gi|146296983|ref|YP_001180754.1| bifunctional GMP synthase/glutamine amidotransferase protein [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410559|gb|ABP67563.1| GMP synthase (glutamine-hydrolyzing) [Caldicellulosiruptor saccharolyticus DSM 8903] (511 aa)
Score = 1460, Expect = 1.1e-159, Identities = 279/508 (54%), Positives = 375/508 (73%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFE-LLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +++LDFGGQY QLIARR+R+  VY EI  YD  +E+II+KNPKGII +GG  SVY + +   +K I+++ +PILGICYG Q++    GG+V       EYG T I+  TN  LF  +   + CWMSH+D V  LP+GF+++AST  C +A+  +REKK YGVQFHPEV  T FG ++++NF+++IC   GDW+  +   E+I EI+ IV +  V+CA+SGGVDS VAAVL  +AIG  L+C+FVDHGLLRK E++EV    K     N+  VD K+ FL  L GV+DPE+KRKIIG+ FI VFE+ A+K+    K+L+QGTIYPD+VESG   + TIKSHHNVGGLPE ++FE ++EPL+ LFKDEVR++G+ L IP + V RQPFPGPGLA+R++GE+TE+KLEI+RE D++FR  I+    + E   WQYF VLT+ +SVGV+GD R+Y YT+ALRAV S+D M+A W +IP + LE++S+ I N V+ ++RVVYDIT+KPP TIEWE
  S:     6 VIVLDFGGQYNQLIARRVRECGVYCEIWPYDTPLEKIIEKNPKGIIFTGGPSSVYEENAPVVDKKIFEIGVPILGICYGNQLIAYFLGGKVSTAL-FREYGKTHIKYNTNSPLFTGLPESSICWMSHTDFVEELPEGFEILASTENCAIAAFGSREKKIYGVQFHPEVVHTEFGQEIIKNFLFNICGCKGDWKTSSFIEERINEIRKIVGNQKVVCALSGGVDSSVAAVLVHKAIGKNLFCIFVDHGLLRKGEAEEVIKTFKGQFDMNVIKVDAKERFLKALCGVIDPERKRKIIGEEFIRVFEEEASKLG-DVKFLVQGTIYPDVVESGVGKAATIKSHHNVGGLPEHIKFERIIEPLRELFKDEVRRVGVELGIPEKIVKRQPFPGPGLAIRIIGEVTEEKLEILREVDWIFRKEIEACGLDEE--IWQYFAVLTDMRSVGVMGDERTYDYTVALRAVTSVDGMTADWARIPYDVLERVSNEIVNTVRKVNRVVYDITSKPPATIEWE 511
>gi|134300214|ref|YP_001113710.1| bifunctional GMP synthase/glutamine amidotransferase protein [Desulfotomaculum reducens MI-1] >gi|134052914|gb|ABO50885.1| GMP synthase (glutamine-hydrolyzing) [Desulfotomaculum reducens MI-1] (513 aa)
Score = 1445, Expect = 5.5e-158, Identities = 275/508 (54%), Positives = 364/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIR-LTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFGGQYTQLIARRIRD+NVY EI  +++SI++I  KNPKGII SGG  SVYG+++   +  +++L+IP+LGICYG Q+M Q+  G+V    +  EYG T +R +  + + +N+  D  CWMSH D V  +P GF+V+A T K  VA+  N EKK + VQFHPEV  T  G ++L++F++ IC  +G W   +   E ++E+K  V +  VLCA+SGGVDS VAAVL  +A+GD L CVFVDHGLLRKNE+++V    +      +  VD  + FL KL+GV DPEQKRKIIG  FI VFE+ A K+     +L+QGT+YPD+VESG+  ++ IKSHHNVGGLPE ++F+L+EPL++LFKDEVR+LG  L +P + V+RQPFPGPGLAVR+LGEIT+ KL I+READF+    I     N E   WQYF VL + +SVGV+GD R+Y Y + +RAV S D M+A W KIP + L  IS+ + N+V  I+RVVYDIT+KPPGTIEWE
  S:     9 ILVLDFGGQYTQLIARRIRDVNVYCEIEPHNVSIDKIKAKNPKGIIFSGGPSSVYGEKAPTVDPAVYELDIPVLGICYGMQLMTQQLKGKVV-PAEMREYGRTTLRVMQCDNILKNLTADEECWMSHGDRVEEVPPGFQVLAQTEKAPVAAMANPEKKLFAVQFHPEVIHTPKGMEVLKSFLFDICGCSGSWSMGSFLDEAVKEVKQRVGNRQVLCALSGGVDSSVAAVLVHRAVGDNLTCVFVDHGLLRKNEAEQVVKTFRDQFNIKLVHVDASERFLGKLQGVTDPEQKRKIIGTEFIRVFEEEARKLG-EIDFLVQGTLYPDVVESGTATAEVIKSHHNVGGLPEDMKFDLVEPLRWLFKDEVRRLGEELGMPEEIVWRQPFPGPGLAVRILGEITKPKLAILREADFVVTDEIKNAGLNRE--IWQYFAVLPDMRSVGVMGDGRTYAYAIVVRAVYSHDGMTADWAKIPHDVLGNISTRLVNEVAEINRVVYDITSKPPGTIEWE 513
>gi|20807079|ref|NP_622250.1| bifunctional GMP synthase/glutamine amidotransferase protein [Thermoanaerobacter tengcongensis MB4] >gi|24211749|sp|Q8RC63|GUAA_THETN GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|20515569|gb|AAM23854.1| GMP synthase - PP-ATPase domain [Thermoanaerobacter tengcongensis MB4] (512 aa)
Score = 1433, Expect = 1.5e-156, Identities = 281/510 (55%), Positives = 364/510 (71%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + ILILDFGGQYTQLIARRIR+ NVY EIV YDIS EEI K +PKGI+LSGG  SVY   + K +K I++L  P+LGICYG Q+M +  GG+V       EYG T++ +  T  LF+ IE D   WMSH+D +   P  FKV+AST  C +A+  N EKK YGVQFHPEV+ T  G ++++NF++ +CD + DW   ++  + ++E+++ V +   +CA+SGGVDS VAAVL  +AI D+L C+FVD GLLR NE   V    +K    NI  VD K  FLS+LKGV DPE+KRKIIG  FIEVF++ A KI    K+L+QGT+YPD++ESG   S TIKSHHNVGGLPE + FEL+EPL+ LFKDEVR++G  L IP + +YRQPFPGPGLAVR++GE+TE+KLEI+R AD + +  + +      +K WQ F +L   KSVGV+GD R+YGY + LR VDSMD M+A W K+P E LE IS+ I N+V  ++RV+YDIT+KPP TIEWE
  S:     6 ETILILDFGGQYTQLIARRIREANVYCEIVPYDISPEEIKKIDPKGIVLSGGPASVYVKNAPKCDKEIFELGYPVLGICYGVQLMTELLGGKVA-PAPVREYGKTEVVINNTIPLFKGIERDTIVWMSHTDQIELPPPDFKVVASTENCPIAAIANVEKKLYGVQFHPEVSHTHRGTEIIRNFLFEVCDCSADWTMDSLIEQTVKEVRAKVGNHKAVCALSGGVDSAVAAVLVDRAIHDQLVCIFVDTGLLRTNEGDMVIETFRKNYDMNIIRVDAKDRFLSRLKGVTDPEEKRKIIGNVFIEVFKEEAMKIG-DVKFLVQGTLYPDVIESGHGISSTIKSHHNVGGLPEDIGFELIEPLRMLFKDEVRQVGKELGIPDEILYRQPFPGPGLAVRIVGEVTEEKLEILRLADSIVQREMKRF--GWYNKVWQSFAILPGIKSVGVMGDERTYGYAIILRVVDSMDGMTADWTKLPYEILESISTSITNEVPGVNRVLYDITSKPPATIEWE 512
>gi|167038114|ref|YP_001665692.1| bifunctional GMP synthase/glutamine amidotransferase protein [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167039174|ref|YP_001662159.1| bifunctional GMP synthase/glutamine amidotransferase protein [Thermoanaerobacter sp. X514] >gi|166853414|gb|ABY91823.1| GMP synthase, large subunit [Thermoanaerobacter sp. X514] >gi|166856948|gb|ABY95356.1| GMP synthase, large subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] (512 aa)
Score = 1432, Expect = 1.9e-156, Identities = 283/508 (55%), Positives = 363/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L+LDFGGQYTQLIARRIR+ NV+ EIV Y+IS EEI KK PKGI+LSGG  SVY   + K +K I++L  P+LGICYG Q+M +  GG+V      +EYG T+I L  T  LF+ IE D   WMSH+D +   P  FKV+AST+ C +A+  N EKK Y VQFHPEV+ T  G ++++NF++ +CD A DW   ++  + ++EIK+ V     +CA+SGGVDS VAAVL  +AI D+L C+FVD GLLRKNE   V    +K    NI  VD K  FLS+LKGV DPE+KRKIIG  FIEVF++ A KI    K+L+QGT+YPD++ESG+  S TIKSHHNVGGLPE + FEL+EPL+ LFKDEVR++G  L IP + +YRQPFPGPGLAVR+LGE+TE+KLEI+R+AD +    + +      +K WQ F VL   KSVGV+GD R+Y Y + LR VDS D M+A W K+P E LE IS+ I N+V  ++RV+YDIT+KPP TIEWE
  S:     8 VLVLDFGGQYTQLIARRIREANVFCEIVPYNISPEEIRKKEPKGIVLSGGPASVYAKNAPKCDKEIFELGYPVLGICYGAQLMTELLGGKVA-PAPVKEYGKTEIVLNNTIPLFKGIERDTVVWMSHTDHIELPPPDFKVVASTDNCPIAAIANVEKKLYAVQFHPEVSHTHRGTEIIRNFLFEVCDCAADWTMDSLIEQTVKEIKAKVGKHKAVCALSGGVDSSVAAVLVDRAIHDQLVCIFVDTGLLRKNEGDMVIETFRKNYDMNIIRVDAKDRFLSRLKGVTDPEEKRKIIGNVFIEVFKEEALKIG-DVKFLVQGTLYPDVIESGNGVSSTIKSHHNVGGLPEDIGFELIEPLRMLFKDEVRQVGKELGIPEEILYRQPFPGPGLAVRILGEVTEEKLEILRQADSIVLREMKKF--GWYNKVWQSFAVLPGIKSVGVMGDERTYAYAIILRVVDSYDGMTADWTKLPYEILESISTSITNEVPGVNRVLYDITSKPPATIEWE 512
>gi|153174161|ref|ZP_01929723.1| GMP synthase [Listeria monocytogenes FSL N3-165] >gi|133730530|gb|EBA32228.1| GMP synthase [Listeria monocytogenes FSL N3-165] (514 aa)
Score = 1431, Expect = 2.7e-156, Identities = 275/510 (53%), Positives = 361/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS--EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KI++LDFG QY QLI RRIR+  VYSE+  + I++EE+   NP GII SGG +SVY + + + ++ I+D+ IPILGICYG Q+M    GG+VE  KD  EYG  DI +   N LF  +  D   WMSH D V+  P GF+V  ++  C +A   + E+  YGVQFHPEV  + +GN+LL+NF  ++C   GDW  +N    +I +I+ IV D  VL A+SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+ +V A L+     NI  VD K+ F+ KL GV DPEQKRKIIG  FI VF+  ANK++   ++L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L +P   V+RQPFPGPGL +RVLGEITE+KLEIVR++D++ R  I    KN+  E + WQYFT L N +SVGV+GD R+Y +T+ +RAV S+D M+A W +IP + LEKIS  I N+V +++RVVYDIT+KPP T+EWE
  S:     8 EKIIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDEDAFRADERIFDMGIPILGICYGMQLMTTHFGGKVERAKD-REYGKADIHVEKPNRLFAGLPTDQVVWMSHGDLVVEEPAGFEVTVTSKSCPIAGIADEERSLYGVQFHPEVRHSVYGNELLKNFALNVCGCKGDWTMENFSEVEIAKIQEIVGDKKVLLALSGGVDSSVVGVLIHKAIGDQLTCIFVDHGLLRKGEADQVMATLQGEFNMNIIKVDAKKRFMDKLAGVSDPEQKRKIIGNEFIYVFDDEANKLD-GVEFLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRALGTELGMPDAIVWRQPFPGPGLGIRVLGEITEEKLEIVRDSDYILREEI----KNAGLEREIWQYFTALPNIRSVGVMGDGRTYDHTVVVRAVTSIDGMTADWARIPWDVLEKISVRIVNEVDHVNRVVYDITSKPPATVEWE 514
>gi|153953103|ref|YP_001393868.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium kluyveri DSM 555] >gi|146345984|gb|EDK32520.1| GuaA [Clostridium kluyveri DSM 555] (510 aa)
Score = 1429, Expect = 4.3e-156, Identities = 273/508 (53%), Positives = 371/508 (73%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++++DFGGQY QLIARR+R+ NVY EIV Y  S+++I +KNP+GII +GG +SVY D + K ++ I+++ +P+LGICYG Q++    GG+VE+ +   EYG TD+ L  +  LF  I+ + +CWMSH+D V + P+GFK+I  + +  VA+  N +KK YGVQFHPEV  T FG ++L NF++ IC++ GDW   +   EKI+ IK  V D  V+CA+SGGVDS VAA++  +A+G +L C+FVDHGLLRK+E  +V  + KK    N   V+ ++ FL KLK + DPE+KRKIIG+ FI VFE+ A K+     +L+QGTIYPD+VESG   S TIKSHHNVGGLPE + F+L+EPL+ LFKDEVR +G  L IP++ V+RQPFPGPGLA+RVLG ITE+KL+I R+AD +FR  I +   N +   WQYF  L N +SVGV+GD R+Y YT+ALRAV S DAM++ W +IP E L+K+S  I N+VK ++R+VYDIT+KPP TIEWE
  S:     6 VIVVDFGGQYNQLIARRVRENNVYCEIVPYTYSVDKIKEKNPRGIIFTGGPNSVYDDNAPKISEDIFEIGVPVLGICYGHQLICTTLGGKVESAQ-VREYGKTDVVLNNSSGLFSGIDKNESCWMSHTDFVSYPPEGFKIIGKSGESPVAAVENIDKKIYGVQFHPEVEHTPFGKKMLSNFLFDICNLKGDWSMSSFVDEKIKSIKEEVGDKKVICAMSGGVDSSVAAMIVHKAVGKQLTCIFVDHGLLRKDEGDQVEDIFKKQFNMNFIRVNAEKRFLQKLKDISDPEKKRKIIGEEFIRVFEEEAKKLG-EIAFLVQGTIYPDVVESGLGTSATIKSHHNVGGLPEDMDFKLIEPLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGNITEEKLQITRDADAIFREEIAK--ANLDETIWQYFACLPNIRSVGVMGDERTYCYTIALRAVISTDAMTSDWARIPYEVLDKVSRRIVNEVKGVNRIVYDITSKPPATIEWE 510
>gi|46907321|ref|YP_013710.1| bifunctional GMP synthase/glutamine amidotransferase protein [Listeria monocytogenes str. 4b F2365] >gi|47091892|ref|ZP_00229686.1| GMP synthase [Listeria monocytogenes str. 4b H7858] >gi|153166423|ref|ZP_01927009.1| GMP synthase [Listeria monocytogenes FSL N1-017] >gi|167014432|ref|ZP_02276965.1| bifunctional GMP synthase/glutamine amidotransferase protein [Listeria monocytogenes FSL J1-194] >gi|50400343|sp|Q720X7|GUAA_LISMF GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|46880588|gb|AAT03887.1| GMP synthase [Listeria monocytogenes str. 4b F2365] >gi|47019608|gb|EAL10347.1| GMP synthase [Listeria monocytogenes str. 4b H7858] >gi|133727620|gb|EBA29318.1| GMP synthase [Listeria monocytogenes FSL N1-017] (514 aa)
Score = 1429, Expect = 4.3e-156, Identities = 275/510 (53%), Positives = 361/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS--EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KI++LDFG QY QLI RRIR+  VYSE+  + I++EE+   NP GII SGG +SVY + + + ++ I+D+ IPILGICYG Q+M    GG+VE  KD  EYG  DI +   N LF  +  D   WMSH D V+  P GF+V  ++  C +A   + E+  YGVQFHPEV  + +GN+LL+NF  ++C   GDW  +N    +I +I+ IV D  VL A+SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+ +V A L+     NI  VD K+ F+ KL GV DPEQKRKIIG  FI VF+  ANK++   ++L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L +P   V+RQPFPGPGL +RVLGEITE+KLEIVR++D++ R  I    KN+  E + WQYFT L N +SVGV+GD R+Y +T+ +RAV S+D M+A W +IP + LEKIS  I N+V +++RVVYDIT+KPP T+EWE
  S:     8 EKIIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDEDAFRADERIFDMGIPILGICYGMQLMTTHFGGKVERAKD-REYGKADIHVEKPNRLFAGLPTDQVVWMSHGDLVVEEPAGFEVTITSKSCPIAGIADEERSLYGVQFHPEVRHSVYGNELLKNFALNVCGCKGDWTMENFSEVEIAKIQEIVGDKKVLLALSGGVDSSVVGVLIHKAIGDQLTCIFVDHGLLRKGEADQVMATLQGEFNMNIIKVDAKKRFMDKLAGVSDPEQKRKIIGNEFIYVFDDEANKLD-GVEFLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRALGTELGMPDAIVWRQPFPGPGLGIRVLGEITEEKLEIVRDSDYILREEI----KNAGLEREIWQYFTALPNIRSVGVMGDGRTYDHTVVVRAVTSIDGMTADWARIPWDVLEKISVRIVNEVDHVNRVVYDITSKPPATVEWE 514
>gi|168265624|ref|ZP_02687589.1| bifunctional GMP synthase/glutamine amidotransferase protein [Listeria monocytogenes FSL J2-071] (514 aa)
Score = 1428, Expect = 5.2e-156, Identities = 275/510 (53%), Positives = 362/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS--EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KI++LDFG QY QLI RRIR+  VYSE+  + I++EE+   NP GII SGG +SVY + + + ++ I+D+ IPILGICYG Q+M    GG+VE  KD  EYG  DI +   + LF  +  D   WMSH D V+  P GF+V A++  C +A+  + E+  YGVQFHPEV  +  GN+LL+NF  ++C   GDW  +N    +I +I+ IV D  VL A+SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+ +V A L+     NI  VD K+ F+ KL GV DPEQKRKIIG  FI VF+  ANK++   ++L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L +P   V+RQPFPGPGL +RVLGEITE+KLEIVR++D++ R  I    KN+  E + WQYFT L N +SVGV+GD R+Y +T+ +RAV S+D M+A W +IP + LEKIS  I N+V +++RVVYDIT+KPP T+EWE
  S:     8 EKIIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDEDAFRADERIFDMGIPILGICYGMQLMTTHFGGKVERAKD-REYGKADIHVEKPSRLFAGLPTDQVVWMSHGDLVVEEPAGFEVTATSKSCPIAAIADEERSLYGVQFHPEVRHSVHGNELLKNFALNVCGCKGDWTMENFSEVEIAKIQEIVGDKKVLLALSGGVDSSVVGVLIHKAIGDQLTCIFVDHGLLRKGEADQVMATLQGEFNMNIIKVDAKKRFMDKLAGVSDPEQKRKIIGNEFIYVFDDEANKLD-GVEFLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRALGTELGMPDAIVWRQPFPGPGLGIRVLGEITEEKLEIVRDSDYILREEI----KNAGLEREIWQYFTALPNIRSVGVMGDGRTYDHTVVVRAVTSIDGMTADWARIPWDVLEKISVRIVNEVDHVNRVVYDITSKPPATVEWE 514
>gi|157691340|ref|YP_001485802.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus pumilus SAFR-032] >gi|157680098|gb|ABV61242.1| GMP synthase (glutamine-hydrolyzing) [Bacillus pumilus SAFR-032] (513 aa)
Score = 1428, Expect = 5.2e-156, Identities = 278/510 (54%), Positives = 361/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + IL+LDFG QY QLI RRIR+  VYSE+  + ++ EEI +  PKGIILSGG +SVY + S + ++ I+DL+IP+LGICYG Q+M    GG+VE      EYG  DI +  T  LF+++  D   WMSH D V+ +P+GF V A++  C  ++    EK FYGVQFHPEV  + +GN LL+NFV+ +CD  G W  +N    ++++I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E++ V     +    N+  VD K  FL+KLKGV DPEQKRKIIG  FI VF+  ++K+     YL QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG  L IP   V+RQPFPGPGL +RVLGEI+E+KLEIVRE+D + R  I       E   WQYFTVL + +SVGV+GD R+Y YT+ +RAV S+D M++ W +IP + LEKIS+ I N+VK+++RVVYDIT+KPP TIEWE
  S:     7 EMILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEIKEMAPKGIILSGGPNSVYDEGSFRCDEKIFDLDIPVLGICYGMQLMTHYLGGKVEA-ASQREYGKADIHINGTPALFKDLPTDQVVWMSHGDLVVEVPEGFTVDATSAHCPNSAMSLAEKNFYGVQFHPEVRHSEYGNDLLKNFVFGVCDCDGKWSMENFIEIEMQKIRETVGDKQVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFNMNVIKVDAKDRFLNKLKGVSDPEQKRKIIGNEFIYVFDDESDKLK-GIDYLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGSELGIPDDIVWRQPFPGPGLGIRVLGEISEEKLEIVRESDAILREEIANF--GLERDIWQYFTVLPDIRSVGVMGDARTYDYTIGIRAVTSIDGMTSDWARIPWDVLEKISTRIVNEVKHVNRVVYDITSKPPATIEWE 513
>gi|16800150|ref|NP_470418.1| bifunctional GMP synthase/glutamine amidotransferase protein [Listeria innocua Clip11262] >gi|24211759|sp|Q92CU0|GUAA_LISIN GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|16413540|emb|CAC96312.1| guaA [Listeria innocua] (518 aa)
Score = 1427, Expect = 8.1e-156, Identities = 275/510 (53%), Positives = 362/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS--EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KI++LDFG QY QLI RRIR+  VYSE+  + I++EE+   NP GII SGG +SVY + + + ++ I+D+ IPILGICYG Q+M    GG+VE  KD  EYG  DI +   + LF  +  D   WMSH D V+  P GF+V A++  C +A   + ++  YGVQFHPEV  + +GN+LL+NF  +IC   GDW  +N    +I +I+ IV D  VL A+SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+ +V A L+     NI  VD K+ F+ KL GV DPEQKRKIIG  FI VF+  ANK++   ++L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L +P   V+RQPFPGPGL +RVLGEITE+KLEIVR++D++ R  I    KN+  E + WQYFT L N +SVGV+GD R+Y +T+ +RAV S+D M+A W +IP + LEKIS  I N+V +++RVVYDIT+KPP T+EWE
  S:    12 EKIIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDEDAFRADERIFDMGIPILGICYGMQLMTTHFGGKVERAKD-REYGKADIHVENPSRLFAGLPTDQVVWMSHGDLVVEEPAGFEVTATSKSCPIAGIADEDRLLYGVQFHPEVRHSAYGNELLKNFALNICGCKGDWTMENFSEVEIAKIQEIVGDKKVLLALSGGVDSSVVGVLIHKAIGDQLTCIFVDHGLLRKGEADQVMATLQGEFNMNIIKVDAKKRFMDKLAGVSDPEQKRKIIGNEFIYVFDDEANKLD-GVEFLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRALGTELGMPDAIVWRQPFPGPGLGIRVLGEITEEKLEIVRDSDYILREEI----KNAGLEREIWQYFTALPNIRSVGVMGDGRTYDHTVVVRAVTSIDGMTADWARIPWDVLEKISVRIVNEVDHVNRVVYDITSKPPATVEWE 518
>gi|153201827|ref|ZP_01943584.1| GMP synthase [Listeria monocytogenes HPB2262] >gi|133735616|gb|EBA37314.1| GMP synthase [Listeria monocytogenes HPB2262] (514 aa)
Score = 1426, Expect = 8.8e-156, Identities = 275/510 (53%), Positives = 360/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS--EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KI++LDFG QY QLI RRIR+  VYSE+  + I++EE+   NP GII SGG +SVY + + + ++ I D+ IPILGICYG Q+M    GG+VE  KD  EYG  DI +   N LF  +  D   WMSH D V+  P GF+V  ++  C +A   + E+  YGVQFHPEV  + +GN+LL+NF  ++C   GDW  +N    +I +I+ IV D  VL A+SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+ +V A L+     NI  VD K+ F+ KL GV DPEQKRKIIG  FI VF+  ANK++   ++L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L +P   V+RQPFPGPGL +RVLGEITE+KLEIVR++D++ R  I    KN+  E + WQYFT L N +SVGV+GD R+Y +T+ +RAV S+D M+A W +IP + LEKIS  I N+V +++RVVYDIT+KPP T+EWE
  S:     8 EKIIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDEDAFRADERILDMGIPILGICYGMQLMTTHFGGKVERAKD-REYGKADIHVEKPNRLFAGLPTDQVVWMSHGDLVVEEPAGFEVTITSKSCPIAGIADEERSLYGVQFHPEVRHSVYGNELLKNFALNVCGCKGDWTMENFSEVEIAKIQEIVGDKKVLLALSGGVDSSVVGVLIHKAIGDQLTCIFVDHGLLRKGEADQVMATLQGEFNMNIIKVDAKKRFMDKLAGVSDPEQKRKIIGNEFIYVFDDEANKLD-GVEFLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRALGTELGMPDAIVWRQPFPGPGLGIRVLGEITEEKLEIVRDSDYILREEI----KNAGLEREIWQYFTALPNIRSVGVMGDGRTYDHTVVVRAVTSIDGMTADWARIPWDVLEKISVRIVNEVDHVNRVVYDITSKPPATVEWE 514
>gi|194016061|ref|ZP_03054676.1| GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase) [Bacillus pumilus ATCC 7061] >gi|194012416|gb|EDW21983.1| GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase) [Bacillus pumilus ATCC 7061] (513 aa)
Score = 1426, Expect = 9.4e-156, Identities = 278/510 (54%), Positives = 360/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + IL+LDFG QY QLI RRIR+  VYSE+  + ++ EEI +  PKGIILSGG +SVY   S + ++ I+DL+IP+LGICYG Q+M    GG+VE      EYG  DI +  T  LF+++  D   WMSH D V+ +P+GF V A++  C  ++    EK FYGVQFHPEV  + +GN LL+NFV+ +CD  G W  +N    ++++I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E++ V     +    N+  VD K  FL+KLKGV DPEQKRKIIG  FI VF+  ++K+     YL QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG  L IP   V+RQPFPGPGL +RVLGEI+E+KLEIVRE+D + R  I       E   WQYFTVL + +SVGV+GD R+Y YT+ +RAV S+D M++ W +IP + LEKIS+ I N+VK+++RVVYDIT+KPP TIEWE
  S:     7 EMILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEIKEMAPKGIILSGGPNSVYDAGSFRCDEKIFDLDIPVLGICYGMQLMTHYLGGKVEA-ASQREYGKADIHINGTPALFKDLPTDQVVWMSHGDLVVEVPEGFTVDATSAHCPNSAMSLAEKNFYGVQFHPEVRHSEYGNDLLKNFVFGVCDCDGKWSMENFIEIEMQKIRQTVGDKQVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFNMNVIKVDAKDRFLNKLKGVSDPEQKRKIIGNEFIYVFDDESDKLK-GIDYLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGSELGIPDDIVWRQPFPGPGLGIRVLGEISEEKLEIVRESDAILREEIANF--GLERDIWQYFTVLPDIRSVGVMGDARTYDYTIGIRAVTSIDGMTSDWARIPWDVLEKISTRIVNEVKHVNRVVYDITSKPPATIEWE 513
>gi|16803136|ref|NP_464621.1| bifunctional GMP synthase/glutamine amidotransferase protein [Listeria monocytogenes EGD-e] >gi|24211754|sp|Q8Y822|GUAA_LISMO GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|16410498|emb|CAC99174.1| guaA [Listeria monocytogenes] (518 aa)
Score = 1425, Expect = 1.3e-155, Identities = 274/510 (53%), Positives = 360/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS--EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KI++LDFG QY QLI RRIR+  VYSE+  + I++EE+   NP GII SGG +SVY + + + ++ I+D+ IPILGICYG Q+M    GG+VE  KD  EYG  DI +   N LF  +  D   WMSH D V+  P GF+V  ++  C +A   + E+  YGVQFHPEV  + +GN+LL+NF  ++C   GDW  +N    +I +I+ IV D  VL A+SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+ +V   L+     NI  VD K+ F+ KL GV DPEQKRKIIG  FI VF+  ANK++   ++L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L +P   V+RQPFPGPGL +RVLGEITE+KLEIVR++D++ R  I    KN+  E + WQYFT L N +SVGV+GD R+Y +T+ +RAV S+D M+A W +IP + LEKIS  I N+V +++RVVYDIT+KPP T+EWE
  S:    12 EKIIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDEDAFRADERIFDMGIPILGICYGMQLMTTHFGGKVERAKD-REYGKADIHVEKPNRLFAGLPTDQVVWMSHGDLVVEEPAGFEVTVTSKSCPIAGIADEERSLYGVQFHPEVRHSVYGNELLKNFALNVCGCKGDWTMENFSEVEIAKIQEIVGDKKVLLALSGGVDSSVVGVLIHKAIGDQLTCIFVDHGLLRKGEADQVMETLQGEFNMNIIKVDAKKRFMDKLAGVSDPEQKRKIIGNEFIYVFDDEANKLD-GVEFLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRALGTELGMPDAIVWRQPFPGPGLGIRVLGEITEEKLEIVRDSDYILREEI----KNAGLEREIWQYFTALPNIRSVGVMGDGRTYDHTVVVRAVTSIDGMTADWARIPWDVLEKISVRIVNEVDHVNRVVYDITSKPPATVEWE 518
>gi|167217285|ref|ZP_02286921.1| bifunctional GMP synthase/glutamine amidotransferase protein [Listeria monocytogenes FSL J1-175] (518 aa)
Score = 1425, Expect = 1.4e-155, Identities = 274/510 (53%), Positives = 361/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS--EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KI++LDFG QY QLI RRIR+  VYSE+  + I++EE+   NP GII SGG +SVY + + + ++ I+D+ IPILGICYG Q+M    GG+VE  KD  EYG  DI +   N LF  +  D   WMSH D V+  P GF+V  ++  C +A   + E+  YGVQFHPEV  + +GN+LL+NF  ++C   GDW  +N    +I +I+ IV D  VL A+SGGVDS V  VL  +AIG++L C+FVDHGLLRK E+ +V A L+     NI  VD K+ F+ KL GV DPEQKRKIIG  FI VF+  ANK++   ++L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L +P   V+RQPFPGPGL +RVLGEITE+KLEIVR++D++ R  I    KN+  E + WQYFT L N +SVGV+GD R+Y +T+ +RAV S+D M+A W +IP + LEKIS  I N+V +++RVVYDIT+KPP T+EWE
  S:    12 EKIIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDEDAFRADERIFDMGIPILGICYGMQLMTTHFGGKVERAKD-REYGKADIHVEKPNRLFAGLPTDQVVWMSHGDLVVEEPAGFEVTITSKSCPIAGIADEERSLYGVQFHPEVRHSVYGNELLKNFALNVCGCKGDWTMENFSEVEIAKIQEIVGDKKVLLALSGGVDSSVVGVLIHKAIGEQLTCIFVDHGLLRKGEADQVMATLQGEFNMNIIKVDAKKRFMDKLAGVSDPEQKRKIIGNEFIYVFDDEANKLD-GVEFLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRALGTELGMPDAIVWRQPFPGPGLGIRVLGEITEEKLEIVRDSDYILREEI----KNAGLEREIWQYFTALPNIRSVGVMGDGRTYDHTVVVRAVTSIDGMTADWARIPWDVLEKISVRIVNEVDHVNRVVYDITSKPPATVEWE 518
>gi|52079121|ref|YP_077912.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus licheniformis ATCC 14580] >gi|52784488|ref|YP_090317.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus licheniformis ATCC 14580] >gi|81386308|sp|Q65MU0|GUAA_BACLD GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|52002332|gb|AAU22274.1| GMP synthetase [Bacillus licheniformis ATCC 14580] >gi|52346990|gb|AAU39624.1| GuaA [Bacillus licheniformis DSM 13] (513 aa)
Score = 1424, Expect = 1.6e-155, Identities = 275/510 (53%), Positives = 368/510 (72%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + IL+LDFG QY QLI RRIR+  VYSE+  + ++ EEI K NPKGIILSGG +SVY + S + ++ I++L+IP+LGICYG Q+M    GG+VE      EYG  +I +    +LF+++  +   WMSH D V+ +P+GF V A+++ C  ++   ++KK+YGVQFHPEV  + +GN LL+NFV+ +C+  G+W  +N    ++++I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E++ V     +    N+  VD K  FL+KLKGV DPEQKRKIIG  FI VF+  A K+     +L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGE+TE+KLEIVRE+D + R  I +   + E   WQYFTVL + +SVGV+GD R+Y YT+ +RAV S+D M++ W +IP + LEKIS+ I N+VK+I+RVVYDIT+KPP TIEWE
  S:     7 EMILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEIKKMNPKGIILSGGPNSVYDEGSFRCDEKIFELDIPVLGICYGMQLMTHYLGGKVEA-ASQREYGKANIHIEGEPDLFKDLPNEQVVWMSHGDLVVEVPEGFTVDATSHHCPNSAMSKKDKKWYGVQFHPEVRHSEYGNDLLKNFVFGVCECVGEWSMENFIEIEMQKIRETVGDKQVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFNMNVIKVDAKDRFLNKLKGVSDPEQKRKIIGNEFIYVFDDEAEKLK-GIDFLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGTELGIPDEIVWRQPFPGPGLGIRVLGEVTEEKLEIVRESDAILREEIAK--ADLEKDIWQYFTVLPDIRSVGVMGDARTYDYTIGIRAVTSIDGMTSDWARIPWDVLEKISTRIVNEVKHINRVVYDITSKPPATIEWE 513
>gi|153195892|ref|ZP_01940300.1| GMP synthase [Listeria monocytogenes 10403S] >gi|127634174|gb|EBA23560.1| GMP synthase [Listeria monocytogenes 10403S] (514 aa)
Score = 1422, Expect = 2.6e-155, Identities = 274/510 (53%), Positives = 360/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS--EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KI++LDFG QY QLI RRIR+  VYSE+  + I++EE+   NP GII SGG +SVY + + + ++ I+D+ IPILGICYG Q+M    GG+VE  KD  EYG  DI +   N LF  +  D   WMSH D V+  P GF+V  ++  C +A   + E+  YGVQFHPEV  + +GN+LL+NF  ++C   GDW  +N    +I +I+ IV D  VL A+SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+ +V   L+     NI  VD K+ F+ KL GV DPEQKRKIIG  FI VF+  ANK++   ++L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L +P   V+RQPFPGPGL +RVLGEITE+KLEIVR++D++ R  I    KN+  E + WQYFT L N +SVGV+GD R+Y +T+ +RAV S+D M+A W +IP + LEKIS  I N+V +++RVVYDIT+KPP T+EWE
  S:     8 EKIIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDEDAFRADERIFDMGIPILGICYGMQLMTTHFGGKVERAKD-REYGKADIHVEKPNRLFAGLPTDQVVWMSHGDLVVEEPAGFEVTVTSKSCPIAGIADEERSLYGVQFHPEVRHSVYGNELLKNFALNVCGCKGDWTMENFSEVEIVKIQEIVGDKKVLLALSGGVDSSVVGVLIHKAIGDQLTCIFVDHGLLRKGEADQVMETLQGEFNMNIIKVDAKKRFMDKLAGVSDPEQKRKIIGNEFIYVFDDEANKLD-GVEFLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRALGTELGMPDAIVWRQPFPGPGLGIRVLGEITEEKLEIVRDSDYILREEI----KNAGLEREIWQYFTALPNIRSVGVMGDGRTYDHTVVVRAVTSIDGMTADWARIPWDVLEKISVRIVNEVDHVNRVVYDITSKPPATVEWE 514
>gi|57652648|ref|YP_185351.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus aureus subsp. aureus COL] >gi|87160103|ref|YP_493103.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus aureus subsp. aureus USA300] >gi|88194173|ref|YP_498964.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151220593|ref|YP_001331415.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|161508662|ref|YP_001574321.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168729325|ref|ZP_02761602.1| GMP synthase (glutamine-hydrolyzing) [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|71152095|sp|Q5HIQ6|GUAA_STAAC GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|57286834|gb|AAW38928.1| GMP synthase [Staphylococcus aureus subsp. aureus COL] >gi|87126077|gb|ABD20591.1| GMP synthase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201731|gb|ABD29541.1| GMP synthase, putative [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150373393|dbj|BAF66653.1| glutamine-hydrolyzing GMP synthase [Staphylococcus aureus subsp. aureus str. Newman] >gi|160367471|gb|ABX28442.1| GMP synthase (glutamine-hydrolyzing) [Staphylococcus aureus subsp. aureus USA300_TCH1516] (513 aa)
Score = 1420, Expect = 4.3e-155, Identities = 280/508 (55%), Positives = 364/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QY QLI RRIR++ VYSE+ D++ISIEEI K NPKGIILSGG +SVY + S   +  I++L IP+LGICYG Q+  +  GG+VE   +  EYG   I   ++ELF  +  +   WMSHSD VI +P+GF+VIA +     A+  +++++ YGVQFHPEV  T +GN LL NFV  +CD  G W  +N    +IE+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E   V     +    NI  V+ K  F++KLKGV DPEQKRKIIG  F+ VF+  A+K+     +L QGT+Y D++ESG+K ++TIKSHHNVGGLPE ++FEL+EP+  LFKDEVRKLG+ L IP   V+RQPFPGPGL +RVLGEITEDKLEIVRE+D + R  I +  +  E + WQYFTVL N +SVGV+GD R+Y +T+ +RAV S+D M++ + +I  E L+KISS I N+V +++RVVYDIT+KPP TIEWE
  S:    10 ILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNLGIPVLGICYGMQLTTKLLGGKVER-ANEREYGKAIINAKSDELFAGLPAEQTVWMSHSDKVIEIPEGFEVIADSPSTDYAAIEDKKRRIYGVQFHPEVRHTEYGNDLLNNFVRRVCDCRGQWTMENFIEIEIEKIRQRVGDRRVLCAMSGGVDSSVVAVLLHKAIGDQLTCIFVDHGLLRKGEGDMVMEQFGEGFNMNIIRVNAKDRFMNKLKGVSDPEQKRKIIGNEFVYVFDDEASKLK-GVDFLAQGTLYTDVIESGTKTAQTIKSHHNVGGLPEDMEFELIEPINTLFKDEVRKLGIELGIPEHLVWRQPFPGPGLGIRVLGEITEDKLEIVRESDAILRQVIRE--EGLEREIWQYFTVLPNIQSVGVMGDYRTYDHTVGIRAVTSIDGMTSDFARIDWEVLQKISSRIVNEVDHVNRVVYDITSKPPSTIEWE 513
>gi|15923381|ref|NP_370915.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus aureus subsp. aureus Mu50] >gi|15926092|ref|NP_373625.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus aureus subsp. aureus N315] >gi|49482642|ref|YP_039866.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|148266876|ref|YP_001245819.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus aureus subsp. aureus JH9] >gi|150392922|ref|YP_001315597.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus aureus subsp. aureus JH1] >gi|156978719|ref|YP_001440978.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus aureus subsp. aureus Mu3] >gi|54037236|sp|P99105|GUAA_STAAN GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|54041333|sp|P64296|GUAA_STAAM GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|56749046|sp|Q6GJQ6|GUAA_STAAR GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|13700305|dbj|BAB41603.1| GMP synthase [Staphylococcus aureus subsp. aureus N315] >gi|14246159|dbj|BAB56553.1| GMP synthase [Staphylococcus aureus subsp. aureus Mu50] >gi|49240771|emb|CAG39433.1| putative GMP synthase [Staphylococcus aureus subsp. aureus MRSA252] >gi|147739945|gb|ABQ48243.1| GMP synthase (glutamine-hydrolyzing) [Staphylococcus aureus subsp. aureus JH9] >gi|149945374|gb|ABR51310.1| GMP synthase, large subunit [Staphylococcus aureus subsp. aureus JH1] >gi|156720854|dbj|BAF77271.1| GMP synthase [Staphylococcus aureus subsp. aureus Mu3] (513 aa)
Score = 1420, Expect = 4.8e-155, Identities = 280/508 (55%), Positives = 364/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QY QLI RRIR++ VYSE+ D++ISIEEI K NPKGIILSGG +SVY + S   +  I++L IP+LGICYG Q+  +  GG+VE   +  EYG   I   ++ELF  +  +   WMSHSD VI +P+GF+VIA +     A+  +++++ YGVQFHPEV  T +GN LL NFV  +CD  G W  +N    +IE+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E   V     +    NI  V+ K  F++KLKGV DPEQKRKIIG  F+ VF+  A+K+     +L QGT+Y D++ESG+K ++TIKSHHNVGGLPE ++FEL+EP+  LFKDEVRKLG+ L IP   V+RQPFPGPGL +RVLGEITEDKLEIVRE+D + R  I +  +  E + WQYFTVL N +SVGV+GD R+Y +T+ +RAV S+D M++ + +I  E L+KISS I N+V +++RVVYDIT+KPP TIEWE
  S:    10 ILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNLGIPVLGICYGMQLTTKLLGGKVER-ANEREYGKAIINAKSDELFAGLPAEQTVWMSHSDKVIEIPEGFEVIADSPSTDYAAIEDKKRRIYGVQFHPEVRHTEYGNDLLNNFVRRVCDCKGQWTMENFIEIEIEKIRQRVGDRRVLCAMSGGVDSSVVAVLLHKAIGDQLTCIFVDHGLLRKGEGDMVMEQFGEGFNMNIIRVNAKDRFMNKLKGVSDPEQKRKIIGNEFVYVFDDEASKLK-GVDFLAQGTLYTDVIESGTKTAQTIKSHHNVGGLPEDMEFELIEPINTLFKDEVRKLGIELGIPEHLVWRQPFPGPGLGIRVLGEITEDKLEIVRESDAILRQVIRE--EGLEREIWQYFTVLPNIQSVGVMGDYRTYDHTVGIRAVTSIDGMTSDFARIDWEVLQKISSRIVNEVDHVNRVVYDITSKPPSTIEWE 513
>gi|47094954|ref|ZP_00232567.1| GMP synthase [Listeria monocytogenes str. 1/2a F6854] >gi|153179205|ref|ZP_01932424.1| GMP synthase [Listeria monocytogenes F6900] >gi|153184726|ref|ZP_01935453.1| GMP synthase [Listeria monocytogenes J0161] >gi|153190499|ref|ZP_01937888.1| GMP synthase [Listeria monocytogenes J2818] >gi|47016572|gb|EAL07492.1| GMP synthase [Listeria monocytogenes str. 1/2a F6854] >gi|126942697|gb|EBA20434.1| GMP synthase [Listeria monocytogenes J0161] >gi|127765881|gb|EBA26225.1| GMP synthase [Listeria monocytogenes J2818] >gi|133732690|gb|EBA34388.1| GMP synthase [Listeria monocytogenes F6900] (514 aa)
Score = 1417, Expect = 1.1e-154, Identities = 273/510 (53%), Positives = 359/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS--EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KI++LDFG QY QLI RRIR+  VYSE+  + I++EE+   NP GII SGG +SVY + + + ++ I+D+ IPILGICYG Q+M    GG+VE  KD  EYG  DI +   + LF  +  D   WMSH D V+  P GF+V  ++  C +A   + E+  YGVQFHPEV  +  GN+LL+NF  ++C   GDW  +N    +I +I+ IV D  VL A+SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+ +V   L+     NI  VD K+ F+ KL GV DPEQKRKIIG  FI VF+  ANK++   ++L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L +P   V+RQPFPGPGL +RVLGEITE+KLEIVR++D++ R  I    KN+  E + WQYFT L N +SVGV+GD R+Y +T+ +RAV S+D M+A W +IP + LEKIS  I N+V +++RVVYDIT+KPP T+EWE
  S:     8 EKIIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDEDAFRADERIFDMGIPILGICYGMQLMTTHFGGKVERAKD-REYGKADIHVEKPSRLFAGLPTDQVVWMSHGDLVVEEPAGFEVTVTSKSCPIAGIADEERSLYGVQFHPEVRHSVHGNELLKNFALNVCGCKGDWTMENFSEVEIAKIQEIVGDKKVLLALSGGVDSSVVGVLIHKAIGDQLTCIFVDHGLLRKGEADQVMTTLQGEFNMNIIKVDAKKRFMDKLAGVSDPEQKRKIIGNEFIYVFDDEANKLD-GVEFLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRALGTELGMPDAIVWRQPFPGPGLGIRVLGEITEEKLEIVRDSDYILREEI----KNAGLEREIWQYFTALPNIRSVGVMGDGRTYDHTVVVRAVTSIDGMTADWARIPWDVLEKISVRIVNEVDHVNRVVYDITSKPPATVEWE 514
>gi|116872487|ref|YP_849268.1| bifunctional GMP synthase/glutamine amidotransferase protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741365|emb|CAK20489.1| guaA [Listeria welshimeri serovar 6b str. SLCC5334] (518 aa)
Score = 1416, Expect = 1.3e-154, Identities = 272/510 (53%), Positives = 358/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KI++LDFG QY QLI RRIR+  VYSE+  + I++EE+   NP GII SGG +SVY   + + ++ I+D+ IPILGICYG Q+M     G+VE  KD  EYG  DI +   + LF  +  D   WMSH D V+  P GF+V A++  C +A   + E+  YGVQFHPEV  + +GN+LL+NF  ++C   GDW  +N    +I +I+ IV D  VL A+SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+ +V A L+     NI  VD K+ F+ KL GV DPEQKRKIIG  FI VF+  ANK++   ++L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L +P   V+RQPFPGPGL +RVLGEITE+KLEIVR++D++ R  I +     E + WQYFT L N +SVGV+GD R+Y +T+ +RAV S+D M+A W +IP + LEKIS  I N+V +++RVVYDIT+KPP T+EWE
  S:    12 EKIIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDKDAFRADERIFDMGIPILGICYGMQLMTTHFDGKVERAKD-REYGKADIHVENPSRLFAGLPTDQVVWMSHGDLVVEEPAGFEVTATSPSCPIAGIADEERLLYGVQFHPEVRHSVYGNELLKNFALNVCGCKGDWTMENFSEVEIAKIQEIVGDKKVLLALSGGVDSSVVGVLIHKAIGDQLTCIFVDHGLLRKGEADQVMATLQGEFNMNIIKVDAKKRFMDKLAGVSDPEQKRKIIGNEFIYVFDDEANKLD-GVEFLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRALGTELGMPDAIVWRQPFPGPGLGIRVLGEITEEKLEIVRDSDYILREEIKK--AGLEREIWQYFTALPNIRSVGVMGDGRTYDHTVVVRAVTSIDGMTADWARIPWDVLEKISVRIVNEVDHVNRVVYDITSKPPATVEWE 518
>gi|21282096|ref|NP_645184.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus aureus subsp. aureus MW2] >gi|49485271|ref|YP_042492.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|24211742|sp|Q8NY69|GUAA_STAAW GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|56748992|sp|Q6GC81|GUAA_STAAS GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|21203532|dbj|BAB94232.1| GMP synthase [Staphylococcus aureus subsp. aureus MW2] >gi|49243714|emb|CAG42139.1| putative GMP synthase [Staphylococcus aureus subsp. aureus MSSA476] (513 aa)
Score = 1415, Expect = 1.6e-154, Identities = 279/508 (54%), Positives = 364/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QY QLI RRIR++ VYSE+ D++ISIEEI K NPKGIILSGG +SVY + S   +  I++L IP+LGICYG Q+  +  GG+VE   +  EYG   I   ++ELF  +  +   WMSHSD VI +P+GF+VIA +     A+  +++++ YGVQFHPEV  T +GN LL NFV  +C+  G W  +N    +IE+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E   V     +    NI  V+ K  F++KLKGV DPEQKRKIIG  F+ VF+  A+K+     +L QGT+Y D++ESG+K ++TIKSHHNVGGLPE ++FEL+EP+  LFKDEVRKLG+ L IP   V+RQPFPGPGL +RVLGEITEDKLEIVRE+D + R  I +  +  E + WQYFTVL N +SVGV+GD R+Y +T+ +RAV S+D M++ + +I  E L+KISS I N+V +++RVVYDIT+KPP TIEWE
  S:    10 ILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNLGIPVLGICYGMQLTTKLLGGKVER-ANEREYGKAIINAKSDELFAGLPAEQTVWMSHSDKVIEIPEGFEVIADSPSTDYAAIEDKKRRIYGVQFHPEVRHTEYGNDLLNNFVRRVCECKGQWTMENFIEIEIEKIRQRVGDRRVLCAMSGGVDSSVVAVLLHKAIGDQLTCIFVDHGLLRKGEGDMVMEQFGEGFNMNIIRVNAKDRFMNKLKGVSDPEQKRKIIGNEFVYVFDDEASKLK-GVDFLAQGTLYTDVIESGTKTAQTIKSHHNVGGLPEDMEFELIEPINTLFKDEVRKLGIELGIPEHLVWRQPFPGPGLGIRVLGEITEDKLEIVRESDAILRQVIRE--EGLEREIWQYFTVLPNIQSVGVMGDYRTYDHTVGIRAVTSIDGMTSDFARIDWEVLQKISSRIVNEVDHVNRVVYDITSKPPSTIEWE 513
>gi|73663631|ref|YP_302412.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|91206832|sp|Q49UU9|GUAA_STAS1 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|72496146|dbj|BAE19467.1| GMP synthase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (513 aa)
Score = 1414, Expect = 2.2e-154, Identities = 278/508 (54%), Positives = 367/508 (72%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QY QLI RRIR++ VYSE+ D++IS+EEI + NPKGIILSGG +SVY + S   +  I++L +PILGICYG Q+  +  GG+VE   +  EYG   I   T+ELF  +  + N WMSHSD VI +P+GF+VIA +     A+  ++ ++ YGVQFHPEV  T +GN LL+NFV  +CD  G+W  +N    +IE+I++ V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E   V     +    NI  VD ++ F+SKL+GV DPEQKRKIIG  FI VF+  A+K+     +L QGT+Y D++ESG+K ++TIKSHHNVGGLPE ++F+L+EP+  LFKDEVR+LG+ L IP   V+RQPFPGPGL +RVLGEITEDKLEIVRE+D + R  I +  +  E + WQYFTVL   +SVGV+GD R+Y +T+ +RAV S+D M++ + +I  E L+KISS I N+V +++RVVYDIT+KPP TIEWE
  S:    10 ILVLDFGSQYNQLITRRIREMGVYSELHDHEISMEEIKRLNPKGIILSGGPNSVYEEDSFTIDPEIYNLGVPILGICYGMQLTTKLLGGKVER-ANEREYGKAIINAKTDELFFGLPEEQNVWMSHSDKVIEIPEGFEVIADSPSTNYAAIEDKSRRIYGVQFHPEVRHTEYGNDLLRNFVRRVCDCIGEWSMENFIEIEIEKIRNQVGDRKVLCAMSGGVDSSVVAVLLHKAIGDQLTCIFVDHGLLRKGEGDMVMEQFGEGFNMNIIRVDAQERFMSKLQGVSDPEQKRKIIGNEFIYVFDDEASKLK-GVDFLAQGTLYTDVIESGTKTAQTIKSHHNVGGLPEDMEFQLIEPINTLFKDEVRELGIELGIPEHLVWRQPFPGPGLGIRVLGEITEDKLEIVRESDAILRQVIRE--EGLEREIWQYFTVLPGIQSVGVMGDYRTYDHTVGIRAVTSIDGMTSDFARIDWEVLQKISSRIVNEVDHVNRVVYDITSKPPSTIEWE 513
>gi|171324911|ref|ZP_02913422.1| GMP synthase, large subunit [Geobacillus sp. WCH70] >gi|171089186|gb|EDT35520.1| GMP synthase, large subunit [Geobacillus sp. WCH70] (512 aa)
Score = 1414, Expect = 2.2e-154, Identities = 272/510 (53%), Positives = 360/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + I++LDFG QY QLI RRIR+  VYSE+  + I+ E+I + N KGII SGG +SVY D +   +  I++L +PILGICYG Q+M    GG+VE      EYG   I++   + LFE +  +   WMSH D V   P+GF V A +  C +A+  N  KKFY VQFHPEV  + +GN +L+NFV+ +C   GDW  ++    ++ +I+ +V D  VLCA+SGGVDS VAAVL  +AIGD+L C+FVDHGLLRK E++ V    ++    N+  VD K+ FLSKLKGV DPEQKRKIIG  FI VF+  A K+    ++L+QGT+Y DI+ESG+  ++TIKSHHNVGGLPE ++F+L+EPL  LFKDEVR LG  L +P + V+RQPFPGPGL +RVLGE+TE+KLEIVRE+D + R  I +   + E   WQYFTVL + +SVGV+GD R+Y YT+ +RAV S+D M+A W +IP E LEKIS+ I N+V +++RVVYDIT+KPP TIEWE
  S:     6 EMIIVLDFGSQYNQLITRRIREFGVYSELHPHTITAEKIQEMNVKGIIFSGGPNSVYDDNAFTCDPKIFELGLPILGICYGMQLMTHHLGGKVEK-ATHREYGKAMIQVRNASALFERLPDEQVVWMSHGDLVTAPPEGFTVDAVSASCPIAAMSNEAKKFYAVQFHPEVRHSVYGNDILRNFVFDVCQCKGDWTMESFIDSEVRKIRELVGDKKVLCALSGGVDSSVAAVLVHRAIGDQLTCIFVDHGLLRKGEAESVMKTFREGFHMNVIKVDAKERFLSKLKGVTDPEQKRKIIGNEFIYVFDDEAAKLE-GIEFLVQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMKFKLIEPLNTLFKDEVRALGTELGLPDEIVWRQPFPGPGLGIRVLGEVTEEKLEIVRESDAILREEIKKAGLDRE--IWQYFTVLPDIRSVGVMGDARTYDYTVGIRAVTSVDGMTADWARIPWEVLEKISTRIVNEVPHVNRVVYDITSKPPATIEWE 512
>gi|192808276|ref|ZP_03036953.1| GMP synthase, large subunit [Geobacillus sp. Y412MC10] >gi|192803696|gb|EDV80199.1| GMP synthase, large subunit [Geobacillus sp. Y412MC10] (512 aa)
Score = 1413, Expect = 3.0e-154, Identities = 266/508 (52%), Positives = 365/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGK---NIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I++LDFGGQY QLIARRIRDL VYSE++ Y+  +E+I   +P+GI+ SGG  SVY + +   +  I+DL +PI GICYG Q+M Q+  G+VE      EYG  ++    N  L + IE     WMSH D V+ LP GFK+ A T    +A+  N +KK Y VQFHPEV  +  GN++++NF+Y +C   G+W  +    +++ EI+ +V +  VLCA+SGGVDS V A+L  +AIGD+L C+F+DHGLLRK E++ V   ++  +GK    +  +D ++ F+SKLKGV DPE+KRKIIG  FI VF++ ++K +  F +L QGT+Y DIVESG+  + TIKSHHNVGGLPE ++FEL+EPLK LFKDEVRK+G  L +P + V+RQPFPGPGLA+RVLGE+TEDKL+IVR++D++ R  I +     + + WQYFT L N KSVGV+GD R+Y YT+ +RAV S+D M+A W +IP + LEKIS  I N+V+N++R+VYD+T+KPP TIEWE
  S:     8 IVVLDFGGQYNQLIARRIRDLGVYSELLPYNTPVEKIKDLSPRGIVFSGGPSSVYSENAPHVDPAIYDLGLPIFGICYGMQLMAQQLDGKVER-ASKREYGKAELEFAPNSTLVKGIEQKQTVWMSHGDHVVSLPSGFKLDAGTESAPIAAMSNEDKKLYAVQFHPEVRHSVHGNEMIKNFLYEVCGCEGNWSMETFIEDQVREIREVVGEKKVLCALSGGVDSSVVAMLIHKAIGDQLTCMFIDHGLLRKGEAESV---METFVGKFDMKVVKIDAQERFMSKLKGVDDPEKKRKIIGNEFIYVFDEESSKFD-DFAFLAQGTLYTDIVESGTDTAHTIKSHHNVGGLPEDMKFELIEPLKALFKDEVRKVGEELGLPDEIVHRQPFPGPGLAIRVLGEVTEDKLQIVRDSDYILREEIAK--AGLDREIWQYFTALPNMKSVGVMGDARTYSYTVGIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVENVNRIVYDVTSKPPATIEWE 512
>gi|82750102|ref|YP_415843.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus aureus RF122] >gi|91206830|sp|Q2YVL5|GUAA_STAAB GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|82655633|emb|CAI80029.1| glutamine-hydrolyzing GMP synthase [Staphylococcus aureus RF122] (513 aa)
Score = 1413, Expect = 3.4e-154, Identities = 279/508 (54%), Positives = 363/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QY QLI RRIR++ VYSE+ D++ISI EI K NPKGIILSGG +SVY + S   +  I++L IP+LGICYG Q+  +  GG+VE   +  EYG   I   ++ELF  +  +   WMSHSD VI +P+GF+VIA +     A+  +++++ YGVQFHPEV  T +GN LL NFV  +CD  G W  +N    +IE+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E   V     +    NI  V+ K  F++KLKGV DPEQKRKIIG  F+ VF+  A+K+     +L QGT+Y D++ESG+K ++TIKSHHNVGGLPE ++FEL+EP+  LFKDEVRKLG+ L IP   V+RQPFPGPGL +RVLGEITEDKLEIVRE+D + R  I +  +  E + WQYFTVL N +SVGV+GD R+Y +T+ +RAV S+D M++ + +I  E L+KISS I N+V +++RVVYDIT+KPP TIEWE
  S:    10 ILVLDFGSQYNQLITRRIREMGVYSELHDHEISIGEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNLGIPVLGICYGMQLTTKLLGGKVER-ANEREYGKAIINTKSDELFAGLPAEQTVWMSHSDKVIEIPEGFEVIADSPSTDYAAIEDKKRRIYGVQFHPEVRHTEYGNDLLNNFVRRVCDCKGQWTMENFIEIEIEKIRQRVGDRRVLCAMSGGVDSSVVAVLLHKAIGDQLTCIFVDHGLLRKGEGDMVMEQFGEGFNMNIIRVNAKDRFMNKLKGVSDPEQKRKIIGNEFVYVFDDEASKLK-GVDFLAQGTLYTDVIESGTKTAQTIKSHHNVGGLPEDMEFELIEPINTLFKDEVRKLGIELGIPEHLVWRQPFPGPGLGIRVLGEITEDKLEIVRESDAILRQVIRE--EGLEREIWQYFTVLPNIQSVGVMGDYRTYDHTVGIRAVTSIDGMTSDFARIDWEVLQKISSRIVNEVDHVNRVVYDITSKPPSTIEWE 513
>gi|154685131|ref|YP_001420292.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus amyloliquefaciens FZB42] >gi|154350982|gb|ABS73061.1| GuaA [Bacillus amyloliquefaciens FZB42] (513 aa)
Score = 1411, Expect = 4.7e-154, Identities = 272/510 (53%), Positives = 363/510 (71%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + IL+LDFG QY QLI RRIR+  VYSE+  + ++ EEI + NPKGIILSGG +SVY + S + ++ I++L+IP+LGICYG Q+M    GG+VE      EYG  +I++  T +LF+++  +   WMSH D V+ +P+GF V A+++ C  ++    +K +YGVQFHPEV  + +GN LL+NFV+ +CD  G W  +N    ++++I+  V D  VLCA+SGGVDS V A L  +AIGD+L C+FVDHGLLRK E++ V     +    N+  VD K  FL+KLKGV DPEQKRKIIG  FI VF+  A+K+     YL QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG  L +P   V+RQPFPGPGL +RVLGE+TE+KLEIVRE+D + R  +       E   WQYFTVL + +SVGV+GD R+Y YT+ +RAV S+D M++ W +IP + LE IS+ I N+VK+I+RVVYDIT+KPP TIEWE
  S:     7 EMILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEIKEMNPKGIILSGGPNSVYDEGSFRCDEKIFELDIPVLGICYGMQLMTHYLGGKVEA-ASQREYGKANIQIQGTPDLFKDLPEEQVVWMSHGDLVVEVPEGFTVDATSHHCPNSAMSKADKNWYGVQFHPEVRHSEYGNDLLKNFVFGVCDCEGKWSMENFIEIEMQKIRETVGDKQVLCALSGGVDSSVVAALIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFNMNVIKVDAKDRFLNKLKGVSDPEQKRKIIGNEFIYVFDDEADKLK-GIDYLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGTELGLPDDIVWRQPFPGPGLGIRVLGEVTEEKLEIVRESDAILREEVAN--HGLERDIWQYFTVLPDIRSVGVMGDARTYDYTIGIRAVTSIDGMTSDWARIPWDVLEVISTRIVNEVKHINRVVYDITSKPPATIEWE 513
>gi|49476755|ref|YP_034594.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|81397417|sp|Q6HPC6|GUAA_BACHK GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|49328311|gb|AAT58957.1| GMP synthase [Bacillus thuringiensis serovar konkukian str. 97-27] (515 aa)
Score = 1408, Expect = 1.0e-153, Identities = 273/510 (53%), Positives = 359/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D I++LDFG QY QLIARRIR+  VYSE+  + I+ EEI   NPKGII SGG +SVYG+ ++  ++ I+DL +PI GICYG Q+M Q+ GG VE   +  EYG   +++   ++L+ N+  +   WMSH D V  LP+GF V A++  C +A   N  K  YGVQFHPEV  +  GN L++NFV+ +C  +  W  +N    ++E+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E++ V     +    N+  VD K+ F++KLKGV DPEQKRKIIG  FI VF+  A+K+     +L QGT+Y DIVESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGEITE+KLEIVRE+D + R  I +   + E   WQYFT L   +SVGV+GD R+Y YT+ +RAV S+D M+A W +IP + LEKIS  I N+VK+++R+VYD+T+KPP TIEWE
  S:     9 DTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFDLGLPIFGICYGMQLMTQQFGGTVER-ANHREYGKAVLKVENESKLYANLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSNEAKNLYGVQFHPEVRHSEHGNDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKVDAKERFMNKLKGVEDPEQKRKIIGNEFIYVFDDEASKLE-GMDFLAQGTLYTDIVESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLGIRVLGEITEEKLEIVRESDAILREEITKAGLDRE--IWQYFTALPGMRSVGVMGDERTYDYTVGIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRIVYDVTSKPPATIEWE 515
>gi|196251089|ref|ZP_03149769.1| GMP synthase, large subunit [Geobacillus sp. G11MC16] >gi|196209383|gb|EDY04162.1| GMP synthase, large subunit [Geobacillus sp. G11MC16] (590 aa)
Score = 1408, Expect = 1.2e-153, Identities = 268/510 (52%), Positives = 359/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNEL-FENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + I++LDFG QY QLI RRIR+  VYSE+  + IS EEI   N KGII SGG +SVY +++   +  I++L +PILGICYG Q+M    GG+VE      EYG   I++  + L F  +  +   WMSH D V   P GF V A+++ C +A+  +  +K+YGVQFHPEV  + +GN +L+ FV+ +C   GDW  +N   E++  I+  V    VLCA+SGGVDS VAAVL  +AIGD+L C+FVDHGLLRK E++ V    ++    N+  VD K+ FL+KLKGV DPEQKRKIIG  FI VF+  A K+    ++L+QGT+Y DI+ESG+  ++TIKSHHNVGGLPE ++FEL+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGE+TE+KLEIVRE+D + R  + +     + + WQYFTVL + +SVGV+GD R+Y YT+A+RAV S+D M+A W +IP + LE+IS+ I N+V +++RVVYDIT+KPP TIEWE
  S:    84 EMIVVLDFGSQYNQLITRRIREFGVYSELHPHTISAEEIRALNAKGIIFSGGPNSVYDEQAFTCDPAIFELGLPILGICYGMQLMAHHLGGKVEK-ATHREYGKALIQVKNDSLLFRGLPDEQVVWMSHGDLVTAPPSGFIVDATSSSCPIAAMSDERRKWYGVQFHPEVRHSIYGNDVLKRFVFDVCGCHGDWTMENFIDEQVRRIREQVGGKKVLCALSGGVDSSVAAVLVHRAIGDQLTCIFVDHGLLRKGEAESVMKTFREQFQMNVIKVDAKERFLAKLKGVSDPEQKRKIIGNEFIYVFDDEAAKLE-GIEFLVQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMKFELIEPLNTLFKDEVRALGTQLGIPDEIVWRQPFPGPGLGIRVLGEVTEEKLEIVRESDAILREEVKK--AGLDREIWQYFTVLPDIRSVGVMGDARTYDYTVAIRAVTSIDGMTADWARIPWDVLERISTRIVNEVPHVNRVVYDITSKPPATIEWE 590
>gi|30260444|ref|NP_842821.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus anthracis str. Ames] >gi|47777798|ref|YP_016877.2| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|166995257|ref|ZP_02261717.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus cereus AH820] >gi|167634217|ref|ZP_02392539.1| GMP synthase [Bacillus anthracis str. A0442] >gi|44887948|sp|Q81VE0|GUAA_BACAN GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|30253765|gb|AAP24307.1| GMP synthase [Bacillus anthracis str. Ames] >gi|47551503|gb|AAT29352.2| GMP synthase [Bacillus anthracis str. 'Ames Ancestor'] >gi|167530531|gb|EDR93246.1| GMP synthase [Bacillus anthracis str. A0442] (512 aa)
Score = 1408, Expect = 1.2e-153, Identities = 272/510 (53%), Positives = 359/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D I++LDFG QY QLIARRIR+  VYSE+  + I+ EEI   NPKGII SGG +SVYG+ ++  ++ I+DL +PI GICYG Q+M Q+ GG VE   +  EYG   +++   ++L+ N+  +   WMSH D V  LP+GF V A++  C +A   N  K  YGVQFHPEV  +  GN L++NFV+ +C  +  W  +N    ++E+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E++ V     +    N+  VD K+ F++KLKGV DPEQKRKIIG  FI VF+  A+K+     +L QGT+Y DIVESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGEITE+KLEIVRE+D + R  I  +    + + WQYFT L   +SVGV+GD R+Y YT+ +RAV S+D M+A W +IP + LEKIS  I N+VK+++R+VYD+T+KPP TIEWE
  S:     6 DTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFDLGLPIFGICYGMQLMTQQFGGTVER-ANHREYGKAVLKVENESKLYANLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSNEAKNLYGVQFHPEVRHSEHGNDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKVDAKERFMNKLKGVEDPEQKRKIIGNEFIYVFDDEASKLE-GMDFLAQGTLYTDIVESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLGIRVLGEITEEKLEIVRESDAILREEI--IKAGLDREIWQYFTALPGMRSVGVMGDERTYDYTVGIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRIVYDVTSKPPATIEWE 512
>gi|47567509|ref|ZP_00238221.1| GMP synthase [Bacillus cereus G9241] >gi|49183286|ref|YP_026538.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus anthracis str. Sterne] >gi|52144972|ref|YP_081857.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus cereus E33L] >gi|65317699|ref|ZP_00390658.1| COG0519: GMP synthase, PP-ATPase domain/subunit [Bacillus anthracis str. A2012] >gi|118476016|ref|YP_893167.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus thuringiensis str. Al Hakam] >gi|167640155|ref|ZP_02398422.1| GMP synthase [Bacillus anthracis str. A0193] >gi|170687797|ref|ZP_02879012.1| GMP synthase [Bacillus anthracis str. A0465] >gi|170709230|ref|ZP_02899652.1| GMP synthase [Bacillus anthracis str. A0389] >gi|177655761|ref|ZP_02937036.1| GMP synthase [Bacillus anthracis str. A0174] >gi|190567444|ref|ZP_03020358.1| GMP synthase [Bacillus anthracis Tsiankovskii-I] >gi|196036858|ref|ZP_03104246.1| GMP synthase [Bacillus cereus W] >gi|196041138|ref|ZP_03108434.1| GMP synthase [Bacillus cereus NVH0597-99] >gi|196046204|ref|ZP_03113431.1| GMP synthase [Bacillus cereus 03BB108] >gi|47555911|gb|EAL14250.1| GMP synthase [Bacillus cereus G9241] >gi|49177213|gb|AAT52589.1| GMP synthase [Bacillus anthracis str. Sterne] >gi|51978441|gb|AAU19991.1| GMP synthase [Bacillus cereus E33L] >gi|118415241|gb|ABK83660.1| GMP synthase (glutamine-hydrolyzing) [Bacillus thuringiensis str. Al Hakam] >gi|167511966|gb|EDR87345.1| GMP synthase [Bacillus anthracis str. A0193] >gi|170125863|gb|EDS94768.1| GMP synthase [Bacillus anthracis str. A0389] >gi|170668324|gb|EDT19072.1| GMP synthase [Bacillus anthracis str. A0465] >gi|172079990|gb|EDT65092.1| GMP synthase [Bacillus anthracis str. A0174] >gi|190561571|gb|EDV15542.1| GMP synthase [Bacillus anthracis Tsiankovskii-I] >gi|195990540|gb|EDX54520.1| GMP synthase [Bacillus cereus W] >gi|196022949|gb|EDX61629.1| GMP synthase [Bacillus cereus 03BB108] >gi|196028073|gb|EDX66684.1| GMP synthase [Bacillus cereus NVH0597-99] (515 aa)
Score = 1408, Expect = 1.3e-153, Identities = 272/510 (53%), Positives = 359/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D I++LDFG QY QLIARRIR+  VYSE+  + I+ EEI   NPKGII SGG +SVYG+ ++  ++ I+DL +PI GICYG Q+M Q+ GG VE   +  EYG   +++   ++L+ N+  +   WMSH D V  LP+GF V A++  C +A   N  K  YGVQFHPEV  +  GN L++NFV+ +C  +  W  +N    ++E+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E++ V     +    N+  VD K+ F++KLKGV DPEQKRKIIG  FI VF+  A+K+     +L QGT+Y DIVESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGEITE+KLEIVRE+D + R  I  +    + + WQYFT L   +SVGV+GD R+Y YT+ +RAV S+D M+A W +IP + LEKIS  I N+VK+++R+VYD+T+KPP TIEWE
  S:     9 DTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFDLGLPIFGICYGMQLMTQQFGGTVER-ANHREYGKAVLKVENESKLYANLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSNEAKNLYGVQFHPEVRHSEHGNDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKVDAKERFMNKLKGVEDPEQKRKIIGNEFIYVFDDEASKLE-GMDFLAQGTLYTDIVESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLGIRVLGEITEEKLEIVRESDAILREEI--IKAGLDREIWQYFTALPGMRSVGVMGDERTYDYTVGIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRIVYDVTSKPPATIEWE 515
>gi|42779372|ref|NP_976619.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus cereus ATCC 10987] >gi|166985474|ref|ZP_02256757.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus cereus AH187] >gi|168164069|ref|ZP_02599302.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus cereus H3081.97] >gi|50400359|sp|Q73ER7|GUAA_BACC1 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|42735288|gb|AAS39227.1| GMP synthase [Bacillus cereus ATCC 10987] (512 aa)
Score = 1407, Expect = 1.7e-153, Identities = 272/510 (53%), Positives = 361/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D I++LDFG QY QLIARRIR+  VYSE+  + I+ EEI + NPKGII SGG +SVYG+ ++  ++ I+DL +PI GICYG Q+M Q+ GG+VE   +  EYG   +++   ++L+ N+  +   WMSH D V  LP+GF V A++  C +A   N  K  YGVQFHPEV  +  GN L++NFV+ +C  +  W  +N    ++E+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E++ V     +    N+  VD K+ F++KLKGV DPEQKRKIIG  FI VF+  A+K+     +L QGT+Y DIVESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGEITE+KLEIVRE+D + R  I  +    + + WQYFT L   +SVGV+GD R+Y YT+ +RAV S+D M+A W +IP + LEKIS  I N+VK+++R+VYD+T+KPP TIEWE
  S:     6 DTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKEINPKGIIFSGGPNSVYGEGALHCDEKIFDLGLPIFGICYGMQLMTQKFGGKVER-ANHREYGKAVLKVENESKLYANLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSNEAKNLYGVQFHPEVRHSEHGNDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKVDAKERFMNKLKGVEDPEQKRKIIGNEFIYVFDDEASKLE-GMDFLAQGTLYTDIVESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLGIRVLGEITEEKLEIVRESDAILREEI--IKAGLDREIWQYFTALPGMRSVGVMGDERTYDYTVGIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRIVYDVTSKPPATIEWE 512
>gi|168144369|ref|ZP_02587598.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus cereus G9842] (512 aa)
Score = 1406, Expect = 2.0e-153, Identities = 271/510 (53%), Positives = 360/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D I++LDFG QY QLIARRIR+  VYSE+  + I+ EEI   NPKGII SGG +SVYG+ ++  ++ I++L +PI GICYG Q+M Q  GG+VE   +  EYG   +++   ++L+ N+  +   WMSH D V  LP+GF V A++  C +A   N EK  YGVQFHPEV  +  GN L++NFV+ +C  +  W  +N    ++E+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E++ V     +    N+  VD ++ F++KLKGV DPEQKRKIIG  FI VF+  A+K+     +L QGT+Y DIVESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGEITE+KLEIVRE+D + R  I  +    + + WQYFT L   +SVGV+GD R+Y YT+ +RAV S+D M+A W +IP + LEKIS  I N+VK+++R+VYD+T+KPP TIEWE
  S:     6 DTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFELGLPIFGICYGMQLMTQHFGGKVER-ANHREYGKAVLKVENESKLYANLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSNEEKNLYGVQFHPEVRHSEHGNDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKVDAQERFMNKLKGVEDPEQKRKIIGNEFIYVFDDEASKLQ-GMDFLAQGTLYTDIVESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLGIRVLGEITEEKLEIVRESDAILREEI--IKAGLDREIWQYFTALPGMRSVGVMGDERTYDYTVGIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRIVYDVTSKPPATIEWE 512
>gi|126649625|ref|ZP_01721866.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus sp. B14905] >gi|126593950|gb|EAZ87873.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus sp. B14905] (517 aa)
Score = 1405, Expect = 2.5e-153, Identities = 266/510 (52%), Positives = 361/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KI++LDFG Q+ QLI RRIR+  V+SE+  + I+ EEI + N  GII SGG +SVY + +   +  I++L +PILGICYG Q+M   NGG+VE   ++ EYG  +I++TT N+LF  +  +   WMSH D V  +P GF+VIA++  C +A+  N E+K Y VQFHPEV  + +GN LL+ FV+ +C+  GDW   N    +I +I+ IV D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDH L RK E ++V     +    N+  +D ++ F+ KL GV DPE+KRKIIG  FI VF++ A+K+     +L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EPLK LFKDEVR LGL L +  + V+RQPFPGPGL +RVLGE+TE+KLEIVRE+DF+ R  I       +   WQYFTVL + +SVGV+GD R+Y Y + +RAV S+D M++ W +IP + LEKIS  + N+VK+++RVVYDIT+KPP TIEWE
  S:    11 EKIVVLDFGSQFNQLITRRIREFGVFSELHPHTITAEEIKEMNAAGIIFSGGPNSVYDENAFHVDPAIFELGLPILGICYGMQLMAHTNGGKVEG-AETREYGKAEIKVTTSNKLFGELPTEQIVWMSHGDHVTEVPAGFEVIATSASCPIAAMANVERKLYAVQFHPEVRHSVYGNDLLRQFVFDVCEAKGDWSMANFIEIEIAKIREIVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCMFVDHNLNRKGEVEQVMKTFTEDFDMNLIKIDARKRFMDKLAGVSDPEKKRKIIGNEFIYVFDEEASKLE-GMDFLAQGTLYTDIIESGTSTAQTIKSHHNVGGLPEDMQFKLIEPLKTLFKDEVRALGLELGLDEKIVWRQPFPGPGLGIRVLGEVTEEKLEIVRESDFILREEIAN--AGLDRDIWQYFTVLPDIRSVGVMGDARTYDYAIGIRAVTSIDGMTSDWARIPWDVLEKISVRLVNEVKHVNRVVYDITSKPPATIEWE 517
>gi|124521696|ref|ZP_01696563.1| GMP synthase, large subunit [Bacillus coagulans 36D1] >gi|124496606|gb|EAY44194.1| GMP synthase, large subunit [Bacillus coagulans 36D1] (517 aa)
Score = 1405, Expect = 2.9e-153, Identities = 269/511 (52%), Positives = 356/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++KI++LDFG QY QLI RRIR+  V+SE+  + ++  EI   NPKGII SGG +SVY   +   ++ I++L +PILGICYG Q+M ++ GG+VE      EYG   I +     LF+ +  D   WMSH D V  +P GF V AS++ C +++  N +K  Y VQFHPEV  + +GN+LL+NF + IC  +G W  +N    +IE+I+  V +  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E++ V     +    N+  VD K+ FL KLKGV DPEQKRKIIG  FI VF+  A K+     +L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QF L+EPL  LFKDEVR +G  L IP + V+RQPFPGPGL +RVLGEITE+KLE+VRE+DF+ R  I +     +   WQYFTVL N +SVGV+GD R+Y YT+ +RAV S+D M++ W +IP E LEKIS+ I N+V +++RVVYDIT+KPP TIEWE
  S:    10 IEKIVVLDFGSQYNQLITRRIREFGVFSELHPHTLTAAEIKAMNPKGIIFSGGPNSVYDQNAFHVDEDIFNLGVPILGICYGMQLMAKKYGGKVE-PASQREYGKATIHVENGGRLFDGLPEDQVVWMSHGDLVTEVPAGFTVDASSDHCPISAMSNTDKHLYAVQFHPEVRHSVYGNELLRNFAFKICGCSGTWSMENYIEMEIEKIRQTVGNKKVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAESVMKTFSEGFNMNVIKVDAKERFLKKLKGVSDPEQKRKIIGNEFIYVFDDEAAKLE-GIDFLAQGTLYTDVIESGTTTAQTIKSHHNVGGLPEDMQFTLIEPLNTLFKDEVRAVGTELGIPDEIVWRQPFPGPGLGIRVLGEITEEKLEMVRESDFILREEIKK--AGLDRDIWQYFTVLPNIRSVGVMGDARTYDYTIGIRAVTSIDGMTSDWARIPWEVLEKISTRIVNEVPHVNRVVYDITSKPPATIEWE 517
>gi|167939704|ref|ZP_02526779.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus cereus AH1134] (512 aa)
Score = 1404, Expect = 3.8e-153, Identities = 271/510 (53%), Positives = 359/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D I++LDFG QY QLIARRIR+  VYSE+  + I+ EEI   NPKGII SGG +SVYG+ ++  ++ I++L +PI GICYG Q+M Q  GG+VE   +  EYG   +++   ++L+ N+  +   WMSH D V  LP+GF V A++  C +A   N  K  YGVQFHPEV  +  GN L++NFV+ +C  +  W  +N    ++E+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E++ V     +    N+  VD K+ F++KLKGV DPEQKRKIIG  FI VF+  A+K+     +L QGT+Y DIVESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGEITE+KLEIVRE+D + R  I  +    + + WQYFT L   +SVGV+GD R+Y YT+ +RAV S+D M+A W +IP + LEKIS  I N+VK+++R+VYD+T+KPP TIEWE
  S:     6 DTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFELGLPIFGICYGMQLMTQHFGGKVER-ANHREYGKAVLKVENESKLYANLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSNEAKNLYGVQFHPEVRHSEHGNDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKVDAKERFMNKLKGVEDPEQKRKIIGNEFIYVFDDEASKLQ-GMDFLAQGTLYTDIVESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLGIRVLGEITEEKLEIVRESDAILREEI--IKAGLDREIWQYFTALPGMRSVGVMGDERTYDYTVGIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRIVYDVTSKPPATIEWE 512
>gi|56418789|ref|YP_146107.1| bifunctional GMP synthase/glutamine amidotransferase protein [Geobacillus kaustophilus HTA426] >gi|81348285|sp|Q5L3E1|GUAA_GEOKA GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|56378631|dbj|BAD74539.1| GMP synthetase (glutamine amidotransferase) [Geobacillus kaustophilus HTA426] (510 aa)
Score = 1403, Expect = 4.9e-153, Identities = 269/510 (52%), Positives = 356/510 (69%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNEL-FENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + I++LDFG QY QLI RRIR+  VYSE+  + I  EEI   N KGII SGG +SVY +++   +  I++L +PILGICYG Q+M    GG+VE      EYG   I++  + L F  +  +   WMSH D V   P GF V A++  C +A+  +  +K+YGVQFHPEV  + +GN LL+ FV+ +C   GDW  +N   E++  I+  V    VLCA+SGGVDS VAAVL  +AIGD+L C+FVDHGLLRK E++ V    ++    N+  VD K  FL+KLKGV DPEQKRKIIG  FI VF+  A K+    ++L+QGT+Y DI+ESG+  ++TIKSHHNVGGLPE ++FEL+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGE+TE+KLEIVRE+D + R  + +   + E   WQYFTVL + +SVGV+GD R+Y YT+A+RAV S+D M+A W +IP + LE+IS+ I N+V +++RVVYDIT+KPP TIEWE
  S:     4 EMIVVLDFGSQYNQLITRRIREFGVYSELHPHTIRAEEIRALNAKGIIFSGGPNSVYDEQAFTCDPAIFELGLPILGICYGMQLMAHHLGGKVEK-ATHREYGKALIQVKNDSLLFHGLPDEQVVWMSHGDLVTAPPAGFAVDATSPSCPIAAMSDERRKWYGVQFHPEVRHSVYGNDLLKKFVFEVCGCRGDWTMENFIDEQVRRIREQVGGKKVLCALSGGVDSSVAAVLVHRAIGDQLTCIFVDHGLLRKGEAESVMKTFREQFQMNVIKVDAKDRFLAKLKGVTDPEQKRKIIGNEFIYVFDDEAAKLE-GIEFLVQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMKFELIEPLNTLFKDEVRALGTQLGIPDEIVWRQPFPGPGLGIRVLGEVTEEKLEIVRESDAILREEVKKAGLDRE--IWQYFTVLPDIRSVGVMGDARTYDYTVAIRAVTSIDGMTADWARIPWDVLERISTRIVNEVPHVNRVVYDITSKPPATIEWE 510
>gi|138893907|ref|YP_001124360.1| bifunctional GMP synthase/glutamine amidotransferase protein [Geobacillus thermodenitrificans NG80-2] >gi|134265420|gb|ABO65615.1| GMP synthetase [Geobacillus thermodenitrificans NG80-2] (513 aa)
Score = 1402, Expect = 5.4e-153, Identities = 271/511 (53%), Positives = 361/511 (70%)
  Q:     1 MDK-----ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNEL-FENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           MDK     I++LDFG QY QLI RRIR+  VYSE+  + IS EEI   N KGII SGG +SVY +++   +  I++L +PILGICYG Q+M    GG+VE      EYG   I++  + L F  +  +   WMSH D V   P GF V A+++ C +A+  +  +K+YGVQFHPEV  + +GN +L+ FV+ +C   GDW  +N   E++  I+  V    VLCA+SGGVDS VAAVL  +AIGD+L C+FVDHGLLRK E++ V    ++    N+  VD K+ FL+KLKGV DPEQKRKIIG  FI VF+  A K+    ++L+QGT+Y DI+ESG+  ++TIKSHHNVGGLPE ++FEL+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGE+TE+KLEIVRE+D + R  + +     + + WQYFTVL + +SVGV+GD R+Y YT+A+RAV S+D M+A W +IP + LE+IS+ I N+V +++RVVYDIT+KPP TIEWE
  S:     1 MDKMNQEMIVVLDFGSQYNQLITRRIREFGVYSELHPHTISAEEIRALNAKGIIFSGGPNSVYDEQAFTCDPAIFELGLPILGICYGMQLMAHHLGGKVEK-ATHREYGKALIQVKNDSLLFRGLPDEQVVWMSHGDLVTAPPSGFIVDATSSSCPIAAMSDERRKWYGVQFHPEVRHSIYGNDVLKRFVFDVCGCHGDWTMENFIDEQVRRIREQVGGKKVLCALSGGVDSSVAAVLVHRAIGDQLTCIFVDHGLLRKGEAESVMKTFREQFQMNVIKVDAKERFLAKLKGVSDPEQKRKIIGNEFIYVFDDEAAKLE-GIEFLVQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMKFELIEPLNTLFKDEVRALGTQLGIPDEIVWRQPFPGPGLGIRVLGEVTEEKLEIVRESDAILREEVKK--AGLDREIWQYFTVLPDIRSVGVMGDARTYDYTVAIRAVTSIDGMTADWARIPWDVLERISTRIVNEVPHVNRVVYDITSKPPATIEWE 513
>gi|152974097|ref|YP_001373614.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152022849|gb|ABS20619.1| GMP synthase, large subunit [Bacillus cereus subsp. cytotoxis NVH 391-98] (512 aa)
Score = 1402, Expect = 6.5e-153, Identities = 271/510 (53%), Positives = 358/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D I++LDFG QY QLIARRIR+  VYSE+  + I+ EEI   NPKGII SGG +SVYG+ +   ++ I++L +PI GICYG Q+M +  GG+VE   +  EYG   +++   ++L+ N+  +   WMSH D V  LP+GF V A++  C +A   N EK+ YGVQFHPEV  +  GN L++NFV+ +C  +  W  +N    ++E+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E++ V     +    N+  +D ++ F+ KLKGV DPEQKRKIIG  FI VF+  A K+     +L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGEITE+KLEIVRE+D + R  I +   + E   WQYFT L   +SVGV+GD R+Y YT+ +RAV S+D M+A W +IP + LEKIS  I N+VK+++RVVYDIT+KPP TIEWE
  S:     6 DTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGENAFHCDEKIFELGLPIFGICYGMQLMTKHFGGKVER-ANHREYGKAVLKVENESKLYTNLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSNEEKQLYGVQFHPEVRHSEHGNDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKIDARERFMKKLKGVEDPEQKRKIIGNEFIYVFDDEAAKLE-GIDFLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLGIRVLGEITEEKLEIVRESDAILREEIQKAGLDRE--IWQYFTALPGMRSVGVMGDERTYDYTVGIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRVVYDITSKPPATIEWE 512
>gi|15613170|ref|NP_241473.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus halodurans C-125] >gi|13627137|sp|Q9KF78|GUAA_BACHD Putative GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|10173221|dbj|BAB04326.1| GMP synthetase [Bacillus halodurans C-125] (513 aa)
Score = 1401, Expect = 7.6e-153, Identities = 268/510 (52%), Positives = 359/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + I++LDFGGQY QLI RRIRDL VYSE+    I+ E++ +  PKGII SGG +S Y + + K +  I+DL +PILGICYG Q+M Q  GG+V+   +  EYG   I +   ++LF+ + ++   WMSH D ++  P+GF V A    C VA+  +  + +YGVQF PEV  + FG+ +L+NF +++C   G+W  +N    ++E+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+F+DHGLLRK E+  V     +    N+  +D K  FLSKL+GV DPEQKRKIIG  FI VFE+ A+K+     +L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE ++FEL+EPL  LFKDEVRKLG  L IP + V+RQPFPGPGL +RVLGEITE+KLEIVRE+D + R  I +   + E   WQYFT L N +SVGV+GD R+Y YT+ +RAV S+D M++ W +IP + LE IS+ I N+VK+++RVVYDIT+KPP TIEWE
  S:     7 EMIVVLDFGGQYNQLITRRIRDLGVYSELHPNTITAEQLKEMKPKGIIFSGGPNSAYAEGAPKCDPAIFDLGVPILGICYGMQLMTQHFGGKVDA-AEHREYGKATITVENQSKLFQGLPVEQTVWMSHGDLIVAPPEGFVVDAQNPSCPVAAMSDEARNYYGVQFQPEVRHSQFGDDMLKNFAFAVCGCEGNWSMENFIELEMEKIREQVGDKQVLCALSGGVDSSVVAVLIHKAIGDQLTCMFIDHGLLRKGEADSVMKTFSEGFNMNVIKIDAKDRFLSKLEGVSDPEQKRKIIGNEFIYVFEEEASKLK-DMDFLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMRFELIEPLNTLFKDEVRKLGTELGIPDEVVWRQPFPGPGLGIRVLGEITEEKLEIVRESDAILREEIKKAGLDRE--IWQYFTALPNMRSVGVMGDARTYDYTVGIRAVTSIDGMTSDWARIPWDVLEIISTRIVNEVKHVNRVVYDITSKPPATIEWE 513
>gi|168138592|ref|ZP_02581821.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus cereus B4264] (512 aa)
Score = 1400, Expect = 9.3e-153, Identities = 271/510 (53%), Positives = 357/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D I++LDFG QY QLIARRIR+  VYSE+  + I+ EEI   NPKGII SGG +SVYG+ ++  ++ I++L +PI GICYG Q+M Q  GG+VE   +  EYG   +++   ++L+ N+  +   WMSH D V  LP+GF V A++  C +A   N  K  YGVQFHPEV  +  GN L++NFV+ +C  +  W  +N    ++E+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E++ V     +    N+  VD K  F+ KLKGV DPEQKRKIIG  FI VF+  A+K+     +L QGT+Y DIVESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGEITE+KLEIVRE+D + R  I  +    + + WQYFT L   +SVGV+GD R+Y YT+ +RAV S+D M+A W +IP + LEKIS  I N+VK+++R+VYD+T+KPP TIEWE
  S:     6 DTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFELGLPIFGICYGMQLMTQHFGGKVER-ANHREYGKAVLKVENESKLYANLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSNEAKNLYGVQFHPEVRHSEHGNDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKVDAKDRFMDKLKGVEDPEQKRKIIGNEFIYVFDDEASKLQ-GMDFLAQGTLYTDIVESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLGIRVLGEITEEKLEIVRESDAILREEI--IKAGLDREIWQYFTALPGMRSVGVMGDERTYDYTVGIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRIVYDVTSKPPATIEWE 512
>gi|75762461|ref|ZP_00742326.1| GMP synthase (glutamine-hydrolyzing) [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74490054|gb|EAO53405.1| GMP synthase (glutamine-hydrolyzing) [Bacillus thuringiensis serovar israelensis ATCC 35646] (515 aa)
Score = 1400, Expect = 9.8e-153, Identities = 270/510 (52%), Positives = 359/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D I++LDFG QY QLIARRIR+  VYSE+  + I+ EEI   NPKGII SGG +SVYG+ ++  ++ I++L +PI GICYG Q+M Q  GG+VE   +  EYG   +++   ++L+ N+  +   WMSH D V  LP+GF V A++  C +A   N  K  YGVQFHPEV  +  GN L++NFV+ +C  +  W  +N    ++E+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E++ V     +    N+  VD ++ F++KLKGV DPEQKRKIIG  FI VF+  A+K+     +L QGT+Y DIVESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGEITE+KLEIVRE+D + R  I  +    + + WQYFT L   +SVGV+GD R+Y YT+ +RAV S+D M+A W +IP + LEKIS  I N+VK+++R+VYD+T+KPP TIEWE
  S:     9 DTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFELGLPIFGICYGMQLMTQHFGGKVER-ANHREYGKAVLKVENESKLYANLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSNEAKNLYGVQFHPEVRHSEHGNDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKVDAQERFMNKLKGVEDPEQKRKIIGNEFIYVFDDEASKLQ-GMDFLAQGTLYTDIVESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLGIRVLGEITEEKLEIVRESDAILREEI--IKAGLDREIWQYFTALPGMRSVGVMGDERTYDYTVGIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRIVYDVTSKPPATIEWE 515
>gi|196254085|ref|ZP_03152673.1| GMP synthase, large subunit [Clostridium thermocellum DSM 4150] >gi|196196487|gb|EDX91396.1| GMP synthase, large subunit [Clostridium thermocellum DSM 4150] (511 aa)
Score = 1400, Expect = 1.0e-152, Identities = 280/508 (55%), Positives = 361/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFGGQY QLIARR+R+ NVY E++ Y+ SI++I  KNPKGII +GG  SV   ++   ++ +++L IPILGICYG Q+M    GG VE   +  EYG  +I   T++ LFE IE ++ CWMSH+  V  LP+GF   A T  C VA+  NREKK YGVQFHPEV  T  G  +L NF+Y IC  +GDW+  +     I  I+  V D  VLCA+SGGVDS VAAVL  +A+G +L C+FVDHGLLRK E  +V  + KK    ++  V+ +  FL KLKGV DPE+KRKIIG+ FI VFE+ A KI     +L+QGTIYPD++ESG   +  IKSHHNVGGLP+ + F E++EPL+ LFKDEVRK+G+ L IP   V RQPFPGPGLAVRV+GE+T++KL+I+R+AD++FR  I     + E    QYF VLT  +SVGV+GD R+Y YTLALRAV ++D M+A W KIP + LEK+S+ I N+VK+I+R+VYDIT KPP TIEWE
  S:     6 ILVLDFGGQYNQLIARRVREANVYCEVLPYNSSIDKIKSKNPKGIIFTGGPASVLDPKAPICDREVFELGIPILGICYGMQLMSHMLGGTVEK-AEQREYGKVNITFDTSSMLFEGIEKESTCWMSHTYYVNNLPEGFVKCADTPNCPVAAIENREKKLYGVQFHPEVVHTPKGRDILNNFLYKICGCSGDWKMASFIEHSINSIREKVGDKKVLCALSGGVDSSVAAVLVHKAVGKQLTCIFVDHGLLRKYEGDQVEEVFKKQFDISLIRVNAEDRFLEKLKGVTDPERKRKIIGEEFIRVFEEEAKKIGT-VDFLVQGTIYPDVIESGVGDAAVIKSHHNVGGLPDYIDFKEIIEPLRSLFKDEVRKVGIELGIPEDIVMRQPFPGPGLAVRVIGEVTKEKLDILRDADYIFREEIKNAGLDREIN--QYFAVLTGMRSVGVMGDERTYDYTLALRAVTTIDFMTADWAKIPYDVLEKVSNRIVNEVKHINRIVYDITTKPPATIEWE 511
>gi|30018516|ref|NP_830147.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus cereus ATCC 14579] >gi|44887947|sp|Q81IS3|GUAA_BACCR GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|29894056|gb|AAP07348.1| GMP synthase, glutamine-hydrolyzing [Bacillus cereus ATCC 14579] (515 aa)
Score = 1400, Expect = 1.1e-152, Identities = 270/510 (52%), Positives = 358/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D I++LDFG QY QLIARRIR+  VYSE+  + I+ EEI   NPKGII SGG +SVYG+ ++  ++ I++L +PI GICYG Q+M Q+ GG+VE   +  EYG   +++   ++L+ N+  +   WMSH D V  LP+GF V A++  C +A   N  K  YGVQFHPEV  +  GN L++NFV+ +C  +  W  +N    ++E+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E++ V     +    N+  VD +  F+ KLKGV DPEQKRKIIG  FI VF+  A+K+     +L QGT+Y DIVESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGEITE+KLEIVRE+D + R  I  +    + + WQYFT L   +SVGV+GD R+Y YT+ +RAV S+D M+A W +IP + LEKIS  I N+VK+++R+VYD+T+KPP TIEWE
  S:     9 DTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFELGLPIFGICYGMQLMTQQFGGKVER-ANHREYGKAVLKVENESKLYANLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSNEAKNLYGVQFHPEVRHSEHGNDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKVDARDRFMDKLKGVEDPEQKRKIIGNEFIYVFDDEASKLQ-GMDFLAQGTLYTDIVESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLGIRVLGEITEEKLEIVRESDAILREEI--IKAGLDREIWQYFTALPGMRSVGVMGDERTYDYTVGIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRIVYDVTSKPPATIEWE 515
>gi|169825804|ref|YP_001695962.1| GMP synthase (glutamine-hydrolyzing) [Lysinibacillus sphaericus C3-41] >gi|168990292|gb|ACA37832.1| GMP synthase (glutamine-hydrolyzing) [Lysinibacillus sphaericus C3-41] (530 aa)
Score = 1399, Expect = 1.2e-152, Identities = 264/510 (51%), Positives = 361/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KI++LDFG Q+ QLI RRIR+  V+SE+  + ++ EEI + N  GII SGG +SVY + +   +  I++L +PILGICYG Q+M   NGG+VE   ++ EYG  +I++T +N+LF  +  +   WMSH D V  +P GF+VIA++  C +A+  N E+K Y VQFHPEV  + +GN LL+ FV+ +C+  GDW   N    +I +I+ IV D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDH L RK E ++V     +    N+  +D ++ F+ KL GV DPE+KRKIIG  FI VF++ A+K+     +L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EPLK LFKDEVR LGL L +  + V+RQPFPGPGL +RVLGE+TE+KLEIVRE+DF+ R  I       +   WQYFTVL + +SVGV+GD R+Y Y + +RAV S+D M++ W +IP + LEKIS  + N+VK+++RVVYDIT+KPP TIEWE
  S:    24 EKIVVLDFGSQFNQLITRRIREFGVFSELHPHTVTAEEIKEMNAAGIIFSGGPNSVYDENAFHVDPAIFELGLPILGICYGMQLMAHTNGGKVEG-AETREYGKAEIKVTASNKLFGELPTEQIVWMSHGDHVTEVPAGFEVIATSASCPIAAMANVERKLYAVQFHPEVRHSVYGNDLLRQFVFDVCEAKGDWSMANFIELEIAKIREIVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCMFVDHNLNRKGEVEQVMKTFTEDFDMNLIKIDARKRFMDKLAGVSDPEKKRKIIGNEFIYVFDEEASKLE-GMDFLAQGTLYTDIIESGTSTAQTIKSHHNVGGLPEDMQFQLIEPLKTLFKDEVRALGLELGLDEKIVWRQPFPGPGLGIRVLGEVTEEKLEIVRESDFILREEIAN--AGLDRDIWQYFTVLPDIRSVGVMGDARTYDYAIGIRAVTSIDGMTSDWARIPWDVLEKISVRLVNEVKHVNRVVYDITSKPPATIEWE 530
>gi|56962710|ref|YP_174436.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus clausii KSM-K16] >gi|81366846|sp|Q5WJI0|GUAA_BACSK GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|56908948|dbj|BAD63475.1| GMP synthetase [Bacillus clausii KSM-K16] (515 aa)
Score = 1399, Expect = 1.4e-152, Identities = 269/510 (52%), Positives = 359/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSE-EYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI-NVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + I++LDFGGQY QLI RRIRDL VYSE+  + ++ +E+ + NP GII SGG +S Y + S K +  I+DL IPILGICYG Q+M    GG+V  DK S  EYG   + +     LF+ + ++   WMSH D ++  P+GF V AS   C VA+  +  +  YGVQFHPEV  + FGN LL+NF + IC   GDW  +N   E+I++I+  V D +VLCA+SGGVDS V AVL  +AIGD+L C+F+DHGLLRK E++ V     +    N+  +D  + FL+KLKGV DPEQKRKIIG  FI VF++ + K+ +    +L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE + FEL+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGEIT++KL+IVRE+D + R  I +   + E   WQYFT L N +SVGV+GD R+Y YT+ +RAV S+D M++ W +IP + LE IS+ I N+V++++R+VYDIT+KPP TIEWE
  S:     7 ETIVVLDFGGQYNQLITRRIRDLGVYSELHSHKLTADELKEMNPIGIIFSGGPNSAYVEGSPKCDPAIYDLGIPILGICYGVQLMTHHFGGKV--DKASHREYGKALLNVENQSPLFKGLPIEQTVWMSHGDKIVAPPEGFTVDASNPSCPVAAMSDESRNLYGVQFHPEVRHSEFGNDLLKNFAFDICGAKGDWSMENFIEEEIKKIREQVGDRHVLCALSGGVDSSVVAVLIHKAIGDQLTCMFIDHGLLRKGEAESVMETFTQGFNMNVVKIDASERFLTKLKGVTDPEQKRKIIGNEFIYVFDEESAKLKDKKMDFLAQGTLYTDIIESGTDTAQTIKSHHNVGGLPEDMAFELIEPLNALFKDEVRALGTELGIPDEIVWRQPFPGPGLGIRVLGEITDEKLKIVRESDAILREEIKKAGLDRE--IWQYFTALPNMRSVGVMGDTRTYDYTVGIRAVTSIDGMTSDWARIPWDVLEIISTRIVNEVEHVNRIVYDITSKPPSTIEWE 515
>gi|163938259|ref|YP_001643143.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus weihenstephanensis KBAB4] >gi|163860456|gb|ABY41515.1| GMP synthase, large subunit [Bacillus weihenstephanensis KBAB4] (512 aa)
Score = 1399, Expect = 1.4e-152, Identities = 270/510 (52%), Positives = 360/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D I++LDFG QY QLIARRIR+  VYSE+  + I+ EEI   NPKGII SGG +SVYG+ ++  ++ I++L +PI GICYG Q+M Q  GG+VE   +  EYG   +++   ++L+ N+  +   WMSH D V  LP+GF V A++  C +A   N  +  YGVQFHPEV  +  GN L++NFV+ +C  +  W  +N    ++E+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK+E++ V     +    N+  VD ++ F++KLKGV DPEQKRKIIG  FI VF+  A+K+     +L QGT+Y DIVESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGEITE+KLEIVRE+D + R  I  +    + + WQYFT L   +SVGV+GD R+Y YT+ +RAV S+D M+A W +IP + LEKIS  I N+VK+++R+VYDIT+KPP TIEWE
  S:     6 DTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFELGLPIFGICYGMQLMTQHFGGKVER-ANHREYGKAVLKVENESKLYANLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSNEGENLYGVQFHPEVRHSEHGNDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKDEAEGVMKTFSEGFHMNVIKVDAQERFMNKLKGVEDPEQKRKIIGNEFIYVFDDEASKLQ-GMDFLAQGTLYTDIVESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLGIRVLGEITEEKLEIVRESDAILREEI--IKAGLDREVWQYFTALPGMRSVGVMGDERTYDYTVGIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRIVYDITSKPPATIEWE 512
>gi|16077703|ref|NP_388517.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus subtilis subsp. subtilis str. 168] >gi|3123227|sp|P29727|GUAA_BACSU GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|2239288|gb|AAB62311.1| GMP synthetase [Bacillus subtilis] >gi|2632949|emb|CAB12455.1| GMP synthetase [Bacillus subtilis subsp. subtilis str. 168] (513 aa)
Score = 1398, Expect = 1.9e-152, Identities = 276/510 (54%), Positives = 363/510 (71%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNK-CLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + IL+LDFG QY QLI RRIR+  VYSE+  + ++ EEI K NPKGIILSGG +SVY + S + ++ I++L+IP+LGICYG Q+M    GG+VE      EYG  +IR+  T +LF ++  +   WMSH D V+ +P+GF V A+T+  C  ++    +KK+YGVQFHPEV  + +GN LL+NFV+ +C+  G+W  +N    ++++I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E++ V     +    N+  VD K  FL+KLKGV DPEQKRKIIG  FI VF+  A+K+     YL QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGE+TE+KLEIVRE+D + R  I       E   WQYFTVL + +SVGV+GD R+Y YT+  R   S+D M++ W +IP + LE IS+ I N+VK+I+RVVYDIT+KPP TIEWE
  S:     7 EMILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEIKKMNPKGIILSGGPNSVYDENSFRCDEKIFELDIPVLGICYGMQLMTHYLGGKVEA-ASQREYGKANIRIEGTPDLFRDLPNEQVVWMSHGDLVVEVPEGFTVDAATSHHCPNSAMSKADKKWYGVQFHPEVRHSEYGNDLLKNFVFGVCECEGEWSMENFIEIEMQKIRETVGDKQVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFNMNVIKVDAKDRFLNKLKGVSDPEQKRKIIGNEFIYVFDDEADKLK-GIDYLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGTELGIPDEIVWRQPFPGPGLGIRVLGEVTEEKLEIVRESDAILREEIAN--HGLERDIWQYFTVLPDIRSVGVMGDARTYDYTIESRRT-SIDGMTSDWARIPWDVLEVISTRIVNEVKHINRVVYDITSKPPATIEWE 513
>gi|164687029|ref|ZP_02211057.1| hypothetical protein CLOBAR_00655 [Clostridium bartlettii DSM 16795] >gi|164603914|gb|EDQ97379.1| hypothetical protein CLOBAR_00655 [Clostridium bartlettii DSM 16795] (511 aa)
Score = 1397, Expect = 2.3e-152, Identities = 276/508 (54%), Positives = 357/508 (70%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSE-EYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG-SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP-WQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFGGQY QLIARR+R+ NVY EI+ Y   IEEI  KNPKGII +GG +S Y + S +  K I+D  IPILGICYG Q M    GG V     +E EYG T I    + LFE +   N+ WMSH+D +  +P+GF++IA T  C VA   N EK  YGVQFHPEV  +  G  +++NF+Y+IC V GDW   +   +K+ E+K+ + D  VLCA+SGGVDS VAAVL  +AIGD L CVFVDHGLLRKNE  +V  + +     N+  V+ +  FL KLKGV +PE KRKIIG+ FI VFE+ +NK+     +L+QGTIYPDIVESG    S TIKSHHNVGGLPE + F+++EPLK LFKDEVRK+GL L I  + ++R PFPGPGL +RV+GE+T++K +I+READ +   Y+D+L K   ++  WQ F  L + K+VGV+GD R+Y Y + LRAV S D M++ WYKIP + LEKI++ I N+V   +RVVYDIT+KPPGTIEWE
  S:     6 VLVIDFGGQYNQLIARRVRENNVYCEIISYKTDIEEIKAKNPKGIIFTGGPNSAYLEDSPQMAKEIYDAGIPILGICYGIQTMCHTLGGTVRKGTAAEKEYGKTAITYKESRLFEGMT-TNSVWMSHTDRIDTVPEGFEIIAYTADCPVAGIQNVEKNLYGVQFHPEVEHSQEGYMIIKNFLYNICGVKGDWTTDSFIKDKVAELKATIGDKKVLCALSGGVDSSVAAVLVHKAIGDNLTCVFVDHGLLRKNEGDDVERIFRNTFDMNLIRVNAEDRFLGKLKGVTEPEAKRKIIGEEFIRVFEEESNKLG-KMDFLVQGTIYPDIVESGLGGESATIKSHHNVGGLPEDVDFQIVEPLKELFKDEVRKIGLELGIEDKLIFRHPFPGPGLGIRVIGEVTKEKCDILREADAI---YMDELRKAGLYREIWQAFATLPDVKTVGVMGDERTYAYLVGLRAVSSSDGMTSDWYKIPYDVLEKIANRIVNEVDGANRVVYDITSKPPGTIEWE 511
>gi|125972896|ref|YP_001036806.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium thermocellum ATCC 27405] >gi|125713121|gb|ABN51613.1| GMP synthase (glutamine-hydrolyzing) [Clostridium thermocellum ATCC 27405] (511 aa)
Score = 1397, Expect = 2.4e-152, Identities = 279/508 (54%), Positives = 361/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFGGQY QLIARR+R+ NVY E++ Y+ SI++I  KNPKGII +GG  SV   ++   ++ +++L IPILGICYG Q+M    GG VE   +  EYG  +I   T++ LFE IE ++ CWMSH+  V  LP+GF   A T  C VA+  NREKK YGVQFHPEV  T  G  +L NF+Y IC  +GDW+  +     I  I+  V D  VLCA+SGGVDS VAAVL  +A+G +L C+FVDHGLLRK E  +V  + KK    ++  V+ +  FL KLKGV DPE+KRKIIG+ FI VFE+ A KI     +L+QGTIYPD++ESG   +  IKSHHNVGGLP+ + F E++EPL+ LFKDEVRK+G+ L IP   V RQPFPGPGLAVRV+GE+T++K++I+R+AD++FR  I     + E    QYF VLT  +SVGV+GD R+Y YTLALRAV ++D M+A W KIP + LEK+S+ I N+VK+I+R+VYDIT KPP TIEWE
  S:     6 ILVLDFGGQYNQLIARRVREANVYCEVLPYNSSIDKIKSKNPKGIIFTGGPASVLDPKAPICDREVFELGIPILGICYGMQLMSHMLGGTVEK-AEQREYGKVNITFDTSSMLFEGIEKESTCWMSHTYYVNNLPEGFVKCADTPNCPVAAIENREKKLYGVQFHPEVVHTPKGRDILNNFLYKICGCSGDWKMASFIEHSINSIREKVGDKKVLCALSGGVDSSVAAVLVHKAVGKQLTCIFVDHGLLRKYEGDQVEEVFKKQFDISLIRVNAEDRFLEKLKGVTDPERKRKIIGEEFIRVFEEEAKKIGT-VDFLVQGTIYPDVIESGVGDAAVIKSHHNVGGLPDYIDFKEIIEPLRSLFKDEVRKVGIELGIPEDIVMRQPFPGPGLAVRVIGEVTKEKVDILRDADYIFREEIKNAGLDREIN--QYFAVLTGMRSVGVMGDERTYDYTLALRAVTTIDFMTADWAKIPYDVLEKVSNRIVNEVKHINRIVYDITTKPPATIEWE 511
>gi|57866023|ref|YP_187668.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus epidermidis RP62A] >gi|71152096|sp|Q5HRX1|GUAA_STAEQ GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|57636681|gb|AAW53469.1| GMP synthase [Staphylococcus epidermidis RP62A] (513 aa)
Score = 1396, Expect = 3.0e-152, Identities = 274/508 (53%), Positives = 363/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QY QLI RRIR++ VYSE+ D++ISIEEI + NPKGIILSGG +SVY + S   +  I++L IP+LGICYG Q+  +  GG+VE   +  EYG   I   ++ELF  +  +   WMSHSD VI +P+GF+VIA +     A+  +++++ YGVQFHPEV  T +GN LL+NFV  +C+  G+W  +N    +IE+I+  V +  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E   V     +    NI  V+ ++ F+SKLKGV DPE+KRKIIG  F+ VF+  A K+     +L QGT+Y D++ESG+K ++TIKSHHNVGGLPE ++FEL+EP+  LFKDEVR LG+ L IP   V+RQPFPGPGL +RVLGEITEDKLEIVRE+D + R  I +  +  E   WQYFTVL   +SVGV+GD R+Y +T+ +RAV S+D M++ + +I  E L+KISS I N+V +++RVVYDIT+KPP TIEWE
  S:    10 ILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKRMNPKGIILSGGPNSVYEEGSFTIDPEIYNLGIPVLGICYGMQLTTKLLGGKVER-ANEREYGKATINAKSDELFFGLPSEQTVWMSHSDKVIEIPEGFEVIADSPSTNYAAIEDKKRRIYGVQFHPEVRHTEYGNDLLRNFVRRVCNCTGEWTMENFIEIEIEKIRQQVGNRKVLCAMSGGVDSSVVAVLLHKAIGDQLTCIFVDHGLLRKGEGDMVMEQFGEGFDMNIIRVNAQERFMSKLKGVSDPERKRKIIGNEFVYVFDDEAAKL-TDVDFLAQGTLYTDVIESGTKTAQTIKSHHNVGGLPEDMEFELIEPINTLFKDEVRALGIELGIPEHLVWRQPFPGPGLGIRVLGEITEDKLEIVRESDAILREVIRE--EGLERDIWQYFTVLPGIQSVGVMGDYRTYDHTVGIRAVTSIDGMTSDFARIDWEVLQKISSRIVNEVDHVNRVVYDITSKPPSTIEWE 513
>gi|116628906|ref|YP_814078.1| bifunctional GMP synthase/glutamine amidotransferase protein [Lactobacillus gasseri ATCC 33323] >gi|116094488|gb|ABJ59640.1| GMP synthase (glutamine-hydrolyzing) [Lactobacillus gasseri ATCC 33323] (517 aa)
Score = 1393, Expect = 6.0e-152, Identities = 272/510 (53%), Positives = 362/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE--LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKI++LDFG QY QLI RRIRD  +YSE++ +D+SIE+I K  PKGII SGG +SVY + ++K +  I+ L IPILGICYG Q+M  + GG+VE   D+ EYG  DI +T     LFE +  +   WMSH D V   P+GFKV A +  C +++  N EKKFYG+QFH EV  + +G  +L+NF +++CD   +W   +    +++EI+  V D  V+  +SGGVDS V A L  +AIGD+L  +FVDHG+LRK+E  +V   L K +G NI  V+ ++ FL KLKGV DPEQKRKIIGK FIEVF + A K+     +L QGT+Y D++ESG+  ++TIKSHHNVGGLPE + FEL+EPL+ LFKDEVR+LG  L IP+  V+RQPFPGPGLA+RVLGE+TEDKL+IVRE+D + R  I +     +   WQYFTVL   +SVGV+GD R+Y YT+ +RAV S+D M+A + K+P + L KIS+ I ++  +I+RVVYDIT+KPP TIEWE
  S:    10 DKIIVLDFGSQYNQLITRRIRDFGIYSELLPHDLSIEKIKKMAPKGIIFSGGPNSVYDEGALKVDPEIFKLGIPILGICYGMQLMSYDLGGKVEK-ADNSEYGRADIEVTDPNAVLFEGLPKEQYVWMSHGDLVTKAPEGFKVTAKSKNCPISAIANDEKKFYGIQFHAEVRNSEYGLDILKNFAFNVCDAKANWTMDDFIEMQVDEIREKVGDKKVILGLSGGVDSSVTATLLHKAIGDQLTAIFVDHGMLRKDEGDQVMQALNKDLGVNIIRVNAQKRFLDKLKGVTDPEQKRKIIGKEFIEVFNEEAKKLK-DVDFLAQGTLYTDVIESGTNTAQTIKSHHNVGGLPEDMHFELIEPLRKLFKDEVRELGEKLGIPHDLVWRQPFPGPGLAIRVLGEVTEDKLKIVRESDAILRDEIKK--AGLQEDIWQYFTVLPGIRSVGVMGDGRTYDYTIGIRAVTSIDGMTADFAKLPWDVLSKISTRIVDECDHINRVVYDITSKPPSTIEWE 517
>gi|27469265|ref|NP_765902.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus epidermidis ATCC 12228] >gi|38372353|sp|Q8CMQ8|GUAA_STAES GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|27316815|gb|AAO05990.1|AE016752_23 GMP synthase [Staphylococcus epidermidis ATCC 12228] (513 aa)
Score = 1391, Expect = 1.0e-151, Identities = 273/508 (53%), Positives = 363/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QY QLI RRIR++ VYSE+ D++ISIEEI + NPKGIILSGG +SVY + S   +  I++L IP+LGICYG Q+  +  GG+VE   +  EYG   I   ++ELF  +  +   WMSHSD VI +P+GF+VIA +     A+  +++++ YGVQFHPEV  T +GN LL+NFV  +C+  G+W  +N    +IE+I+  V +  VLCA+SGGVDS V AVL  +AIG++L C+FVDHGLLRK E   V     +    NI  V+ ++ F+SKLKGV DPE+KRKIIG  F+ VF+  A K+     +L QGT+Y D++ESG+K ++TIKSHHNVGGLPE ++FEL+EP+  LFKDEVR LG+ L IP   V+RQPFPGPGL +RVLGEITEDKLEIVRE+D + R  I +  +  E   WQYFTVL   +SVGV+GD R+Y +T+ +RAV S+D M++ + +I  E L+KISS I N+V +++RVVYDIT+KPP TIEWE
  S:    10 ILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKRMNPKGIILSGGPNSVYEEGSFTIDPEIYNLGIPVLGICYGMQLTTKLLGGKVER-ANEREYGKATINAKSDELFFGLPSEQTVWMSHSDKVIEIPEGFEVIADSPSTNYAAIEDKKRRIYGVQFHPEVRHTEYGNDLLRNFVRRVCNCTGEWTMENFIEIEIEKIRQQVGNRKVLCAMSGGVDSSVVAVLLHKAIGEQLTCIFVDHGLLRKGEGDMVMEQFGEGFDMNIIRVNAQERFMSKLKGVSDPERKRKIIGNEFVYVFDDEAAKL-TDVDFLAQGTLYTDVIESGTKTAQTIKSHHNVGGLPEDMEFELIEPINTLFKDEVRALGIELGIPEHLVWRQPFPGPGLGIRVLGEITEDKLEIVRESDAILREVIRE--EGLERDIWQYFTVLPGIQSVGVMGDYRTYDHTVGIRAVTSIDGMTSDFARIDWEVLQKISSRIVNEVDHVNRVVYDITSKPPSTIEWE 513
>gi|15605784|ref|NP_213161.1| bifunctional GMP synthase/glutamine amidotransferase protein [Aquifex aeolicus VF5] >gi|6225492|sp|O66601|GUAA_AQUAE GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|2982942|gb|AAC06558.1| GMP synthase [Aquifex aeolicus VF5] (510 aa)
Score = 1391, Expect = 1.1e-151, Identities = 274/508 (53%), Positives = 367/508 (72%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+++FG QY QLIARR+R+L VYSEIV +D  +EEI KKNP GII SGG  SVY + +  P+K I++L +PILGICYG QV+  + GG+V    + +EYG   +R+   + +FE I  +++ WMSH+D V+ LP+GF+V+A +     A   NREKK YG QFHPEVT T FG ++L NF+Y +C    +WE  +   EKIEEI+  V D  V+ A+SGGVDS VAAVLT +AIGDKL+C F+DHGLLR  E +EV   L+ L G  + +VD  + FL KLKGV DPE+KRKIIG+TFIEVFE+ A KI    ++LLQGT+YPD+VES G K S  IK+HHNVGGLPER+  +LLEP + LFKDEVRK+G  L +P + + R PFPGPGLA+R++GE+ +  LEI+R+AD++F   I +L K   + + WQ F VL   KSVGV+GD R+Y   +ALRAV+S+D M+A W ++P + L+++   I N+V+ ++RVVYDI++KPP TIEWE
  S:     6 ILVVNFGSQYVQLIARRVRELGVYSEIVHWDTPVEEIKKKNPYGIIFSGGPASVYAEGAPLPDKRIYELGVPILGICYGLQVITHQLGGKVVR-SEKQEYGRARLRIIKEDVIFEGIPKESDVWMSHADKVVELPEGFEVLAVSENSPYAVIANREKKIYGFQFHPEVTHTVFGKEMLANFIYGVCKAEKNWEMGDFIHEKIEEIRKTVGDAKVIAALSGGVDSTVAAVLTHRAIGDKLHCFFIDHGLLRYKEREEVEKNLRSL-GLPLTVVDASEEFLEKLKGVEDPEEKRKIIGRTFIEVFEREAKKIEGA-EFLLQGTLYPDVVESAGIKGSAKIKTHHNVGGLPERMNLKLLEPFRELFKDEVRKIGKLLGVPEEILRRHPFPGPGLAIRIIGEVNKKDLEILRKADYIF---IQELKKEGLYDRVWQAFAVLLPVKSVGVMGDVRTYEKVVALRAVESVDGMTADWARLPYDFLDRVMRRIINEVEGVNRVVYDISSKPPSTIEWE 510
>gi|169186885|ref|ZP_02847046.1| GMP synthase, large subunit [Paenibacillus sp. JDR-2] >gi|169006854|gb|EDS53704.1| GMP synthase, large subunit [Paenibacillus sp. JDR-2] (511 aa)
Score = 1391, Expect = 1.1e-151, Identities = 265/508 (52%), Positives = 364/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGK---NIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS-EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I++LDFGGQY QLIARRIRDL VYSE++ ++ S+E I +  PKGI+ SGG  SVY ++S   +  I+DL +PI GICYG Q+M  +  G+VE      EYG  ++     + L + ++     WMSHSD V+  P GF+V AST    +A+  N ++KF+ VQFHPEV  + +GN++++NF+Y+IC   G+W  ++   + I +I++ V D  VLC +SGGVDS V A+L  +AIGD+L C+F+DHG+LRK+E++ V   ++  +GK    +  +D  + FL KLKGV DPEQKRKIIG  FI VF++ + K+   F +L QGT+Y DIVESG+  ++TIKSHHNVGGLPE ++FEL+EPLK LFKDEVRK+G    +P + V+RQPFPGPGLA+RVLGE+TEDKL IVRE+D + R   D++ K   + + WQYFT L   KSVGV+GD R+Y YT+ +RAV S+D M+A W +IP + LEKIS  I N+V N++R+VYD+T+KPP TIEWE
  S:     7 IIVLDFGGQYNQLIARRIRDLGVYSELLPFNTSVERIRELQPKGIVFSGGPASVYEEKSPLVDPAIYDLGVPIFGICYGMQMMSHQLEGKVER-AGKREYGKAEVDFAEGSHLAQGLDARQTVWMSHSDLVVEPPAGFRVDASTEHAPIAAMSNPDRKFFAVQFHPEVRHSVYGNEMIRNFLYNICGCEGNWTMESWIEDTITDIRNQVGDRKVLCGLSGGVDSSVVAMLIHKAIGDQLTCMFIDHGMLRKDEAESV---METFVGKFDMKVVKIDASERFLGKLKGVTDPEQKRKIIGNEFIYVFDEESAKLG-EFDFLAQGTLYTDIVESGTATAQTIKSHHNVGGLPEDMKFELVEPLKTLFKDEVRKVGAECGLPDEIVHRQPFPGPGLAIRVLGEVTEDKLHIVRESDAILR---DEIAKAGLDREIWQYFTALPGMKSVGVMGDARTYSYTVGIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVDNVNRIVYDVTSKPPATIEWE 511
>gi|70727581|ref|YP_254497.1| bifunctional GMP synthase/glutamine amidotransferase protein [Staphylococcus haemolyticus JCSC1435] >gi|91206831|sp|Q4L386|GUAA_STAHJ GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|68448307|dbj|BAE05891.1| GMP synthase [Staphylococcus haemolyticus JCSC1435] (513 aa)
Score = 1389, Expect = 1.9e-151, Identities = 271/508 (53%), Positives = 361/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QY QLI RRIR++ VYSE+ D++IS++EI + NPKGIILSGG +SVY + S   +  I++L IP+LGICYG Q+  +  GG+VE   +  EYG   I   ++ELF  +  +   WMSHSD VI +P GF+VIA +     A+  +++++ YGVQFHPEV  T +GN LL+NFV  +C+  G+W  +N    ++E+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E   V     +    NI  V+ ++ F+ KLKGV DPEQKRKIIG  F+ VF+  A K+     +L QGT+Y D++ESG+K ++TIKSHHNVGGLPE ++FEL+EP+  LFKDEVR LG+ L IP   V+RQPFPGPGL +RVLGEITEDKLEIVRE+D + R  + +  +  E   WQYFTVL   +SVGV+GD R+Y +T+ +RAV S+D M++ + +I  E L+KISS I N+V +++RVVYDIT+KPP TIEWE
  S:    10 ILVLDFGSQYNQLITRRIREMGVYSELHDHEISVDEIKRMNPKGIILSGGPNSVYEEGSFTIDPEIYNLGIPVLGICYGMQLTTKLLGGKVER-ANEREYGKAIINAKSDELFFGLPAEQTVWMSHSDKVIEIPDGFEVIADSPSTNYAAIEDKKRRIYGVQFHPEVRHTEYGNDLLRNFVRRVCECTGEWTMENFIDIEVEKIRKRVGDRKVLCAMSGGVDSSVVAVLLHKAIGDQLTCIFVDHGLLRKGEGDMVMEQFGEGFDMNIIRVNAQERFMDKLKGVSDPEQKRKIIGNEFVYVFDDEAAKL-TDVDFLAQGTLYTDVIESGTKTAQTIKSHHNVGGLPEDMEFELIEPINTLFKDEVRALGIELGIPEHLVWRQPFPGPGLGIRVLGEITEDKLEIVRESDAILREVVRE--EGLERDIWQYFTVLPGIQSVGVMGDYRTYDHTVGIRAVTSIDGMTSDFARIDWEVLQKISSRIVNEVDHVNRVVYDITSKPPSTIEWE 513
>gi|160934354|ref|ZP_02081741.1| hypothetical protein CLOLEP_03225 [Clostridium leptum DSM 753] >gi|156867027|gb|EDO60399.1| hypothetical protein CLOLEP_03225 [Clostridium leptum DSM 753] (515 aa)
Score = 1388, Expect = 2.8e-151, Identities = 272/510 (53%), Positives = 361/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFE-LLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + ILILDFG QY+QLIARR+RDLNV+ EI  Y IS +EI KK  KGII SGG +SVY +++++ +  I+ L IP+LGICYG Q+M    GG V+   D+ EYG+T + + T+  +F   + +N CWMSH+D +  +P+GF+VIA T  C VA+  N+EKK Y  QFHPEV  +  GN  L+NF+Y +C   GDW   +   + I+ +K  + D  VLCA+SGGVDS VAA+L  +A+G +L C+FVDHGLLRK+E  +V  + +K    N+  V+ K  FLSKL GV +PE+KRKIIG+ FI VFE+ + K+    ++L QGTIYPD+VESG   +  IKSHHNVGGLPE + FE ++EPL+ LFKDEVR+ GL L IP   V+RQPFPGPGLA+R++G+IT +KLEI++ AD +FR  I       + K  QYF VLT  KSVGV+GD R+Y  T+ALR V + D M+A W +IP E LEK+S+ I N+V N++RVVYDIT+KPP TIEWE
  S:     8 EAILILDFGAQYSQLIARRVRDLNVFCEIKSYQISADEIAKKGYKGIIFSGGPNSVYAEKALRCDPDIFSLGIPVLGICYGAQLMAHLLGGTVQQ-SDAREYGNTMVHVETDSPVFFGAQQENICWMSHTDYISKVPEGFRVIAQTEGCPVAAMENQEKKLYAFQFHPEVEHSREGNFYLKNFLYGVCGCKGDWVMSSFVKDTIQSLKEKIGDKKVLCALSGGVDSSVAALLVHKAVGKQLTCIFVDHGLLRKDEGDQVETVFRKQFDMNLIRVNAKDRFLSKLAGVSEPEKKRKIIGEEFIRVFEEESQKLG-KIEFLCQGTIYPDVVESGVGEAAVIKSHHNVGGLPEDVGFEGIIEPLRDLFKDEVRQAGLELGIPGPLVWRQPFPGPGLAIRIMGDITAEKLEILKNADAIFREEIAS--AGLDRKISQYFAVLTGIKSVGVMGDGRTYDNTIALRGVTTSDFMTADWARIPYEVLEKVSNRIINEVSNVNRVVYDITSKPPATIEWE 515
>gi|143012|gb|AAA22497.1| GMP synthetase (513 aa)
Score = 1382, Expect = 1.3e-150, Identities = 275/510 (53%), Positives = 362/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNR-EKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + IL+LDFG QY QLI RRIR+  VYSE+  + ++ EEI K NPKGIILSGG +SVY + S + ++ I++L+IP+LGICYG Q+M    GG+VE      EYG  +IR+  T +LF ++  +   WMSH D V+ +P+GF V A+T+     SA ++ +KK++GVQFHPEV  + +GN LL+NFV+ +C+  G+W  +N    ++++I+  V D  VLC +SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E + V     +    N+  VD K  FL+KLKGV DPEQKRKIIG  FI VF+  A+K+     YL QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG  L IP + V+RQPFPGPGL +RVLGE+TE+KLEIVRE+D + R  I       E   WQYFTVL + +SVGV+GD R+Y YT+  R   S+D M++ W +IP + LE IS+ I N+VK+I+RVVYDIT+KPP TIEWE
  S:     7 EMILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEIKKMNPKGIILSGGPNSVYDENSFRCDEKIFELDIPVLGICYGMQLMTHYLGGKVEA-ATQREYGKANIRIEGTPDLFRDLPNEQVVWMSHGDLVVEVPEGFTVDAATSHHCPNSAMSKGDKKWHGVQFHPEVRHSEYGNDLLKNFVFGVCESEGEWSMENFIEIEMQKIREQVGDKQVLCGLSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEREGVMKTFSEGFNMNVIKVDAKDRFLNKLKGVSDPEQKRKIIGNEFIYVFDDEADKLK-GIDYLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGTELGIPDEIVWRQPFPGPGLGIRVLGEVTEEKLEIVRESDAILREEIAN--HGLERDIWQYFTVLPDIRSVGVMGDARTYDYTIESRRT-SIDGMTSDWARIPWDVLEVISTRIVNEVKHINRVVYDITSKPPATIEWE 513
>gi|167404133|ref|ZP_02308940.1| bifunctional GMP synthase/glutamine amidotransferase protein [Listeria monocytogenes FSL J2-003] (514 aa)
Score = 1381, Expect = 1.5e-150, Identities = 269/510 (52%), Positives = 354/510 (69%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS--EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KI++LDFG QY QLI RRIR+  VYSE+  + I++EE+   NP GII SGG +SVY + + + ++ I+D+ IPILGICYG Q+M    GG+VE  KD  EYG  DI +   N LF  +  D   WMSH D V+  P GF+V  ++  C +A   + E+  YGVQFHPEV  + +GN+LL+NF  ++C   GDW  +N    +I +I+ IV D  VL A+SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+ +V A L+     NI  VD K+ F+ KL GV DPEQKRKIIG  FI VF+  ANK++   ++L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L +P   V+RQPFPGP L       ITE+KLEIVR++D++ R  I    KN+  E + WQYFT L N +SVGV+GD R+Y +T+ +RAV S+D M+A W +IP + LEKIS  I N+V +++RVVYDIT+KPP T+EWE
  S:     8 EKIIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDEDAFRADERIFDMGIPILGICYGMQLMTTHFGGKVERAKD-REYGKADIHVEKPNRLFAGLPTDQVVWMSHGDLVVEEPAGFEVTVTSKSCPIAGIADEERSLYGVQFHPEVRHSVYGNELLKNFALNVCGCKGDWTMENFSEVEIAKIQEIVGDKKVLLALSGGVDSSVVGVLIHKAIGDQLTCIFVDHGLLRKGEADQVMATLQGEFNMNIIKVDAKKRFMDKLAGVSDPEQKRKIIGNEFIYVFDDEANKLD-GVEFLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRALGTELGMPDAIVWRQPFPGPRLRNPRTWRITEEKLEIVRDSDYILREEI----KNAGLEREIWQYFTALPNIRSVGVMGDGRTYDHTVVVRAVTSIDGMTADWARIPWDVLEKISVRIVNEVDHVNRVVYDITSKPPATVEWE 514
>gi|172056478|ref|YP_001812938.1| GMP synthase, large subunit [Exiguobacterium sibiricum 255-15] >gi|171988999|gb|ACB59921.1| GMP synthase, large subunit [Exiguobacterium sibiricum 255-15] (514 aa)
Score = 1381, Expect = 1.5e-150, Identities = 267/510 (52%), Positives = 350/510 (68%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + IL+LDFGGQY QLI RRIRDL VYSE+  + I+  E+    P GII SGG  SVY + + + +  I+DL IPI GICYG Q+M Q  GG VE      EYG   + L   + ++ N+ L+   WMSHSD V  +P GF V  +   C +AS  N E K YGVQ+HPEV  T FG +LL+NF++ +C   GDW  +N    +I +IK  V D  VLCA+SGGVDS V A L   AIGD+L C+FVDHGLLRK E++ V          N+  +D +  FL+KLKG+ DPEQKRKIIG  F+ VF++ A+K+     +L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EP+  LFKDEVR+LG  L +  + V+RQPFPGPGL +RVLGEIT++KLEIVRE+DF+ R  I +     E + WQYFTVL   +SVGV+GD R+Y Y + +RAV S+D M++ W +IP + LEKIS  I N+V+N++RV+YD+T+KPP TIEWE
  S:     8 EMILVLDFGGQYNQLITRRIRDLGVYSELHSHKITAAEVKDIAPAGIIFSGGPRSVYAEDAYRCDPEIFDLGIPIFGICYGMQLMSQHFGGTVER-AGHREYGKATLTLNDPSPMYANLPLEQTVWMSHSDLVTSVPNGFVVDGTNVSCPIASIKNEELKMYGVQYHPEVNHTMFGKELLKNFLFEVCQCTGDWSMENFIEIEIAKIKEEVGDKKVLCALSGGVDSSVVAALIHAAIGDQLTCMFVDHGLLRKGEAESVMKTFADHFHMNVIKIDAQDRFLNKLKGISDPEQKRKIIGNEFVYVFDEEASKL-TDMDFLAQGTLYTDIIESGTDTAQTIKSHHNVGGLPEDMQFKLIEPINTLFKDEVRELGKELGLSDEIVWRQPFPGPGLGIRVLGEITDEKLEIVRESDFILRDEIKK--AGLEREIWQYFTVLPPLRSVGVMGDERTYDYAVGIRAVTSIDGMTSDWARIPWDVLEKISVRIVNEVQNVNRVLYDVTSKPPSTIEWE 514
>gi|23098171|ref|NP_691637.1| bifunctional GMP synthase/glutamine amidotransferase protein [Oceanobacillus iheyensis HTE831] >gi|44887959|sp|Q8CXK8|GUAA_OCEIH GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|22776396|dbj|BAC12672.1| GMP synthase (glutamine-hydrolyzing) [Oceanobacillus iheyensis HTE831] (511 aa)
Score = 1377, Expect = 5.0e-150, Identities = 268/508 (52%), Positives = 349/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L+LDFG QY QLI RRIR+  VYSE+  + ++ EEI + NPKGIILSGG  SVY + S + ++GI++L IP+LGICYG Q+M     G+VE  K+  EYG   I L     LF++       WMSH D V   P  F + A++    +A+  N EK  YGVQFHPEV  T +GN LL  FV+ +C   GDW  +N    ++E+I+  V D  VLCA+SGGVDS V A L  +AIGD+L C+FVDHGLLRKNE  +V  +  +    NI  VD K  FL KL+GV DPE KRKIIG  FI VF+  A+K+     +L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QF L+EPL  LFKDEVR+LG  L +P + V+RQPFPGPGLA+R+LGE+TE+ LEIVRE+D + R  I +     +   WQYFTVL N KSVGV+GD R+Y +T+ +RAV S+D M++ W +IP + LE+IS+ + N V NI+RVVYD+T+KPP TIEWE
  S:     7 VLVLDFGSQYNQLITRRIREFGVYSELHSHKLTAEEIKEMNPKGIILSGGPHSVYDENSFRCDEGIFELGIPVLGICYGMQLMSLHYDGKVERSKN-REYGKALIELDGEPVLFKDTPKGQTVWMSHGDKVTAAPPSFNIDATSPSTPIAAISNVEKNLYGVQFHPEVRHTEYGNDLLNRFVFDVCGCTGDWSIENFIDMEVEKIQETVGDRKVLCALSGGVDSSVVAALIHKAIGDQLTCIFVDHGLLRKNEGDDVMKVFAEDFQMNIIKVDAKDRFLFKLEGVSDPELKRKIIGNEFIYVFDDEASKLK-DIDFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMQFTLIEPLNTLFKDEVRELGSQLGVPDRIVWRQPFPGPGLAIRILGEVTEEHLEIVRESDAILREEIAK--AGLDRDIWQYFTVLPNIKSVGVMGDARTYAHTIGIRAVTSIDGMTSDWARIPWDVLERISTRLVNDVDNINRVVYDVTSKPPATIEWE 511
>gi|170016947|ref|YP_001727866.1| GMP synthase [Leuconostoc citreum KM20] >gi|169803804|gb|ACA82422.1| GMP synthase [Leuconostoc citreum KM20] (515 aa)
Score = 1374, Expect = 1.0e-149, Identities = 263/510 (51%), Positives = 358/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN--ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS-EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DK+L+LD+G QY QLI RRIR++ V+SE+    ++ EE+   NPK I+LSGG  SVY   +   + GI++L IP+LG+CYG Q+M Q  GGQVE +  + E+G T ++ T +   LF +        MSHSD+V+ LP+GF V   ++K  +A+  N E++ YGVQFH E T +  G Q+LQNFV  I     +W+      E+I  I+  V D  VL  +SGGVDS V  VL  +AIG++L  +FVDHGLLRKNE+++V  ++    G NI  VD +  FLSKL GV DPEQKRKIIG  FIEVF   A K+     +L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR+LG +L++P++ V+RQPFPGPGL +R+LG+ITEDKLEIVR++D++ R   D++ K   E   WQYFTVLT  +SVGV+GD R+Y YT+A+RA+ S+D M+A + ++P   L+KIS+ I N+V +I+RVVYDIT KPP T+EWE
  S:     7 DKVLVLDYGSQYNQLITRRIREMGVFSELKSRHMTAEEVKAYNPKAIVLSGGPKSVYETDAFAIDNGIFELGIPVLGVCYGMQLMAQNLGGQVEANPGNGEFGQTALKKTESAGRLFAHTPESQTVLMSHSDNVVSLPEGFVVAGGSDKTPIAAIANDERRLYGVQFHAETTLSEHGKQILQNFVLDIAQAEANWDMSGFIDEQIARIRETVGDKKVLLGLSGGVDSSVVGVLLHKAIGNQLTSIFVDHGLLRKNEAEQVMTMMGDQFGLNIIKVDAQDRFLSKLAGVTDPEQKRKIIGNEFIEVFNDEATKLK-DIDFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRELGEALNMPHEMVWRQPFPGPGLGIRILGDITEDKLEIVRDSDWILR---DEIAKAGLEGDVWQYFTVLTGVRSVGVMGDYRTYDYTIAIRAITSVDGMTADFAQLPWPLLQKISARIVNEVGHINRVVYDITAKPPATVEWE 515
>gi|83590931|ref|YP_430940.1| bifunctional GMP synthase/glutamine amidotransferase protein [Moorella thermoacetica ATCC 39073] >gi|91206810|sp|Q2RGP2|GUAA_MOOTA GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|83573845|gb|ABC20397.1| GMP synthase (glutamine-hydrolyzing) [Moorella thermoacetica ATCC 39073] (516 aa)
Score = 1373, Expect = 1.3e-149, Identities = 256/508 (50%), Positives = 356/508 (70%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L+LDFGGQY QLIARR+R+  VYSE++ Y+  +E+I+ + P+GII SGG  SVY   + + ++ +++  IPILGICYG Q+M  + GG+VE      EYG T + +T  + LF  +     CWMSH D +   P GF+V A +    VA+  +  +K YGVQFHPEV  T  G ++L+ F++ +C   GDW   +   +++  I+  V +  VLCA+SGGVDS VAA L  +A+GD+L CVFV+HGLLR+ E+++V     + +G NI  VD  + FL KL GV DPE+KRKIIG  FI VFE+ A K+     +L+QGT+YPD++ESG++ +  IKSHHNVGGLPE ++ EL+EPL+ LFKDEVR++G  L +P + V+RQPFPGPGLA+R+LGE+T +KLEI+R+AD +    I +  LY+    + WQ F VL + KSVGV+GD R+Y Y + LRAV S DAM+A W ++P + LE+ISS I N+V++I+RVVYDIT+KPP TIEWE
  S:    12 VLVLDFGGQYNQLIARRVREAGVYSEMIPYNTPLEKILARRPRGIIFSGGPASVYSLGAPRIDRALYESGIPILGICYGMQLMAHDLGGRVEG-ASGREYGKTQLEITAADPLFAGLPESIQCWMSHGDYISAPPPGFQVTARSAYTPVAAMSDPARKLYGVQFHPEVKHTPMGQEILRRFLFQVCGCRGDWSVSSFIEDQVAAIRRQVGNGRVLCALSGGVDSSVAAALVHRAVGDRLTCVFVNHGLLRQGEAEQVQRAFGQAMGMNIVYVDASRRFLEKLTGVTDPEEKRKIIGHEFIRVFEEEARKLG-RVDFLVQGTLYPDVIESGTETAAVIKSHHNVGGLPEDMELELIEPLRLLFKDEVRRVGEELGLPEEIVWRQPFPGPGLAIRILGEVTPEKLEILRQADAIVTEEIRRAGLYR----EIWQSFAVLPSMKSVGVMGDERTYAYPIVLRAVTSDDAMTADWARLPYDLLERISSRIVNEVRHINRVVYDITSKPPATIEWE 516
>gi|163763137|ref|ZP_02170200.1| GMP synthase PP-ATPase domain/subunit-like protein [Bacillus selenitireducens MLS10] >gi|160356405|gb|EDP83055.1| GMP synthase PP-ATPase domain/subunit-like protein [Bacillus selenitireducens MLS10] (512 aa)
Score = 1373, Expect = 1.3e-149, Identities = 262/510 (51%), Positives = 355/510 (69%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++I++LDFGGQY QLI RRIRDL V+SE+V + ++ +++   NP GII SGG  SVY D + + ++ I+DL IP+LGICYG Q+M     G VE   +  EYG   I +   ++LF+++ L+   WMSH D V   P+GF+V A    C VA+  N  K  YGVQFHPEV  T  GN +L+NF+Y +C   G+W  +N    ++E+I+  V D  VLCA+SGGVDS V A L  +AIGD+L C+F+DHGLLRKNE++ V     +    N+  +D ++ FL KL GV DPEQKRKIIG  FI +FE+ A K+     +L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE ++F+L+EPL  LFKDEVR +G  L +  + V+RQPFPGPGL +RVLGEIT++KLEIVRE+D + R  I +     +   WQYFT L + +SVGV+GD R+Y YT+ +RAV S+D M++ W +IP + LE IS+ I N+VK+++RVVYDIT+KPP TIEWE
  S:     6 ERIIVLDFGGQYNQLITRRIRDLGVFSELVSHKVTADDVKAMNPTGIIFSGGPGSVYADGAPRCDEAIFDLGIPVLGICYGMQLMTDHFNGSVEA-ANHREYGKAAITIEHPSKLFKDLPLEQMVWMSHGDLVKAPPEGFQVDAVNPSCPVAAMSNEAKNLYGVQFHPEVQNTEHGNAMLKNFIYEVCGCEGNWSMENFIDIEVEKIRENVGDRKVLCALSGGVDSSVVAALVHKAIGDQLICMFIDHGLLRKNEAKSVMETFAEGFDMNVIKIDAQERFLGKLAGVSDPEQKRKIIGNEFIYIFEEEAAKLE-DVDFLAQGTLYTDIIESGTDTAQTIKSHHNVGGLPEDMKFDLIEPLNTLFKDEVRAVGSELGLSDEIVWRQPFPGPGLGIRVLGEITDEKLEIVRESDQILRDEIKK--AGLDRHIWQYFTALPDMRSVGVMGDARTYDYTVGIRAVTSIDGMTSDWARIPYDVLEIISTRIVNEVKHVNRVVYDITSKPPSTIEWE 512
>gi|169831787|ref|YP_001717769.1| GMP synthase, large subunit [Candidatus Desulforudis audaxviator MP104C] >gi|169638631|gb|ACA60137.1| GMP synthase, large subunit [Candidatus Desulforudis audaxviator MP104C] (513 aa)
Score = 1373, Expect = 1.3e-149, Identities = 264/508 (51%), Positives = 350/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIR-LTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L+LDFGGQYTQLIARRIR+  VY EI+ Y    E+I+ + PKGI+ SGG  SVY + + +    ++D  IPILGICYG Q+M ++ GG V +  +  EYG T++  L  + LF  +E    CWMSH D V   P GF V A T    VA+  +  +K +G+QFHPEV  T  G Q+LQ F+Y +C   GDW   +   + + +I+  V D  VLCA+SGGVDS VAA L  +A+GD+L CVFVDHGLLR+ ES++V     +  G  +  V+ +  FL +L GV DPE KR+IIG  FI VFE+ A K+  P  +L+QGTIYPD+VESG+     IK+HHNVGGLPE ++F+L+EPL++LFKDEVR LG  L +P + V+RQPFPGPGLAVRVLGE+T +KLE +R AD +    I +  LY+    + WQ F VL   +SVGV+GD R+YGYT+ +RAV+S+DAM+A W ++P E LE +S  + N+VK I+RVVYDIT+KPPGTIEWE
  S:     9 VLVLDFGGQYTQLIARRIRECRVYCEILPYHTPAEDIVSRRPKGIVFSGGPSSVYQEGAPQCAVSLYDAGIPILGICYGMQLMARQLGGTV-SPAERREYGKTELEVLDGSGLFRGLEDRERCWMSHGDRVDAPPPGFAVTARTAHSPVAAMADPVRKLFGLQFHPEVRHTPRGVQILQRFLYEVCGCRGDWTMSSFLEDAVAQIRREVGDGRVLCALSGGVDSSVAAALVHRAVGDRLTCVFVDHGLLRQGESEQVRETFARRFGMRLVHVEAQDRFLDRLAGVEDPEAKRRIIGTEFIRVFEEEAAKLG-PIDFLVQGTIYPDVVESGTATGAVIKTHHNVGGLPEDIRFKLIEPLRWLFKDEVRVLGEELGLPEEIVWRQPFPGPGLAVRVLGEVTREKLECLRAADAVVDEEIRRAGLYR----QVWQSFAVLPPIRSVGVMGDERTYGYTIVIRAVESVDAMTADWVRLPYEVLETMSRRLVNEVKGINRVVYDITSKPPGTIEWE 513
>gi|145956121|ref|ZP_01805118.1| hypothetical protein CdifQ_04000221 [Clostridium difficile QCD-32g58] >gi|168696059|ref|ZP_02728336.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium difficile QCD-37x79] >gi|168722952|ref|ZP_02755229.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium difficile QCD-76w55] >gi|168732589|ref|ZP_02764866.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium difficile QCD-97b34] >gi|196161756|ref|ZP_03122317.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium difficile CIP 107932] (511 aa)
Score = 1373, Expect = 1.4e-149, Identities = 269/508 (52%), Positives = 364/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV-ENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP-WQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFGGQY QLIARR+R+ NVY EI+    SIE I +KNPKGII +GG +S Y + S   +K I++L +PILGICYG Q+M    GG V + +K  +EYG T I    + LFE I   N+ WMSH+D +  +P+GF ++A+TN C VA+  N E+  YGVQFHPEV     G+++L NF+Y+IC V GDW   +   +KI+E+K  + D   LCA+SGGVDS VAAVL  +AIGD L C+FVDHGLLRKNE  +V  + ++    N+  V+ +  FLSKLKGV +PE KRKIIG+ FI VFE+ +NK+     +L+QGTIYPD++ESG   + TIKSHHNVGG+PE + F E++EPL+ LFKDEVRK+GL L I    ++R PFPGPGL +RV+G++T++K +I+READ +   Y+D+L K   ++  WQ F  L + K+VGV+GD R+Y Y + LRAV S D M++ WYK+P + LE+IS+ I N+V  ++RVVYDIT+KPPGTIEWE
  S:     6 VLVIDFGGQYNQLIARRVRENNVYCEILPCTASIERIKEKNPKGIIFTGGPNSAYLEDSPTISKEIFELGVPILGICYGIQIMSHVLGGVVRKGNKQEKEYGKTSITYGKSSLFEGIT-TNSVWMSHTDLIEKVPEGFTIVANTNDCPVAAMENVERNLYGVQFHPEVEHCLEGDKILTNFLYNICKVKGDWTTDSFIEDKIKELKEKIGDKKALCALSGGVDSSVAAVLIHKAIGDNLTCIFVDHGLLRKNEGNDVERIFREKFDINLIRVNAEDRFLSKLKGVSEPEAKRKIIGEEFIRVFEEESNKLG-KMDFLVQGTIYPDVIESGHGNAATIKSHHNVGGIPEDVDFQEIVEPLRELFKDEVRKIGLELGIEEGLIFRHPFPGPGLGIRVIGDVTKEKCDILREADAV---YMDELRKAGLYREIWQAFATLPDVKTVGVMGDERTYAYLVGLRAVTSSDGMTSDWYKMPYDVLERISNRIINEVDGVNRVVYDITSKPPGTIEWE 511
>gi|196162995|ref|ZP_03123526.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium difficile QCD-23m63] (511 aa)
Score = 1372, Expect = 1.7e-149, Identities = 269/508 (52%), Positives = 364/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV-ENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP-WQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFGGQY QLIARR+R+ NVY EI+    SIE I +KNPKGII +GG +S Y + S   +K I++L +PILGICYG Q+M    GG V + +K  +EYG T I    + LFE I   N+ WMSH+D +  +P+GF ++A+TN C VA+  N E+  YGVQFHPEV     G+++L NF+Y+IC V GDW   +   +KI+E+K  + D   LCA+SGGVDS VAAVL  +AIGD L C+FVDHGLLRKNE  +V  + ++    N+  V+ +  FLSKLKGV +PE KRKIIG+ FI VFE+ +NK+     +L+QGTIYPD++ESG   + TIKSHHNVGG+PE + F E++EPL+ LFKDEVRK+GL L I    ++R PFPGPGL +RV+G++T++K +I+READ +   Y+D+L K   ++  WQ F  L + K+VGV+GD R+Y Y + LRAV S D M++ WYK+P + LE+IS+ I N+V  ++RVVYDIT+KPPGTIEWE
  S:     6 VLVIDFGGQYNQLIARRVRENNVYCEILPCTASIERIKEKNPKGIIFTGGPNSAYLEDSPTISKEIFELGVPILGICYGIQIMSHVLGGVVRKGNKQEKEYGKTAITYGKSSLFEGIT-TNSVWMSHTDLIETVPEGFTIVANTNDCPVAAMENVERNLYGVQFHPEVEHCLEGDKILTNFLYNICKVKGDWTTDSFIEDKIKELKEKIGDKKALCALSGGVDSSVAAVLIHKAIGDNLTCIFVDHGLLRKNEGNDVERIFREKFDINLIRVNAEDRFLSKLKGVSEPEAKRKIIGEEFIRVFEEESNKLG-KMDFLVQGTIYPDVIESGHGNAATIKSHHNVGGIPEDVDFQEIVEPLRELFKDEVRKIGLELGIEEGLIFRHPFPGPGLGIRVIGDVTKEKCDILREADAV---YMDELRKAGLYREIWQAFATLPDVKTVGVMGDERTYAYLVGLRAVTSSDGMTSDWYKMPYDVLERISNRIINEVDGVNRVVYDITSKPPGTIEWE 511
>gi|116492215|ref|YP_803950.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pediococcus pentosaceus ATCC 25745] >gi|116102365|gb|ABJ67508.1| GMP synthase (glutamine-hydrolyzing) [Pediococcus pentosaceus ATCC 25745] (517 aa)
Score = 1372, Expect = 1.8e-149, Identities = 261/510 (51%), Positives = 357/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE--LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKI++LDFG QY QLI RRIR+  +YSE++ + I+ EEI K NPKGII SGG +SVY   + + +  I+ L IPILGICYG Q+M    GG+VE   D+ EYG  DI +T ++  +F+ +      WMSH D V  +P+GFK +A++  C +AS  +  +KFYGVQFH EV  T +GN++L++F + +C+   +W   +    ++++I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+++V   L+   G NI  VD +  FLSKL GV +PEQKRKIIG  FI+VF   A K+     +L QGT+Y D++ESG+  ++TIKSHHNVGGLPE + FEL+EPL+ LFKDE R LG  L +P   V+RQPFPGPGL +RV+GEITEDKL+IVR++D + R  I +     +   WQYFTVL   +SVGV+GD R+Y YT+ +RAV+S+D M+A + +IP + L+KIS  I N+V +++R+VYDIT+KPP T+EWE
  S:    10 DKIIVLDFGSQYNQLITRRIREFGIYSELLSHKITAEEIKKINPKGIIFSGGPNSVYDKDAFRIDPEIYKLGIPILGICYGMQLMTYNLGGRVE-PADNREYGHADIDVTDDQAVMFKELPAKQTVWMSHGDLVREVPEGFKTVATSANCPIASMADDARKFYGVQFHAEVRNTQYGNEILRHFAFDVCEAKANWSMNDFIDMQVQQIRETVGDRKVLLGLSGGVDSSVVGVLLNKAIGDQLVCIFVDHGLLRKGEAKQVMDSLEGKFGLNIIKVDAQDRFLSKLAGVSEPEQKRKIIGNEFIQVFNDEAQKLK-GIDFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMHFELIEPLRTLFKDEARDLGEKLGMPEDLVWRQPFPGPGLGIRVIGEITEDKLQIVRDSDLILREEIKK--AGLDRDIWQYFTVLPGIRSVGVMGDGRTYDYTVGIRAVNSIDGMTADFARIPWDVLQKISVRIVNEVDHVNRIVYDITSKPPATVEWE 517
>gi|58336584|ref|YP_193169.1| bifunctional GMP synthase/glutamine amidotransferase protein [Lactobacillus acidophilus NCFM] >gi|75358092|sp|Q5FMD6|GUAA_LACAC GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|58253901|gb|AAV42138.1| GMP synthase [Lactobacillus acidophilus NCFM] (516 aa)
Score = 1372, Expect = 1.9e-149, Identities = 265/510 (51%), Positives = 362/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT--NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKI++LDFG QY QLI RRIRD  +YSE++ +D+SIE+I + NPKGII SGG +SVY D ++K +  I+ L IPILGICYG Q+M  + GG+VE   +++EYG  +I +    + LF+ +      WMSH D V   P+GF+V AS+  C +A+  N +KKFYG+QFH EV  + +G  +L++F + +C    +W   +    +++EI+  V D  V+  +SGGVDS V A L  +AIGD+L  +FVDHG+LRK+E  +V   L K +G NI  V+ ++ FL+KLKGV DPEQKRKIIGK FIEVF + A K+     +L QGT+Y D++ESG+  ++TIKSHHNVGGLPE + F+L+EPL+ LFKDEVR+LG  L IP+  V+RQPFPGPGL +RVLGE+TEDKL+IVRE+D + R  I +     + K WQYFTVL   +SVGV+GD R+Y YT+ +RAV S+D M+A + +IP + L  IS  I N+V N++R+VYD+T+KPP TIEWE
  S:     9 DKIIVLDFGSQYNQLITRRIRDFGIYSELLPHDLSIEKIKEMNPKGIIFSGGPNSVYDDGALKVDPEIFKLGIPILGICYGMQLMSYDLGGKVER-AENKEYGRANITVEDPDSALFKGLPTKQYVWMSHGDLVTQAPEGFEVTASSKNCPIAAIANPDKKFYGIQFHAEVRNSEYGLDILKHFAFDVCGAVANWTMADFIDMQVDEIRKEVGDKKVILGLSGGVDSSVTATLLHKAIGDQLTAIFVDHGMLRKDEGDQVMKALNKDLGVNIIRVNAQERFLNKLKGVTDPEQKRKIIGKEFIEVFNEEAKKLK-DVDFLAQGTLYTDVIESGTNTAQTIKSHHNVGGLPEDMNFKLIEPLRKLFKDEVRELGEKLGIPHDLVWRQPFPGPGLGIRVLGEVTEDKLKIVRESDAILREEIKK--AGLQEKIWQYFTVLPGIRSVGVMGDGRTYDYTIGIRAVTSIDGMTADFAQIPWDVLGHISDRIVNEVDNVNRIVYDVTSKPPSTIEWE 516
>gi|126697769|ref|YP_001086666.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium difficile 630] >gi|168714611|ref|ZP_02746888.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium difficile QCD-63q42] >gi|196124361|ref|ZP_03116110.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium difficile ATCC 43255] >gi|115249206|emb|CAJ67019.1| GMP synthase [glutamine-hydrolyzing] [Clostridium difficile 630] (511 aa)
Score = 1371, Expect = 2.2e-149, Identities = 269/508 (52%), Positives = 364/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV-ENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP-WQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFGGQY QLIARR+R+ NVY EI+    SIE I +KNPKGII +GG +S Y + S   +K I++L +PILGICYG Q+M    GG V + +K  +EYG T I    + LFE I   N+ WMSH+D +  +P+GF ++A+TN C VA+  N E+  YGVQFHPEV     G+++L NF+Y+IC V GDW   +   +KI+E+K  + D   LCA+SGGVDS VAAVL  +AIGD L C+FVDHGLLRKNE  +V  + ++    N+  V+ +  FLSKLKGV +PE KRKIIG+ FI VFE+ +NK+     +L+QGTIYPD++ESG   + TIKSHHNVGG+PE + F E++EPL+ LFKDEVRK+GL L I    ++R PFPGPGL +RV+G++T++K +I+READ +   Y+D+L K   ++  WQ F  L + K+VGV+GD R+Y Y + LRAV S D M++ WYK+P + LE+IS+ I N+V  ++RVVYDIT+KPPGTIEWE
  S:     6 VLVIDFGGQYNQLIARRVRENNVYCEILPCTASIERIKEKNPKGIIFTGGPNSAYLEDSPTISKEIFELGVPILGICYGIQIMSHVLGGVVRKGNKQEKEYGKTAITYGKSSLFEGIT-TNSVWMSHTDLIEKVPEGFTIVANTNDCPVAAMENVERNLYGVQFHPEVEHCLEGDKILTNFLYNICKVKGDWTTDSFIEDKIKELKEKIGDKKALCALSGGVDSSVAAVLIHKAIGDNLTCIFVDHGLLRKNEGNDVERIFREKFDINLIRVNAEDRFLSKLKGVSEPEAKRKIIGEEFIRVFEEESNKLG-KMDFLVQGTIYPDVIESGHGNAATIKSHHNVGGIPEDVDFQEIVEPLRELFKDEVRKIGLELGIEEGLIFRHPFPGPGLGIRVIGDVTKEKCDILREADAV---YMDELRKAGLYREIWQAFATLPDVKTVGVMGDERTYAYLVGLRAVTSSDGMTSDWYKMPYDVLERISNRIINEVDGVNRVVYDITSKPPGTIEWE 511
>gi|160947468|ref|ZP_02094635.1| hypothetical protein PEPMIC_01402 [Peptostreptococcus micros ATCC 33270] >gi|158446602|gb|EDP23597.1| hypothetical protein PEPMIC_01402 [Peptostreptococcus micros ATCC 33270] (510 aa)
Score = 1367, Expect = 6.2e-149, Identities = 277/508 (54%), Positives = 363/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGST-DIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPW-QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL++DFGGQY QLIARR+RDLNVY E+V Y+ ++ EI +K P GII +GG +SVY +++ K  K I++ NIPILG+CYG Q++ Q  GG VE   D +E+G T  I+   ++L  N++ +   WMSH D V+ LP+GF  I  T+ C  A   N EKK Y VQ+HPEV  +  G +L+++F+Y IC+ +GDW  +N   E+I++IK  V D  VL A+SGGVDS V A L ++AIG +L CVFVD GL+RKNE  EV    K     N   V+ K  FL KLKGV DPEQKRKIIG+ FI VFE  A KI     YL QGTIYPD++ESG   +K IKSHHNVGGLP+ + F +L+EPL+ LFKDEVR+LGL L +P   V+RQPFPGPGL +RV+GE+TE+KLEI+R+AD +FR   +++ K  E K   QYF V+TN+K+VGV+GD R+Y YTLALR V + D M+A W +IP E L+++S  I N+V+NI+R+VYDIT+KPP TIEWE
  S:     6 ILVVDFGGQYNQLIARRVRDLNVYCEVVPYNKAVNEIKRKKPTGIIFTGGPNSVYDEKAPKIEKEIFEFNIPILGLCYGMQLISQTFGGVVEK-ADKKEFGKTLCIKDKNSKLISNMKSETTVWMSHQDQVVKLPEGFDCIQHTDTCPYAGIENEEKKIYAVQYHPEVNHSEEGKELIKSFLYDICNASGDWTMQNFMNEQIDKIKQTVGDKKVLLALSGGVDSSVCASLLSKAIGSQLTCVFVDTGLMRKNEGDEVEEAFKN-DELNFVRVNAKDRFLEKLKGVTDPEQKRKIIGEEFIRVFEDEAKKIG-QVDYLAQGTIYPDVIESGLGDAKVIKSHHNVGGLPDVVDFRDLIEPLRDLFKDEVRRLGLELKMPEYLVFRQPFPGPGLGIRVMGEVTEEKLEILRDADAIFR---EEIAKAGEDKNISQYFAVITNNKTVGVMGDFRTYDYTLALRGVTTTDFMTADWARIPYEVLDRVSVRIVNEVENINRIVYDITSKPPATIEWE 510
>gi|187604256|ref|ZP_02990466.1| GMP synthase, large subunit [Exiguobacterium sp. AT1b] >gi|187483805|gb|EDU21799.1| GMP synthase, large subunit [Exiguobacterium sp. AT1b] (513 aa)
Score = 1366, Expect = 8.6e-149, Identities = 263/510 (51%), Positives = 350/510 (68%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT--TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + IL+LDFGGQY QLI RR+RDL VYSE+  + ++  EI + NP GII SGG +SVY + + + +  I++L IPI GICYG Q+M    GG+VE      EYG   +  T   + ++  + +++  WMSH D V+  P+GF V  +   C VAS  N E K YGVQ+HPEV  + +GN +L+NF+Y +C   G+W  +N    ++E+I+ IV D  VLCA+SGGVDS V A L  +AIGD+L C+FVDHGLLRK E+  V           +  +D ++ FL+KL GV DPEQKRKIIG  FI VF++ A+K+ V   +L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE + F L+EPL  LFKDEVR LG  L +P   V+RQPFPGPGL +RVLGEITE+KLEIVRE+D + R  + +     E   WQYFTVLT  +SVGV+GD R+Y Y + +RAV S+D M++ W +IP + LEKIS  I N+V +++RV+YDIT+KPP TIEWE
  S:     6 EMILVLDFGGQYNQLITRRVRDLGVYSELHSHKMTAAEIRELNPIGIIFSGGPNSVYAEGAYRCDPEIFELGIPIFGICYGMQLMTHHFGGRVERAA-HREYGKATLFSTPEASAIYNGLPVEHTVWMSHGDLVMEAPEGFIVDGTNPSCPVASIKNDELKMYGVQYHPEVRHSEYGNDILKNFIYEVCGAKGEWSMENFIDLEVEKIREIVGDKQVLCALSGGVDSSVVAALVHRAIGDQLTCMFVDHGLLRKGEADSVMKTFADGFNMKVIKIDAQERFLTKLAGVSDPEQKRKIIGNEFIYVFDEEASKL-VDMDFLAQGTLYTDIIESGTDTAQTIKSHHNVGGLPEDMNFTLIEPLNTLFKDEVRALGTELGLPDYIVWRQPFPGPGLGIRVLGEITEEKLEIVRESDAILREEVKK--AGLERDIWQYFTVLTPIRSVGVMGDERTYDYAVGVRAVTSIDGMTSDWARIPWDVLEKISVRIVNEVSHVNRVLYDITSKPPATIEWE 513
>gi|28377744|ref|NP_784636.1| bifunctional GMP synthase/glutamine amidotransferase protein [Lactobacillus plantarum WCFS1] >gi|38257526|sp|Q88Y74|GUAA_LACPL GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|28270577|emb|CAD63481.1| GMP synthase (glutamine-hydrolysing) [Lactobacillus plantarum WCFS1] (518 aa)
Score = 1365, Expect = 1.1e-148, Identities = 265/510 (51%), Positives = 361/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQE-NGGQVENDKDSEEYGSTDIRLTTNE--LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D IL+LDFG QY QLI RRIRD  VYSE++   I+ EEI  ++PKGII SGG +SVY D + + +  I+ L +PILGICYG Q+M     GG+VE+  D+ EYG  +I +T++   LF++   + + WMSH D V   P GF V+A++  C +A+  + ++K YG+QFH EV  T +GN +L++F + +C    +W   +    +IE+I++ V D  VL  +SGGVDS V  VL  +AIG +L  +FVDHGLLRK E+ +V A L+   G NI  VD K  FLSKL GV DPE+KRKIIG  FI+VF++ A K+N   ++L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QF+L+EPL+ LFKDE R+LG  L +P   V+RQPFPGPGL +RV+GEITEDKLEIVR++DF+ R  I +   + E   WQYFTVL   KSVGV+GD R+Y YT+ +RAV S+D M+A + +IP + L+KIS  I N+V +++R+VYD+T+KPP TIEWE
  S:    10 DSILVLDFGSQYNQLITRRIRDFGVYSELLPNTITAEEIKARHPKGIIFSGGPNSVYDDGAFRVDPEIFKLGLPILGICYGMQLMTYTLAGGKVES-ADNREYGKANIDVTSDSATLFKDTPAEQSVWMSHGDLVTQAPDGFDVVATSKNCPIAAIQDVDRKLYGIQFHAEVRNTDYGNDILRHFAFDVCQAEANWSMDDFIDMQIEKIRAEVGDKKVLLGLSGGVDSSVVGVLLHKAIGTQLTSIFVDHGLLRKGEADQVMASLEGKFGLNIIKVDAKDRFLSKLAGVSDPERKRKIIGNEFIQVFDEEATKLN-GMEFLAQGTLYTDVIESGTSTAQTIKSHHNVGGLPEDMQFKLIEPLRTLFKDEARELGEKLGMPSDLVWRQPFPGPGLGIRVIGEITEDKLEIVRDSDFILRDEIKKAGLDRE--IWQYFTVLPGIKSVGVMGDGRTYDYTVGIRAVTSIDGMTADFARIPWDVLQKISVRIVNEVDHVNRIVYDVTSKPPSTIEWE 518
>gi|167628194|ref|YP_001678693.1| bifunctional GMP synthase/glutamine amidotransferase protein [Heliobacterium modesticaldum Ice1] >gi|167590934|gb|ABZ82682.1| gmp synthase (glutamine-hydrolyzing) [Heliobacterium modesticaldum Ice1] (513 aa)
Score = 1365, Expect = 1.2e-148, Identities = 261/510 (51%), Positives = 358/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVL-TNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + IL+LDFGGQY QLIARR+R+L+VY E+  Y IS++ I + NPKGII +GG  SVY +++   +  I+DL IPILGICYG Q+M+ + GG+V    +S EYG   + +T +E  F  +E D  CWMSH D V  LP GF     T+    A+  +  ++FYGVQFHPEV  T  G  +++NF++ +C   G+W  +N   E++  I++ V    VLCA+SGGVDS VAA+L  +A+G++L CV+VDHG +R NES+ +    +  +G N+  V+  + F++K+ GV DPE KRK IG  FI VFE+ A K+     +L+QGT+YPD+VESG+  ++TIK+HHNVGGLPE ++FEL+EPL+ LFKDEVR++G  L +P   V+RQPFPGPGLA+RVLGEIT++ L+I+R AD +    I +  LY+    + WQ F VL T  +SVGV+GD R+Y Y   LRAV S DAM+A W ++P E LEKIS+ I N+VK ++RVVYDIT+KPPGTIEWE
  S:     6 ETILVLDFGGQYNQLIARRVRELHVYCEMHPYTISVDAIREMNPKGIIFTGGPASVYEEKAPAVDPAIYDLGIPILGICYGMQLMVNQLGGKV-GRAESREYGKASLTITASEGPFAGMEGDVQCWMSHGDKVEVLPHGFVGSGKTDHAPFAAMADPVRRFYGVQFHPEVRHTPQGMDMMRNFLFGVCGCTGEWTMENFIEEQVAAIRARVGSGKVLCALSGGVDSSVAALLVHRAVGEQLTCVYVDHGFMRLNESERIIKTFRDELGMNLIAVEASERFMAKVAGVSDPETKRKSIGNEFIRVFEEEAAKLG-QVDFLVQGTLYPDVVESGTSTAETIKTHHNVGGLPEDMKFELIEPLRTLFKDEVREVGQRLGLPEDIVWRQPFPGPGLAIRVLGEITKESLDILRHADDIVFQEIKKAGLYR----QIWQSFVVLPTTVRSVGVMGDGRTYEYPAILRAVTSDDAMTADWARLPYELLEKISNRIVNEVKGVNRVVYDITSKPPGTIEWE 513
>gi|89100241|ref|ZP_01173108.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus sp. NRRL B-14911] >gi|89085091|gb|EAR64225.1| bifunctional GMP synthase/glutamine amidotransferase protein [Bacillus sp. NRRL B-14911] (517 aa)
Score = 1363, Expect = 2.2e-148, Identities = 264/510 (51%), Positives = 350/510 (68%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + I++LDFG QY QLI RRIR+  VYSE+  + I+ EEI + NP GII SGG +SVYG+ +   ++ I++L +PI GICYG Q+M    GG+VE  K   EYG   + L   ++LF  +  +   WMSH D V   P+GF V      C +A+  N E+  Y VQFHPEV  + +GN +L+NFV+ +C   G+W  +N    + E+I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+FVDHGLLRK E++ V     +    N+  VD K  FL+KLKGV DPEQKRKIIG  FI VF+  A K+    ++L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L I  + V+RQPFPGPGL +RVLGEI+++KLEIVRE+D + R  I +     +   WQYFTVL + +SVGV+GD R+Y YT+ +RAV S+D M++ W ++P + LE IS+ I N+V +I+RVVYDIT+KPP TIEWE
  S:    11 EMIVVLDFGSQYNQLITRRIREFGVYSELHPHTITAEEIKEMNPSGIIFSGGPNSVYGENAFGCDERIFELGLPIFGICYGMQLMTMHFGGKVERAK-HREYGKAVLTLEHESKLFAGLPNEQTVWMSHGDLVTEAPEGFSVDGINPSCPIAAMSNEERGLYAVQFHPEVRHSVYGNDILKNFVFGVCGCKGEWSMENFIEIETEKIRQAVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAESVMKTFSEGFNMNVIKVDAKDRFLNKLKGVSDPEQKRKIIGNEFIYVFDDEAAKLE-GIEFLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRALGTELGIADEVVWRQPFPGPGLGIRVLGEISDEKLEIVRESDAILRDEIKK--AGLDRDIWQYFTVLPDIRSVGVMGDARTYDYTIGIRAVTSIDGMTSDWARVPWDVLEIISTRIVNEVDHINRVVYDITSKPPATIEWE 517
>gi|42518314|ref|NP_964244.1| bifunctional GMP synthase/glutamine amidotransferase protein [Lactobacillus johnsonii NCC 533] >gi|50400372|sp|Q74LF7|GUAA_LACJO GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|41582598|gb|AAS08210.1| GMP synthase [Lactobacillus johnsonii NCC 533] (517 aa)
Score = 1363, Expect = 2.2e-148, Identities = 267/510 (52%), Positives = 359/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE--LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS--EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKI++LDFG QY QLI RRIRD  +YSE++ +D+SIE+I +  PKGII SGG +SVY   ++K +  I+ L IPILGICYG Q+M  + GG+VE   D+ EYG  DI +      LFE +  +   WMSH D V   P+GF + A +  C +++  N EKKFYG+QFH EV  + +G  +L+NF + +C    +W   +    +++EI+  V D  V+  +SGGVDS V A L  +AIGD+L  +FVDHG+LRK+E  +V   L K +G NI  V+ ++ FL+KLKGV DPEQKRKIIGK FIEVF + A K+     +L QGT+Y D++ESG+  ++TIKSHHNVGGLPE + FEL+EPL+ LFKDEVR+LG  L IP+  V+RQPFPGPGL +RV+GE+TEDKL+IVRE+D + R  I    KN+  +   WQYFTVL   +SVGV+GD R+Y YT+ +RAV S+D M+A + +IP + L KIS+ I ++  +I+RVVYDIT+KPP TIEWE
  S:    10 DKIIVLDFGSQYNQLITRRIRDFGIYSELLPHDLSIEKIKEMAPKGIIFSGGPNSVYDKGALKVDPEIFKLGIPILGICYGMQLMSYDLGGKVEK-ADNSEYGRADIEVIDPNAVLFEGLPREQYVWMSHGDLVTKAPEGFTITAKSKNCPISAIANDEKKFYGIQFHAEVRNSEYGLDILKNFAFKVCGAKANWTMDDFIEMQVDEIRKKVGDKKVILGLSGGVDSSVTATLLHKAIGDQLTAIFVDHGMLRKDEGDQVMQALNKDLGVNIIRVNAQERFLNKLKGVTDPEQKRKIIGKEFIEVFNEEAKKLK-DVDFLAQGTLYTDVIESGTNTAQTIKSHHNVGGLPEDMHFELIEPLRKLFKDEVRELGEKLGIPHDLVWRQPFPGPGLGIRVIGEVTEDKLKIVRESDAILREEI----KNAGLQEDIWQYFTVLPGIRSVGVMGDGRTYDYTIGIRAVTSIDGMTADFAQIPWDVLSKISTRIVDECDHINRVVYDITSKPPSTIEWE 517
>gi|42527224|ref|NP_972322.1| bifunctional GMP synthase/glutamine amidotransferase protein [Treponema denticola ATCC 35405] >gi|50400363|sp|Q73LZ4|GUAA_TREDE GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|41817648|gb|AAS12233.1| GMP synthase [Treponema denticola ATCC 35405] (523 aa)
Score = 1361, Expect = 3.7e-148, Identities = 275/510 (53%), Positives = 361/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFE-LLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KILI+DFGGQY QLIARR+RDLNVYS+IV    +++ I +  P GII +GG +SVY +++  P K I++LNIPILGICYG Q M    GG+VE      E+G T  +  T   LF+NI+  ++ WMSH D V  LP+GF   A T     A+  N+EKK YG+QFH EV  +  G  +++NF+Y++C   GDW  K+   E I+++++ VKD  VL A+SGGVDS V A L  +A+G  L C+FVDHGL+RKNE  EV A  +     N   V+ +  FL KLKGV DPE+KRKIIG+ FI VFE+ A KI     +L QGTIY D+VESG+K S  IKSHHNVGGLP+ + F+ L+EPLK LFKDE+R LG  L +P   V+RQPFPGPGLA+R++GEITE+KL+I+READ ++RS ++  + + +    QYF VLT++K+VGV+GD R+Y YTLALRAV + D MSA W +IP E L+K+SS I N+VK I+R+VYDIT+KPP TIEWE
  S:    17 EKILIVDFGGQYNQLIARRVRDLNVYSDIVPASKALDYIRENKPIGIIFTGGPNSVYEEKAPLPPKEIFNLNIPILGICYGMQAMAHCLGGKVEKSL-KREFGKTLTKFDTGIPLFKNIKDKSSVWMSHVDCVSRLPEGFVSAAQTANTKNAAMANKEKKLYGIQFHAEVEHSEEGQNIIKNFLYNVCGAKGDWNMKSFLAEAIKDVQNTVKDGKVLLALSGGVDSSVLAALLNRAVGKNLTCIFVDHGLMRKNEGDEVEAAFRD-TPMNFIRVNAESRFLGKLKGVSDPEKKRKIIGEEFIRVFEEEAEKIGT-VDFLAQGTIYADVVESGTKGSAVIKSHHNVGGLPDHISFKSLIEPLKTLFKDEIRNLGTELGLPDYLVHRQPFPGPGLAIRIMGEITEEKLDILREADAIWRSELE--HADIKKDLSQYFAVLTSTKTVGVMGDFRTYDYTLALRAVKTSDFMSADWVRIPYEVLDKVSSRIINEVKGINRIVYDITSKPPATIEWE 523
>gi|109647310|ref|ZP_01371214.1| GMP synthase, large subunit [Desulfitobacterium hafniense DCB-2] >gi|109642556|gb|EAT52110.1| GMP synthase, large subunit [Desulfitobacterium hafniense DCB-2] (510 aa)
Score = 1360, Expect = 3.9e-148, Identities = 261/508 (51%), Positives = 357/508 (70%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L+LDFGGQY QLIARR+R+ +VYSE++ Y   +EEI  +NPKGII SGG  SV  + + K ++ I++L IPI GICYG Q+M  + GG+V +  +  EYG   + +   + L++ +  +  CWMSH DSV  LP+GF + A T+   VA+  +  + FYGVQFHPEV  T  G  +L++F++ IC   G+W  ++    +++ I+  V D  VLCA+SGGVDS VAAVL  +AIGD+L CVFVDHG +RKNE ++V  +  +     +  VD ++ F++K+ GV DPE KR  IG  FI +FE  A K+     +L+QGT+YPDIVESG+  ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR++G  L IP + V+RQPFPGPGLA+R++GE+TE+KL+I+READ +    I    LYK    + WQ F VL   KSVGV+GD R+Y Y + +RAV S DAM+A W ++P + +EKIS+ I N+VK ++RVVYDIT+KPPGTIEWE
  S:     6 VLVLDFGGQYNQLIARRVREAHVYSEMISYKTPVEEIKARNPKGIIFSGGPASVNQEGAPKVDEAIYELGIPIFGICYGMQLMTVQLGGKVMH-PEVREYGKAMLHVDQAKGLWKGLGGERQCWMSHGDSVTELPEGFVIAAHTDHTPVAAMMDETRHFYGVQFHPEVKHTPDGQAMLKHFLFDICGCHGEWTMESFIDAQVKAIREKVGDRQVLCALSGGVDSSVAAVLVHKAIGDQLTCVFVDHGFMRKNEPEQVKKIFTEQFHLKLIFVDARERFMAKIGGVSDPETKRIGIGNEFIRLFEDEARKLG-QIDFLVQGTLYPDIVESGTDTAETIKSHHNVGGLPEDMQFELIEPLDMLFKDEVREVGAELGIPDEIVWRQPFPGPGLAIRIIGEVTEEKLDILREADAVIVEEIRNAGLYK----EVWQSFAVLPTIKSVGVMGDGRTYAYPIVVRAVTSEDAMTADWARLPYDLMEKISTRIVNEVKGVNRVVYDITSKPPGTIEWE 510
>gi|194467107|ref|ZP_03073094.1| GMP synthase, large subunit [Lactobacillus reuteri 100-23] >gi|194454143|gb|EDX43040.1| GMP synthase, large subunit [Lactobacillus reuteri 100-23] (517 aa)
Score = 1360, Expect = 4.2e-148, Identities = 265/510 (51%), Positives = 359/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE--LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKI++LDFG QY QLI RR+RD  +YSE++ + ++ +EI + NPKGII SGG +SVY   + K +  I+ L IPILGICYG Q+M  + GG+VE   D+ EYG  DI +  +E  LF+ +      WMSH D V   P GF+V A++  C +AS  + ++KFYGVQFHPEV  + +G  +L+ F + +C    +W   +    +I+EI+  V D  V+  +SGGVDS V AVL  +AIGD+L C+FVDHGLLRKNE+ +V   L + +G NI  VD    FL KL+GV DPEQKRKIIGK FIEVF + A KI     +L QGT+Y D++ESG+  ++TIKSHHNVGGLP++L F+L+EPL+ LFKDE R+LG  L IP++ V+RQPFPGPGL +RV+GEIT +KLEIVRE+D + R  I +   + E   WQYFTVL   +SVGV+GD R+Y Y +A+RAV S+D M+A + KIP + L+KIS  I N+V +++R++YD+T+KPP TIE+E
  S:    10 DKIIVLDFGSQYNQLITRRLRDFGIYSELLSHKLTADEIKEINPKGIIFSGGPNSVYDPNAFKVDPEIFKLGIPILGICYGMQLMSYDLGGKVEK-ADNSEYGRADIEVLDDEAVLFKGLPKKQYVWMSHGDLVTQAPAGFEVTATSKNCPIASIADNDRKFYGVQFHPEVRNSEYGLDILRRFAFDVCGAKANWTMDDFIDMQIDEIRKEVGDKKVILGLSGGVDSSVTAVLIHKAIGDQLTCIFVDHGLLRKNEANQVMDALSRDLGVNIIKVDAADRFLGKLEGVTDPEQKRKIIGKEFIEVFNEEAKKIK-DADFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPKKLGFKLIEPLRKLFKDETRELGEKLGIPHELVWRQPFPGPGLGIRVIGEITPEKLEIVRESDAILREEIKKAGLDEE--IWQYFTVLPGIRSVGVMGDGRTYDYAVAIRAVTSIDGMTADFAKIPWDILQKISVRIVNEVDHVNRILYDVTSKPPSTIEYE 517
>gi|116627714|ref|YP_820333.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus thermophilus LMD-9] >gi|116100991|gb|ABJ66137.1| GMP synthase (glutamine-hydrolyzing) [Streptococcus thermophilus LMD-9] (520 aa)
Score = 1357, Expect = 1.0e-147, Identities = 261/511 (51%), Positives = 357/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + KI++LD+G QY QLIARRIR+  V+SE+  + I+ +E+   NP GIILSGG +SVY + +   ++ I++L IPILGICYG Q++  + GG+V    +  + EYG + +RL   +ELF     +    MSH D+V  +P+GF ++A +  C  A+  + +K FYG+QFHPEV  T +GN +L+NF +SIC   GDW   N    +I +I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK ES +V  +L    G NI  VD  + FL  L GV DPE+KRKIIG  F+ VF+  A+K+     +L QGT+Y DI+ESG++ ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG  L +P + V+RQPFPGPGLA+R++GEITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + K+P E L+KIS  I N+V++++R+VYDIT+KPP T+EWE
  S:    10 VQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITADEVRAINPIGIILSGGPNSVYAEDAFGIDEEIFELGIPILGICYGMQLLTHKLGGKVVPAGEAGNREYGQSTLRLRAQSELFAGTPEEQVVLMSHGDAVTEIPEGFHLVADSVDCPFAAMEDTKKNFYGIQFHPEVRHTVYGNDILKNFAFSICGAKGDWSMANFVDMQIAQIRETVGDRKVLLGLSGGVDSSVVGVLLQKAIGDQLTCIFVDHGLLRKGESDQVMEMLGGKFGLNIIRVDASKRFLDLLAGVDDPEKKRKIIGNEFVHVFDDEASKLK-GVDFLAQGTLYTDIIESGTETAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGTELGMPDEVVWRQPFPGPGLAIRIMGEITEEKLETVRESDAILREEIAK--AGLDRDVWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAKLPWEVLQKISVRIVNEVEHVNRIVYDITSKPPATVEWE 520
>gi|89896684|ref|YP_520171.1| bifunctional GMP synthase/glutamine amidotransferase protein [Desulfitobacterium hafniense Y51] >gi|89336132|dbj|BAE85727.1| hypothetical protein [Desulfitobacterium hafniense Y51] (510 aa)
Score = 1356, Expect = 1.2e-147, Identities = 260/508 (51%), Positives = 357/508 (70%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L+LDFGGQY QLIARR+R+ +VYSE++ Y   +EEI  +NPKGII SGG  SV  + + K ++ I++L IPI GICYG Q+M  + GG+V +  +  EYG   + +   + L++ +  +  CWMSH DSV  LP+GF + A T+   VA+  +  + FYGVQFHPEV  T  G  +L++F++ IC   G+W  ++    +++ I+  V +  VLCA+SGGVDS VAAVL  +AIGD+L CVFVDHG +RKNE ++V  +  +     +  VD ++ F++K+ GV DPE KR  IG  FI +FE  A K+     +L+QGT+YPDIVESG+  ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR++G  L IP + V+RQPFPGPGLA+R++GE+TE+KL+I+READ +    I    LYK    + WQ F VL   KSVGV+GD R+Y Y + +RAV S DAM+A W ++P + +EKIS+ I N+VK ++RVVYDIT+KPPGTIEWE
  S:     6 VLVLDFGGQYNQLIARRVREAHVYSEMISYKTPVEEIKARNPKGIIFSGGPASVNQEGAPKVDEAIYELGIPIFGICYGMQLMTVQLGGKVMH-PEVREYGKAMLHVDQAKGLWKGLGGERQCWMSHGDSVTELPEGFVIAAHTDHTPVAAMTDETRHFYGVQFHPEVKHTPDGQAMLKHFLFDICGCHGEWTMESFIDAQVKAIREKVGERQVLCALSGGVDSSVAAVLVHKAIGDQLTCVFVDHGFMRKNEPEQVKKIFTEQFHLKLIFVDARERFMAKIGGVSDPETKRIGIGNEFIRLFEDEARKLG-QIDFLVQGTLYPDIVESGTDTAETIKSHHNVGGLPEDMQFELIEPLDMLFKDEVREVGAELGIPDEIVWRQPFPGPGLAIRIIGEVTEEKLDILREADAVIVEEIRNAGLYK----EVWQSFAVLPTIKSVGVMGDGRTYAYPIVVRAVTSEDAMTADWARLPYDLMEKISTRIVNEVKGVNRVVYDITSKPPGTIEWE 510
>gi|169824011|ref|YP_001691622.1| GMP synthase [Finegoldia magna ATCC 29328] >gi|167830816|dbj|BAG07732.1| GMP synthase [Finegoldia magna ATCC 29328] (510 aa)
Score = 1356, Expect = 1.3e-147, Identities = 273/508 (53%), Positives = 365/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPW-QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++++DFGGQY QLIARR+RDLNVY E+V Y  +++ I +K P GII +GG +SVY + S +  K I++LNIPILG+CYG Q++ ++ GG VE  K+  E+G T+ +++  + + + +  ++  WMSH+D V   P+GF +I +T+ C VA+  N +KK + VQ+HPEV  T  G  L++NF+Y IC   GDW  +N   E+I++I+  V D  VL A+SGGVDS V A L ++AIG  L CVFVDHGL+RKNE  EV A  K     N   V+ K  FL+KLKGV DPEQKRKIIG+ FI VFE  A KI     +L QGTIYPD++ESG   +  IKSHHNVGGLP+ + F +L+EPL+ LFKDEVR+LGL L++P   VYRQPFPGPGL +RV+GEITE+KLE++READF+FR   D++ K    K   QYF V+TN+++VGV+GD R+Y YTLALRAV + D M+A W +IP E L+K S  I N+V +I+R+VYDIT+KPP TIEWE
  S:     6 VIVVDFGGQYNQLIARRVRDLNVYCEVVPYKKALDVIKEKQPIGIIFTGGPNSVYEENSPQIEKEIFELNIPILGMCYGMQLISKDFGGVVEKAKN-REFGKTNAKISNQSSILKGMSDESIVWMSHTDFVSEKPEGFDIIQTTDSCPVAAIANEDKKIFAVQYHPEVNHTVEGKTLIKNFLYEICKADGDWTMENFLEEQIQKIRKTVGDKKVLLALSGGVDSSVCAALLSRAIGKNLTCVFVDHGLMRKNEGDEVEAAFKN-DELNFVRVNAKDRFLNKLKGVSDPEQKRKIIGEEFIRVFEDEAKKIG-SVDFLAQGTIYPDVIESGQGDASVIKSHHNVGGLPDVVDFKDLIEPLRDLFKDEVRRLGLELEMPEYLVYRQPFPGPGLGIRVMGEITEEKLEVLREADFIFR---DEVAKAGIDKDINQYFAVITNNRTVGVMGDFRTYDYTLALRAVTTTDFMTADWARIPYEVLDKTSVRIINEVDHINRIVYDITSKPPATIEWE 510
>gi|111610209|gb|ABH11596.1| GMP synthase/glutamine amidotransferase [Lactobacillus helveticus CNRZ32] (525 aa)
Score = 1355, Expect = 1.9e-147, Identities = 263/510 (51%), Positives = 360/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT--NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKI++LDFG QY QLI RRIRD  +YSE++ +D+SI +I + +PKGII SGG +SVY D ++K +  I+ L IPILGICYG Q+M  + GG+VE   +++EYG  +I +    + LF+ +      WMSH D V   P GF+V AS+  C +A+  N +KKFYG+QFH EV  + +G  +L++F + +C    +W   +    K+++I+  V D  V+  +SGGVDS V A L  +AIGD+L  +FVDHG+LRK+E  +V   L K +G NI  V+ ++ FL KLKGV DPEQKRKIIGK FIEVF + A K+    K+L QGT+Y D++ESG+  ++TIKSHHNVGGLP+ + F+L+EPL+ LFKDEVR+LG  L IP+  V+RQPFPGPGL +RVLGE+TEDKL+IVR++D + R  I +     + K WQYFTVL   +SVGV+GD R+Y YT+ +RAV S+D M+A + +IP + L  IS  I N+V N++RVVYD+T+KPP TIEWE
  S:    18 DKIIVLDFGSQYNQLITRRIRDFGIYSELLPHDLSIAKIKEMHPKGIIFSGGPNSVYDDGALKVDPEIFKLGIPILGICYGMQLMSYDLGGKVEQ-AENKEYGRANITVEDPDSALFKGLPSKQYVWMSHGDLVTKAPNGFEVAASSKNCPIAAIANPDKKFYGIQFHAEVRNSEYGLDILKHFAFDVCGADANWTMNDFIDMKVDDIRKEVGDKKVILGLSGGVDSSVTATLLHKAIGDQLTAIFVDHGMLRKDEGDQVMQALNKDLGVNIIRVNAQKRFLDKLKGVTDPEQKRKIIGKEFIEVFNEEAKKLK-DVKFLAQGTLYTDVIESGTNTAQTIKSHHNVGGLPKDMHFKLIEPLRKLFKDEVRELGERLGIPHDLVWRQPFPGPGLGIRVLGEVTEDKLKIVRDSDAILREEIKK--AGLQEKIWQYFTVLPGIRSVGVMGDGRTYDYTIGIRAVTSIDGMTADFAQIPWDVLGHISDRIVNEVDNVNRVVYDVTSKPPSTIEWE 525
>gi|188997529|ref|YP_001931780.1| GMP synthase, large subunit [Sulfurihydrogenibium sp. YO3AOP1] >gi|188932596|gb|ACD67226.1| GMP synthase, large subunit [Sulfurihydrogenibium sp. YO3AOP1] (511 aa)
Score = 1353, Expect = 2.5e-147, Identities = 270/508 (53%), Positives = 355/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QYTQLIARRIR+LNVYSEI+ ++ S+EEI+K NPKGII SGG  SVY   + KP++ ++DL +PILGICYG Q++    GG+V    D  EYG  ++ +  +E LF NI      WMSH+D VI LP+GF+VI  T     A+  N+EKK +GVQFHPEV+ T  G ++L+NF   IC    DW   N  +EK  EI+ +V D   +CA+SGGVDS VAAVL   AIGD L C+FVD+GLLRK E ++V    +     ++ +VD K  FL  LKG+ DPEQKRKIIG  FIEVFE+ A K+    +YL+QGT+YPD++ES S    S  IK+HHNVGGLPER+  +L+EPL+ LFKDEVR+LG  L +P + +YRQPFPGPGLA+RV+GE+ E+ L I+READ +    I +  LYK+     WQ F VL    +VGV+GD R+Y   +A+RAV+S D M+A W ++P + L+ +   I N+VK ++RVVYDI++KPP TIEWE
  S:     5 IVILDFGSQYTQLIARRIRELNVYSEILPFNASVEEILKHNPKGIIFSGGPASVYEPDAPKPDEKVYDLGLPILGICYGLQLITHHFGGEVIK-ADKHEYGKAELEVLDHEDLFYNIPHYTQVWMSHADKVIKLPEGFEVIGRTFNAPFAAVRNKEKKIWGVQFHPEVSHTLLGKEMLKNFAVRICKCKQDWTMGNFLMEKQVEIRKMVGDKKAICALSGGVDSSVAAVLVHNAIGDNLTCIFVDNGLLRKGEREQVEKTFRDNFHISLIVVDAKDRFLKALKGITDPEQKRKIIGNLFIEVFEEEAKKLK-DVEYLVQGTLYPDVIESVSVKGPSAVIKTHHNVGGLPERMNLKLIEPLRELFKDEVRELGKELGLPEEIIYRQPFPGPGLAIRVIGEVNENDLNILREADAIVLEEIKKAGLYKDL----WQSFAVLLPIYTVGVMGDYRTYEKVIAIRAVESTDGMTADWARLPYDLLDTMMRRIINEVKGVNRVVYDISSKPPATIEWE 511
>gi|69247008|ref|ZP_00604209.1| GMP synthase, C-terminal:GMP synthase, N-terminal [Enterococcus faecium DO] >gi|68194993|gb|EAN09459.1| GMP synthase, C-terminal:GMP synthase, N-terminal [Enterococcus faecium DO] (537 aa)
Score = 1353, Expect = 3.1e-147, Identities = 262/509 (51%), Positives = 354/509 (69%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE--LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI--NVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KI++LD+G QY QLI RRIR+  V+SE++ + I+ EE+   NPKGIILSGG +SVY +++   ++ I+DL IP+LGICYG Q++  + GG+V+  K+  EYG  ++ +T+ E  LF+N       WMSH D V   P  F V+A++  C +AS  N E+K YG+QFH EV  + +GN LL++F   +C   GDW   N    +I +I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDH LLRK E+++V   L    G NI  VD K+ FLSKL GV DPE+KRKIIG  F+ VF+  A K+       +L QGT+Y D++ESG++ ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR+LG  L +P   V+RQPFPGPGL +RVLGE+TE+KLEIVRE+D + R  I       +   WQYFTVL   +SVGV+GD R+Y YT+ +RAV S+D M+A + +IP E L+KIS  I N+V +++R+VYDIT+KPP T+EWE
  S:    28 KIIVLDYGSQYNQLITRRIREFGVFSELMSHRITAEEVKAMNPKGIILSGGPNSVYDEKAFGIDEKIFDLGIPVLGICYGMQLITYKLGGKVKPAKN-REYGKAELEITSAEAALFQNTPEKQTVWMSHGDLVTQAPTDFDVVATSKDCPIASIQNAERKMYGIQFHAEVRHSEYGNDLLRHFTLDVCQCTGDWTMDNFIDMEIAKIREQVGDKKVLLGLSGGVDSSVVGVLLQKAIGDQLTCIFVDHVLLRKGEAEQVMESLGGKFGLNIIKVDAKERFLSKLAGVSDPEEKRKIIGNEFVYVFDDEATKLAGEEGVSFLAQGTLYTDVIESGTETAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRELGTQLGMPDSIVWRQPFPGPGLGIRVLGELTEEKLEIVRESDAILREEIAN--AGLDRDIWQYFTVLPGIRSVGVMGDGRTYDYTVGIRAVTSIDGMTADFARIPWEVLQKISVRIVNEVAHVNRIVYDITSKPPATVEWE 537
>gi|37522184|ref|NP_925561.1| bifunctional GMP synthase/glutamine amidotransferase protein [Gloeobacter violaceus PCC 7421] >gi|44887933|sp|Q7NHC2|GUAA_GLOVI GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|35213184|dbj|BAC90556.1| GMP synthetase [Gloeobacter violaceus PCC 7421] (551 aa)
Score = 1351, Expect = 5.3e-147, Identities = 258/510 (50%), Positives = 352/510 (69%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + + ILDFG QY++LIARRIR+  VYSE++ Y   I EI +  PKGIILSGG +SVY   + + +  +W+L IPILG+CYG Q+M+Q+ GG VE   +  EYG   + +    +LF N+E     WMSH+DSV+ +P+GF+++A T     A+  +  +  YGVQFHPEV  +  G  LL+NFVY IC    +W       E I E+++ V D  VL A+SGGVDS   A L  +AIGD L C+F+D G +RKNE + +  L K+     +  VD  + F+ +L+GV DPEQKRKIIG  FI VFE  + ++  PF YL QGT+YPDI+ES         G + +  IKSHHNVGGLPE L+F+L+EPLK LFKDEVR++G +L +P + V RQPFPGPGLA+RVLGE+T+DK++I+READF+ R  +++  + +++  WQ F VL   K+VGV+GD R+Y Y LALR V S D M+A W ++P + LE+I++ I N+V  I+RVV DIT+KPPGTIEWE
  S:    36 EMVAILDFGSQYSELIARRIRETKVYSEVLSYQTPIAEIRRLAPKGIILSGGPNSVYEAYAPQCDPALWELGIPILGVCYGMQLMVQQLGGAVER-AERAEYGKASLFINDPTDLFTNVEDGTTMWMSHADSVLRMPEGFELLAHTENTPCAAIAHHSRHLYGVQFHPEVVHSRGGMALLRNFVYHICGCEPEWTTAAFIEEAIREVRARVGDKRVLLALSGGVDSSTLAFLLHRAIGDNLTCMFIDQGFMRKNEPERLVKLFKEQFHIPVAYVDAAERFIVRLEGVSDPEQKRKIIGAEFIRVFESESQRLG-PFDYLAQGTLYPDIIESAGENIDPKTGERVAVKIKSHHNVGGLPENLRFKLVEPLKRLFKDEVRQVGRALGLPEEIVQRQPFPGPGLAIRVLGELTKDKVDILREADFILRQEVNRSGRYNDY--WQSFAVLLPVKTVGVMGDRRTYAYALALRFVTSEDGMTADWARVPYDLLEQIANRIVNEVPGINRVVLDITSKPPGTIEWE 551
>gi|148544824|ref|YP_001272194.1| bifunctional GMP synthase/glutamine amidotransferase protein [Lactobacillus reuteri F275] >gi|184154165|ref|YP_001842506.1| GMP synthase [Lactobacillus reuteri F275] >gi|148531858|gb|ABQ83857.1| GMP synthase (glutamine-hydrolyzing) [Lactobacillus reuteri F275] >gi|183225509|dbj|BAG26026.1| GMP synthase [Lactobacillus reuteri F275] (517 aa)
Score = 1350, Expect = 6.8e-147, Identities = 264/510 (51%), Positives = 357/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE--LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKI+ LDFG QY QLI RR+RD  +YSE++ + ++ +EI + NPKGII SGG +SVY   + K +  I+ L IPILGICYG Q+M  + GG+VE   D+ EYG  DI +  +E  L + +      WMSH D V   P GF+V A++  C +AS  + ++KFYGVQFHPEV  + +G  +L+ F + +C    +W   +    +I+EI+  V D  V+  +SGGVDS V AVL  +AIGD+L C+FVDHGLLRKNE+ +V   L + +G NI  VD    FL KL+GV DPEQKRKIIGK FIEVF + A KI     +L QGT+Y D++ESG+  ++TIKSHHNVGGLP++L F+L+EPL+ LFKDE R+LG  L IP++ V+RQPFPGPGL +RV+GEIT +KLEIVRE+D + R  I +   + E   WQYFTVL   +SVGV+GD R+Y Y +A+RAV S+D M+A + KIP + L+KIS  I N+V +++R++YD+T+KPP TIE+E
  S:    10 DKIIALDFGSQYNQLITRRLRDFGIYSELLSHKLTADEIKEINPKGIIFSGGPNSVYDPNAFKVDPEIFKLGIPILGICYGMQLMSYDLGGKVEK-ADNSEYGRADIEVLDDEAVLLKGLPKKQYVWMSHGDLVTQAPAGFEVTATSKNCPIASIADNDRKFYGVQFHPEVRNSEYGLDILRRFAFDVCGAKANWTMDDFIDMQIDEIRKEVGDKKVILGLSGGVDSSVTAVLIHKAIGDQLTCIFVDHGLLRKNEADQVMDALSRDLGVNIIKVDAADRFLGKLEGVTDPEQKRKIIGKEFIEVFNEEAKKIK-DADFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPKKLGFKLIEPLRKLFKDETRELGEKLGIPHELVWRQPFPGPGLGIRVIGEITPEKLEIVRESDAILREEIKKAGLDEE--IWQYFTVLPGIRSVGVMGDGRTYDYAVAIRAVTSIDGMTADFAKIPWDILQKISVRIVNEVDHVNRILYDVTSKPPSTIEYE 517
>gi|55820926|ref|YP_139368.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus thermophilus LMG 18311] >gi|81560671|sp|Q5M4P4|GUAA_STRT2 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|55736911|gb|AAV60553.1| GMP synthase [Streptococcus thermophilus LMG 18311] (527 aa)
Score = 1350, Expect = 7.0e-147, Identities = 260/511 (50%), Positives = 355/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + KI++LD+G QY QLIARRIR+  V+SE+  + I+ +E+   NP GIILSGG +SVY + +   ++ I++L IPILGICYG Q++  + GG+V    +  + EYG + +RL   +ELF     +    MSH D+V  +P+GF ++A +  C  A+  + +K FYG+QFHPEV  T +GN +L+NF +SIC   GDW   N    +I +I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E  +V  +L    G NI  VD  + FL  L GV DPE+KRKIIG  F+ VF+  A+K+     +L QGT+Y DI+ESG++ ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG  L +P + V+RQPFPGPGLA+R++GEITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + K+P E L+KIS  I N+V +++R+VYDIT+KPP T+EWE
  S:    17 VQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITADEVRAINPIGIILSGGPNSVYAEDAFGIDEEIFELGIPILGICYGMQLLTHKLGGKVVPAGEAGNREYGQSTLRLRAQSELFAGTPEEQVVLMSHGDAVTEIPEGFHLVADSVDCPFAAMEDTKKNFYGIQFHPEVRHTVYGNDILKNFAFSICGAKGDWSMANFVDMQIAQIRETVGDRKVLLGLSGGVDSSVVGVLLQKAIGDQLTCIFVDHGLLRKGEGDQVMEMLGGKFGLNIIRVDASKRFLDLLAGVDDPEKKRKIIGNEFVHVFDDEASKLK-GVDFLAQGTLYTDIIESGTETAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGTELGMPDEVVWRQPFPGPGLAIRIMGEITEEKLETVRESDAILREEIAK--AGLDRDVWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAKLPWEVLQKISVRIVNEVDHVNRIVYDITSKPPATVEWE 527
>gi|195953020|ref|YP_002121310.1| GMP synthase, large subunit [Hydrogenobaculum sp. Y04AAS1] >gi|195932632|gb|ACG57332.1| GMP synthase, large subunit [Hydrogenobaculum sp. Y04AAS1] (507 aa)
Score = 1349, Expect = 7.3e-147, Identities = 285/508 (56%), Positives = 350/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +LI+ FG QY QLIAR++R+L VYSEIV  DI IEEII K P  +I SGG  SVY   + K +K I++L IP+LGICYG Q++  E GG VE   D  EYG   +    N  F+NI      WMSH+D V  LPK F+ I  ++    A   +     YGVQFH EV  T +G ++L NF++ I     +W  K+ K  KIEEI+  V +  V+CAISGGVDS VAAVLT +AIGDKL C+FVDHGLLRKNES+EV + L KL G NI  +D+  LFL KLK V DPEQKRKIIG TFIE+FE+ A K N  F  LLQGT+YPD+VES G   S  IKSHHNVGGLPE++  +LLEPL+ LFKDEVR LGL LD+P   VYR PFPGPGLA+R++G++ E+ L I+READ +F   I++L K N   K WQ   VL   KSVGV+GDNR+YG  LALRAVDS D M+A+  K+P E LE +   I  +VK I+RVVYDI++KPP TIEWE
  S:     5 VLIVSFGSQYVQLIARKVRELGVYSEIVLPDIDIEEIITKKPCALIFSGGPYSVYEKNAPKLDKKIYELGIPVLGICYGHQLIAYEFGGIVEK-SDKHEYGKAYLDFKPNIFFKNIPQHTVVWMSHADKVSTLPKDFESIGFSDNSENAVIKHNHFPIYGVQFHLEVYHTEYGKEMLSNFLFDIAKCHQNWNMKSFKEHKIEEIRVTVGNKKVICAISGGVDSAVAAVLTHKAIGDKLTCIFVDHGLLRKNESKEVISNLTKL-GLNIVALDRSNLFLEKLKNVEDPEQKRKIIGNTFIEIFEEEAKKYNAEF--LLQGTLYPDLVESAGIHGSAKIKSHHNVGGLPEKMNLKLLEPLRELFKDEVRALGLELDLPKDMVYRHPFPGPGLAIRIIGDVKEEDLNILREADAIF---IEELKKWNLYDKTWQASAVLLPIKSVGVMGDNRTYGKVLALRAVDSQDGMTAEPSKLPYEFLEHVMRRIIQEVKGINRVVYDISSKPPATIEWE 507
>gi|29374817|ref|NP_813969.1| bifunctional GMP synthase/glutamine amidotransferase protein [Enterococcus faecalis V583] >gi|44887950|sp|Q839J8|GUAA_ENTFA GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|29342275|gb|AAO80041.1| GMP synthase [Enterococcus faecalis V583] (520 aa)
Score = 1349, Expect = 7.6e-147, Identities = 260/511 (50%), Positives = 350/511 (68%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI--NVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++KI++LDFG Q+ QLI RRIR+  V+SE++ +  + EEI K  PKGII SGG +SVY   +   +  I++L IPILGICYG Q+M    GG+VE   +  EYG  ++ +  +  LF+        WMSH D V  +  GF+ + ++N C +AS  +  +KFYGVQFHPEV  + +GN LL++F + +C   GDW  +N    ++ +I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+++V   L    G NI  VD K+ FLSKL GV DPEQKRKIIG  F+ VF+  A K+       +L QGT+Y D++ESG++ ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG  L +P   V+RQPFPGPGL +RVLGEITEDKL+IVR++D + R  I       +   WQYFTVL   +SVGV+GD R+Y YT+ +RAV S+D M+A + +IP + L+KIS  I N+V +++R+VYDIT+KPP T+EWE
  S:    10 VEKIIVLDFGSQFNQLITRRIREFGVFSELLSHRTTAEEIRKIAPKGIIFSGGPNSVYDKDAFSIDPEIYELGIPILGICYGMQLMTHNLGGKVEPAAN-REYGKAELEILGDATLFQGTPAKQTVWMSHGDLVTEIAPGFEKVGTSNDCPIASIEDANRKFYGVQFHPEVRHSEYGNDLLRHFAFDVCGCTGDWSMENFIDMEVAKIREQVGDKKVLLGLSGGVDSSVVGVLLQKAIGDQLTCIFVDHGLLRKGEAEQVMESLGGKFGLNIIKVDAKERFLSKLAGVSDPEQKRKIIGNEFVYVFDDEATKLAGEEGVSFLAQGTLYTDVIESGTETAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGTELGMPDAIVWRQPFPGPGLGIRVLGEITEDKLQIVRDSDAILREEIAA--AGLDRDIWQYFTVLPGIRSVGVMGDGRTYDYTVGIRAVTSIDGMTADFARIPWDVLQKISVRIVNEVAHVNRIVYDITSKPPATVEWE 520
>gi|13627050|sp|O85192|GUAA_LACRH GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|3483135|gb|AAC33274.1| GMP synthetase [Lactobacillus rhamnosus] (517 aa)
Score = 1348, Expect = 1.1e-146, Identities = 257/510 (50%), Positives = 361/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT--TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKI++LD+G QY QLI RRIR+  +YSE+  + I+  E+ K  PKGII SGG +SVY + ++  ++ I+ L IPILG+CYG Q+M Q  GG VE   D+ EYG  DI +T  + +LF ++  D   WMSH D V  +P GF+  A++  C +++  + ++KFYG+QFH EV  T +G+++L +F + +C    +W   +   ++I +I++ V D  VL  +SGGVDS V  VL  +AIG +L  +FVDHGLLRK E+++V   LK   G NI  V+ K  FL+ L+GV DPE+KRKIIG+ FIEVF + A K+N   ++L QGT+Y D+VESG+  ++TIKSHHNVGGLPE L+F+L+EPL  LFKDEVR+LG  L +P+  V+RQPFPGPGL +RV+GE+TEDKLEIVR++D++ R  I +     +   WQYFTVL   +SVGV+GD R+Y YT+ +RA+ S+D M+A + +I  + L++ISS I N+VK+++RVVYDIT+KPP TIEWE
  S:    10 DKIIVLDYGSQYNQLITRRIREFGIYSELKPHTITAAEVKKIAPKGIIFSGGPNSVYDEGALGVDEDIFKLGIPILGVCYGMQLMAQRLGGDVE-PADNREYGKADIEVTDASAKLFHDLPKDQTVWMSHGDLVTRVPDGFRTTATSVNCPISAMDDDDRKFYGIQFHAEVQNTQYGHEILHHFAFDVCHAEANWSMDDFITKQIAKIRAEVGDKRVLLGLSGGVDSSVVGVLLHKAIGTQLTSIFVDHGLLRKGEAEQVMDSLKGKFGLNIIKVNAKDRFLNDLRGVTDPEKKRKIIGRDFIEVFNEEAAKLN-GIEFLAQGTLYTDVVESGTDTAQTIKSHHNVGGLPEDLKFKLIEPLNKLFKDEVRELGEKLGMPHSLVWRQPFPGPGLGIRVIGEVTEDKLEIVRDSDYILREEIAK--HGLDKDIWQYFTVLPGIRSVGVMGDGRTYDYTIGIRAITSIDGMTADFARIDWDVLQEISSRIVNEVKHVNRVVYDITSKPPATIEWE 517
>gi|196189226|gb|EDX84190.1| glutamine amidotransferase, SNO family [Synechococcus sp. PCC 7335] (542 aa)
Score = 1347, Expect = 1.6e-146, Identities = 255/508 (50%), Positives = 353/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + ILDFG QY++LIARRIR+  VYSE++ Y  S E++ + NPKGIILSGG +SVY   +   +  IW+L IP+LG+CYG Q+M+Q+ GGQVE   +  EYG   + +    ++ +N+   +  WMSH+DSV  LP+GF+V+A T     A+  N +KKFYGVQFHPEV  +T G+ L++NFVY IC     W  +    E I E+++ V D  VL A+SGGVDS   A L  +AIG++L C+F+D G +RK E + +  +       N+  +D +  FL+K+KGV DPE+KRKIIG  FI+VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLPE L+F+L+EPL+ LFKDEVRK+G ++++P   V R PFPGPGLA+R+LGE+T ++L I+READ++ R  I +   +S H  WQ F VL   +SVGV+GD R+Y Y + LR V S D M+A W + P E LE IS+ + N+V+ ++RVVYDIT+KPPGTIEWE
  S:    29 LAILDFGSQYSELIARRIRETEVYSEVLSYRTSAEQLRQLNPKGIILSGGPNSVYDKGAPACDPEIWNLGIPVLGVCYGMQLMVQQLGGQVER-VERGEYGKASLLVDAGTDILKNVADASTMWMSHADSVTRLPEGFEVLAHTVNTPQAAIANHQKKFYGVQFHPEVVHSTEGSTLIRNFVYDICQCEPTWTTEAFVEEAIREVRAKVGDQRVLLALSGGVDSSTLAFLLHKAIGEQLTCMFIDQGFMRKREPERLIEIFNNRFHINVEYIDARDRFLAKIKGVTDPEEKRKIIGHEFIQVFEEESTRLG-PFDYLAQGTLYPDVIESADTNVDPSTGERVAVKIKSHHNVGGLPEDLRFKLIEPLRKLFKDEVRKVGTAVNLPEDIVRRHPFPGPGLAIRILGEVTAERLHILREADYIIRQEIRR--SDSYHDFWQAFGVLLPVRSVGVMGDQRTYAYPIVLRLVSSEDGMTADWSRAPYELLENISNRVVNEVEGVNRVVYDITSKPPGTIEWE 542
>gi|160878422|ref|YP_001557390.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clostridium phytofermentans ISDg] >gi|160427088|gb|ABX40651.1| GMP synthase, large subunit [Clostridium phytofermentans ISDg] (507 aa)
Score = 1346, Expect = 1.7e-146, Identities = 257/508 (50%), Positives = 358/508 (70%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +++LDFGGQY QLIARR+R+ NVY E++ Y+IS+E+I + NPKGII +GG  SVY + +   +KGI++L IP+LGICYG Q+M    GG V +  +  EYG T+I++ TT++LF+++  +  CWMSH+D +    +GF V +S++ C VA+    +KK Y VQFHPEV  T  G ++L+NF+Y +C+  GDW+  +   E I+ ++  + D  VLCA+SGGVDS VAAV+ ++A+G +L C+FVDHGLLRKNE  EV  +       N   V+ +Q F  +L GV DPE KRKIIG+ FI VFE+ A KI     +L QGTIYPD++ESG   S  IKSHHNVGGLPE + F E++EPL+ LFKDEVRK GL L IP + V+RQPFPGPGL +R++GE+T +++++V+EAD ++R  I       +    QYF  LTN +SVG +GD R+Y Y +ALRAV + D M+A++ ++P E L K+SS I N+VK ++RV+YD T KPP TIE+E
  S:     2 VIVLDFGGQYNQLIARRVRECNVYCEVMPYNISLEKIKELNPKGIIFTGGPASVYAEGAPHCDKGIFELGIPVLGICYGAQLMTHLLGGSVTS-AEVREYGKTEIKVNTTSKLFKDVAENTICWMSHTDHIKTPAEGFVVTSSSDSCPVAAVEMVDKKLYSVQFHPEVVHTQEGTKMLRNFLYEVCECNGDWKMASFTEESIQALRDKIGDKKVLCALSGGVDSSVAAVMISKAVGKQLTCIFVDHGLLRKNEGDEVEQIFTTQFDVNFVRVNAQQRFYDRLAGVTDPETKRKIIGEEFIRVFEEEAKKIGT-VDFLAQGTIYPDVIESGLGKSAVIKSHHNVGGLPEHVDFKEIVEPLRLLFKDEVRKAGLELGIPEKLVFRQPFPGPGLGIRIIGEVTPERIKLVQEADAIYREEIAN--AGLDRSIGQYFAALTNMQSVGCMGDERTYDYAIALRAVTTTDFMTAEFAELPWELLGKVSSRIVNEVKGVNRVLYDCTGKPPATIEFE 507
>gi|116495445|ref|YP_807179.1| bifunctional GMP synthase/glutamine amidotransferase protein [Lactobacillus casei ATCC 334] >gi|191638913|ref|YP_001988079.1| GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) [Lactobacillus casei] >gi|116105595|gb|ABJ70737.1| GMP synthase (glutamine-hydrolyzing) [Lactobacillus casei ATCC 334] >gi|190713215|emb|CAQ67221.1| GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) [Lactobacillus casei BL23] (517 aa)
Score = 1346, Expect = 1.7e-146, Identities = 259/510 (50%), Positives = 360/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN--ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKI++LD+G QY QLI RRIR+  +YSE+  + I+  E+ K  PKGII SGG +SVY + ++  ++ ++ L IPILG+CYG Q+M Q  GG VE   D+ EYG  DI +T +  +LF ++  D   WMSH D V  +P+GF+  A++  C +++  + ++KFYG+QFH EV  T +G+++L +F + IC    +W   +   ++I++I++ V D  VL  +SGGVDS V  VL  +AIG +L  +FVDHGLLRK E+ +V   LK   G NI  V+ K  FL  LKGV DPE+KRKIIG+ FIEVF + A K+N    +L QGT+Y D+VESG+  ++TIKSHHNVGGLPE L+F+L+EPL  LFKDEVR+LG  L +P+  V+RQPFPGPGL +RV+GE+TEDKLEIVR++D++ R  I +     +   WQYFTVL   +SVGV+GD R+Y YT+ +RA+ S+D M+A + +I  + L++ISS I N+VKN++RVVYDIT+KPP TIEWE
  S:    10 DKIIVLDYGSQYNQLITRRIREFGIYSELKPHTITAAEVKKIAPKGIIFSGGPNSVYDEGALGVDEDLFKLGIPILGVCYGMQLMAQRLGGDVE-PADNREYGKADIEVTDDSAKLFRDLPKDQTVWMSHGDLVTRVPEGFRRTATSINCPISAMDDDDRKFYGIQFHAEVQNTQYGHEILHHFAFDICKAEANWSMDDFITKQIDKIRAEVGDKRVLLGLSGGVDSSVVGVLLHKAIGTQLTSIFVDHGLLRKGEADQVMESLKGKFGLNIIKVNAKDRFLGDLKGVTDPEKKRKIIGRDFIEVFNEEAAKLN-GIDFLAQGTLYTDVVESGTDTAQTIKSHHNVGGLPEDLKFKLIEPLNKLFKDEVRELGEKLGMPHALVWRQPFPGPGLGIRVIGEVTEDKLEIVRDSDYILREEIAK--HGLDKDIWQYFTVLPGFRSVGVMGDGRTYDYTIGIRAITSIDGMTADFARINWDVLQEISSRIVNEVKNVNRVVYDITSKPPATIEWE 517
>gi|55822848|ref|YP_141289.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus thermophilus CNRZ1066] >gi|81559474|sp|Q5M029|GUAA_STRT1 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|55738833|gb|AAV62474.1| GMP synthase [Streptococcus thermophilus CNRZ1066] (527 aa)
Score = 1346, Expect = 1.9e-146, Identities = 259/511 (50%), Positives = 355/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + KI++LD+G QY QLIARRIR+  V+SE+  + I+ +E+   NP GIILSGG +SVY + +   ++ I++L IPILGICYG Q++  + GG+V    +  + EYG + +RL   +ELF     +    MSH D+V  +P+GF ++A +  C  A+  + +K FYG+QFHPEV  T +GN +L+NF +SIC   GDW   N    +I +I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E  +V  +L    G NI  VD  + FL  L GV DP++KRKIIG  F+ VF+  A+K+     +L QGT+Y DI+ESG++ ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG  L +P + V+RQPFPGPGLA+R++GEITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + K+P E L+KIS  I N+V +++R+VYDIT+KPP T+EWE
  S:    17 VQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITADEVRAINPIGIILSGGPNSVYAEDAFGIDEEIFELGIPILGICYGMQLLTHKLGGKVVPAGEAGNREYGQSTLRLRAQSELFAGTPEEQVVLMSHGDAVTEIPEGFHLVADSVDCPFAAMEDTKKNFYGIQFHPEVRHTVYGNDILKNFAFSICGAKGDWSMANFVDMQIAQIRETVGDRKVLLGLSGGVDSSVVGVLLQKAIGDQLTCIFVDHGLLRKGEGDQVMEMLGGKFGLNIIRVDASKRFLDLLAGVDDPDKKRKIIGNEFVHVFDDEASKLK-GVDFLAQGTLYTDIIESGTETAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGTELGMPDEVVWRQPFPGPGLAIRIMGEITEEKLETVRESDAILREEIAK--AGLDRDVWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAKLPWEVLQKISVRIVNEVDHVNRIVYDITSKPPATVEWE 527
>gi|89094123|ref|ZP_01167066.1| bifunctional GMP synthase/glutamine amidotransferase protein [Oceanospirillum sp. MED92] >gi|89081598|gb|EAR60827.1| bifunctional GMP synthase/glutamine amidotransferase protein [Oceanospirillum sp. MED92] (526 aa)
Score = 1345, Expect = 2.1e-146, Identities = 266/509 (52%), Positives = 356/509 (69%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN--ELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFS---KTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY EI  +D+S E+I +  PKG+IL+GG +SV    S +  + ++DL++P+LGICYG Q M  + GG+V    D  E+G   +RL ++   L E IE        L  + WMSH D V  LP+GF VIAST    +A+ C+ EK+F+GVQFHPEVT T  G ++L+ FV  IC     W   NI  ++IE+++  V +  VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLRK E  +V  +  K +G  +   D + LFL +L+G  DPE+KRKIIG TFIEVF+  A K++    +L QGTIYPD++ES +  +     IKSHHNVGGLPE +QFEL+EPL+ LFKDEVRKLGL L +PY  VYR PFPGPGL VR+LGE+ ++  +I+READ +F   I++L+K +  HK  Q F V    KSVGVVGD R Y Y +A+RAV+++D M+A+W  +P E LE +SS I N++  +SRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCEIHAWDMSEEDIREFAPKGVILAGGPESVTEGDSPRAPEVVFDLDVPVLGICYGMQTMAAQMGGEVST-SDKREFGYAQVRLESSPSRLLEGIEDHVANNGSLSLDVWMSHGDKVTALPEGFTVIASTESAPIAAMCHPEKQFFGVQFHPEVTHTKQGGRILERFVVEICGTEALWNSANIIKDQIEKVREQVGNQKVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRKQEGDQVMDMFAKNMGVRVIRADAEDLFLGRLEGENDPEKKRKIIGNTFIEVFDDEATKLS-DVNFLAQGTIYPDVIESAAAKTGKAHVIKSHHNVGGLPEDMQFELVEPLRELFKDEVRKLGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADILREADAIF---IEELHKADWYHKTSQAFAVFLPVKSVGVVGDGRRYEYVIAIRAVETIDFMTARWAHLPYELLETVSSRIINEIPKVSRVTYDVSSKPPATIEWE 526
>gi|22537128|ref|NP_687979.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus agalactiae 2603V/R] >gi|25011007|ref|NP_735402.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus agalactiae NEM316] >gi|76788259|ref|YP_329683.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus agalactiae A909] >gi|76797788|ref|ZP_00780054.1| GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase) [Streptococcus agalactiae 18RS21] >gi|77405704|ref|ZP_00782791.1| GMP synthase [Streptococcus agalactiae H36B] >gi|77412429|ref|ZP_00788735.1| GMP synthase [Streptococcus agalactiae CJB111] >gi|44887960|sp|Q8E5M8|GUAA_STRA3 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|44888000|sp|Q8DZX7|GUAA_STRA5 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|91206833|sp|Q3K1C0|GUAA_STRA1 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|22533990|gb|AAM99851.1|AE014236_5 GMP synthase [Streptococcus agalactiae 2603V/R] >gi|23095407|emb|CAD46612.1| Unknown [Streptococcus agalactiae NEM316] >gi|76563316|gb|ABA45900.1| GMP synthase [Streptococcus agalactiae A909] >gi|76586864|gb|EAO63356.1| GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase) [Streptococcus agalactiae 18RS21] >gi|77161520|gb|EAO72525.1| GMP synthase [Streptococcus agalactiae CJB111] >gi|77175700|gb|EAO78482.1| GMP synthase [Streptococcus agalactiae H36B] (520 aa)
Score = 1342, Expect = 5.4e-146, Identities = 259/511 (50%), Positives = 356/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + KI++LD+G QY QLIARRIR+  V+SE+  + I+ +EI   NP GI+LSGG +SVY D +   ++ I++L IPILGICYG Q++  + GG+V    +    EYG + +RL + + LF     +    MSH D+V  +P+GF ++  +  C  A+  N EK+FYG+QFHPEV  + +GN +L+NF  +IC   GDW   N    +I +I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRKNE  +V  +L    G NI  VD  + FL  L GV DPE+KRKIIG  F+ VF+  A+K+     +L QGT+Y DI+ESG++ ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG +L +P + V+RQPFPGPGLA+RV+GEITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + ++P + L+KIS+ I N+V +++R+VYDIT+KPP T+EWE
  S:    10 IQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITADEIRDINPIGIVLSGGPNSVYADGAFGIDEEIFELGIPILGICYGMQLITHKLGGKVLPAGEAGHREYGQSALRLRSESALFAGTPQEQLVLMSHGDAVTEIPEGFHLVGDSVDCPFAAMENTEKQFYGIQFHPEVRHSVYGNDILKNFAVNICGARGDWSMDNFIDMEIAKIRETVGDRKVLLGLSGGVDSSVVGVLLQRAIGDQLTCIFVDHGLLRKNEGDQVMDMLGGKFGLNIIRVDASKRFLDLLSGVEDPERKRKIIGNEFVYVFDDEASKLK-GVDFLAQGTLYTDIIESGTETAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGTALGMPDEVVWRQPFPGPGLAIRVMGEITEEKLETVRESDAILREEIAK--AGLDRDVWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAQLPWDVLKKISTRIVNEVDHVNRIVYDITSKPPATVEWE 520
>gi|77408612|ref|ZP_00785347.1| GMP synthase [Streptococcus agalactiae COH1] >gi|77172805|gb|EAO75939.1| GMP synthase [Streptococcus agalactiae COH1] (520 aa)
Score = 1341, Expect = 7.0e-146, Identities = 259/511 (50%), Positives = 355/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + KI++LD+G QY QLIARRIR+  V+SE+  + I+ +EI   NP GI+LSGG +SVY D +   ++ I++L IPILGICYG Q++  + GG+V    +    EYG + +RL + + LF     +    MSH D+V  +P+GF ++  +  C  A+  N EK+FYG+QFHPEV  + +GN +L+NF  +IC   GDW   N    +I +I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRKNE  +V  +L    G NI  VD  + FL  L GV DPE+KRKIIG  F+ VF+  A+K+     +L QGT+Y DI+ESG++ ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG +L +P + V+RQPFPGPGLA+RV+GEITE+KLE VRE+D + R  I +     +   WQYFTV T   SVGV+GD R+Y YT+A+RA+ S+D M+A + ++P + L+KIS+ I N+V +++R+VYDIT+KPP T+EWE
  S:    10 IQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITADEIRDINPIGIVLSGGPNSVYADGAFGIDEEIFELGIPILGICYGMQLITHKLGGKVLPAGEAGHREYGQSALRLRSESALFAGTPQEQLVLMSHGDAVTEIPEGFHLVGDSVDCPFAAMENTEKQFYGIQFHPEVRHSVYGNDILKNFAVNICGARGDWSMDNFIDMEIAKIRETVGDRKVLLGLSGGVDSSVVGVLLQRAIGDQLTCIFVDHGLLRKNEGDQVMDMLGGKFGLNIIRVDASKRFLDLLSGVEDPERKRKIIGNEFVYVFDDEASKLK-GVDFLAQGTLYTDIIESGTETAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGTALGMPDEVVWRQPFPGPGLAIRVMGEITEEKLETVRESDAILREEIAK--AGLDRDVWQYFTVNTGVHSVGVMGDGRTYDYTIAIRAITSIDGMTADFAQLPWDVLKKISTRIVNEVDHVNRIVYDITSKPPATVEWE 520
>gi|167464930|ref|ZP_02330019.1| bifunctional GMP synthase/glutamine amidotransferase protein [Paenibacillus larvae subsp. larvae BRL-230010] (494 aa)
Score = 1341, Expect = 7.7e-146, Identities = 263/497 (52%), Positives = 351/497 (70%)
  Q:    15 QLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELF-ENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGK---NIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           QLIARRIRDL VYSE++ Y+  IE+I   NPKGI+ SGG +SVYG+ S   +  I+DL IPILGICYG Q++  +  G+V+      EYG ++I  T   L  + +      WMSH D V+ LP+GF + AST    +A+  +  K+   VQFHPEV  + +GN +++NF++ +C   G+W  ++   + I++I+  V D  VLCA+SGGVDS V AVL  +AIGD+L C+F+DHGLLRK+E++ V   ++  +GK    +  +D +  FL KL GV DPEQKRKIIG  FI VFE+ +  I   F +L QGT+Y DIVESG+  ++TIKSHHNVGGLPE ++FEL+EPLK LFKDEVRK+G    +P + V+RQPFPGPGLA+RVLGE+TE+KL IVRE+D + R  I +   +SE   WQYFT L N KSVGV+GD R+Y YT+ +RAV S+D M+A W +IP + LEKIS  I N+V+N++RVVYDIT+KPP TIEWE
  S:     1 QLIARRIRDLGVYSELMPYNTPIEKIKDLNPKGIVFSGGPNSVYGEDSPLVDPAIYDLGIPILGICYGMQLIAHQLKGKVQR-AGKREYGKSEIAFTPESLLAKGLGSKQVVWMSHGDHVVGLPEGFVIEASTEHAPIAAMSHPHKQIVAVQFHPEVRHSVYGNDMIKNFIFEMCQCHGEWTMESFIEDTIKDIREQVGDRKVLCALSGGVDSSVVAVLIHKAIGDQLTCMFIDHGLLRKDEAEGV---METFVGKFDMKVIKIDARDRFLGKLAGVEDPEQKRKIIGNEFIYVFEEESAHIG-EFDFLAQGTLYTDIVESGTDTAQTIKSHHNVGGLPEGMRFELIEPLKALFKDEVRKVGEECGLPREIVWRQPFPGPGLAIRVLGEVTEEKLHIVRESDAILREEIAKAGLDSE--IWQYFTALPNMKSVGVMGDARTYSYTVGIRAVTSIDGMTADWARIPYDVLEKISVRIVNEVENVNRVVYDITSKPPATIEWE 494
>gi|163790890|ref|ZP_02185314.1| bifunctional GMP synthase/glutamine amidotransferase protein [Carnobacterium sp. AT7] >gi|159873843|gb|EDP67923.1| bifunctional GMP synthase/glutamine amidotransferase protein [Carnobacterium sp. AT7] (516 aa)
Score = 1340, Expect = 9.4e-146, Identities = 258/511 (50%), Positives = 353/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE--LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++K+++LDFG QY QLI RRIR+  VYSE++ + ++ EE+   N KGII SGG  SVY + S   +  I+++ IPILGICYG Q+M    GG+VE   ++ EYG   I +   +  LF ++  +   WMSH D V  +P+GF V A++  C +AS  N +K F+ VQFHPEV  +  GN +L+NF + IC+  G+W   +    +I  I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK ES++V   L    G NI  VD K+ F++KL GV DPE KRKIIG  F+ VF+  A K++    +L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR+LG+ L +P   V+RQPFPGPGL +RV+GEITE+KLEIVR++D++ R  I       +   WQYFTVL   +SVGV+GD R+Y YT+ +RAV S+D M++ + +IP + L+KIS  I N+VK+++R+VYDIT+KPP TIEWE
  S:     8 VEKMIVLDFGSQYNQLITRRIREFGVYSELLSHKVTAEELRGMNAKGIIFSGGPMSVYDEGSFSVDPEIFNMGIPILGICYGMQLMTTALGGKVEG-SENREYGKASIAINDQKAPLFNSLAENETVWMSHGDLVTQVPEGFVVSATSPHCPIASMFNPKKNFHAVQFHPEVRHSEHGNDMLKNFTFDICECEGNWSIADFIESEIAIIRETVGDKKVLLGLSGGVDSSVVGVLLQKAIGDQLTCIFVDHGLLRKGESEQVMESLVGKFGLNIIRVDAKERFMAKLAGVSDPETKRKIIGNEFVYVFDDEATKLD-GVNFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPENMQFKLIEPLNTLFKDEVRELGIQLGMPESLVWRQPFPGPGLGIRVIGEITEEKLEIVRDSDYILREEIAA--AGLDRDIWQYFTVLPGFRSVGVMGDGRTYDYTIGIRAVTSIDGMTSDFARIPWDILQKISVRIVNEVKHVNRIVYDITSKPPSTIEWE 516
>gi|149011672|ref|ZP_01832868.1| GMP synthase, C-terminal domain [Streptococcus pneumoniae SP19-BS75] >gi|147764103|gb|EDK71035.1| GMP synthase, C-terminal domain [Streptococcus pneumoniae SP19-BS75] (520 aa)
Score = 1339, Expect = 1.1e-145, Identities = 260/511 (50%), Positives = 351/511 (68%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++KI++LD+G QY QLI+RRIR++ V+SE+  + IS  E+ + NP GIILSGG +SVY D S   +  I++L IPILGICYG Q++  + GG+V    D  + EYG + +  T + LFE+   +    MSH D+V  +P  F    ++  C  A+  N +K  YG+QFHPEV  + +GN +L+NF  +IC   GDW   N    +I++I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+ +V  +L    G NI   D  + FL KL GV DPEQKRKIIG  F+ VF+  A+K+    K+L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QFEL+EPL  L+KDEVR LG  L +P   V+RQPFPGPGLA+RV+GEITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + KIP E L+KIS  I N+V +++R+VYDIT+KPP T+EWE
  S:    11 VEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDIDPEIFELGIPILGICYGMQLLTHKLGGKVVPAGDAGNREYGQSTLTHTPSALFESTPDEQTVLMSHGDAVTEIPADFVRTGTSADCPYAAIENPDKHIYGIQFHPEVRHSVYGNDILRNFALNICKAKGDWSMDNFIDMQIKKIRETVGDKRVLLGLSGGVDSSVVGVLLQKAIGDQLICIFVDHGLLRKGEADQVMDMLGGKFGLNIVKADAAKRFLDKLAGVSDPEQKRKIIGNEFVYVFDDEASKLK-DVKFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEEMQFELIEPLNTLYKDEVRALGTELGMPDHIVWRQPFPGPGLAIRVMGEITEEKLETVRESDAILREEIAK--AGLDRDIWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAKIPWEVLQKISVRIVNEVDHVNRIVYDITSKPPATVEWE 520
>gi|159030575|emb|CAO88238.1| guaA [Microcystis aeruginosa PCC 7806] (541 aa)
Score = 1339, Expect = 1.1e-145, Identities = 254/508 (50%), Positives = 354/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+ NVYSE++ Y  S E++ + NPKGIILSGG +SVY   +   +  IW+L +PILG+CYG Q+M+Q+ GG+VE  K +E YG   + +    +L  N+E  +  WMSH DS + LP GF+++A T+    A+  + +KK +GVQFHPEV  +  G  L++NFVY IC     W  +    E I EI++ V D  VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +  +  +     +  V+ ++ FL+++ GV DPE+KR+ IG  FI+VFE+ +N++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRKLG S+ +P + V RQPFPGPGLA+R+LGE+T DKL I+R+AD++ R  I++  +   H  WQ F VL   +SVGV+GD R+Y Y + LR V S D M+A W ++P + LE IS+ I N+VK ++RVVYDIT+KPPGTIEWE
  S:    28 IIILDFGSQYSELIARRIRETNVYSEVLSYRTSAEQLAQINPKGIILSGGPNSVYDPGAPHCDPEIWNLGVPILGVCYGMQLMVQQLGGRVERAKRAE-YGKASLFINDPTDLLTNVEDGSTAWMSHGDSCVELPAGFEILAHTDNTDCAAIADHQKKLFGVQFHPEVVHSVGGIALIRNFVYHICKCDPTWTTEAFVEESIREIRAKVGDKRVLLALSGGVDSSTLAFLLHRAIGDQLTCMFIDQGFMRKGEPERLMQIFNEQFHIGVQYVNARKRFLAQVAGVTDPEEKRRRIGHEFIQVFEEESNRLG-PFDYLAQGTLYPDVIESADSNVDPKTGERVAVKIKSHHNVGGLPKNLRFKLVEPLRKLFKDEVRKLGRSIGLPEEIVRRQPFPGPGLAIRILGEVTADKLNILRDADWVVRDEINK--QGMYHDFWQAFAVLLPVRSVGVMGDQRTYAYPIVLRLVSSEDGMTADWSRVPYDLLETISNRIVNEVKGVNRVVYDITSKPPGTIEWE 541
>gi|114567299|ref|YP_754453.1| bifunctional GMP synthase/glutamine amidotransferase protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338234|gb|ABI69082.1| GMP synthase (glutamine-hydrolyzing) [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (510 aa)
Score = 1339, Expect = 1.1e-145, Identities = 259/510 (50%), Positives = 363/510 (71%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + +++LDFGGQY QLIARR+R+L+VYSE++ YD S EEI+ K P+ IIL+G   SV+G  +   +  ++ L IP+LGICYG Q+M ++ GG+V+      EYG   ++LT  +E+F+ +  +   WMSH D++I LP+GF++ AST  C VA+    +++ YGVQFHPEV  +T+G  +++NF++ IC + GDW+  +   E IEEIK+ V    VLCA+SGGVDS VAA L  QA+G++L CVFVD+GLLRK E+ +V     K +  N+  VD ++ FL+KL G+ +PE+KRKIIG+ FI +FE+   K+     YL+QGTIYPDIVESG+  ++TIKSHHNVGGLPE + F+L+EPL+ LFKDEVR +G  L IP + ++RQPFPGPGL VRVL E++ +KLEI+READ + R  I +     E + WQ F VL   +SVGV+GD R+Y Y + +RAV S DAM+A+  ++P E L+ ++  I N+V  ++RV YDIT+KPPGTIEWE
  S:     4 ETVVVLDFGGQYNQLIARRVRELSVYSEMLPYDTSYEEIVAKKPQAIILTGSPASVHGGEAPGCDPRVFSLGIPVLGICYGMQLMAEQMGGKVQ-PSSLREYGRAVLQLTGKDEIFKGLPDEMQVWMSHGDTIISLPEGFRITASTANCPVAAISCPQRRLYGVQFHPEVRHSTYGMDIIRNFLFEICGLRGDWDLSDFISEAIEEIKNKVGKKRVLCALSGGVDSSVAATLVHQAVGEQLVCVFVDNGLLRKGEASQVIDTFAKEMKMNLVFVDARERFLAKLAGITEPERKRKIIGEEFIRIFEEEKAKLG-EIDYLVQGTIYPDIVESGTSTAQTIKSHHNVGGLPEDMDFQLIEPLRLLFKDEVRLVGEKLGIPAEILWRQPFPGPGLGVRVLEEVSFEKLEILREADAIVRDEIKK--AGLEREIWQAFAVLPPVRSVGVMGDARTYAYPIIIRAVISEDAMTAEVARLPWELLDIMARRIVNEVAGVNRVAYDITSKPPGTIEWE 510
>gi|69247087|ref|ZP_00604219.1| GMP synthase, C-terminal:GMP synthase, N-terminal [Enterococcus faecium DO] >gi|68194971|gb|EAN09438.1| GMP synthase, C-terminal:GMP synthase, N-terminal [Enterococcus faecium DO] (521 aa)
Score = 1339, Expect = 1.2e-145, Identities = 259/511 (50%), Positives = 355/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE--LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI--NVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++KI++LD+G QY QLI RRIRDL V+SE++ + I+ EE+   NPKGIILSGG +SVY + +   +  I++L IP+LGICYG Q++  + GG VE  K+  EYG   + +T+++  LF+        WMSH D V  +P+GF+ + ++  C +AS  +  + FYG+QFH EV  + +G +LL++F + +C   G+W   N    ++E+I+  V D  VL  +SGGVDS V  VL  +AIGD+L  +FVDHGLLRK E+++V   L    G NI  V+ +  FL KLKGV DPEQKRKIIG  F+ VF+  A K+       +L QGT+Y D++ESG++ ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR+LG  L +P   V+RQPFPGPGL +RVLGEITEDKLEIVRE+D + R  I       +   WQYFTVL   +SVGV+GD R+Y YT+ +RAV S+D M+A + +IP E L+KIS  I N+V +++R+VYDIT+KPP T+EWE
  S:    10 VEKIIVLDYGSQYNQLITRRIRDLGVFSELLSHRITAEEVKAMNPKGIILSGGPNSVYDENAFGIDPEIFNLGIPVLGICYGMQLITYKLGGSVEPAKN-REYGKALLEVTSDQAVLFKETPKQQTVWMSHGDLVTKVPEGFETVGTSKDCPIASIQDTTRNFYGIQFHAEVRHSEYGIELLRHFAFDVCHCEGNWTMDNFIDMQVEKIREQVGDKKVLLGLSGGVDSSVVGVLLQKAIGDQLTSIFVDHGLLRKGEAEQVMESLGGKFGLNIIKVNARDRFLDKLKGVSDPEQKRKIIGNEFVYVFDDEATKLAGEEGVSFLAQGTLYTDVIESGTETAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRELGTQLGMPDSIVWRQPFPGPGLGIRVLGEITEDKLEIVRESDAILREEIAA--AGLDRDIWQYFTVLPGIRSVGVMGDGRTYDYTVGIRAVTSIDGMTADFARIPWEVLQKISVRIVNEVAHVNRIVYDITSKPPATVEWE 521
>gi|168486141|ref|ZP_02710649.1| GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase) [Streptococcus pneumoniae CDC1087-00] >gi|183570763|gb|EDT91291.1| GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase) [Streptococcus pneumoniae CDC1087-00] (520 aa)
Score = 1339, Expect = 1.3e-145, Identities = 260/511 (50%), Positives = 351/511 (68%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++KI++LD+G QY QLI+RRIR++ V+SE+  + IS  E+ + NP GIILSGG +SVY D S   +  I++L IPILGICYG Q++  + GG+V    D  + EYG + +  T + LFE+   +    MSH D+V  +P  F    ++  C  A+  N +K  YG+QFHPEV  + +GN +L+NF  +IC   GDW   N    +I++I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+ +V  +L    G NI   D  + FL KL GV DPEQKRKIIG  F+ VF+  A+K+    K+L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QFEL+EPL  L+KDEVR LG  L +P   V+RQPFPGPGLA+RV+GEITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + KIP E L+KIS  I N+V +++R+VYDIT+KPP T+EWE
  S:    11 VEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYDDGSFDIDPEIFELGIPILGICYGMQLLTHKLGGKVVPAGDAGNREYGQSTLTHTPSALFESTPDEQTVLMSHGDAVTEIPADFVRTGTSADCPYAAIENPDKHIYGIQFHPEVRHSVYGNDILRNFALNICKAKGDWSMDNFIDMQIKKIRETVGDKRVLLGLSGGVDSSVVGVLLQKAIGDQLICIFVDHGLLRKGEADQVMDMLGGKFGLNIVKADAAKRFLDKLAGVSDPEQKRKIIGNEFVYVFDDEASKLK-DVKFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMQFELIEPLNTLYKDEVRALGTELGMPDHIVWRQPFPGPGLAIRVMGEITEEKLETVRESDAILREEIAK--AGLDRDIWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAKIPWEVLQKISVRIVNEVDHVNRIVYDITSKPPATVEWE 520
>gi|166364457|ref|YP_001656730.1| bifunctional GMP synthase/glutamine amidotransferase protein [Microcystis aeruginosa NIES-843] >gi|166086830|dbj|BAG01538.1| GMP synthetase [Microcystis aeruginosa NIES-843] (541 aa)
Score = 1338, Expect = 1.6e-145, Identities = 253/508 (49%), Positives = 354/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+ NVYSE++ Y  S E++ + NPKGIILSGG +SVY   +   +  IW+L +P+LG+CYG Q+M+Q+ GG+VE  K +E YG   + +    +L  N+E  +  WMSH DS + LP GF+++A T+    A+  + +KK +GVQFHPEV  +  G  L++NFVY IC     W  +    E I EI++ V D  VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +  +  +     +  V+ ++ FL+++ GV DPE+KR+ IG  FI+VFE+ +N++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRKLG S+ +P + V RQPFPGPGLA+R+LGE+T DKL I+R+AD++ R  I++  +   H  WQ F VL   +SVGV+GD R+Y Y + LR V S D M+A W ++P + LE IS+ I N+VK ++RVVYDIT+KPPGTIEWE
  S:    28 IIILDFGSQYSELIARRIRETNVYSEVLSYRTSAEQLAQINPKGIILSGGPNSVYDPGAPHCDPEIWNLGVPVLGVCYGMQLMVQQLGGRVERAKRAE-YGKASLFINDPTDLLTNVEDGSTAWMSHGDSCVELPAGFEILAHTDNTDCAAIADHKKKLFGVQFHPEVVHSVGGIALIRNFVYHICKCEPTWTTEAFVEESIREIRAKVGDKRVLLALSGGVDSSTLAFLLHRAIGDQLTCMFIDQGFMRKGEPERLMQIFNEQFHIRVEYVNARERFLAQVAGVTDPEEKRRRIGHEFIQVFEEESNRLG-PFDYLAQGTLYPDVIESADSNVDPKTGERVAVKIKSHHNVGGLPKNLRFKLVEPLRKLFKDEVRKLGRSIGLPEEIVRRQPFPGPGLAIRILGEVTADKLNILRDADWVVRDEINK--QGMYHDFWQAFAVLLPVRSVGVMGDQRTYAYPIVLRLVSSEDGMTADWSRVPYDLLETISNRIVNEVKGVNRVVYDITSKPPGTIEWE 541
>gi|15901295|ref|NP_345899.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus pneumoniae TIGR4] >gi|15903343|ref|NP_358893.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus pneumoniae R6] >gi|111657364|ref|ZP_01408121.1| hypothetical protein SpneT_02001417 [Streptococcus pneumoniae TIGR4] >gi|116516474|ref|YP_816740.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus pneumoniae D39] >gi|148984786|ref|ZP_01818039.1| GMP synthase, C-terminal domain [Streptococcus pneumoniae SP3-BS71] >gi|148990253|ref|ZP_01821464.1| GMP synthase, C-terminal domain [Streptococcus pneumoniae SP6-BS73] >gi|148997498|ref|ZP_01825103.1| GMP synthase, C-terminal domain [Streptococcus pneumoniae SP11-BS70] >gi|149002837|ref|ZP_01827763.1| GMP synthase, C-terminal domain [Streptococcus pneumoniae SP14-BS69] >gi|149007285|ref|ZP_01830943.1| GMP synthase, C-terminal domain [Streptococcus pneumoniae SP18-BS74] >gi|149019388|ref|ZP_01834750.1| GMP synthase, C-terminal domain [Streptococcus pneumoniae SP23-BS72] >gi|168489607|ref|ZP_02713806.1| GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase) [Streptococcus pneumoniae SP195] >gi|168491344|ref|ZP_02715487.1| GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase) [Streptococcus pneumoniae CDC0288-04] >gi|168575904|ref|ZP_02721819.1| GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase) [Streptococcus pneumoniae MLV-016] >gi|169833631|ref|YP_001694864.1| GMP synthase [glutamine-hydrolyzing] (glutamineamidotransferase) (GMP synthetase) [Streptococcus pneumoniae Hungary19A-6] >gi|194397166|ref|YP_002038080.1| GMP synthase [Streptococcus pneumoniae G54] >gi|54037232|sp|P64298|GUAA_STRR6 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|54041336|sp|P64297|GUAA_STRPN GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|14972933|gb|AAK75539.1| GMP synthase [Streptococcus pneumoniae TIGR4] >gi|15458943|gb|AAL00104.1| Glutamine amidotransferase [Streptococcus pneumoniae R6] >gi|116077050|gb|ABJ54770.1| GMP synthase, C-terminal domain [Streptococcus pneumoniae D39] >gi|147756553|gb|EDK63594.1| GMP synthase, C-terminal domain [Streptococcus pneumoniae SP11-BS70] >gi|147759131|gb|EDK66125.1| GMP synthase, C-terminal domain [Streptococcus pneumoniae SP14-BS69] >gi|147761089|gb|EDK68057.1| GMP synthase, C-terminal domain [Streptococcus pneumoniae SP18-BS74] >gi|147922808|gb|EDK73924.1| GMP synthase, C-terminal domain [Streptococcus pneumoniae SP3-BS71] >gi|147924392|gb|EDK75482.1| GMP synthase, C-terminal domain [Streptococcus pneumoniae SP6-BS73] >gi|147931258|gb|EDK82237.1| GMP synthase, C-terminal domain [Streptococcus pneumoniae SP23-BS72] >gi|168996133|gb|ACA36745.1| GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase) [Streptococcus pneumoniae Hungary19A-6] >gi|183571993|gb|EDT92521.1| GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase) [Streptococcus pneumoniae SP195] >gi|183574391|gb|EDT94919.1| GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase) [Streptococcus pneumoniae CDC0288-04] >gi|183578306|gb|EDT98834.1| GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase) [Streptococcus pneumoniae MLV-016] >gi|194356833|gb|ACF55281.1| GMP synthase [Streptococcus pneumoniae G54] (520 aa)
Score = 1338, Expect = 1.6e-145, Identities = 260/511 (50%), Positives = 351/511 (68%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++KI++LD+G QY QLI+RRIR++ V+SE+  + IS  E+ + NP GIILSGG +SVY D S   +  I++L IPILGICYG Q++  + GG+V    D  + EYG + +  T + LFE+   +    MSH D+V  +P  F    ++  C  A+  N +K  YG+QFHPEV  + +GN +L+NF  +IC   GDW   N    +I++I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+ +V  +L    G NI   D  + FL KL GV DPEQKRKIIG  F+ VF+  A+K+    K+L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QFEL+EPL  L+KDEVR LG  L +P   V+RQPFPGPGLA+RV+GEITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + KIP E L+KIS  I N+V +++R+VYDIT+KPP T+EWE
  S:    11 VEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDIDPEIFELGIPILGICYGMQLLTHKLGGKVVPAGDAGNREYGQSTLTHTPSALFESTPDEQTVLMSHGDAVTEIPADFVRTGTSADCPYAAIENPDKHIYGIQFHPEVRHSVYGNDILRNFALNICKAKGDWSMDNFIDMQIKKIRETVGDKRVLLGLSGGVDSSVVGVLLQKAIGDQLICIFVDHGLLRKGEADQVMDMLGGKFGLNIVKADAAKRFLDKLAGVSDPEQKRKIIGNEFVYVFDDEASKLK-DVKFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMQFELIEPLNTLYKDEVRALGTELGMPDHIVWRQPFPGPGLAIRVMGEITEEKLETVRESDAILREEIAK--AGLDRDIWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAKIPWEVLQKISVRIVNEVDHVNRIVYDITSKPPATVEWE 520
>gi|148992672|ref|ZP_01822340.1| GMP synthase, C-terminal domain [Streptococcus pneumoniae SP9-BS68] >gi|168483941|ref|ZP_02708893.1| GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase) [Streptococcus pneumoniae CDC1873-00] >gi|182684403|ref|YP_001836150.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus pneumoniae CGSP14] >gi|147928689|gb|EDK79703.1| GMP synthase, C-terminal domain [Streptococcus pneumoniae SP9-BS68] >gi|172042797|gb|EDT50843.1| GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase) [Streptococcus pneumoniae CDC1873-00] >gi|182629737|gb|ACB90685.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus pneumoniae CGSP14] (520 aa)
Score = 1338, Expect = 1.7e-145, Identities = 260/511 (50%), Positives = 351/511 (68%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++KI++LD+G QY QLI+RRIR++ V+SE+  + IS  E+ + NP GIILSGG +SVY D S   +  I++L IPILGICYG Q++  + GG+V    D  + EYG + +  T + LFE+   +    MSH D+V  +P  F    ++  C  A+  N +K  YG+QFHPEV  + +GN +L+NF  +IC   GDW   N    +I++I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+ +V  +L    G NI   D  + FL KL GV DPEQKRKIIG  F+ VF+  A+K+    K+L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QFEL+EPL  L+KDEVR LG  L +P   V+RQPFPGPGLA+RV+GEITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + KIP E L+KIS  I N+V +++R+VYDIT+KPP T+EWE
  S:    11 VEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDIDPEIFELGIPILGICYGMQLLTHKLGGKVVPAGDAGNREYGQSTLTHTPSALFESTPDEQTVLMSHGDAVTEIPADFVRTGTSADCPYAAIENPDKHIYGIQFHPEVRHSVYGNDILRNFALNICKAKGDWSMDNFIDMQIKKIRKTVGDKRVLLGLSGGVDSSVVGVLLQKAIGDQLICIFVDHGLLRKGEADQVMDMLGGKFGLNIVKADAAKRFLDKLAGVSDPEQKRKIIGNEFVYVFDDEASKLK-DVKFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMQFELIEPLNTLYKDEVRALGTELGMPDHIVWRQPFPGPGLAIRVMGEITEEKLETVRESDAILREEIAK--AGLDRDIWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAKIPWEVLQKISVRIVNEVDHVNRIVYDITSKPPATVEWE 520
>gi|118727763|ref|ZP_01576352.1| GMP synthase, large subunit [Clostridium cellulolyticum H10] >gi|118662828|gb|EAV69500.1| GMP synthase, large subunit [Clostridium cellulolyticum H10] (511 aa)
Score = 1337, Expect = 2.0e-145, Identities = 265/510 (51%), Positives = 353/510 (69%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + IL+LDFGGQY QLIARR+R+ NVY E++ Y+ S+E I   N KGII +GG +SV  + + K + G+++L IP+LGICYG Q+M    GG V    +  EYG  +I +  ++ LF +++ +  CWMSH+  V   PKGF+VIA +  C   +  + EK  Y VQFHPEV  T  G ++L+NF+Y+IC   GDW+  +     I  I+  V D  VLCA+SGGVDS VAAVL  +AIG +L C+FVDHGLLRK E  +V  + +K    N+  V+ +  FL +LKGV DPE KRKIIG+ FI VFE  A KI     +L+QGTIYPD++ESG   +  IKSHHNVGGLPE + F E++EPL+ LFKDEVR+ G  L IP   V+RQPFPGPGLA+RV+G++T++KL+ +R+ D++FR  I     + E    QYFTVLTN +SVGV+GD R+Y Y LALRAV + D M+A W +IP + LEK+S+ I N+VK I+R+VYDIT+KPP TIEWE
  S:     4 EMILVLDFGGQYNQLIARRVREANVYCEVIPYNASLERIKSYNAKGIIFTGGPNSVLDEGAPKCDPGVFELGIPVLGICYGMQLMSVMLGGSV-TAANQREYGKVEICVDKSQPLFRDVDENTICWMSHTYYVDTPPKGFEVIAKSANCPTGAMQHVEKNLYAVQFHPEVMHTPKGKEMLKNFLYNICGCKGDWKMSSFVENSINAIREKVGDKKVLCALSGGVDSSVAAVLIHKAIGKQLTCIFVDHGLLRKYEGDQVEQIFRKQYDINLIRVNCEDRFLQRLKGVSDPETKRKIIGEEFIRVFEDEAKKIG-KVDFLVQGTIYPDVIESGIGDAAVIKSHHNVGGLPEHVDFKEIIEPLRSLFKDEVRRAGEELGIPEDLVWRQPFPGPGLAIRVIGDLTKEKLDTLRDTDYIFREEIKAAGLDKEIN--QYFTVLTNMRSVGVMGDERTYDYALALRAVTTTDFMTADWARIPYDILEKVSTRIVNEVKQINRIVYDITSKPPATIEWE 511
>gi|78187788|ref|YP_375831.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pelodictyon luteolum DSM 273] >gi|91206815|sp|Q3B1J3|GUAA_PELLD GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|78167690|gb|ABB24788.1| GMP synthase (glutamine-hydrolyzing) [Pelodictyon luteolum DSM 273] (513 aa)
Score = 1336, Expect = 2.4e-145, Identities = 270/511 (52%), Positives = 361/511 (70%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-----LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNK---CLVASACNREK-KFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP-WQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           M  +L+LDFG QYTQLIARRIR+L +YSEI+ Y  + E I + +PK IILSGG  SVYG+ +I P+ GI+ L +PILGICYG Q +    GG VE+    +E+G   I +   E     LF++I  D++ WMSH D V  +P+GF++ AS+     C + S   +   K YG+QFHPEV  T +G QLL NF+ +I  +  DW  K+    +IE+I+       V+C ISGGVDS VAAVL ++AIG +L+CVFVD+GLLRKNE+++V   LK L G NI L D   LFL +LKGV  PE+KRKIIG+TFI VFE+  N+     K+L+QGT+YPD++ES S    S+TIKSHHNVGGLP+R++ +L+EPL+ LFKDEVR +G  L IP   + R PFPGPGLAVRVLG +T ++L+I+READ +   YID+L  +  ++  WQ F+VL   +SVGV+GD R+Y   LALRAV+S D M+A W  +P + L K+S+ I N+V+ I+RV YDI++KPP TIEWE
  S:     1 MQSVLVLDFGSQYTQLIARRIRELGIYSEILPYSTTPEAIREHDPKAIILSGGPTSVYGESAILPHPGIFSLGLPILGICYGLQAIANHFGGAVESSS-KQEFGRAKILVDRTEGHESMLFKDIP-DSDVWMSHGDKVTRMPEGFQITASSGNSEMCAIESFGPKAALKIYGLQFHPEVQHTLYGKQLLSNFLINIAGIRPDWSSKSFIEHQIEDIRQRADKGTVICGISGGVDSTVAAVLVSKAIGKQLHCVFVDNGLLRKNEARKVMEFLKPL-GLNITLADSADLFLGRLKGVASPEKKRKIIGRTFIRVFEEHINE----EKFLVQGTLYPDVIESQSVKGPSETIKSHHNVGGLPKRMKLKLIEPLRELFKDEVRAVGRELGIPEDILMRHPFPGPGLAVRVLGSLTRERLDILREADEI---YIDELKSSGLYQQVWQAFSVLLPVQSVGVMGDKRTYENVLALRAVESTDGMTADWAHLPHDFLAKVSNRIINEVRGINRVAYDISSKPPATIEWE 513
>gi|77413629|ref|ZP_00789815.1| GMP synthase [Streptococcus agalactiae 515] >gi|77160338|gb|EAO71463.1| GMP synthase [Streptococcus agalactiae 515] (520 aa)
Score = 1336, Expect = 2.7e-145, Identities = 259/511 (50%), Positives = 354/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + KI++LD+G QY QLIARRIR+  V+SE+  + I+ +EI   NP GI+LSGG +SVY D +   ++ I++L IPILGICYG Q++  + GG+V    +    EYG + +RL + + LF     +    MSH D+V  +P+GF ++  +  C  A+  N EK+FYG+QFHPEV  + +GN +L+NF  +IC   GDW   N     I +I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRKNE  +V  +L    G NI  VD  + FL  L GV DPE+KRKIIG  F+ VF+  A+K+     +L QGT+Y DI+ESG++ ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG +L +P + V+RQPFPGPGLA+RV+GEITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + ++P + L+KIS  I N+V +++R+VYDIT+KPP T+EWE
  S:    10 IQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITADEIRDINPIGIVLSGGPNSVYADGAFGIDEEIFELGIPILGICYGMQLITHKLGGKVLPAGEAGHREYGQSALRLRSESALFAGTPQEQLVLMSHGDAVTEIPEGFHLVGDSVDCPFAAMENTEKQFYGIQFHPEVRHSVYGNDILKNFAVNICGARGDWSMDNFIDMXIAKIRETVGDRKVLLGLSGGVDSSVVGVLLQRAIGDQLTCIFVDHGLLRKNEGDQVMDMLGGKFGLNIIRVDASKRFLDLLSGVEDPERKRKIIGNEFVYVFDDEASKLK-GVDFLAQGTLYTDIIESGTETAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGTALGMPDEVVWRQPFPGPGLAIRVMGEITEEKLETVRESDAILREEIAK--AGLDRDVWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAQLPWDVLKKISIRIVNEVDHVNRIVYDITSKPPATVEWE 520
>gi|147678886|ref|YP_001213101.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pelotomaculum thermopropionicum SI] >gi|146274983|dbj|BAF60732.1| hypothetical GMP synthase [Pelotomaculum thermopropionicum SI] (513 aa)
Score = 1335, Expect = 3.3e-145, Identities = 257/510 (50%), Positives = 346/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIR-LTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + +++LDFGGQY+ LIARR+R+L V+ E++ +   +EEI KK P+GII SGG  SVY   +   +  ++DL +PILGICYG Q+M  + GG+V +     EYG T +  L    LF  +E    CWMSH D V   P GF V A T+K  VA+  +  +K Y VQFHPEV  T  G  +L+ F+Y IC   G W   +     + E++  V     LCA+SGGVDS VAAVL  +A+GD+L CVFV+HGLLRK E+++V    K+    N+  VD ++ FLS+L GV DPE KRKIIG+ FI VFE  A  +     +L+QGT+YPD+VESG+  +  IKSHHNVG LP  ++F L+EPL++LFKDEVR+LG  + +P + ++RQPFPGPGLAVR+LGE+TE KL I++EAD +    I +  LY+    + WQ F VL + KSVGV+GD R+Y YT+A+RAV S DAM+A W ++P E LE ISS I +++K ++RVVYDIT+KPP TIEWE
  S:     7 EMVIVLDFGGQYSHLIARRVRELKVFCEMLPFSTPVEEIKKKGPRGIIFSGGPSSVYQKNAPFCDPAVYDLGVPILGICYGMQLMAYQLGGRV-SPAGRREYGRTGLNVLDRGGLFSGLEPFEQCWMSHGDLVELPPPGFNVTARTDKAPVAAMADPARKLYAVQFHPEVVHTPKGQDILRTFLYGICGCRGLWTMGSFLERAVAEVQEQVGSGRALCALSGGVDSSVAAVLVHRAVGDRLTCVFVNHGLLRKGEAEQVQKTFKEKFKMNLIYVDARRRFLSRLAGVTDPEMKRKIIGEEFIRVFEDQAAALG-QVDFLVQGTLYPDVVESGTATAAVIKSHHNVGCLPGDMRFGLVEPLRWLFKDEVRELGEEMGLPEEVIWRQPFPGPGLAVRILGEVTEHKLAILQEADAIVEEEIRKAGLYR----QIWQSFAVLPDIKSVGVMGDERTYSYTVAVRAVHSRDAMTADWVRLPYEVLEAISSRIVSEIKEVNRVVYDITSKPPATIEWE 513
>gi|193214830|ref|YP_001996029.1| GMP synthase, large subunit [Chloroherpeton thalassium ATCC 35110] >gi|193088307|gb|ACF13582.1| GMP synthase, large subunit [Chloroherpeton thalassium ATCC 35110] (514 aa)
Score = 1334, Expect = 4.9e-145, Identities = 268/511 (52%), Positives = 374/511 (73%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNEL-----FENIELDNNCWMSHSDSVIFLPKGFKVIAST-NKCLVASACNREK---KFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEK-VANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           M+ +++LDFG QYTQLIARRIR+L +YSEI+ Y  S E + ++NPK +ILSGG  SVY   +  P++ I++L+IPILGICYG Q + +  GG+V       E+G   + +   NEL     F+NI  D+  WMSHSD +  LPKGF + A T N  L A      +   + +G+QFHPEV  T FG +LL NF+ +I  +  DW P++    +I  IK +V D   +CAISGGVDS VAAVL ++A+GDKL+C+FVD+GLLRKNE+++V   LK+L G N+  VD  +LFLS+LK VV PE+KRKIIG+TFI+VFE+ + N+     K+L+QGT+YPD++ES S    S+TIK+HHNVGGLP+R++ +L+EPL+ LFKDEVRK+G  LD+P + + R PFPGPGLAVRVLG +++++L+++READ +F   ID+L K+  + + WQ FTVL   ++VGV+GDNR+Y   +ALRAV+S D M+A W ++P + L  +S+ I N+V+ I+RV YDI++KPP TIEWE
  S:     1 MNSVIVLDFGSQYTQLIARRIRELGIYSEILPYHTSAEALRERNPKALILSGGPTSVYDAFAPMPDEKIYELDIPILGICYGLQAIAKHFGGEVAASP-KREFGRAQMNIVRQNELAESLLFKNIP-DSTVWMSHSDKLTCLPKGFHITAQTANSELCAIEVTEGEGAHRIFGLQFHPEVHHTEFGEKLLSNFLINIAGITPDWSPQSFIDSEIARIKELVGDQTAICAISGGVDSSVAAVLVSRALGDKLHCIFVDNGLLRKNEAEKVQEKLKQL-GLNLTTVDASELFLSRLKNVVSPERKRKIIGRTFIKVFEEHIHNE-----KFLVQGTLYPDVIESVSVKGPSQTIKTHHNVGGLPKRMKLKLIEPLRELFKDEVRKVGKLLDVPDEILTRHPFPGPGLAVRVLGSVSKERLDVLREADAIF---IDELKKHDLYLQIWQAFTVLLPVQTVGVMGDNRTYENAVALRAVNSTDGMTADWARLPNDFLAHVSNRIINEVRGINRVTYDISSKPPATIEWE 514
>gi|24379503|ref|NP_721458.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus mutans UA159] >gi|44887999|sp|Q8DU81|GUAA_STRMU GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|24377443|gb|AAN58764.1|AE014945_1 putative GMP synthase [Streptococcus mutans UA159] (517 aa)
Score = 1333, Expect = 5.7e-145, Identities = 255/511 (49%), Positives = 356/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + KI++LD+G QY QLIARRIR+  ++SE+  + ++ +E+   NP GI+LSGG  SVY + +   +K I DL IP+LGICYG Q++ ++ GG+V       + EYG + + LT N ELF+    +    MSH D+V  +P+GF+++  ++ C  A+  N EKK +G+QFHPEV  T +GN +L+NF +++C   GDW   +    +IE+I+  V +  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E  +V  +L    G NI  VD  + FL  L G+ DPE+KRKIIG  F+ VF+  A+K      +L QGT+Y D++ESG++ ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG +L +P + V+RQPFPGPGLA+RV+GEIT +KLE VRE+D + R  I     N +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + +IP E L+KIS  I N+V++++R+VYDIT+KPP T+EWE
  S:     7 IQKIIVLDYGSQYNQLIARRIREFGIFSELRSHKVTADEVRAINPIGIVLSGGPSSVYAEDAFDIDKEILDLGIPVLGICYGMQLLTEKLGGKVVPAGQTGNSEYGQSTLHLTENSELFKETPAEQTVLMSHGDAVTEIPEGFQLVGKSSDCPYAAIENVEKKIFGIQFHPEVRHTEYGNAILRNFAFNVCKAKGDWSMDSFIDMEIEKIREQVGNRKVLLGLSGGVDSSVVGVLLQKAIGDQLTCIFVDHGLLRKGEGDQVMEMLGGRFGLNIIRVDASKRFLDLLAGIDDPEKKRKIIGNEFVYVFDDEASK-QKGVDFLAQGTLYTDVIESGTETAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRTLGTALGMPDEIVWRQPFPGPGLAIRVMGEITAEKLETVRESDAILREEIAAAGLNRD--IWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFARIPWEVLQKISVRIVNEVEHVNRIVYDITSKPPATVEWE 517
>gi|186899108|ref|ZP_02972071.1| GMP synthase, large subunit [Cyanothece sp. PCC 7424] >gi|186693710|gb|EDU18323.1| GMP synthase, large subunit [Cyanothece sp. PCC 7424] (542 aa)
Score = 1333, Expect = 6.0e-145, Identities = 252/508 (49%), Positives = 354/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+ NVYSE++ Y  S E++ +  PKGIILSGG +SVY   + +  + IWDL IPILG+CYG Q+M+Q+ GG+VE  K +E YG   + +    +L  N+E ++  WMSH DS I LP GFK++A T+    A+  N E+K +GVQFHPEV  +  G  L++NFVY IC+    W  +    E I EI++ + D  VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +  +        +  V+ ++ FL +LKGV DPE+KR++IG  FI+VFE+ +N++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRK+  S+ +P + V R PFPGPGLA+R++GE+T ++L+I+R+ADF+ R  I +  +   H  WQ F VL   +SVGV+GD R+Y + + LR + S D M+A W K+P + LE IS+ I N+V+ ++RVVYDIT+KPPGTIEWE
  S:    29 IVILDFGSQYSELIARRIRETNVYSEVLSYRTSAEQLRQLAPKGIILSGGPNSVYDKNAPQCTQEIWDLGIPILGVCYGMQLMVQQLGGKVERAKRAE-YGKASLHIDDPTDLLTNVEDNSIAWMSHGDSCIELPDGFKILAHTDNTPCAAIANHEQKLFGVQFHPEVVHSVGGIALIRNFVYHICECEPTWTTEAFVEEAIREIRAKIGDKRVLLALSGGVDSSTLAFLLHRAIGDQLTCMFIDQGFMRKGEPERLMEIFDHQFHIPVVYVNSREQFLEQLKGVTDPEEKRRLIGHEFIKVFEEESNRLG-PFDYLAQGTLYPDVIESADSNVDPQTGERVAVKIKSHHNVGGLPKNLRFKLVEPLRKLFKDEVRKVARSIGLPEEIVRRHPFPGPGLAIRIIGEVTSERLKILRDADFVVRDEISK--QGMYHDFWQAFAVLLPVRSVGVMGDQRTYAHPVVLRLITSEDGMTADWAKVPYDLLEIISNRIVNEVRGVNRVVYDITSKPPGTIEWE 542
>gi|21673016|ref|NP_661081.1| bifunctional GMP synthase/glutamine amidotransferase protein [Chlorobium tepidum TLS] >gi|44887968|sp|Q8KFZ5|GUAA_CHLTE GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|21646081|gb|AAM71423.1| GMP synthase [Chlorobium tepidum TLS] (516 aa)
Score = 1333, Expect = 6.2e-145, Identities = 268/511 (52%), Positives = 361/511 (70%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE----LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNK---CLVASACNREK-KFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +  +++LDFG QYTQLIARRIR++ +YSEI  Y    E I    PK IILSGG +SVY +++  P+  ++ L +P+LGICYG Q + +  GG VE+    +E+G   + +  +E    LF +I  D++ WMSH D V  LP+GF+V AST     C + S  ++   K YG+QFHPEV  + +G QLL NF+  I  +  DW PK+    +IEEIK +  D  V+C ISGGVDS VAAVL ++AIGDKL+CVFVD+GLLRK+E+ +V   LK L G NI LVD   LFL +LKGV  PE+KRKIIG+TFI+VFEK  +      K+L+QGT+YPD++ES S    S+TIKSHHNVGGLP+R++ +L+EPL+ LFKDEVR +G  L I    + R PFPGPGLAVRVLG +T ++L+++R+AD +F   ID+L  +  + K WQ F+VL   +SVGV+GD R+Y   LALRAV+S D M+A W  +P + L K+S+ I N+V+ I+RVVYDI++KPP TIEWE
  S:     5 LQSVIVLDFGSQYTQLIARRIREIGIYSEIFPYHTKAETIRAHQPKAIILSGGPNSVYDEKAFMPDPEVFSLGVPVLGICYGLQAIAKHFGGNVESSS-KQEFGRAKMLVNHDESESLLFRDIP-DSDVWMSHGDKVTQLPEGFRVTASTANAEVCAIESFGSKAALKVYGLQFHPEVQHSLYGKQLLSNFLIDIAGITPDWSPKSFIQHQIEEIKRVAGDSTVVCGISGGVDSTVAAVLVSKAIGDKLHCVFVDNGLLRKDEAVKVMEFLKPL-GLNISLVDASDLFLGRLKGVASPEKKRKIIGRTFIQVFEKNIHD----EKFLVQGTLYPDVIESVSVKGPSETIKSHHNVGGLPKRMKLKLIEPLRELFKDEVRAVGRELGIAEDILMRHPFPGPGLAVRVLGSLTRERLDVLRDADQIF---IDELKSSGLYSKVWQAFSVLLPVQSVGVMGDKRTYENVLALRAVESTDGMTADWAHLPHDFLAKVSNRIINEVRGINRVVYDISSKPPATIEWE 516
>gi|168493347|ref|ZP_02717490.1| GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase) [Streptococcus pneumoniae CDC3059-06] >gi|183576575|gb|EDT97103.1| GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase) [Streptococcus pneumoniae CDC3059-06] (520 aa)
Score = 1333, Expect = 6.7e-145, Identities = 260/511 (50%), Positives = 350/511 (68%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++KI++LD+G QY QLI+RRIR++ V+SE+  + IS  E+ + NP GIILSGG +SVY D S   +  I++L IPILGICYG Q++  + GG+V    D  + EYG + +  T + LFE+   +    MSH D+V  +P  F    ++  C  A+  N +K  YG+QFHPEV  + +GN +L+NF  +IC   GDW   N    +I++I   V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+ +V  +L    G NI   D  + FL KL GV DPEQKRKIIG  F+ VF+  A+K+    K+L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QFEL+EPL  L+KDEVR LG  L +P   V+RQPFPGPGLA+RV+GEITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + KIP E L+KIS  I N+V +++R+VYDIT+KPP T+EWE
  S:    11 VEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDIDPEIFELGIPILGICYGMQLLTHKLGGKVVPAGDAGNREYGQSTLTHTPSALFESTPDEQTVLMSHGDAVTEIPADFVRTGTSADCPYAAIENPDKHIYGIQFHPEVRHSVYGNDILRNFALNICKAKGDWSMDNFIDMQIKKICETVGDKRVLLGLSGGVDSSVVGVLLQKAIGDQLICIFVDHGLLRKGEADQVMDMLGGKFGLNIVKADAAKRFLDKLAGVSDPEQKRKIIGNEFVYVFDDEASKLK-DVKFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMQFELIEPLNTLYKDEVRALGTELGMPDHIVWRQPFPGPGLAIRVMGEITEEKLETVRESDAILREEIAK--AGLDRDIWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAKIPWEVLQKISVRIVNEVDHVNRIVYDITSKPPATVEWE 520
>gi|94988651|ref|YP_596752.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus pyogenes MGAS9429] >gi|94992475|ref|YP_600574.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus pyogenes MGAS2096] >gi|94542159|gb|ABF32208.1| GMP synthase (glutamine-hydrolyzing) [Streptococcus pyogenes MGAS9429] >gi|94545983|gb|ABF36030.1| GMP synthase (glutamine-hydrolyzing) [Streptococcus pyogenes MGAS2096] (520 aa)
Score = 1332, Expect = 8.1e-145, Identities = 257/511 (50%), Positives = 354/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + KI++LD+G QY QLIARRIR+  V+SE+  + I+ +E+ + NP GI+LSGG +SVY D +   +  I++L IPILGICYG Q++  + GG+V       + EYG + + L  T++LF     +    MSH D+V  +P+GF ++  +N C  A+  N EK  YG+QFHPEV  + +GN +LQNF  SIC   GDW   N    +I +I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK+E  +V  +L    G NI  VD  + FL  L  V DPE+KRKIIG  F+ VF+  A+K+     +L QGT+Y DI+ESG++ ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG++L +P + V+RQPFPGPGLA+RV+G ITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + ++P + L+KIS+ I N+V +++R+VYDIT+KPP T+EWE
  S:    10 VQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGIDPEIFELGIPILGICYGMQLITHKLGGKVVPAGQAGNREYGQSTLHLRETSKLFSGTPQEQLVLMSHGDAVTEIPEGFHLVGDSNDCPYAAIENTEKNLYGIQFHPEVRHSVYGNDILQNFAISICGARGDWSMDNFIDMEIAKIRETVGDRKVLLGLSGGVDSSVVGVLLQKAIGDQLTCIFVDHGLLRKDEGDQVMGMLGGKFGLNIIRVDASKRFLDLLADVEDPEKKRKIIGNEFVYVFDDEASKLK-GVDFLAQGTLYTDIIESGTETAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGIALGMPEEIVWRQPFPGPGLAIRVMGAITEEKLETVRESDAILREEIAK--AGLDRDVWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAQLPWDVLKKISTRIVNEVDHVNRIVYDITSKPPATVEWE 520
>gi|195978133|ref|YP_002123377.1| GMP synthase [glutamine-hydrolyzing] GuaA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974838|gb|ACG62364.1| GMP synthase [glutamine-hydrolyzing] GuaA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (515 aa)
Score = 1331, Expect = 9.1e-145, Identities = 258/511 (50%), Positives = 350/511 (68%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + KI++LD+G QY QLIARRIR+  V+SE+  + I+ +E+   NP GI+LSGG +SVY   +   +  I++L IPILGICYG Q++    GG+V         EYG + +RL + + LF     +    MSH D+V  +P+GF ++  +N C  A+  N +K+ YG+QFHPEV  + +GN +L+NF  SIC   GDW   N    +I +I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRKNE  +V  +L    G NI  VD  + FL  L GV DPE+KRKIIG  F+ VF+  A+K+     +L QGT+Y DI+ESG++ ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG +L +P + V+RQPFPGPGLA+RV+GEIT +KLE VRE+D + R  I +     E   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + ++P E L+KIS  I N+V +++R+VYDIT+KPP T+EWE
  S:     5 VQKIIVLDYGSQYNQLIARRIREFGVFSELKSHHITAQELRDINPIGIVLSGGPNSVYATDAFGIDPEIFELGIPILGICYGMQLITHTLGGKVVPAGQAGHREYGQSSLRLRSASALFAGTPDEQLVLMSHGDAVTEIPEGFHLVGDSNDCPYAAMENTKKRLYGIQFHPEVRHSVYGNDILKNFAISICGGRGDWSMDNFIDMQIAKIRETVGDRKVLLGLSGGVDSSVVGVLLQKAIGDQLTCIFVDHGLLRKNEGDQVMEMLGGRFGLNIIRVDASKRFLDLLAGVEDPEKKRKIIGNEFVYVFDDEASKLK-GVDFLAQGTLYTDIIESGTETAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGTALGMPDEVVWRQPFPGPGLAIRVMGEITAEKLETVRESDAILREEIAK--AGLERDVWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAQLPWEVLKKISVRIVNEVDHVNRIVYDITSKPPATVEWE 515
>gi|163782973|ref|ZP_02177968.1| GMP synthase [Hydrogenivirga sp. 128-5-R1-1] >gi|159881653|gb|EDP75162.1| GMP synthase [Hydrogenivirga sp. 128-5-R1-1] (510 aa)
Score = 1331, Expect = 1.1e-144, Identities = 258/508 (50%), Positives = 357/508 (70%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L+++FG QY QLIARRIR+L VYSEIV +D  +EEI  K P G+I SGG  SVY + +  P+  I+DL +PILGICYG QV+  + GG+VE   D +EYG   +R+   + +FE I  + + WMSH+D V  LP+GF+ +A ++    A   + +++FYG QFHPEV  T +G +LL NFVY +C    +WE  +   EK++EI+  V D +V+ A+SGGVDS VA+VL  +AIGD+L+C F+DHGLLR  E +EV   L+ L G  + +VD   LFL +LKGV DPE+KRKIIG TFI+VFE+ A  +    ++LLQGT+YPD+VES G K S  IK+HHNVGGLPE++  +LLEP + LFKDEVR++G  L IP   + R PFPGPGLA+R+LGE+  + LE++R+AD +F   I++L +N  + + WQ F VL   +SVGV+GD R+Y   +ALRAV+S D M+A WY+ P + L+ +   I N+V+ + RVVYD+++KPP TIEWE
  S:     6 VLVVNFGSQYVQLIARRIRELGVYSEIVHWDTLLEEIRGKEPYGLIFSGGPASVYSEDAPLPDPNIYDLGVPILGICYGLQVIAYQLGGKVEK-SDHQEYGRARLRVIKRDTIFEGIPDEFDVWMSHADKVSDLPEGFETLAISDNSPHAVIASSDRRFYGFQFHPEVVHTAYGKELLANFVYGVCGAHRNWEMGDFIEEKVKEIRETVGDAHVIAALSGGVDSTVASVLVHRAIGDRLHCFFIDHGLLRLGEREEVEKNLRAL-GLPLKVVDASDLFLERLKGVEDPEEKRKIIGNTFIKVFEREARNVEGA-EFLLQGTLYPDVVESAGIKGSAKIKTHHNVGGLPEKMHLKLLEPFRELFKDEVREIGKLLGIPTDILGRHPFPGPGLAIRILGEVNREDLEVLRKADSIF---IEELKRNGFYDRIWQAFAVLLPIRSVGVMGDVRTYEKVIALRAVESTDGMTADWYRFPYDFLDHVMRRIINEVRGVGRVVYDVSSKPPSTIEWE 510
>gi|87119585|ref|ZP_01075482.1| bifunctional GMP synthase/glutamine amidotransferase protein [Marinomonas sp. MED121] >gi|86165061|gb|EAQ66329.1| bifunctional GMP synthase/glutamine amidotransferase protein [Marinomonas sp. MED121] (525 aa)
Score = 1330, Expect = 1.4e-144, Identities = 266/509 (52%), Positives = 355/509 (69%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENI--ELDNN------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R++ VY E+  +D+  +EII+  PKGIIL+GG +SV    S +  + ++ L +P+LGICYG Q M ++ GG+VE+  +  E+G   IR   +  L  +I   + NN       WMSH D V  +P  F ++AST  C +A   N  KKFYG+QFHPEVT T  G  LL  FV  IC+    W P NI  + IE ++  V D  VL A+SGGVDS V A L  +AIGD+L CVFVD+GLLR NE  +V A+  + +G  +  VD + LFLS+LKG  DPE KRKIIG +FIE+F++ ++K+N   ++L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++ EL+EPL+ LFKDEVRKLGL+L +PY  VYR PFPGPGL VR+LGE+ +D  +I+R AD +F   I++L ++  + K  Q F V    KSVGVVGD R Y Y +ALRAV+++D M+A+W  +P E LE +S  I N++++ISRV YD+++KPP TIEWE
  S:     9 KILILDFGSQYTQLIARRVREIGVYCEVRAFDMEDQEIIEFAPKGIILAGGPESVTEAGSPRAPESVFTLGVPVLGICYGMQTMSEQLGGKVES-SELREFGYAQIRTHGDTGLLTDIVDHVANNGVHLLDVWMSHGDKVTEMPTDFALMASTESCPIAGMANEAKKFYGLQFHPEVTHTKQGGALLSRFVVDICECETLWTPDNIATDAIERMREQVGDKQVLLALSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLNEGDQVMAMFAENMGVKVIRVDAEDLFLSRLKGEADPEAKRKIIGNSFIEIFDEESSKLN-EIEFLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMKMELVEPLRELFKDEVRKLGLALGLPYDMVYRHPFPGPGLGVRILGEVKKDYADILRRADAIF---IEELRRSGWYDKTSQAFAVFLPVKSVGVVGDGRRYEYVVALRAVETIDFMTARWAHLPYELLETVSGRIINEIEHISRVTYDVSSKPPATIEWE 525
>gi|90962508|ref|YP_536424.1| bifunctional GMP synthase/glutamine amidotransferase protein [Lactobacillus salivarius UCC118] >gi|90821702|gb|ABE00341.1| GMP synthase [Lactobacillus salivarius UCC118] (518 aa)
Score = 1330, Expect = 1.4e-144, Identities = 258/510 (50%), Positives = 362/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQE-NGGQVENDKDSEEYGSTDIRLTTNE--LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKI++LDFG QY QLI RRIR+  VYSE++ + ++  +I + NPKGII SGG +SVY D + + +  I++L IPILGICYG Q+M    +GG+VE+  D++EYG   I +   E  +F+++      WMSH D V  +P+GF+V A+++ C +++  N  KKFYG+QFH EV  T +GN +L++F + +C    +W   +    +I++I+  V D  VL  +SGGVDS V  VL  +AIG++L  +FVDHGLLRK E+++V   L    G NI  VD K+ FL+KL GV DPE+KRKIIG  FI VF+  + K+    ++L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR+LG  L +P++ V+RQPFPGPGL +RV+GEITE+KLEIVR++D + R  I +     + + WQYFTVL   +SVGV+GD R+Y YT+ +RAV S+D M+A + +IP + L++IS  I N+V +++RVVYDIT+KPP TIEWE
  S:    10 DKIIVLDFGSQYNQLITRRIREFGVYSELLSHKLTAAQIKEMNPKGIIFSGGPNSVYDDGAFQIDPEIFELGIPILGICYGMQLMAHNLSGGKVES-ADNKEYGKAIITVKNQENVMFKDLPETQTVWMSHGDLVTQVPEGFEVTATSDNCPISAMANDAKKFYGLQFHTEVRNTEYGNDILRHFAFDVCQARSNWSMDDFIDMQIQKIRETVGDKKVLLGLSGGVDSSVVGVLLHKAIGNQLTSIFVDHGLLRKGEAEQVMDSLGGKFGLNIIKVDAKERFLNKLAGVSDPEKKRKIIGNEFIRVFDDESAKLE-GIEFLAQGTLYTDIIESGTDTAQTIKSHHNVGGLPEDVQFKLIEPLNTLFKDEVRELGEKLGMPHELVWRQPFPGPGLGIRVIGEITEEKLEIVRDSDLILREEIAK--HGLDKEIWQYFTVLPGIRSVGVMGDGRTYDYTVGIRAVTSIDGMTADFAQIPWDVLQEISVRIVNEVDHVNRVVYDITSKPPATIEWE 518
>gi|154503546|ref|ZP_02040606.1| hypothetical protein RUMGNA_01370 [Ruminococcus gnavus ATCC 29149] >gi|153795646|gb|EDN78066.1| hypothetical protein RUMGNA_01370 [Ruminococcus gnavus ATCC 29149] (515 aa)
Score = 1329, Expect = 1.7e-144, Identities = 263/508 (51%), Positives = 359/508 (70%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL--TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALL--KKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG-SKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +++LDFGGQY QL+ARR+R+ NVY EI  Y   +++I   NPKGIIL+GG +S Y   S    K +++L IP+LG+CYG Q+MM   GG+V+   D  EYG T++ +   ++++FE +     CWMSH D +  +  GF++ A T  C VA+A N EK+ Y +QFHPEV  T  G ++L NFV ++C  AGDW+        I+EI++ V D  VLCA+SGGVDS VAAV+ ++AIG++L CVFVDHGLLRKNE  EV A+   +     N   V+ +Q F  KL GV +PEQKRKIIG+ FI VFE+ A KI     +L+QGTIYPD+VESG    S  IKSHHNVGGLP+ + F E++EPL+ LFKDEVRK GL L +P + V+RQPFPGPGL +R++GE+TE+K++IV++AD ++R  +D    N      QYF  LTN +SVGV+GD R+Y Y +ALRAV+++D M+A+  +IP E L K++S I N+V +++RVVYD+T KPPGTIE+E
  S:     6 VIVLDFGGQYNQLVARRVRECNVYCEIYSYKTDLQKIKDMNPKGIILTGGPNSCYEADSPTYTKELFELGIPVLGLCYGAQLMMHVLGGEVKR-ADVREYGKTEVLIDKASSKVFEGVSASTICWMSHFDYIAQIAPGFEITAHTADCPVAAAENAEKQLYAIQFHPEVLHTVQGKEMLSNFVRNVCGCAGDWKMDEFVENSIKEIRAKVGDGKVLCALSGGVDSSVAAVMLSKAIGNQLTCVFVDHGLLRKNEGDEVEAIFGPEGDYDLNFIRVNAQQRFYEKLAGVTEPEQKRKIIGEEFIRVFEEEAKKIGT-VDFLVQGTIYPDVVESGLGGESAVIKSHHNVGGLPDYVDFKEIIEPLRDLFKDEVRKAGLELGLPERLVFRQPFPGPGLGIRIIGEVTEEKVKIVQDADAIYREEMDAAGMNKTVG--QYFAALTNMRSVGVMGDERTYDYAVALRAVNTIDFMTAESAEIPWEVLHKVTSRIVNEVNHVNRVVYDLTGKPPGTIEFE 515
>gi|171779380|ref|ZP_02920344.1| hypothetical protein STRINF_01225 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281997|gb|EDT47428.1| hypothetical protein STRINF_01225 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (520 aa)
Score = 1329, Expect = 1.8e-144, Identities = 256/511 (50%), Positives = 348/511 (68%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + KI++LD+G QY QLIARRIR+  V+SE+  + I+ +E+   NP GI+LSGG +SVY D +   ++ I++L IPILGICYG Q++  + GG+V         EYG + +RL   +ELF     +    MSH D+V  +P GF ++  +  C  A+  N EKK +G+QFHPEV  + +G  +L+NF + IC   GDW   N    +I EI+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E  +V  +L    G NI  VD  + FL  L GV DPE+KRKIIG  F+ VF+  A K+     +L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG +LD+P + V+RQPFPGPGLA+RV+GEIT ++LE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + +IP + L+KIS  I N+V +++R+VYDIT+KPP T+EWE
  S:    10 VQKIIVLDYGSQYNQLIARRIREFGVFSELRSHKITADEVRAINPIGIVLSGGPNSVYADNAFGIDEEIFELGIPILGICYGMQLLTDKLGGKVVPAGQTGHSEYGQSTLRLKAKSELFAETPDEQTVLMSHGDAVTEIPAGFHLVGDSADCPYAAIENTEKKIFGIQFHPEVRHSVYGKDILRNFAFRICGAKGDWSMDNFIDLQINEIRQKVGDRKVLLGLSGGVDSSVVGVLLQRAIGDQLTCIFVDHGLLRKGEGDQVMNMLGGKFGLNIIRVDASKRFLDLLAGVDDPEKKRKIIGNEFVSVFDDEARKLK-GVDFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGTALDMPDEIVWRQPFPGPGLAIRVMGEITAERLETVRESDAILREEIAK--AGLDRDIWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFARIPWDVLQKISVRIVNEVDHVNRIVYDITSKPPATVEWE 520
>gi|22299961|ref|NP_683208.1| bifunctional GMP synthase/glutamine amidotransferase protein [Thermosynechococcus elongatus BP-1] >gi|44887998|sp|Q8DGA5|GUAA_SYNEL GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|22296146|dbj|BAC09970.1| GMP synthetase [Thermosynechococcus elongatus BP-1] (535 aa)
Score = 1329, Expect = 1.9e-144, Identities = 254/508 (50%), Positives = 352/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYID--QLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+  VYSE++ Y  + E++ +  PKGIILSGG +SVY + + + +  IW+L IPILG+CYG Q+M+Q+ GG VE    + EYG   + +    +L  N+E +   WMSH DSV  LP GF+V+A T+   +A+  + E+K YGVQFHPEV  +  G  L++NFVY ICD    W       E I E+++ V D  VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +  L ++     +  V+ +  FL++L GV DPE+KRK IG  FI VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLPE L+F+L+EPL+ LFKDEVR++G SL +P + V R PFPGPGLA+R+LGE+T ++LEI+R+AD + R  I+  Q+Y    H+ WQ F VL   ++VGV+GD R+Y Y + LR V S D M+A W ++P + LE+IS+ I N+V  ++RVVYDIT+KPPGTIEWE
  S:    22 IVILDFGSQYSELIARRIRETQVYSEVISYRTTAEQLAQLAPKGIILSGGPNSVYDENAPQCDPEIWNLGIPILGVCYGMQLMVQQLGGTVER-AIAGEYGKAALFIDDPTDLLTNVEQETIMWMSHGDSVTELPPGFRVLAHTDNTPIAAIAHPERKLYGVQFHPEVVHSVGGIALIRNFVYHICDCEPTWTTAAFVEEAIREVRAKVGDKRVLLALSGGVDSSTLAFLLHRAIGDQLTCMFIDQGFMRKGEPERLLKLFQEQFHIKVEYVNARDRFLAQLVGVTDPEEKRKRIGHEFIRVFEEESQRLG-PFDYLAQGTLYPDVIESANTNIDPQTGERVAVKIKSHHNVGGLPENLRFKLVEPLRKLFKDEVRQVGRSLGLPEEIVQRHPFPGPGLAIRILGEVTPERLEILRDADLIVRQEINRAQMY----HELWQAFAVLLPIRTVGVMGDQRTYAYPVVLRFVTSEDGMTADWARVPYDLLERISNRIVNEVPGVNRVVYDITSKPPGTIEWE 535
>gi|189499321|ref|YP_001958791.1| GMP synthase, large subunit [Chlorobium phaeobacteroides BS1] >gi|189494762|gb|ACE03310.1| GMP synthase, large subunit [Chlorobium phaeobacteroides BS1] (514 aa)
Score = 1328, Expect = 2.1e-144, Identities = 259/511 (50%), Positives = 369/511 (72%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE------LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNK---CLVASACNREK-KFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           M  +L+LDFG QYTQLIARRIR++ +YSEIV Y+  +E+I + NP  IILSGG  SVYG+ +  P++GI+ L +PILGICYG QV+    GG V++    +E+G  +I++  ++      LF++I  D++ WMSH D V+ +P+GF+V AS+     C + ++ ++   K +G+QFHPEV  T +G QLL NF+  I  +  DW PK+    +IEEI++ V  + V+C ISGGVDS VAAVL ++AIG +L+CVFVD+GLLRK+E  +V  +LK L G ++ LVD +++FL +LK +  PE+KRKIIG+TFI +FE+  ++     K+L+QGT+YPD++ES S    S+TIKSHHNVGGLP+R++ +L+EPL+ LFKDEVR +G  L I    + R PFPGPGLAVRVLG +++ +L+I+R+AD +F   +    +N  H  WQ F+VL   +SVGV+GD R+Y   LALRAV+S D M+A W  +P E L ++S+ I N+V+ I+RV YDI++KPP TIEWE
  S:     1 MHSVLVLDFGSQYTQLIARRIREIGIYSEIVPYNTPLEKIREHNPGAIILSGGPSSVYGESAFHPDEGIFKLGVPILGICYGLQVIATHFGGSVDSSA-KQEFGRAEIQVERHDGNPQSMLFKDIP-DSHVWMSHGDKVVRMPEGFRVTASSGNSEMCAIEASGDKAALKVFGLQFHPEVQHTLYGKQLLSNFLLDIAGLTPDWSPKSFIEHQIEEIRTTVGKNTVICGISGGVDSTVAAVLVSKAIGKQLHCVFVDNGLLRKHEGDKVMKILKPL-GLSVNLVDAEEIFLKRLKSIASPEKKRKIIGRTFIHIFEEQIHE----EKFLVQGTLYPDVIESVSVKGPSETIKSHHNVGGLPKRMKLKLIEPLRELFKDEVRAVGRELGIDEDILMRHPFPGPGLAVRVLGSVSKTRLDILRDADEIFLEELKS--QNLYHHVWQAFSVLLPVQSVGVMGDKRTYENVLALRAVESSDGMTADWAHLPHEFLSRVSNRIINEVRGINRVAYDISSKPPATIEWE 514
>gi|90021107|ref|YP_526934.1| bifunctional GMP synthase/glutamine amidotransferase protein [Saccharophagus degradans 2-40] >gi|89950707|gb|ABD80722.1| GMP synthase (glutamine-hydrolyzing) [Saccharophagus degradans 2-40] (542 aa)
Score = 1328, Expect = 2.2e-144, Identities = 263/509 (51%), Positives = 357/509 (70%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIE--LDN------NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS-EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VYSEI  +D+S EEI +  PKGIIL+GG +SV    S +  + +++L IP+LGICYG Q M ++ GG+VE+  + +E+G   +++     L ++I+  +D+      + WMSH D V+ +P+ F ++AST  C +A     EKKFYGVQFHPEVT T  G ++ ++F   +C     W   NI  + I  +++ V DD VL  +SGGVDS V A L  +AIGDKL CVFVD+GLLRKNE  +V  +  K +G  +   D   LFL  L G  DPE+KRKIIG TFI++F++ A+K+    K+L QGTIYPD++ES  SK  K   IKSHHNVGGLPE +QFEL+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  EI+READ +F   +++L+     HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LEK+S+ I N++  +SRV YD+++KPP TIEWE
  S:    26 RILILDFGSQYTQLIARRVREVGVYSEIRAWDVSDEEIKEFAPKGIILAGGPESVTAGFSPRAPQLVFELGIPVLGICYGMQTMAEQLGGKVES-SNVQEFGYAQVKIENECALIKDIKDHVDDGGAALLDVWMSHGDKVVAMPEQFTLMASTPSCPIAGMAWEEKKFYGVQFHPEVTHTLQGKRIFEHFALELCGCEALWTAANIVEDAIGRVRAQVGDDKVLLGLSGGVDSSVVAALLHKAIGDKLTCVFVDNGLLRKNEGDQVMDMFAKNMGVKVIRADAADLFLGNLAGESDPEKKRKIIGNTFIDIFDQEASKLK-DVKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPEDMQFELVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYAEILREADAIF---LEELHAAGWYHKTSQAFAVFVPVKSVGVVGDARRYAWVIALRAVETIDFMTARWAHLPYELLEKVSNRIINEISGVSRVTYDVSSKPPATIEWE 542
>gi|119356142|ref|YP_910786.1| bifunctional GMP synthase/glutamine amidotransferase protein [Chlorobium phaeobacteroides DSM 266] >gi|119353491|gb|ABL64362.1| GMP synthase (glutamine-hydrolyzing) [Chlorobium phaeobacteroides DSM 266] (513 aa)
Score = 1328, Expect = 2.3e-144, Identities = 267/511 (52%), Positives = 362/511 (70%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-----LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNK---CLVASACNREK-KFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP-WQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           M  + +LDFG QYTQLIARRIR+L +YSEI+ Y+ S E I + +PK IILSGG  SVYGD ++ P+ G++ L +P+LGICYG Q + +  GG+V      +E+G   + ++ NE     LF NI  D++ WMSH D V+ LP+GF+V AS+     C + S  ++   K YG+QFHPEV  T +G QLL NF+  I  +  DW PK+    +IEEI++    D V+C ISGGVDS VAAVL +QAIG +L+CVFVD+GLLRKNE+ +V   LK L G ++ L D   LFL +L  V  PE+KRKIIG+TFI VFE+  N+     KYL+QGT+YPD++ES S    S+TIKSHHNVGGLP+R++ +L+EPL+ LFKDEVR +G  L I    + R PFPGPGLAVRVLG ++  +L+I+READ +F   I++L  +  ++  WQ F+VL   +SVGV+GD R+Y   LALRAV+S D M+A W ++P + L ++S+ I N+V+ I+RV YDI++KPP TIEWE
  S:     1 MQSVTVLDFGSQYTQLIARRIRELGIYSEILPYNASPETIREHDPKAIILSGGPTSVYGDSALLPDGGVFMLGVPVLGICYGLQAIAKHFGGEVAGSS-KQEFGRAKMLVSHNEESESPLFRNIP-DSDVWMSHGDKVVRLPEGFRVTASSENSEMCALESYGSKAALKVYGLQFHPEVQHTLYGKQLLSNFLIDIAGIKPDWSPKSFIGHQIEEIRARAGKDKVICGISGGVDSTVAAVLVSQAIGKQLHCVFVDNGLLRKNEAVKVMNFLKPL-GLSVTLADASDLFLKRLDKVASPEKKRKIIGRTFIHVFEQHLNE----EKYLVQGTLYPDVIESVSVKGPSETIKSHHNVGGLPKRMKLKLIEPLRELFKDEVRAVGRELGIAEDILMRHPFPGPGLAVRVLGSVSRPRLDILREADEIF---IEELKTSGLYQHVWQAFSVLLPVQSVGVMGDKRTYENVLALRAVESTDGMTADWAQLPHDFLARVSNRIINEVRGINRVAYDISSKPPATIEWE 513
>gi|15675169|ref|NP_269343.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus pyogenes M1 GAS] >gi|19746136|ref|NP_607272.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus pyogenes MGAS8232] >gi|56808413|ref|ZP_00366163.1| COG0519: GMP synthase, PP-ATPase domain/subunit [Streptococcus pyogenes M49 591] >gi|71903556|ref|YP_280359.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus pyogenes MGAS6180] >gi|71910732|ref|YP_282282.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus pyogenes MGAS5005] >gi|94994464|ref|YP_602562.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus pyogenes MGAS10750] >gi|54037233|sp|P64300|GUAA_STRP8 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|54041337|sp|P64299|GUAA_STRP1 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|91206834|sp|Q48TF6|GUAA_STRPM GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|13622332|gb|AAK34064.1| putative GMP synthase [Streptococcus pyogenes M1 GAS] >gi|19748312|gb|AAL97771.1| putative GMP synthase [Streptococcus pyogenes MGAS8232] >gi|71802651|gb|AAX72004.1| glutamine-hydrolyzing GMP synthase [Streptococcus pyogenes MGAS6180] >gi|71853514|gb|AAZ51537.1| GMP synthase (glutamine-hydrolyzing) [Streptococcus pyogenes MGAS5005] >gi|94547972|gb|ABF38018.1| GMP synthase (glutamine-hydrolyzing) [Streptococcus pyogenes MGAS10750] (520 aa)
Score = 1328, Expect = 2.5e-144, Identities = 256/511 (50%), Positives = 354/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + KI++LD+G QY QLIARRIR+  V+SE+  + I+ +E+ + NP GI+LSGG +SVY D +   +  I++L IPILGICYG Q++  + GG+V       + EYG + + L  T++LF     +    MSH D+V  +P+GF ++  +N C  A+  N EK  YG+QFHPEV  + +GN +L+NF  SIC   GDW   N    +I +I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK+E  +V  +L    G NI  VD  + FL  L  V DPE+KRKIIG  F+ VF+  A+K+     +L QGT+Y DI+ESG++ ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG++L +P + V+RQPFPGPGLA+RV+G ITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + ++P + L+KIS+ I N+V +++R+VYDIT+KPP T+EWE
  S:    10 VQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGIDPEIFELGIPILGICYGMQLITHKLGGKVVPAGQAGNREYGQSTLHLRETSKLFSGTPQEQLVLMSHGDAVTEIPEGFHLVGDSNDCPYAAIENTEKNLYGIQFHPEVRHSVYGNDILKNFAISICGARGDWSMDNFIDMEIAKIRETVGDRKVLLGLSGGVDSSVVGVLLQKAIGDQLTCIFVDHGLLRKDEGDQVMGMLGGKFGLNIIRVDASKRFLDLLADVEDPEKKRKIIGNEFVYVFDDEASKLK-GVDFLAQGTLYTDIIESGTETAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGIALGMPEEIVWRQPFPGPGLAIRVMGAITEEKLETVRESDAILREEIAK--AGLDRDVWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAQLPWDVLKKISTRIVNEVDHVNRIVYDITSKPPATVEWE 520
>gi|126660833|ref|ZP_01731927.1| bifunctional GMP synthase/glutamine amidotransferase protein [Cyanothece sp. CCY0110] >gi|126617884|gb|EAZ88659.1| bifunctional GMP synthase/glutamine amidotransferase protein [Cyanothece sp. CCY0110] (542 aa)
Score = 1327, Expect = 2.7e-144, Identities = 252/508 (49%), Positives = 353/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+  VYSE++ Y  + E++ + NPKGIILSGG +SVY +R+ + +  IW+L IP+LG+CYG Q+M+++ GGQVE     E YG   +R+    +L  N+E  +  WMSH DS   LP+GF ++A T   L A+  + EKK +GVQFHPEV  +  G  L++NFVY IC+    W  +    E I EI++ V+D  VL A+SGGVDS   A L  QAIGD L C+F+D G +RK E + +  +  K     +  V+ +  FL +L+GV+DPE+KR++IG  FI+VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRK+G S+ +P + V R PFPGPGLA+R++GE+T ++L I+R+ADF+ R  I +  +   H  WQ F VL   +SVGV+GD R+Y + + LR + S D M+A W K+P + LE IS+ I N+VK ++RVVYDIT+KPPGTIEWE
  S:    29 IVILDFGSQYSELIARRIRETQVYSEVLSYRTTAEKLRQLNPKGIILSGGPNSVYDNRAPQCDPDIWELGIPVLGVCYGMQLMVKQLGGQVEKAVRGE-YGKASLRIDDPTDLLTNVEDGSIMWMSHGDSCTRLPEGFSILAHTENTLCAAIADHEKKLFGVQFHPEVVHSVDGIALIRNFVYHICECEPTWTTEAFVDETIREIRAKVRDKRVLLALSGGVDSSTLAFLLHQAIGDNLTCMFIDQGFMRKGEPERLMDIFDKQFHIPVEYVNARDRFLKQLEGVIDPEKKRRLIGHEFIQVFEEESKRLG-PFDYLAQGTLYPDVIESADTNIDPKTGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRSIGLPEEIVRRHPFPGPGLAIRIIGEVTSERLNILRDADFVVRDEIGK--QGMYHDFWQAFAVLLPIRSVGVMGDQRTYAHPIVLRLISSEDGMTADWSKVPYDLLETISNRIVNEVKGVNRVVYDITSKPPGTIEWE 542
>gi|50914254|ref|YP_060226.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus pyogenes MGAS10394] >gi|73919721|sp|Q5XC20|GUAA_STRP6 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|50903328|gb|AAT87043.1| GMP synthase [glutamine-hydrolyzing] [Streptococcus pyogenes MGAS10394] (520 aa)
Score = 1327, Expect = 2.7e-144, Identities = 256/511 (50%), Positives = 354/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + KI++LD+G QY QLIARRIR+  V+SE+  + I+ +E+ + NP GI+LSGG +SVY D +   +  I++L IPILGICYG Q++  + GG+V       + EYG + + L  T++LF     +    MSH D+V  +P+GF ++  +N C  A+  N EK  YG+QFHPEV  + +GN +L+NF  SIC   GDW   N    +I +I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK+E  +V  +L    G NI  VD  + FL  L  V DPE+KRKIIG  F+ VF+  A+K+     +L QGT+Y DI+ESG++ ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG++L +P + V+RQPFPGPGLA+RV+G ITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + ++P + L+KIS+ I N+V +++R+VYDIT+KPP T+EWE
  S:    10 VQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGIDPEIFELGIPILGICYGMQLITHKLGGKVVPAGQAGNREYGQSTLHLRETSKLFSGTPQEQLVLMSHGDAVTEIPEGFHLVGDSNDCPYAAIENTEKNLYGIQFHPEVRHSVYGNDILKNFAISICGARGDWSMDNFIDMEIAKIRETVGDRKVLLGLSGGVDSSVVGVLLQKAIGDQLTCIFVDHGLLRKDEGDQVMGMLGGKFGLNIIRVDASKRFLDLLADVEDPEKKRKIIGNEFVYVFDDEASKLK-GVDFLAQGTLYTDIIESGTETAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGIALGMPEEIVWRQPFPGPGLAIRVMGPITEEKLETVRESDAILREEIAK--AGLDRDVWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAQLPWDVLKKISTRIVNEVDHVNRIVYDITSKPPATVEWE 520
>gi|21910381|ref|NP_664649.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus pyogenes MGAS315] >gi|28895957|ref|NP_802307.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus pyogenes SSI-1] >gi|25452983|sp|Q8K7E6|GUAA_STRP3 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|21904578|gb|AAM79452.1| putative GMP synthase [Streptococcus pyogenes MGAS315] >gi|28811207|dbj|BAC64140.1| putative GMP synthase [Streptococcus pyogenes SSI-1] (520 aa)
Score = 1327, Expect = 2.7e-144, Identities = 256/511 (50%), Positives = 354/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + KI++LD+G QY QLIARRIR+  V+SE+  + I+ +E+ + NP GI+LSGG +SVY D +   +  I++L IPILGICYG Q++  + GG+V       + EYG + + L  T++LF     +    MSH D+V  +P+GF ++  +N C  A+  N EK  YG+QFHPEV  + +GN +L+NF  SIC   GDW   N    +I +I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK+E  +V  +L    G NI  VD  + FL  L  V DPE+KRKIIG  F+ VF+  A+K+     +L QGT+Y DI+ESG++ ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG++L +P + V+RQPFPGPGLA+RV+G ITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + ++P + L+KIS+ I N+V +++R+VYDIT+KPP T+EWE
  S:    10 VQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELHEINPIGIVLSGGPNSVYADNAFGIDPEIFELGIPILGICYGMQLITHKLGGKVVPAGQAGNREYGQSTLHLRETSKLFSGTPQEQLVLMSHGDAVTEIPEGFHLVGDSNDCPYAAIENTEKNLYGIQFHPEVRHSVYGNDILKNFAISICGARGDWSMDNFIDMEITKIRETVGDRKVLLGLSGGVDSSVVGVLLQKAIGDQLTCIFVDHGLLRKDEGDQVMGMLGGKFGLNIIRVDASKRFLDLLADVEDPEKKRKIIGNEFVYVFDDEASKLK-GVDFLAQGTLYTDIIESGTETAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGIALGMPEEIVWRQPFPGPGLAIRVMGAITEEKLETVRESDAILREEIAK--AGLDRDVWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAQLPWDVLKKISTRIVNEVDHVNRIVYDITSKPPATVEWE 520
>gi|139473722|ref|YP_001128438.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus pyogenes str. Manfredo] >gi|134271969|emb|CAM30207.1| GMP synthase [Streptococcus pyogenes str. Manfredo] (520 aa)
Score = 1327, Expect = 2.8e-144, Identities = 256/511 (50%), Positives = 354/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + KI++LD+G QY QLIARRIR+  V+SE+  + I+ +E+ + NP GI+LSGG +SVY D +   +  I++L IPILGICYG Q++  + GG+V       + EYG + + L  T++LF     +    MSH D+V  +P+GF ++  +N C  A+  N EK  YG+QFHPEV  + +GN +L+NF  SIC   GDW   N    +I +I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK+E  +V  +L    G NI  VD  + FL  L  V DPE+KRKIIG  F+ VF+  A+K+     +L QGT+Y DI+ESG++ ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG++L +P + V+RQPFPGPGLA+RV+G ITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + ++P + L+KIS+ I N+V +++R+VYDIT+KPP T+EWE
  S:    10 VQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGIDPEIFELEIPILGICYGMQLITHKLGGKVVPAGQAGNREYGQSTLHLRETSKLFSGTPQEQLVLMSHGDAVTEIPEGFHLVGDSNDCPYAAIENTEKNLYGIQFHPEVRHSVYGNDILKNFAISICGARGDWSMDNFIDMEIAKIRETVGDRKVLLGLSGGVDSSVVGVLLQKAIGDQLTCIFVDHGLLRKDEGDQVMGMLGGKFGLNIIRVDASKRFLDLLADVEDPEKKRKIIGNEFVYVFDDEASKLK-GVDFLAQGTLYTDIIESGTETAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGIALGMPEEIVWRQPFPGPGLAIRVMGAITEEKLETVRESDAILREEIAK--AGLDRDVWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAQLPWDVLKKISTRIVNEVDHVNRIVYDITSKPPATVEWE 520
>gi|157149979|ref|YP_001450409.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus gordonii str. Challis substr. CH1] >gi|157074773|gb|ABV09456.1| GMP synthase [Streptococcus gordonii str. Challis substr. CH1] (518 aa)
Score = 1327, Expect = 3.0e-144, Identities = 260/511 (50%), Positives = 351/511 (68%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++KI++LD+G QY QLI+RRIR++ V+SE+    IS  E+ + NP GIILSGG +SVY D S   +  I++L IPILGICYG Q++  + GG+V    D  + EYG + +  T++ LFE+   +    MSH D+V  +P  F    ++  C  A+  +  KK YG+QFHPEV  + FG  +L+NF  +IC   GDW   N    +I++I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+ +V  +L    G NI   D  + FL KL GV DPEQKRKIIG  F+ VF+  A+K+    K+L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QFEL+EPL  L+KDEVR LG  L +P + V+RQPFPGPGLA+RV+GEITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + KIP E L+KIS  I N+V +++R+VYDIT+KPP T+EWE
  S:     9 VEKIIVLDYGSQYNQLISRRIREIGVFSELKSNKISAAEVKEINPVGIILSGGPNSVYEDGSFDIDPEIFELGIPILGICYGMQLLTHKLGGKVVPAGDAGNREYGQSKLTRTSSPLFESTPEEQFVLMSHGDAVTEIPADFVRTGTSADCPFAAIEHPAKKIYGIQFHPEVRHSEFGYDILRNFALNICGAKGDWSMDNFIDMQIKQIRETVGDKRVLLGLSGGVDSSVVGVLLQKAIGDQLICIFVDHGLLRKGEADQVMEMLGGKFGLNIVKADAAKRFLDKLAGVSDPEQKRKIIGNEFVYVFDDEASKLK-DVKFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMQFELIEPLNTLYKDEVRALGTELGMPDEIVWRQPFPGPGLAIRVMGEITEEKLETVRESDAILREEIAK--AGLDRDIWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAKIPWEVLQKISVRIVNEVDHVNRIVYDITSKPPATVEWE 518
>gi|193213507|ref|YP_001999460.1| GMP synthase, large subunit [Chlorobaculum parvum NCIB 8327] >gi|193086984|gb|ACF12260.1| GMP synthase, large subunit [Chlorobaculum parvum NCIB 8327] (516 aa)
Score = 1327, Expect = 3.1e-144, Identities = 265/511 (51%), Positives = 362/511 (70%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE----LFENIELDNNCWMSHSDSVIFLPKGFKVIAST---NKCLVASACNREK-KFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +  +++LDFG QYTQLIARRIR++ +YSEI  Y  S EE+ K  PK IILSGG +SVY + +  P+  ++ L +P+LGICYG Q + +  GG VE+    +E+G   + ++ +E    LF++I  D++ WMSH D V  LP GF+V AST     C + S  ++   K +G+QFHPEV  + +G QLL NF+  I  +  DW PK+    +IEEIK +  D  V+C ISGGVDS VAAVL ++AIGDKL+CVFVD+GLLRK+E+ +V   LK L G  + L D   LFL +LKGV  PE+KRKIIG+TFI VFE+  +      K+L+QGT+YPD++ES S    S+TIKSHHNVGGLP+R++ +L+EPL+ LFKDEVR +G  L I    + R PFPGPGLAVRVLG +T+++L+++READ +F   ID+L ++  + K WQ F+VL   +SVGV+GD R+Y   LALRAV+S D M+A W  +P + L K+S+ I N+V+ I+RV YDI++KPP TIEWE
  S:     5 LQSVIVLDFGSQYTQLIARRIREIGIYSEIFPYHTSAEELKKHQPKAIILSGGPNSVYDETAFMPDPEVFSLGVPVLGICYGLQAIAKHFGGNVESSS-KQEFGRAKMLVSHDERESMLFKDIP-DSDVWMSHGDKVTKLPDGFRVTASTANAEMCAIESFGSKAALKVFGLQFHPEVQHSLYGKQLLSNFLIDIAGITPDWSPKSFIQHQIEEIKRVAGDSTVVCGISGGVDSTVAAVLVSKAIGDKLHCVFVDNGLLRKDEATKVMEFLKPL-GLKVTLADASDLFLGRLKGVASPEKKRKIIGRTFIRVFEENIHD----EKFLVQGTLYPDVIESVSVKGPSETIKSHHNVGGLPKRMKLKLIEPLRELFKDEVRAVGRELGIAEDILMRHPFPGPGLAVRVLGSLTKERLDVLREADQIF---IDELKESGLYQKVWQAFSVLLPVQSVGVMGDKRTYENVLALRAVESTDGMTADWAHLPHDFLSKVSNRIINEVRGINRVAYDISSKPPATIEWE 516
>gi|67921332|ref|ZP_00514851.1| GMP synthase, C-terminal:GMP synthase, N-terminal [Crocosphaera watsonii WH 8501] >gi|67857449|gb|EAM52689.1| GMP synthase, C-terminal:GMP synthase, N-terminal [Crocosphaera watsonii WH 8501] (515 aa)
Score = 1327, Expect = 3.2e-144, Identities = 252/508 (49%), Positives = 351/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+  VYSE++ Y  ++E++ + NPKGIILSGG +SVY DR+ + +  IW L IP+LG+CYG Q+M+++ GGQVE     E YG   + +    +L  N+E  +  WMSH DS   LP+GF ++A T   + A+  N EKK +GVQFHPEV  +  G  L++NFVY IC+    W  +    E I EI++ V D  VL A+SGGVDS   A L  QAIGDKL C+F+D G +RK E + +  +  +     +  V  +  FL+KL+G+ DPE+KR++IG  FI+VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRK+G S+ +P + V R PFPGPGLA+R++GE+T ++L I+R+ADF+ R  I +  +   H  WQ F VL   +SVGV+GD R+Y + + LR + S D M+A W K+P + LE IS+ I N+VK ++RVVYDIT+KPPGTIEWE
  S:     2 IVILDFGSQYSELIARRIRETQVYSEVLSYRTTVEKLRQLNPKGIILSGGPNSVYDDRAPQCDPEIWQLGIPVLGVCYGMQLMVKQLGGQVEKATRGE-YGKASLCIDDPTDLLTNVEDGSTMWMSHGDSCTRLPEGFSILAHTENTVCAAIANHEKKLFGVQFHPEVVHSVDGIALIRNFVYHICECEPTWTTEAFVDETIREIRAKVGDKRVLLALSGGVDSSTLAFLLHQAIGDKLTCMFIDQGFMRKGEPERLMDIFDRQFHIPVEYVHARDRFLNKLEGITDPEKKRRLIGHEFIQVFEEESKRLG-PFDYLAQGTLYPDVIESADTNVDPKTGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRSIGLPEEIVRRHPFPGPGLAIRIIGEVTSERLNILRDADFVVRDEIAK--QGMYHDFWQAFAVLLPVRSVGVMGDQRTYAHPIVLRLITSEDGMTADWAKVPYDLLEIISNRIVNEVKGVNRVVYDITSKPPGTIEWE 515
>gi|81096281|ref|ZP_00874628.1| GMP synthase, C-terminal:GMP synthase, N-terminal [Streptococcus suis 89/1591] >gi|146318527|ref|YP_001198239.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus suis 05ZYH33] >gi|146320723|ref|YP_001200434.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus suis 98HAH33] >gi|80977625|gb|EAP41161.1| GMP synthase, C-terminal:GMP synthase, N-terminal [Streptococcus suis 89/1591] >gi|145689333|gb|ABP89839.1| GMP synthase, PP-ATPase domain/subunit [Streptococcus suis 05ZYH33] >gi|145691529|gb|ABP92034.1| GMP synthase, PP-ATPase domain/subunit [Streptococcus suis 98HAH33] (516 aa)
Score = 1326, Expect = 3.4e-144, Identities = 254/511 (49%), Positives = 356/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + KI++LD+G QY QLI+RRIR+  V+SE+ ++ I+ EE+   NP GI+LSGG +SVY + +   +  I++L IPILGICYG Q++  + GG+V    +  + EYG ++++L T + LF     +    MSH D+V  +P  F ++  +  C  A+  N E++ YG+QFHPEV  + +GN +L+NF + IC   GDW  +N    +IE+I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRKNE  +V  +L    G NI  VD  + FL  L GV DPE+KRKIIG  F+ VF+  A+K+    ++L QGT+Y DI+ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG +L +P + V+RQPFPGPGLA+RV+GEITE+KL+ VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + K+P + L+KIS  I N+V +++R+VYDIT+KPP T+EWE
  S:     6 VQKIIVLDYGSQYNQLISRRIREFGVFSELKNHKITAEEVRAINPIGIVLSGGPNSVYAENAFDIDPEIFELGIPILGICYGMQLITHKLGGKVVPAGEAGNREYGQSNLQLKTESALFAGTPEEQLVLMSHGDAVTEIPADFHLVGLSADCPYAAIENTERRIYGIQFHPEVRHSVYGNDILKNFAFGICGAKGDWTMENFIETEIEKIRQTVGDKKVLLGLSGGVDSSVVGVLLQRAIGDQLTCIFVDHGLLRKNEGDQVMEMLGGKFGLNIIRVDAAKRFLDLLAGVSDPEKKRKIIGNEFVYVFDDEASKL-TDVEFLAQGTLYTDIIESGTDTAETIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRALGTALGMPDEVVWRQPFPGPGLAIRVMGEITEEKLQTVRESDAILREEIAK--AGLDRDVWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSVDGMTADFAKLPWDVLQKISVRIVNEVDHVNRIVYDITSKPPATVEWE 516
>gi|169335396|ref|ZP_02862589.1| hypothetical protein ANASTE_01808 [Anaerofustis stercorihominis DSM 17244] >gi|169258134|gb|EDS72100.1| hypothetical protein ANASTE_01808 [Anaerofustis stercorihominis DSM 17244] (515 aa)
Score = 1326, Expect = 4.1e-144, Identities = 269/508 (52%), Positives = 357/508 (70%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNEL-FENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALL--KKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +++LDFGGQY QLIARR+R+ NVY EI  Y IS+EE+ + NPKGII +GG +SVYG+ S    K +++  IPILGICYG Q+M  + GG VE    SE YG T++ L T+ L FE+I+  N CWMSH+D +   P+GFKV   T  C VA+  N++K  Y VQFHPEV  T  G +++ NF+Y+IC  +GDW+  +   + I+ IK  V +  VLCA+SGGVDS VAAV+ A+A+G +L CVFVDHGLLRKNE  EV A+         N    + +Q F  KL GV DPE KRKIIG+ FI VFE+ A KI     +L+QGTIYPD+VESG   S  IKSHHNVGGLP+ + F E++EPL+ LFKDEVRK G  L IP   V RQPFPGPGLA+R++GE+TE+K++IV++AD ++R  + +     +    QYF  LTN +SVGV+GD R+Y Y +ALRAV + D M+A+  K+P E L K+++ I N+V +++RV+YD T+KPPGTIE+E
  S:     8 VIVLDFGGQYNQLIARRVRECNVYCEIKPYTISLEELKELNPKGIIFTGGPNSVYGEDSATYTKEVFEAGIPILGICYGSQLMAHKLGGTVETAPVSE-YGHTEVELDTSSLLFEDIDEKNICWMSHTDYISKEPQGFKVTGKTPVCPVAAMENKDKNLYAVQFHPEVMHTKKGTKIISNFLYNICKCSGDWKMDSFVEDTIKNIKEKVGNGKVLCALSGGVDSSVAAVMLAKAVGKQLTCVFVDHGLLRKNEGDEVEAVFGPDGPYDLNFIRANVQQRFYDKLAGVTDPETKRKIIGEEFIRVFEEEAKKIGT-VDFLVQGTIYPDVVESGLDKSAVIKSHHNVGGLPDYVDFKEIIEPLRDLFKDEVRKAGKELGIPEYLVMRQPFPGPGLAIRIIGEVTEEKVKIVQDADAIYREEVAK--AGIDKDLGQYFAALTNMRSVGVMGDFRTYDYAIALRAVMTSDFMTAEAAKLPWEVLHKVTTRIVNEVDHVNRVLYDCTSKPPGTIEFE 515
>gi|124021760|ref|YP_001016067.1| bifunctional GMP synthase/glutamine amidotransferase protein [Prochlorococcus marinus str. MIT 9303] >gi|123962046|gb|ABM76802.1| Glutamine amidotransferase class-I:GMP synthase [Prochlorococcus marinus str. MIT 9303] (528 aa)
Score = 1326, Expect = 4.2e-144, Identities = 254/508 (50%), Positives = 346/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARR+R+  VYS ++ Y  S +E+ +  PKGIILSGG  SVY +R+   +  IWDL IP+LG+CYG Q+M+Q+ GG+VE      EYG   + +    +L  N+E  +  WMSH DSV  LP+GF  +A T     A+     +  YGVQFHPEV  +T G  L++NFVY IC    DW       E + +++S V D  VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +     +    N+  ++ +Q F+SKL G+VDPE+KRKIIG  FI VFE+ +N++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRK+G SL +P + V R PFPGPGLA+R+LGE+T++KL  +R+AD + R  I +  LY    H+ WQ F VL   +SVGV+GD R+Y + + LR V S D M+A W ++P E LE+IS+ I N+V+ ++RVV DIT+KPPGTIEWE
  S:    14 IVILDFGSQYSELIARRVRETEVYSLVMSYSTSADELRQLAPKGIILSGGPSSVYAERAPLCDPNIWDLGIPVLGVCYGMQLMVQQLGGRVEMATGKAEYGKAPLEIDDPTDLLTNVENGSTMWMSHGDSVRALPEGFVRLAHTANTPDAAVAYHTRSLYGVQFHPEVVHSTDGMSLIRNFVYHICGCEPDWTTTAFIEEAVSQVRSQVGDKRVLLALSGGVDSSTLAFLLKKAIGDQLTCMFIDQGFMRKGEPEFLMDFFDRKFNINVEYINARQRFISKLNGIVDPEEKRKIIGTEFIRVFEEESNRLG-PFDYLAQGTLYPDVIESAGTNIDPKTGERVAVKIKSHHNVGGLPKDLQFKLVEPLRRLFKDEVRKVGRSLGLPEEIVRRHPFPGPGLAIRILGEVTDEKLNCLRDADLIVREEIREAGLY----HEIWQAFAVLLPVRSVGVMGDQRTYAWPIVLRCVSSEDGMTADWSRLPDELLERISNRIVNEVRGVNRVVLDITSKPPGTIEWE 528
>gi|160913582|ref|ZP_02076272.1| hypothetical protein EUBDOL_00058 [Eubacterium dolichum DSM 3991] >gi|158434043|gb|EDP12332.1| hypothetical protein EUBDOL_00058 [Eubacterium dolichum DSM 3991] (513 aa)
Score = 1325, Expect = 5.3e-144, Identities = 258/510 (50%), Positives = 352/510 (69%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIK-KNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINV--PFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKI++LDFG QY QLIARRIR+  VYSE+  + ++I+EI    + KGII SGG +SVY + +   +  I++  IPILGICYG Q+  + NGG+V+   +++EYG  +IR+  +  LF+ +      WMSH D V  L  GF+  AS++ C  A+  N EK+ Y +QFHPEV  + FGN +L+NFV+ +C    DW  ++    +IE I+  V +D VL  +SGGVDS V A L  +AIGD+L C+F+DHGLLRK E++ V     + +  N+  +D K+ FLSKL GV DPE KRKIIG  F+  F++   K+      K+L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG +L +P + V+RQPFPGPGL +RVLGEITE+KL IVR++DF+ R  I +     E   WQYFT LTN +SVGV+GD R+Y Y +A+R V S+D M+  W KIP E L+ IS+ I N+V +++RV+YDIT KPP TIE+E
  S:     3 DKIIVLDFGSQYNQLIARRIREFGVYSELHPHTLTIDEIKAFGDVKGIIFSGGPNSVYDEHAYMCDPAIYEAGIPILGICYGMQMTHEMNGGKVKA-CEAKEYGRCEIRVDVDCPLFKGLPKKQIVWMSHGDQVAELADGFQKTASSDTCTFAATHNLEKQIYTLQFHPEVRHSEFGNDILRNFVFEVCHAKNDWSMESFIDVEIEAIRKKVGNDKVLLGLSGGVDSSVVAALLHKAIGDQLICMFIDHGLLRKGEAESVMETFGREMNINLVKIDAKERFLSKLVGVSDPEAKRKIIGNEFVYTFDEEVKKLTSGENIKWLAQGTLYTDVIESGTHTAQTIKSHHNVGGLPEDMQFQLIEPLNTLFKDEVRALGEALGLPSEMVWRQPFPGPGLGIRVLGEITEEKLTIVRDSDFILREEIAK--AGLERDIWQYFTALTNMRSVGVMGDQRTYDYAVAIRGVTSIDGMTGDWAKIPYEVLDIISTRIVNEVAHVNRVLYDITCKPPATIEFE 513
>gi|148651832|ref|YP_001278925.1| bifunctional GMP synthase/glutamine amidotransferase protein [Psychrobacter sp. PRwf-1] >gi|148570916|gb|ABQ92975.1| GMP synthase (glutamine-hydrolyzing) [Psychrobacter sp. PRwf-1] (532 aa)
Score = 1324, Expect = 6.3e-144, Identities = 257/510 (50%), Positives = 355/510 (69%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIE---LDNN---CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINV-----PFKYLLQGTIYPDIVESGSKF---SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D+ILI+D+G QY+QLIARR+R+  V+ E+  YDI    I     KG+ILSGG +SV+ + S + N+ ++DLN+PILGICYG Q M    GG+V+   D  E+G+  I +T +  L + IE    DN+    WMSH D V+  PKGF ++AST  C +A   N +KK+YG+QFHPEVT T  G+ LL  FV+ +C  AGDW P NI   ++E++K  + D  VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E  +V  +  + +G  +  VD +  FLS L G  +PE KRKIIGKTFI+VF   A  I+      P ++L QGTIYPD++ES       +  IKSHHNVGGLP+ LQFEL+EPL+ LFKDEVRKLG++L +P++ +YR PFPGPGL VR+LGE+ ++  +I+R+AD +F   +++       K  Q F V T  KSVGVVGD R Y + +ALRAV+++D M+A++  +P E +E +S+ I N++K++SRV YD+++KPP TIEWE
  S:    11 DRILIIDYGSQYSQLIARRVREAGVFCEMYPYDIDTSRIEAFGAKGVILSGGPESVHDENSPRINQALFDLNVPILGICYGMQAMADHFGGKVQA-SDVHEFGAATIDVTGHSALLDGIEDEHKDNSRLHVWMSHGDKVVEAPKGFDIVASTPSCPIAVMVNEDKKYYGLQFHPEVTHTLQGDVLLSRFVHQVCGCAGDWTPDNIIDMRVEQLKEQIGDKQVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLHEGDQVMQVFAENMGVKVVRVDAEDRFLSALAGESEPEAKRKIIGKTFIDVFADAARDISQGSDGKPVEFLAQGTIYPDVIESAKSHQGKAHVIKSHHNVGGLPDDLQFELVEPLRDLFKDEVRKLGIALGLPHKMIYRHPFPGPGLGVRILGEVKKEYADILRQADAIFMQELER--SGWYEKTAQAFAVFTPVKSVGVVGDGRRYAWVIALRAVETIDFMTARFAHLPYELIETVSNRIMNEIKDVSRVTYDVSSKPPATIEWE 532
>gi|51891639|ref|YP_074330.1| bifunctional GMP synthase/glutamine amidotransferase protein [Symbiobacterium thermophilum IAM 14863] >gi|81389576|sp|Q67S57|GUAA_SYMTH GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|51855328|dbj|BAD39486.1| GMP synthetase [Symbiobacterium thermophilum IAM 14863] (513 aa)
Score = 1324, Expect = 6.8e-144, Identities = 251/510 (49%), Positives = 352/510 (69%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE--LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP-WQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D I+++DFGGQY+ LIARR+R+  VY EI  +   ++   +   KGII SGG  SV    + + +  I++L IPILGICYG Q+M  + GG+V   +  E YG   +RL   E  L   +  ++  WMSH DSV  +P GF+V+ +T    VA   +  ++ YGVQFHPEV  T  G ++L+NF+++I    GDW  ++    ++EEI+  V    VLCA+SGGVDS VAAVL  +A+GD+L C+FVDHGL+RK E ++V    +     ++  VD  + FLSKL+GV DPEQKRKIIG  FI +FE  A K+     +L+QGT+YPD++ESG++ ++ IKSHHNVGGLPE ++F+L+EP + LFKDEVR +G +L +P + V R PFPGPGL VRVLGE+T +KLEI+READ   R +++++ K   +   WQ FTVL + +SVGV+GD R+Y Y + LRAV S DAM+A +Y++P + LE+I+S I N+V +++RVVYD+T+KPPGTIEWE
  S:     6 DLIVVVDFGGQYSHLIARRVREAQVYCEIWPFTAPVQRYREAGVKGIIFSGGPASVEQADAPRIDPAIYELGIPILGICYGMQLMALQLGGEVRRGQQGE-YGRATLRLADAEHPLLRGLGRESLVWMSHFDSVTRVPSGFRVLGATENTAVAVMGDDARRLYGVQFHPEVVHTAQGREILRNFLFNIAGCRGDWTTESFITRQVEEIRRQVGSGRVLCALSGGVDSSVAAVLVHKAVGDQLTCIFVDHGLMRKGEPEQVVRTFRDHFHIHLVHVDASERFLSKLRGVTDPEQKRKIIGNEFIRLFEDEARKLG-QIDFLVQGTVYPDVIESGTETARVIKSHHNVGGLPEDMRFQLIEPFRQLFKDEVRAVGRALGVPEEIVGRHPFPGPGLGVRVLGEVTPEKLEILREAD---RIFVEEIRKAGLYDELWQAFTVLPDVRSVGVMGDERTYAYPVVLRAVTSEDAMTADFYRLPWDLLERIASRIVNEVPHVNRVVYDVTSKPPGTIEWE 513
>gi|104773463|ref|YP_618443.1| bifunctional GMP synthase/glutamine amidotransferase protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513450|ref|YP_812356.1| bifunctional GMP synthase/glutamine amidotransferase protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103422544|emb|CAI97137.1| GMP synthase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116092765|gb|ABJ57918.1| GMP synthase (glutamine-hydrolyzing) [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (517 aa)
Score = 1324, Expect = 7.3e-144, Identities = 260/510 (50%), Positives = 354/510 (69%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE--LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS--EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKI++LDFG QY QLI RRIRD  +YSE++ + I+ EE+ K  PKGII SGG +SVY + ++  +  I++L IPILGICYG Q+M Q+ GG VE   ++E YGS  I +   +  L++ +      WMSH D V  +P+GF+V+AS+  C +AS  + ++KFY VQFH EV  + +G  +L+ F + +C    +W   +     ++ I+  V +  V+  ISGGVDS V A L  +AIG +L  +FVDHGLLRKNES EV A LK+ +G NI  VD K  F+SKL GV DPE+KRKIIG  F++VF   A KI    K+L QGT+Y D++ESG+  + TIKSHHNVGGLPE +QF+L+EPL+ LFKDEVR LG  L +P+  V+RQPFPGPGLA+RV+GEITE+KL IVR+AD + R  +    KN+  +   WQYF  L   +SVGV+GD R+Y Y + +RAV S+D M+A + +IP + L+KIS  I N+VK ++RV+YD+T+KPP TIE+E
  S:    10 DKIIVLDFGSQYNQLITRRIRDFGIYSELLPHTITAEEVKKIAPKGIIFSGGPNSVYDENALDVDPEIFELGIPILGICYGMQLMTQKLGGTVEKAGEAE-YGSAHIEVKEADSPLYKGLPEKQVVWMSHGDLVTKVPEGFEVLASSKNCPIASMADPDRKFYAVQFHAEVRNSEYGLDILRRFAFDVCGAKDNWTMDDFIKLSVDSIREEVGNANVILGISGGVDSSVTATLLHKAIGSQLTAIFVDHGLLRKNESDEVMAALKEGLGVNIVRVDAKDRFMSKLAGVTDPEKKRKIIGNEFVQVFNDEAKKIK-DAKFLAQGTLYTDVIESGTDTAHTIKSHHNVGGLPEDMQFKLIEPLRQLFKDEVRVLGEKLGLPHDLVWRQPFPGPGLAIRVIGEITEEKLRIVRDADAILREEV----KNAGLQESIWQYFVALPGMRSVGVMGDGRTYDYAVCIRAVTSIDGMTADFAQIPWDVLQKISVRIVNEVKQVNRVLYDVTSKPPATIEYE 517
>gi|172038179|ref|YP_001804680.1| GMP synthetase [Cyanothece sp. ATCC 51142] >gi|171699633|gb|ACB52614.1| GMP synthetase [Cyanothece sp. ATCC 51142] (542 aa)
Score = 1323, Expect = 8.3e-144, Identities = 250/508 (49%), Positives = 351/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+  VYSE++ Y  + +++ + NPKGIILSGG +SVY DR+ + +  IW L IP+LG+CYG Q+M+++ GGQVE     E YG   +R+    +L  N+E  +  WMSH DS   LP+GF ++A T   L A+  + +KK +GVQFHPEV  +  G  L++NFVY IC+    W  +    E I EI++ V+D  VL A+SGGVDS   A L  QAIGD L C+F+D G +RK E + +  +  K     +  V+ +  FL +L+GV DPE+KR++IG  FI+VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRK+G S+ +P + V R PFPGPGLA+R++GE+T ++L I+R+ADF+ R  I +  +   H  WQ F VL   +SVGV+GD R+Y + + LR + S D M+A W ++P + LE IS+ I N+VK ++RVVYDIT+KPPGTIEWE
  S:    29 IVILDFGSQYSELIARRIRETQVYSEVLSYRTTAQKLRQLNPKGIILSGGPNSVYDDRAPQCDPDIWQLGIPVLGVCYGMQLMVKQLGGQVEKALRGE-YGKASLRIDDPTDLLTNVEDGSTMWMSHGDSCTRLPEGFSILAHTENTLCAAIADHDKKLFGVQFHPEVVHSVDGIALIRNFVYHICECEPTWTTEAFVDETIREIRAKVRDKRVLLALSGGVDSSTLAFLLHQAIGDNLTCMFIDQGFMRKGEPERLMDIFDKQFHIPVEYVNARDRFLKQLEGVTDPEKKRRLIGHEFIQVFEEESKRLG-PFDYLAQGTLYPDVIESADTNIDPKTGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRSIGLPEEIVRRHPFPGPGLAIRIIGEVTSERLNILRDADFVVRDEIGK--QGMYHDFWQAFAVLLPIRSVGVMGDQRTYAHPIVLRLISSEDGMTADWSRVPYDLLETISNRIVNEVKGVNRVVYDITSKPPGTIEWE 542
>gi|94990542|ref|YP_598642.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus pyogenes MGAS10270] >gi|94544050|gb|ABF34098.1| GMP synthase (glutamine-hydrolyzing) [Streptococcus pyogenes MGAS10270] (520 aa)
Score = 1323, Expect = 8.5e-144, Identities = 256/511 (50%), Positives = 353/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + KI++LD+G QY QLIARRIR+  V SE+  + I+ +E+ + NP GI+LSGG +SVY D +   +  I++L IPILGICYG Q++  + GG+V       + EYG + + L  T++LF     +    MSH D+V  +P+GF ++  +N C  A+  N EK  YG+QFHPEV  + +GN +L+NF  SIC   GDW   N    +I +I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK+E  +V  +L    G NI  VD  + FL  L  V DPE+KRKIIG  F+ VF+  A+K+     +L QGT+Y DI+ESG++ ++TIKSHHNVGGLPE +QFEL+EPL  LFKDEVR LG++L +P + V+RQPFPGPGLA+RV+G ITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + ++P + L+KIS+ I N+V +++R+VYDIT+KPP T+EWE
  S:    10 VQKIIVLDYGSQYNQLIARRIREFGVLSELKSHKITAQELHEINPIGIVLSGGPNSVYADNAFGIDPEIFELGIPILGICYGMQLITHKLGGKVVPAGQAGNREYGQSTLHLRETSKLFSGTPQEQLVLMSHGDAVTEIPEGFHLVGDSNDCPYAAIENTEKNLYGIQFHPEVRHSVYGNDILKNFAISICGARGDWSMDNFIDMEITKIRETVGDRKVLLGLSGGVDSSVVGVLLQKAIGDQLTCIFVDHGLLRKDEGDQVMGMLGGKFGLNIIRVDASKRFLDLLADVEDPEKKRKIIGNEFVYVFDDEASKLK-GVDFLAQGTLYTDIIESGTETAQTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGIALGMPEEIVWRQPFPGPGLAIRVMGAITEEKLETVRESDAILREEIAK--AGLDRDVWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAQLPWDVLKKISTRIVNEVDHVNRIVYDITSKPPATVEWE 520
>gi|196258509|ref|ZP_03157043.1| GMP synthase, large subunit [Cyanothece sp. PCC 7822] >gi|196200423|gb|EDX95244.1| GMP synthase, large subunit [Cyanothece sp. PCC 7822] (528 aa)
Score = 1323, Expect = 9.0e-144, Identities = 247/508 (48%), Positives = 353/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++ILDFG QY++LIARRIR+ NVYSE++ Y  + E++ +  PKGIILSGG +SVY   +   ++ IW+L IPILG+CYG Q+M+Q+ GG+VE  K +E YG   + +    +L  N+E  +  WMSH DS I LP+GF+ +A T     A+  + EKK +GVQFHPEV  +  G  L++NFVY IC     W  +    E + EI++ V D  VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +  +  +     +  V+ ++ FL++LKGV DPE+KR++IG  FI+VFE+ +N++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRKL  ++ +P + V R PFPGPGLA+R++GE+T ++L+I+R+ADF+ R  I +  +   H  WQ F VL   +SVGV+GD R+Y + + LR + S D M+A W ++P + LE IS+ I N+V+ ++RVVYDIT+KPPGTIEWE
  S:    15 LVILDFGSQYSELIARRIRETNVYSEVLSYRTTAEQLRQLAPKGIILSGGPNSVYDPNAPHCDRAIWELGIPILGVCYGMQLMVQQLGGKVERAKRAE-YGKAALYIDDPTDLLTNVENGSTAWMSHGDSCIELPQGFENLAHTENTACAAIAHHEKKLFGVQFHPEVVHSVGGIALIRNFVYHICKCEPTWTTEAFVEESVREIRAKVGDKRVLLALSGGVDSSTLAFLLHRAIGDQLTCMFIDQGFMRKGEPERLVQIFDQQFHIPVVYVNSRERFLTQLKGVTDPEEKRRLIGHEFIKVFEEESNRLG-PFDYLAQGTLYPDVIESADSNVDPQTGERVAVKIKSHHNVGGLPKNLRFKLVEPLRKLFKDEVRKLARAIGLPEEIVRRHPFPGPGLAIRIIGEVTSERLKILRDADFIVRDEISK--QGMYHDFWQAFAVLLPVRSVGVMGDQRTYAHPIVLRLITSEDGMTADWARVPYDLLETISNRIVNEVRGVNRVVYDITSKPPGTIEWE 528
>gi|124485953|ref|YP_001030569.1| bifunctional GMP synthase/glutamine amidotransferase protein [Methanocorpusculum labreanum Z] >gi|124363494|gb|ABN07302.1| GMP synthase (glutamine-hydrolyzing) [Methanocorpusculum labreanum Z] (508 aa)
Score = 1323, Expect = 9.2e-144, Identities = 255/511 (49%), Positives = 349/511 (68%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           M+ IL+LDFGGQY QLI+RR+R+ +V+ E+    I + EI + N  GII +GG  SVY   +   + GI++L IPILGICYG Q+     GG V +   + EYG T I    + +F+N+  +  CWMSH+D +  +P GF  +A T+ C VA+  N  KK Y VQFHPEV  T  G  +++NF+Y +C   G W   +   +++ +++  + D  VLCA+SGGVDS VAAVL  +A+G +L C+FVDHGLLRKNE  EV  + +     N+  V+ +  FL KL GV DPE+KRKIIG+ FI VFE  A KI     +L+QGTIYPD++ESG   +  IKSHHNVGGLP+ + F E++EPL+ LFKDEVR+ GL L IP + V+RQPFPGPGLA+RV+G+IT++KLEIVR+AD ++R  I +   + +    QYF  LTN +SVGV+GD R+Y Y + LRAV + D M+A W +IP   LEK+SS I N+V++++RV+YDIT+KPP TIE+E
  S:     1 MESILVLDFGGQYNQLISRRVREAHVFCEVKPCTIPLSEIKEGNYAGIIFTGGPASVYAKNAPTVDAGIFELGIPILGICYGAQLTAYLLGGNVAS-ATTREYGKTSISTEESPIFKNVPRETTCWMSHTDYISEVPAGFVKVAHTSVCPVAAMANPAKKIYAVQFHPEVMHTPEGMTMIKNFLYDVCGCKGTWHMSSFVEDQVLQLREKIGDKKVLCALSGGVDSSVAAVLINKAVGKQLTCIFVDHGLLRKNEGNEVEEIFRNQFDINLIRVNVEDQFLGKLAGVSDPEKKRKIIGEEFIRVFEAEAKKIGT-VDFLVQGTIYPDVIESGPGAAAVIKSHHNVGGLPDNVDFKEIIEPLRILFKDEVRRAGLELGIPEKLVWRQPFPGPGLAIRVIGDITKEKLEIVRDADAIYREEIAKAGIDRDIN--QYFAALTNMRSVGVMGDERTYDYAVVLRAVTTTDFMTADWAQIPFAVLEKVSSRIINEVRHVNRVLYDITSKPPATIEYE 508
>gi|149194572|ref|ZP_01871668.1| bifunctional GMP synthase/glutamine amidotransferase protein [Caminibacter mediatlanticus TB-2] >gi|149135316|gb|EDM23796.1| bifunctional GMP synthase/glutamine amidotransferase protein [Caminibacter mediatlanticus TB-2] (511 aa)
Score = 1320, Expect = 1.7e-143, Identities = 273/509 (53%), Positives = 355/509 (69%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R+  VYSEIV Y   ++   +K PKGII SGG  SVY   + + +K I++L +PILGICYG Q++  + GG+V    D  EYG  ++ +   ++LF+N+      WMSHSD V  LP GFK IA T     A+  N EK+ Y +QFHPEVT +  G+++L+NF   +C+V   W+  +   E+I++IK  V D+ V+CA+SGGVDS V A L  +AIGDKL  +FVD GLLRKNE +EV    K ++   +  VD K  FLS+LKGV DPE+KRKIIG TFIEVF++ A K +   K+L QGT+YPD++ES S    SKTIKSHHNVGGLPE ++FEL+EPL+ LFKDEVRKLGL L +P   VYR PFPGPGLA+R++GE+ E  LEI+READ +    +    LY     K WQ F VL N KSVGV+GDNR+Y  T+A+R V S D M+A +  +P E LE++S+ I N+V  I+RVVYDI++KPP TIEWE
  S:     4 EILILDFGSQYTQLIARRLREEGVYSEIVPYFDGLKAAKEKKPKGIIFSGGPASVYEKDAYRVDKEIYNLGLPILGICYGMQLITVDFGGEVVR-ADHHEYGKAELFIDDEHKLFKNVSNPTIVWMSHSDRVEKLPDGFKRIAHTKNAPYAAIVNYEKEIYAIQFHPEVTHSVEGSKILRNFAREVCNVTTKWDMAHFAKEQIKKIKEEVGDNKVICALSGGVDSSVTAALLHEAIGDKLIPIFVDTGLLRKNEREEVEHAFKNVLHVPLITVDAKDKFLSRLKGVTDPEEKRKIIGHTFIEVFDEEAKK-HKDAKFLAQGTLYPDVIESVSVKGPSKTIKSHHNVGGLPEWMKFELIEPLRELFKDEVRKLGLELGLPKDLVYRHPFPGPGLAIRIMGEVNEKDLEILREADAILIQELKAWGLYD----KVWQAFAVLLNVKSVGVMGDNRTYDNTVAIRCVSSTDGMTATFSHLPHEFLERVSTRIINEVDGINRVVYDISSKPPATIEWE 511
>gi|148265151|ref|YP_001231857.1| bifunctional GMP synthase/glutamine amidotransferase protein [Geobacter uraniireducens Rf4] >gi|146398651|gb|ABQ27284.1| GMP synthase (glutamine-hydrolyzing) [Geobacter uraniireducens Rf4] (516 aa)
Score = 1320, Expect = 1.9e-143, Identities = 264/510 (51%), Positives = 351/510 (68%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKF--SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP-WQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KILILDFG Q TQLIARR+R+ ++Y EI  Y +S E+I +  PKGIILSGG  SVY   +   + G++DL +P+LGICYG Q+M Q+ GG+VE   D  E+G + ++L   ++LF   +   + WMSH D +  +P GF+VIA T  C VA+  + ++ FYGVQFHPEV  T  G+++  NF+++IC     W   N    +IE I+  V    VLCA+SGGVDS V AVL  +AIGD+L+CVFV++GLLRK E+++V  L  K    N+  VD    FL KL GV DPE KRKIIG  FI +FE+ A KI     YL QGT+YPD++ES S    S  IKSHHNVGGLPE++  +LLEP++ LFKDEVR LG  L +P + +YRQPFPGPGLA+R +GE++ + L+I+READ +    ID++ K   ++  WQ F VL   K+VGV+GD R+Y  T+ALRAV+S+D M+A W K+P E L  ISS I N+VK ++RVVYDI+ KPP TIEWE
  S:     8 EKILILDFGSQVTQLIARRVREQSIYCEIHPYSMSFEKIKEFAPKGIILSGGPSSVYDKDAPHSDLGVFDLGLPVLGICYGMQLMTQQLGGKVER-SDKREFGGSSLQLDDVSDLFAGFDGAADVWMSHGDRIEEMPAGFQVIAHTEHCPVAAMKDEKRHFYGVQFHPEVVHTPRGDEMFGNFLFNICGCEPTWTMANFIETEIESIRRKVGTGRVLCALSGGVDSSVVAVLIHKAIGDQLHCVFVNNGLLRKGEAEKVVNLFSKHFRINLDYVDASDRFLEKLSGVSDPETKRKIIGNEFIYLFEEEAKKIG-KVDYLAQGTLYPDVIESVSTKGPSAVIKSHHNVGGLPEKMNLKLLEPVRELFKDEVRLLGKELGMPDEVIYRQPFPGPGLAIRCIGELSRENLDILREADAIV---IDEIRKAGLYREIWQSFAVLLPVKTVGVMGDARTYENTVALRAVNSLDGMTADWVKLPYELLGSISSRIINEVKGVNRVVYDISQKPPATIEWE 516
>gi|89210573|ref|ZP_01188961.1| GMP synthase, C-terminal:GMP synthase, N-terminal [Halothermothrix orenii H 168] >gi|89159835|gb|EAR79495.1| GMP synthase, C-terminal:GMP synthase, N-terminal [Halothermothrix orenii H 168] (510 aa)
Score = 1320, Expect = 2.0e-143, Identities = 270/510 (52%), Positives = 358/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQE-NGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKIL+LDFGGQY+QLIARR+R+ NVYS I  Y+ISI++I   NP GII SGG  SV G  +   +K ++ LNIPILGICYG Q+M     GG VE  +  E YG   + +T  ++LFE I  D+  WMSH D V  +P GFKV A T+   VA+  N E KFYGVQFHPEV  T  G  +++N+++ +C V G W   +   E+I+ IK  V    V+  +SGGVDS VA+ +  +AIGD+L C+FVDHGLLRK E+++V           +  VD ++ FL++L GV DPE KRKIIG+ FI VFE+ A K+    +YL+QGT+Y D++ESGS+ ++TIKSHHNVGGLP+ + F+L+EPL+ LFKDEVRK+G  L +P + V+RQPFPGPGLA+R++GEI   KLEI+R+AD + +  I +   YK    + WQ F VL + KSVGV+GD R+YGY + LRAV S DAM+A W ++P E LEKIS+ I N+V +++RVVYDIT+KPP TIEWE
  S:     4 DKILVLDFGGQYSQLIARRVRECNVYSIIKPYNISIDQIKDINPAGIIFSGGPKSVTGPEAPMIDKEVFKLNIPILGICYGMQLMTALLPGGAVEKARHGE-YGKARLHITEKDKLFEGIS-DSQVWMSHWDRVKKVPDGFKVTAKTDITPVAAMGNPELKFYGVQFHPEVVHTIQGLNIIRNYLFKVCGVKGTWNMADFINEEIDRIKEEVGSSQVISGLSGGVDSAVASTMVHRAIGDQLTCIFVDHGLLRKGEAEQVKRTFVDEFNIPLVYVDARERFLNRLNGVKDPETKRKIIGEEFIRVFEEEARKLG-DARYLVQGTLYSDVIESGSETAETIKSHHNVGGLPDNMDFKLIEPLRNLFKDEVRKIGEVLGLPDEIVWRQPFPGPGLAIRIIGEIDGKKLEILRKADSIIQEEIKEAGYYK----EIWQSFAVLPDLKSVGVMGDTRTYGYPIILRAVTSDDAMTADWARLPYELLEKISTRIVNEVDSVNRVVYDITSKPPATIEWE 510
>gi|152985472|ref|YP_001346731.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pseudomonas aeruginosa PA7] >gi|150960630|gb|ABR82655.1| GMP synthase [Pseudomonas aeruginosa PA7] (527 aa)
Score = 1317, Expect = 4.7e-143, Identities = 258/509 (50%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY EI  +D+S E II   P+GIIL+GG +SV+   S +  + ++DL +P+ GICYG Q M ++ GG+V+   D  E+G   + +     L + IE        L  + WMSH D V  +P GF ++AST  C +A+  +  + +YGVQFHPEVT T  G ++L  FV  IC  A  W P NI  + I  +++ V    VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E  +V A+  + +G  +   + +  FL +L GV DPE+KRKIIG+TFIEVF++ A K+    K+L QGTIYPD++ES G+K  K   IKSHHNVGGLPE +QFEL+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +++R+AD +F   I++L   +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LEK+S+ I N++  ISRV YD+++KPP TIEWE
  S:    11 RILILDFGSQYTQLIARRVREIGVYCEIHPFDMSDEAIIAFAPRGIILAGGPESVHEADSPRAPQAVFDLKVPLFGICYGMQTMAEQMGGKVQG-SDLREFGYARVDVVGKARLLDGIEDHVDDDGVLGLDVWMSHGDKVTEMPAGFHILASTPSCPIAAMADDARAYYGVQFHPEVTHTKQGLRILSRFVLDICGCAALWTPSNIVEDAIATVRAQVGSSKVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLHEGDQVMAMFAENMGVKVIRANAEDKFLGRLAGVADPEEKRKIIGRTFIEVFDEEATKLQ-DVKFLAQGTIYPDVIESAGAKTGKAHVIKSHHNVGGLPEDMQFELVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADLLRQADHIF---IEELRAFDWYHKTSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETIDFMTARWAHLPYELLEKVSNRIINEIAGISRVTYDVSSKPPATIEWE 527
>gi|116051794|ref|YP_789364.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pseudomonas aeruginosa UCBPP-PA14] >gi|115587015|gb|ABJ13030.1| GMP synthase [Pseudomonas aeruginosa UCBPP-PA14] (525 aa)
Score = 1317, Expect = 4.8e-143, Identities = 258/509 (50%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY EI  +D+S E II   P+GIIL+GG +SV+   S +  + ++DL +P+ GICYG Q M ++ GG+V+   D  E+G   + +     L + IE        L  + WMSH D V  +P GF ++AST  C +A+  +  + +YGVQFHPEVT T  G ++L  FV  IC  A  W P NI  + I  +++ V    VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E  +V A+  + +G  +   + +  FL +L GV DPE+KRKIIG+TFIEVF++ A K+    K+L QGTIYPD++ES G+K  K   IKSHHNVGGLPE +QFEL+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +++R+AD +F   I++L   +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LEK+S+ I N++  ISRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCEIHPFDMSNEAIIAFAPRGIILAGGPESVHEADSPRAPQAVFDLKVPLFGICYGMQTMAEQMGGKVQG-SDVREFGYARVDVVGKARLLDGIEDHVDDDGVLGLDVWMSHGDKVTEMPAGFHILASTPSCPIAAMADDARAYYGVQFHPEVTHTKQGLRILSRFVLDICGCAALWTPSNIVDDAIATVRAQVGSSKVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLHEGDQVMAMFAENMGVKVIRANAEDKFLGRLAGVADPEEKRKIIGRTFIEVFDEEATKLQ-DVKFLAQGTIYPDVIESAGAKTGKAHVIKSHHNVGGLPEDMQFELVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADLLRQADHIF---IEELRAFDWYHKTSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETIDFMTARWAHLPYELLEKVSNRIINEIAGISRVTYDVSSKPPATIEWE 525
>gi|17230338|ref|NP_486886.1| bifunctional GMP synthase/glutamine amidotransferase protein [Nostoc sp. PCC 7120] >gi|44887971|sp|Q8YT80|GUAA_ANASP GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|17131940|dbj|BAB74545.1| GMP synthase (glutamine-hydrolyzing) [Nostoc sp. PCC 7120] (540 aa)
Score = 1316, Expect = 4.9e-143, Identities = 253/508 (49%), Positives = 344/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+  VYSE++ Y    E + + NPKGIILSGG  SVY DR+   +  IW+L +PILG+CYG Q+M+ + GG+V    D  EYG   + +    +L  N+E     WMSH DSV  +P GF+V+A T+    A+  + EKK YGVQFHPEV  +  G  L++NFVY IC+    W       E I E+++ V D  VL A+SGGVDS   A L  +AIGD+L CVF+D G +RK E + +  L ++     +  V+ +  FL  + GV DPE+KR+ IG  FI+VFE+ +  +  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRK+G S+ +P + V RQPFPGPGLA+R+LGE+T D+L I+R+AD + R  I+Q    +E+  WQ F VL   +SVGV+GD R+Y Y + LR V S D M+A W ++P + LE IS+ I N+VK ++RVV+DIT+KPPGTIEWE
  S:    27 IIILDFGSQYSELIARRIRETQVYSEVLSYRTPAEHLRQLNPKGIILSGGPSSVYSDRAPHCDPEIWNLGVPILGVCYGMQLMVNQLGGEVAK-ADRGEYGKASLHIDDPTDLLTNVEDGTTMWMSHGDSVTKMPPGFEVLAHTDNTPCAAVADHEKKLYGVQFHPEVVHSVGGLALIRNFVYHICECEPTWTTAAFVEEAIREVRAKVGDKRVLLALSGGVDSSTLAFLMHKAIGDQLTCVFIDQGFMRKYEPERLVKLFQEQFHIPVEYVNARDRFLDIMSGVTDPEEKRRRIGHEFIQVFEETSKNLG-PFDYLAQGTLYPDVIESADTNVDPQTGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRSVGLPEEIVQRQPFPGPGLAIRILGEVTADRLNILRDADLIVRQEINQRGLYNEY--WQAFAVLLPIRSVGVMGDQRTYAYPIVLRIVKSEDGMTADWARVPYDVLEAISNRIVNEVKGVNRVVFDITSKPPGTIEWE 540
>gi|50083437|ref|YP_044947.1| bifunctional GMP synthase/glutamine amidotransferase protein [Acinetobacter sp. ADP1] >gi|81393985|sp|Q6FFN2|GUAA_ACIAD GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|49529413|emb|CAG67125.1| GMP synthetase (glutamine aminotransferase) [Acinetobacter sp. ADP1] (550 aa)
Score = 1316, Expect = 5.0e-143, Identities = 260/510 (50%), Positives = 360/510 (70%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSE-EYGSTDIRLTTNELFENIELDNN---CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D+ILILDFG QY+QLIARR+R+  VYSE+  +D+S E+I   NP GIILSGG +SV+ + S +  + +++L +P+LGICYGFQ M ++ GG+VE     E  Y   DI+   ++L  N++   N    WMSH D V  LP+GF   AST  C  A+A +  ++FYGVQFHPEVT T  G +LL NFV+ IC   G W P++I   ++E++++ + D+ VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR NE  +V  +    +G  +   D ++ FL+ L G VDPE+KRKIIG+ FIEVF + A K++   K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ L+FEL+EPL+ LFKDEVRKLG +L +P+  +YR PFPGPGL VR+LGE+ ++  +I+R AD +F   + +L  +  + K  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A++  +P E ++KIS+ I N++K++SRVVYD+++KPP TIEWE
  S:    38 DRILILDFGSQYSQLIARRVREAGVYSEMYAFDMSEEDIRAFNPNGIILSGGPESVHEEGSPRAPQVVFELGVPVLGICYGFQTMSEQLGGKVEPGTVHEFGYAEVDIQ-QRDQLVGNLQDRENQLHVWMSHGDKVSRLPEGFSTTASTPSCPFAAASDEARRFYGVQFHPEVTHTAKGAELLANFVHKICGCGGLWTPEHIIDLRVEQLRAQIGDEKVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLNEGDQVMQMFADNMGIRVIRADAEERFLTALAGEVDPEKKRKIIGREFIEVFAEEARKLD-GVKFLAQGTIYPDVIESAASKQGKAHVIKSHHNVGGLPDDLEFELVEPLRDLFKDEVRKLGTTLGLPHSMIYRHPFPGPGLGVRILGEVKKEYADILRLADDIF---MQELRASGWYDKTAQAFAVFQPVKSVGVVGDGRRYAWVIALRAVETVDFMTARFAHLPYELVDKISTRIMNEIKDVSRVVYDVSSKPPATIEWE 550
>gi|163816407|ref|ZP_02207773.1| hypothetical protein COPEUT_02596 [Coprococcus eutactus ATCC 27759] >gi|158448404|gb|EDP25399.1| hypothetical protein COPEUT_02596 [Coprococcus eutactus ATCC 27759] (513 aa)
Score = 1316, Expect = 5.3e-143, Identities = 267/511 (52%), Positives = 358/511 (70%)
  Q:     1 MDK--ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALL--KKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           MDK  I++LDFGGQY QLIARR+R+ NVY+E+  Y + +E+I + NPKGII +GG +SVY D S   +K I++L IPILGICYG Q+M    GG+V     SE YG T++ +  T++LF ++     CWMSH+D +  +P+GFK  A T  C VA+  N EKK Y  QFHPEV  T  G ++L+ FV  +C  AGDW+  +   + IE +++ + D  VLCA+SGGVDS VAAVL ++AIG +L CVFVDHGLLRKNE  EV A+         N   V+ +  F SKL GV +PE KRKIIG+ FI VFE+ A KI     +L+QGTIYPD++ESG   S  IKSHHNVGGLP+ + F E++EPL+ LFKDEVRK GL L IP   V+RQPFPGPGL +R++GE+T +K++IV++AD ++R  I +     +    QYF  LTN +SVG +GD R+Y Y +ALRAV++ D M+A   +IP E L+K+ + I N+VK ++RV+YD+T+KPPGTIE+E
  S:     1 MDKELIIVLDFGGQYNQLIARRVRECNVYAEVHPYTLPLEKIKEMNPKGIIFTGGPNSVYKDESPSCSKEIFELGIPILGICYGSQLMAHLLGGKVSTAPVSE-YGRTEVEVDKTSKLFADVNDKTICWMSHTDYIAEVPEGFKKTAYTPVCPVAAMENAEKKLYATQFHPEVMHTEEGMKMLRAFVMDVCQCAGDWKMDSFVKDTIESLRAKIGDGKVLCALSGGVDSSVAAVLLSKAIGKQLTCVFVDHGLLRKNEGDEVEAVFGPDGPYDLNFIRVNAQDRFYSKLAGVTEPEAKRKIIGEEFIRVFEEEAKKIGA-VDFLVQGTIYPDVIESGLDKSAVIKSHHNVGGLPDYVDFKEIVEPLRLLFKDEVRKAGLELGIPEYLVFRQPFPGPGLGIRIIGEVTAEKVKIVQDADAIYREEIAK--AGLDRSFGQYFAALTNMRSVGCMGDFRTYDYAVALRAVNTTDFMTADCSEIPFEVLQKVMNRIINEVKGVNRVMYDLTSKPPGTIEFE 513
>gi|188589233|ref|YP_001919810.1| GMP synthase [Clostridium botulinum E3 str. Alaska E43] >gi|188499514|gb|ACD52650.1| GMP synthase [Clostridium botulinum E3 str. Alaska E43] (513 aa)
Score = 1316, Expect = 5.5e-143, Identities = 264/510 (51%), Positives = 356/510 (69%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGK------NIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D +L++DFGGQY QLIARR+R+ NVY E+  Y++S++EI + NPKGII +GG +SVYG+ S   +K I++L +PI GICYG Q+M    GG+V     SE YG T + +   ++LFE +     CWMSH+D +   P+GFKVI  T  C VA+    +K  Y VQFHPEV  T  G ++L NFVY+IC   GDW+  +   + IEE++  V +  VLCA+SGGVDS VAAVL ++A+G +L CVFVDHGLLRKNE  EV    +++ G       N   V+ ++ F  KL G+ +PEQKRKIIG+ FI VFE+ A KI     YL+QGTIYPD++ESG   S  IKSHHNVGGLP+ + F E++EPL+ LFKDEVRK GL L IP + V+RQPFPGPGL +R++GE+T +K++IV++AD ++R  I     + E    QYF  LTN +SVGV+GD R+Y Y +ALRAV + D M+A+   +P E L K+++ I N+VK ++RV+YD T KPP TIE+E
  S:     4 DLVLVIDFGGQYNQLIARRVRECNVYCEVHPYNLSVDEIKQMNPKGIIFTGGPNSVYGENSPLCDKAIFELGVPIFGICYGSQLMSHMLGGKVATAPVSE-YGKTKVDVNIESKLFEGVSSSTICWMSHTDYIEKAPEGFKVIGKTPVCPVAAMECEDKNLYAVQFHPEVMHTEEGTKMLSNFVYNICGCTGDWKMDSFVEKTIEEVRQKVGNGKVLCALSGGVDSSVAAVLLSRAVGKQLTCVFVDHGLLRKNEGDEV----EEIFGPNGQYDLNFIRVNAQERFYEKLAGIEEPEQKRKIIGEEFIRVFEEEAKKIGT-VDYLVQGTIYPDVIESGLGKSAVIKSHHNVGGLPDYVDFKEIIEPLRLLFKDEVRKAGLELGIPEKLVFRQPFPGPGLGIRIIGEVTAEKVKIVQDADAIYREEIANAGIDKEIG--QYFAALTNMRSVGVMGDERTYDYAIALRAVTTSDFMTAESADLPWEVLGKVTTRIVNEVKGVNRVMYDCTGKPPATIEFE 513
>gi|107103288|ref|ZP_01367206.1| hypothetical protein PaerPA_01004357 [Pseudomonas aeruginosa PACS2] (527 aa)
Score = 1316, Expect = 6.0e-143, Identities = 258/509 (50%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY EI  +D+S E II   P+GIIL+GG +SV+   S +  + ++DL +P+ GICYG Q M ++ GG+V+   D  E+G   + +     L + IE        L  + WMSH D V  +P GF ++AST  C +A+  +  + +YGVQFHPEVT T  G ++L  FV  IC  A  W P NI  + I  +++ V    VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E  +V A+  + +G  +   + +  FL +L GV DPE+KRKIIG+TFIEVF++ A K+    K+L QGTIYPD++ES G+K  K   IKSHHNVGGLPE +QFEL+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +++R+AD +F   I++L   +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LEK+S+ I N++  ISRV YD+++KPP TIEWE
  S:    11 RILILDFGSQYTQLIARRVREIGVYCEIHPFDMSNEAIIAFAPRGIILAGGPESVHEADSPRAPQAVFDLKVPLFGICYGMQTMAEQMGGKVQG-SDLREFGYARVDVVGKARLLDGIEDHVDDDGVLGLDVWMSHGDKVTEMPAGFHILASTPSCPIAAMADDARAYYGVQFHPEVTHTKQGLRILSRFVLDICGCAALWTPSNIVDDAIATVRAQVGSSKVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLHEGDQVMAMFAENMGVKVIRANAEDKFLGRLAGVADPEEKRKIIGRTFIEVFDEEATKLQ-DVKFLAQGTIYPDVIESAGAKTGKAHVIKSHHNVGGLPEDMQFELVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADLLRQADHIF---IEELRAFDWYHKTSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETIDFMTARWAHLPYELLEKVSNRIINEIAGISRVTYDVSSKPPATIEWE 527
>gi|15598964|ref|NP_252458.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pseudomonas aeruginosa PAO1] >gi|13627134|sp|Q9HXM6|GUAA_PSEAE GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|9949940|gb|AAG07156.1|AE004796_1 GMP synthase [Pseudomonas aeruginosa PAO1] (525 aa)
Score = 1316, Expect = 6.0e-143, Identities = 258/509 (50%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY EI  +D+S E II   P+GIIL+GG +SV+   S +  + ++DL +P+ GICYG Q M ++ GG+V+   D  E+G   + +     L + IE        L  + WMSH D V  +P GF ++AST  C +A+  +  + +YGVQFHPEVT T  G ++L  FV  IC  A  W P NI  + I  +++ V    VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E  +V A+  + +G  +   + +  FL +L GV DPE+KRKIIG+TFIEVF++ A K+    K+L QGTIYPD++ES G+K  K   IKSHHNVGGLPE +QFEL+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +++R+AD +F   I++L   +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LEK+S+ I N++  ISRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCEIHPFDMSNEAIIAFAPRGIILAGGPESVHEADSPRAPQAVFDLKVPLFGICYGMQTMAEQMGGKVQG-SDLREFGYARVDVVGKARLLDGIEDHVDDDGVLGLDVWMSHGDKVTEMPAGFHILASTPSCPIAAMADDARAYYGVQFHPEVTHTKQGLRILSRFVLDICGCAALWTPSNIVDDAIATVRAQVGSSKVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLHEGDQVMAMFAENMGVKVIRANAEDKFLGRLAGVADPEEKRKIIGRTFIEVFDEEATKLQ-DVKFLAQGTIYPDVIESAGAKTGKAHVIKSHHNVGGLPEDMQFELVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADLLRQADHIF---IEELRAFDWYHKTSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETIDFMTARWAHLPYELLEKVSNRIINEIAGISRVTYDVSSKPPATIEWE 525
>gi|75907277|ref|YP_321573.1| bifunctional GMP synthase/glutamine amidotransferase protein [Anabaena variabilis ATCC 29413] >gi|91206794|sp|Q3MEA8|GUAA_ANAVT GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|75701002|gb|ABA20678.1| GMP synthase (glutamine-hydrolyzing) [Anabaena variabilis ATCC 29413] (540 aa)
Score = 1316, Expect = 6.1e-143, Identities = 253/508 (49%), Positives = 345/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+  VYSE++ Y  S E + + NPKGIILSGG  SVY DR+   +  IW+L +PILG+CYG Q+M+ + GG+V    D  EYG   + +    +L  N+E     WMSH DSV  +P GF+V+A T+    A+  + +KK YGVQFHPEV  +  G  L++NFVY IC+    W       E I E+++ V D  VL A+SGGVDS   A L  +AIGD+L CVF+D G +RK E + +  L ++     +  V+ +  FL  + GV DPE+KR+ IG  FI+VFE+ +  +  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRK+G S+ +P + V RQPFPGPGLA+R+LGE+T D+L I+R+AD + R  I+Q    +E+  WQ F VL   +SVGV+GD R+Y Y + LR V S D M+A W ++P + LE IS+ I N+VK ++RVV+DIT+KPPGTIEWE
  S:    27 IIILDFGSQYSELIARRIRETQVYSEVLSYRTSAEHLRQLNPKGIILSGGPSSVYSDRAPHCDPEIWNLGVPILGVCYGMQLMVNQLGGEVAK-ADRGEYGKASLHIDDPTDLLTNVEDGTTMWMSHGDSVTKMPPGFEVLAHTDNTPCAAVADHDKKLYGVQFHPEVVHSIGGLALIRNFVYHICECEPTWTTAAFVEEAIREVRAKVGDKRVLLALSGGVDSSTLAFLMHKAIGDQLTCVFIDQGFMRKYEPERLVKLFQEQFHIPVEYVNARDRFLDIMVGVTDPEEKRRRIGHEFIQVFEETSRNLG-PFDYLAQGTLYPDVIESADTNVDPQTGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRSVGLPEEIVQRQPFPGPGLAIRILGEVTADRLNILRDADLIVRQEINQRGLYNEY--WQAFAVLLPIRSVGVMGDQRTYAYPIVLRIVKSEDGMTADWARVPYDVLEAISNRIVNEVKGVNRVVFDITSKPPGTIEWE 540
>gi|78188567|ref|YP_378905.1| bifunctional GMP synthase/glutamine amidotransferase protein [Chlorobium chlorochromatii CaD3] >gi|91206800|sp|Q3AT13|GUAA_CHLCH GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|78170766|gb|ABB27862.1| GMP synthase (glutamine-hydrolyzing) [Chlorobium chlorochromatii CaD3] (511 aa)
Score = 1315, Expect = 6.5e-143, Identities = 262/511 (51%), Positives = 359/511 (70%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT---NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLV----ASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           M  +L+LDFG QYTQLIARRIR+LN+YSEI+ Y+   + I    PK IILSGG +SVY   +  P+  I+ L IP+LGICYG Q + +  GG V +  +  E+G + I +     N LF+NI  +++ WMSH D V+ LP+GF+  AS++   +    ++  N     YG+QFHPEV  T +G ++L NF+ +I  +  DW  K+    +IEEI+    ++ V+C ISGGVDS VAAVL ++AIG +L+CVFVD+GLLRKNE+++V   LK L G +I L D   LFL +LKGV  PE+KRKIIG+TFI+VFE+  +      K+L+QGT+YPD++ES S    S+TIKSHHNVGGLP+R++ +L+EPL+ LFKDEVR +G  L IP   + R PFPGPGLAVRVLG +T ++LEI+READ +   YI++L  +  + K WQ F VL   +SVGV+GD R+Y   LALRAV+S D M+A W  +P + L ++S+ I N+V+ I+RV YDI++KPP TIEWE
  S:     1 MQSVLVLDFGSQYTQLIARRIRELNIYSEILPYNTPADTIRTHQPKAIILSGGPNSVYDQTAFMPDPAIFSLGIPVLGICYGLQAIAKHFGGVVAS-SNKHEFGRSKILVEQQGDNPLFQNIP-NSDVWMSHGDKVMQLPEGFRATASSDNSEICAFESTGVNSPAHIYGLQFHPEVQHTLYGKEMLGNFLLNIAAITPDWSSKSFIEHQIEEIRRKAGNNTVICGISGGVDSTVAAVLVSKAIGKQLHCVFVDNGLLRKNEAEKVMHFLKPL-GLHITLADSSDLFLKRLKGVASPEKKRKIIGRTFIQVFEEQIHH----EKFLVQGTLYPDVIESISVKGPSETIKSHHNVGGLPKRMKLKLIEPLRELFKDEVRAVGRELGIPEDILMRHPFPGPGLAVRVLGSLTHERLEILREADEI---YIEELQASGLYSKVWQAFAVLLPVQSVGVMGDKRTYENVLALRAVESSDGMTADWAPLPHDFLARVSNRIINEVRGINRVAYDISSKPPATIEWE 511
>gi|81299000|ref|YP_399208.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus elongatus PCC 7942] >gi|81167881|gb|ABB56221.1| GMP synthase (glutamine-hydrolyzing) [Synechococcus elongatus PCC 7942] (575 aa)
Score = 1315, Expect = 7.5e-143, Identities = 249/510 (48%), Positives = 350/510 (68%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + ++ILDFG QY++LIARRIR+  VYSE++ Y  + ++I + +PKGIILSGG +SVY D +   +  IW+L IP+LG+CYG Q+M+Q+ GGQV+   +  EYG   + +    +L  N+E  +  WMSH DSV  +P+GF+++A T+    A+  + ++KFYGVQFHPEV  +  G  L++NFVY ICD    W  +    E I EI++ V D  VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +  +  +    ++  +  +  FL +L+G+ DPE+KRK IG  FI VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVR++G SL +P + V R PFPGPGLA+R+LGE+T +KL I+R+AD + R  +++     E   WQ F VL   KSVGV+GD R+Y Y + LR V S D M+A W + P + LE IS+ I N+VK ++RVVYDIT+KPPGTIEWE
  S:    60 EMLIILDFGSQYSELIARRIRETQVYSEVLSYRTTADQIRQLSPKGIILSGGPNSVYDDYAPVCDPEIWNLGIPVLGVCYGMQLMVQQLGGQVDR-AERGEYGKAALVIDDPTDLLTNVEPGSTMWMSHGDSVKTMPEGFELLAHTDNTPCAAIADHQRKFYGVQFHPEVVHSVHGMALIRNFVYHICDCEPTWTTETFVEEAIREIRARVGDKRVLLALSGGVDSSTLAFLLHRAIGDQLTCMFIDQGFMRKGEPERLMEVFNEKFKIHVEYIQARDRFLQRLEGITDPEEKRKRIGHEFIRVFEEESRRLG-PFDYLAQGTLYPDVIESADTNVDPKTGERVAVKIKSHHNVGGLPKDLQFKLVEPLRRLFKDEVRQVGRSLGLPEEIVKRHPFPGPGLAIRILGEVTAEKLNILRDADLIVRQEVNRQGYYDEF--WQAFAVLLPVKSVGVMGDKRTYAYPVVLRFVSSEDGMTADWSRAPYDLLETISNRIVNEVKGVNRVVYDITSKPPGTIEWE 575
>gi|158337547|ref|YP_001518722.1| bifunctional GMP synthase/glutamine amidotransferase protein [Acaryochloris marina MBIC11017] >gi|158307788|gb|ABW29405.1| GMP synthase [Acaryochloris marina MBIC11017] (541 aa)
Score = 1314, Expect = 8.3e-143, Identities = 252/508 (49%), Positives = 344/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+  VYSE++ Y  SIE++ + NPKGIILSGG +SVY   +   +  IW+L IP+LG+CYG Q+M+Q+ GGQVE   D+ EYG   + +    +L  N+E     WMSH DSV  LP+GFKV+A T     A+  + +++ YGVQFHPEV  +  G  L+ NFVY IC+    W  +    E I E+++ V +  VL A+SGGVDS   A L  +AIGD L C+F+D G +RK E + +  L +      +  V  +  FL +L G+ DPE+KRK IG  FI+VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRK+G SL +P + V R PFPGPGLA+R++GE+T ++L I+R+AD + R  +++    SE   WQ F VL   +SVGV+GD R+Y Y + LR V S D M+A W + P E LE IS+ I N+VK ++RV YDIT+KPPGTIEWE
  S:    28 IVILDFGSQYSELIARRIRETQVYSEVLSYRTSIEQLRQLNPKGIILSGGPNSVYAQHAPACDPEIWNLGIPVLGVCYGMQLMVQQLGGQVEA-SDAAEYGKASLIIDDPTDLLTNVEDQTTMWMSHGDSVTALPEGFKVLAHTANTPQAAVAHHDRQLYGVQFHPEVVHSQGGQALICNFVYHICECEPTWTTEAFVEEAIREVRAKVGNKRVLLALSGGVDSSTLAFLLHKAIGDNLTCMFIDQGFMRKLEPERLIKLFRDQFHIPVEYVMARDRFLERLNGITDPEEKRKRIGHEFIQVFEEESRRLG-PFDYLAQGTLYPDVIESADTNVDPATGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRSLGLPEEIVNRHPFPGPGLAIRIIGEVTAERLNILRDADLIVRQEVNRSGNYSEF--WQAFAVLLPVRSVGVMGDQRTYAYPVVLRFVSSEDGMTADWSRAPYELLETISNRIVNEVKGVNRVAYDITSKPPGTIEWE 541
>gi|189345786|ref|YP_001942315.1| GMP synthase, large subunit [Chlorobium limicola DSM 245] >gi|189339933|gb|ACD89336.1| GMP synthase, large subunit [Chlorobium limicola DSM 245] (513 aa)
Score = 1314, Expect = 9.0e-143, Identities = 265/511 (51%), Positives = 362/511 (70%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-----ELFENIELDNNCWMSHSDSVIFLPKGFKVIAST-NKCLVASACNREK---KFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           M  +L+LDFG QYTQLIARRIR+L +YSEI+ Y+ + E I +  PK IILSGG  SVYG+ +I P++GI+ L +PILGICYG Q + +  GG+V +    +E+G   + ++ +      LF NI  D++ WMSH D V+ LP GF++ AS+ N  + A      K   K +G+QFHPEV  T +G QLL NF+  I  +  DW PK+    +IEEI+    D+ V+C ISGGVDS VAAVL ++AIG  L+CVFVD+GLLRKNE+ +V   LK L G  + L D  +LFL +LK V  PE+KRKIIG+TFI+VFE+  +K     K+L+QGT+YPD++ES S    S+TIKSHHNVGGLP+R++ +L+EPL+ LFKDEVR +G  L I    + R PFPGPGLAVRVLG +++++L+I+R+AD +F   +    LY+    K WQ F+VL   +SVGV+GD R+Y   LALRAV+S D M+A W ++P + L ++S+ I N+V+ I+RV YDI++KPP TIEWE
  S:     1 MQSVLVLDFGSQYTQLIARRIRELGIYSEILPYNTTPETIREHAPKAIILSGGPTSVYGESAILPHEGIFSLGLPILGICYGLQAIAKHFGGEVASSA-KQEFGRAKMLVSRDGEPESMLFRNIP-DSDVWMSHGDKVVNLPDGFRITASSANSEMCALETYGSKGALKVFGLQFHPEVQHTLYGKQLLSNFLIDIAGITPDWSPKHFIDHQIEEIRRTAGDETVICGISGGVDSSVAAVLVSRAIGKNLHCVFVDNGLLRKNEADKVMQFLKHL-GLRLTLADASELFLKRLKNVASPEKKRKIIGRTFIQVFEEQLDK----EKFLVQGTLYPDVIESVSVKGPSETIKSHHNVGGLPKRMKLKLIEPLRELFKDEVRAVGRELGIAEDILMRHPFPGPGLAVRVLGSVSKERLDILRDADEIFLEELKSSGLYQ----KVWQAFSVLLPVQSVGVMGDKRTYENVLALRAVESSDGMTADWAQLPHDFLARVSNRIINEVRGINRVAYDISSKPPATIEWE 513
>gi|182419326|ref|ZP_02950578.1| GMP synthase [Clostridium butyricum 5521] >gi|182376657|gb|EDT74229.1| GMP synthase [Clostridium butyricum 5521] (513 aa)
Score = 1313, Expect = 1.4e-142, Identities = 263/508 (51%), Positives = 353/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALL--KKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL++DFGGQY QLIARR+R+ NVY E+  Y +S+EEI + NPKGII +GG +SVYG+ S   +K ++++ +PILGICYG Q+M    GG+V     SE YG T++ +  + +LF+ +     CWMSH+D +   P+GFK+  +T  C VA+    EK  Y VQFHPEV  T  G ++L NFVY++C  +GDW+  +   + IEEI++ V +   LCA+SGGVDS VAAVL ++AIG +L CVFVDHGLLRKNE  EV A+         N   V+ ++ F  KL GV DPE KRKIIG+ FI VFE+ A KI     +L+QGTIYPD++ESG   S  IKSHHNVGGLP+ + F E++EPL+ LFKDEVRK GL L IP + VYRQPFPGPGL +R++GE+T +K+ IV++AD ++R  I     + E    QYF  LTN +SVGV+GD R+Y Y +ALRAV + D M+A+   +P E L K+++ I N+VK ++RV+YD T KPP TIE+E
  S:     6 ILVIDFGGQYNQLIARRVRECNVYCEVHPYTLSVEEIKEMNPKGIIFTGGPNSVYGEDSPLCDKALFEIGLPILGICYGSQLMSHMLGGKVATAPVSE-YGKTEVDVKVDSKLFDGVSSKTICWMSHTDYIEKAPEGFKITGNTPVCPVAAMECEEKNLYAVQFHPEVMHTQEGTKMLNNFVYNVCGCSGDWKMDSFVEKTIEEIRAKVGNGKALCALSGGVDSSVAAVLLSKAIGKQLTCVFVDHGLLRKNEGDEVEAIFGPNGNYDLNFIRVNAQERFYEKLAGVEDPETKRKIIGEEFIRVFEEEAKKIGA-VDFLVQGTIYPDVIESGLGKSAVIKSHHNVGGLPDYVDFKEIIEPLRLLFKDEVRKAGLELGIPEKLVYRQPFPGPGLGIRIIGEVTAEKVRIVQDADAIYREEIANAGIDKEIG--QYFAALTNMRSVGVMGDERTYDYAIALRAVTTSDFMTAESADLPWEVLGKVTTRIVNEVKGVNRVMYDCTGKPPATIEFE 513
>gi|94501253|ref|ZP_01307775.1| bifunctional GMP synthase/glutamine amidotransferase protein [Oceanobacter sp. RED65] >gi|94426680|gb|EAT11666.1| bifunctional GMP synthase/glutamine amidotransferase protein [Oceanobacter sp. RED65] (524 aa)
Score = 1312, Expect = 1.8e-142, Identities = 260/509 (51%), Positives = 361/509 (70%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENI--ELDN------NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R+L V+SEI  +D+S +EI + +PK IIL+GG +SV+   S +  + ++D+ +PILGICYG Q M ++ GG+V+   D  E+G   I++ +    F++I   +DN      + WMSH D V  +P GF+++AST  C +A+  + EK+F+GVQFHPEVT T  G ++L++FV  I      W P NI  ++I  ++  V +  VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLRKNE   V  +  K +G  +   D + LFL KL G+ DPE+KRK+IG TFI+VF++ A KI     +L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++ EL+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +++READ +F   I++L+  +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LEK+S+ I N+++++SRV YD+++KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRVRELGVFSEIRPWDMSFDEIKEFDPKAIILAGGPESVHEANSPRATEEVFDMGLPILGICYGMQTMAEQLGGKVQG-SDIREFGYAQIKVESAGPFFKDISDHIDNKGSTYLDVWMSHGDKVSEMPAGFELMASTPSCPIAAMYHEEKQFFGVQFHPEVTHTLQGGRMLEHFVRDIAGCEALWTPANIIEDQIARVREQVGERKVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRKNEGDMVMDMFAKNMGVKVIRADAEDLFLGKLNGIDDPEKKRKVIGNTFIDVFDEEAGKIK-EVDFLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMKMELVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADVLREADAIF---IEELHNFDWYHKTSQAFAVFLPVKSVGVVGDQRRYEWVIALRAVETIDFMTARWAHLPYELLEKVSNRIINEIEHVSRVTYDVSSKPPATIEWE 524
>gi|186681209|ref|YP_001864405.1| GMP synthase, large subunit [Nostoc punctiforme PCC 73102] >gi|186463661|gb|ACC79462.1| GMP synthase, large subunit [Nostoc punctiforme PCC 73102] (540 aa)
Score = 1311, Expect = 2.4e-142, Identities = 251/508 (49%), Positives = 345/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+  VYSE++ Y  + E++ + NPKGIILSGG  SVYGD +   +  IW+L IP+LG+CYG Q+M+ + GG+V    D  EYG   + +    +L  N+E     WMSH DSV  +P GF+++A T     A+  + E+K YGVQFHPEV  +  G  L++NFVY ICD    W       E I EI++ V +  VL A+SGGVDS   A L  +AIG++L CVF+D G +RK E + +  L ++     +  V+ +  FL+K+ GV DPE+KR+ IG  FI VFE+ + ++   F YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRK+G S+ +P + V RQPFPGPGLA+R+LGE+T ++L I+R+AD + R  I+Q  +   H  WQ F VL   +SVGV+GD R+Y Y + LR V S D M+A W ++P + LE IS+ I N+VK ++RVVYDIT+KPPGTIEWE
  S:    27 IIILDFGSQYSELIARRIRETQVYSEVLSYRTTSEQLRQLNPKGIILSGGPSSVYGDNAPHCDPEIWNLGIPVLGVCYGMQLMVNQLGGEVAK-ADRGEYGKASLYIDDPTDLLTNVEDGTTMWMSHGDSVTQMPSGFELLAHTENTPCAAIADHERKLYGVQFHPEVVHSIGGIALIRNFVYHICDCEPTWTTAAFVEEAIREIRTRVGEKRVLLALSGGVDSSTLAFLLYKAIGEQLTCVFIDQGFMRKYEPERLVKLFQEQFHIPVEYVNARDRFLAKVAGVTDPEEKRRRIGHEFINVFEETSKRLG-HFDYLAQGTLYPDVIESADTNADPQTGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRSIGLPEEIVQRQPFPGPGLAIRILGEVTSERLNILRDADLIVRQEINQ--RGMYHDFWQAFAVLLPIRSVGVMGDQRTYAYPIVLRIVTSEDGMTADWARVPYDVLEVISTRIVNEVKGVNRVVYDITSKPPGTIEWE 540
>gi|177664923|ref|ZP_02940724.1| GMP synthase, large subunit [Cyanothece sp. PCC 8801] >gi|196243645|ref|ZP_03142374.1| GMP synthase, large subunit [Cyanothece sp. PCC 8802] >gi|172076034|gb|EDT61447.1| GMP synthase, large subunit [Cyanothece sp. PCC 8801] >gi|196208562|gb|EDY03352.1| GMP synthase, large subunit [Cyanothece sp. PCC 8802] (542 aa)
Score = 1309, Expect = 3.3e-142, Identities = 249/508 (49%), Positives = 347/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++ILDFG QY++LIARRIR+  VYSE++ Y  +IE+I + NP+GIILSGG +SVY +R+ + +  I+ L +PILG+CYG Q+M+Q+ GGQVE  K  E YG   + +    +L  N+E  +  WMSH DS   LP+GF ++A T     A+  + +KK +GVQFHPEV  +  G  L++NFVY IC     W  +    E I EI++ V D  VL A+SGGVDS   A L  +AIGD L C+F+D G +RK E + +  +  K     +  V+ +  FL +L GV DPE KR++IG  FI+VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRKLG ++ +P + V R PFPGPGLA+R++GE+T ++L I+R+ADF+ R  I +  +   H  WQ F VL   +SVGV+GD R+Y + + LR + S D M+A W K+P + LE IS+ I N+VK ++RVVYDIT+KPPGTIEWE
  S:    29 LVILDFGSQYSELIARRIRETQVYSEVLSYRTTIEQIRQLNPRGIILSGGPNSVYDNRAPQCDPEIFHLGVPILGVCYGMQLMVQQLGGQVERAKRGE-YGKASLFIDDPTDLLTNVEDGSTMWMSHGDSCTQLPEGFDILAHTENTSCAAIAHHQKKLFGVQFHPEVVHSVGGIALIRNFVYHICQCEPTWTTEAFVEESIREIRAKVGDKRVLLALSGGVDSSTLAFLLHRAIGDNLTCMFIDQGFMRKGEPERLVEIFDKQFHIPVEYVNARTRFLEQLAGVTDPETKRRLIGHEFIQVFEEESERLG-PFDYLAQGTLYPDVIESADTNVDPQTGERVAVKIKSHHNVGGLPKNLRFKLVEPLRKLFKDEVRKLGRAIGLPEEIVRRHPFPGPGLAIRIIGEVTAERLNILRDADFIVRDEISK--QGMYHDFWQAFAVLLPVRSVGVMGDRRTYAHPIVLRLITSEDGMTADWAKVPYDLLETISNRIVNEVKGVNRVVYDITSKPPGTIEWE 542
>gi|167760717|ref|ZP_02432844.1| hypothetical protein CLOSCI_03102 [Clostridium scindens ATCC 35704] >gi|167661604|gb|EDS05734.1| hypothetical protein CLOSCI_03102 [Clostridium scindens ATCC 35704] (515 aa)
Score = 1308, Expect = 4.3e-142, Identities = 262/508 (51%), Positives = 353/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL--TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALL--KKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG-SKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++++DFGGQY QL+ARR+R+ NVY EI  Y   +E+I + NPKGIIL+GG +S Y   S    K +++L IP+LG+CYG Q+MM   GG+VE+  D  EYG T++ +  T + +FE +     CWMSH D +  +  GF++ A T  C VA+A N E+K Y +Q+HPEV  T  G ++L NFV  +C  AGDW   +   E I +I+  V    VLCA+SGGVDS VAAVL ++A+GD+L CVFVDHGLLRKNE  EV A    +     N   V+ +Q F  KL GV +PE KRKIIG+ FI VFE+ A KI     +L+QGTIYPD+VESG    S  IKSHHNVGGLP+ + F E++EPL+ LFKDEVRK GL L IP   V+RQPFPGPGL +R++GE+TE+K+++V+ AD ++R  I       +    QYF  LTN +SVGV+GD R+Y Y +ALRAV+++D M+A+  +IP E L K++S I N+V +++RV+YDIT+KPPGTIE+E
  S:     6 VIVIDFGGQYNQLVARRVRECNVYCEIYSYKTDLEKIKEMNPKGIILTGGPNSCYEADSPTYKKELFELGIPVLGLCYGAQLMMHILGGKVES-ADVREYGKTEVIIDKTQSPIFEGVSSPTICWMSHFDYISKVAPGFEITAHTADCPVAAAENPEQKLYAIQYHPEVLHTAEGTKMLSNFVLGVCGCAGDWRMDSFVEESIRQIREKVGKGKVLCALSGGVDSSVAAVLLSKAVGDQLTCVFVDHGLLRKNEGDEVEAAFGPEGAYDLNFIRVNAQQRFYEKLAGVSEPEAKRKIIGEEFIRVFEEEAKKIGA-VDFLVQGTIYPDVVESGLGGESAVIKSHHNVGGLPDCVDFKEIIEPLRDLFKDEVRKAGLELGIPKHLVFRQPFPGPGLGIRIVGEVTEEKVKMVQNADAIYREEIAN--AGLDKSVGQYFAALTNMRSVGVMGDERTYDYAVALRAVNTIDFMTAEAAEIPWEVLHKVTSRIVNEVDHVNRVMYDITSKPPGTIEFE 515
>gi|119484405|ref|ZP_01619022.1| bifunctional GMP synthase/glutamine amidotransferase protein [Lyngbya sp. PCC 8106] >gi|119457879|gb|EAW39002.1| bifunctional GMP synthase/glutamine amidotransferase protein [Lyngbya sp. PCC 8106] (539 aa)
Score = 1308, Expect = 4.5e-142, Identities = 248/508 (48%), Positives = 349/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+I+DFG QY++LIARRIR+  VYSE++ Y  + E++   NP+GIILSGG +SVY   +   +  IW+L IPILG+CYG Q+M+Q+ GGQVE  + +E YG   + +    +L  N+E  +  WMSH+DS   LP GF+++A T     A+    E+K YGVQFHPEV  +  G  L++NFVY IC+    W  +    E I E+++ V D  VL A+SGGVDS   A L  +AIGD L C+F+D G +RK E + +  L ++     +  V+ ++ FL+KL GV DPE+KRKIIG  FI VFE+ ++++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRK+G S+ +P + V R PFPGPGLA+R++GE+T ++L I+R+ADF+ R  I +  +   H  WQ F VL   +SVGV+GD R+Y + + LR V S D M+A W ++P + LE IS+ + N+V+ ++RVVYDIT+KPPGTIEWE
  S:    26 IVIMDFGSQYSELIARRIRETEVYSEVISYRTTAEQLATLNPQGIILSGGPNSVYDQGAPHCDPNIWNLGIPILGVCYGMQLMVQQLGGQVERAQRAE-YGKASLLIDDPTDLLTNVENGSTMWMSHADSCTQLPTGFEILAHTENTPCAAIAEHERKLYGVQFHPEVVHSVGGLALIRNFVYHICNCQPTWTTEAFVEEAIREVRAKVGDKRVLLALSGGVDSSTLAFLMHRAIGDNLTCMFIDQGFMRKYEPERLVKLFEEQFHIPVQYVNARERFLTKLNGVTDPEEKRKIIGHEFIGVFEEESSRLG-PFDYLAQGTLYPDVIESADTNVDPQTGERVAVKIKSHHNVGGLPKDLRFKLIEPLRKLFKDEVRKVGRSIGLPEEIVRRHPFPGPGLAIRIIGEVTPERLRILRDADFVVRDEISK--QGIYHDFWQAFAVLLPVRSVGVMGDQRTYAHPVVLRFVSSEDGMTADWSRVPYDLLEIISNRMVNEVEGVNRVVYDITSKPPGTIEWE 539
>gi|108803659|ref|YP_643596.1| bifunctional GMP synthase/glutamine amidotransferase protein [Rubrobacter xylanophilus DSM 9941] >gi|108764902|gb|ABG03784.1| GMP synthase (glutamine-hydrolyzing) [Rubrobacter xylanophilus DSM 9941] (506 aa)
Score = 1308, Expect = 4.5e-142, Identities = 245/508 (48%), Positives = 345/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I++LDFGGQY QLIARR+R+  V+SE++ YD  +EEI +++P+GIILSGG +SVY   + + +  ++DL +P+LGICYG Q+M    GG+V       EYG + + +  + ELF     +   W SH D+V+  P GF+V A T    + +     +  YGVQFHPEV  T +G ++L+NF++  C  A DW P NI  E +E ++  V     +CA+SGGVDS  AA+L  +AIGDKL CVFVDHGLLR+NE+++V    ++  G  +  VD ++ FL +L GV DPE KRKI+G+ FI VFE+ A KI    ++L+QGT+Y D++ESG++ +  IKSHHNVGGLPE +  EL+EPL+ LFKDEVR +   L +P + V+RQPFPGPGLA+R++GE+T ++LEI+R+AD + +  I         + WQ F VL    SVGV+GD R+Y Y + +RAV S DAM+A W ++P + LE+IS+ I N+V  ++RV  DIT+KPPGTIEWE
  S:     2 IVVLDFGGQYAQLIARRVREARVFSELLPYDTPLEEIRRRDPEGIILSGGPNSVYERGAPRVDAALFDLGVPVLGICYGMQLMALTLGGEV-GAVQIREYGRSKLEVRGHGELFSGTPDEQTVWTSHGDAVLAAPPGFRVTARTPSVPILAFEEPSRGLYGVQFHPEVRHTEYGMEILKNFLFEACGCAPDWTPVNIVTEAVERVREQVGASRAICALSGGVDSATAAMLVHRAIGDKLTCVFVDHGLLRQNEAEQVVEAFRREAGLPLVHVDARERFLDRLAGVTDPEAKRKIVGEEFIRVFEEEAGKIR-DARFLVQGTLYSDVIESGTRDAARIKSHHNVGGLPEVMDLELVEPLRNLFKDEVRVVAAELGMPERLVWRQPFPGPGLAIRIIGEVTAERLEILRKADAVLQDEIRS--AGYYRRLWQSFAVLPAVHSVGVMGDARTYAYPIVIRAVTSDDAMTADWARLPYDLLERISNRIINEVPGVNRVALDITSKPPGTIEWE 506
>gi|56751331|ref|YP_172032.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus elongatus PCC 6301] >gi|81595982|sp|Q5N2F8|GUAA_SYNP6 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|56686290|dbj|BAD79512.1| GMP synthetase [Synechococcus elongatus PCC 6301] (534 aa)
Score = 1308, Expect = 4.7e-142, Identities = 249/510 (48%), Positives = 350/510 (68%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + ++ILDFG QY++LIARRIR+  VYSE++ Y  + ++I + +PKGIILSGG +SVY D +   +  IW+L IP+LG+CYG Q+M+Q+ GGQV+   +  EYG   + +    +L  N+E  +  WMSH DSV  +P+GF+++A T+    A+  + ++KFYGVQFHPEV  +  G  L++NFVY ICD    W  +    E I EI++ V D  VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +  +  +    ++  +  +  FL +L+G+ DPE+KRK IG  FI VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVR++G SL +P + V R PFPGPGLA+R+LGE+T +KL I+R+AD + R  +++     E   WQ F VL   KSVGV+GD R+Y Y + LR V S D M+A W + P + LE IS+ I N+VK ++RVVYDIT+KPPGTIEWE
  S:    19 EMLIILDFGSQYSELIARRIRETQVYSEVLSYRTTADQIRQLSPKGIILSGGPNSVYDDYAPVCDPEIWNLGIPVLGVCYGMQLMVQQLGGQVDR-AERGEYGKAALVIDDPTDLLTNVEPGSTMWMSHGDSVKTMPEGFELLAHTDNTPCAAIADHQRKFYGVQFHPEVVHSVHGMALIRNFVYHICDCEPTWTTETFVEEAIREIRARVGDKRVLLALSGGVDSSTLAFLLHRAIGDQLTCMFIDQGFMRKGEPERLMEVFNEKFKIHVEYIQARDRFLQRLEGITDPEEKRKRIGHEFIRVFEEESRRLG-PFDYLAQGTLYPDVIESADTNVDPKTGERVAVKIKSHHNVGGLPKDLQFKLVEPLRRLFKDEVRQVGRSLGLPEEIVKRHPFPGPGLAIRILGEVTAEKLNILRDADLIVRQEVNRQGYYDEF--WQAFAVLLPVKSVGVMGDKRTYAYPVVLRFVSSEDGMTADWSRAPYDLLETISNRIVNEVKGVNRVVYDITSKPPGTIEWE 534
>gi|87307823|ref|ZP_01089966.1| GMP synthase [Blastopirellula marina DSM 3645] >gi|87289437|gb|EAQ81328.1| GMP synthase [Blastopirellula marina DSM 3645] (529 aa)
Score = 1307, Expect = 6.3e-142, Identities = 257/510 (50%), Positives = 348/510 (68%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKF---SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KIL+LDFG QY QLIARR+R+ NVY EIV +DIS+E I   NP+GIILSGG  SVY + + + + GI+ + IP+LGICYG Q++ Q  GGQV+N     EYG   I ++ NE LF  +  + + WMSH D V  + + F+ +AST+ C +A+  ++E   Y +QFHPEVT T  G Q+L+NFV S+CD  G W+  +   + I EI+  V D+ V+C +SGGVDS V A L  QAIG +L C+ VD+GLLRK E++ V A   K    ++ +VD K  FL +L G+ +P++KR+ IG  F+E F+  A KI    K+L QGT+YPD++ESG+     + TIK HHNVGGLP+ L FEL+EPL+ LFKDEVRKLGL L +P   V+R PFPGPGLAVR L +ITE+KL ++READ +  S I    LY+ +     Q F VL   +SVGV+GD R+Y   +A+R V++ D M+A W  +P E L +IS+ I N+VK ++RV YDI+ KPP TIEWE
  S:    20 EKILVLDFGSQYAQLIARRVREQNVYCEIVRHDISVERIAAHNPRGIILSGGPSSVYEEGAPQCDPGIFAMGIPVLGICYGMQLICQAFGGQVKN-TSQREYGHAKISISPNEDLFGGLPSETDVWMSHGDQVTNVTESFEPLASTSTCPIAAMRHKELPLYAMQFHPEVTHTPLGFQILRNFVISVCDCEGLWKLHDFAQQTIAEIRERVGDNRVICGLSGGVDSAVVAALLYQAIGPQLSCILVDNGLLRKQEAESVIAEFTKHFKTDLHVVDAKDQFLKELAGITEPQEKRRRIGYQFVECFKAEALKIK-DAKFLAQGTLYPDVIESGAALDGPAATIKLHHNVGGLPKELGFELIEPLRDLFKDEVRKLGLELGLPEDLVWRHPFPGPGLAVRCLSDITEEKLSVLREADSIVVSEIKAAGLYRQTS----QAFAVLLPVQSVGVMGDARTYENAVAVRCVNTDDFMTATWSYLPYEVLARISTRIINEVKGVNRVCYDISTKPPATIEWE 529
>gi|145220392|ref|YP_001131101.1| bifunctional GMP synthase/glutamine amidotransferase protein [Prosthecochloris vibrioformis DSM 265] >gi|145206556|gb|ABP37599.1| GMP synthase (glutamine-hydrolyzing) [Prosthecochloris vibrioformis DSM 265] (513 aa)
Score = 1307, Expect = 6.4e-142, Identities = 264/511 (51%), Positives = 361/511 (70%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDI---RLTTNE--LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNK---CLVASACNREK-KFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP-WQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           M  +L+LDFG QYTQLIARRIR+L +YSEI+ Y  + E I + NP+ IILSGG  SVYGD +I P+ GI+ L +PILGICYG Q +    GG VE+    +E+G   I   R   +E  LFE    D++ WMSH D V  +P+GF+V AS+     C + S  ++   K YG+QFHPEV  + +G QLL NF+ +I  +  DW  K+    +IE+I+    ++ V+C ISGGVDS VAAVL ++AIG +L+CVFVD+GLLRKNE+++V   LK L G  + L D + LFL++LKGV  PE+KRKIIG+TFI VFE+  ++     K+L+QGT+YPD++ES S    S+TIKSHHNVGGLP+R++ +L+EPL+ LFKDEVR +G  L I    + R PFPGPGLAVRVLG +  +++EI++ AD +F   I++L  +  ++  WQ F+VL   +SVGV+GD R+Y   LALRAV+S D M+A W  +P + L K+S+ I N+V+ I+RV YDI++KPP TIEWE
  S:     1 MQSVLVLDFGSQYTQLIARRIRELGIYSEILPYSTTPETIREHNPRAIILSGGPTSVYGDSAILPHPGIFSLGLPILGICYGLQAIANHFGGAVES-SSKQEFGRAKILVDRSADHESLLFEGFP-DSDVWMSHGDKVTRMPEGFRVTASSGNSEMCAIESYGSKAALKIYGLQFHPEVQHSLYGKQLLGNFLLNIAGITPDWSSKSFIDHQIEDIRERAGNNTVICGISGGVDSTVAAVLVSKAIGKQLHCVFVDNGLLRKNEAEKVMQFLKPL-GLKVTLADSRDLFLTRLKGVASPEKKRKIIGRTFIRVFEEHIHE----EKFLVQGTLYPDVIESVSVKGPSETIKSHHNVGGLPKRMKLKLIEPLRELFKDEVRAVGRELGIAEDILMRHPFPGPGLAVRVLGSVNPERVEILQNADEIF---IEELKSSGLYQQVWQAFSVLLPVQSVGVMGDKRTYENVLALRAVESTDGMTADWAHLPHDFLAKVSNRIINEVRGINRVAYDISSKPPATIEWE 513
>gi|194333159|ref|YP_002015019.1| GMP synthase, large subunit [Prosthecochloris aestuarii DSM 271] >gi|194310977|gb|ACF45372.1| GMP synthase, large subunit [Prosthecochloris aestuarii DSM 271] (518 aa)
Score = 1307, Expect = 6.5e-142, Identities = 261/511 (51%), Positives = 363/511 (71%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDI------RLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNK---CLV-ASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           M  +L+LDFG QYTQLIARRIR++ +YSEI+ Y   ++ I +  P  IILSGG +SVYG+ ++ P+KGI+ L +PILGICYG QV+    GG+V      +E+G   I       +  + LF +I  D++ WMSH D V+ +P+GF + AS+     C + A+      K YG+QFHPEV  + +G QLL NF+  I  +  DW PK+    +IEEI+    +  V+C ISGGVDS VAAVL ++AIG KL+CVFV++GLLRKNE ++V ++LK L G NI +VD +++FL +LK V  PE+KRKIIG+TFI +FE+  ++     K+L+QGT+YPD++ES S    S+TIKSHHNVGGLP+R++ +L+EPL+ LFKDEVR +G  L I    + R PFPGPGLAVRVLG +T+++L+I+R+AD +F   +++L K N   + WQ F+VL   +SVGV+GD R+Y   LALRAV+S D M+A W  +P E L  +S+ I N+V+ I+RV YDI++KPP TIEWE
  S:     5 MQSVLVLDFGSQYTQLIARRIREIGIYSEIIPYSTPLDTIKEHKPGAIILSGGPNSVYGEDALLPDKGIFSLGVPILGICYGLQVIATHFGGEVAVSS-KQEFGRAKILVDRENDVAASRLFSDIP-DSDVWMSHGDKVVRMPEGFSITASSGNSEMCAIEATGSKAALKVYGLQFHPEVQHSLYGKQLLSNFLIDIAGLKPDWSPKSFIEHQIEEIRKTAGNATVICGISGGVDSTVAAVLVSKAIGKKLHCVFVNNGLLRKNEGEKVMSILKPL-GLNITMVDAEEIFLKRLKSVASPEKKRKIIGRTFIHIFEEQIHE----EKFLVQGTLYPDVIESVSVKGPSETIKSHHNVGGLPKRMKLKLIEPLRELFKDEVRAVGRELGIDEDILMRHPFPGPGLAVRVLGSLTKERLDILRDADEIF---LEELKKQNLYQQVWQAFSVLLPVQSVGVMGDKRTYENVLALRAVESSDGMTADWAHLPHEFLSHVSNRIINEVRGINRVAYDISSKPPATIEWE 518
>gi|167747719|ref|ZP_02419846.1| hypothetical protein ANACAC_02440 [Anaerostipes caccae DSM 14662] >gi|167653081|gb|EDR97210.1| hypothetical protein ANACAC_02440 [Anaerostipes caccae DSM 14662] (513 aa)
Score = 1306, Expect = 8.1e-142, Identities = 265/510 (51%), Positives = 354/510 (69%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALL--KKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +K L+LDFGGQY QLIARR+R+ +VY EI  Y  S+EEI + NPKGII +GG +SVYG+ S    K I++L IPILGICYG Q+M    GG+VE    SE YG T++ L  +++LF+ +     CWMSH+D +   P+GFK+ A+T  C VA+  N +KK Y  QFHPEV  T  G +++ NF+Y +C   GDW   +   + I+ I+  V D  VLCA+SGGVDS VAAV+ A+A+G +L CVFVDHGLLRKNE  EV A+   +     N   V+ +  F  KL GV +PEQKRKIIG+ FI VFE+ A KI     +L+QGTIYPD+VESG   S TIKSHHNVGGLP+ + F E++EPL+ LFKDEVR+ G  L IP   V RQPFPGPGL +R++GE+T +K++IV++AD ++R  I +     +    QYF  LTN +SVGV+GD R+Y Y +ALRAV++ D M+A   +IP E L K+++ I N+V++++RV+YD T KPP TIE+E
  S:     4 EKFLVLDFGGQYNQLIARRVRECSVYCEIKPYTASLEEIKEYNPKGIIFTGGPNSVYGEDSATYEKEIFELGIPILGICYGSQLMAHVLGGKVETAPVSE-YGHTEVDLDNSSKLFDGVGDKTVCWMSHTDYIAQAPEGFKITATTPVCPVAAMENADKKLYATQFHPEVMHTEQGKEMIYNFLYKVCGCKGDWNMDSFVDDMIKSIREKVGDGKVLCALSGGVDSSVAAVMLAKAVGKQLTCVFVDHGLLRKNEGDEVEAVFGPEGPYDLNFIRVNVQDRFYEKLAGVEEPEQKRKIIGEEFIRVFEEEAKKIG-SVDFLVQGTIYPDVVESGVGKSATIKSHHNVGGLPDYVDFKEIIEPLRDLFKDEVRQAGRELGIPEYLVMRQPFPGPGLGIRIIGEVTAEKVKIVQDADAIYREEIAK--AGVDKGLGQYFAALTNMRSVGVMGDGRTYDYAIALRAVNTSDFMTADAAQIPWEVLGKVTTRIVNEVEHVNRVMYDCTGKPPATIEFE 513
>gi|167751537|ref|ZP_02423664.1| hypothetical protein EUBSIR_02538 [Eubacterium siraeum DSM 15702] >gi|167655345|gb|EDR99474.1| hypothetical protein EUBSIR_02538 [Eubacterium siraeum DSM 15702] (519 aa)
Score = 1306, Expect = 8.8e-142, Identities = 259/508 (50%), Positives = 345/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFGGQY QLIARR+R+ N+Y E++ Y   IE+I  KNPKGII +GG  SVY D S +  K I++L IPI GICYG Q M+   GG +   N+  + E+G T+    T   +F+ ++ ++  WMSH+D +  LP GFK +  ++KC  A+  N EK FY  QFHPEV  T  G  +L NF+Y +C   GDW  +N   E I++I+  V D  VL A+SGGVDS VA  L ++A+G++L CVFVDHG +RKNE  EV    K     N   V+    F+ KL+GV DPE KRK IG+ FI VFE+ A KI     +L+QGTIYPD++ESG+  +  IKSHHNVGGLP+ + F E++EPL+ LFKDEVRKLG  L +    V+RQPFPGPGLA+R++GEIT +KL  +++AD++FR  I       +    QYF VLTN +SVGV+GD+R+Y YTLALR V + D M+A + +IP + LEK S  I N+VKNI+R+ YDIT+KPP TIEWE
  S:    12 VLVIDFGGQYNQLIARRVREHNIYCEVISYKTPIEQIKAKNPKGIIFTGGPRSVYLDDSPRMTKEIFELGIPIFGICYGAQFMVYGLGGTIGKANENAAAEFGRTECEFDTECAVFDGLKKNSVVWMSHNDYIEVLPDGFKAVGHSDKCPYAAIENVEKGFYATQFHPEVNHTEQGFDMLGNFLYKVCHCKGDWTMRNYAEEAIKQIREKVGDGKVLLALSGGVDSSVACALLSKAVGNQLTCVFVDHGFMRKNEGDEVEQAFKDW-DVNFIRVNAADRFIGKLEGVSDPETKRKTIGEEFIRVFEEEAKKIG-KVDFLVQGTIYPDVIESGTGDAAVIKSHHNVGGLPDYVDFKEIIEPLRLLFKDEVRKLGTELGLSDVLVWRQPFPGPGLAIRIIGEITREKLATLQDADYIFREEIAN--AGLDRSINQYFAVLTNMRSVGVMGDDRTYDYTLALRGVTTSDFMTADFARIPYDVLEKASVRIVNEVKNINRICYDITSKPPATIEWE 519
>gi|187932912|ref|YP_001884624.1| GMP synthase [Clostridium botulinum B str. Eklund 17B] >gi|187721065|gb|ACD22286.1| GMP synthase [Clostridium botulinum B str. Eklund 17B] (513 aa)
Score = 1306, Expect = 8.9e-142, Identities = 263/510 (51%), Positives = 356/510 (69%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGK------NIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D +L++DFGGQY QLIARR+R+ NVY E+  Y++S++EI + NPKGII +GG +SVYG+ S   +K I++L +PI GICYG Q+M    GG+V     SE YG T + +   ++LFE +     CWMSH+D +   P+ FKVI +T  C VA+    +K  Y VQFHPEV  T  G ++L NFVY+IC   GDW+  +   + IEE++  V +  VLCA+SGGVDS VAAVL ++A+G +L CVFVDHGLLRKNE  EV    +++ G       N   V+ ++ F  KL G+ +PEQKRKIIG+ FI VFE+ A KI     YL+QGTIYPD++ESG   S  IKSHHNVGGLP+ + F E++EPL+ LFKDEVRK GL L IP + V+RQPFPGPGL +R++GE+T +K++IV++AD ++R  I     + E    QYF  LTN +SVGV+GD R+Y Y +ALRAV + D M+A+   +P E L K+++ I N+VK ++RV+YD T KPP TIE+E
  S:     4 DLVLVIDFGGQYNQLIARRVRECNVYCEVHPYNLSVDEIKQMNPKGIIFTGGPNSVYGENSPLCDKAIFELGVPIFGICYGSQLMSHILGGKVATAPVSE-YGKTKVDVNIESKLFEGVSSSTICWMSHTDYIEKAPEEFKVIGNTPVCPVAAMECEDKNLYAVQFHPEVMHTEEGTKMLSNFVYNICGCTGDWKMDSFVEKTIEEVRQKVGNGKVLCALSGGVDSSVAAVLLSRAVGKQLTCVFVDHGLLRKNEGDEV----EEIFGPNGQYDLNFIRVNAQERFYEKLAGIEEPEQKRKIIGEEFIRVFEEEAKKIGT-VDYLVQGTIYPDVIESGLGKSAVIKSHHNVGGLPDYVDFKEIIEPLRLLFKDEVRKAGLELGIPEKLVFRQPFPGPGLGIRIIGEVTAEKVKIVQDADAIYREEIANAGIDKEIG--QYFAALTNMRSVGVMGDERTYDYAIALRAVTTSDFMTAESADLPWEVLGKVTTRIVNEVKGVNRVMYDCTGKPPATIEFE 513
>gi|81427749|ref|YP_394748.1| bifunctional GMP synthase/glutamine amidotransferase protein [Lactobacillus sakei subsp. sakei 23K] >gi|91206809|sp|Q38ZE1|GUAA_LACSS GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|78609390|emb|CAI54436.1| Guanosine monophosphate synthase (Glutamine amidotransferase) [Lactobacillus sakei subsp. sakei 23K] (517 aa)
Score = 1305, Expect = 1.1e-141, Identities = 255/510 (50%), Positives = 347/510 (68%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT--NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKI++LD+G QY QLI RRIR+  ++SE++    +  EI K  PKGII SGG  SVY   +   +  I++L IPILGICYG Q++  +NGG VE   +  EYG  +I +T   ++LF+ +      WMSH D V  +P+G+  +A ++     +  NR+K  YG+QFH EV  T FGN +L+NF + +C    +W   +    +IE+I+  V D  VL  +SGGVDS V  VL  +AIGD+L  +FVDHGLLRK E ++V   L    G NI  VD K+ F+SKL GV DPE+KRKIIG  FI+VF++ A K+N    +L QGT+Y DI+ESG+  + TIKSHHNVGGLPE +QF L+EPL  LFKDEVR LG  L +PY+ V+RQPFPGPGL +RVLGE+TEDKL+IVR++D + R   +      +   WQYFTVL   +SVGV+GD R+Y YT+ +RAV+S+D M+A + +IP + L+K+S  I N+V +++R+VYDIT+KPP T+EWE
  S:    10 DKIIVLDYGSQYNQLITRRIREFGIFSELLPNTTTAAEIKKIAPKGIIFSGGPMSVYDGGAFSVDPEIFELGIPILGICYGMQLISFKNGGNVEASTE-REYGKAEITVTDKDSDLFKGLPEKQTVWMSHGDKVTAIPEGYVTVAESDNTPFTAIENRDKHIYGIQFHTEVQNTEFGNDILKNFAFGVCGAQDNWTMNDFIDMQIEKIREQVGDKKVLLGLSGGVDSSVVGVLLHRAIGDQLVSIFVDHGLLRKGEVEQVMESLGGKFGLNIIQVDAKERFMSKLAGVSDPEKKRKIIGNEFIQVFDEEATKLN-GIDFLAQGTLYTDIIESGTSTATTIKSHHNVGGLPEDMQFSLIEPLNTLFKDEVRDLGEKLGMPYELVWRQPFPGPGLGIRVLGEVTEDKLKIVRDSDLILRE--EFALAGLDKTVWQYFTVLPGIRSVGVMGDGRTYDYTVGIRAVNSIDGMTADFSRIPWDILQKVSVRIVNEVDHVNRIVYDITSKPPSTVEWE 517
>gi|125717986|ref|YP_001035119.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptococcus sanguinis SK36] >gi|125497903|gb|ABN44569.1| GMP synthase [glutamine-hydrolyzing], putative [Streptococcus sanguinis SK36] (520 aa)
Score = 1305, Expect = 1.1e-141, Identities = 257/511 (50%), Positives = 347/511 (67%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV--ENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++KI++LD+G QY QLI+RRIR++ V+SE+  + I+ +E+    P GIILSGG +SVY D S   +  I++L IPILGICYG Q++  + GG+V       + EYG +++  T N  LF          MSH D+V  +P  F    ++  C  A+  N  KK YG+QFHPEV  + FG  +L+NF  +IC   GDW   N    +I++I+  V D  VL  +SGGVDS V  VL  +AIGD+L C+FVDHGLLRK E+ +V  +L    G NI   D  + FL KL GV DPEQKRKIIG  F+ VF+  A+K+    K+L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QFEL+EPL  L+KDEVR LG  L +P + V+RQPFPGPGLA+RV+GEITE+KLE VRE+D + R  I +     +   WQYFTV T  +SVGV+GD R+Y YT+A+RA+ S+D M+A + KIP + L+KIS  I N+V +++R+VYDIT+KPP T+EWE
  S:    10 VEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKITADEVRAIQPVGIILSGGPNSVYEDGSFDIDPEIFELGIPILGICYGMQLLTHKLGGKVVPAGHAGNREYGQSNLSHTANSSLFNGTPESQLVLMSHGDAVTEIPTDFVRTGTSADCPFAAIENPTKKIYGIQFHPEVRHSEFGYDILRNFALNICGAKGDWSMDNFIDMEIQKIRQTVGDKKVLLGLSGGVDSSVVGVLLQKAIGDQLICIFVDHGLLRKGEADQVMDMLGGKFGLNIVKADAAKRFLDKLAGVSDPEQKRKIIGNEFVYVFDDEASKLK-DVKFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMQFELIEPLNTLYKDEVRALGTELGMPDEIVWRQPFPGPGLAIRVMGEITEEKLETVRESDAILREEIAK--AGLDRDIWQYFTVNTGVRSVGVMGDGRTYDYTIAIRAITSIDGMTADFAKIPWDVLQKISVRIVNEVDHVNRIVYDITSKPPATVEWE 520
>gi|152998143|ref|YP_001342978.1| bifunctional GMP synthase/glutamine amidotransferase protein [Marinomonas sp. MWYL1] >gi|150839067|gb|ABR73043.1| GMP synthase, large subunit [Marinomonas sp. MWYL1] (525 aa)
Score = 1304, Expect = 1.2e-141, Identities = 262/509 (51%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIE--LDNN------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R++ VY E+  +D+  +++I  +PKGIIL+GG +SV    S +  + ++ L +P+ GICYG Q M ++ GG+V+   +  E+G   IR      LF++I+  + NN       WMSH D VI +P+ F ++AST+ C +A+  N  KKFYGVQFHPEVT T  G ++L  F+  IC     W P NI  + IE ++  V D  VL A+SGGVDS V A L  +AIGD+L CVFVD+GLLR +E  +V  +    +G  +  VD + LFL KL    DPE+KRKIIG TFI+VF+  A K+    ++L QGTIYPD++ES  SK  K   IKSHHNVGGLPE +QF+L+EPL+ LFKDEVRKLGL L +PY  VYR PFPGPGL VR+LGE+ ++  +I+R AD +F   I++L     + K  Q F V    KSVGVVGD R Y Y +ALRAV+++D M+A+W  +P E LEK+S  I N++++ISRV YD+++KPP TIEWE
  S:     9 KILILDFGSQYTQLIARRVREIGVYCEVRAFDMEDQDVIDFDPKGIILAGGPESVPEPGSPRAPEAVFTLGVPVFGICYGMQTMAEQLGGKVQG-SEIREFGYAQIRKHEGPALFDDIQDHIANNGVALLDVWMSHGDKVITMPEDFTLMASTDSCPIAAMANEAKKFYGVQFHPEVTHTLQGGRILSRFIVDICGCDTLWTPANIAQDAIERMQEQVGDKKVLLALSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLHEGDQVMKMFADNMGVKVIRVDAEDLFLGKLANEADPEKKRKIIGNTFIDVFDTEATKL-TDVEFLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPEDMQFKLVEPLRELFKDEVRKLGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADILRRADAIF---IEELRNAGWYEKTSQAFAVFLPVKSVGVVGDGRRYEYVVALRAVETIDFMTARWAHLPYELLEKVSGRIINEIEHISRVTYDVSSKPPATIEWE 525
>gi|149175320|ref|ZP_01853942.1| GMP synthase [Planctomyces maris DSM 8797] >gi|148845929|gb|EDL60270.1| GMP synthase [Planctomyces maris DSM 8797] (532 aa)
Score = 1303, Expect = 1.9e-141, Identities = 259/508 (50%), Positives = 350/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGST-DIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSK---FSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG Q  QLI RR+R+ NV+S++   D+S E I + NPKGIILSGG  SVYG+ S +P+  I++L IPILGICYG Q++    G +V+   +S E+G T    L  + LF  +      WMSH D V  L + F+ +AST  C  A+  +  K F+G+QFHPEVT T FG  LL NFV  +C   G W+  N+  ++IE I+  V D  V+C +SGGVDS V A L  +AIG +L C+FVD+GLLRK E+ EV     +    ++ +VD + LFLS+L GV DP++KRKIIG+ FIEVF+K A  I    K+L QGT+YPD++ESG+     + TIKSHHNVGGLPE+L FEL+EPL+ LFKDEVR++G  L +P + +YR PFPGPGLAVR LGE+TE++L+++READ +    I++L+K N   K  Q F VL   +SVGV+GD R+Y    A+RAV++ D M+A W  +P E LE++S+ I N V+ I+RVVYD+++KPP TIEWE
  S:    25 ILVLDFGSQTAQLITRRVREQNVFSQLARPDLSAERIRELNPKGIILSGGPASVYGENSPQPDPEIFNLGIPILGICYGMQLVCASQGCEVKGG-ESREFGRTPSTVLDHSNLFSGVPSQFIAWMSHGDQVQNLSEHFESLASTETCQFAAVKHHSKPFFGLQFHPEVTHTEFGGLLLSNFVQKVCGCEGTWKISNLIEQEIETIRKRVGDKQVICGLSGGVDSSVVAALLYRAIGSQLSCIFVDNGLLRKGEADEVEHRFGEHFKTDLHVVDARDLFLSELAGVTDPQEKRKIIGRLFIEVFQKEAASIENA-KFLAQGTLYPDVIESGANPDGPAATIKSHHNVGGLPEKLGFELIEPLRELFKDEVRQMGHELGLPDELIYRHPFPGPGLAVRCLGEVTEERLKVLREADLIV---IEELHKANLYRKTKQAFAVLLPIRSVGVMGDGRTYEDVAAIRAVETDDFMTANWSPLPHEVLERMSTRITNNVRGINRVVYDVSSKPPSTIEWE 532
>gi|145618583|ref|ZP_01774641.1| GMP synthase, large subunit [Geobacter bemidjiensis Bem] >gi|144945217|gb|EDJ80284.1| GMP synthase, large subunit [Geobacter bemidjiensis Bem] >gi|197086520|gb|ACH37791.1| GMP synthase, large subunit [Geobacter bemidjiensis Bem] (516 aa)
Score = 1302, Expect = 2.1e-141, Identities = 258/510 (50%), Positives = 351/510 (68%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKF--SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP-WQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +K+LILDFG Q TQLIARR+R+ +VY EI  Y++++E+I    PKGIILSGG  SVY   +   + GI+DL IP+LGICYG Q+M Q+ GG+VE   D  E+G   + L   +E+F   +     WMSH D +  +P GF+++A T  C VA+  + ++ F+GVQFHPEV  T  G++++ NF++++C     W   N    ++  I+  V    VLCA+SGGVDS V AVL  +AIGD+L+CVFV++GLLRK E+ +V  L  K    N+  VD    FL  L+GV DPEQKRKIIG  FI +FE+ A K+     YL QGT+YPD++ES S    S  IKSHHNVGGLPE++  +LLEP++ LFKDEVR LG  L +P + VYRQPFPGPGLA+R +GE++ +KL+I+R+AD +    I+++ K   ++  WQ F VL   K+VGV+GD R+Y +T+ALRAV+S+D M+A W K+P E L  ISS I N+VK ++RVVYDI+ KPP TIEWE
  S:     8 EKVLILDFGSQVTQLIARRVREQSVYCEIHPYNMALEKIKAFAPKGIILSGGPSSVYDKDAPHSDLGIYDLGIPVLGICYGMQLMTQQLGGRVER-CDKREFGRATLALDGKSEIFAGFDGGAEVWMSHGDRIEAMPAGFQLMAHTTGCPVAAMKDEKRNFFGVQFHPEVVHTPRGDEMIGNFLFNVCGSKPTWTMANFIETELASIREKVGTGKVLCALSGGVDSAVVAVLIHKAIGDQLHCVFVNNGLLRKGEADKVVNLFTKHFKINLAHVDAADRFLGMLEGVSDPEQKRKIIGNEFIYLFEEEAKKLG-QVDYLAQGTLYPDVIESVSTKGPSAVIKSHHNVGGLPEKMNLKLLEPVRELFKDEVRLLGKELGMPDEVVYRQPFPGPGLAIRCIGELSAEKLDILRDADAIV---IEEIRKAGLYREIWQSFAVLLPVKTVGVMGDARTYEWTVALRAVNSLDGMTADWVKLPYELLGSISSRIINEVKGVNRVVYDISQKPPATIEWE 516
>gi|160936182|ref|ZP_02083555.1| hypothetical protein CLOBOL_01078 [Clostridium bolteae ATCC BAA-613] >gi|158440992|gb|EDP18716.1| hypothetical protein CLOBOL_01078 [Clostridium bolteae ATCC BAA-613] (513 aa)
Score = 1301, Expect = 2.9e-141, Identities = 261/510 (51%), Positives = 354/510 (69%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALL--KKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + I++LDFGGQY QLIARR+R+ +VY E+  YD+S+E+I + NPKGII +GG D V+ D + + +K I++L IP+LGICYG Q+M     G V+    SE YG T++ + T+++LF+ +     CWMSH   +  +P GF++ A T+ C VA     EK FY VQFHPEV  T  G ++L NFVY++C  +GDW+  +     I+ ++  + +  VLCA+SGGVDS VAAV+ ++AIG +L CVFVDHGLLRKNE  EV A+   +     N   V+ ++ F ++LKGV +PE KRKIIG+ FI VFE+ A KI     YL+QGTIYPD++ESG   S  IKSHHNVGGLPE + F EL+EPL+ LFKDEVRK GL L IP   V+RQPFPGPGL VR++GE+T DK+ IV++AD ++R  I +     +    QYF  LTN +SVG +GD R+Y Y +ALRAV + D M+A+  +IP E L K++S I N+VK ++RV+YD T KPP TIE+E
  S:     4 EMIIVLDFGGQYNQLIARRVRECSVYCEVHPYDMSLEKIKEMNPKGIIFTGGPDVVFEDGAPRCSKEIFELGIPVLGICYGAQLMSYLLDGVVKKAVVSE-YGHTEVDVDTSSKLFDGVSSKTVCWMSHGVYIAEVPAGFRITAHTDSCPVAGMECPEKNFYAVQFHPEVVHTKEGTRMLSNFVYNVCGCSGDWKMDSFVDTTIKALREKIGNGKVLCALSGGVDSSVAAVMLSKAIGKQLTCVFVDHGLLRKNEGDEVEAVFGPEGAYDLNFIRVNAQERFYARLKGVEEPEAKRKIIGEEFIRVFEEEAKKIGA-VDYLVQGTIYPDVIESGLGKSAVIKSHHNVGGLPEHVDFKELVEPLRLLFKDEVRKAGLELGIPEYLVFRQPFPGPGLGVRIIGEVTADKVRIVQDADAIYREEIAK--AGVDKNLGQYFAALTNMRSVGCMGDERTYDYAVALRAVLTSDFMTAESAQIPWEVLGKVTSRIVNEVKGVNRVLYDCTGKPPATIEFE 513
>gi|113474718|ref|YP_720779.1| bifunctional GMP synthase/glutamine amidotransferase protein [Trichodesmium erythraeum IMS101] >gi|110165766|gb|ABG50306.1| GMP synthase (glutamine-hydrolyzing) [Trichodesmium erythraeum IMS101] (575 aa)
Score = 1300, Expect = 3.6e-141, Identities = 253/508 (49%), Positives = 346/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+  VYSE++ Y  +  ++   NPKGIILSGG +SVY + +   +  IW+L IPILG+CYG Q+M+++ GG+VE  + +E YG   + +    +L  NIE     WMSH DSV  +P GF+V+A T+     +  +  KK YG QFHPEV  +  G  L++NFVY IC     W  +    E I EI++ V D  VL A+SGGVDS   A L  QAIGDKL C+F+D G +RK E + +  +  +    ++  V+ +  FLS LKGV DPE+KRK+IG  FI+VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVR +G S+ +P + V R PFPGPGLA+R+LGE+T+ +L+I+R+ADF+ R  I Q  +   H  WQ F VL   +SVGV+GD R+Y Y + LR V S D M+A W ++P + LE IS+ I N+VK ++RVVYDIT+KPPGTIEWE
  S:    62 IVILDFGSQYSELIARRIRETQVYSEVISYRTTAAKLADINPKGIILSGGPNSVYDEGAPHCDPEIWNLGIPILGVCYGMQLMVKQLGGEVERTQLAE-YGKASVSIDDPTDLLTNIEEGTTMWMSHGDSVTKMPSGFEVLAHTDNTPCGAIADHNKKLYGTQFHPEVVHSIGGQVLIRNFVYHICKCEPTWTTEAFVEEAIREIRAKVGDKRVLLALSGGVDSSTLAFLLHQAIGDKLTCMFIDQGFMRKYEPENLVKIFHESFHISVKYVNARDRFLSILKGVSDPEEKRKLIGHEFIQVFEEESKRLG-PFDYLAQGTLYPDVIESANTNVDPKTGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRNVGRSIGLPEEIVRRHPFPGPGLAIRILGEVTDKRLKILRDADFIVRDEIRQ--QGMYHDFWQAFAVLLPIQSVGVMGDQRTYAYPIVLRFVKSEDGMTADWSRVPYDLLETISNRIVNEVKGVNRVVYDITSKPPGTIEWE 575
>gi|192360356|ref|YP_001982568.1| GMP synthase, C- domain protein [Cellvibrio japonicus Ueda107] >gi|190686521|gb|ACE84199.1| GMP synthase, C- domain protein [Cellvibrio japonicus Ueda107] (525 aa)
Score = 1300, Expect = 4.2e-141, Identities = 254/509 (49%), Positives = 350/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-----TTNELFENIELDN----NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFS---KTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLY-KNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ V+SEI  +D+S +EI    P GIIL+GG +S   + + +  + ++ L +P+LGICYG Q M  + GG VE+     E+G   I+         ++ ++++ D     + WMSH D V  +P+GF+++AST  C +A   N  KKFYGVQFHPEVT T  G +L ++FV  +C     W P NI  + I++++  V  D VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLRKNE  +V  +  K +G  +   D +QLFL KL GV DPE+KRKIIG TFI+VF+  A K+    K+L QGTIYPD++ES +  +     IKSHHNVGGLPE + F+L+EPL+ LFKDEVR +GL L +PY  VYR PFPGPGL VR+LGE+ ++  +I+READ +F   +++L   +  HK  Q F V    KSVGVVGD R Y + ++LRAV+++D M+A+W  +P E LEK+S+ I N++  +SRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVFSEIRAWDMSDDEIRAYKPSGIILAGGPESTTEEEAPRAPEAVFALGVPVLGICYGMQTMAMQMGGWVESSA-IREFGYAQIKAHGQSSLLQDIKDHVDQDGSALLDVWMSHGDKVTKMPEGFELMASTPSCPIAGMYNEAKKFYGVQFHPEVTHTLQGKRLFEHFVLQLCACEKLWTPANIVEDAIKKVREQVGTDKVLLGLSGGVDSSVVAALLHRAIGDQLTCVFVDNGLLRKNEGDQVMDMFAKNMGVRVIRADAEQLFLGKLAGVSDPEKKRKIIGGTFIDVFDTEATKLQ-EVKWLAQGTIYPDVIESAAAKTGKAHVIKSHHNVGGLPEDMAFKLVEPLRELFKDEVRAIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADILREADAIF---LEELRAADWYHKTSQAFAVFLPVKSVGVVGDGRRYEWVISLRAVETVDFMTARWAHLPYELLEKVSNRIINEISGVSRVCYDVSSKPPATIEWE 525
>gi|116491142|ref|YP_810686.1| bifunctional GMP synthase/glutamine amidotransferase protein [Oenococcus oeni PSU-1] >gi|116091867|gb|ABJ57021.1| GMP synthase (glutamine-hydrolyzing) [Oenococcus oeni PSU-1] (517 aa)
Score = 1299, Expect = 4.7e-141, Identities = 259/510 (50%), Positives = 353/510 (69%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQE-NGGQVENDKDSEEYGSTDIRLTTNEL-FENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS-EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKIL+LD+G QY QLI RRIR+  V+SE+    ++I+EI    PK IILSGG  SVY D +   +  I+ L IPILG+CYG Q+M     GG+V  +  + E+G   +    N L F N        MSH DSV  +P+GF V A T+K  +A+  + +KK YG QFH E T + +GNQ+L+NFV+ I     +W+ K+   ++IE+I++ V +  VL  +SGGVDS V AVL  +AIG +L C+FVDHGLLRKNE++ V   L    G NI  VD ++ FL KL+G+ +PEQKRKIIGK FIE F   A K++    +L QGT+Y D++ESG+  ++TIKSHHNVGGLP+ + F+L+EPL+ LFKDE RKLG  + +P+  V+RQPFPGPGLA+R+LGEITE+KL +VR++D + R   D++ K   E   WQYFT+LT  +SVGV+GD R+Y +T+A+RA+ S+D M+A + K+P + L KIS  I N+V +I+RVVYDIT+KPP TIEWE
  S:     9 DKILVLDYGSQYNQLITRRIREFGVFSELKSRKMTIDEIKDYVPKAIILSGGPKSVYADDAFTIDPEIFRLGIPILGVCYGMQLMAYVLPGGKVLPNDGNGEFGQAALHFDENSLLFANTPEGQKVLMSHGDSVEAVPEGFVVAAKTDKTKIAAIADDDKKLYGAQFHAETTLSEYGNQILKNFVFKIAQCQANWQMKDFINDQIEKIRTEVGNKKVLLGLSGGVDSSVVAVLLHKAIGRQLTCIFVDHGLLRKNEAKLVMESLAGKFGLNIIKVDAQKRFLDKLEGISEPEQKRKIIGKEFIETFNDEAKKLD-GIDFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPKEMHFKLIEPLRTLFKDEARKLGEEMQMPHALVWRQPFPGPGLAIRILGEITEEKLAVVRDSDAILR---DEIAKAGLEDSVWQYFTILTGLRSVGVMGDGRTYDWTIAIRAITSVDGMTADFAKLPWDLLGKISERIVNEVGHINRVVYDITSKPPATIEWE 517
>gi|118586895|ref|ZP_01544328.1| GMP synthase [Oenococcus oeni ATCC BAA-1163] >gi|118432622|gb|EAV39355.1| GMP synthase [Oenococcus oeni ATCC BAA-1163] (531 aa)
Score = 1299, Expect = 5.2e-141, Identities = 259/510 (50%), Positives = 353/510 (69%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQE-NGGQVENDKDSEEYGSTDIRLTTNEL-FENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS-EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKIL+LD+G QY QLI RRIR+  V+SE+    ++I+EI    PK IILSGG  SVY D +   +  I+ L IPILG+CYG Q+M     GG+V  +  + E+G   +    N L F N        MSH DSV  +P+GF V A T+K  +A+  + +KK YG QFH E T + +GNQ+L+NFV+ I     +W+ K+   ++IE+I++ V +  VL  +SGGVDS V AVL  +AIG +L C+FVDHGLLRKNE++ V   L    G NI  VD ++ FL KL+G+ +PEQKRKIIGK FIE F   A K++    +L QGT+Y D++ESG+  ++TIKSHHNVGGLP+ + F+L+EPL+ LFKDE RKLG  + +P+  V+RQPFPGPGLA+R+LGEITE+KL +VR++D + R   D++ K   E   WQYFT+LT  +SVGV+GD R+Y +T+A+RA+ S+D M+A + K+P + L KIS  I N+V +I+RVVYDIT+KPP TIEWE
  S:    23 DKILVLDYGSQYNQLITRRIREFGVFSELKSRKMTIDEIKDYVPKAIILSGGPKSVYADDAFTIDPEIFRLGIPILGVCYGMQLMAYVLPGGKVLPNDGNGEFGQAALHFDENSLLFANTPEGQKVLMSHGDSVEAVPEGFVVAAKTDKTKIAAIADDDKKLYGAQFHAETTLSEYGNQILKNFVFKIAQCQANWQMKDFINDQIEKIRTEVGNKKVLLGLSGGVDSSVVAVLLHKAIGRQLTCIFVDHGLLRKNEAKLVMESLAGKFGLNIIKVDAQKRFLDKLEGISEPEQKRKIIGKEFIETFNDEAKKLD-GIDFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPKEMHFKLIEPLRTLFKDEARKLGEEMQMPHALVWRQPFPGPGLAIRILGEITEEKLAVVRDSDAILR---DEIAKAGLEDSVWQYFTILTGLRSVGVMGDGRTYDWTIAIRAITSVDGMTADFAKLPWDLLGKISERIVNEVGHINRVVYDITSKPPATIEWE 531
>gi|110597654|ref|ZP_01385939.1| GMP synthase [Chlorobium ferrooxidans DSM 13031] >gi|110340774|gb|EAT59251.1| GMP synthase [Chlorobium ferrooxidans DSM 13031] (513 aa)
Score = 1299, Expect = 5.9e-141, Identities = 261/511 (51%), Positives = 362/511 (70%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-----LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNK---CLVASACNREK-KFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP-WQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           M  +L+LDFG QYTQLIARR R+L +YSEI+ Y+ + E I + NP  IILSGG  SVY + +I P+ GI+ L IPILGICYG Q + +  GG+V +    +E+G   I +  ++     LF NI  D++ WMSH D V+ LP+GF++ AS+     C   S+ ++   K Y +QFHPEV  + +G QLL NF+  I  +  DW  K+    +IE+I+     + V+C ISGGVDS VAAVL ++AIG +L+CVFVD+GLLRKNE+++V + LK L G  + L D   LFL++LK V  PE+KRKIIG+TFI+VFE+  N+     K+L+QGT+YPD++ES S    S+TIKSHHNVGGLP+R++ +L+EPL+ LFKDEVR +G  L I    + R PFPGPGLAVRVLG +T ++L+I+READ +   YI++L  +  ++  WQ F+VL   +SVGV+GD R+Y   LALRAV+S D M+A W ++P + L ++S+ I N+V+ I+RV YDI++KPP TIEWE
  S:     1 MQSVLVLDFGSQYTQLIARRTRELGIYSEILPYNTTPETIREHNPGAIILSGGPTSVYDENAILPHDGIFSLGIPILGICYGLQAIAKHFGGKVASSL-KQEFGRAKILVKRDDNHESMLFRNIP-DSDVWMSHGDKVVRLPEGFRITASSENSEMCAFESSGSKGALKIYALQFHPEVQHSLYGKQLLSNFLIDIAGIKPDWSSKSFIEHQIEDIRQKAGKETVICGISGGVDSTVAAVLVSRAIGKQLHCVFVDNGLLRKNEAEKVMSFLKPL-GLRVTLADASDLFLNRLKSVASPEKKRKIIGRTFIQVFEEHMNQ----EKFLVQGTLYPDVIESVSVKGPSETIKSHHNVGGLPKRMKLKLIEPLRELFKDEVRAVGRELGIAEDILMRHPFPGPGLAVRVLGSLTRERLDILREADEI---YIEELKSSGLYQQVWQAFSVLLPVQSVGVMGDKRTYENVLALRAVESTDGMTADWAQLPHDFLARVSNRIINEVRGINRVAYDISSKPPATIEWE 513
>gi|78211601|ref|YP_380380.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus sp. CC9605] >gi|78196060|gb|ABB33825.1| GMP synthase [Synechococcus sp. CC9605] (528 aa)
Score = 1298, Expect = 6.0e-141, Identities = 247/508 (48%), Positives = 343/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARR+R+  V+S ++ Y  S EE+ +  PKGIILSGG  SVY + +   + GIWDL IP+LG+CYG Q+M+Q+ GG VE      EYG   + +    +L  N++  +  WMSH DSV  LP+GF  +A T     A+  + ++K YGVQFHPEV  +T G  L++NFVY +C    DW       E +  ++  V D  VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +     +    ++  ++ +Q F+ KL+G+ DPE+KRKIIG  FI VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRK+G SL +P + V R PFPGPGLA+R+LGE+T++KL+ +R+AD + R  I +  LY    H  WQ F VL   +SVGV+GD R+Y + + LR V S D M+A W ++P + +E IS+ I N+VK ++RVV DIT+KPPGTIEWE
  S:    14 IVILDFGSQYSELIARRVRETEVFSVVLGYSTSAEELRRMAPKGIILSGGPSSVYAEHAPLCDPGIWDLGIPVLGVCYGMQLMVQQLGGVVEAATGKAEYGKAPLEVDDPTDLLTNVDNGSTMWMSHGDSVKALPEGFVRLAHTANTPEAAVAHLQRKLYGVQFHPEVVHSTCGMALIRNFVYHVCGCDPDWTTAAFIDEAVALVREQVGDKRVLLALSGGVDSSTLAFLLKKAIGDQLTCMFIDQGFMRKGEPEFLMDFFDRKFNIHVEYINARQRFIGKLEGITDPEEKRKIIGTEFIRVFEEESKRLG-PFDYLAQGTLYPDVIESAGTNVDPKTGERVAVKIKSHHNVGGLPKDLQFKLVEPLRKLFKDEVRKVGRSLGLPEEIVRRHPFPGPGLAIRILGEVTDEKLDCLRDADLIVRQEIKEAGLY----HDIWQAFAVLLPVRSVGVMGDKRTYAWPIVLRCVSSEDGMTADWSRLPYDLMETISNRIVNEVKGVNRVVLDITSKPPGTIEWE 528
>gi|196238411|ref|ZP_03137186.1| GMP synthase, large subunit [Cyanothece sp. PCC 7425] >gi|196217254|gb|EDY11898.1| GMP synthase, large subunit [Cyanothece sp. PCC 7425] (515 aa)
Score = 1296, Expect = 1.3e-140, Identities = 254/508 (50%), Positives = 346/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I ILDFG QY++LIARRIR+  VYSE++ Y  +  ++   N KGIILSGG  SVY  ++   +  IW+L IP+LG+CYG Q+M+Q+ GG+VE     E YG   + +    +L  N+E +   WMSH DSV  LP GFK +A T+    A+  + ++K YGVQFHPEV  +  G  L++NFVY IC     W  +    E I EI++ V D  VL A+SGGVDS   A L  +AIG++L C+F+D G +RKNE + +  L ++     +  V+  + FL +L+GV DPE+KRK IG  FI+VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRK+G SL +P + V R PFPGPGLA+R+LG+IT ++L I+READF+ R  I++  LY+      WQ F VL   +SVGV+GD+R+Y Y + LR V S D M+A W + P E LEKIS+ I N+V  ++RVVYDIT+KPPGTIEWE
  S:     2 IAILDFGSQYSELIARRIRETQVYSEVLSYRTTAAQLQTLNLKGIILSGGPSSVYDAKAPLCDPEIWNLGIPVLGVCYGMQLMVQQLGGEVERSALGE-YGKASLLIDDPTDLLTNVENETTMWMSHGDSVSQLPAGFKTLAHTDNTPCAAIADHKRKLYGVQFHPEVVHSLGGQALIRNFVYHICQCEPTWTTELFVEEAIREIRAKVGDKRVLLALSGGVDSSTLAFLLYRAIGNQLTCMFIDQGFMRKNEPERLVKLFREQFHIPVEYVNASERFLERLEGVTDPEEKRKRIGHEFIQVFEEESRRLG-PFDYLAQGTLYPDVIESADTNVDPETGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRSLGLPEEIVQRHPFPGPGLAIRILGDITPERLHILREADFIVRQEINRSGLYQEF----WQAFAVLLPIRSVGVMGDHRTYAYPIVLRLVSSEDGMTADWSRAPYELLEKISNRIVNEVPGVNRVVYDITSKPPGTIEWE 515
>gi|92112863|ref|YP_572791.1| bifunctional GMP synthase/glutamine amidotransferase protein [Chromohalobacter salexigens DSM 3043] >gi|91795953|gb|ABE58092.1| GMP synthase (glutamine-hydrolyzing) [Chromohalobacter salexigens DSM 3043] (525 aa)
Score = 1295, Expect = 1.4e-140, Identities = 261/509 (51%), Positives = 354/509 (69%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIE--LDNN-------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R++ VYSE+  +DIS EEI +  P GIIL+GG +SV    S +  + ++++ +P+LGICYG Q M ++ GG+VE  +  +E+G   +R+   N L ++I+  +D++        WMSH D V  +P+ F V AST  C +A+    +K+FYGVQFHPEVT T  G ++L++FV  IC     W P  I  +    ++  V D +VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLRKNE  +V       +G  +  VD +  FL+KL+G  DPE KRKIIG TFI+VF++ A KI     +L QGTIYPD++ES  SK  K   IKSHHNVGGLPE ++ +L+EPL+ LFKDEVRKLGL L +PY  VYR PFPGPGL VR+LGE+ ++  +I+READ +F   I++L+  +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LEK+S+ I N++  +SRV YD+++KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRVREIGVYSEVRAFDISEEEIREYRPNGIILAGGPESVTELASPRAPQCVFEMGLPVLGICYGMQTMAEQLGGKVEGSQ-KQEFGYAQVRIDADNALLKDIKDHVDHDTGRALLDVWMSHGDKVAQVPETFTVTASTPSCPIAAMAWEDKQFYGVQFHPEVTHTQQGQRILEHFVLGICQAERLWTPAQIIDDLCVRVREQVGDRHVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRKNEGDQVMETFASHMGVRVLRVDAEDEFLTKLEGENDPEAKRKIIGNTFIDVFDREAAKIE-GVDFLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPETMKLKLVEPLRELFKDEVRKLGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADILREADAIF---IEELHNADWYHKTSQAFAVFLPVKSVGVVGDGRRYEWVIALRAVETIDFMTARWAHLPYELLEKVSNRIINEISGVSRVTYDVSSKPPATIEWE 525
>gi|33862318|ref|NP_893878.1| bifunctional GMP synthase/glutamine amidotransferase protein [Prochlorococcus marinus str. MIT 9313] >gi|44887937|sp|Q7V9A9|GUAA_PROMM GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|33640431|emb|CAE20220.1| Glutamine amidotransferase class-I:GMP synthase [Prochlorococcus marinus str. MIT 9313] (528 aa)
Score = 1295, Expect = 1.5e-140, Identities = 248/508 (48%), Positives = 347/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARR+R+  VYS ++ Y  S +E+ +  PKGIILSGG  SVY +R+   +  IWDL IP+LG+CYG Q+M+Q+ GG+VE      EYG   +++    +L  N+E  +  WMSH D V  LP+GF  +A T     A+  +  ++FYGVQFHPEV  ++ G  L++NFVY IC    +W       E I ++++ V    VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +     +    N+  ++ +Q F+SKLKG++DPE+KRKIIG  FI VFE+ +N++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRK+G +L +P + V R PFPGPGLA+R+L E+ ++KL  +R+AD + R  I +  LY    H+ WQ F VL   +SVGV+GD R+Y + + LR V S D M+A W ++P E LE+IS+ I N+V+ ++RVV DIT+KPPGTIEWE
  S:    14 IVILDFGSQYSELIARRVRETEVYSLVMSYCTSADELRQLAPKGIILSGGPSSVYAERAPLCDPNIWDLGIPVLGVCYGMQLMVQQLGGRVEAAIGKAEYGKAPLQVEDPRDLLTNVESGSTMWMSHGDVVRDLPEGFVRLAHTANTPDAAVADHNRQFYGVQFHPEVVHSSHGIALIRNFVYHICGCEPNWTTTAFIEEAIAQVQAQVGQKRVLLALSGGVDSSTLAFLLKKAIGDQLTCMFIDQGFMRKGEPEFLMDFFDQKFHINVEYINARQRFISKLKGIIDPEEKRKIIGTEFIRVFEEESNRLG-PFDYLAQGTLYPDVIESSGTNIDPKTGERVAVKIKSHHNVGGLPKDLQFKLVEPLRRLFKDEVRKVGRALGLPEEIVRRHPFPGPGLAIRILDEVNDEKLNCLRDADLIVREEIREAGLY----HEIWQAFAVLLPVRSVGVMGDKRTYAWPIVLRCVSSEDGMTADWSRLPHELLERISNRIVNEVRGVNRVVLDITSKPPGTIEWE 528
>gi|148241148|ref|YP_001226305.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus sp. RCC307] >gi|147849458|emb|CAK26952.1| GMP synthase (glutamine-hydrolyzing) [Synechococcus sp. RCC307] (563 aa)
Score = 1294, Expect = 2.0e-140, Identities = 245/508 (48%), Positives = 345/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARR+R+  VYS +V +  ++E++    P+GIILSGG  SVY   +   + GIWDL IP+LG+CYG Q+M+Q+ GG VE  +  E YG   + +    +L  N++  +  WMSH DSV  LP GF  +A T+    A+  +  +K YGVQFHPEV  +T G  L++NF+Y +C    DW  +    E I ++++ V    VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +     K    N+  ++ ++ F++KL G+ DPE+KR+IIG  FI VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRK+G SL +P + V R PFPGPGLA+R+LGE++E+KL+I+R+AD + R  +    LY    H  WQ F VL   +SVGV+GD R+Y Y + LR V S D M+A W ++P + +E+IS+ I N+V  ++RVVYDIT+KPPGTIEWE
  S:    50 IVILDFGSQYSELIARRVRETEVYSLVVSHTTTLEQLKALGPRGIILSGGPSSVYAAGAPLCDPGIWDLGIPVLGVCYGMQLMVQQLGGSVEASERGE-YGKAPLFVDDPTDLLTNVDDGSTMWMSHGDSVQALPDGFTRLAHTDNTPEAAIAHHGRKLYGVQFHPEVVHSTCGMALIRNFIYHVCGCEPDWTTEAFIDEAIADVRARVGSKRVLLALSGGVDSSTLAFLLHKAIGDQLTCMFIDQGFMRKGEPEFLVEFFDKRFHINVEYINARERFINKLAGITDPEEKRRIIGTEFIRVFEEESKRLG-PFDYLAQGTLYPDVIESAGTNVDPKTGERVAVKIKSHHNVGGLPKDLQFKLVEPLRRLFKDEVRKVGRSLGLPEEIVRRHPFPGPGLAIRILGEVSEEKLDILRDADLIVREEVRDAGLY----HDIWQAFAVLLPVRSVGVMGDKRTYAYPIVLRCVGSEDGMTADWSRLPYDLMERISNRIVNEVNGVNRVVYDITSKPPGTIEWE 563
>gi|67156482|ref|ZP_00418075.1| GMP synthase, C-terminal:GMP synthase, N-terminal [Azotobacter vinelandii AvOP] >gi|67086241|gb|EAM05711.1| GMP synthase, C-terminal:GMP synthase, N-terminal [Azotobacter vinelandii AvOP] (526 aa)
Score = 1294, Expect = 2.0e-140, Identities = 255/509 (50%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY E+  +D+S EEI    P+GIIL+GG +SV+   S +  + ++DL +P+ GICYG Q M ++ GG+V+   D  E+G   + +     L + IE        L  + WMSH D V  +P+GF V+AST  C +A+  + ++++YGVQFHPEVT T  G ++L  FV  IC     W P NI  + I ++++ V    VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E  +V A+  + +G  +   D +  FL+ L GV DPEQKRKIIG+TFIEVF+  A K+    ++L QGTIYPD++ES G++  K   IKSHHNVGGLPE +  +L+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +++R AD +F   I++L K +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LEK+S+ I N++  ISRV YD+++KPP TIEWE
  S:    10 RILILDFGSQYTQLIARRVREIGVYCELHPFDMSNEEIRAFAPRGIILAGGPESVHEADSPRAPQAVFDLGVPLFGICYGMQTMAEQLGGKVQG-SDLREFGYARVDVVGKARLLDGIEDHVDDDGVLGLDVWMSHGDKVTGIPEGFHVLASTPSCPIAAMADDKRRYYGVQFHPEVTHTKQGLRILGRFVREICGCEALWTPSNIVEDAIAQVRAQVGGANVLLGLSGGVDSSVVAALLHRAIGDRLTCVFVDNGLLRLHEGDQVMAMFAENMGVKVIRADAEAQFLANLAGVSDPEQKRKIIGRTFIEVFDAEAAKLE-NIRFLAQGTIYPDVIESAGARTGKAHVIKSHHNVGGLPEDMNLKLVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADLLRRADHIF---IEELRKADWYHKVSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETVDFMTARWAHLPYELLEKVSNRIINEIDGISRVTYDVSSKPPATIEWE 526
>gi|171058746|ref|YP_001791095.1| GMP synthase, large subunit [Leptothrix cholodnii SP-6] >gi|170776191|gb|ACB34330.1| GMP synthase, large subunit [Leptothrix cholodnii SP-6] (532 aa)
Score = 1294, Expect = 2.0e-140, Identities = 261/510 (51%), Positives = 340/510 (66%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNC--------WMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI----NVPFKYLLQGTIYPDIVESGSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPW-----QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKILILDFG Q TQLIARR+R+ +VY EI   D+S + I    PK IILSG + S Y D  ++  + +WD  +P+LGICYG Q M  + GG+VE   D  E+G  ++R   + +LF+ IE             WMSH D V  LP GFK++AST  C +A   N +K++Y VQFHPEVT T  G  +L  FV  I    GDW   +   E +  I++ V D+ V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR NE   V  +    +   +  V+  + FL  LKGV DPEQKRKIIG+ F+EVF+  A K+    N   K+L QGTIYPD+VESG   SK  TIKSHHNVGGLPE L  +LLEPL+ LFKDEVR+LG++L +P+  VYR PFPGPGL VR+LGE+  +  E+++ AD +F   + +    +  K W     Q FTV    KSVGV+GD R+Y Y +ALRAV + D M+A W ++P   L+K+SS I N+V+ I+RV YD+++KPP TIEWE
  S:     4 DKILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFIKTFAPKAIILSGSHASTYEDHQLRAPQAVWDAGVPVLGICYGMQTMAVQLGGKVEW-SDHREFGYAEVRARGHTKLFDGIEDFATAEGHGMLKVWMSHGDKVTELPPGFKLMASTPSCPIAGMANEDKRYYAVQFHPEVTHTLQGAAMLTRFVRDIAGCRGDWIMGDYIAEAVAHIRAQVGDEEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDHGLLRLNEGAMVMEMFAGRLHAKVVHVEAAEQFLGHLKGVTDPEQKRKIIGREFVEVFQAEAAKLKGDGNKGAKWLAQGTIYPDVVESGGTASKKATIKSHHNVGGLPETLGLKLLEPLRELFKDEVRELGVALGLPHDMVYRHPFPGPGLGVRILGEVKPEFAELLKRADHIFIEELRKTVDEATGKTWYDLTSQAFTVFLPVKSVGVMGDGRTYDYVVALRAVQTSDFMTADWAELPYALLKKVSSRIINEVRGINRVTYDVSSKPPATIEWE 532
>gi|119512578|ref|ZP_01631655.1| bifunctional GMP synthase/glutamine amidotransferase protein [Nodularia spumigena CCY9414] >gi|119462778|gb|EAW43738.1| bifunctional GMP synthase/glutamine amidotransferase protein [Nodularia spumigena CCY9414] (539 aa)
Score = 1293, Expect = 2.5e-140, Identities = 252/508 (49%), Positives = 345/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+  VYSE++ Y  + E + K NPKGIILSGG  SVY D +   +  IW+L IPILG+CYG Q+M+++  G+V    D  EYG   + +    +L  N+E     WMSH DSV  +P GF+++A T+    A+  + EKK YGVQFHPEV  +  G  L++NFVY ICD    W  +    E I EI++ V D  VL A+SGGVDS   A L  +AIG++L CVF+D G +RK E + +  L K+     +  V  +  FL+ ++G+ DPE+KR+ IG  FI+VFE+ + ++   F YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRK+G S+ +P + V RQPFPGPGLA+R+LGE+T ++L I+R+AD + R  I++  +   H  WQ F VL   +SVGV+GD R+Y Y + LR V S D M+A W +IP + LE IS+ I N+VK ++RVVYDIT+KPPGTIEWE
  S:    26 IVILDFGSQYSELIARRIRETQVYSEVLSYRTTPEHLRKLNPKGIILSGGPSSVYDDHAPHCDPEIWNLGIPILGVCYGMQLMVKQLDGEVAK-ADRGEYGKASLYIDDPTDLLTNVEEGTTMWMSHGDSVTKMPTGFELLAHTDNTPCAAIADHEKKLYGVQFHPEVVHSLGGLPLIRNFVYHICDCEPTWTTEAFVEEAIREIRARVGDKRVLLALSGGVDSSTLAFLLYKAIGEQLTCVFIDQGFMRKLEPERLLKLFKEQFHIPVEYVMARDRFLNMIEGITDPEEKRRRIGHEFIQVFEETSKRLG-HFDYLAQGTLYPDVIESADTNVDPQTGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRSIGLPEEIVQRQPFPGPGLAIRILGEVTPERLNILRDADLIVRQEINK--RGLYHDVWQAFAVLLPIRSVGVMGDKRTYAYPIVLRIVTSEDGMTADWARIPYDILEDISNRIVNEVKGVNRVVYDITSKPPGTIEWE 539
>gi|125623845|ref|YP_001032328.1| bifunctional GMP synthase/glutamine amidotransferase protein [Lactococcus lactis subsp. cremoris MG1363] >gi|146345430|sp|Q9Z6H4|GUAA_LACLM GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|124492653|emb|CAL97602.1| GMP synthase [Lactococcus lactis subsp. cremoris MG1363] (513 aa)
Score = 1293, Expect = 2.8e-140, Identities = 251/511 (49%), Positives = 351/511 (68%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++KI++LD+G QY QLIARRIR++ V+SE++ + ++ +EI + NP GIILSGG +SVY + S   +  I++L +P+LGICYG Q+M  + GG VE   +  EYG   ++LT  + LF       +  MSH D V  +P+GF V+ ++     A+  N E+  YG+QFHPEV  +  G ++L+NF  +IC   G+W  +N    +I++I+  V D  VL  +SGGVDS V  VL  +AIGD+L  +FVDHG LRK E+ +V   L    G NI  VD ++ F+ KL G+ DPE KRKIIG  F+ VF+  ANK+     +L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L +P + V+RQPFPGPGLA+RVLG++TE+KLE VRE+D + R  I       E   WQYFTV T+ KSVGV+GD R+Y YTLA+RA+ S+D M+A + ++P + L+KIS  I N+V +++R+VYDIT+KPP T+EW+
  S:     6 LEKIIVLDYGSQYNQLIARRIREIGVFSELMSHKVTAKEIREINPIGIILSGGPNSVYDEGSFDIDPEIFELGLPVLGICYGMQLMSYKLGGMVEAAGE-REYGVAPLQLTEKSALFAGTPEVQDVLMSHGDRVTAIPEGFHVVGTSPNSPFAAVENTERNLYGIQFHPEVRHSVHGTEMLRNFALNICGAKGNWSMENFIDMQIKDIREKVGDKKVLLGLSGGVDSSVVGVLLQRAIGDQLTSIFVDHGFLRKGEADQVMETLGGKFGLNIIKVDAQKRFMDKLVGLSDPETKRKIIGNEFVYVFDDEANKLE-GVDFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMQFQLIEPLNTLFKDEVRALGTQLGMPDEIVWRQPFPGPGLAIRVLGDLTEEKLETVRESDAILREEIAA--SGLERDVWQYFTVNTDVKSVGVMGDQRTYDYTLAIRAITSIDGMTADFAQLPWDLLQKISKRIVNEVDHVNRIVYDITSKPPATVEWQ 513
>gi|56479231|ref|YP_160820.1| bifunctional GMP synthase/glutamine amidotransferase protein [Azoarcus sp. EbN1] >gi|81356291|sp|Q5NYE5|GUAA_AZOSE GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|56315274|emb|CAI09919.1| GMP synthase [Azoarcus sp. EbN1] (521 aa)
Score = 1293, Expect = 2.8e-140, Identities = 263/509 (51%), Positives = 346/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNN--------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG Q TQLIARR+R+  VY EI  +D+S + + +  P G+ILSGG +SVY        + +++L +P+LGICYG Q M Q+ GG VE+     E+G  +IR    +ELF +IE   N         WMSH D V  LP GFKVIAS   C VA   +  +KFY VQFHPEVT T  G  +L  FV+ IC    DW   +   E IE++++ V  + V+  +SGGVDS V A L  +AIG++L CVFVD+GLLR NE+++V     + +G  +  VD  + F+  LKGV DPE KRKIIG+ F+EVF+  ANK+    K+L QGTIYPD++ES GSK  K  TIKSHHNVGGLPE L  +LLEPL+ LFKDEVR+LG++L +P++ VYR PFPGPGL VR+LGE+ ++  E++R AD +F   ID+L     + K  Q F V    KSVGV+GD R+Y Y +ALRAV++ D M+A W ++P   L K+S+ I N+V+ I+RVVYDI+ KPP TIEWE
  S:     5 KILILDFGSQVTQLIARRVREQQVYCEIHPFDVSDDFVREFAPAGVILSGGPNSVYEAVGWHAPQSVFELGVPVLGICYGMQTMAQQLGGSVES-SGKREFGYAEIRARGHSELFRSIEDRTNDEGHGLLDVWMSHGDKVTALPPGFKVIASNESCPVAGMADEVRKFYAVQFHPEVTHTIKGRDMLARFVHEICGCGRDWNMPDYVNEAIEKVRAQVGQEEVILGLSGGVDSSVVAALLHRAIGEQLTCVFVDNGLLRLNEAEQVMLTFARNLGVKVIHVDATEQFMGHLKGVSDPEAKRKIIGREFVEVFQAEANKLPNA-KWLAQGTIYPDVIESAGSKTGKAHTIKSHHNVGGLPETLNLKLLEPLRELFKDEVRELGIALGLPHEMVYRHPFPGPGLGVRILGEVKQEFAELLRRADAIF---IDELRAADWYDKTSQAFAVFLPVKSVGVMGDGRTYEYVVALRAVETQDFMTAHWAELPHSLLGKVSNRIINEVRGINRVVYDISGKPPATIEWE 521
>gi|186456023|ref|ZP_02966337.1| GMP synthase, large subunit [bacterium Ellin514] >gi|184208101|gb|EDU05146.1| GMP synthase, large subunit [bacterium Ellin514] (513 aa)
Score = 1292, Expect = 3.3e-140, Identities = 261/510 (51%), Positives = 351/510 (68%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN--ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS-EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++I+ILDFG QYTQ+IARRIR+ NVYS I+ YD   EEI    PKG+ILSGG  SVY   + +P+K I+DL IPILGICYG Q++ Q  GG+VE  +   EYG   +++  +   LF N+      W SH D +  LP+GFK +A T     A+  N  KK YG+QFHPEV  T  G +++ NFV++IC     W   +   + +E I++ V ++ V+  +SGGVDS VAA L  +AIG++L C+FV++GLLR  E++ V  +  +     +   D   LFL +LKGV DPE+KRKIIGKTFIEVFE  A K     K+L QGT+YPDI+ES       +  IKSHHNVGGLP++++F+L+EPLK LFKDEVR+LGL L +P + V RQPFPGPGLAVR+LGE+T  + EI+READ +    ++++  +   +K WQ F VL   KSVGV+GD R+Y YT+ALRAV+S D M+A W K+P + LEK+SS I N+VK ++RV +DI++KPP TIEWE
  S:     3 EQIVILDFGSQYTQVIARRIRECNVYSIILRYDTPAEEIAAMQPKGLILSGGPASVYTKGAPQPDKAIFDLGIPILGICYGLQLVAQYLGGKVEKGQ-KREYGKGTLQVKDSFCALFANLPEKLQVWNSHGDKLTKLPRGFKSVAITENSDYAAIENHAKKMYGLQFHPEVAHTPQGREIISNFVHNICGCGKLWTMHSYIDQAVEAIRNQVGNEKVILGLSGGVDSSVAAALLHKAIGNQLTCIFVNNGLLRGREAKTVQEVFGRHFKIKLQYEDASNLFLKRLKGVTDPERKRKIIGKTFIEVFE-AATKRAGKAKFLAQGTLYPDIIESVPIAGNPAAMIKSHHNVGGLPKKMRFQLVEPLKSLFKDEVRELGLELGLPREIVLRQPFPGPGLAVRILGEVTPRRCEILREADTIV---VEEMKTSGWYYKIWQSFAVLLPVKSVGVMGDERTYDYTIALRAVESQDGMTADWVKLPYDLLEKLSSRIINEVKGVNRVCFDISSKPPATIEWE 513
>gi|88809316|ref|ZP_01124824.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus sp. WH 7805] >gi|88786535|gb|EAR17694.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus sp. WH 7805] (528 aa)
Score = 1292, Expect = 3.4e-140, Identities = 245/508 (48%), Positives = 342/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARR+R+  V+S ++ Y  + EE+ +  PKGIILSGG  SVY + +   +  IW+L IP+LG+CYG Q+M+Q+ GG+V       EYG   + +    +L  N+   +  WMSH DSV  LP+GF  +A T     A+  N +++ YGVQFHPEV  +T G  +++NFVY IC    DW       E +++++S V D  VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +     +    ++  ++ +Q FL KLK + DPEQKRKIIG  FI VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRK+G SL +P + V R PFPGPGLA+R+LGE+T +KL  +R+AD + R  + +  LY    H+ WQ F VL   +SVGV+GD R+Y + + LR V S D M+A W ++P + +E IS+ I N+VK ++RVV DIT+KPPGTIEWE
  S:    14 IVILDFGSQYSELIARRVRETEVFSVVLGYSTTAEELRRMAPKGIILSGGPSSVYAEHAPLCDPEIWNLGIPVLGVCYGMQLMVQQLGGRVVAATGKAEYGKAPLEVDDPTDLLTNVANGSTMWMSHGDSVEALPEGFVRLAHTANTPEAAVANHQRRLYGVQFHPEVVHSTCGMAMIRNFVYHICGCEPDWTTAAFIEEAVKQVRSQVGDKRVLLALSGGVDSSTLAFLLKKAIGDQLTCMFIDQGFMRKGEPEFLMDFFDRKFNIHVEYINARQRFLEKLKDITDPEQKRKIIGTEFIRVFEEESRRLG-PFDYLAQGTLYPDVIESAGTNVDPKTGERVAVKIKSHHNVGGLPKDLQFKLVEPLRKLFKDEVRKVGRSLGLPEEIVRRHPFPGPGLAIRILGEVTAEKLNCLRDADLIVREEVKEAGLY----HEIWQAFAVLLPVRSVGVMGDKRTYAWPIVLRCVSSEDGMTADWSRLPYDLMETISNRIVNEVKGVNRVVLDITSKPPGTIEWE 528
>gi|116334330|ref|YP_795857.1| bifunctional GMP synthase/glutamine amidotransferase protein [Lactobacillus brevis ATCC 367] >gi|116099677|gb|ABJ64826.1| GMP synthase (glutamine-hydrolyzing) [Lactobacillus brevis ATCC 367] (521 aa)
Score = 1292, Expect = 3.5e-140, Identities = 249/510 (48%), Positives = 348/510 (68%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQE-NGGQVENDKDSEEYGSTDIRLTTNE--LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKI++LDFG QY QLI RRIRDL VYSE+  + ++  EI    PKGII SGG +SVY   +   +  I++L IPILGICYG Q+M     GG+VE+  D+ EYG  DI + +++  LF +   +   WMSH D V  +P GF+ +A++  C +++  +  + FYG+QFH EV  T +GN +L++F + +C    +W   +    +I +I+  V D  VL  +SGGVDS V  VL  +AIG +L  +FVDHGLLRK E+++V   L+   G NI  V+ +  FLSKL GV +PE+KRKIIG  FI+VF   A K++    +L QGT+Y D++ESG+  ++TIKSHHNVGGLPE + F+L+EPL+ LFKDE R+LG  L +P + V+RQPFPGPGL +RVLGEIT +KL+IVR++D + R  I +     +   WQYFTVL N KSVGV+GD R+Y Y + +RAV S+D M+A +  IP + L+ IS  I N+V++++R++YD+T+KPP TIEWE
  S:    13 DKIIVLDFGSQYNQLITRRIRDLGVYSELKAHTMTAAEIKAWGPKGIIFSGGPNSVYDSSAFNVDPEIFNLGIPILGICYGMQLMAHSLTGGKVES-ADNREYGRADITVLSDDAKLFHDTPKEQTVWMSHGDLVTQVPDGFERVATSENCPISAMQDTTRNFYGIQFHAEVRNTEYGNDILKHFAFDVCQAQANWSMDDFIDLQIAQIRETVGDKKVLLGLSGGVDSSVVGVLLHKAIGSQLTSIFVDHGLLRKGEAKQVMDSLEGKFGLNIVQVNAQDRFLSKLAGVTEPEKKRKIIGNEFIQVFNDEAQKLD-GIDFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMHFQLIEPLRSLFKDEARELGEKLGMPSELVWRQPFPGPGLGIRVLGEITPEKLQIVRDSDLILREEIKK--AGLDRDIWQYFTVLPNIKSVGVMGDGRTYDYAVGIRAVTSIDGMTADFAHIPWDVLQDISVRIVNEVEHVNRILYDVTSKPPSTIEWE 521
>gi|78778422|ref|YP_396534.1| bifunctional GMP synthase/glutamine amidotransferase protein [Prochlorococcus marinus str. MIT 9312] >gi|91206817|sp|Q31DE7|GUAA_PROM9 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|78711921|gb|ABB49098.1| GMP synthase (glutamine-hydrolyzing) [Prochlorococcus marinus str. MIT 9312] (528 aa)
Score = 1292, Expect = 3.5e-140, Identities = 260/508 (51%), Positives = 349/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ILILDFG QY++LIARRIR+ NV+S +V   ISIEEI   NPKGIILSGG +SVY   + K ++ I++L IPILGICYG Q+M++E GG V +     EYG   I +   +EL  ++E  +  WMSH DS+  LP GF  IA T   L A+  N  KK +GVQFHPEV  + FG  +++NFVY I     DW  +    E I  I+  V +  VL A+SGGVDS   A L  +AIG++L C+F+D G +RK E + +     K     +  ++ ++ F+SKLKG+ DPEQKRKIIG+ FI VFE+ +N++  PF+YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRKLG +L +P + + R PFPGPGLA+R+LGE+  +KL+ +R+AD++ R  I +  LY +     WQ F VL   K+VGV+GD R+Y + + LR V S D M+A W KIP   LE+IS+ I N+V +++RVVYDIT+KPPGTIEWE
  S:    14 ILILDFGSQYSELIARRIRETNVFSLVVSNCISIEEINDINPKGIILSGGPNSVYEKNAPKCDEKIFNLGIPILGICYGMQLMVKELGGSVTSATKKAEYGRAPINIDQESELLSDVEDKSIMWMSHGDSINCLPDGFNKIAHTENTLHAAISNDRKKLFGVQFHPEVIHSEFGITVIKNFVYGISSCVADWTTETYIEETIPRIRDQVGNKKVLLALSGGVDSSTLAFLLNKAIGNQLTCMFIDQGFMRKGEPEFLMNFFDKKFHIKVEYINARERFISKLKGITDPEQKRKIIGEEFIRVFEEESNRLG-PFQYLAQGTLYPDVIESAGTNIDPKTGERIAVKIKSHHNVGGLPKDLQFKLVEPLRKLFKDEVRKLGAALGLPDEIIKRHPFPGPGLAIRILGEVNNEKLDCLRDADWIVRDEIKKAGLYNDI----WQAFAVLLPVKTVGVMGDKRTYAWPIVLRCVSSEDGMTADWSKIPFPILERISNRIVNEVVSVNRVVYDITSKPPGTIEWE 528
>gi|93004847|ref|YP_579284.1| bifunctional GMP synthase/glutamine amidotransferase protein [Psychrobacter cryohalolentis K5] >gi|92392525|gb|ABE73800.1| GMP synthase (glutamine-hydrolyzing) [Psychrobacter cryohalolentis K5] (531 aa)
Score = 1292, Expect = 3.7e-140, Identities = 249/510 (48%), Positives = 348/510 (68%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL----TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVP-----FKYLLQGTIYPDIVESGSKF---SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D+ILILDFG QY+QLIARR+RD  V+ E+  YDI  + II    KG+ILSGG +SV+ D S + N  ++D+ +P+LGICYG Q M +  GG+V +  D  E+G+  I +    T  +  E+     N WMSH D V+  P+GF ++AST  C +A   +  + +YG+QFHPEVT T  G  LL  FV+ ICD AG W P NI   +IE++K  + D  VL  +SGGVDS V A L  +AIGD+L CVFVD GLLR +E  +V  +  + +G  +  VD ++LFL+ L G  DPE KRKIIGKTFI+VF   A +++        ++L QGTIYPD++ES       +  IKSHHNVGGLP+ L FEL+EPL+ LFKDEVRKLG++L +P + + R PFPGPGL VR+LG++T++  +I+R AD +F   +++L ++  + K  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A++  +P + +E +S+ I N++  +SRV YD+++KPP TIEWE
  S:    13 DRILILDFGSQYSQLIARRVRDSGVFCEMFPYDIDTQRIIDFGAKGVILSGGPESVHADDSPRINDAVFDIGVPVLGICYGMQAMAERFGGKV-HASDIHEFGAATINIDGKSTLTDGIEDAAAKLNVWMSHGDKVVDAPQGFDIVASTPSCPIAIMADDSRHYYGLQFHPEVTHTAQGQALLGRFVHQICDCAGSWTPDNIIDMRIEQLKKQIGDKQVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDTGLLRLHEGDQVMQIFAENMGVKVIRVDAEELFLTALAGESDPEAKRKIIGKTFIDVFANSAREVSEQSDGKVIEFLAQGTIYPDVIESAKSHQGKAHVIKSHHNVGGLPDDLAFELVEPLRDLFKDEVRKLGITLGLPAKMINRHPFPGPGLGVRILGKVTKEFADILRSADAIF---MEELERSGWYEKTAQAFAVFQPIKSVGVVGDGRRYAWVIALRAVETVDFMTARFAHLPYDLIETVSNRIMNEIAEVSRVTYDVSSKPPATIEWE 531
>gi|170780979|ref|YP_001709311.1| GMP synthase [Clavibacter michiganensis subsp. sepedonicus] >gi|169155547|emb|CAQ00659.1| GMP synthase [Clavibacter michiganensis subsp. sepedonicus] (526 aa)
Score = 1291, Expect = 3.8e-140, Identities = 252/508 (49%), Positives = 347/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINV-------PFKYLLQGTIYPDIVESGSKF-SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFG QY QLIARR+R+ NVYSEIV   I+ EEI  K+P GI+LSGG  SVY + S   ++GI +L +P+LGICYGFQVM +  GG+V +     EYGST + LT  + L +    D   WMSH DSV   P+GF+++AS+    VA+  + E++ YGVQ+HPEV  +  G  +L+NF++    + GDW   N+  E++E I++ V D  V+C +SGGVDS VAA +  +A+GD+L CVFVDHGLLR++E ++V        G  +  VD    FL  L GV DPE KRKIIG+ FI  FE  A  + +       P ++L+QGT+YPD+VESG    +  IKSHHNVGGLPE L+FEL+EPL+ LFKDEVR +G  L +P   V RQPFPGPGL +R++GE+T ++LE++R+AD + R+ +     + E   WQ   V L + +SVGV GD R+YG+ + LR V S DAM+A W ++P + L +IS+ I N+V  ++RVV D+T+KPPGTIEWE
  S:    12 VLVVDFGAQYAQLIARRVREANVYSEIVPSTITAEEIRAKDPSGIVLSGGPSSVYEEGSPGLDEGILELGVPVLGICYGFQVMARALGGEVAH-TGQREYGSTAVTLTPGSTLLDGQPDDQTVWMSHGDSVSKAPEGFEILASSASTPVAAFASDERRLYGVQWHPEVKHSAHGQAVLENFLHRAAGIPGDWNSGNVIAEQVERIRAQVGDARVICGLSGGVDSAVAAAIVHRAVGDQLTCVFVDHGLLRQDERRQVEEDYVAATGVRLVTVDAADQFLDGLAGVTDPEAKRKIIGREFIRSFEGAAEALVLEAKADGEPIRFLVQGTLYPDVVESGGGTGTANIKSHHNVGGLPEDLKFELVEPLRTLFKDEVRAIGRELGLPEAIVGRQPFPGPGLGIRIVGEVTAERLELLRKADAIARAELTAAGLDDE--IWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWTRLPYDVLARISNRITNEVDGVNRVVLDVTSKPPGTIEWE 526
>gi|91792628|ref|YP_562279.1| bifunctional GMP synthase/glutamine amidotransferase protein [Shewanella denitrificans OS217] >gi|91714630|gb|ABE54556.1| GMP synthase [Shewanella denitrificans OS217] (525 aa)
Score = 1291, Expect = 4.0e-140, Identities = 257/509 (50%), Positives = 354/509 (69%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIR-LTTNELFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARRIR++ VY E+  +D+S  +I + NP+GIIL+GG +SV  + S +  + +++  +P+LGICYG Q M ++ GG+V       E+G   +  L  + LF+ IE          LD   WMSH D V  +P+GFK +A T+ C  A+  N EK+FYGVQFHPEVT T  G ++L++F  +IC    +W+P +I  + IE IK+ V DD V+  +SGGVDS V A+L  +AIG KL CVFVD+GLLR NE+++V  +     G NI  VD +  FL  + GV DPE KRKIIG+ F+E+F++ + K     K+L QGTIYPD++ES GS   K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+K +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRIREIGVYCELWAWDVSEAQIREFNPQGIILAGGPESVTAENSPRAPEYVFNAGVPVLGICYGMQTMSEQLGGKVIQGVGEGEFGYAQVEMLLESALFKGIEDAISPAGRPLLD--VWMSHGDKVSAIPEGFKAVAKTDTCPFAAMANEEKRFYGVQFHPEVTHTRQGLRMLEHFAVAICGCGTNWKPSSIIEDAIERIKAQVGDDEVILGLSGGVDSSVVAMLLHRAIGKKLTCVFVDNGLLRLNEAEQVLEMFGDHFGLNIVHVDAENRFLDAMAGVADPEAKRKIIGRVFVEIFDEESKKC-ANAKWLAQGTIYPDVIESAGSATGKAHVIKSHHNVGGLPDDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVDGISRVVYDISGKPPATIEWE 525
>gi|170077976|ref|YP_001734614.1| GMP synthetase [Synechococcus sp. PCC 7002] >gi|169885645|gb|ACA99358.1| GMP synthetase [Synechococcus sp. PCC 7002] (540 aa)
Score = 1291, Expect = 4.2e-140, Identities = 245/508 (48%), Positives = 346/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP-WQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+  VYSE++ Y  S E++ + NP GIILSGG  SVY D +   +  IW+L IP+LG+CYG Q+M+++ GG VE  K +E YG   I +    +L  N+E  +  WMSH DS + LP+GF+++A T+    A+  +  ++ YGVQFHPEV  +  G  L++NFVY IC     W  +    E I EI++ V D  VL A+SGGVDS   A L  QAIGD+L C+F+D G +RK E + +  +  +     +  ++ +  F+ KLKGV DPE+KR++IG  FI VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLPE L+F+L+EPL+ LFKDEVRK+  S+ +P + + R PFPGPGLA+R++GE+T ++L I+R+AD++ R   D++ K   +   WQ F VL   +SVGV+GD R+Y + + LR + S D M+A W + P E LE IS+ + N+VK ++RVVYDIT+KPPGTIEWE
  S:    27 IVILDFGSQYSELIARRIRETEVYSEVISYRTSAEQLRQLNPSGIILSGGPSSVYDDYAPACDPEIWNLGIPVLGVCYGMQLMVKQLGGTVERAKHAE-YGKASIFIDDPTDLLTNVEEGSTMWMSHGDSCVHLPEGFEILAHTDNTPCAAIAHHGRQLYGVQFHPEVVHSQDGMALIRNFVYHICKCEPTWTTEAFVEEAIREIRARVGDQRVLLALSGGVDSSTLAFLLHQAIGDQLTCMFIDQGFMRKGEPERLVEIFDEQFHIPVAYINARDRFIDKLKGVTDPEEKRRLIGHEFIAVFEEESKRLG-PFDYLAQGTLYPDVIESADTNVDPKTGERVAVKIKSHHNVGGLPEDLRFKLVEPLRKLFKDEVRKVAASIGLPEEIIRRHPFPGPGLAIRIIGEVTAERLNILRDADWVVR---DEIKKQGVYSDFWQAFAVLLPIRSVGVMGDKRTYAHPVVLRMITSEDGMTADWARPPYELLETISNRMVNEVKGVNRVVYDITSKPPGTIEWE 540
>gi|116749554|ref|YP_846241.1| bifunctional GMP synthase/glutamine amidotransferase protein [Syntrophobacter fumaroxidans MPOB] >gi|116698618|gb|ABK17806.1| GMP synthase (glutamine-hydrolyzing) [Syntrophobacter fumaroxidans MPOB] (518 aa)
Score = 1291, Expect = 4.4e-140, Identities = 248/510 (48%), Positives = 347/510 (68%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDN-NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP-WQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +++LILDFG QYTQLIARR+R+ +VY EI  +++ +E I    PKGIILSGG  SV+   +   +  I++L +P+LGICYG Q+M ++ GG VE   D  EYG   I +   +ELF +IE +    WMSH D ++ LP GF ++A ++    A+  N E++ YGVQFHPEV  T  G  +L NF++  C     W  K+     +  I+  V DD V+CA+SGGVDS V AVL   AIG +L+C+FV++GLLRK E++ V  + +     N+   D   LFL +LK V DPE+KRKIIG  F+E+FE+ A ++    KYL QGT+YPD++ES S    S TIK+HHNVGGLPER+  +L+EPL+ LFKDEVR LG  L +P + + R PFPGPGLA+R +G +T + LEI+R+AD   R  ++++  +  +   WQ F VL   +SVGV+GD R+Y   +A+RAV+S+DAM+A W ++P E L++IS+ I N+VK ++RVVYDI++KPPGTIEWE
  S:     9 ERVLILDFGSQYTQLIARRVRESHVYCEIHPFNMDMESIKAFRPKGIILSGGPSSVHEQGAPFSDPAIFELGVPVLGICYGMQLMARQLGGSVER-ADRREYGPATIDIDVPDELFRDIEREGVRVWMSHGDRILELPAGFSILARSDNSPAAAMGNSERRLYGVQFHPEVVHTPCGKDILDNFLFRTCRCRATWTMKSFVESAVASIREQVGDDQVICALSGGVDSSVVAVLLHNAIGSRLHCIFVNNGLLRKGEAESVQRVFRDHFSINLIYADASDLFLERLKDVTDPERKRKIIGNLFVELFEREAGRLE-SVKYLAQGTLYPDVIESVSFKGPSATIKTHHNVGGLPERMNLKLIEPLRELFKDEVRMLGRELGLPERIIMRHPFPGPGLAIRTIGAVTPESLEILRDAD---RIILEEIEASGWYDHVWQAFAVLLPIRSVGVMGDERTYDQVVAVRAVESVDAMTADWARLPYEVLQRISNRIINEVKGVNRVVYDISSKPPGTIEWE 518
>gi|161506835|ref|YP_001576789.1| bifunctional GMP synthase/glutamine amidotransferase protein [Lactobacillus helveticus DPC 4571] >gi|160347824|gb|ABX26498.1| GMP synthase [Lactobacillus helveticus DPC 4571] (494 aa)
Score = 1291, Expect = 4.6e-140, Identities = 251/496 (50%), Positives = 347/496 (69%)
  Q:    16 LIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT--NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +I RRIRD  +YSE++ +D+SI +I + +PKGII SGG +SVY D ++K +  I+ L IPILGICYG Q+M  + GG+VE   +++EYG  +I +    + LF+ +      WMSH D V   P GF+V AS+  C +A+  N +KKFYG+QFH EV  + +G  +L++F + +C    +W   +    K+++I+  V D  V+  +SGGVDS V A L  +AIGD+L  +FVDHG+LRK+E  +V   L K +G NI  V+ ++ FL KLKGV DPEQKRKIIGK FIEVF + A K+     +L QGT+Y D++ESG+  ++TIKSHHNVGGLP+ + F+L+EPL+ LFKDEVR+LG  L IP+  V+RQPFPGPGL +RVLGE+TEDKL+IVR++D + R  I +     + K WQYFTVL   +SVGV+GD R+Y YT+ +RAV S+D M+A + +IP + L  IS  I N+V N++RVVYD+T+KPP TIEWE
  S:     1 MITRRIRDFGIYSELLPHDLSIAKIKEMHPKGIIFSGGPNSVYDDGALKVDPEIFKLGIPILGICYGMQLMSYDLGGKVEQ-AENKEYGRANITVEDPDSALFKGLPSKQYVWMSHGDLVTKAPNGFEVAASSKNCPIAAIANPDKKFYGIQFHAEVRNSEYGLDILKHFAFDVCGADANWTMNDFIDMKVDDIRKEVGDKKVILGLSGGVDSSVTATLLHKAIGDQLTAIFVDHGMLRKDEGDQVMQALNKDLGVNIIRVNAQKRFLDKLKGVTDPEQKRKIIGKEFIEVFNEEAKKLK-DVNFLAQGTLYTDVIESGTNTAQTIKSHHNVGGLPKDMHFKLIEPLRKLFKDEVRELGERLGIPHDLVWRQPFPGPGLGIRVLGEVTEDKLKIVRDSDAILREEIKK--AGLQEKIWQYFTVLPGIRSVGVMGDGRTYDYTIGIRAVTSIDGMTADFAQIPWDVLGHISDRIVNEVDNVNRVVYDVTSKPPSTIEWE 494
>gi|148273738|ref|YP_001223299.1| bifunctional GMP synthase/glutamine amidotransferase protein [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147831668|emb|CAN02637.1| GMP synthase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (526 aa)
Score = 1290, Expect = 5.1e-140, Identities = 253/508 (49%), Positives = 347/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINV-------PFKYLLQGTIYPDIVESGSKF-SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFG QY QLIARR+R+ NVYSEIV   I+ EEI  K+P GI+LSGG  SVY + S   ++GI +L +P+LGICYGFQVM +  GG+V +   + EYGST + LT  + L +    D   WMSH DSV   P+GF+V+AS+    VA+  + E++ YGVQ+HPEV  +  G  +L+NF++    + GDW   N+  E++E I++ V D  V+C +SGGVDS VAA +  +A+GD+L CVFVDHGLLR +E ++V        G  +  VD    FL  L GV DPE KRKIIG+ FI  FE  A  + +       P ++L+QGT+YPD+VESG    +  IKSHHNVGGLPE L+FEL+EPL+ LFKDEVR +G  L +P   V RQPFPGPGL +R++GE+T ++LE++R+AD + R+ +     + E   WQ   V L + +SVGV GD R+YG+ + LR V S DAM+A W ++P + L +IS+ I N+V  ++RVV D+T+KPPGTIEWE
  S:    12 VLVVDFGAQYAQLIARRVREANVYSEIVPSTITAEEIRAKDPSGIVLSGGPSSVYEEGSPGLDEGILELGVPVLGICYGFQVMARALGGEVAH-TGAREYGSTAVTLTPGSTLLDGQPDDQTVWMSHGDSVSKAPEGFEVLASSASTPVAAFASDERRLYGVQWHPEVKHSAHGQAVLENFLHRAAGIPGDWNSGNVIAEQVERIRAQVGDAKVICGLSGGVDSAVAAAIVHRAVGDQLTCVFVDHGLLRHDERRQVEEDYVAATGVRLVTVDAADQFLDGLTGVTDPEAKRKIIGREFIRSFEGAAEALVLEAKADGEPIRFLVQGTLYPDVVESGGGTGTANIKSHHNVGGLPEDLKFELVEPLRTLFKDEVRAIGRELGLPEVIVGRQPFPGPGLGIRIVGEVTAERLELLRKADAIARAELTAAGLDGE--IWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWTRLPYDVLARISNRITNEVDGVNRVVLDVTSKPPGTIEWE 526
>gi|194337627|ref|YP_002019421.1| GMP synthase, large subunit [Pelodictyon phaeoclathratiforme BU-1] >gi|194310104|gb|ACF44804.1| GMP synthase, large subunit [Pelodictyon phaeoclathratiforme BU-1] (513 aa)
Score = 1290, Expect = 5.3e-140, Identities = 262/511 (51%), Positives = 356/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-----LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNK---CLVASACNREK-KFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           M  +L+LDFG QYTQLIARRIR+L +YSEI+ Y+ + E I + NPK IILSGG  SVY   +I P+ GI+ L IP+LGICYG QV+ +  GG+V +     E+G   I +  +      LF +I  D++ WMSH D V+ LP+GF+V AS+     C   S  ++   K Y +QFHPEV  T +G QLL NF+ +I  +  DW  K+    ++EEI      + V+C ISGGVDS VAAV+  +AIG +L+CVFVD+GLLRKNE+++V   L  L G  + LVD   LFL +LK V  PE+KRKIIG+TFI+VFE+   +     K+L+QGT+YPD++ES S    S+TIKSHHNVGGLP+R++ +L+EPL+ LFKDEVR +G  L I    + R PFPGPGLAVRVLG +T+++L+I+R+AD +F   I++L     + K WQ F VL   +SVGV+GD R+Y   LALRAV+S D M+A W ++P + L ++S+ I N+V+ I+RV YDI++KPP TIEWE
  S:     1 MQSVLVLDFGSQYTQLIARRIRELGIYSEILPYNTTPESIREHNPKAIILSGGPTSVYDASAILPDDGIFSLGIPMLGICYGLQVIAKHFGGEVAS-SSKHEFGRAKIMVAQDNEPESPLFHDIP-DSDVWMSHGDKVMQLPEGFRVTASSENSEMCAFESFGSKGALKIYALQFHPEVQHTLYGKQLLSNFLITIAGITPDWSSKSFIEHQLEEISRKAGKETVICGISGGVDSTVAAVMVGKAIGKQLHCVFVDNGLLRKNEAEKVMTFLSTL-GLRVTLVDASDLFLKRLKTVASPEKKRKIIGRTFIQVFEEQMEQ----EKFLVQGTLYPDVIESVSVKGPSETIKSHHNVGGLPKRMKLKLIEPLRELFKDEVRAVGRELGIAEDILMRHPFPGPGLAVRVLGSVTKERLDILRDADEIF---IEELKSTGLYQKVWQAFAVLLPVQSVGVMGDKRTYENVLALRAVESSDGMTADWAQLPHDFLARVSNRIINEVRGINRVAYDISSKPPATIEWE 513
>gi|71064590|ref|YP_263317.1| bifunctional GMP synthase/glutamine amidotransferase protein [Psychrobacter arcticus 273-4] >gi|91206823|sp|Q4FVS5|GUAA_PSYA2 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|71037575|gb|AAZ17883.1| GMP synthase (glutamine-hydrolyzing) [Psychrobacter arcticus 273-4] (536 aa)
Score = 1290, Expect = 5.6e-140, Identities = 251/510 (49%), Positives = 346/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL----TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVP-----FKYLLQGTIYPDIVESGSKF---SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D+ILILDFG QY+QLIARR+RD  V+ E+  YDI  + I     KGIILSGG +SV+ + S + N  +++L +P+LGICYG Q M +  GG+V +  D  E+G+  I +    T     E+     N WMSH D V+  P+GF ++AST  C +A   +  + +YG+QFHPEVT T  G  LL  FV+ ICD AG W P NI   +IE++K  + D  VL  +SGGVDS V A L  +AIGD+L CVFVD GLLR +E  +V  +  + +G  +  VD ++LFL+ L G  DPE KRKIIGKTFI+VF   A +I+        ++L QGTIYPD++ES       +  IKSHHNVGGLP+ L FEL+EPL+ LFKDEVRKLG++L +P + + R PFPGPGL VR+LGE+T++  +I+R AD +F   +++L K+  + K  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A++  +P + +E +S+ I N++  +SRV YD+++KPP TIEWE
  S:    18 DRILILDFGSQYSQLIARRVRDSGVFCEMFPYDIDTQRITDFGAKGIILSGGPESVHAENSPRINDAVFELGVPVLGICYGMQAMAERFGGKV-HASDIHEFGAATINIDGKSTLTNGIEDAAAKLNVWMSHGDKVVDAPQGFDIVASTPSCPIAIMADDSRHYYGLQFHPEVTHTAQGQALLGRFVHEICDCAGSWTPDNIIDMRIEQLKKQIGDKQVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDTGLLRLHEGDQVMQIFAENMGVKVIRVDAEELFLTALAGESDPEAKRKIIGKTFIDVFANSAREISEQSDGKVIEFLAQGTIYPDVIESAKSHQGKAHVIKSHHNVGGLPDDLAFELVEPLRDLFKDEVRKLGITLGLPAKMINRHPFPGPGLGVRILGEVTKEFADILRSADAIF---MEELEKSGWYEKTAQAFAVFQPIKSVGVVGDGRRYAWVIALRAVETVDFMTARFAHLPYDLIETVSNRIMNEIAEVSRVTYDVSSKPPATIEWE 536
>gi|186476070|ref|YP_001857540.1| GMP synthase, large subunit [Burkholderia phymatum STM815] >gi|184192529|gb|ACC70494.1| GMP synthase, large subunit [Burkholderia phymatum STM815] (527 aa)
Score = 1290, Expect = 6.2e-140, Identities = 258/510 (50%), Positives = 347/510 (68%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDN---------NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLF----RSYIDQLYKNSEHKPW-----QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKILILDFG Q TQLIARRIR+ +V SEI  +D+S E I    P GIILSGG +SV    + +  + +++  +P+LGICYG Q M ++ GG+V++     E+G  ++R   +  F +   D            WMSH D V+ +P+GF+++AST  C +A+  +  + FYGVQ+HPEVT T  G  +L+ FV  IC    DWE  N   E +E I+  V D++V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR NE+++V ++    +G  +  VD  + F+SKLKGV DPE KRKIIG  F+EVF+  A K+    K+L QGTIYPD++ES   G K + TIKSHHNVGGLPE L  +LLEPL+ LFKDEVR+LG+ L +P   VYR PFPGPGL VR+LGE+  +  +++R AD +F    R++ID+       K W     Q F V    KSVGV+GD R+Y Y +ALRAV ++D M+A W  +P + L  +S+ I N+V+ I+RVVYDI+ KPP TIEWE
  S:     3 DKILILDFGSQVTQLIARRIREAHVLSEIHPHDVSDEFIRDFKPTGIILSGGPNSVTETDTPRAPQAVFEAGVPVLGICYGMQTMAEQLGGKVDSGH-LREFGYAEVRARNHTSFLDGIQDFATPEGHGMLKVWMSHGDKVLEMPQGFQLMASTESCPIAAMADETRHFYGVQWHPEVTHTVQGRAMLERFVLKICGAKPDWEMGNYIDEAVENIRKQVGDEHVILGLSGGVDSSVAAALLHRAIGDQLTCVFVDHGLLRLNEAEQVMSMFADNLGVKVIHVDASEAFMSKLKGVTDPEAKRKIIGAEFVEVFQTEAGKL-TDAKWLAQGTIYPDVIESAGKGKKAAHTIKSHHNVGGLPETLNLKLLEPLRELFKDEVRELGVKLGLPPSMVYRHPFPGPGLGVRILGEVKREYADLLRRADAIFIESLRTFIDK----DTDKSWYDLTSQAFAVFLPVKSVGVMGDGRTYEYVVALRAVQTLDFMTAHWAHLPHDLLGHVSNRIINEVRGINRVVYDISGKPPATIEWE 527
>gi|4321715|gb|AAD15805.1| GMP synthase [Lactococcus lactis] (513 aa)
Score = 1290, Expect = 6.4e-140, Identities = 250/511 (48%), Positives = 351/511 (68%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++KI++LD+G QY QLIARRIR++ V+SE++ + ++ +EI + NP GIILSGG +SVY + S   +  I++L +P+LGICYG Q+M  + GG VE   +  EYG   ++LT  + LF       +  MSH D V  +P+GF V+ ++     A+  N E+  YG+QFHPEV  +  G ++L+NF  +IC   G+W  +N    +I++I+  V D  VL  +SGGVDS V  VL  +AIGD+L  +FVDHG LRK E+ +V   L    G NI  VD ++ F+ KL G+ DPE +RKIIG  F+ VF+  ANK+     +L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L +P + V+RQPFPGPGLA+RVLG++TE+KLE VRE+D + R  I       E   WQYFTV T+ KSVGV+GD R+Y YTLA+RA+ S+D M+A + ++P + L+KIS  I N+V +++R+VYDIT+KPP T+EW+
  S:     6 LEKIIVLDYGSQYNQLIARRIREIGVFSELMSHKVTAKEIREINPIGIILSGGPNSVYDEGSFDIDPEIFELGLPVLGICYGMQLMSYKLGGMVEAAGE-REYGVAPLQLTEKSALFAGTPEVQDVLMSHGDRVTAIPEGFHVVGTSPNSPFAAVENTERNLYGIQFHPEVRHSVHGTEMLRNFALNICGAKGNWSMENFIDMQIKDIREKVGDKKVLLGLSGGVDSSVVGVLLQRAIGDQLTSIFVDHGFLRKGEADQVMETLGGKFGLNIIKVDAQKRFMDKLVGLSDPETQRKIIGNEFVYVFDDEANKLE-GVDFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMQFQLIEPLNTLFKDEVRALGTQLGMPDEIVWRQPFPGPGLAIRVLGDLTEEKLETVRESDAILREEIAA--SGLERDVWQYFTVNTDVKSVGVMGDQRTYDYTLAIRAITSIDGMTADFAQLPWDLLQKISKRIVNEVDHVNRIVYDITSKPPATVEWQ 513
>gi|87301596|ref|ZP_01084436.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus sp. WH 5701] >gi|87283813|gb|EAQ75767.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus sp. WH 5701] (532 aa)
Score = 1289, Expect = 6.6e-140, Identities = 248/508 (48%), Positives = 342/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARR+R+  VYS ++ Y  S+E+I +  PKGIILSGG +SVY + +   +  IW L IP+LG+CYG Q+M+Q+ GGQVE      EYG   + +    +L  N+E  +  WMSH DSV  LP GF  +A T+    A+  + +++ YGVQFHPEV  +  G  +++NFVY IC    DW       E + +++  V D  VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +           +  ++ +  FL+KL GV DPEQKRKIIG  FI VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRK+G SL +P + V R PFPGPGLA+R+LGE++ +KL I+R+AD + R  + +  LY    H+ WQ F VL   +SVGV+GD R+Y Y + LR V S D M+A W ++P + LE+IS+ I N+V+ ++RVV DIT+KPPGTIEWE
  S:    19 IVILDFGSQYSELIARRVRETEVYSLVLGYATSVEDIKRLAPKGIILSGGPNSVYDEGAPLCDPAIWSLGIPVLGVCYGMQLMVQQLGGQVEA-AGRGEYGKAPLYVDDPVDLLTNVEHGSTMWMSHGDSVQALPPGFSRLAHTDNTPEAAVADHQRRLYGVQFHPEVVHSRGGMAMIRNFVYHICGCEPDWTTAAFIDEALADVRDRVGDKRVLLALSGGVDSSTLAFLLHRAIGDQLTCMFIDQGFMRKGEPEFLTEFFDAQFHIRVEYINARDRFLAKLDGVTDPEQKRKIIGAEFIRVFEEESKRLG-PFDYLAQGTLYPDVIESAGTNLDPKTGERVAVKIKSHHNVGGLPKDLQFKLVEPLRRLFKDEVRKVGRSLGLPEEIVRRHPFPGPGLAIRILGEVSAEKLNILRDADLIVREEVQEAGLY----HEIWQAFAVLLPVRSVGVMGDKRTYAYPIVLRCVSSEDGMTADWSRLPYDLLERISNRIVNEVQGVNRVVLDITSKPPGTIEWE 532
>gi|169351304|ref|ZP_02868242.1| hypothetical protein CLOSPI_02084 [Clostridium spiroforme DSM 1552] >gi|169292366|gb|EDS74499.1| hypothetical protein CLOSPI_02084 [Clostridium spiroforme DSM 1552] (515 aa)
Score = 1289, Expect = 8.4e-140, Identities = 259/508 (50%), Positives = 361/508 (71%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTD--IRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGK------NIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG-SKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++++DFGGQY QL+ARR+R+ NVY EI  Y   +E+I + NPKGIIL+GG +S Y + S    K +++L IP+LG+CYG Q+M    GG+VE   D  EYG ++  I  T ++LF+++  ++ CWMSH D +  +  GF++ + T  C VAS  N E+K Y +QFHPEV  T  G  +L NFV  +C+ +GDW   +   E+++ I+  V +  VLCA+SGGVDS VAAVL ++AIG++L CVFVDHGLLRKNE  EV    +++ G       N   V+ +Q +  KLKG+ +PE KRKIIG+ FI VFE+ A KI     +L+QGTIYPD+VESG    S  IKSHHNVGGLP+ + F E++EPL+ LFKDEVRK+GL L IP   V+RQPFPGPGL +R++GE+TE+K++IV++AD ++R  I +     +    QYF  LTN +SVGV+GD R+Y Y +ALRAV+++D M+A+  +IP E L K+ S I N+V+ ++RV+YDIT+KPPGTIE+E
  S:     6 VIVIDFGGQYNQLVARRVRECNVYCEIYSYKTDLEKIKEMNPKGIILTGGPNSCYLEDSPTYQKELFELGIPVLGLCYGAQLMQHVLGGKVER-ADVREYGKSNLIISKTDSKLFKDVPKESICWMSHFDYISKIAPGFEITSYTKDCPVASCENEEQKLYAIQFHPEVLHTEHGKNILSNFVMDVCNCSGDWRMDSFVEEQVKAIREKVGNGKVLCALSGGVDSSVAAVLLSKAIGNQLTCVFVDHGLLRKNEGDEV----EEVFGPNGHYELNFIRVNAQQRYYDKLKGIEEPEAKRKIIGEEFIRVFEEEAKKIGT-VDFLVQGTIYPDVVESGLGGESAVIKSHHNVGGLPDAVDFKEIIEPLRDLFKDEVRKVGLELGIPEYLVFRQPFPGPGLGIRIIGEVTEEKVKIVQDADAIYREEIAK--AGLDKTIGQYFAALTNMRSVGVMGDERTYDYAIALRAVNTIDFMTAEAAQIPYEVLNKVMSRIINEVRGVNRVMYDITSKPPGTIEFE 515
>gi|72162988|ref|YP_290645.1| bifunctional GMP synthase/glutamine amidotransferase protein [Thermobifida fusca YX] >gi|91206835|sp|Q47LQ0|GUAA_THEFY GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|71916720|gb|AAZ56622.1| GMP synthase (glutamine-hydrolyzing) [Thermobifida fusca YX] (528 aa)
Score = 1289, Expect = 8.4e-140, Identities = 252/510 (49%), Positives = 343/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI-------NVPFKYLLQGTIYPDIVES-GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D +L++DFG QY QLIARR+R+ +VYSEIV   + +EE++ K PK IILSGG  SVY D + +   G++D  +PILGICYGFQVM Q  GG VE    S EYG T I + T+  LF ++      WMSH D+V  +P GF V   T    VA+  +R++  YGVQFHPEV  T  G  +LQ+F+Y        W   NI  +++  I++ +     +C +SGGVDS VAA L  +AIGD+L CVFVDHGLLR+ E+++V        G ++ +VD ++ FL+ L GV DPE KRKIIG+ FI VFE+ A +I       +   ++L+QGT+YPD+VES G   +  IKSHHNVGGLP+ LQF L+EPL+ LFKDEVR++G  L +P + V+R PFPGPGLA+R++GE+T ++LEI+R AD + R  + +     +   WQ   V L + +SVGV GD R+YG+ + LR V S DAM+A W ++P + L  IS+ I N+V +I+RV  DIT+KPPGTIEWE
  S:    12 DTVLVVDFGAQYAQLIARRVRECHVYSEIVPPTMPVEEMLAKKPKAIILSGGPSSVYADGAPQAPPGLFDTGVPILGICYGFQVMAQTLGGTVERTGRS-EYGRTTINVATDSLLFHSLPQQQTVWMSHGDAVSQVPDGFTVTGQTADAPVAAMEHRDRALYGVQFHPEVVHTEHGRAVLQHFLYEAAGCRPTWTMVNIVEDQVARIRAQIGSKRAICGLSGGVDSAVAAALVQRAIGDRLTCVFVDHGLLRQGEAEQVEKDFVAATGASLKVVDAQERFLTALAGVTDPETKRKIIGREFIRVFEQAAREIVAEAGEGDEAVEFLVQGTLYPDVVESGGGNGTANIKSHHNVGGLPDDLQFTLVEPLRELFKDEVRRVGEELGLPAEMVWRHPFPGPGLAIRIVGEVTAERLEILRAADAIVREELTR--AGLDRAIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVTSEDAMTADWARVPYDVLATISNRITNEVPDINRVTLDITSKPPGTIEWE 528
>gi|154496648|ref|ZP_02035344.1| hypothetical protein BACCAP_00940 [Bacteroides capillosus ATCC 29799] >gi|150273900|gb|EDN01000.1| hypothetical protein BACCAP_00940 [Bacteroides capillosus ATCC 29799] (513 aa)
Score = 1288, Expect = 9.1e-140, Identities = 251/508 (49%), Positives = 345/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVE--NDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +++LDFGGQY QLIARR+R+  VY E+  Y   +E+I    P GII +GG +SVY +++   +  I++L IP+LGICYG Q+M    GGQV    D  + EYG T+    T+ ++F+ +      WMSH D +  +P+GF ++A ++ C   +  +  + FYGVQ+HPEV  T  G  +++NF+Y +C  AGDW   + K   I EI+  V    VL A+SGGVDS V A L A+A+G++L CVFVDHGL+RK+E  EV     +    N   VD +  FL KL GV +PE+KRKIIG+ FI VFE+ A KI     +L QGTIYPD++ESG+  +  IKSHHNVGGLP+ + F E++EPL+ LFKDEVR+LG  L +P   V RQPFPGPGLA+R++G+IT++K + +READF+FR  I +   +      QYF VLTN++SVGV+GD R+Y YTLALRAV + D M+A W +IP E L+++S  I N+VK I+R+ YDIT+KPP T+EWE
  S:     6 VVVLDFGGQYNQLIARRVRECGVYCEVKPYTTPLEQIKAMAPIGIIFTGGPNSVYDEKAPHVDPEIFNLGIPVLGICYGCQLMAHTLGGQVTAAQDDSAREYGKTETYYNTDCKIFKGLPSQGISWMSHGDYMAKVPQGFDLVAHSDACPNVAIADESRGFYGVQYHPEVNHTENGVAMIRNFLYEVCGAAGDWTMGDYKNTAIREIREKVGSGKVLLALSGGVDSSVVAALLAEAVGNQLTCVFVDHGLMRKDEGDEVEQAFARW-DINFVRVDAESRFLLKLAGVSEPERKRKIIGEEFIRVFEEEAKKIGA-VDFLAQGTIYPDVIESGAGDAAVIKSHHNVGGLPDYVDFKEIIEPLRLLFKDEVRQLGRELGLPEYLVSRQPFPGPGLAIRIIGDITKEKADTLREADFIFRDEIAKAGLDGGIN--QYFAVLTNTRSVGVMGDGRTYDYTLALRAVTTDDFMTADWARIPYEVLDRVSVRIVNEVKGINRICYDITSKPPATVEWE 513
>gi|169797667|ref|YP_001715460.1| GMP synthetase (glutamine aminotransferase) [Acinetobacter baumannii AYE] >gi|184156475|ref|YP_001844814.1| GMP synthase PP-ATPase subunit [Acinetobacter baumannii ACICU] >gi|169150594|emb|CAM88503.1| GMP synthetase (glutamine aminotransferase) [Acinetobacter baumannii] >gi|183208069|gb|ACC55467.1| GMP synthase, PP-ATPase domain/subunit [Acinetobacter baumannii ACICU] >gi|193076025|gb|ABO10615.2| GMP synthetase [Acinetobacter baumannii ATCC 17978] (522 aa)
Score = 1288, Expect = 9.9e-140, Identities = 256/510 (50%), Positives = 356/510 (69%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSE-EYGSTDIRLTTNELFENIELDNN---CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D+ILILDFG QY+QLIARR+R+  VYSE+  +D+S E+I    P GIILSGG +SV+ + S +  + +++L +P+LGICYG Q M ++ GG+VE     E  Y   DI +  ++L  N++   N    WMSH D V  +P+GF + AST  C VA+  +  ++FYGVQFHPEVT T  G +LL NFV+ IC   G W P++I   ++E+++  + ++ VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR NE  +V  +  + +G  +   D +  FL+ L GV DPE KRKIIG+ FIEVF + A K++   K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ L FEL+EPL+ LFKDEVRKLG +L +P+  +YR PFPGPGL VR+LGE+ ++  +I+R AD +F   + +L  +  + K  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A++  +P E ++KIS+ I N++K++SRVVYD+++KPP TIEWE
  S:    10 DRILILDFGSQYSQLIARRVREAGVYSEMYAFDMSEEDIRAFKPNGIILSGGPESVHEEGSPRAPQVVFELGVPVLGICYGLQTMSEQLGGKVEPGTVHEFGYAEVDI-VKRDQLIGNLQDRENQLHVWMSHGDKVSQIPEGFTITASTPSCPVAAVSDETRRFYGVQFHPEVTHTAKGEELLSNFVHKICGCGGLWTPEHIIDLRVEQLREQIGNEKVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLNEGDQVMQMFAENMGIRVIRADAEARFLNALAGVTDPEAKRKIIGREFIEVFAEEARKLD-GVKFLAQGTIYPDVIESAASKQGKAHVIKSHHNVGGLPDDLAFELVEPLRDLFKDEVRKLGTTLGLPHSMIYRHPFPGPGLGVRILGEVKKEYADILRLADDIF---MQELRDSGWYDKTAQAFAVFQPVKSVGVVGDGRRYAWVIALRAVETVDFMTARFAHLPYELVDKISTRIMNEIKDVSRVVYDVSSKPPATIEWE 522
>gi|189424960|ref|YP_001952137.1| GMP synthase, large subunit [Geobacter lovleyi SZ] >gi|189421219|gb|ACD95617.1| GMP synthase, large subunit [Geobacter lovleyi SZ] (517 aa)
Score = 1288, Expect = 1.0e-139, Identities = 254/509 (49%), Positives = 346/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKF--SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP-WQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG Q TQLIARRIR+ +VY EI  Y++ +E+I    P+GIILSGG  SVY   +   + G+++L +P+LGICYG Q+M  + GG+VE   D  E+G   + +  T +LF  +      WMSH D +  +PKGF  IA T+    A+  + +++ Y VQFHPEV  T  G ++L NFV+++C     W   N    +I  I+  V +  V+CA+SGGVDS V AVL  +AIGD+L C+FV++GLLRK E+++V  L  +    N+  V+    FL KLKG+ DPEQKRKIIG  FI +FE  A KI     +L QGT+YPD++ES S    S  IKSHHNVGGLP+R++ +L+EP++ LFKDEVR LG  L +P + ++RQPFPGPGLA+R +GEIT D+LEI+RE+D +    +D++ K   ++  WQ F VL   +SVGV+GD R+Y YT+ALRAV+S+D M+A W K+P E +  ISS I N+VK ++RVVYDI+ KPP TIEWE
  S:    10 KILILDFGSQVTQLIARRIREQSVYCEIHPYNMGLEKIKAFAPQGIILSGGPSSVYDADAPHSDAGVYELGVPVLGICYGMQLMTSQLGGKVER-SDKREFGRAAMTIDDTTDLFSGLSGKEEVWMSHGDKIEQMPKGFSAIAHTDNTPAAAMKDEKRRLYAVQFHPEVVHTPKGAEMLGNFVFTVCGCQPIWTMANFIETEIAAIREKVGNGKVICALSGGVDSSVVAVLLHKAIGDQLQCIFVNNGLLRKGEAEKVVNLFTRHFKINLDYVEASSRFLDKLKGITDPEQKRKIIGNEFIYLFEDEAKKIGT-VDWLAQGTLYPDVIESVSTKGPSAVIKSHHNVGGLPDRMKMKLIEPVRELFKDEVRLLGKELGLPDEVIHRQPFPGPGLAIRCIGEITADRLEILRESDAIV---LDEIRKAGLYREIWQSFAVLLPVRSVGVMGDARTYDYTIALRAVNSLDGMTADWVKLPYEVMGSISSRIINEVKGVNRVVYDISQKPPATIEWE 517
>gi|16331412|ref|NP_442140.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechocystis sp. PCC 6803] >gi|1346218|sp|P49057|GUAA_SYNY3 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|1001583|dbj|BAA10210.1| GMP synthetase [Synechocystis sp. PCC 6803] (542 aa)
Score = 1288, Expect = 1.1e-139, Identities = 244/508 (48%), Positives = 346/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+  VYSE++ Y  + +++ +  PKGIILSGG +SVY   + + +  I+ L +P+LG+CYG Q+M+++ GG+VE  K  E YG   + +    +L  N+E D+  WMSH DS + LP GF+++A T+    A+  + +K  +GVQFHPEV  +  G  L++NFVY IC     W       E I E++S V D  VL A+SGGVDS   A L  +AIGD L C+F+D G +RK E + +  L        +  V+ +  FL +L+GV DPE+KR++IG  FI+VFE+ +N++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRKLG S+ +P + V R PFPGPGLA+R++GE+T ++L I+R+ADF+ R  I +  +   H  WQ F VL   +SVGV+GD R+Y + + LR + S D M+A W ++P + LE IS+ I N+VK ++RVVYDIT+KPPGTIEWE
  S:    29 IVILDFGSQYSELIARRIRETEVYSEVLSYRTTAQQLREIKPKGIILSGGPNSVYDQGAPECDPEIFQLGVPVLGVCYGMQLMVKQLGGRVERAKRGE-YGKASLHIDDPTDLLTNVENDSTMWMSHGDSCVDLPTGFEILAHTDNTPCAAIADHQKALFGVQFHPEVVHSVGGIALIRNFVYHICHCEPTWTTAAFIEESIREVRSQVGDRRVLLALSGGVDSSTLAFLLHRAIGDNLTCMFIDQGFMRKGEPERLVELFDHQFHIPVQYVNARDRFLKQLEGVTDPEEKRRLIGHEFIQVFEEESNRLG-PFDYLAQGTLYPDVIESADSNVDPKTGERVAVKIKSHHNVGGLPKNLRFKLVEPLRKLFKDEVRKLGRSIGLPEEIVRRHPFPGPGLAIRIIGEVTSERLNILRDADFIVRDEISK--RGIYHDYWQAFAVLLPIRSVGVMGDKRTYAHPVVLRFITSEDGMTADWARVPYDILEAISNRIVNEVKGVNRVVYDITSKPPGTIEWE 542
>gi|15673468|ref|NP_267642.1| bifunctional GMP synthase/glutamine amidotransferase protein [Lactococcus lactis subsp. lactis Il1403] >gi|13627131|sp|Q9CFJ0|GUAA_LACLA GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|12724481|gb|AAK05584.1|AE006379_1 GMP synthase (EC 6.3.5.2) [Lactococcus lactis subsp. lactis Il1403] (513 aa)
Score = 1287, Expect = 1.1e-139, Identities = 250/511 (48%), Positives = 350/511 (68%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++KI++LD+G QY QLIARRIR++ V+SE++ + ++ +EI + NP GIILSGG +SVY + S   +  I++L +P+LGICYG Q++  + GG VE   +  EYG   ++LT  + LF       +  MSH D V  +P+GF V+ ++     A+  N E+  YG+QFHPEV  +  G ++L+NF  +IC   G+W  +N    +I+ I+  V D  VL  +SGGVDS V  VL  +AIGD+L  +FVDHG LRK E+ +V   L    G NI  VD ++ F+ KL G+ DPE KRKIIG  F+ VF+  ANK+     +L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L +P + V+RQPFPGPGLA+RVLG++TE+KLE VRE+D + R  I       E   WQYFTV T+ KSVGV+GD R+Y YTLA+RA+ S+D M+A + ++P + L+KIS  I N+V +++R+VYDIT+KPP T+EW+
  S:     6 LEKIIVLDYGSQYNQLIARRIREIGVFSELMSHKVTAKEIREINPIGIILSGGPNSVYDEGSFDIDPEIFELGLPVLGICYGMQLLSYKLGGMVEAAGE-REYGVAPLQLTGKSALFAGTPEVQDVLMSHGDRVTAIPEGFHVVGTSPNSPFAAVENTERNLYGIQFHPEVRHSVHGTEMLRNFALNICGAKGNWSMENFIDMQIKNIREKVGDKKVLLGLSGGVDSSVVGVLLQRAIGDQLTSIFVDHGFLRKGEADQVMETLGGKFGLNIIKVDAQKRFMDKLVGLSDPETKRKIIGNEFVYVFDDEANKLE-GVDFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMQFQLIEPLNTLFKDEVRALGTQLGMPDEIVWRQPFPGPGLAIRVLGDLTEEKLETVRESDAILREEIAA--AGLERDVWQYFTVNTDVKSVGVMGDQRTYDYTLAIRAITSIDGMTADFAQLPWDLLQKISKRIVNEVDHVNRIVYDITSKPPATVEWQ 513
>gi|169632146|ref|YP_001705882.1| GMP synthetase (glutamine aminotransferase) [Acinetobacter baumannii SDF] >gi|169150938|emb|CAO99551.1| GMP synthetase (glutamine aminotransferase) [Acinetobacter baumannii] (522 aa)
Score = 1287, Expect = 1.1e-139, Identities = 256/510 (50%), Positives = 356/510 (69%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSE-EYGSTDIRLTTNELFENIELDNN---CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D+ILILDFG QY+QLIARR+R+  VYSE+  +D+S E+I    P GIILSGG +SV+ + S +  + +++L +P+LGICYG Q M ++ GG+VE     E  Y   DI +  ++L  N++   N    WMSH D V  +P+GF + AST  C VA+  +  ++FYGVQFHPEVT T  G +LL NFV+ IC   G W P++I   ++E+++  + ++ VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR NE  +V  +  + +G  +   D +  FL+ L GV DPE KRKIIG+ FIEVF + A K++   K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ L FEL+EPL+ LFKDEVRKLG +L +P+  +YR PFPGPGL VR+LGE+ ++  +I+R AD +F   + +L  +  + K  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A++  +P E ++KIS+ I N++K++SRVVYD+++KPP TIEWE
  S:    10 DRILILDFGSQYSQLIARRVREAGVYSEMYAFDMSEEDIRAFKPNGIILSGGPESVHEEGSPRAPQVVFELGVPVLGICYGLQTMSEQLGGKVELGTVHEFGYAEVDI-VKRDQLIGNLQDRENQLHVWMSHGDKVSQIPEGFTITASTPSCPVAAVSDETRRFYGVQFHPEVTHTAKGEELLSNFVHKICGCGGLWTPEHIIDLRVEQLREQIGNEKVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLNEGDQVMQMFAENMGIRVIRADAEARFLNALAGVTDPEAKRKIIGREFIEVFAEEARKLD-GVKFLAQGTIYPDVIESAASKQGKAHVIKSHHNVGGLPDDLAFELVEPLRDLFKDEVRKLGTTLGLPHSMIYRHPFPGPGLGVRILGEVKKEYADILRLADDIF---MQELRDSGWYGKTAQAFAVFQPVKSVGVVGDGRRYAWVIALRAVETVDFMTARFAHLPYELVDKISTRIMNEIKDVSRVVYDVSSKPPATIEWE 522
>gi|152991082|ref|YP_001356804.1| bifunctional GMP synthase/glutamine amidotransferase protein [Nitratiruptor sp. SB155-2] >gi|151422943|dbj|BAF70447.1| GMP synthase (glutamine-hydrolyzing) [Nitratiruptor sp. SB155-2] (516 aa)
Score = 1287, Expect = 1.2e-139, Identities = 268/508 (52%), Positives = 350/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-----TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QYTQLIARR+R++ VY EI  +   IE I  K P+GIILSGG  SVY   + + +K I++L IP+LGICYG Q++  + GGQV    +  EYG   +           LFE  +     WMSH D V  LP GF  IA T+    A+  N EK+ Y +QFHPEV+ +  G ++L+NF   IC +   W+  +   E+IE+I+  V +D VLCA+SGGVDS V   L  +AIGDKL  VFVD+GLLR+ E ++V  + K ++   + +VD K+ FL+ L+G+ DPEQKRKIIG TFIEVFE+ A K +   KYL QGT+YPD++ES S    S+TIKSHHNVGGLP+ ++FEL+EPL+ LFKDEVRKLGL L +P + VYR PFPGPGLA+R+LGE+ E+ L++VR+AD +    I    LY+    K WQ F VL N KSVGV+GD R+Y  T+ALR V+S D M+A +  IP + LE IS+ I N+V  I+RVVYDIT+KPPGTIEWE
  S:     6 IVILDFGSQYTQLIARRLREVGVYCEIYPFFEPIENIRAKKPQGIILSGGPASVYEPDAPRVDKAIYELGIPVLGICYGMQLITVDFGGQVVRALE-HEYGKAKLYFDPIHGKVCPLFEGTKDGQIVWMSHGDKVTELPAGFIRIAHTDNSPYAAIANEEKQIYALQFHPEVSHSQEGQKILENFARKICGITSKWDMGHFAKEQIEKIRQRVGEDKVLCALSGGVDSSVVTALLYEAIGDKLIPVFVDNGLLREGEREKVEYVFKNMLKVPLIVVDAKERFLNALQGITDPEQKRKIIGHTFIEVFEEEAKK-HTDVKYLAQGTLYPDVIESVSVKGPSETIKSHHNVGGLPDWMKFELIEPLRELFKDEVRKLGLELGLPREMVYRHPFPGPGLAIRILGEVNEEALDLVRKADTILLEEIKAHGLYE----KLWQSFAVLLNVKSVGVMGDKRTYENTVALRIVESSDGMTATFAHIPHDLLELISNRIINEVDGINRVVYDITSKPPGTIEWE 516
>gi|119897872|ref|YP_933085.1| bifunctional GMP synthase/glutamine amidotransferase protein [Azoarcus sp. BH72] >gi|119670285|emb|CAL94198.1| GMP synthase (glutamine-hydrolyzing) [Azoarcus sp. BH72] (521 aa)
Score = 1287, Expect = 1.2e-139, Identities = 260/509 (51%), Positives = 347/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNC--------WMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG Q +QLIARR+R+ +VY E+  YD+S   I    P+GIILSGG +SVY     +  + +++L +P+LGICYG Q M ++ GG+VE+     E+G  ++R    ++LF+ IE   N         WMSH D V  LP GFKVI S   C VA+  + E+ FYGVQFHPEVT T  G ++L  FV+ IC    DW   +   E +E+I++ V D+ V+  +SGGVDS VAA L  +AIGD+L CVFVD+GLLR NE  +V     + +G  +  VD  + F+  LKGV DPEQKRKIIG+ F+EVF+  A K+    ++L QGTIYPD++ES G+K  K   IKSHHNVGGLPE L  +LLEPL+ LFKDEVR+LG++L +P+  VYR PFPGPGL VR+LGE+ ++  +++R AD +F   ID+L     + K  Q F V    KSVGV+GD R+Y Y +ALRAV + D M+A W ++P   L K+S+ I N+V+ I+RVVYDI+ KPP TIEWE
  S:     5 KILILDFGSQVSQLIARRVREQHVYCELHPYDVSEAFIRDFKPQGIILSGGPNSVYEAVDWRAPQVVFELGVPVLGICYGMQTMAEQLGGKVESSA-KREFGYAELRARGHSKLFQGIEDRTNAEGHGLLDVWMSHGDKVTELPAGFKVIGSNESCPVAAMADEERGFYGVQFHPEVTHTIKGKEMLARFVHEICGCGNDWNMPDYISEAVEKIRAQVGDEEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDNGLLRLNEGAQVMETFNRSLGVKVIHVDATEQFMGHLKGVSDPEQKRKIIGREFVEVFQAEAAKLPKA-RWLAQGTIYPDVIESAGAKTGKAHAIKSHHNVGGLPETLNLKLLEPLRDLFKDEVRELGVALGLPHDMVYRHPFPGPGLGVRILGEVKKEFADLLRRADAIF---IDELRAADWYDKTSQAFAVFLPVKSVGVMGDGRTYEYVVALRAVQTQDFMTAHWAELPHSLLGKVSNRIINEVRGINRVVYDISGKPPATIEWE 521
>gi|170723354|ref|YP_001751042.1| GMP synthase, large subunit [Pseudomonas putida W619] >gi|169761357|gb|ACA74673.1| GMP synthase, large subunit [Pseudomonas putida W619] (525 aa)
Score = 1287, Expect = 1.3e-139, Identities = 253/509 (49%), Positives = 349/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY E+  +D+  E I + NP+GIIL+GG +SV+   S +  + ++DLN+P+LGICYG Q M ++ GG+VE   D  E+G   + +   + L + IE        L  + WMSH D V  +P  F ++AST  C +A   +  + +YGVQFHPEVT T  G ++L  FV  IC     W P NI  + I +++  V    VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E  +V A+ K+ +G  +   D ++ FL  L+G  DPE+KRKIIG+TFI+VF+  A+K++   ++L QGTIYPD++ES G+K  K   IKSHHNVGGLPE +  +L+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +I+R AD +F   I++L K +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P + LE +S  I N++  ISRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFNPRGIILAGGPESVHEANSPRAPQAVFDLNVPLLGICYGMQTMAEQLGGKVEG-SDLREFGYARVDVVGKSRLLDGIEDHVDGDGVLGLDVWMSHGDKVTQMPGNFNILASTPSCPIAGMFDDARGYYGVQFHPEVTHTKQGGRILSRFVQDICGCEALWTPSNIVEDAIAQVRQQVGSANVLLGLSGGVDSSVVAALLHRAIGDQLTCVFVDNGLLRLHEGDQVMAMFKENMGVKVIRADAEKQFLDNLEGEADPEKKRKIIGRTFIDVFDAEASKLD-NIQFLAQGTIYPDVIESAGAKSGKAHVIKSHHNVGGLPEEMNLKLVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADILRRADHIF---IEELRKADWYHKTSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETVDFMTARWAHLPYDLLETVSGRIINEIDGISRVTYDVSSKPPATIEWE 525
>gi|159902578|ref|YP_001549922.1| bifunctional GMP synthase/glutamine amidotransferase protein [Prochlorococcus marinus str. MIT 9211] >gi|159887754|gb|ABX07968.1| Glutamine amidotransferase class-I:GMP synthase [Prochlorococcus marinus str. MIT 9211] (548 aa)
Score = 1287, Expect = 1.4e-139, Identities = 250/508 (49%), Positives = 342/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+  VYS ++ Y  S  E+ K  PKGIILSGG  SVY   +   +  IWDL+IP+LG+CYG QVM+Q+ GG V       EYG   + +     L  N+E  +  WMSH DSV  LP+GF  +A T+  L A+     K+FYGVQFHPEV  +T G  +++NFVY+IC    DW       E I  ++S V D  VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +     +    N+  ++ ++ F+SKL+G+ DPE KRK+IG+ FI VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRK+G +L +P + V R PFPGPGLA+R+LGE+T++KL  +R+AD + R  I++  LY    H+ WQ F VL    SVGV+GD R+Y + + +R V S D M+A W ++P   L+ IS+ + N+VK ++RVV DIT+KPPGTIEWE
  S:    34 IVILDFGSQYSELIARRIRETEVYSIVLSYSTSAAELRKLAPKGIILSGGPSSVYTASAPLSDPEIWDLDIPVLGVCYGMQVMVQQLGGHVTAAVGKAEYGKAPLHVDDPTALLTNVESGSTMWMSHGDSVDKLPRGFVRLAHTSNTLEAAIALHTKRFYGVQFHPEVVHSTQGMVMIRNFVYNICCCQPDWTTSTFIDEAISTVRSQVGDKKVLLALSGGVDSSTLAFLLKRAIGDQLTCMFIDQGFMRKGEPEFLMEFFDQKFKINVQYINARERFISKLQGISDPEDKRKVIGREFIRVFEEESERLG-PFDYLAQGTLYPDVIESSGTNLDPKTGERIAVKIKSHHNVGGLPKDLQFKLVEPLRMLFKDEVRKVGRALGLPEEIVGRHPFPGPGLAIRILGEVTDEKLNCLRDADLIVREEINRAGLY----HEIWQAFAVLLPVCSVGVMGDQRTYAWPIVVRCVSSEDGMTADWSRLPDSLLQIISNRVVNEVKGVNRVVLDITSKPPGTIEWE 548
>gi|161702166|gb|ABX75631.1| GMP synthase [Lactococcus lactis subsp. lactis] (513 aa)
Score = 1286, Expect = 1.5e-139, Identities = 250/511 (48%), Positives = 350/511 (68%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++KI++LD+G QY QLIARRIR++ V+SE++ + ++ +EI + NP GIILSGG +SVY + S   +  I++L +P+LGICYG Q+M  + GG VE   +  EYG   ++LT  + LF       +  MSH D V  +P+GF V+ ++     A+  N E+  YG+QFHPEV  +  G ++L+NF  +IC   G+W  +N    +I++I+  V D  VL  +SGGVDS V  VL  +AIGD+L  +FVDHG LRK E+ +V   L    G NI  VD ++ F+ KL G+ DPE KRKIIG  F+ VF+  ANK+     +L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L +P + V+RQPFPGPGLA+RVLG++TE+KLE VRE+D + R  I       E   WQYFTV  + KSVGV+GD R+Y YTLA+RA+ S+D M+A + ++P + L+KIS  I N+V +++R+VYDIT+KPP T+EW+
  S:     6 LEKIIVLDYGSQYNQLIARRIREIGVFSELMSHKVTAKEIREINPIGIILSGGPNSVYDEGSFDIDPEIFELGLPVLGICYGMQLMSYKLGGMVEAAGE-REYGVAPLQLTEKSALFAGTPEVQDVLMSHGDRVTAIPEGFHVVGTSPNSPFAAVENTERNLYGIQFHPEVRHSVHGTEMLRNFALNICGAKGNWSMENFIDMQIKDIREKVGDKKVLLGLSGGVDSSVVGVLLQRAIGDQLTSIFVDHGFLRKGEADQVMETLGGKFGLNIIKVDAQKRFMDKLVGLSDPETKRKIIGNEFVYVFDDEANKLE-GVDFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMQFQLIEPLNTLFKDEVRALGTQLGMPDEIVWRQPFPGPGLAIRVLGDLTEEKLETVRESDAILREEIAA--AGLERDVWQYFTVNIDVKSVGVMGDQRTYDYTLAIRAITSIDGMTADFAQLPWDLLQKISKRIVNEVDHVNRIVYDITSKPPATVEWQ 513
>gi|124547116|ref|ZP_01706075.1| GMP synthase, large subunit [Shewanella putrefaciens 200] >gi|124509590|gb|EAY53668.1| GMP synthase, large subunit [Shewanella putrefaciens 200] (525 aa)
Score = 1286, Expect = 1.5e-139, Identities = 256/509 (50%), Positives = 350/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIR-LTTNELFENIELDNN--------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARRIR++ VY E+  +D++  +I +  P GIIL+GG +SV  + S +  + +++  IP+LGICYG Q M ++ GG+V       E+G   I  LT + LF++IE   N         WMSH D V  +P+GF  +A T+ C  A+  N EK+FYGVQFHPEVT T  G ++L +F   IC  A +W+P +I  + IE +K  + DD V+  +SGGVDS V A+L  +AIG KL CVFVD+GLLR NE+ +V  +     G NI  VD +  FL  +KGV DPE KRKIIG+ F+E+F++ + K     K+L QGTIYPD++ES GS   K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+K +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTAENSPRAPEYVFNAGIPVLGICYGMQTMSEQLGGKVIQGVGEGEFGYAQIEMLTKSALFKDIEDAVNSEGKPLLDVWMSHGDKVSAIPEGFVAVAKTDTCPFAAMANEEKRFYGVQFHPEVTHTRQGMRMLSHFALDICGCAANWKPSSIIEDAIERLKKQIGDDEVILGLSGGVDSSVVAMLLHRAIGTKLTCVFVDNGLLRLNEAAQVMEMFGDHFGLNIIHVDAENRFLDAMKGVADPEAKRKIIGRVFVEIFDEESKKC-ANAKWLAQGTIYPDVIESAGSATGKAHVIKSHHNVGGLPDDMELGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVDGISRVVYDISGKPPATIEWE 525
>gi|116512291|ref|YP_809507.1| bifunctional GMP synthase/glutamine amidotransferase protein [Lactococcus lactis subsp. cremoris SK11] >gi|116107945|gb|ABJ73085.1| GMP synthase (glutamine-hydrolyzing) [Lactococcus lactis subsp. cremoris SK11] (513 aa)
Score = 1286, Expect = 1.5e-139, Identities = 249/511 (48%), Positives = 350/511 (68%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++KI++LD+G QY QLIARRIR++ V+SE++ + ++ +EI + NP GIILSGG +SVY + S   +  I++L +P+LGICYG Q+M  + GG VE   +  EYG   ++LT  + LF       +  MSH D V  +P+GF V+ ++     A+  N E+  YG+QFHPEV  +  G ++L+NF  + C   G+W  +N    +I++++  V D  VL  +SGGVDS V  VL  +AIGD+L  +FVDHG LRK E+ +V   L    G NI  VD ++ F+ KL G+ DPE KRKIIG  F+ VF+  ANK+     +L QGT+Y D++ESG+  ++TIKSHHNVGGLPE +QF+L+EPL  LFKDEVR LG  L +P + V+RQPFPGPGLA+RVLG++TE+KLE VRE+D + R  I       E   WQYFTV T+ KSVGV+GD R+Y YTLA+RA+ S+D M+A + ++P + L+KIS  I N+V +++R+VYDIT+KPP T+EW+
  S:     6 LEKIIVLDYGSQYNQLIARRIREIGVFSELMSHKVTAKEIREINPIGIILSGGPNSVYDEGSFDIDPEIFELGLPVLGICYGMQLMSYKLGGMVEAAGE-REYGVAPLQLTEKSALFAGTPEVQDVLMSHGDRVTAIPEGFHVVGTSPNSPFAAVENTERNLYGIQFHPEVRHSVHGTEMLRNFALNTCGAKGNWSMENFIDMQIKDVREKVGDKKVLLGLSGGVDSSVVGVLLQRAIGDQLTSIFVDHGFLRKGEADQVMETLGGKFGLNIIKVDAQKRFMDKLVGLSDPETKRKIIGNEFVYVFDDEANKLE-GVDFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMQFQLIEPLNTLFKDEVRALGTQLGMPDEIVWRQPFPGPGLAIRVLGDLTEEKLETVRESDAILREEIAA--SGLERDVWQYFTVNTDVKSVGVMGDQRTYDYTLAIRAITSIDGMTADFAQLPWDLLQKISKRIVNEVDHVNRIVYDITSKPPATVEWQ 513
>gi|146308500|ref|YP_001188965.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pseudomonas mendocina ymp] >gi|145576701|gb|ABP86233.1| GMP synthase (glutamine-hydrolyzing) [Pseudomonas mendocina ymp] (525 aa)
Score = 1286, Expect = 1.6e-139, Identities = 252/509 (49%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY E+  +D+S E+I    P+GIIL+GG +SV+   S +  + ++DLN+P+LGICYG Q M ++ GG+VE   D  E+G   + +   ++L   IE           + WMSH D V  LP+GF ++AST  C +A+  +  + +YGVQFHPEVT T  G ++L  FV  I      W P NI  + +  +++ V D  VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E  +V A+  + +G  +   + ++ FLS L G  DPE+KRKIIG+TFI+VF+  A+K++   ++L QGTIYPD++ES G+K  K   IKSHHNVGGLPE +  +L+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +++R AD +F   I++L K +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LE +S  I N+++ ISRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCELHPWDMSDEDIRAFAPRGIILAGGPESVHEANSPRAPQAVFDLNVPVLGICYGMQTMAEQLGGKVEG-SDLREFGYARVDVVGKSQLLAGIEDHVDADGVFGLDVWMSHGDKVTRLPEGFHILASTPSCPIAAMSDDTRHYYGVQFHPEVTHTKQGGRILSRFVLEISGCEALWTPANIVEDAVAAVRAQVGDANVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLHEGDQVMAMFAENMGVKVIRANAEEQFLSNLAGESDPEKKRKIIGRTFIDVFDAEASKLD-NIQFLAQGTIYPDVIESAGAKSGKAHVIKSHHNVGGLPEEMNLKLVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADLLRRADHIF---IEELRKADWYHKTSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETVDFMTARWAHLPYELLETVSGRIINEIEGISRVTYDVSSKPPATIEWE 525
>gi|126668433|ref|ZP_01739390.1| GMP synthase, PP-ATPase domain/subunit [Marinobacter sp. ELB17] >gi|126627142|gb|EAZ97782.1| GMP synthase, PP-ATPase domain/subunit [Marinobacter sp. ELB17] (525 aa)
Score = 1286, Expect = 1.8e-139, Identities = 252/509 (49%), Positives = 353/509 (69%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL---------TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI-NVPFKYLLQGTIYPDIVES-GSKFSKT--IKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+RD+ VY E+  +DI+ EE+   NPKGI+L+GG +SV      +   G++D  IP+LGICYG Q M ++ GG+V +  +  E+G   I++          T+ L    E   + WMSH D V+ +P+GF+++AST    +A+  +  +  YG+QFHPEVT T  G ++L++FV +IC     W P  I  + +++I+  V  D VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR NE  +V  +    +G  +   D ++ FL+ LKGV DPEQKRK+IG TFI+VF++ A +I NV   +L QGTIYPD++ES  SK  K+  IKSHHNVGGLPE ++ +L+EPL+ LFKDEVR++GL L +PY  VYR PFPGPGL VR+LGE+ +D  +I+R AD +F   +++L++ +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LE +S+ I N++  +SRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVRDIGVYCEVRAFDITAEELDAFNPKGILLAGGPESVTELGGPRAPDGLFDREIPVLGICYGMQTMAEQLGGRVAS-SEKREFGYAQIKVRAKGPLLQDITDHLTATGESLLDVWMSHGDKVVAMPEGFELLASTESAPIAAMQDLSRNLYGLQFHPEVTHTLQGKRILEHFVMNICGCEALWTPAKIVDDAVQKIREQVGTDKVLLGLSGGVDSSVTAALLHKAIGDQLTCVFVDNGLLRLNEGDQVMDMFGSSMGVKVIRADAEERFLTNLKGVSDPEQKRKVIGNTFIDVFDEEATRIQNV--NWLAQGTIYPDVIESAASKTGKSHVIKSHHNVGGLPETMKLKLVEPLRELFKDEVRRIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKDYADILRRADAIF---LEELHRADYYHKTSQAFAVFLPVKSVGVVGDARRYEWVIALRAVETIDFMTARWAHLPYELLETVSNRIINEISGVSRVTYDVSSKPPATIEWE 525
>gi|146283337|ref|YP_001173490.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pseudomonas stutzeri A1501] >gi|145571542|gb|ABP80648.1| GMP synthase [Pseudomonas stutzeri A1501] (526 aa)
Score = 1285, Expect = 1.9e-139, Identities = 253/509 (49%), Positives = 355/509 (69%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIE--LDNN------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI-NVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSE--HKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY E+  +D+S ++I    P+GIIL+GG +SV+   S +  + ++DL +P+ GICYG Q M ++ GG+V+   D  E+G   + L   + LF+ IE  +D++       WMSH D V  +P GF ++AST  C +A+  +  + +YGVQFHPEVT T  G ++L  F+  IC     W P NI  + I ++++ V D  VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E  +V A+  + +G  +   D +  FL  L+G  DPE+KRKIIG+TFI+VF+  A+K+ N+ F  L QGTIYPD++ES G+K  K   IKSHHNVGGLPE +  +L+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +++R AD +F S +    +N++  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LEK+S+ I N+++ ISRV YD+++KPP TIEWE
  S:    10 RILILDFGSQYTQLIARRVREIGVYCELHPWDMSEDDIRAFAPRGIILAGGPESVHEAGSPRAPQAVFDLGVPLFGICYGMQTMSEQLGGKVQG-SDVREFGYARVDLVGKSRLFDGIEDHMDDDGVFGLDVWMSHGDKVTEIPAGFHILASTPSCPIAAMGDDARGYYGVQFHPEVTHTRQGGRILSRFILEICGCEALWTPSNIVEDAIAQVRAQVGDANVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLHEGDQVMAMFAENMGVKVIRADAEAQFLGNLEGEADPEKKRKIIGRTFIDVFDAEASKLPNIQF--LAQGTIYPDVIESAGAKSGKAHVIKSHHNVGGLPEEMNLKLVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADLLRRADDIFISEL----RNADWYHKVSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETIDFMTARWAHLPYELLEKVSNRIINEIEGISRVTYDVSSKPPATIEWE 526
>gi|149375102|ref|ZP_01892874.1| bifunctional GMP synthase/glutamine amidotransferase protein [Marinobacter algicola DG893] >gi|149360466|gb|EDM48918.1| bifunctional GMP synthase/glutamine amidotransferase protein [Marinobacter algicola DG893] (525 aa)
Score = 1285, Expect = 2.0e-139, Identities = 253/509 (49%), Positives = 353/509 (69%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL---------TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY EI  +DI+ EE+ + NPKGIIL+GG +SV      +  +G++D  IP+LGICYG Q M ++ GG+V +  +  E+G   +++          T+ L    E   + WMSH D V+ +P+GF+++AST    +++  +  +  YGVQFHPEVT T  G ++L++F+ +IC     W P  I  + +E+I+S V    VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR NE  +V  +    +G  +  VD + LFLSKLKG+ DPE+KRKIIG TFI+VF+  A  I     +L QGTIYPD++ES  SK  K   IKSHHNVGGLPE ++ +L+EPL+ LFKDEVR++GL L +PY  VYR PFPGPGL VR+LGE+ ++  EI+R AD +F   +++L++ +  HK  Q F V    KSVGVVGD R Y Y +ALRAV+++D M+A+W  +P + LE +S+ I N+++ +SRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCEIKAFDITDEELKEFNPKGIILAGGPESVTQLGGPRAPEGLFDKGIPVLGICYGMQTMAEQLGGRVAS-SEKREFGYAQVKVRAKGPLLKDITDHLTATGESLLDVWMSHGDKVVVMPEGFELLASTESAPISAMQDTSRNLYGVQFHPEVTHTLQGKRILEHFILNICQCEALWTPAKIVDDAVEQIRSQVGSGKVLLGLSGGVDSSVTAALLHKAIGDQLTCVFVDNGLLRLNEGDQVMDMFASNMGVKVIRVDAEDLFLSKLKGIDDPEKKRKIIGNTFIDVFDDEAANIR-DVNWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPETMKMKLVEPLRELFKDEVRRIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYAEILRRADAIF---LEELHRADFYHKTSQAFAVFLPVKSVGVVGDARRYEYVVALRAVETIDFMTARWAHLPYDLLETVSNRIINEIEGVSRVTYDVSSKPPATIEWE 525
>gi|168333408|ref|ZP_02691688.1| GMP synthase, large subunit [Epulopiscium sp. 'N.t. morphotype B'] (513 aa)
Score = 1285, Expect = 2.3e-139, Identities = 256/508 (50%), Positives = 345/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALL--KKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I++LDFGGQY QLIARRIR+  VY E+  YD+ +E++    PKG+I +GG +S+Y   +   +K I+++ +PILGICYG Q++    GG V   K SE YG T I L  N +LFE++  +  CWMSH+D+V  +P GF + A +  C +A+  N   K Y VQFHPEV  T  G  +L NF   +C  AGDW+  +   E+IE I++ V     L A+SGGVDS VAA++ ++AIG  L CVFVDHGLLRKNE  EV A+   K  +  N   VD  + F +KL GV DPE KRKIIG+ FI VFE+ A KI     + +QGTIYPDI+ESG   S  IKSHHNVGGLP+ + F E++EPL+ LFKDEVRK+G+ L +  + V RQPFPGPGL +R++GE+T +K+ IV++AD ++R  I   +   + +  QYF  LTN KSVGV+GD+R+Y Y + LRAV++ D M+AK  KIP E LEK+++ I N+V  ++RV+YD+T KPP TIE E
  S:     6 IVVLDFGGQYNQLIARRIREAGVYCEVHPYDMPLEKLKALAPKGLIFTGGPNSIYAADAAICDKAIFEMGVPILGICYGAQLIAHMLGGVVAKAKTSE-YGRTAISLNANSKLFESLNGETICWMSHTDAVKEVPAGFNITAESVDCPIAAFENAASKVYAVQFHPEVAHTENGEMMLNNFARVVCGCAGDWQMADFAKEQIEAIRAKVGAGKALLALSGGVDSSVAAMILSKAIGKGLTCVFVDHGLLRKNEGDEVEAIFADKNKLDLNFIRVDASKRFYAKLAGVTDPEAKRKIIGEEFIRVFEEEAKKIGA-VDFFVQGTIYPDIIESGLNKSAVIKSHHNVGGLPDYVDFKEIIEPLRLLFKDEVRKVGIELGLDSKLVNRQPFPGPGLGIRIIGEVTAEKIRIVQDADAIYREEI--AFAGLDEQIGQYFAALTNMKSVGVMGDSRTYDYAVVLRAVETSDFMTAKSVKIPWEVLEKVTTRIVNEVGGVNRVLYDLTGKPPATIELE 513
>gi|187924407|ref|YP_001896049.1| GMP synthase, large subunit [Burkholderia phytofirmans PsJN] >gi|187715601|gb|ACD16825.1| GMP synthase, large subunit [Burkholderia phytofirmans PsJN] (527 aa)
Score = 1285, Expect = 2.3e-139, Identities = 258/510 (50%), Positives = 345/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNN--------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLF----RSYIDQLYKNSEHKPW-----QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKILILDFG Q TQLIARR+R+ NVYSEI  YD+    I    PKG+ILSGG  SV    + +  + +++L +P+LGICYG Q M ++ GG+V+      E+G  ++R   +  L E I+             WMSH D V+ +P GF ++AST  C +A+  + ++ FYG+Q+HPEVT T  G  +L+ FV  IC    DWE  N   E + +I+  V +++V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR NE+++V A     +G  +  VD  ++FL KL GV DPE KRKIIG  F+EVF+  A ++    K+L QGTIYPD++ES   G K ++TIKSHHNVGGLPE L  +LLEPL+ LFKDEVR+LG+ L +P   VYR PFPGPGL VR+LGE+  D  +++R AD +F    R++ID+       K W     Q F V    KSVGV+GD R+Y Y +ALRAV ++D M+A W  +P E L  +S+ I N+V+ I+RVVYDI+ KPP TIEWE
  S:     3 DKILILDFGSQVTQLIARRVREANVYSEIHPYDVDASFIRDFAPKGVILSGGPSSVTETDTPRVPQAVFELGVPVLGICYGMQAMAEQLGGKVDIGH-LREFGYAEVRARNHTSLLEGIKDFTTPEGHGMLKVWMSHGDKVLEMPPGFALMASTESCPIAAMADEKRHFYGLQWHPEVTHTVQGRAMLERFVLQICGARADWEMGNYIDEAVAKIREQVGNEHVILGLSGGVDSSVAAALLHRAIGDQLTCVFVDHGLLRLNEAEQVMATFADHLGVKVIHVDASEVFLRKLAGVTDPEAKRKIIGAEFVEVFQAEAGRL-TDAKWLAQGTIYPDVIESAGKGKKGAQTIKSHHNVGGLPETLNLKLLEPLRELFKDEVRELGVKLGLPPAMVYRHPFPGPGLGVRILGEVKRDFADLLRRADAIFIETLRTFIDK----ETGKSWYDLTSQAFAVFLPVKSVGVMGDGRTYEYVVALRAVQTLDFMTAHWAHLPHELLGHVSNRIINEVRGINRVVYDISGKPPATIEWE 527
>gi|134301919|ref|YP_001121888.1| bifunctional GMP synthase/glutamine amidotransferase protein [Francisella tularensis subsp. tularensis WY96-3418] >gi|134049696|gb|ABO46767.1| GMP synthase (glutamine-hydrolyzing) [Francisella tularensis subsp. tularensis WY96-3418] (516 aa)
Score = 1285, Expect = 2.3e-139, Identities = 261/509 (51%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL--TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R+L V+ EI  +D++ + I     KGIILSGG +SVY D  +K  + +++L +P+LGICYG Q M+ ++GG+V+   D  E+G   I +  +TN +F N+E +   WMSHSD V    + F++IAS+    VA+  ++ K F+GVQFHPE T T  G Q+++NFV +IC     W  +NI    I+EIK  V  D V+  +SGGVDS V A +  QAIGD+L C+FVD GLLR NE  +V  +  + +  N+  ++ K  FL  L+G+ DPEQKRKIIGK F+++F++ A KI    K+L QGTIY D++ES G+  SK   IKSHHNVGGLP+ ++ +LLEPL+ LFKDEVRKLGL L +PY  +YR PFPGPGL VR+LGEI ++ +E +++AD +F    ++LYK N  H   Q F V    KSVGVVGD R Y Y +ALRAV S+D M+A W  +P + L  +S+ I N+VK +SRVVYD+T KPPGTIEWE
  S:     8 KILILDFGSQYTQLIARRVRELGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVY-DSDVKAPEIVFELGVPVLGICYGMQTMVMQHGGEVKG-ADQSEFGKAIINILNSTNNIFSNMEHEQLVWMSHSDKVTQTGEHFEIIASSTNAPVAAVAHKNKPFFGVQFHPETTHTENGKQIIENFVVNICGCDTLWNIENIIENDIKEIKQKVGTDKVILGLSGGVDSSVVAAILHQAIGDQLTCIFVDTGLLRLNEGDQVMQVFAEHMDINVIRINAKNRFLDALRGICDPEQKRKIIGKLFVDIFDEEAAKIENA-KWLAQGTIYSDVIESAGNNQSKAHVIKSHHNVGGLPKEMKLKLLEPLRELFKDEVRKLGLGLGLPYNMLYRHPFPGPGLGVRILGEIKKEYVETLQKADAIF---TEELYKHNLYHDVSQAFGVFLPVKSVGVVGDQRRYEYVIALRAVVSIDFMTATWANLPYDFLSLVSNRIVNEVKQVSRVVYDVTGKPPGTIEWE 516
>gi|78183626|ref|YP_376060.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus sp. CC9902] >gi|78167920|gb|ABB25017.1| GMP synthase (glutamine-hydrolyzing) [Synechococcus sp. CC9902] (528 aa)
Score = 1285, Expect = 2.3e-139, Identities = 246/508 (48%), Positives = 339/508 (66%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARR+R+  V+S ++ Y  + +E+ +  PKGIILSGG  SVY + +   +  IWDL IP+LG+CYG Q+M+Q+ GG VE      EYG   + +    +L  N+E  +  WMSH DSV  LP+GF  +A T     A+  N E+KFYGVQFHPEV  +T G  L++NFV  IC    DW       E +  ++  V    VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +     +    N+  ++ ++ F+ KLKG+ DPE KRKIIG  FI VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRK+G +L +P + V R PFPGPGLA+R+LGE+T++KL  +R+AD + R  I    LY    H  WQ F VL   +SVGV+GD R+Y + + LR V S D M+A W ++P + +E+IS+ I N+VK ++RVV DIT+KPPGTIEWE
  S:    14 IVILDFGSQYSELIARRVRETEVFSVVIGYSTTADELRRMAPKGIILSGGPSSVYAEHAPVCDPAIWDLGIPVLGVCYGMQLMVQQLGGAVEAATGKAEYGKAPLEVDDPTDLLNNVENGSTMWMSHGDSVKALPEGFVRLAHTANTPEAAVANLERKFYGVQFHPEVVHSTCGMALIRNFVNHICGCEQDWTTNAFIDEAVALVREQVGQKRVLLALSGGVDSSTLAFLLKKAIGDQLTCMFIDQGFMRKGEPEFLMEFFDQKFNINVEYINARKRFIDKLKGITDPEDKRKIIGTEFIRVFEEESKRLG-PFDYLAQGTLYPDVIESAGTNVDPKTGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRNLGLPEEIVRRHPFPGPGLAIRILGEVTDEKLNCLRDADLIVREEIRDAGLY----HDIWQAFAVLLPVRSVGVMGDQRTYAWPIVLRCVSSEDGMTADWSRLPYDLMERISNRIVNEVKGVNRVVMDITSKPPGTIEWE 528
>gi|194553444|ref|YP_002088471.1| GMP synthase [Pseudomonas aeruginosa 2192] >gi|126195837|gb|EAZ59900.1| GMP synthase [Pseudomonas aeruginosa 2192] (525 aa)
Score = 1285, Expect = 2.4e-139, Identities = 254/509 (49%), Positives = 346/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY EI  +D+S E II   P+GIIL+GG +SV+   S +  + ++DL +P+ GICYG Q M ++ GG+V+   D  E+G   + +     L + IE        L  + WMSH D V  +P GF ++AST  C +A+  +  + +YGVQFHPEVT T  G ++L  FV  IC  A  W P NI  + I  +++ V    VL  +SGGVDS V A L  +AIGD+L CV     LLR +E  +V A+  + +G  +   + +  FL +L GV DPE+KRKIIG+TFIEVF++ A K+    K+L QGTIYPD++ES G+K  K   IKSHHNVGGLPE +QFEL+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +++R+AD +F   I++L   +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LEK+S+ I N++  ISRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCEIHPFDMSNEAIIAFAPRGIILAGGPESVHEADSPRAPQAVFDLKVPLFGICYGMQTMAEQMGGKVQG-SDLREFGYARVDVVGKARLLDGIEDHVDDDGVLGLDVWMSHGDKVTEMPAGFHILASTPSCPIAAMADDARAYYGVQFHPEVTHTKQGLRILSRFVLDICGCAALWTPSNIVDDAIATVRAQVGSSKVLLGLSGGVDSSVVAALLHKAIGDQLTCVVRRQRLLRLHEGDQVMAMFAENMGVKVIRANAEDKFLGRLAGVADPEEKRKIIGRTFIEVFDEEATKLQ-DVKFLAQGTIYPDVIESAGAKTGKAHVIKSHHNVGGLPEDMQFELVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADLLRQADHIF---IEELRAFDWYHKTSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETIDFMTARWAHLPYELLEKVSNRIINEIAGISRVTYDVSSKPPATIEWE 525
>gi|33864583|ref|NP_896142.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus sp. WH 8102] >gi|44887992|sp|Q7UA53|GUAA_SYNPX GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|33632106|emb|CAE06562.1| GMP synthase (glutamine-hydrolysing) [Synechococcus sp. WH 8102] (528 aa)
Score = 1284, Expect = 2.5e-139, Identities = 244/508 (48%), Positives = 341/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARR+R+  V+S ++ Y  S EE+    PKGI+LSGG  SVY + +   +  IW+L IP+LG+CYG Q+M+Q+ GG VE      EYG   + +    +L  N+   +  WMSH DSV  LP+GF  +A T     A+  + +++ YGVQFHPEV  +T G  L++NFVY IC    DW       E +  ++  V +  VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +     +    ++  ++ +Q F+SKLKG+ DPE+KRKIIG  FI VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRK+G +L +P + V R PFPGPGLA+R+LGE+T++KL  +R+AD + R  I +  LY    H+ WQ F VL   +SVGV+GD R+Y + + LR V S D M+A W ++P + +E IS+ I N+VK ++RVV DIT+KPPGTIEWE
  S:    14 IVILDFGSQYSELIARRVRETEVFSVVLGYSTSAEELRAMQPKGIVLSGGPSSVYAEHAPLCDPAIWELGIPVLGVCYGMQLMVQQLGGVVEAASGKAEYGKAPLEVDDPTDLLTNVTGGSTMWMSHGDSVKALPEGFVRLAHTANTPEAAVAHLQRRLYGVQFHPEVVHSTCGMALIRNFVYHICGCEPDWTTSAFIDEAVAVVREQVGEKRVLLALSGGVDSSTLAFLLKKAIGDQLTCMFIDQGFMRKGEPEFLMDFFDRKFNIHVEYINARQRFISKLKGITDPEEKRKIIGTEFIRVFEEESKRLG-PFDYLAQGTLYPDVIESAGTNVDPKTGERVAVKIKSHHNVGGLPKDLQFKLVEPLRKLFKDEVRKVGRALGLPEEIVRRHPFPGPGLAIRILGEVTDEKLNCLRDADLIVREEIREAGLY----HEIWQAFAVLLPVRSVGVMGDKRTYAWPIVLRCVSSEDGMTADWSRLPYDLMETISNRIVNEVKGVNRVVLDITSKPPGTIEWE 528
>gi|15793529|ref|NP_283351.1| bifunctional GMP synthase/glutamine amidotransferase protein [Neisseria meningitidis Z2491] >gi|13627135|sp|Q9JW60|GUAA_NEIMA GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|121051514|emb|CAM07811.1| putative GMP synthetase [Neisseria meningitidis Z2491] (521 aa)
Score = 1284, Expect = 2.5e-139, Identities = 260/510 (50%), Positives = 343/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDN----NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG---SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHK--PW-----QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKILILDFG Q TQLIARR+R+ +VY E+  +D+ ++EI   NPKGIILSGG +SVY +   + + GI+DL IPILGICYG Q M    GG+V+   +  E+G   ++   +EL   I+ D     + WMSH D V  LP GF VI  T  C +A   N EK+FYG+QFHPEVT T  G  LL  FV  IC     W   N   E + +I+  V  D V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR NE + V  +  + +G  +  VD +  F++KL GV DPE+KRKIIG  FIEVF+    K+    K+L QGTIYPD++ES    +K +  IKSHHNVGGLPE ++ +LLEPL+ LFKDEVR+LG++L +P + VYR PFPGPGL VR+LGE+ ++  +++R+AD +F   I +L   ++     W     Q F V    KSVGV+GD R+Y Y +ALRAV + D M+A W ++P   L ++S+ I N+VK I+RVVYD++ KPP TIEWE
  S:     4 DKILILDFGSQVTQLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVY-ESDYQADTGIFDLGIPILGICYGMQFMAHHLGGEVQ-PGNQREFGYAQVKTIDSELTRGIQDDTPNTLDVWMSHGDKVSKLPTGFTVIGDTPSCPIAMMENAEKQFYGIQFHPEVTHTKQGRALLNRFVLDICGAQPGWTMPNYIEEAVAKIREQVGSDEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDHGLLRLNEGKMVMDMFARNLGVKVIHVDAEGQFMAKLAGVTDPEKKRKIIGAEFIEVFDAEEKKLTNA-KWLAQGTIYPDVIESAGAKTKKAHAIKSHHNVGGLPENMKLKLLEPLRDLFKDEVRELGVALGLPREMVYRHPFPGPGLGVRILGEVKKEYADLLRQADDIF---IQELRNTTDENGTSWYDLTSQAFAVFLPVKSVGVMGDGRTYDYVVALRAVITSDFMTAHWAELPYSLLGRVSNRIINEVKGINRVVYDVSGKPPATIEWE 521
>gi|120598185|ref|YP_962759.1| bifunctional GMP synthase/glutamine amidotransferase protein [Shewanella sp. W3-18-1] >gi|146293741|ref|YP_001184165.1| bifunctional GMP synthase/glutamine amidotransferase protein [Shewanella putrefaciens CN-32] >gi|120558278|gb|ABM24205.1| GMP synthase, large subunit [Shewanella sp. W3-18-1] >gi|145565431|gb|ABP76366.1| GMP synthase, large subunit [Shewanella putrefaciens CN-32] (525 aa)
Score = 1284, Expect = 2.9e-139, Identities = 256/509 (50%), Positives = 349/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIR-LTTNELFENIELDNN--------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARRIR++ VY E+  +D++  +I +  P GIIL+GG +SV  + S +  + +++  IP+LGICYG Q M ++ GG+V       E+G   I  LT + LF++IE   N         WMSH D V  +P+GF  +A T+ C  A+  N EK+FYGVQFHPEVT T  G ++L +F   IC  A +W+P +I  + IE +K  + DD V+  +SGGVDS V A+L  +AIG KL CVFVD+GLLR NE+ +V  +     G NI  VD +  FL  +KGV DPE KRKIIG+ F+E+F++ + K     K+L QGTIYPD++ES GS   K   IKSHHNVGGLP+ +   L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+K +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTAENSPRAPEYVFNAGIPVLGICYGMQTMSEQLGGKVIQGVGEGEFGYAQIEMLTKSALFKDIEDAVNSEGKPLLDVWMSHGDKVSAIPEGFVAVAKTDTCPFAAMANEEKRFYGVQFHPEVTHTRQGMRMLSHFALDICGCAANWKPSSIIEDAIERLKKQIGDDEVILGLSGGVDSSVVAMLLHRAIGKKLTCVFVDNGLLRLNEAAQVMEMFGDHFGLNIIHVDAENRFLDAMKGVADPEAKRKIIGRVFVEIFDEESKKC-ANAKWLAQGTIYPDVIESAGSATGKAHVIKSHHNVGGLPDDMALGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVDGISRVVYDISGKPPATIEWE 525
>gi|196176576|gb|EDX71589.1| GMP synthase, C-terminal domain protein [Microcoleus chthonoplastes PCC 7420] (542 aa)
Score = 1284, Expect = 3.1e-139, Identities = 252/508 (49%), Positives = 347/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+  VYSE++ Y  S E++ + +PKGIILSGG +SVY D + + +  I  + IPILG+CYG Q+M+Q+ GG+V   +  E YG  ++ +    +L  N+E  +  WMSH DS   LP GF+V+A T+    A+  + +K  YGVQFHPEV  +  G  L++NFVY ICD    W  +    E I EI++ V D  VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +  L +      +  V+ +  FL++L+GV DPE+KR+ IG  FI VFE+  +KI  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRK+G S+ +P   V R PFPGPGLA+R++GE+T ++L I+R+AD + R  I++  LYK    + WQ F VL   +SVGV+GD R+Y Y + LR V S D M+A W ++P E LE IS+ I N+VK ++RV YDIT+KPPGTIEWE
  S:    29 IVILDFGSQYSELIARRIRETQVYSEVISYRTSAEQLRQLSPKGIILSGGPNSVYDDAAPQCDPEILLMGIPILGVCYGMQLMVQQLGGKVTRSQRGE-YGKAELHIDDPTDLLTNVEESSTMWMSHGDSCQELPDGFEVLAHTDNTPCAAIADHQKHLYGVQFHPEVVHSVGGIALIRNFVYHICDCEPTWTTEAFVEEAIREIRAKVGDKRVLLALSGGVDSSTLAFLLHKAIGDQLTCMFIDQGFMRKLEPERLVKLFQDEFHIPVEYVNARDRFLARLEGVTDPEEKRRRIGHEFIRVFEE-QSKILGPFDYLAQGTLYPDVIESADTNVDPKTGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRSIGLPEAIVRRHPFPGPGLAIRIIGEVTAERLNILRDADLIVRQEINRHGLYK----ELWQAFAVLLPIRSVGVMGDQRTYAYPVVLRLVSSEDGMTADWSRVPYELLELISNRIVNEVKGVNRVAYDITSKPPGTIEWE 542
>gi|87123303|ref|ZP_01079154.1| GMP synthase [Synechococcus sp. RS9917] >gi|86169023|gb|EAQ70279.1| GMP synthase [Synechococcus sp. RS9917] (528 aa)
Score = 1284, Expect = 3.1e-139, Identities = 246/508 (48%), Positives = 342/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARR+R+  VYS ++ Y  S EE+ +  PKGIILSGG  SVY + +   +  +W L IP+LG+CYG Q+M+Q+ GG+VE      EYG   + +    +L  N++  +  WMSH DSV  LP GF  +A T    +A+  + +++ YGVQFHPEV  +T G  L++NFVY IC    DW       E +  ++  V +  VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +     +    ++  +  ++ FL KL G+ DPE+KRKIIG  FI VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRK+G SL +P + V R PFPGPGLA+R+LGE+T++KL+ +R+AD + R  I +  LY    H+ WQ F VL   +SVGV+GD R+Y + + LR V S D M+A W ++P E LE+IS+ I N+VK ++RVV DIT+KPPGTIEWE
  S:    14 IVILDFGSQYSELIARRVRETEVYSVVLGYSTSAEELRELAPKGIILSGGPSSVYAEGAPLCDPALWSLGIPVLGVCYGMQLMVQQLGGRVEAATGKAEYGKAPLVVDDPTDLLTNVDDGSTMWMSHGDSVEALPPGFVGLAHTANTPMAAVADHQRQLYGVQFHPEVVHSTCGMALIRNFVYHICGCDPDWTTAAFIDEAVRLVREQVGEKRVLLALSGGVDSSTLAFLLKKAIGDQLTCMFIDQGFMRKGEPEFLMDFFDRKFNIHVEYIHARKRFLDKLAGITDPEEKRKIIGTEFIRVFEEESKRLG-PFDYLAQGTLYPDVIESAGTNIDPKTGERVAVKIKSHHNVGGLPKDLQFKLVEPLRKLFKDEVRKVGRSLGLPEEIVRRHPFPGPGLAIRILGEVTDEKLDCLRDADLIVREEIKEAGLY----HEIWQAFAVLLPVRSVGVMGDKRTYAWPIVLRCVSSEDGMTADWSRLPPELLERISNRIVNEVKGVNRVVLDITSKPPGTIEWE 528
>gi|88799912|ref|ZP_01115484.1| bifunctional GMP synthase/glutamine amidotransferase protein [Reinekea sp. MED297] >gi|88777343|gb|EAR08546.1| bifunctional GMP synthase/glutamine amidotransferase protein [Reinekea sp. MED297] (525 aa)
Score = 1283, Expect = 3.5e-139, Identities = 256/509 (50%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNN--------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R+L VY EI  +D++ +E+ + +P GIILSGG +SV    S +  + +++L+IP+LGICYG Q M  + GG V   K+ +E+G  ++++  +    N   D +         WMSH D V  LP+GF ++ ST  C +A+  N +KK YG+QFHPEVT T  G  LL+ FV ++ +    W P+NI  ++++ ++  V D  VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLRK+E  +V A+  + +G  +   D +  FL+ LKGV DPE+KRKIIG  FIEVF++ A+ I     +L QGTIYPD++ES  SK  K   IKSHHNVGGLPE ++  L+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +I+READ +F   I++L K +  HK  Q F V    KSVGVVGD R Y + +++RAV+++D M+A W  +P E L K+S+ I N++  +SRVVYDI+ KPP TIEWE
  S:    10 KILILDFGSQYTQLIARRVRELGVYCEIRAFDMTEDEVREFSPNGIILSGGPESVTAANSPRAPEVVFNLDIPVLGICYGMQTMAVQFGGDVSASKE-QEFGYAEVKVEGDGALLNGLADRSTAEGDLLEVWMSHGDKVSRLPEGFTLMGSTPSCPIAAMANDDKKLYGIQFHPEVTHTLKGLDLLERFVRTMANCEALWTPENIIDDQVDRVREQVGDRNVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRKDEGDQVMAMFAENMGVRVIRADAEDRFLNALKGVSDPEEKRKIIGHQFIEVFDEQAHSIQ-DVDFLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPEEMKLSLVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADILREADAIF---IEELRKADWYHKTSQAFAVFLPVKSVGVVGDGRRYEWVISIRAVETVDFMTAHWAHLPYELLGKVSNRIINEISGVSRVVYDISGKPPATIEWE 525
>gi|121634172|ref|YP_974417.1| bifunctional GMP synthase/glutamine amidotransferase protein [Neisseria meningitidis FAM18] >gi|120865878|emb|CAM09614.1| putative GMP synthetase [Neisseria meningitidis FAM18] (521 aa)
Score = 1283, Expect = 3.6e-139, Identities = 260/510 (50%), Positives = 342/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDN----NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG---SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHK--PW-----QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKILILDFG Q TQLIARR+R+ +VY E+  +D+ ++EI   NPKGIILSGG +SVY +   + + GI+DL IPILGICYG Q M    GG+V+   +  E+G   ++   +EL   I+ D     + WMSH D V  LP GF VI  T  C +A   N EK+FYG+QFHPEVT T  G  LL  FV  IC     W   N   E + +I+  V  D V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR NE + V  +  + +G  +  VD +  F+ KL GV DPE+KRKIIG  FIEVF+    K+    K+L QGTIYPD++ES    +K +  IKSHHNVGGLPE ++ +LLEPL+ LFKDEVR+LG++L +P + VYR PFPGPGL VR+LGE+ ++  +++R+AD +F   I +L   ++     W     Q F V    KSVGV+GD R+Y Y +ALRAV + D M+A W ++P   L ++S+ I N+VK I+RVVYD++ KPP TIEWE
  S:     4 DKILILDFGSQVTQLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVY-ESDYQADTGIFDLGIPILGICYGMQFMAHHLGGEVQ-PGNQREFGYAQVKTIDSELTRGIQDDTPNTLDVWMSHGDKVSKLPTGFTVIGDTPSCPIAMMENAEKQFYGIQFHPEVTHTKQGRALLNRFVLDICGAQPSWTMPNYIEEAVAKIREQVGSDEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDHGLLRLNEGKMVMDMFARNLGVKVIHVDAEGQFMEKLAGVTDPEKKRKIIGAEFIEVFDAEEKKLTNA-KWLAQGTIYPDVIESAGAKTKKAHAIKSHHNVGGLPENMKLKLLEPLRDLFKDEVRELGVALGLPREMVYRHPFPGPGLGVRILGEVKKEYADLLRQADDIF---IQELRNTTDENGTSWYDLTSQAFAVFLPVKSVGVMGDGRTYDYVVALRAVITSDFMTAHWAELPYSLLGRVSNRIINEVKGINRVVYDVSGKPPATIEWE 521
>gi|157122326|gb|EDO66466.1| GMP synthase [Francisella tularensis subsp. holarctica FSC022] (516 aa)
Score = 1283, Expect = 3.9e-139, Identities = 261/509 (51%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT--TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R++ V+ EI  +D++ + I K   KGIILSGG +SVY D  +K  + +++L +P+LGICYG Q M+ ++GG+V+   D  E+G   I +   TN +F N+E +   WMSHSD V    + F++IAS+    VA+  ++ K F+GVQFHPE T T  G Q+++NFV +IC     W  +NI    I+EIK  V  D V+  +SGGVDS V A +  QAIGD+L C+FVD GLLR NE  +V  +  + +  N+  ++ K  FL  L+G+ DPEQKRKIIGK F+++F++ A KI    K+L QGTIY D++ES G+  SK   IKSHHNVGGLP+ ++ +LLEPL+ LFKDEVRKLGL L +PY  +YR PFPGPGL VR+LGEI ++ +E +++AD +F    ++LYK N  H   Q F V    KSVGVVGD R Y Y +ALRAV S+D M+A W  +P + L  +S+ I N+VK +SRVVYD+T KPPGTIEWE
  S:     8 KILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKKYQAKGIILSGGPESVY-DSDVKAPEIVFELGVPVLGICYGMQTMVMQHGGEVKG-ADQSEFGKAIINILNLTNNIFSNMEHEQLVWMSHSDKVTQTGEHFEIIASSTNAPVAAVAHKNKPFFGVQFHPETTHTENGKQIIENFVVNICGCDTLWNIENIIENDIKEIKQKVGTDKVILGLSGGVDSSVVAAILHQAIGDQLTCIFVDTGLLRLNEGDQVMQVFAEHMDINVIRINAKNRFLDALRGICDPEQKRKIIGKLFVDIFDEEAAKIENA-KWLAQGTIYSDVIESAGNNQSKAHVIKSHHNVGGLPKEMKLKLLEPLRELFKDEVRKLGLGLGLPYNMLYRHPFPGPGLGVRILGEIKKEYVETLQKADAIF---TEELYKHNLYHDVSQAFGVFLPIKSVGVVGDQRRYEYVIALRAVVSIDFMTATWANLPYDFLSLVSNRIVNEVKQVSRVVYDVTGKPPGTIEWE 516
>gi|15677751|ref|NP_274914.1| bifunctional GMP synthase/glutamine amidotransferase protein [Neisseria meningitidis MC58] >gi|13627136|sp|Q9JXR2|GUAA_NEIMB GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|7227178|gb|AAF42250.1| GMP synthase [Neisseria meningitidis MC58] (521 aa)
Score = 1283, Expect = 4.1e-139, Identities = 260/510 (50%), Positives = 344/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDN----NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG---SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHK--PW-----QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKILILDFG Q TQLIARR+R+ +VY E+  +D+ ++EI   NPKGIILSGG +SVY +   + + GI+DL IP+LGICYG Q M    GG+V+   +  E+G   ++   +EL   I+       + WMSH D V  LP GF VI +T  C +A   N EK+FYG+QFHPEVT T  G  LL  FV  IC     W   N   E + +I+  V  D V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR NES+ V  +  + +G  +  VD +  F++KL GV DPE+KRKIIG  FIEVF+    K+    K+L QGTIYPD++ES    +K +  IKSHHNVGGLPE ++ +LLEPL+ LFKDEVR+LG++L +P + VYR PFPGPGL VR+LGE+ ++  +++R+AD +F   I +L   ++     W     Q F V    KSVGV+GD R+Y Y +ALRAV + D M+A W ++P   L K+S+ I N+VK I+RVVYD++ KPP TIEWE
  S:     4 DKILILDFGSQVTQLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVY-ESDYQADTGIFDLGIPVLGICYGMQFMAHHLGGEVQ-PGNQREFGYAQVKTIDSELTRGIQDGEPNTLDVWMSHGDKVSKLPDGFAVIGNTPSCPIAMMENAEKQFYGIQFHPEVTHTKQGRALLNRFVLDICGAQPGWTMPNYIEEAVAKIREQVGSDEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDHGLLRLNESKMVMDMFARNLGVKVIHVDAEGQFMAKLAGVTDPEKKRKIIGAEFIEVFDAEEKKLTNA-KWLAQGTIYPDVIESAGAKTKKAHAIKSHHNVGGLPENMKLKLLEPLRDLFKDEVRELGVALGLPREMVYRHPFPGPGLGVRILGEVKKEYADLLRQADDIF---IQELRNTTDENGTSWYDLTSQAFAVFLPVKSVGVMGDGRTYDYVIALRAVITSDFMTAHWAELPYSLLGKVSNRIINEVKGINRVVYDVSGKPPATIEWE 521
>gi|167032045|ref|YP_001667276.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pseudomonas putida GB-1] >gi|166858533|gb|ABY96940.1| GMP synthase, large subunit [Pseudomonas putida GB-1] (525 aa)
Score = 1283, Expect = 4.2e-139, Identities = 252/509 (49%), Positives = 348/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY E+  +D+  E I + NP+GIIL+GG +SV+   S +  + ++DLN+P+LGICYG Q M ++ GG+VE   D  E+G   + +   + L + IE        L  + WMSH D V  +P  F ++AST  C +A   +  + +YGVQFHPEVT T  G ++L  FV  IC     W   NI  + I ++++ V    VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E  +V A+ K+ +G  +   D ++ FL  L+G  DPE+KRKIIG+TFI++F+  A+K+    ++L QGTIYPD++ES G+K  K   IKSHHNVGGLPE +  +L+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +I+R AD +F   I++L K +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LE +S  I N++  ISRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFNPRGIILAGGPESVHEANSPRAPQAVFDLNVPVLGICYGMQTMAEQMGGKVEG-SDLREFGYARVDVVGKSRLLDGIEDHVDDDGVLGLDVWMSHGDKVTQMPGNFNILASTPSCPIAGMYDDARGYYGVQFHPEVTHTKQGGRILSRFVQDICGCEALWTASNIVEDAIAQVRAQVGSANVLLGLSGGVDSSVVAALLHRAIGDQLTCVFVDNGLLRLHEGDQVMAMFKENMGVKVIRADAEKQFLDNLEGEADPEKKRKIIGRTFIDIFDAEASKLE-NIQFLAQGTIYPDVIESAGAKSGKAHVIKSHHNVGGLPEEMNLKLVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADILRRADHIF---IEELRKADWYHKTSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETVDFMTARWAHLPYELLETVSGRIINEIDGISRVTYDVSSKPPATIEWE 525
>gi|151572029|gb|EDN37683.1| GMP synthase [Francisella tularensis subsp. novicida GA99-3548] (516 aa)
Score = 1282, Expect = 4.3e-139, Identities = 260/509 (51%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL--TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R++ V+ EI  +D++ + I     KGIILSGG +SVY D  +K  + +++L +P+LGICYG Q M+ ++GG+V+   D  E+G   I +  +TN +F N+E +   WMSHSD V    + F++IAS+    VA+  ++ K F+GVQFHPE T T  G Q+++NFV +IC     W  +NI    I+EIK  V  D V+  +SGGVDS V A +  QAIGD+L C+FVD GLLR NE  +V  +  + +  N+  ++ K  FL  L+G+ DPEQKRKIIGK F+++F++ A KI    K+L QGTIY D++ES G+  SK   IKSHHNVGGLP+ ++ +LLEPL+ LFKDEVRKLGL L +PY  +YR PFPGPGL VR+LGEI ++ +E +++AD +F    ++LYK N  H   Q F V    KSVGVVGD R Y Y +ALRAV S+D M+A W  +P + L  +S+ I N+VK +SRVVYD+T KPPGTIEWE
  S:     8 KILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVY-DSDVKAPEIVFELGVPVLGICYGMQTMVMQHGGEVKG-ADQSEFGKAIINILNSTNNIFSNMEHEQLVWMSHSDKVTQTGEHFEIIASSTNAPVAAVAHKSKPFFGVQFHPETTHTENGKQIIENFVVNICGCDTLWNIENIIENDIKEIKQKVGTDKVILGLSGGVDSSVVAAILHQAIGDQLTCIFVDTGLLRLNEGNQVMQVFAEHMDINVIRINAKNRFLDALRGICDPEQKRKIIGKLFVDIFDEEAAKIENA-KWLAQGTIYSDVIESAGNNQSKAHVIKSHHNVGGLPKEMKLKLLEPLRELFKDEVRKLGLGLGLPYNMLYRHPFPGPGLGVRILGEIKKEYVETLQKADAIF---TEELYKHNLYHDVSQAFGVFLPVKSVGVVGDQRRYEYVIALRAVVSIDFMTATWANLPYDFLSLVSNRIVNEVKQVSRVVYDVTGKPPGTIEWE 516
>gi|118474706|ref|YP_892420.1| bifunctional GMP synthase/glutamine amidotransferase protein [Campylobacter fetus subsp. fetus 82-40] >gi|118413932|gb|ABK82352.1| GMP synthase, glutamine-hydrolyzing [Campylobacter fetus subsp. fetus 82-40] (510 aa)
Score = 1282, Expect = 5.0e-139, Identities = 256/508 (50%), Positives = 351/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QYTQLIARR+R+  VY+E++ +++SIE I  KNPKGIILSGG  SVY   +   ++G++ L +P+LGICYG Q++  +NG  V      +EYG  ++ +    + F+ +   +  WMSHSD V  LP+GF+V+A++         N +KK Y +QFHPEV  + FG+ +L+NF   IC     W   +   ++++ I+  V +D VLCA+SGGVDS V A L A AI D L  VFVD+GLLR NE+++V  + K  +G N+  +D  +LFLS+LKGV DPE+KRKIIG+TFIEVF+K A K +   KYL QGT+Y D++ES   GS  SKTIKSHHNVGGLPE ++FEL+EPL+ +FKDEVR+LGL L +    VYR PFPGPGLA+R++GE+    LE++R+AD + R   ++L  +  + K WQ F VL N  SVGV+GDNR+Y   + LR VD+ D M+A + ++P + LE  S  I N+V  I+RVVYDI++KPP TIEWE
  S:     6 ILVLDFGSQYTQLIARRLREQGVYAELMPFNVSIEAIKAKNPKGIILSGGPASVYAKDAYFCDEGVFTLGLPVLGICYGMQLLAHKNGADVA-PAGHKEYGKANLNIVKKCDFFKGVPDTSVVWMSHSDKVNELPQGFEVLANSENSEFCVFANLDKKLYALQFHPEVAHSEFGDTMLKNFA-KICGCESTWNMGSFAKKEVQAIREKVGNDKVLCAVSGGVDSSVVAALLAHAIPDNLIVVFVDNGLLRTNEAKQVEEMFKLKLGVNLISIDASELFLSRLKGVRDPEKKRKIIGETFIEVFDKEAKK-HSNVKYLAQGTLYTDVIESSVVGS--SKTIKSHHNVGGLPEWMEFELIEPLREIFKDEVRRLGLELGLSRDIVYRHPFPGPGLAIRIMGEVNTSSLELLRKADVILR---EELKSSGWYDKTWQAFCVLLNVNSVGVMGDNRTYENAVCLRVVDASDGMTASFSRLPYDLLENCSRRIINEVDGINRVVYDISSKPPATIEWE 510
>gi|117926294|ref|YP_866911.1| bifunctional GMP synthase/glutamine amidotransferase protein [Magnetococcus sp. MC-1] >gi|117610050|gb|ABK45505.1| GMP synthase (glutamine-hydrolyzing) [Magnetococcus sp. MC-1] (533 aa)
Score = 1282, Expect = 5.1e-139, Identities = 256/510 (50%), Positives = 344/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE---LFENI---ELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KILILD+G QYTQLIARR+R+  VY EI  ++++ E +   NP+G+ILSGG+ SVY   + + N  +  L +P+LGICYG Q++ +  GG V    D  EYG  +I+    +   LFE        +  WMSH D V  LPKGF   AST    +A+  N     YGVQFHPEV  T  G +L+ NFV +IC   G W        ++E ++++V DD V+  +SGGVDS V A L  +AIG++L CVFVD+GLLR NE  +V     + +G  +  VD +  FL KL GV DPE+KRKIIG TFIE+F++ A KI    K+L QGTIYPD+VES G+K  K   IKSHHNVGGLPE +Q +LLEPL+ LFKDEVRK+GL L +P++ V+R PFPGPGL VR+LGE+ ++  +++R AD +   Y+D+LY +  + +  Q FTV    KSVGV+GD R+Y Y +ALRAV++ D M+A WY +P + L  I++ I N++  I+RV YDIT+KPPGTIEWE
  S:    19 EKILILDYGSQYTQLIARRVRETQVYCEIHGHEMAAEAVRAFNPQGVILSGGHQSVYDVGAAELNDAVMALGVPVLGICYGMQLLGRHFGGTVA-PSDKREYGRAEIQACAGQVGALFEGFVEAGAKSTVWMSHGDHVEMLPKGFVTTASTLNAPLAAMANEATHMYGVQFHPEVNHTDNGERLIHNFVRTICGCHGLWTSDGFIEYEVERVRALVGDDKVILGLSGGVDSSVVAALLHRAIGEQLTCVFVDNGLLRLNEGDQVMETFAQNMGVKVIRVDAEARFLGKLAGVSDPEKKRKIIGHTFIEIFDEEAGKIENA-KWLAQGTIYPDVVESAGTKTGKATNIKSHHNVGGLPEDMQLKLLEPLRELFKDEVRKVGLELGLPHRMVFRHPFPGPGLGVRILGEVKKEYADLLRRADAI---YMDELYASGHYERISQAFTVFLPVKSVGVMGDGRTYDYVVALRAVETKDFMTATWYPMPHDLLSHIANRIINEIDGINRVTYDITSKPPGTIEWE 533
>gi|56708108|ref|YP_170004.1| bifunctional GMP synthase/glutamine amidotransferase protein [Francisella tularensis subsp. tularensis SCHU S4] >gi|110670579|ref|YP_667136.1| bifunctional GMP synthase/glutamine amidotransferase protein [Francisella tularensis subsp. tularensis FSC198] >gi|81597476|sp|Q5NG38|GUAA_FRATT GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|56604600|emb|CAG45652.1| GMP synthase (glutamine-hydrolyzing) [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320912|emb|CAL09035.1| GMP synthase (glutamine-hydrolyzing) [Francisella tularensis subsp. tularensis FSC 198] >gi|151568835|gb|EDN34489.1| GMP synthase [Francisella tularensis subsp. tularensis FSC033] (516 aa)
Score = 1282, Expect = 5.3e-139, Identities = 260/509 (51%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL--TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R++ V+ EI  +D++ + I     KGIILSGG +SVY D  +K  + +++L +P+LGICYG Q M+ ++GG+V+   D  E+G   I +  +TN +F N+E +   WMSHSD V    + F++IAS+    VA+  ++ K F+GVQFHPE T T  G Q+++NFV +IC     W  +NI    I+EIK  V  D V+  +SGGVDS V A +  QAIGD+L C+FVD GLLR NE  +V  +  + +  N+  ++ K  FL  L+G+ DPEQKRKIIGK F+++F++ A KI    K+L QGTIY D++ES G+  SK   IKSHHNVGGLP+ ++ +LLEPL+ LFKDEVRKLGL L +PY  +YR PFPGPGL VR+LGEI ++ +E +++AD +F    ++LYK N  H   Q F V    KSVGVVGD R Y Y +ALRAV S+D M+A W  +P + L  +S+ I N+VK +SRVVYD+T KPPGTIEWE
  S:     8 KILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVY-DSDVKAPEIVFELGVPVLGICYGMQTMVMQHGGEVKG-ADQSEFGKAIINILNSTNNIFSNMEHEQLVWMSHSDKVTQTGEHFEIIASSTNAPVAAVAHKNKPFFGVQFHPETTHTENGKQIIENFVVNICGCDTLWNIENIIENDIKEIKQKVGTDKVILGLSGGVDSSVVAAILHQAIGDQLTCIFVDTGLLRLNEGDQVMQVFAEHMDINVIRINAKNRFLDALRGICDPEQKRKIIGKLFVDIFDEEAAKIENA-KWLAQGTIYSDVIESAGNNQSKAHVIKSHHNVGGLPKEMKLKLLEPLRELFKDEVRKLGLGLGLPYNMLYRHPFPGPGLGVRILGEIKKEYVETLQKADAIF---TEELYKHNLYHDVSQAFGVFLPVKSVGVVGDQRRYEYVIALRAVVSIDFMTATWANLPYDFLSLVSNRIVNEVKQVSRVVYDVTGKPPGTIEWE 516
>gi|33860597|ref|NP_892158.1| bifunctional GMP synthase/glutamine amidotransferase protein [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|44887936|sp|Q7V3N7|GUAA_PROMP GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|33633539|emb|CAE18496.1| Glutamine amidotransferase class-I:GMP synthase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (528 aa)
Score = 1281, Expect = 5.5e-139, Identities = 254/508 (50%), Positives = 350/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ILILDFG QY++LIARRIR+ +V+S +V    S++EI   NPKGIILSGG  SVY D + K +  I+DL IPILGICYG Q+M++E GG+V    +  EYG   I +   ++L  N++  +  WMSH DS+  LP+GF  I+ T   L A+  N++KK +GVQFHPEV  + FG  +++NFVYSI     DW  +    E I  IK  V D  VL A+SGGVDS   A L  +AIG KL C+F+D G +RK E + +     K     +  ++ ++ F+ KL G+ DPE+KRKIIG+ FI VFE+ +N++  PF+YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRK+G +L +P + + R PFPGPGLA+R+LG+++ +KL  +R+AD++ R  I +  LY +     WQ F VL   K+VGV+GD R+Y + + LR V S D M+A W +IP E LE+IS+ I N+V+ ++RVV+DIT+KPPGTIEWE
  S:    14 ILILDFGSQYSELIARRIREADVFSLVVSNFTSVKEIQDINPKGIILSGGPSSVYEDNAPKCDAKIFDLGIPILGICYGMQLMVKELGGEVTPAINKAEYGRAPINIDCESDLLSNVQDKSIMWMSHGDSINNLPEGFIKISHTENTLHAAISNKQKKLFGVQFHPEVIHSEFGMTVIKNFVYSIAKCKADWTTETFLEETIPRIKQQVGDKRVLLALSGGVDSSTLAFLLNKAIGKKLTCMFIDQGFMRKGEPEFLMEFFDKKFHIKVEYINARERFIDKLNGITDPEEKRKIIGREFIRVFEEESNRLG-PFQYLAQGTLYPDVIESAGTNLDPKTGERIAVKIKSHHNVGGLPKDLQFKLVEPLRKLFKDEVRKVGGALGLPDEIIKRHPFPGPGLAIRILGDVSHEKLNCLRDADWIVRDEIKKAGLYNDI----WQAFAVLLPVKTVGVMGDKRTYAWPIVLRCVSSEDGMTADWSRIPYETLERISNRIVNEVEQVNRVVFDITSKPPGTIEWE 528
>gi|26987768|ref|NP_743193.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pseudomonas putida KT2440] >gi|38257494|sp|Q88P21|GUAA_PSEPK GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|24982461|gb|AAN66657.1|AE016293_7 GMP synthase [Pseudomonas putida KT2440] (525 aa)
Score = 1281, Expect = 5.9e-139, Identities = 253/509 (49%), Positives = 348/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY E+  +D+  E I + NP+GIIL+GG +SV+   S +  + ++DLN+P+LGICYG Q M ++ GG+VE   D  E+G   + +   + L + IE        L  + WMSH D V  +P  F ++AST  C +A   +  + +YGVQFHPEVT T  G ++L  FV  IC     W   NI  + I ++++ V    VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E  +V A+ K+ +G  +   D ++ FL  L+G  DPE+KRKIIG+TFI+VF+  A+K+    ++L QGTIYPD++ES G+K  K   IKSHHNVGGLPE +  +L+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +I+R AD +F   I++L K +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LE +S  I N++  ISRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFNPRGIILAGGPESVHEANSPRAPQAVFDLNVPVLGICYGMQTMAEQMGGKVEG-SDLREFGYARVDVVGKSRLLDGIEDHVDDDGVLGLDVWMSHGDKVTQMPGNFNILASTPSCPIAGMYDDVRGYYGVQFHPEVTHTKQGGRILSRFVQDICGCEALWTASNIVEDAIAQVRAQVGSANVLLGLSGGVDSSVVAALLHRAIGDQLTCVFVDNGLLRLHEGDQVMAMFKENMGVKVIRADAEKQFLDNLEGEADPEKKRKIIGRTFIDVFDAEASKLE-NIQFLAQGTIYPDVIESAGAKSGKAHVIKSHHNVGGLPEEMNLKLVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADILRRADHIF---IEELRKADWYHKTSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETVDFMTARWAHLPYELLETVSGRIINEIDGISRVTYDVSSKPPATIEWE 525
>gi|153004390|ref|YP_001378715.1| bifunctional GMP synthase/glutamine amidotransferase protein [Anaeromyxobacter sp. Fw109-5] >gi|152027963|gb|ABS25731.1| GMP synthase, large subunit [Anaeromyxobacter sp. Fw109-5] (518 aa)
Score = 1281, Expect = 6.0e-139, Identities = 252/510 (49%), Positives = 348/510 (68%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINV---PFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KILILDFG QYTQLIARR+R+L VY EI    ++ E +    P+G++LSGG  SV  + S + ++ +++L +P+LGICYG Q++  E GG+V+      EYG   I    + ELFE +    + WMSH D V  LP GF+ IAST     A+  +R ++F+GVQFHPEV  T  G  +L+NF Y +C  +G W  +      +E+I++ VKD +V+CA+SGGVDS VAA+L  +AIGD+L C+FVD+G+LR  E  +V  +   +    +  VD    FL++L GV DPEQKRKIIG+ FI VFE+    +       ++L+QGT+YPD++ES S    S TIKSHHNVGGLPE ++  L+EPL+ LFKDEVR+LGL L +P   V RQPFPGPGLA+RVLGE+TE++L ++R+AD + +  I    LY+    K WQ F VL   +SVGV+GD R+Y  T A+RA++S D M+  W ++P E L ++SS I N+V+ I+RVVYDI++KPP TIEWE
  S:     6 EKILILDFGSQYTQLIARRLRELGVYCEIHPCTMTPEAMRAFAPRGVVLSGGPASVLAEGSPRADRLVFELGVPVLGICYGLQLLAHELGGRVDKAA-HREYGPATIETREDAELFEGLPRRLDVWMSHGDRVEKLPPGFEPIASTPSAPFAAVEDRRRRFFGVQFHPEVVHTPLGKDVLRNFAYRVCGCSGSWSMRAYAEIAVEQIRAQVKDGHVICALSGGVDSAVAALLVHRAIGDRLRCIFVDNGVLRAGERAQVEEVFGGMFHLPLVTVDASARFLARLAGVTDPEQKRKIIGREFIAVFEEQVEDLAAHGERAQFLVQGTLYPDVIESVSFKGPSATIKSHHNVGGLPEVMKLGLVEPLRELFKDEVRRLGLELGLPQHIVQRQPFPGPGLAIRVLGEVTEERLALLRKADTIVQEEIRAAGLYE----KLWQAFAVLLPVRSVGVMGDERTYEATCAVRAIESTDGMTGDWARLPYELLGRMSSRIINEVRGINRVVYDISSKPPATIEWE 518
>gi|118497489|ref|YP_898539.1| bifunctional GMP synthase/glutamine amidotransferase protein [Francisella tularensis subsp. novicida U112] >gi|195536182|ref|ZP_03079189.1| GMP synthase, C- domain protein [Francisella tularensis subsp. novicida FTE] >gi|118423395|gb|ABK89785.1| GMP synthetase (glutamine-hydrolyzing) [Francisella tularensis subsp. novicida U112] >gi|194372659|gb|EDX27370.1| GMP synthase, C- domain protein [Francisella tularensis subsp. novicida FTE] (516 aa)
Score = 1281, Expect = 6.0e-139, Identities = 261/509 (51%), Positives = 350/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL--TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R++ V+ EI  +D++ + I     KGIILSGG +SVY D  +K  + ++ L IP+LGICYG Q M+ ++GG+V+   D  E+G   I +  +TN +F N+E +   WMSHSD V    + F++IAS+    VA+  ++ K F+GVQFHPE T T  G Q+++NFV +IC     W  +NI    I+EIK  V  D V+  +SGGVDS V A +  QAIGD+L C+FVD GLLR NE  +V  +  + +  N+  ++ K  FL  L+G+ DPEQKRKIIGK F+++F++ A KI    K+L QGTIY D++ES G+  SK   IKSHHNVGGLP+ ++ +LLEPL+ LFKDEVRKLGL L +PY  +YR PFPGPGL VR+LGEI ++ +E +++AD +F    ++LYK N  H   Q F V    KSVGVVGD R Y Y +ALRAV S+D M+A W  +P + L  +S+ I N+VK +SRVVYD+T KPPGTIEWE
  S:     8 KILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVY-DSDVKAPEIVFKLGIPVLGICYGMQTMVMQHGGEVKG-ADQSEFGKAIINILNSTNNIFSNMEHEQLVWMSHSDKVTQTGEHFEIIASSTNAPVAAVAHKSKPFFGVQFHPETTHTENGKQIIENFVVNICGCDTLWNIENIIENDIKEIKQKVGTDKVILGLSGGVDSSVVAAILHQAIGDQLTCIFVDTGLLRLNEGNQVMQVFAEHMDINVIRINAKNRFLDALRGICDPEQKRKIIGKLFVDIFDEEAAKIENA-KWLAQGTIYSDVIESAGNNQSKAHVIKSHHNVGGLPKEMKLKLLEPLRELFKDEVRKLGLGLGLPYNMLYRHPFPGPGLGVRILGEIKKEYVETLQKADAIF---TEELYKHNLYHDVSQAFGVFLPVKSVGVVGDQRRYEYVIALRAVVSIDFMTATWANLPYDFLSLVSNRIVNEVKQVSRVVYDVTGKPPGTIEWE 516
>gi|84497925|ref|ZP_00996722.1| bifunctional GMP synthase/glutamine amidotransferase protein [Janibacter sp. HTCC2649] >gi|84381425|gb|EAP97308.1| bifunctional GMP synthase/glutamine amidotransferase protein [Janibacter sp. HTCC2649] (529 aa)
Score = 1281, Expect = 6.2e-139, Identities = 249/508 (49%), Positives = 347/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT--TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI-------NVPFKYLLQGTIYPDIVESGSKF-SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS-EHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++++DFG QY QLIARR+R+ NV+SE+V   +   E++ K P  IILSGG  SVY + +   +  + +  IP+ G+CYGFQ M++  GG VE    SE YGST  +++  T+ LF     + + WMSH DS    P G +V A+T+   VA+  + E++ YGVQ+HPEV  +TFG ++L+NF+     ++G+W   N+    +E++K  V D  VLCA+SGGVDS VAA L  +A+GD+L CVFVDHGLLR  E+++V        G ++  VD K  FLS L GV DPE+KRKIIG+ FI VFE+ A  +         P ++L+QGT+YPD+VESG    +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVR++GL L +P   V+RQPFPGPGL +R++GE+T ++LEI+R AD + R   D+L     +   WQ   V L + +SVGV GD R+YG+ + LR V S DAM+A W ++P + L KIS+ I N+V  ++RVV D+T+KPPGTIEWE
  S:    14 VIVVDFGAQYAQLIARRVREANVFSEVVPSTMPASELLAKEPAAIILSGGPSSVYAEGAPTLDPALLEAGIPVFGMCYGFQAMVKALGGTVEKTGLSE-YGSTPAQISDSTSTLFNGQPAEQSVWMSHGDSATAAPDGMRVTATTSGAPVAAFEDDERRLYGVQWHPEVLHSTFGQRVLENFLLRGAGLSGEWTAHNVVESLVEQVKETVGDKRVLCALSGGVDSSVAAALVQRAVGDQLTCVFVDHGLLRSGEAEQVRQEFVAATGVDLVTVDAKDQFLSALAGVSDPEEKRKIIGREFIRVFEQAARDVVGSAESDGHPVEFLVQGTLYPDVVESGGGTGTANIKSHHNVGGLPDDLQFKLVEPLRLLFKDEVRQVGLELGVPEAIVWRQPFPGPGLGIRIVGEVTGERLEILRAADQIAR---DELSAAGLDRDIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWTRVPYDVLAKISTRITNEVSEVNRVVLDVTSKPPGTIEWE 529
>gi|151570556|gb|EDN36210.1| GMP synthetase [Francisella tularensis subsp. novicida GA99-3549] (516 aa)
Score = 1281, Expect = 6.5e-139, Identities = 260/509 (51%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL--TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R++ V+ EI  +D++   I     KGIILSGG +SVY D  +K  + +++L +P+LGICYG Q M+ ++GG+V+   D  E+G   I +  +TN++F N+E +   WMSHSD V    + F++IAS+    VA+  ++ K F+GVQFHPE T T  G Q+++NFV +IC     W  +NI    I+EIK  V  D V+  +SGGVDS V A +  QAIGD+L C+FVD GLLR NE  +V  +  + +  N+  ++ K  FL  L+G+ DPEQKRKIIGK F+++F++ A KI    K+L QGTIY D++ES G+  SK   IKSHHNVGGLP+ ++ +LLEPL+ LFKDEVRKLGL L +PY  +YR PFPGPGL VR+LGEI ++ +E +++AD +F    ++LYK N  H   Q F V    KSVGVVGD R Y Y +ALRAV S+D M+A W  +P + L  +S+ I N+VK +SRVVYD+T KPPGTIEWE
  S:     8 KILILDFGSQYTQLIARRVREVGVFCEIFPHDVAANFIKNYQAKGIILSGGPESVY-DSDVKAPEIVFELGVPVLGICYGMQTMVMQHGGEVKG-ADQSEFGKAIINILNSTNKIFSNMEHEQLVWMSHSDKVTQTGEHFEIIASSTNAPVAAVAHKSKPFFGVQFHPETTHTENGKQIIENFVVNICGCDTLWNIENIIENDIKEIKQKVGTDKVILGLSGGVDSSVVAAILHQAIGDQLTCIFVDTGLLRLNEGDQVMQVFAEHMDINVIRINAKNRFLDALRGICDPEQKRKIIGKLFVDIFDEEAAKIENA-KWLAQGTIYSDVIESAGNNQSKAHVIKSHHNVGGLPKEMKLKLLEPLRELFKDEVRKLGLGLGLPYNMLYRHPFPGPGLGVRILGEIKKEYVETLQKADAIF---TEELYKHNLYHDVSQAFGVFLPVKSVGVVGDQRRYEYVIALRAVVSIDFMTATWANLPYDFLSLVSNRIVNEVKQVSRVVYDVTGKPPGTIEWE 516
>gi|148546315|ref|YP_001266417.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pseudomonas putida F1] >gi|148510373|gb|ABQ77233.1| GMP synthase (glutamine-hydrolyzing) [Pseudomonas putida F1] (525 aa)
Score = 1281, Expect = 6.7e-139, Identities = 253/509 (49%), Positives = 347/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY E+  +D+  E I + NP+GIIL+GG +SV+   S +  + ++DLN+P+LGICYG Q M ++ GG+VE   D  E+G   + +   + L + IE        L  + WMSH D V  +P  F ++AST  C +A   +  + +YGVQFHPEVT T  G ++L  FV  IC     W   NI  + I ++++ V    VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E  +V A+ K+ +G  +   D ++ FL  L G  DPE+KRKIIG+TFI+VF+  A+K+    ++L QGTIYPD++ES G+K  K   IKSHHNVGGLPE +  +L+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +I+R AD +F   I++L K +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LE +S  I N++  ISRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFNPRGIILAGGPESVHEANSPRAPQAVFDLNVPVLGICYGMQTMAEQMGGKVEG-SDLREFGYARVDVVGKSRLLDGIEDHVDDDGVLGLDVWMSHGDKVTQMPGNFNILASTPSCPIAGMYDDVRGYYGVQFHPEVTHTKQGGRILSRFVQDICGCEALWTASNIVEDAIAQVRAQVGSANVLLGLSGGVDSSVVAALLHRAIGDQLTCVFVDNGLLRLHEGDQVMAMFKENMGVKVIRADAEKQFLDNLAGEADPEKKRKIIGRTFIDVFDAEASKLE-NIQFLAQGTIYPDVIESAGAKSGKAHVIKSHHNVGGLPEEMNLKLVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADILRRADHIF---IEELRKADWYHKTSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETVDFMTARWAHLPYELLETVSGRIINEIDGISRVTYDVSSKPPATIEWE 525
>gi|187931657|ref|YP_001891641.1| GMP synthase (glutamine-hydrolyzing) [Francisella tularensis subsp. mediasiatica FSC147] >gi|187712566|gb|ACD30863.1| GMP synthase (glutamine-hydrolyzing) [Francisella tularensis subsp. mediasiatica FSC147] (516 aa)
Score = 1281, Expect = 6.8e-139, Identities = 260/509 (51%), Positives = 352/509 (69%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL--TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R+++V+ EI  +D++ + I     KGIILSGG +SVY D  +K  + +++L +P+LGICYG Q M+ ++GG+V+   D  E+G   I +  +TN +F N+E +   WMSHSD V    + F++IAS+    VA+  ++ K F+GVQFHPE T T  G Q+++NFV +IC     W  +NI    I+EIK  V  D V+  +SGGVDS V A +  QAIGD+L C+FVD GLLR NE  +V  +  + +  N+  ++ K  FL  L+G+ DPEQKRKIIGK F+++F++ A KI    K+L QGTIY D++ES G+  SK   IKSHHNVGGLP+ ++ +LLEPL+ LFKDEVRKLGL L +PY  +YR PFPGPGL VR+LGEI ++ +E +++AD +F    ++LYK N  H   Q F V    KSVGVVGD R Y Y +ALRAV S+D M+A W  +P + L  +S+ I N+VK +SRVVYD+T KPPGTIEWE
  S:     8 KILILDFGSQYTQLIARRVREVDVFCEIFPHDVAADFIKNYQAKGIILSGGPESVY-DSDVKAPEIVFELGVPVLGICYGMQTMVMQHGGEVKG-ADQSEFGKAIINILNSTNNIFSNMEHEQLVWMSHSDKVTQTGEHFEIIASSTNAPVAAVAHKNKPFFGVQFHPETTHTENGKQIIENFVVNICGCDTLWNIENIIENDIKEIKQKVGTDKVILGLSGGVDSSVVAAILHQAIGDQLTCIFVDTGLLRLNEDDQVMQVFAEHMDINVIRINAKNRFLDALRGICDPEQKRKIIGKLFVDIFDEEAAKIENA-KWLAQGTIYSDVIESAGNNQSKAHVIKSHHNVGGLPKEMKLKLLEPLRELFKDEVRKLGLGLGLPYNMLYRHPFPGPGLGVRILGEIKKEYVETLQKADAIF---TEELYKHNLYHDVSQAFGVFLPVKSVGVVGDQRRYEYVIALRAVVSIDFMTATWANLPYDFLSLVSNRIVNEVKQVSRVVYDVTGKPPGTIEWE 516
>gi|196234632|ref|ZP_03133450.1| GMP synthase, large subunit [Chthoniobacter flavus Ellin428] >gi|196221301|gb|EDY15853.1| GMP synthase, large subunit [Chthoniobacter flavus Ellin428] (521 aa)
Score = 1281, Expect = 6.9e-139, Identities = 254/509 (49%), Positives = 345/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFL----VDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKIN----VPFKYLLQGTIYPDIVES---GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +I+ILDFG QYTQ+IARRIR+  V+S+I+ ++   ++I    P+GII SGG  SVYG  +  P+K I++L IPILGICYG Q+M    GG+VE+     EYG   + LTT   LF N+    + W SH D +  LPKGF+ I  T+    A     +K+FYG+QFHPEV  T  G  +L NFVY IC    DW   +   +  EE++  V DD+V+  +SGGVDS VAA L  +AIGD+L CVFV++GLLR NE++ V    +++ G N  +    VD    FL KLKGV DPE+KRKIIG  F+ VFE    ++       FK+L QGT+YPD++ES   G   +  IKSHHNVGGLP+ ++F+L+EPL+ LFKDEVR++G  L +P + V RQPFPGPGLAVR+LGEIT+++L I+READ +  + +     +  ++ WQ F  L   +SVGV+GD R+Y  T+A+R V+S D M+A W ++P + L KISS I N+VK ++RV YDI++KPP TIEWE
  S:     8 RIVILDFGSQYTQVIARRIRECQVFSQILPHNAPAKKIAALKPQGIIFSGGPASVYGKGAPHPDKAIFELGIPILGICYGVQLMAHHLGGKVEHST-HREYGPGMLHLTTKSPLFHNLPEVLDIWNSHGDKITKLPKGFRAIGKTDNSPYAVVEQPKKRFYGLQFHPEVVHTPRGKDILANFVYQICGCKMDWTMGSFIDQTCEEVRQQVGDDHVILGLSGGVDSSVAAALLHKAIGDQLTCVFVNNGLLRSNEAETV----QRVFGDNFHVKLKYVDASTRFLKKLKGVTDPERKRKIIGNEFVRVFEDATKQLTRGKKSKFKFLAQGTLYPDVIESVAIGGNPASLIKSHHNVGGLPKNMKFKLVEPLRQLFKDEVREVGAQLGLPKEIVQRQPFPGPGLAVRILGEITKERLRILREADAIVVAEMKA--SDWYYRVWQSFAALLPVRSVGVMGDERTYAQTIAVRIVESQDGMTADWVRLPYDVLAKISSRIINEVKGVNRVCYDISSKPPATIEWE 521
>gi|189485394|ref|YP_001956335.1| GMP synthase [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287353|dbj|BAG13874.1| GMP synthase [uncultured Termite group 1 bacterium phylotype Rs-D17] (509 aa)
Score = 1280, Expect = 7.7e-139, Identities = 261/508 (51%), Positives = 356/508 (70%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIK-KNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS-KFSKT-IKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ILILDFG QYTQLIARRIR+  VY E+   +  I+     K+ KGIILSGGY+SVY   +  P+  IW+L++PILGICYG Q++ + +GG+V   K   E+G  ++ +  N  LF  +  +   WMSH D +  +PKGF++ A ++    A+  N  K  YGVQFHPEV  +  G  +L+NF++ IC +  DW  K+  +E+++ I   V    VLCA+SGGVDS VAAV+  +AIG +L CV+VDHGL +  E++ V  +  ++ GKN+ +V  K++FLSKLKG+ DPEQKRKIIG TFIEVF+    K+     +LLQGTIY D++ES S K +K+ IKSHHNVGGLPE+++ +L+EPL++LFKDEVR LG  L +P + + RQPFPGPGLA+R LGEIT++KL I++EAD +    I +  LY+    K WQ F ++   K+VGV+GD R+Y Y +A+RAV+S DAM+A W K+P E L KISS I N+VK  +RVVYDI++KPP TIEWE
  S:     2 ILILDFGSQYTQLIARRIREEKVYCELCPGNKPIKSFSGIKDLKGIILSGGYESVYSKDAPWPDPEIWELDVPILGICYGMQLIAELHGGKVAPSK-RREFGLANVNVKCNSSLFNGLSSEETLWMSHGDKLSKIPKGFEITAKSDNSPYAAIENTAKNIYGVQFHPEVKHSVNGRTILKNFIFKICGLKRDWTMKSYIVEEVKRIHKQVGKSKVLCALSGGVDSSVAAVMLYKAIGKQLICVYVDHGLQKLGETERVRKVFGRMFGKNLIIVSAKKIFLSKLKGITDPEQKRKIIGHTFIEVFDGEVKKLK-GINFLLQGTIYSDVIESVSIKGAKSPIKSHHNVGGLPEKMKMKLVEPLRFLFKDEVRVLGKELGVPSEIIDRQPFPGPGLAIRTLGEITKEKLNILKEADNIVTEEIIKAGLYE----KIWQSFAIILPVKTVGVMGDARTYEYVIAIRAVNSEDAMTADWVKLPYELLSKISSRIINEVKGTNRVVYDISDKPPATIEWE 509
>gi|91775492|ref|YP_545248.1| bifunctional GMP synthase/glutamine amidotransferase protein [Methylobacillus flagellatus KT] >gi|91709479|gb|ABE49407.1| GMP synthase (glutamine-hydrolyzing) [Methylobacillus flagellatus KT] (526 aa)
Score = 1280, Expect = 9.1e-139, Identities = 258/509 (50%), Positives = 348/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNC--------WMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG---SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQL--YKNSEHKPW-----QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARRIR+ NVY E+  +D+S   I + NP G+ILSGG +SVY D + +  + +++L +P+LGICYG Q M  + GG VEN     E+G  +IR   +  L + I+  +N         WMSH D V  LP+GFK+IAS +   +A   +  ++FY VQFHPEVT T  G  LL  FV+ IC     W   +     ++ I+  V  D V+  +SGGVDS VAA L  +AIGD+L CVFVD+GLLR NE+++V     K +G  +  VD    FL  L GV DPE KRKIIG+ F+EVF++ A K+    K+L QGTIYPD++ES    +K + TIKSHHNVGGLP+ L+ +LLEPL+ LFKDEVR+LG++L +P+  VYR PFPGPGL VR+LGE+  +  +++R+AD +F   I++L   K+++ K W     Q F V    KSVGV+GD R+Y Y +ALRAV + D M+A W ++P + L K+S+ I N+V+ I+RVVYDI+ KPP TIEWE
  S:     4 KILILDFGSQYTQLIARRIREANVYCELHSWDVSDAFIREFNPAGVILSGGPNSVYEDETPRAPQSVFELGVPVLGICYGMQTMAAQLGGSVENAA-KREFGYAEIRAQGHSALLKGIQDKSNAEGHGLLDVWMSHGDKVTALPEGFKIIASNSATPIAGMADENRRFYAVQFHPEVTHTKQGKALLNRFVHDICGCDQSWNMPDYVETAVQRIREEVGCDEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDNGLLRLNEAEQVMETFGKNLGVKVIHVDASAKFLGDLSGVNDPEAKRKIIGREFVEVFQQEAAKLPQA-KWLAQGTIYPDVIESAGAKTKKAHTIKSHHNVGGLPDTLKLKLLEPLRELFKDEVRELGIALGLPHDMVYRHPFPGPGLGVRILGEVKREYADLLRQADHIF---IEELRSTKDADGKSWYDKTSQAFAVFLPVKSVGVMGDGRTYDYVVALRAVVTTDFMTAHWAELPYDLLGKVSNRIINEVRGINRVVYDISGKPPATIEWE 526
>gi|148238384|ref|YP_001223771.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus sp. WH 7803] >gi|147846923|emb|CAK22474.1| GMP synthase (glutamine-hydrolyzing) [Synechococcus sp. WH 7803] (539 aa)
Score = 1279, Expect = 9.5e-139, Identities = 243/508 (47%), Positives = 341/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARR+R+  V+S ++ Y  + E++ +  P GIILSGG  SVY + +   +  IW+L IP+LG+CYG Q+M+Q+ GG+V       EYG   + +    +L  N++  +  WMSH DSV  LP GF  +A T     A+  N +++ YGVQFHPEV  +T G  +++NFVY IC    DW       E +++++S V D  VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +     +    ++  ++ +Q FL KLK + DPEQKRKIIG  FI VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRK+G SL +P + V R PFPGPGLA+R+LGE+T +KL  +R+AD + R  + +  LY    H+ WQ F VL   +SVGV+GD R+Y + + LR V S D M+A W ++P + +E IS+ I N+VK ++RVV DIT+KPPGTIEWE
  S:    25 IVILDFGSQYSELIARRVRETEVFSVVLGYSTTAEDLRRMAPLGIILSGGPSSVYAEHAPLCDPEIWNLGIPVLGVCYGMQLMVQQLGGRVVAATGKAEYGKAPLEVDDPTDLLTNVDNGSTMWMSHGDSVEALPDGFVRLAHTANTPEAAVANLQRRLYGVQFHPEVVHSTCGMAMIRNFVYHICGCEPDWTTAAFIEEAVKQVRSQVGDKRVLLALSGGVDSSTLAFLLKKAIGDQLTCMFIDQGFMRKGEPEFLMDFFDRKFNIHVEYINARQRFLDKLKDITDPEQKRKIIGTEFIRVFEEESRRLG-PFDYLAQGTLYPDVIESAGTDVDPKTGERVAVKIKSHHNVGGLPKDLQFKLVEPLRKLFKDEVRKVGRSLGLPEEIVRRHPFPGPGLAIRILGEVTAEKLNCLRDADLIVREEVKEAGLY----HEIWQAFAVLLPVRSVGVMGDKRTYAWPIVLRCVSSEDGMTADWSRLPYDLMETISNRIVNEVKGVNRVVLDITSKPPGTIEWE 539
>gi|113954939|ref|YP_729285.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus sp. CC9311] >gi|113882290|gb|ABI47248.1| GMP synthase, glutamine-hydrolyzing [Synechococcus sp. CC9311] (528 aa)
Score = 1279, Expect = 9.6e-139, Identities = 242/508 (47%), Positives = 340/508 (66%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARR+R+  V+S ++ Y  S EE+    P+GIILSGG  SVY D +   +  IWDL +P+LG+CYG Q+M+Q+ GGQV       EYG   +++     L  N+E  +  WMSH DSV  LP GF  +A T     A+  N +++ YGVQFHPEV  +T G  +++NFVY IC    DW  +    E +  ++  V    VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +     +    ++  ++ ++ F+ KL G+ DPE+KRKIIG  FI VFE+ + ++  PF YL+QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRK+G +L +P + V R PFPGPGLA+R+LGE+TE+KL+ +R+AD + R  ++   LY    H  WQ F VL   +SVGV+GD R+Y + + LR V S D M+A W ++P + +E IS+ I N+VK ++RVV DIT+KPPGTIEWE
  S:    14 IVILDFGSQYSELIARRVRETEVFSVVLGYSTSAEELRALAPRGIILSGGPSSVYADEAPLCDPAIWDLGVPVLGVCYGMQLMVQQLGGQVVAATGKAEYGKAPLKVDDPTALLTNVESGSTMWMSHGDSVEALPDGFLRLAHTANTPEAAIANHKRRLYGVQFHPEVVHSTGGMVMIRNFVYHICGCEPDWTTEAFIDEAVANVRDQVGQKRVLLALSGGVDSSTLAFLLKKAIGDQLTCMFIDQGFMRKGEPEFLMEFFDRKFNIHVEYINARERFIKKLDGITDPEEKRKIIGTEFIRVFEEESRRLG-PFDYLVQGTLYPDVIESAGTNVDPKTGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRTLGLPEEIVSRHPFPGPGLAIRILGEVTEEKLDCLRDADLIVREEVNAAGLY----HDIWQAFAVLLPVRSVGVMGDKRTYAWPIVLRCVSSEDGMTADWSRLPYDLMEVISNRIVNEVKGVNRVVMDITSKPPGTIEWE 528
>gi|154148437|ref|YP_001406222.1| bifunctional GMP synthase/glutamine amidotransferase protein [Campylobacter hominis ATCC BAA-381] >gi|153804446|gb|ABS51453.1| gmp synthase [glutamine-hydrolyzing] (glutamineamidotransferase) (gmp synthetase) (gmps) [Campylobacter hominis ATCC BAA-381] (511 aa)
Score = 1279, Expect = 9.8e-139, Identities = 261/508 (51%), Positives = 348/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I++LDFG QYTQLIARR+R+  VY+EI+ ++  I +I +KNPKG+ILSGG  SVY   +  PN  I++LN+PILGICYG Q++    G  V    + +EYG ++++  + N L ++ +     WMSHSD V  LP GFK IA +      + C+ ++K Y +QFHPEV  +  G+++L+NF   ICD    W   N    K EEIK  V  D VLCA+SGGVDS V A L A  I + L  VFVD+GLLR +E+++V    K  +G  +  +D  +LFL +LKG+ DPE+KRKIIGKTFIEVFE+ A K +   KYL QGT+Y DI+ES   GS  SKTIKSHHNVGGLP+ ++F+L+EPLK +FKDEVRKLG  L +    VYR PFPGPGLA+R+LGEIT +KL ++R+AD + R   D+L  +  + K WQ F VL N  SVGV+GDNR+Y   + +R VD+ D M+A + ++P + LE IS  I N+V  I+RVVYDI++KPP TIEWE
  S:     6 IIVLDFGSQYTQLIARRLREQGVYTEILPFNAKISQIKEKNPKGLILSGGPASVYAKDAYFPNDEIFNLNLPILGICYGMQLIAYHFGASV-TPTNKKEYGKSNLKFVSENALLKDTKDGQIVWMSHSDKVENLPDGFKTIAVSENSPFCAFCDEKRKIYALQFHPEVAHSECGDKILKNFAKYICDCESTWNMGNFAKIKCEEIKKQVGKDRVLCAVSGGVDSSVVAALLAHCIKENLIVVFVDNGLLRTDEAKQVEQTFKLKLGVELISIDASELFLGRLKGITDPEEKRKIIGKTFIEVFEREAKK-HQNVKYLAQGTLYTDIIESSVVGS--SKTIKSHHNVGGLPKDMKFKLIEPLKEIFKDEVRKLGTELGLSPDLVYRHPFPGPGLAIRILGEITPEKLCVLRKADVILR---DELKSSGWYNKTWQAFCVLLNVNSVGVMGDNRTYENAVCIRVVDASDGMTASFSRLPYDLLENISRRIINEVDGINRVVYDISSKPPATIEWE 511
>gi|85860898|ref|YP_463100.1| bifunctional GMP synthase/glutamine amidotransferase protein [Syntrophus aciditrophicus SB] >gi|85723989|gb|ABC78932.1| GMP synthase (glutamine-hydrolyzing) [Syntrophus aciditrophicus SB] (510 aa)
Score = 1279, Expect = 1.2e-138, Identities = 250/508 (49%), Positives = 347/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT--NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKF---SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH--KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ILI+DFG QY QLIARR+R+L VY +I   +I++E I    P+GIILSGG  S+Y  +S K +KGI+DLNIPILGICYG Q M+   GG+V       EYG   + +      +F  +  +  CWMSH D++  LP GF + AST     A+  +  ++ YG+QFHPEV  T  G ++L+NF++S+C     W   +   + +EEI+S V D  V+  +SGGVDS VAA+L  QAIG++L CVFVD+GLLR+ E+++V +L K+    N+     K  FL  LKG+VDPE+KRKIIG+ F+EVF++ A KI     YL QGT+YPD++ES S F   S  IKSHHNVGGLP R++ +L+EPLK+LFKDEVR LG  L +    ++R PFPGPGL +R++GE+T+ +L ++R+AD +    I    K +++  + WQ F VL   KSVG++GD R+Y +  A+RAV S DAM+A W ++P + L KI++ I N+V+ I+RVVYDI++KPP TIEWE
  S:     2 ILIIDFGSQYNQLIARRVRELEVYCQIEPPEIALETIKALQPEGIILSGGPASIYEPKSPKVDKGIFDLNIPILGICYGLQYMVDSLGGKVIRSA-KREYGFAQLHIVREGKGIFAGVTENTRCWMSHGDTIDQLPAGFAITASTANTPAAAMEDPVRRLYGLQFHPEVVHTPEGKKMLENFLFSVCGCRKSWTMASFIRDSVEEIRSTVGDRKVVLGLSGGVDSSVAALLLHQAIGNQLTCVFVDNGLLRQGEAEKVRSLFKQHFHMNVRFARAKAQFLDALKGIVDPERKRKIIGRVFVEVFDQEARKIR-DVDYLAQGTLYPDVIESRSAFGGPSAVIKSHHNVGGLPRRMKLKLIEPLKHLFKDEVRLLGRELGLSDDMIWRHPFPGPGLGIRIIGEVTDKRLSLLRKADAILLEEI----KAADYYGRLWQSFVVLLPLKSVGIMGDQRTYEHIAAIRAVTSDDAMTADWARLPHDLLGKIANRIINEVRGINRVVYDISSKPPSTIEWE 510
>gi|94984705|ref|YP_604069.1| bifunctional GMP synthase/glutamine amidotransferase protein [Deinococcus geothermalis DSM 11300] >gi|94554986|gb|ABF44900.1| GMP synthase [Deinococcus geothermalis DSM 11300] (505 aa)
Score = 1279, Expect = 1.2e-138, Identities = 260/508 (51%), Positives = 339/508 (66%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++ILDFG Q+T+LIARR+R+L  YS I+    S+E I ++NP+GI+LSGG  SVY   + +P  G+ DL++PILG+CYG Q +  E GG V+      EYG  D+     +LF  I+ +   WMSHSDSV  LP+G++VIA+T    VA   N   + YGVQFHPEV  T  G QLL NF+  IC VA DW  ++I  E IE+++  V    VL AISGGVDS    +L A+AIGD+L  VF+DHGLLR  E ++V A L+ L G N+  VD  + FL  L GV DPEQKRKIIG+ FI  FE+ A K   PF +L QGT+YPD++ES G + +  IKSHHNVGGLPE L F+L+EP + LFKDEVR++   L +P     R PFPGPGLA+R LGE+T +KL+I++  D +F S + +  LY        Q   VLT  +SVGV+GD R+Y YT ALRAV + D M+A+W ++P E L  +S+ I N+V  I+RVVYDIT KPP TIEWE
  S:     3 VVILDFGSQFTRLIARRLRELGAYSVILPGTASLERIAQENPQGIVLSGGPSSVYDANAPRPAPGVLDLDVPILGVCYGMQFLAHEAGGAVQR-AGKREYGKADLTRYGGQLFAGIQGEFVAWMSHSDSVTQLPQGYEVIAATEDTPVAGIENTVTRRYGVQFHPEVVHTPKGGQLLANFL-EICGVARDWNAEHIVDELIEDVRRQVGAGRVLLAISGGVDSSTLGLLLARAIGDRLTAVFIDHGLLRLGEREQVEAALRPL-GVNLVTVDASEEFLGALAGVSDPEQKRKIIGREFIRAFEREARKYG-PFDFLAQGTLYPDVIESAGGEGAANIKSHHNVGGLPEDLAFKLVEPFRTLFKDEVREIARLLGLPDAIRMRHPFPGPGLAIRCLGEVTREKLDILKRVDDIFISGLREFGLYDGCS----QALAVLTPIQSVGVMGDERTYSYTAALRAVTTDDFMTAEWARLPYEFLATMSNRIVNQVHEINRVVYDITGKPPATIEWE 505
>gi|167756430|ref|ZP_02428557.1| hypothetical protein CLORAM_01963 [Clostridium ramosum DSM 1402] >gi|167703838|gb|EDS18417.1| hypothetical protein CLORAM_01963 [Clostridium ramosum DSM 1402] (515 aa)
Score = 1278, Expect = 1.3e-138, Identities = 255/508 (50%), Positives = 357/508 (70%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE--LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALL--KKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG-SKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ++++DFGGQY QL+ARR+R+ NVY EI  Y + IE+I + NPKGIIL+GG +S Y + S    K +++L IP+LG+CYG Q+M    GG+VE   D  EYG + + ++  E  L +++ +++ CWMSH D +  +  GF++ + T  C VAS  +  KK Y +QFHPEV  T +G ++L NFV  +C+ +GDW   +   E+I+ I+  V +  VLCA+SGGVDS VAAVL ++AIG++L CVFVDHGLLRKNE  EV  +         N   V+ ++ +  KLKGV +PE KRKIIG+ FI VFE+ A KI     +L+QGTIYPD+VESG    S  IKSHHNVGGLP+ + F E++EPL+ LFKDEVRK+GL L IP   V+RQPFPGPGL +R++GE+T +K+ IV++AD ++R  I +     +    QYF  LTN +SVGV+GD R+Y + +ALRAV+++D M+A+  +IP E L K+ S I N+V+ ++RV+YDIT+KPPGTIE+E
  S:     6 VIVIDFGGQYNQLVARRVRECNVYCEIYSYKVDIEKIKEMNPKGIILTGGPNSCYLEDSPTYQKELFELGIPVLGLCYGAQLMQHVLGGKVEK-ADVREYGKSHLIVSKQESKLMKDVAVESICWMSHFDYISKIAPGFEITSYTKDCPVASCEDESKKLYAIQFHPEVLHTEYGTKMLSNFVLDVCNCSGDWRMDSFVEEQIKAIREKVGNGKVLCALSGGVDSSVAAVLLSKAIGNQLTCVFVDHGLLRKNEGDEVETVFGPDGQYDLNFIRVNAQERYYEKLKGVEEPEAKRKIIGEEFIRVFEEEAKKIGT-VDFLVQGTIYPDVVESGLGGESAVIKSHHNVGGLPDAVDFKEIIEPLRDLFKDEVRKVGLELGIPEYLVFRQPFPGPGLGIRIIGEVTAEKVRIVQDADAIYREEIAK--AGLDRSIGQYFAALTNMRSVGVMGDERTYDHAIALRAVNTIDFMTAEAAQIPYEVLNKVMSRIINEVRGVNRVMYDITSKPPGTIEFE 515
>gi|90416235|ref|ZP_01224167.1| bifunctional GMP synthase/glutamine amidotransferase protein [marine gamma proteobacterium HTCC2207] >gi|90331960|gb|EAS47174.1| bifunctional GMP synthase/glutamine amidotransferase protein [marine gamma proteobacterium HTCC2207] (525 aa)
Score = 1278, Expect = 1.3e-138, Identities = 258/509 (50%), Positives = 350/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSI-KPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-----ELFENIELDN----NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI-NVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R++ V+SEI  +DI+ EEI + NPKGIILSGG +SV G  S  +    ++ + +P+LGICYG Q M  + GG+V+   D  E+G   +++        ++ ++I  D     + WMSH D V+ +P+GF ++AST  C +A   N EKKFYG+QFHPEVT T  G ++ Q+F   IC   G W    I  ++I  +K  V D +VL  +SGGVDS V A L  +AIG +L CVFVD+GLLRKNE   V  +    +G  +   + +  FL  L GV DPE+KRK+IG TFIE+F++ + KI NV F  L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ +  EL+EPL+ LFKDEVRK+G+ L +P+  VYR PFPGPGL VR+LGE+  +  +I+READ +F   I++L+    + K  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LEK+S+ I N++ ++SRV YD+++KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRVREIGVFSEIRAWDITEEEIREFNPKGIILSGGPESVTGGASAPRAPDCVFTMGLPVLGICYGMQTMAGQLGGKVDT-SDVREFGYAQVKVENQSALLRDIKDHIGSDGESLLDVWMSHGDKVVAMPEGFSLMASTPSCPIAGMVNEEKKFYGIQFHPEVTHTLQGERMFQHFALEICGCEGLWTAAAIIEDQIARVKQQVGDSHVLLGLSGGVDSSVVAALLHKAIGAQLTCVFVDNGLLRKNEGDMVMEMFANNMGVKVIRANAQDKFLDGLAGVSDPEKKRKVIGNTFIEIFDEESQKIKNVNF--LAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMALELVEPLRELFKDEVRKIGVELGLPHDMVYRHPFPGPGLGVRILGEVKREYCDILREADAIF---IEELHNFGWYQKTSQAFAVFLPVKSVGVVGDARRYEWVIALRAVETIDFMTARWAHLPYELLEKVSNRIINEISDVSRVAYDVSSKPPATIEWE 525
>gi|62261326|gb|AAX77978.1| unknown protein [synthetic construct] (551 aa)
Score = 1278, Expect = 1.3e-138, Identities = 260/509 (51%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL--TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R++ V+ EI  +D++ + I     KGIILSGG +SVY D  +K  + +++L +P+LGICYG Q M+ ++GG+V+   D  E+G   I +  +TN +F N+E +   WMSHSD V    + F++IAS+    VA+  ++ K F+GVQFHPE T T  G Q+++NFV +IC     W  +NI    I+EIK  V  D V+  +SGGVDS V A +  QAIGD+L C+FVD GLLR NE  +V  +  + +  N+  ++ K  FL  L+G+ DPEQKRKIIGK F+++F++ A KI    K+L QGTIY D++ES G+  SK   IKSHHNVGGLP+ ++ +LLEPL+ LFKDEVRKLGL L +PY  +YR PFPGPGL VR+LGEI ++ +E +++AD +F    ++LYK N  H   Q F V    KSVGVVGD R Y Y +ALRAV S+D M+A W  +P + L  +S+ I N+VK +SRVVYD+T KPPGTIEWE
  S:    34 KILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVY-DSDVKAPEIVFELGVPVLGICYGMQTMVMQHGGEVKG-ADQSEFGKAIINILNSTNNIFSNMEHEQLVWMSHSDKVTQTGEHFEIIASSTNAPVAAVAHKNKPFFGVQFHPETTHTENGKQIIENFVVNICGCDTLWNIENIIENDIKEIKQKVGTDKVILGLSGGVDSSVVAAILHQAIGDQLTCIFVDTGLLRLNEGDQVMQVFAEHMDINVIRINAKNRFLDALRGICDPEQKRKIIGKLFVDIFDEEAAKIENA-KWLAQGTIYSDVIESAGNNQSKAHVIKSHHNVGGLPKEMKLKLLEPLRELFKDEVRKLGLGLGLPYNMLYRHPFPGPGLGVRILGEIKKEYVETLQKADAIF---TEELYKHNLYHDVSQAFGVFLPVKSVGVVGDQRRYEYVIALRAVVSIDFMTATWANLPYDFLSLVSNRIVNEVKQVSRVVYDVTGKPPGTIEWE 542
>gi|115314848|ref|YP_763571.1| bifunctional GMP synthase/glutamine amidotransferase protein [Francisella tularensis subsp. holarctica OSU18] >gi|156502497|ref|YP_001428562.1| bifunctional GMP synthase/glutamine amidotransferase protein [Francisella tularensis subsp. holarctica FTNF002-00] >gi|115129747|gb|ABI82934.1| GMP synthase (glutamine-hydrolyzing) [Francisella tularensis subsp. holarctica OSU18] >gi|156253100|gb|ABU61606.1| GMP synthase(glutamine-hydrolyzing) protein [Francisella tularensis subsp. holarctica FTNF002-00] (516 aa)
Score = 1278, Expect = 1.4e-138, Identities = 260/509 (51%), Positives = 350/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT--TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R++ V+ EI  +D++ + I     KGIILSGG +SVY D  +K  + +++L +P+LGICYG Q M+ ++GG+V+   D  E+G   I +   TN +F N+E +   WMSHSD V    + F++IAS+    VA+  ++ K F+GVQFHPE T T  G Q+++NFV +IC     W  +NI    I+EIK  V  D V+  +SGGVDS V A +  QAIGD+L C+FVD GLLR NE  +V  +  + +  N+  ++ K  FL  L+G+ DPEQKRKIIGK F+++F++ A KI    K+L QGTIY D++ES G+  SK   IKSHHNVGGLP+ ++ +LLEPL+ LFKDEVRKLGL L +PY  +YR PFPGPGL VR+LGEI ++ +E +++AD +F    ++LYK N  H   Q F V    KSVGVVGD R Y Y +ALRAV S+D M+A W  +P + L  +S+ I N+VK +SRVVYD+T KPPGTIEWE
  S:     8 KILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVY-DSDVKAPEIVFELGVPVLGICYGMQTMVMQHGGEVKG-ADQSEFGKAIINILNLTNNIFSNMEHEQLVWMSHSDKVTQTGEHFEIIASSTNAPVAAVAHKNKPFFGVQFHPETTHTENGKQIIENFVVNICGCDTLWNIENIIENDIKEIKQKVGTDKVILGLSGGVDSSVVAAILHQAIGDQLTCIFVDTGLLRLNEGDQVMQVFAEHMDINVIRINAKNRFLDALRGICDPEQKRKIIGKLFVDIFDEEAAKIENA-KWLAQGTIYSDVIESAGNNQSKAHVIKSHHNVGGLPKEMKLKLLEPLRELFKDEVRKLGLGLGLPYNMLYRHPFPGPGLGVRILGEIKKEYVETLQKADAIF---TEELYKHNLYHDVSQAFGVFLPIKSVGVVGDQRRYEYVIALRAVVSIDFMTATWANLPYDFLSLVSNRIVNEVKQVSRVVYDVTGKPPGTIEWE 516
>gi|89256406|ref|YP_513768.1| bifunctional GMP synthase/glutamine amidotransferase protein [Francisella tularensis subsp. holarctica] >gi|167010428|ref|ZP_02275359.1| bifunctional GMP synthase/glutamine amidotransferase protein [Francisella tularensis subsp. holarctica FSC200] >gi|89144237|emb|CAJ79510.1| GMP synthase (glutamine-hydrolyzing) [Francisella tularensis subsp. holarctica LVS] >gi|134253553|gb|EBA52647.1| GMP synthase (glutamine-hydrolyzing) [Francisella tularensis subsp. holarctica 257] (516 aa)
Score = 1278, Expect = 1.4e-138, Identities = 258/509 (50%), Positives = 348/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT--TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKF---SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R++ V+ EI  +D++ + I     KGIILSGG +SVY D  +K  + +++L +P+LGICYG Q M+ ++GG+V+   D  E+G   I +   TN +F N+E +   WMSHSD V    + F++IAS+    VA+  ++ K F+GVQFHPE T T  G Q+++NFV +IC     W  +NI    I+EIK  V  D V+  +SGGVDS V A +  QAIGD+L C+FVD GLLR NE  +V  +  + +  N+  ++ K  FL  L+G+ DPEQKRKIIGK F+++F++ A KI    K+L QGTIY D++ES S     +  IKSHHNVGGLP+ ++ +LLEPL+ LFKDEVRKLGL L +PY  +YR PFPGPGL VR+LGEI ++ +E +++AD +F    ++LYK N  H   Q F V    KSVGVVGD R Y Y +ALRAV S+D M+A W  +P + L  +S+ I N+VK +SRVVYD+T KPPGTIEWE
  S:     8 KILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVY-DSDVKAPEIVFELGVPVLGICYGMQTMVMQHGGEVKG-ADQSEFGKAIINILNLTNNIFSNMEHEQLVWMSHSDKVTQTGEHFEIIASSTNAPVAAVAHKNKPFFGVQFHPETTHTENGKQIIENFVVNICGCDTLWNIENIIENDIKEIKQKVGTDKVILGLSGGVDSSVVAAILHQAIGDQLTCIFVDTGLLRLNEGDQVMQVFAEHMDINVIRINAKNRFLDALRGICDPEQKRKIIGKLFVDIFDEEAAKIENA-KWLAQGTIYSDVIESASNNQSKAHVIKSHHNVGGLPKEMKLKLLEPLRELFKDEVRKLGLGLGLPYNMLYRHPFPGPGLGVRILGEIKKEYVETLQKADAIF---TEELYKHNLYHDVSQAFGVFLPIKSVGVVGDQRRYEYVIALRAVVSIDFMTATWANLPYDFLSLVSNRIVNEVKQVSRVVYDVTGKPPGTIEWE 516
>gi|85712713|ref|ZP_01043758.1| bifunctional GMP synthase/glutamine amidotransferase protein [Idiomarina baltica OS145] >gi|85693445|gb|EAQ31398.1| bifunctional GMP synthase/glutamine amidotransferase protein [Idiomarina baltica OS145] (525 aa)
Score = 1278, Expect = 1.5e-138, Identities = 260/509 (51%), Positives = 347/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARRIR++ VY E+  +D+  ++I   +PKGIILSGG +SV    S +    ++   +P+LG+CYG Q M  + GG V+   +  E+G   I L T   LFE IE          LD   WMSH D V  +P+GF  +A+T+ C  A+  +  ++FYGVQFHPEVT T  G ++L++FV  IC     W P  I  + IE I+  V  D V+  +SGGVDS V A+L  +AIG +L CVFVD+GLLR NE+++V  +     G NI  V  +Q FL  LKG  DPE+KRKIIG TFIE+F++ A+++     +L QGTIYPD++ES GSK  K   IKSHHNVGGLPE ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGEI ++  +++R AD +F   ID+L+K +  HK  Q F V    +SVGV+GD R Y + ++LRAV+++D M+A+W  +P E LEK+S+ I N+V  ISRV YDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRIREIGVYCELWAWDVDEQDIKDFDPKGIILSGGPESVTEAGSPRAPDYVFKAGVPVLGVCYGMQTMAHQLGGSVQGSLE-REFGYAQIELVTESPLFEAIEDAVSEDGKPLLD--VWMSHGDKVEAIPEGFHTVATTSYCPYAAMADESRRFYGVQFHPEVTHTRQGMRMLEHFVSGICGCEKQWTPAQIIEDAIERIREQVGSDKVILGLSGGVDSSVTAMLLHRAIGSQLTCVFVDNGLLRLNEAEQVMEMFGDHFGLNIIPVAAEQRFLDALKGEADPEKKRKIIGNTFIEIFDEQASQL-TEVDWLAQGTIYPDVIESAGSKTGKAHVIKSHHNVGGLPEDMKLGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRADAIF---IDELHKADWYHKVSQAFAVFLPVRSVGVMGDQRKYDWVVSLRAVETIDFMTARWAHLPYELLEKVSNRIINEVDGISRVTYDISGKPPATIEWE 525
>gi|123965271|ref|YP_001010352.1| bifunctional GMP synthase/glutamine amidotransferase protein [Prochlorococcus marinus str. MIT 9515] >gi|123199637|gb|ABM71245.1| Glutamine amidotransferase class-I:GMP synthase [Prochlorococcus marinus str. MIT 9515] (528 aa)
Score = 1277, Expect = 1.7e-138, Identities = 255/508 (50%), Positives = 349/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ILILDFG QY++LIARRIR+ NV+S +V   IS +EI   NP+GIILSGG +SVY D + K ++ I++L IP+LGICYG Q+M++E GG V    +  EYG   I++   ++L  +++  +  WMSH DS+  LP GF  IA T   L A+  N+EKK +GVQFHPEV  + +G  +++NFVYSI     DW  +    E I  IK  V D  VL A+SGGVDS   A L  +AIG +L C+F+D G +RK E + +     K     +  ++ ++ FL KL GV DPE+KRKIIG  FI VFE+ ++++  PF+YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRKLG +L +P + + R PFPGPGLA+R+LGE++ +KL  +R+AD++ R  I +  LY +     WQ F VL   K+VGV+GD R+Y + + LR V S D M+A W +IP E LE+IS+ I N+V  ++RVV+DIT+KPPGTIEWE
  S:    14 ILILDFGSQYSELIARRIREANVFSLVVSNFISTKEIQDINPQGIILSGGPNSVYEDNAPKCDQNIFNLGIPVLGICYGMQLMVKELGGTVTPANNRSEYGRAPIKIDFESDLLSSVKDKSIMWMSHGDSINHLPNGFIKIAHTENTLHAAISNKEKKLFGVQFHPEVIHSEYGMTVIKNFVYSISKCKADWNTETFLEETIPRIKEQVGDKKVLLALSGGVDSSTLAFLLNKAIGKQLTCMFIDQGFMRKGEPEFLMEFFAKKFHIKVEYINARERFLHKLNGVTDPEEKRKIIGGEFIRVFEEESHRLG-PFEYLAQGTLYPDVIESAGTNLDPKTGERIAVKIKSHHNVGGLPKDLQFKLVEPLRKLFKDEVRKLGNALGLPDEIIKRHPFPGPGLAIRILGEVSIEKLNCLRDADWIVRDEIKKAGLYNDI----WQAFAVLLPVKTVGVMGDKRTYAWPVVLRCVSSEDGMTADWSRIPYETLERISNRIVNEVAQVNRVVFDITSKPPGTIEWE 528
>gi|91784093|ref|YP_559299.1| bifunctional GMP synthase/glutamine amidotransferase protein [Burkholderia xenovorans LB400] >gi|91688047|gb|ABE31247.1| GMP synthase (glutamine-hydrolyzing) [Burkholderia xenovorans LB400] (527 aa)
Score = 1277, Expect = 1.9e-138, Identities = 258/510 (50%), Positives = 342/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNN--------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLF----RSYIDQLYKNSEHKPW-----QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKILILDFG Q TQLIARR+R+ NVYSEI  YD+    I    PKG+ILSGG  SV    + +  + +++L +P+LGICYG Q M ++ GG+V+      E+G  ++R   +  L E I              WMSH D V+ +P GF ++AST  C +A+  +  + FYG+Q+HPEVT T  G  +L+ FV  IC    DWE  +   E + +I+  V  ++V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR NE+++V A     +G  +  VD  ++FL KL GV DPE KRKIIG  F+EVF+  A K+    K+L QGTIYPD++ES   G K ++TIKSHHNVGGLPE L  +LLEPL+ LFKDEVR+LG+ L +P   VYR PFPGPGL VR+LGE+  D  +++R AD +F    R++ID+       K W     Q F V    KSVGV+GD R+Y Y +ALRAV ++D M+A W  +P E L  +S+ I N+V+ I+RVVYDI+ KPP TIEWE
  S:     3 DKILILDFGSQVTQLIARRVREANVYSEIHPYDVDASFIRDFAPKGVILSGGPSSVTETDTPRVPQAVFELGVPVLGICYGMQAMAEQLGGKVDIGH-LREFGYAEVRARNHTSLLEGISDFTTPEGHGMLKVWMSHGDKVLEMPPGFALMASTESCPIAAMADETRHFYGLQWHPEVTHTVQGRAMLERFVLKICGAQPDWEMGHYIDEAVAKIREQVGQEHVILGLSGGVDSSVAAALLHRAIGDQLTCVFVDHGLLRLNEAEQVMATFADHLGVKVIHVDASEVFLRKLAGVTDPEAKRKIIGAEFVEVFQTEAGKL-TDAKWLAQGTIYPDVIESAGKGKKATQTIKSHHNVGGLPETLNLKLLEPLRELFKDEVRELGVKLGLPPAMVYRHPFPGPGLGVRILGEVKRDFADLLRRADAIFIETLRTFIDK----ETGKSWYDLTSQAFAVFLPVKSVGVMGDGRTYEYVVALRAVQTLDFMTAHWAHLPHELLGHVSNRIINEVRGINRVVYDISGKPPATIEWE 527
>gi|113969579|ref|YP_733372.1| bifunctional GMP synthase/glutamine amidotransferase protein [Shewanella sp. MR-4] >gi|117919685|ref|YP_868877.1| bifunctional GMP synthase/glutamine amidotransferase protein [Shewanella sp. ANA-3] >gi|113884263|gb|ABI38315.1| GMP synthase, large subunit [Shewanella sp. MR-4] >gi|117612017|gb|ABK47471.1| GMP synthase, large subunit [Shewanella sp. ANA-3] (525 aa)
Score = 1277, Expect = 1.9e-138, Identities = 257/509 (50%), Positives = 350/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIR-LTTNELFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARRIR++ VY E+  +D++  +I +  P GIIL+GG +SV  D S +  + +++  +P+LGICYG Q M ++ GG+V       E+G   I  L  + LF++IE          LD   WMSH D V  +P+GF  +A T+ C  A+    EK+FYGVQFHPEVT T  G ++L +F   IC  A +W+P +I  + IE +K  V DD V+  +SGGVDS V A+L  +AIG KL CVFVD+GLLR NE+++V  +     G NI  VD +  FL  LKG  DPE KRKIIG+ F+E+F++ A K  V  K+L QGTIYPD++ES GS   K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+K +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N++  ISRVVYDI+ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTADNSPRAPEYVFNAGVPVLGICYGMQTMSEQLGGKVIQGVGEGEFGYAQIEMLAQSALFKDIEDAVSADGKSLLD--VWMSHGDKVSAIPEGFVAVAKTDTCPFAAMSCEEKRFYGVQFHPEVTHTRQGMRMLSHFALDICGCAANWKPSSIIEDAIERLKKQVGDDEVILGLSGGVDSSVVAMLLHRAIGKKLTCVFVDNGLLRLNEAKQVMEMFGDHFGLNIVHVDAENRFLDALKGEADPEAKRKIIGRVFVEIFDEEAKKC-VNAKWLAQGTIYPDVIESAGSATGKAHVIKSHHNVGGLPDDMELGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEIDGISRVVYDISGKPPATIEWE 525
>gi|83647621|ref|YP_436056.1| bifunctional GMP synthase/glutamine amidotransferase protein [Hahella chejuensis KCTC 2396] >gi|83635664|gb|ABC31631.1| GMP synthase, PP-ATPase domain/subunit [Hahella chejuensis KCTC 2396] (526 aa)
Score = 1277, Expect = 2.0e-138, Identities = 257/509 (50%), Positives = 355/509 (69%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE--LFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFS---KTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS-EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY EI  +D+S  +I + NPKG+IL+GG +SV    S +  + ++++++P+LGICYG Q M ++ GG+V    +  E+G   +++  +E  LFENI+          LD   WMSH D V+ LP+GF + AST    +A+  +  K ++GVQFHPEVT T  G ++L+ F+ +IC     W P  I  + I ++++ V  D VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E  +V  +  K +G  +   + +  FLSKL G  DPE+KRKIIG TFIEVF+  A KI    K+L QGTIYPD++ES +  +     IKSHHNVGGLPE ++ +L+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +I+READ +F   I++L++    HK  Q F V    KSVGVVGD R Y Y +ALRAV+++D M+A+W  +P E LEKIS+ I N++  +SRVVYD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCEIYPFDMSEADIREFNPKGVILAGGPESVTELGSPRAPECLFNMDLPLLGICYGMQTMAEQMGGKVAG-SNVREFGYAQVKIERSEDGLFENIKDHVAEDGKPLLD--VWMSHGDKVVALPEGFVISASTPSAPIAAMQHESKPWFGVQFHPEVTHTLQGRRMLERFLVNICGCKQLWTPGRIIEDAITQVRNQVGQDKVLLGLSGGVDSSVVAALLHRAIGDQLTCVFVDNGLLRLHEGDQVMDMFAKNMGIKVVRANAQDQFLSKLAGENDPERKRKIIGHTFIEVFDAEAAKIK-DVKWLAQGTIYPDVIESAAAKTGKAHVIKSHHNVGGLPEDMEMQLVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADILREADAIF---IEELHRAELYHKVSQAFAVFLPVKSVGVVGDARRYEYVIALRAVETIDFMTARWAHLPYELLEKISNRIINEISGVSRVVYDVSSKPPATIEWE 526
>gi|167770355|ref|ZP_02442408.1| hypothetical protein ANACOL_01698 [Anaerotruncus colihominis DSM 17241] >gi|167667677|gb|EDS11807.1| hypothetical protein ANACOL_01698 [Anaerotruncus colihominis DSM 17241] (510 aa)
Score = 1276, Expect = 2.1e-138, Identities = 255/508 (50%), Positives = 338/508 (66%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFL--VDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I++LDFGGQY QLIARR+R+ +VY E++ Y   +EEII K P GII +GG +SVY D S + ++ I++  IP+LGICYG Q+M    GG V +  D+ EYG T     T   LF+ +      WMSH+D +  LP GF   A T++C  A+  +   K YG+Q HPEV  T  G  +L+NF+Y +C   GDW   +     I+ ++  +    VL A+SGGVDS VAA L ++A+G +L C+FVDHGL+RKNE  EV A       ++I    V+  + FL KL GV DPE+KRKIIG+ FI VFE+ A KI     YL QGTIYPD++ESG+  +  IKSHHNVGGLP+ + F E++EPL+ LFKDE R LG  L +P   V RQPFPGPGLA+R++GEIT +K+ I++ AD +FR+ I       E    QYF VLT+ +SVGV+GD R+Y YTLALR V + D M+A W +IP E L+ IS  I N+V+ I+R+VYDIT+KPP TIEWE
  S:     6 IVVLDFGGQYNQLIARRVRECSVYCEVLPYRTPLEEIIAKKPIGIIFTGGPNSVYADNSPRIDRAIFEQGIPVLGICYGIQLMAYTLGGHVVS-PDTREYGKTITYYDTECVLFKGLPKQGISWMSHTDYIDALPAGFTATAHTDRCPTAAMQDPVHKLYGLQMHPEVLHTENGIAMLRNFLYEVCGAMGDWTMGDYAQTAIDALRHKIGSGKVLLALSGGVDSSVAAALLSRAVGKQLTCIFVDHGLMRKNEGDEVEAAFAD---RDIHFVRVNAGERFLGKLAGVDDPERKRKIIGEEFIRVFEEEAKKIG-HVDYLAQGTIYPDVIESGAGDAAVIKSHHNVGGLPDYVDFKEIVEPLRLLFKDETRALGRELGLPDYLVDRQPFPGPGLAIRIIGEITPEKVSILQNADAIFRAEIAN--AGLERDIHQYFAVLTSMRSVGVMGDGRTYDYTLALRGVTTTDFMTADWARIPFETLDLISRRIVNEVRGINRIVYDITSKPPATIEWE 510
>gi|167623309|ref|YP_001673603.1| bifunctional GMP synthase/glutamine amidotransferase protein [Shewanella halifaxensis HAW-EB4] >gi|167353331|gb|ABZ75944.1| GMP synthase, large subunit [Shewanella halifaxensis HAW-EB4] (525 aa)
Score = 1276, Expect = 2.2e-138, Identities = 254/509 (49%), Positives = 353/509 (69%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSKT--IKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARRIR++ VY E+  +D+S E+I +  P GIIL+GG +SV  + S +  + +++  +P+LGICYG Q M ++ GG+V       E+G   + + T + LF+ IE          LD   WMSH D V  +P+GF  +A T  C  A+  N +K+FYGVQFHPEVT T  G ++L++F   IC  A +W+P +I  + IE +K+ + DD V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE+++V  +     G NI  VD +  FL  + G  +PE KRKIIG+ F+E+F++ + K  V  K+L QGTIYPD++ES GS   K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+K +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRIREIGVYCELWAWDVSEEQIREFAPNGIILAGGPESVTAENSPRAPEYVFNAGVPVLGICYGMQTMSEQLGGKVIQGVGEGEFGYAQVEVQTESALFKAIEDAVSETGKPLLD--VWMSHGDKVSAIPEGFVAVAKTETCPFAAMANEDKQFYGVQFHPEVTHTRQGKRMLEHFALEICACAANWKPASIIEDAIERLKAQIGDDEVILGLSGGVDSSVVAMLLHRAIGDKLTCVFVDNGLLRLNEAEQVMEMFGDHFGLNIVHVDAENRFLDAMAGEAEPEAKRKIIGRVFVEIFDEESKKC-VNAKWLAQGTIYPDVIESAGSATGKAHCIKSHHNVGGLPDDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRLADAIF---IEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 525
>gi|27363886|ref|NP_759414.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio vulnificus CMCP6] >gi|31340140|sp|Q8DF07|GUAA_VIBVU GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|27360003|gb|AAO08941.1|AE016798_101 GMP synthase, PP-ATPase domain/subunit [Vibrio vulnificus CMCP6] (517 aa)
Score = 1276, Expect = 2.3e-138, Identities = 251/509 (49%), Positives = 350/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLY-KNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARR+R++ VY E+  +D+   +I + NP GIILSGG +SV  D S +  + ++D  +P+LG+CYG Q M ++ GG+V    D  E+G   ++++  + +F+++E   + WMSH D V+ +P GF  +  T+ C  A+  N EKK+YGVQFHPEVT T  G Q+L+NFV  IC     W  ++I  + +  IK  V DD V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE Q+V  +     G NI  VD ++ FL  L+G  DPE+KRK IG  F++VF++ + K+    K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY+ +YR PFPGPGL VRVLGEI ++  +++R AD +F   I++L+  +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L K+S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEDNSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGKVST-SDEREFGYAAVKVSGESAIFKDLEATQDVWMSHGDKVVEIPAGFTKVGETDTCPYAAMANEEKKYYGVQFHPEVTHTKNGLQMLENFVLGICGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAMLVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEERFLKALEGKSDPEEKRKTIGHVFVDVFDEESKKLKNA-KWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMEMGLVEPLRELFKDEVRKIGLELGLPYEMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRADAIF---IEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517
>gi|57241821|ref|ZP_00369765.1| GMP synthase, C-terminal domain protein [Campylobacter lari RM2100] >gi|57017461|gb|EAL54239.1| GMP synthase, C-terminal domain protein [Campylobacter lari RM2100] (511 aa)
Score = 1276, Expect = 2.5e-138, Identities = 254/508 (50%), Positives = 348/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG-SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QYTQLIARR+R+  VY+EI+ +++S++EI  K PKGIILSGG  SVY + +   +KG++DLNIP+LGICYG Q+M    G  V      +EYG   I +  + +LF+N+      WMSHSD V  LP+GF+V+A++         + ++KF+ +QFHPEV  + FG  +L+NF    C+    W   +    + ++IK  V +D VLCA+SGGVDS V A L A AI D++  VFVD+GLLR  E ++V  + K  +G ++  +D +++FLS+L GV DPEQKRKIIG TFIEVFE+ A K +   KYL QGT+Y DI+ES     SKTIKSHHNVGGLPE++  +L+EPLK +FKDEVR LG+ L +    VYR PFPGPGLA+R++GE+ E  LE++R+AD +    I++L  +  + K WQ F VL N +SVGV+GDNR+Y   + +R V++ D M+A +  +P E LE IS  I N+V  I+RVVYDI++KPP TIEWE
  S:     6 ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLDEIKAKEPKGIILSGGPASVYANDAYFCDKGVFDLNIPVLGICYGMQLMAHHFGANVA-PAGHKEYGKATIDIQNDSDLFKNLPKKQTVWMSHSDKVENLPQGFEVLATSENSPFCVFGDEKRKFFALQFHPEVQHSEFGKSILKNFAKYACNCDSVWNMGSFAKTQAQKIKEEVGNDKVLCAVSGGVDSSVVAALLASAIKDQVVVVFVDNGLLRSGEKEQVEYMFKHTLGIDLISIDAREIFLSRLAGVRDPEQKRKIIGNTFIEVFEEEAKK-HKDVKYLAQGTLYTDIIESSVVGASKTIKSHHNVGGLPEKMNLKLIEPLKEIFKDEVRALGMELGLSKDVVYRHPFPGPGLAIRIMGEVNEPSLELLRKADVIL---IEELKSSGWYDKTWQAFCVLLNVQSVGVMGDNRTYDNAVCVRVVNASDGMTATFSHLPYELLENISRRIINEVNGINRVVYDISSKPPATIEWE 511
>gi|24374803|ref|NP_718846.1| bifunctional GMP synthase/glutamine amidotransferase protein [Shewanella oneidensis MR-1] >gi|44887962|sp|Q8EC52|GUAA_SHEON GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|24349480|gb|AAN56290.1|AE015766_6 GMP synthase [Shewanella oneidensis MR-1] (525 aa)
Score = 1276, Expect = 2.6e-138, Identities = 258/509 (50%), Positives = 348/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIR-LTTNELFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARRIR++ VY E+  +D++  +I +  P GIIL+GG +SV  D S +  + +++  +P+LGICYG Q M ++ GG+V       E+G   I  L  + LF+ IE          LD   WMSH D V  +P GF  +A T+ C  A+    EK+FYGVQFHPEVT T  G ++L +F   IC  A +W+P +I  + IE +K  V DD V+  +SGGVDS V A+L  +AIG KL CVFVD+GLLR NE+++V  +     G NI  VD +  FL  LKG  DPE KRKIIG+ F+E+F++ A K  V  K+L QGTIYPD++ES GS   K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+K +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTADNSPRAPEYVFNAGVPVLGICYGMQTMSEQLGGKVIQGVGEGEFGYAQIEMLAESALFKGIEDAVSSDGKSLLD--VWMSHGDKVSAIPAGFVAVAKTDTCPFAAMSCEEKRFYGVQFHPEVTHTRQGMRMLSHFALDICGCAANWKPSSIIEDAIERLKKQVGDDEVILGLSGGVDSSVVAMLLHRAIGKKLTCVFVDNGLLRLNEAKQVMEMFGDHFGLNIVHVDAENRFLDALKGEADPEAKRKIIGRVFVEIFDEEAKKC-VNAKWLAQGTIYPDVIESAGSATGKAHVIKSHHNVGGLPDDMELGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVDGISRVVYDISGKPPATIEWE 525
>gi|114562316|ref|YP_749829.1| bifunctional GMP synthase/glutamine amidotransferase protein [Shewanella frigidimarina NCIMB 400] >gi|114333609|gb|ABI70991.1| GMP synthase, large subunit [Shewanella frigidimarina NCIMB 400] (525 aa)
Score = 1275, Expect = 2.8e-138, Identities = 256/509 (50%), Positives = 348/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARRIR++ VY E+  +D+S  +I +  P GIIL+GG +SV  D S +  + +++  +P+LGICYG Q M ++ GG+V       E+G   I L TT+ LF++IE          LD   WMSH D V  +P GF  +A T  C  A+  N EK FYGVQFHPEVT T  G ++L++F   IC    +W+P +I  + IE +K  + DD V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE+++V  +     G NI  VD +  FL  + G  +PE KRKIIG+ F+E+F++ + K     K+L QGTIYPD++ES GS   K   IKSHHNVGGLP  ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+K +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRIREIGVYCELWAWDVSEAQIREFAPNGIILAGGPESVTADNSPRAPEYVFNAGVPVLGICYGMQTMSEQLGGKVIQGVGEGEFGYAQIELQTTSALFKSIEDAVSAEGKPLLD--VWMSHGDKVSAIPDGFVTVAKTATCPFAAMANEEKGFYGVQFHPEVTHTRQGQRMLEHFALDICGCKANWKPSSIIEDAIERLKKQIGDDEVILGLSGGVDSSVVAMLLHRAIGDKLTCVFVDNGLLRLNEAEQVLEMFGDHFGLNIVHVDAENRFLDAMAGEAEPEAKRKIIGRVFVEIFDEESKKC-ANAKWLAQGTIYPDVIESAGSATGKAHVIKSHHNVGGLPADMKMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRSADAIF---IEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVDGISRVVYDISGKPPATIEWE 525
>gi|114046812|ref|YP_737362.1| bifunctional GMP synthase/glutamine amidotransferase protein [Shewanella sp. MR-7] >gi|113888254|gb|ABI42305.1| GMP synthase, large subunit [Shewanella sp. MR-7] (525 aa)
Score = 1275, Expect = 2.9e-138, Identities = 255/509 (50%), Positives = 349/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIR-LTTNELFENIELDNN--------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARRIR++ VY E+  +D++  +I +  P GIIL+GG +SV  D S +  + +++  +P+LGICYG Q M ++ GG+V       E+G   I  L  + LF++IE   N         WMSH D V  +P+GF  +A T+ C  A+    EK+FYGVQFHPEVT T  G ++L +F   IC  A +W+P +I  + IE +K  V DD V+  +SGGVDS V A+L  +AIG KL CVFVD+GLLR NE+++V  +     G NI  +D +  FL  LKG  DPE KRKIIG+ F+E+F++ A K  V  K+L QGTIYPD++ES GS   K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+K +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N++  ISRVVYDI+ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTADNSPRAPEYVFNAGVPVLGICYGMQTMSEQLGGKVIQGVGEGEFGYAQIEMLAQSALFKDIEDAVNSDGKSLLDVWMSHGDKVSAIPEGFVAVAKTDTCPFAAMSCEEKRFYGVQFHPEVTHTRQGMRMLSHFALDICGCAANWKPSSIIEDAIERLKKQVGDDEVILGLSGGVDSSVVAMLLHRAIGKKLTCVFVDNGLLRLNEAKQVMEMFGDHFGLNIVHIDAENRFLDALKGEADPEAKRKIIGRVFVEIFDEEAKKC-VNAKWLAQGTIYPDVIESAGSATGKAHVIKSHHNVGGLPDDMELGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEIDGISRVVYDISGKPPATIEWE 525
>gi|37678960|ref|NP_933569.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio vulnificus YJ016] >gi|44887991|sp|Q7MNE1|GUAA_VIBVY GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|37197702|dbj|BAC93540.1| GMP synthase [Vibrio vulnificus YJ016] (517 aa)
Score = 1275, Expect = 2.9e-138, Identities = 250/509 (49%), Positives = 350/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLY-KNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARR+R++ VY E+  +D+   +I + NP GIILSGG +SV  D S +  + ++D  +P+LG+CYG Q M ++ GG+V    D  E+G   ++++  + +F+++E   + WMSH D V+ +P GF  +  T+ C  A+  N EKK+YGVQFHPEVT T  G Q+L+NFV  +C     W  ++I  + +  IK  V DD V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE Q+V  +     G NI  VD ++ FL  L+G  DPE+KRK IG  F++VF++ + K+    K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY+ +YR PFPGPGL VRVLGEI ++  +++R AD +F   I++L+  +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L K+S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEDNSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGKVST-SDEREFGYAAVKVSGESAIFKDLEATQDVWMSHGDKVVEIPAGFTKVGETDTCPYAAMANEEKKYYGVQFHPEVTHTKNGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAMLVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEERFLKALEGKSDPEEKRKTIGHVFVDVFDEESKKLKNA-KWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMEMGLVEPLRELFKDEVRKIGLELGLPYEMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRADAIF---IEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517
>gi|119476442|ref|ZP_01616793.1| bifunctional GMP synthase/glutamine amidotransferase protein [marine gamma proteobacterium HTCC2143] >gi|119450306|gb|EAW31541.1| bifunctional GMP synthase/glutamine amidotransferase protein [marine gamma proteobacterium HTCC2143] (526 aa)
Score = 1275, Expect = 3.0e-138, Identities = 252/509 (49%), Positives = 354/509 (69%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIE--LDN-------NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS-KFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLY-KNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VYSE+  +D+  +EI    P+GIIL+GG +SV   +S +    +++L +P+LGICYG Q M ++ GG+V +  +  E+G   I++  ++ L  +I+  +D+       + WMSH D V  +P  F+++AST  C +A   + EK FYG+QFHPEVT T  G ++ ++FV  +CD    W P NI  + ++ ++S+V  D VL  +SGGVDS V A L  +AIG +L CVFVD+GLLRKNE  +V  +  K +G  +   D   +FL  L G  DPE+KRKIIG TFI++F++ A  I     +L QGTIYPD++ES + K  K   IKSHHNVGGLP+ +QF+L+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +I+READ +F   +++L+  +  HK  Q F V    KSVGVVGD R Y Y +ALRAV+++D M+A+W  +P E LEK+S+ I N++  ISRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYSEVRAFDMDADEIKAFQPRGIILAGGPESVTEGQSPRAPAIVFELGVPVLGICYGMQTMAEQLGGKVAS-SELREFGYAQIKVQGSSALLHDIKDHVDSKDGAALLDVWMSHGDKVSEMPVDFQLMASTESCPIAGMYHPEKNFYGIQFHPEVTHTLQGKRIFEHFVLELCDCDVLWTPANIVEDAVDTVRSLVGTDKVLLGLSGGVDSSVVAALLHRAIGSQLTCVFVDNGLLRKNEGDQVMDMFAKNMGVKVIRADAADIFLGNLVGESDPEKKRKIIGNTFIDIFDQQAALIQ-DVNWLAQGTIYPDVIESAAGKTGKAHVIKSHHNVGGLPDDMQFKLIEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADILREADAIF---LEELHAADWYHKTSQAFVVFLPVKSVGVVGDGRRYEYVVALRAVETVDFMTARWAHLPYELLEKVSNRIINEISGISRVAYDVSSKPPATIEWE 526
>gi|119775492|ref|YP_928232.1| bifunctional GMP synthase/glutamine amidotransferase protein [Shewanella amazonensis SB2B] >gi|119767992|gb|ABM00563.1| GMP synthase [Shewanella amazonensis SB2B] (525 aa)
Score = 1274, Expect = 4.0e-138, Identities = 256/509 (50%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIR-LTTNELFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARRIR++ VY E+  +D++  +I +  P GI+L+GG +SV  D S +  + ++D  +P+LGICYG Q M ++ GG+V       E+G   +  LT + L  +IE          LD   WMSH D V  +P+GF  +A T  C  A   N +KKFYGVQFHPEVT T  G ++L++FV  IC     W+P +I  + +E IK+ V DD V+  +SGGVDS V A+L  +AIG++L CVFVD+GLLR NE+++V  +     G NI  VD +  FL  LKG  DPE KRKIIG+ F+E+F++ A+K  V  K+L QGTIYPD++ES GS   K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L++ +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIVLAGGPESVTEDNSPRAPEYVFDAGVPVLGICYGMQTMSEQLGGKVIQGVGEREFGYAQVEVLTDSALLRHIEDGISDAGKPVLD--VWMSHGDKVSAIPEGFVAVAKTETCPFAVMANEDKKFYGVQFHPEVTHTRQGKRMLEHFVMDICGCDNKWQPASIIEDAVERIKAQVGDDEVILGLSGGVDSSVTAMLLHRAIGERLTCVFVDNGLLRLNEAKQVLEMFGDHFGLNIVHVDAENRFLEALKGENDPEAKRKIIGRVFVEIFDEEASKC-VNAKWLAQGTIYPDVIESAGSATGKAHVIKSHHNVGGLPDDMELGLVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHRADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVDGISRVVYDISGKPPATIEWE 525
>gi|104783362|ref|YP_609860.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pseudomonas entomophila L48] >gi|95112349|emb|CAK17076.1| GMP synthetase (glutamine aminotransferase) [Pseudomonas entomophila L48] (525 aa)
Score = 1274, Expect = 4.3e-138, Identities = 253/509 (49%), Positives = 346/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY E+  +D+  E I + NP+GIIL+GG +SV+   S +  + ++DL +P+LGICYG Q M ++ GG+VE   D  E+G   + +   + L + IE        L  + WMSH D V  +P  F V+AST  C +A   +    +YGVQFHPEVT T  G ++L  FV  IC     W   NI  + I ++++ V    VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E  +V A+ K+ +G  +   D ++ FL  L+G  DPE+KRKIIG+TFI+VF+  A+K+    ++L QGTIYPD++ES G+K  K   IKSHHNVGGLPE +  +L+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +I+R AD +F   I++L K +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LE +S  I N++  ISRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFNPRGIILAGGPESVHEANSPRAPQAVFDLKVPVLGICYGMQTMAEQMGGKVEG-SDLREFGYARVDVVGKSRLLDGIEDHVDDDGVLGLDVWMSHGDKVTQMPGNFSVLASTPSCPIAGMYDDALGYYGVQFHPEVTHTKQGGRILSRFVQDICGCEALWTASNIVEDAIAQVRAQVGSANVLLGLSGGVDSSVVAALLHRAIGDQLTCVFVDNGLLRLHEGDQVMAMFKENMGVKVIRADAEKQFLDNLEGEADPEKKRKIIGRTFIDVFDAEASKLE-NIQFLAQGTIYPDVIESAGAKSGKAHVIKSHHNVGGLPEEMNLKLVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADILRRADHIF---IEELRKADWYHKTSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETVDFMTARWAHLPYELLETVSGRIINEIDGISRVTYDVSSKPPATIEWE 525
>gi|145225479|ref|YP_001136157.1| bifunctional GMP synthase/glutamine amidotransferase protein [Mycobacterium gilvum PYR-GCK] >gi|145217965|gb|ABP47369.1| GMP synthase (glutamine-hydrolyzing) [Mycobacterium gilvum PYR-GCK] (522 aa)
Score = 1274, Expect = 4.4e-138, Identities = 242/508 (47%), Positives = 338/508 (66%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFE-------KVANKINVPFKYLLQGTIYPDIVES-GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +LI+DFG QY QLIARR+R+  V+SE++ +  SIEEI  ++P+ ++LSGG  SVY D + + +  ++DL+IP+ GICYGFQ M Q  GG V     SE YG T++++   EL  ++      WMSH D+V   P GF+V+A++    VA+  NR ++  GVQ+HPEV  +  G Q+L  F++    +   W P NI    +E++++ + D   +C +SGGVDS VAA L  +AIGD+L CVFVDHGLLR  E  +V        G N+  VD    FL  L GV +PE KRKIIG+ FI  FE       + ++  +VP ++L+QGT+YPD+VES G   +  IKSHHNVGGLP+ L+F L+EPL+ LFKDEVR +G  L +P + V RQPFPGPGL +R++GE+T D+L+ +R AD + R  +       +H+ WQ   V L + +SVGV GD R+YG+ + LR V S DAM+A W ++P E LE+IS+ I N+V  ++RVV DIT+KPPGTIEWE
  S:     9 VLIVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIKARDPRAVVLSGGPSSVYADGAPQLDPALFDLDIPVFGICYGFQAMAQALGGTVARTGTSE-YGRTELKVAGGELHSDLPEVQPVWMSHGDAVTEAPSGFEVVATSVGAPVAAFENRARRLAGVQYHPEVMHSPHGQQVLSRFLHEFAGIDAAWTPANIAEALVEQVRNQIGDGRAICGLSGGVDSAVAAALVQRAIGDRLTCVFVDHGLLRAGERAQVQRDFVAATGANLVTVDVADRFLEALSGVTNPEGKRKIIGREFIRAFEGAVRDTVERSDGSDVPVEFLVQGTLYPDVVESGGGSGTANIKSHHNVGGLPDDLKFALVEPLRLLFKDEVRAVGRELGLPEEIVARQPFPGPGLGIRIIGEVTSDRLDTLRRADVIAREELTA--AGLDHQIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWTRVPYEVLERISTRITNEVPEVNRVVLDITSKPPGTIEWE 522
>gi|126695374|ref|YP_001090260.1| bifunctional GMP synthase/glutamine amidotransferase protein [Prochlorococcus marinus str. MIT 9301] >gi|126542417|gb|ABO16659.1| Glutamine amidotransferase class-I:GMP synthase [Prochlorococcus marinus str. MIT 9301] (528 aa)
Score = 1274, Expect = 4.4e-138, Identities = 256/508 (50%), Positives = 352/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ILILDFG QY++LIARRIR+ NV+S +V   ISIE+I   NPKGIILSGG +SVY   + K +K I++L IPILGICYG Q+M++E GG V +     EYG   I +   ++L  ++E  +  WMSH DS+  LP GF  IA T   L A+  N  KK +GVQFHPEV  + FG ++++NFVY+I     DW  +    E I  I+  V +  VL A+SGGVDS   A L  +AIG++L C+F+D G +RK E + +     K     +  ++ ++ F++KLKG+ DPEQKRKIIG+ FI VFE+ +N++  PF+YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRK+G +L +P + + R PFPGPGLA+R+LGE+  +KL+ +R+AD++ R  I +  LY +     WQ F VL   K+VGV+GD R+Y + + LR V S D M+A W KIP + LE+I++ I N+V +++RVVYDIT+KPPGTIEWE
  S:    14 ILILDFGSQYSELIARRIRETNVFSLVVSNCISIEDINDINPKGIILSGGPNSVYEQNAPKCDKKIFNLGIPILGICYGMQLMVKELGGSVISATKKAEYGRAPINIDQESDLLRDVEDKSIMWMSHGDSINCLPDGFNKIAHTENTLHAAISNDIKKLFGVQFHPEVVHSEFGMKIIKNFVYNISCCEADWTTETYIEETIPRIREQVGNKKVLLALSGGVDSSTLAFLLNKAIGNQLTCMFIDQGFMRKGEPEFLMNFFDKKFHIKVEYINARERFIAKLKGITDPEQKRKIIGEEFIRVFEEESNRLG-PFQYLAQGTLYPDVIESAGTNIDPKTGERIAVKIKSHHNVGGLPKDLQFKLVEPLRKLFKDEVRKVGGALGLPDEIIKRHPFPGPGLAIRILGEVNNEKLDCLRDADWIVRDEIKKAGLYNDI----WQAFAVLLPVKTVGVMGDKRTYAWPIVLRCVSSEDGMTADWSKIPFKILERIANRIVNEVISVNRVVYDITSKPPGTIEWE 528
>gi|160894878|ref|ZP_02075652.1| hypothetical protein CLOL250_02428 [Clostridium sp. L2-50] >gi|156863309|gb|EDO56740.1| hypothetical protein CLOL250_02428 [Clostridium sp. L2-50] (587 aa)
Score = 1273, Expect = 5.9e-138, Identities = 258/508 (50%), Positives = 348/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALL--KKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I++LDFGGQY QLIARR+R+ NVY+E+  Y +SI+EI K NPKGII +GG +SVY   S   +K I++L IPILGICYG Q+M    GG+V     SE YG T++ +  N  LF+++     CWMSH+D +   P+GF   A+T  C  A+  N EK  Y  QFHPEV  T  G ++L+ FV  +C  +GDW+  +   + I+ ++  + +  VLCA+SGGVDS VAAVL ++A+G +L CVFVD GLLRKNE  EV A+         N   V+ +  F  KL GVV+PE KRKIIG+ FI VFE+ A KI     +L+QGTIYPD++ESG   S TIKSHHNVGGLP+ + F E++EPL+ LFKDEVRK G  L IP   V RQPFPGPGL +R++GE+T +K++IV++AD+++R  I +     +    QYF  LTN +SVGV+GD R+Y Y +ALRAV + D M+A    IP E L+++ + I N+VK ++RV+YD+T+KPPGTIE+E
  S:    80 IIVLDFGGQYNQLIARRVRECNVYAEVHPYTMSIDEIKKMNPKGIIFTGGPNSVYKADSPSYSKEIFELGIPILGICYGSQLMAHVLGGKVATAPVSE-YGRTEVTVDKNSILFKDVNKSTICWMSHTDYIAEAPEGFVSTATTPNCPFAAMENAEKNLYATQFHPEVMHTEEGMKMLRAFVMDVCKCSGDWKMDSFVEDTIKSLREKIGNGKVLCALSGGVDSSVAAVLLSKAVGKQLTCVFVDQGLLRKNEGDEVEAVFGPDGPYDLNFIRVNAQDRFYQKLAGVVEPEAKRKIIGEEFIRVFEEEAKKIGA-VDFLVQGTIYPDVIESGLGKSATIKSHHNVGGLPDYVDFKEIVEPLRLLFKDEVRKAGRELGIPEYLVSRQPFPGPGLGIRIVGEVTAEKVKIVQDADYIYREEIAK--AGLDKGLGQYFAALTNMRSVGVMGDERTYDYAVALRAVCTSDFMTADCADIPFEVLQRVMTRIINEVKGVNRVMYDLTSKPPGTIEFE 587
>gi|110600017|ref|ZP_01388247.1| GMP synthase, C-terminal domain:GMP synthase, N-terminal domain [Geobacter sp. FRC-32] >gi|110549318|gb|EAT62514.1| GMP synthase, C-terminal domain:GMP synthase, N-terminal domain [Geobacter sp. FRC-32] (520 aa)
Score = 1273, Expect = 6.1e-138, Identities = 259/510 (50%), Positives = 342/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDI--RLTTNELFENIELDNN--CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLY-KNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KILILDFG QYTQLIARR+R+ +VY E+  +D+ +  I    P GIILSGG  SVY + +    + +++L +P+LGICYG Q+M +  GG+V       E+G  ++  + T   LF+   LD     WMSH D V  +P+GF+V A T    V +  N     YGVQFHPEV  T  G QL+  FV  IC  +G W P  I  + +  IK  V  D V+  +SGGVDS VAA L  +AIG++L CVFVD+GLLR  E  +V A   + +G  +  VD +  FLS L GV DPE+KRKIIG  F+E+FE+ +NKI    ++L QGTIYPD++ES G+K  K   IKSHHNVGGLPE ++ +LLEPL+ LFKDEVR +G  L +P+Q V+R PFPGPGL VR+LGE+ +D  +I+R+AD +   YI++LY  +  HK  Q F V    KSVGV+GD R+Y Y +ALRAV++ D M+A WY +P E L +ISS I N+VK I+RVVYDI++KPP TIEWE
  S:     8 EKILILDFGSQYTQLIARRVREAHVYCELHPFDLELAAIRSFAPSGIILSGGPKSVYEEGAPAVAEELFELGVPVLGICYGMQLMSRHFGGEVV-PAGKREFGHAELLAQGTPGPLFDGFFLDGKSPVWMSHGDHVSQVPEGFQVAAGTANAPVCAIQNLACNLYGVQFHPEVNHTPRGEQLIDTFVRKICGCSGKWTPGQIIEDAVARIKQQVGSDRVILGLSGGVDSSVAAALIHRAIGEQLTCVFVDNGLLRLGEGDQVMATFAQNLGVKVIRVDAEDRFLSALAGVSDPEKKRKIIGGLFVEIFEEESNKI-TDARWLAQGTIYPDVIESAGAKTGKAHNIKSHHNVGGLPEHMKLKLLEPLRELFKDEVRAIGEELGLPHQMVWRHPFPGPGLGVRILGEVRKDYADILRQADAI---YIEELYAADHYHKISQAFAVFLPVKSVGVMGDGRTYEYVVALRAVETKDFMTAGWYPLPYEDLARISSRIINEVKGINRVVYDISSKPPATIEWE 520
>gi|21223164|ref|NP_628943.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptomyces coelicolor A3(2)] >gi|13627139|sp|Q9L0H2|GUAA_STRCO GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|7320904|emb|CAB82024.1| GMP synthase [Streptomyces coelicolor A3(2)] (526 aa)
Score = 1272, Expect = 6.5e-138, Identities = 245/508 (48%), Positives = 346/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT--TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI----NVPFKYLLQGTIYPDIVESGSKF-SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFG QY QLIARR+R+  VYSEIV   + +EEI+ KNP  IILSGG  SVY   +   ++ +++  +P+ G+CYGFQ+M Q  GG V+N   + EYG T++ ++  ++ LFE    + + WMSH D+    P+GF V  ST+   VA+  N EKK YGVQ+HPEV  +T G Q+L++F+Y    ++ DW   N+  E++  I++ V D   +C +SGGVDS VAA L  +AIG +L CV+VDHGL+RK E+++V        G  + +VD  + FL  L GV DPEQKRKIIG+ FI VFE+   +I         +L+QGT+YPD+VESG    +  IKSHHNVGGLP+ ++FEL+EPL+ LFKDEVR +G  L +P + V RQPFPGPGL +R++GE+T+++L+++READ + R  +       +   WQ   V L + +SVGV GD R+YG+ + LR V S DAM+A W ++P E L KIS+ I N+V +++RVV D+T+KPPGTIEWE
  S:    14 VLVVDFGAQYAQLIARRVREARVYSEIVPSSMPVEEILAKNPAAIILSGGPSSVYEAGAPTLDRSLFEAGVPVFGMCYGFQLMAQTLGGTVDN-SGAREYGRTELAVSKPSSTLFEGTPAEQSVWMSHGDACSAAPEGFTVTGSTDVVPVAAFENDEKKLYGVQYHPEVMHSTHGQQVLEHFLYRGAGLSPDWTTGNVIEEQVAAIRAQVGDRRAICGLSGGVDSAVAAALVQKAIGSQLTCVYVDHGLMRKGETEQVEKDFVAATGVQLKVVDASERFLGALAGVSDPEQKRKIIGREFIRVFEQAQLEIMREDGPEVAFLVQGTLYPDVVESGGGTGTANIKSHHNVGGLPDDIEFELVEPLRQLFKDEVRMVGQELGLPDEIVQRQPFPGPGLGIRIVGEVTKERLDLLREADAIAREELTA--AGLDRDIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWSRLPYEVLSKISTRITNEVTDVNRVVLDVTSKPPGTIEWE 526
>gi|149113842|ref|ZP_01840599.1| GMP synthase, large subunit [Shewanella baltica OS223] >gi|146866593|gb|EDK51820.1| GMP synthase, large subunit [Shewanella baltica OS223] (525 aa)
Score = 1272, Expect = 6.9e-138, Identities = 252/509 (49%), Positives = 348/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNEL-FENIELDNN--------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARRIR++ VY E+  +D++  +I +  P GIIL+GG +SV  + S +  + ++   +P+LGICYG Q M ++ GG+V       E+G   I + T+ L F+ IE   N         WMSH D V  +P+GF  +A T+ C  A+  N EK+F+GVQFHPEVT T  G ++L +F   IC  A +W+P +I  + IE +K  + DD V+  +SGGVDS V A+L  +AIG KL CVFVD+GLLR NE+++V  +     G NI  VD +  FL  +KG  DPE KRKIIG+ F+E+F++ + K     K+L QGTIYPD++ES GS   K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+K +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTAENSPRAPEYVFTAGVPVLGICYGMQTMSEQLGGKVIQGVGEGEFGYAQIEMLTDSLLFKGIEDAVNSEGKPLLDVWMSHGDKVSAIPEGFVAVAKTDTCPFAAMANEEKQFFGVQFHPEVTHTRQGMRMLSHFALDICGCAANWKPSSIIEDAIERLKKQIGDDEVILGLSGGVDSSVVAMLLHRAIGKKLTCVFVDNGLLRLNEAEQVMEMFGDHFGLNIIHVDAENRFLDAMKGEADPEAKRKIIGRVFVEIFDEESKKC-ANAKWLAQGTIYPDVIESAGSATGKAHVIKSHHNVGGLPDHMELGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETVDFMTAHWAHLPYDFLGRVSNRIINEVDGISRVVYDISGKPPATIEWE 525
>gi|170725915|ref|YP_001759941.1| GMP synthase, large subunit [Shewanella woodyi ATCC 51908] >gi|169811262|gb|ACA85846.1| GMP synthase, large subunit [Shewanella woodyi ATCC 51908] (525 aa)
Score = 1272, Expect = 7.1e-138, Identities = 257/509 (50%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARRIR++ VY E+  +D+S E+I +  P GIIL+GG +SV    S +  + ++   +P+LGICYG Q M ++ GG+V       E+G   + L T +ELF++IE          LD   WMSH D V  +P+GF  +A+T  C  A+  N EKKFYGVQFHPEVT T  G ++L++F   IC    +W+P +I  + IE +K  + DD V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE+Q+V  +     G NI  VD +  FL  + G  DPE KRKIIG  F+++F++ + K  V  K+L QGTIYPD++ES GS   K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+K +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N++  ISRVVYDI+ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRIREIGVYCELWAWDVSEEQIKEFAPNGIILAGGPESVTAKDSPRAPEYVFTAGVPVLGICYGMQTMSEQLGGKVIQGVGEGEFGYAQVELQTQSELFKSIEDAISDSGKPLLD--VWMSHGDKVSEIPEGFVTVANTETCPYAAMANEEKKFYGVQFHPEVTHTRQGKRMLEHFALDICQCDANWKPASIIEDAIERLKQQIGDDEVILGLSGGVDSSVVAMLLHRAIGDKLTCVFVDNGLLRLNEAQQVMDMFGDHFGLNIVHVDAENRFLDAMAGEADPEAKRKIIGHVFVDIFDEESKKC-VNAKWLAQGTIYPDVIESAGSATGKAHVIKSHHNVGGLPDDMEMGLVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRLADAIF---IEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEIDGISRVVYDISGKPPATIEWE 525
>gi|120554647|ref|YP_958998.1| bifunctional GMP synthase/glutamine amidotransferase protein [Marinobacter aquaeolei VT8] >gi|120324496|gb|ABM18811.1| GMP synthase (glutamine-hydrolyzing) [Marinobacter aquaeolei VT8] (525 aa)
Score = 1272, Expect = 7.4e-138, Identities = 253/509 (49%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL---------TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY EI  +DI+ +E+ + NPKGIIL+GG +SV      +  +G++D  IP+LGICYG Q M ++ GG+V +  +  E+G   +++          T+ L    +   + WMSH D V+ +P+GF+++AST    +A+  +  +  YGVQFHPEVT T  G ++L++FV +I      W P  I  + + +I+  V  D VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E  +V  +    +G  +  VD + LFLSKLKGV DPEQKRKIIG TFI+VF+  A  I     +L QGTIYPD++ES  SK  K   IKSHHNVGGLPE ++ +L+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  +I+R AD +F   +++L++ +  HK  Q F V    KSVGVVGD R Y Y +A+RAV+++D M+A+W ++P E LE +S+ I N++  +SRV YDI++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCEIKAFDITDDELNEFNPKGIILAGGPESVTQLGGPRAPEGLFDRGIPVLGICYGMQTMAEQLGGRVAS-SEKREFGYAQVKVRAKGPLLADITDHLTPAGDSLLDVWMSHGDKVVAMPEGFELLASTESAPIAAMQDLSRNLYGVQFHPEVTHTLQGKRILEHFVLTISGCEALWTPAKIVDDAVRQIREQVGSDKVLLGLSGGVDSSVTAALLHKAIGDQLTCVFVDNGLLRLHEGDQVMDMFASNMGVKVIRVDAEDLFLSKLKGVNDPEQKRKIIGNTFIDVFDDEAANIK-DVNWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPETMKMKLVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADILRRADAIF---LEELHRADLYHKTSQAFAVFLPVKSVGVVGDARRYEYVIAIRAVETVDFMTARWARLPYELLETVSNRIINEISGVSRVTYDISSKPPATIEWE 525
>gi|119505204|ref|ZP_01627279.1| GMP synthase (glutamine-hydrolyzing) [marine gamma proteobacterium HTCC2080] >gi|119458895|gb|EAW39995.1| GMP synthase (glutamine-hydrolyzing) [marine gamma proteobacterium HTCC2080] (525 aa)
Score = 1272, Expect = 7.6e-138, Identities = 252/509 (49%), Positives = 349/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNN--------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R+  VYSEI  +DI+  +I   NP GI+LSGG +SV    S +  + +++L +P+LGICYG Q M  + GG+V+  + SE +G   IR + +  L ++I   ++         WMSH D V+ LP  F+ IA T+ C +A   +  K ++G+QFHPEVT TT G ++ ++FV  IC     W P NI  + I+ +++ V  D VL  +SGGVDS V A +  +AIGD+L CVFVD+GLLR +E ++V A+  + +G  +   + +  FL KLKGV DPE KRK IG TFIEVF++ A KI    K+L QGTIYPD++ES GSK  K   IKSHHNVGGLP+ +  EL+EPL+ LFKDEVR++GL L +P   V+R PFPGPGL VR+LGE+ ++  +++R+AD +F   I++L+++  + K  Q F V    KSVGVVGD R Y Y +A+RAV ++D M+A+W  +P E LE +S+ I N++  ISRV YDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREAGVYSEIYAWDITEADIRAFNPSGIVLSGGPESVTEADSPRAPEVVFELEVPVLGICYGMQTMAVQMGGEVQGSETSE-FGYAQIRRSADGGLLQDISDHHDDSGQALLDVWMSHGDKVVSLPPNFQCIAETDSCPLAGIAHNAKPWFGIQFHPEVTHTTQGERIFEHFVLEICGCEALWTPANIVEDAIQRVRTQVGTDRVLLGLSGGVDSSVVAAMLHRAIGDQLTCVFVDNGLLRLDEGEQVMAMFAQNMGVRVIRANAEARFLGKLKGVSDPEAKRKAIGNTFIEVFDEEATKI-TGVKWLAQGTIYPDVIESAGSKTGKAHVIKSHHNVGGLPDDMALELVEPLRELFKDEVRRIGLELGLPKDMVFRHPFPGPGLGVRILGEVKKEYADLLRQADAIF---IEELHRSGWYDKTSQAFAVFLPVKSVGVVGDGRRYEYVIAIRAVQTVDFMTARWAHLPYELLEVVSNRIINEISGISRVTYDISGKPPATIEWE 525
>gi|170692169|ref|ZP_02883332.1| GMP synthase, large subunit [Burkholderia graminis C4D1M] >gi|170142599|gb|EDT10764.1| GMP synthase, large subunit [Burkholderia graminis C4D1M] (527 aa)
Score = 1272, Expect = 7.7e-138, Identities = 257/510 (50%), Positives = 344/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNN--------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLF----RSYIDQLYKNSEHKPW-----QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKILILDFG Q TQLIARR+R+ NVYSEI  YD+    I    PKG+ILSGG  SV    + +  + +++L +P+LGICYG Q M ++ GG+V+      E+G  ++R   +  L E I              WMSH D V+ +P GF ++AST  C +A+  + ++ FYG+Q+HPEVT T  G  +L+ FV  IC    DWE  +   E + +I+  V +++V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR NE+++V A     +G  +  VD   +FL KL+GV DPE KRKIIG  F+EVF+  A K+    K+L QGTIYPD++ES   G K ++TIKSHHNVGGLPE L  +LLEPL+ LFKDEVR+LG+ L +P   VYR PFPGPGL VR+LGE+  +  +++R AD +F    R++ID+       K W     Q F V    KSVGV+GD R+Y Y +ALRAV ++D M+A W  +P E L  +S+ I N+V+ I+RVVYDI+ KPP TIEWE
  S:     3 DKILILDFGSQVTQLIARRVREANVYSEIHPYDVDASFIRDFAPKGVILSGGPSSVTETDTPRVPQVVFELGVPVLGICYGMQAMAEQLGGRVDIGH-LREFGYAEVRARNHTSLLEGISDFTTPEGHGMLKVWMSHGDKVLEMPPGFALMASTESCPIAAMADEQRHFYGLQWHPEVTHTVQGRAMLERFVLQICGARPDWEMGHYIDEAVAKIREQVGNEHVILGLSGGVDSSVAAALLHRAIGDQLTCVFVDHGLLRLNEAEQVMATFADHLGVKVIHVDASDVFLRKLEGVTDPEAKRKIIGAEFVEVFQTEAGKL-TDAKWLAQGTIYPDVIESAGKGKKATQTIKSHHNVGGLPETLNLKLLEPLRELFKDEVRELGVKLGLPPAMVYRHPFPGPGLGVRILGEVKREFADLLRRADAIFIETLRTFIDK----ETGKSWYDLTSQAFAVFLPVKSVGVMGDGRTYEYVVALRAVQTLDFMTAHWAHLPHELLGHVSNRIINEVRGINRVVYDISGKPPATIEWE 527
>gi|120402525|ref|YP_952354.1| bifunctional GMP synthase/glutamine amidotransferase protein [Mycobacterium vanbaalenii PYR-1] >gi|119955343|gb|ABM12348.1| GMP synthase (glutamine-hydrolyzing) [Mycobacterium vanbaalenii PYR-1] (522 aa)
Score = 1272, Expect = 7.8e-138, Identities = 237/508 (46%), Positives = 340/508 (66%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFE-------KVANKINVPFKYLLQGTIYPDIVES-GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFG QY QLIARR+R+  V+SE++ +  S+EEI  +NP+ ++LSGG  SVY D + + +  ++DL++P+ GICYGFQ M Q  GG V +   SE YG T++++   +L  ++      WMSH D+V   P+GF+V+A++    VA+  NR ++  GVQ+HPEV  +  G Q+L  F++    +   W P NI    +E++++ + D   +C +SGGVDS VAA L  +AIGD+L CVFVDHGLLR  E  +V        G N+  VD    FL  L GV +PE KRKIIG+ FI  FE       +  +  +VP ++L+QGT+YPD+VES G   +  IKSHHNVGGLP+ L+F L+EPL+ LFKDEVR +G  L +P + V RQPFPGPGL +R++GE+T ++L+ +R AD + R  +       +H+ WQ   V L + +SVGV GD R+YG+ + LR V S DAM+A W ++P E LE+IS+ I N+V+ ++RVV D+T+KPPGTIEWE
  S:     9 VLVVDFGAQYAQLIARRVREARVFSEVIPHTTSVEEIKARNPRAVVLSGGPASVYADGAPQLDPALFDLDVPVFGICYGFQAMAQALGGTVAHTGTSE-YGRTELKVAGGQLHTDLPETQPVWMSHGDAVTAAPEGFEVVATSAGAPVAAFENRARRLAGVQYHPEVMHSPHGQQVLSRFLHEFAGIDATWTPANIAEALVEQVRTQIGDGRAICGLSGGVDSAVAAALVQRAIGDRLTCVFVDHGLLRSGERAQVQRDFVAATGANLVTVDVADRFLEALSGVTNPEGKRKIIGREFIRAFEGAVRDALESQDGSDVPVEFLVQGTLYPDVVESGGGSGTANIKSHHNVGGLPDDLKFTLVEPLRLLFKDEVRAVGRELGLPEEIVARQPFPGPGLGIRIVGEVTAERLDTLRRADAIAREELTS--AGLDHQIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWTRVPYEVLERISTRITNEVREVNRVVLDVTSKPPGTIEWE 522
>gi|50843224|ref|YP_056451.1| bifunctional GMP synthase/glutamine amidotransferase protein [Propionibacterium acnes KPA171202] >gi|81611253|sp|Q6A6X1|GUAA_PROAC GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|50840826|gb|AAT83493.1| GMP synthase [glutamine-hydrolyzing] [Propionibacterium acnes KPA171202] (530 aa)
Score = 1271, Expect = 8.3e-138, Identities = 249/510 (48%), Positives = 341/510 (66%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINV--PFKYLLQGTIYPDIVES-GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D +L++DFG QY QLIARR+R+ NVYSEIV +++ + +++ K P  IILSGG  SVY + +   +  +++  +P+LGICYGFQ M Q  GGQV +   S EYG T + +T+  +L   I    + WMSH DSV   P+GF  +A T    VA+  + E++  GVQ+HPEV  T  G  +L++F++ I     DW   +I  ++I +I+  V D  V+C +SGGVDS VAA L  +A+GD+L CVFVDHGLLR+ E+++V        G ++ + D+ Q FL  L GV DPE KRKIIG+ FI  FE VA ++N   P  +L+QGT+YPD+VES G + +  IKSHHNVGGLP+  QF L+EPL+ LFKDEVR +GL L +P   V+RQPFPGPGLA+R++GE+T ++LE++R AD + R  +       + K WQ   V L++  SVGV GD R+YG  + LR V S DAM+A W +IP + LEKIS+ I N    I+RVV DIT+KPP TIEWE
  S:    19 DVVLVVDFGAQYAQLIARRVREANVYSEIVPHNMPVRDMLAKEPAAIILSGGPASVYVEGAPSVDPALFNAGVPVLGICYGFQAMAQALGGQVAHTGAS-EYGRTSLCITSAGQLLSRIPHTISVWMSHGDSVSRAPEGFSTLARTAGAPVAAFEDVERRLVGVQWHPEVHHTESGQTVLEHFLFDIAGCRPDWNASSIVGDQIAQIRGQVGDRRVICGLSGGVDSAVAAALVQRAVGDQLTCVFVDHGLLRQGEAEQVKNDFVAATGADLVVADESQRFLDALAGVTDPETKRKIIGREFIRTFEDVAKRLNADQPIDFLVQGTLYPDVVESGGGEGAANIKSHHNVGGLPDDFQFSLVEPLRTLFKDEVRAVGLELGLPEDIVWRQPFPGPGLAIRIIGEVTAERLEVLRTADAITREEMGA--AGLDRKVWQCPVVLLSDVHSVGVQGDGRTYGSPIVLRPVTSEDAMTADWARIPYDVLEKISTRITNACPQINRVVLDITSKPPATIEWE 530
>gi|34557924|ref|NP_907739.1| bifunctional GMP synthase/glutamine amidotransferase protein [Wolinella succinogenes DSM 1740] >gi|44887990|sp|Q7M8K2|GUAA_WOLSU GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|34483642|emb|CAE10639.1| GMP SYNTHASE [Wolinella succinogenes] (521 aa)
Score = 1271, Expect = 9.1e-138, Identities = 258/508 (50%), Positives = 344/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-----TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +LILDFG QYTQLIARR+R+  +Y EIV Y   +E I  + PKGIILSGG  SVY + +   +K +++L IP+LGICYG Q+M    GG V    +  EYG  ++       + ++LFE        WMSH D V  LP+GF  IA +     A+  ++EK FY VQFHPEV  +  G   L+NF   IC    DW   N   E+I++I+  VK   VLCA+SGGVDS V A L  +AIG+KL  VFVDHGLLR  E + V  + K+ +   +  VD  ++FL KLKGV DPE KRKIIG+TFIEVF+  A K +   +YL QGT+YPD++ES S    SKTIKSHHNVGGLP+ + FEL+EPL+ LFKDEVR LG  L +P + + R PFPGPGLA+R++GE+  + LE++R+AD +    +D+L K+  + K WQ FTVL N +SVGV+GDNR+Y  T+ +R V+++D M+A +  +P E LE++S+ I N+V  I+RVVYDI++KPP TIEWE
  S:    11 LLILDFGSQYTQLIARRLREYGIYCEIVPYHEKLEAIKAREPKGIILSGGPASVYEEDAFLIDKAVFELGIPVLGICYGMQLMTHYFGGVVAK-AEHHEYGKAEVIFDALEGSESKLFEGCHSGKVVWMSHGDKVEKLPEGFTRIAHSTNSPFAAIAHQEKPFYAVQFHPEVVHSEEGALYLKNFALGICGCENDWNMHNFAEEQIKKIQERVKSGKVLCAVSGGVDSSVVAALLYRAIGEKLIPVFVDHGLLRAGEREAVEKMFKENLHVPLITVDASEIFLGKLKGVSDPETKRKIIGETFIEVFDVEAKKHD-GIQYLAQGTLYPDVIESVSVKGPSKTIKSHHNVGGLPDWMTFELIEPLRELFKDEVRALGAELGMPREMLMRHPFPGPGLAIRIMGEVNFEDLELLRKADVIM---LDELKKSGFYDKTWQAFTVLLNVRSVGVMGDNRTYDNTVCVRVVEAIDGMTATFAHLPHELLERMSTRIINEVDGINRVVYDISSKPPATIEWE 521
>gi|116074322|ref|ZP_01471584.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus sp. RS9916] >gi|116069627|gb|EAU75379.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus sp. RS9916] (528 aa)
Score = 1271, Expect = 9.5e-138, Identities = 243/508 (47%), Positives = 339/508 (66%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARR+R+  V+S ++ Y  S  E+ +  P GIILSGG  SVY + +   +  IW+L IP+LG+CYG Q+M+Q+ GG VE      EYG   + +    +L  N++  +  WMSH DSV  LP+GF  +A T     A+  +  ++ YGVQFHPEV  +T G  L++NFVY +C    DW       E +  ++  V D  VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +     +    ++  ++ +Q FL+KL G+ DPE+KRKIIG  FI VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRK+G +L +P + V R PFPGPGLA+R+LGE+T++KL+ +R+AD + R  I +  LY    H  WQ F VL   +SVGV+GD R+Y + + LR V S D M+A W ++P + LE IS+ I N+VK ++RVV DIT+KPPGTIEWE
  S:    14 IVILDFGSQYSELIARRVRETEVFSLVLGYSTSAAELREMAPAGIILSGGPSSVYSEGAPLCDPEIWNLGIPVLGVCYGMQLMVQQLGGVVEAATGKAEYGKAPLEVDDPTDLLTNVDSGSTMWMSHGDSVKALPEGFVRLAHTANTPEAAVADHNRRLYGVQFHPEVVHSTCGMALIRNFVYHVCGCEPDWTTDAFIEEAVALVRDQVGDKRVLLALSGGVDSSTLAFLLKKAIGDQLTCMFIDQGFMRKGEPEFLMDFFDRKFNIHVEYINARQRFLAKLNGITDPEEKRKIIGTEFIRVFEEESKRLG-PFDYLAQGTLYPDVIESAGTNVDPKTGERVAVKIKSHHNVGGLPKDLQFKLVEPLRKLFKDEVRKVGRNLGLPEEIVRRHPFPGPGLAIRILGEVTDEKLDCLRDADLIVREEIKEAGLY----HDIWQAFAVLLPVRSVGVMGDKRTYAWPIVLRCVSSEDGMTADWSRLPADLLETISNRIVNEVKGVNRVVLDITSKPPGTIEWE 528
>gi|59802458|ref|YP_209170.1| bifunctional GMP synthase/glutamine amidotransferase protein [Neisseria gonorrhoeae FA 1090] >gi|75355263|sp|Q5F4X9|GUAA_NEIG1 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|59719353|gb|AAW90758.1| putative GMP synthetase [Neisseria gonorrhoeae FA 1090] (521 aa)
Score = 1270, Expect = 1.1e-137, Identities = 257/510 (50%), Positives = 342/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDN----NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG---SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHK--PW-----QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKILILDFG Q T+LIARR+R+ +VY E+  +D+ ++EI   NPKGIILSGG +SVY +   + + GI+DL IP+LGICYG Q M    GG+V+   +  E+G   ++   + L   I+ D     + WMSH D V  LP GF VI  T  C +A   N EK+FYG+QFHPEVT T  G  LL  FV  IC     W   N   E + +I+  V  D V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR NE + V  +  + +G  +  VD +  F++KL GV DPE+KRKIIG  FIEVF+    K+    K+L QGTIYPD++ES    +K +  IKSHHNVGGLPE ++ +LLEPL+ LFKDEVR+LG++L +P + VYR PFPGPGL VR+LGE+ ++  +++R+AD +F   I +L   ++     W     Q F V    KSVGV+GD R+Y Y +ALRAV + D M+A W ++P   L ++S+ I N+VK I+RVVYD++ KPP TIEWE
  S:     4 DKILILDFGSQVTRLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVY-ESDYQADTGIFDLGIPVLGICYGMQFMAHHLGGEVQ-PGNQREFGYAQVKTIDSGLTRGIQDDAPNTLDVWMSHGDKVSKLPDGFAVIGDTPSCPIAMMENAEKQFYGIQFHPEVTHTKQGRALLNRFVLDICGAQPGWTMPNYIEEAVAKIREQVGSDEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDHGLLRLNEGKMVMDMFARNLGVKVIHVDAEGQFMAKLAGVTDPEKKRKIIGAEFIEVFDAEEKKLTNA-KWLAQGTIYPDVIESAGAKTKKAHAIKSHHNVGGLPENMKLKLLEPLRDLFKDEVRELGVALGLPREMVYRHPFPGPGLGVRILGEVKKEYADLLRQADDIF---IQELRNTTDENGTSWYDLTSQAFAVFLPVKSVGVMGDGRTYDYVVALRAVITSDFMTAHWAELPYSLLGRVSNRIINEVKGINRVVYDVSGKPPATIEWE 521
>gi|77164138|ref|YP_342663.1| bifunctional GMP synthase/glutamine amidotransferase protein [Nitrosococcus oceani ATCC 19707] >gi|91206812|sp|Q3JDG3|GUAA_NITOC GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|76882452|gb|ABA57133.1| GMP synthase (glutamine-hydrolyzing) [Nitrosococcus oceani ATCC 19707] (524 aa)
Score = 1270, Expect = 1.2e-137, Identities = 257/509 (50%), Positives = 347/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDN--------NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R+  VY EI  YD++   +    P+GIILSGG  S  G+ + + +  I++L +P+LGICYG QVM  + GG+VE      EYG   + +   + L +NIE           + WMSH D VI LP+GFK IA+T    +A   + +++FYG QFHPEVT T  G ++L+ F+Y IC     WEP++I  + IE I++ V  D VL  +SGGVDS VAA L  +AIGD+L CVFVD+GLLR+ E+ +V A   + +G  +  +  +  FL  L GV+DPE KRKIIG+ FIEVFE+ A K+    ++L QGTIYPD++ES G K  K   IKSHHNVGGLPE L  +LLEPL+ LFKDEVR+LG  L +P++ VYR PFPGPGL VR+LGE+ ++  +++R AD +F   I++L+ +  + K  Q F V    KSVGV+GD R Y + +ALRAV+S+D M+A+W  +P + L+ +S  I N+V  ISRV YDI+ KPP TIEWE
  S:     8 RILILDFGSQYTQLIARRVREAGVYCEIHPYDMAESTLRDFAPRGIILSGGPASTVGETAPRLSPLIFELGVPLLGICYGMQVMAAQLGGRVEVSA-QREYGYAQVYVHGHSRLLQNIEDHTTAGGEALLDVWMSHGDRVIGLPEGFKRIAATAHAPLAGMADEKRRFYGFQFHPEVTHTRQGIRILERFIYDICGCEALWEPRHIIAKSIENIRTKVGADTVLLGLSGGVDSSVAAALLHKAIGDQLICVFVDNGLLRQGEADQVMATFARHLGIKVIHISAETRFLEALAGVIDPEAKRKIIGRVFIEVFEEEAAKLPNA-QWLAQGTIYPDVIESAGGKTGKAQVIKSHHNVGGLPEELNLKLLEPLRELFKDEVRQLGTELGLPFELVYRHPFPGPGLGVRILGEVKKEYADLLRLADAIF---IEELHAHDWYDKVSQAFAVFLPVKSVGVMGDGRCYDFVVALRAVESVDFMTARWAHLPYDFLDHVSRRIINEVAGISRVTYDISGKPPATIEWE 524
>gi|194100128|ref|YP_002003268.1| GMP synthase [Neisseria gonorrhoeae NCCP11945] >gi|193935418|gb|ACF31242.1| GMP synthase [Neisseria gonorrhoeae NCCP11945] (521 aa)
Score = 1270, Expect = 1.2e-137, Identities = 257/510 (50%), Positives = 342/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDN----NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG---SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHK--PW-----QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKILILDFG Q T+LIARR+R+ +VY E+  +D+ ++EI   NPKGIILSGG +SVY +   + + GI+DL IP+LGICYG Q M    GG+V+   +  E+G   ++   + L   I+ D     + WMSH D V  LP GF VI  T  C +A   N EK+FYG+QFHPEVT T  G  LL  FV  IC     W   N   E + +I+  V  D V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR NE + V  +  + +G  +  VD +  F++KL GV DPE+KRKIIG  FIEVF+    K+    K+L QGTIYPD++ES    +K +  IKSHHNVGGLPE ++ +LLEPL+ LFKDEVR+LG++L +P + VYR PFPGPGL VR+LGE+ ++  +++R+AD +F   I +L   ++     W     Q F V    KSVGV+GD R+Y Y +ALRAV + D M+A W ++P   L ++S+ I N+VK I+RVVYD++ KPP TIEWE
  S:     4 DKILILDFGSQVTRLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVY-ESDYQADTGIFDLGIPVLGICYGMQFMAHHLGGEVQ-PGNQREFGYAQVKTIDSGLTRGIQDDAPNTLDVWMSHGDKVSKLPDGFAVIGDTPSCPIAMMENTEKQFYGIQFHPEVTHTKQGRALLNRFVLDICGAQPGWTMPNYIEEAVAKIREQVGSDEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDHGLLRLNEGKMVMDMFARNLGVKVIHVDAEGQFMAKLAGVTDPEKKRKIIGAEFIEVFDAEEKKLTNA-KWLAQGTIYPDVIESAGAKTKKAHAIKSHHNVGGLPENMKLKLLEPLRDLFKDEVRELGVALGLPREMVYRHPFPGPGLGVRILGEVKKEYADLLRQADDIF---IQELRNTTDENGTSWYDLTSQAFAVFLPVKSVGVMGDGRTYDYVVALRAVITSDFMTAHWAELPYSLLGRVSNRIINEVKGINRVVYDVSGKPPATIEWE 521
>gi|77460808|ref|YP_350315.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pseudomonas fluorescens PfO-1] >gi|91206822|sp|Q3K7D0|GUAA_PSEPF GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|77384811|gb|ABA76324.1| GMP synthase (glutamine-hydrolyzing) [Pseudomonas fluorescens PfO-1] (525 aa)
Score = 1270, Expect = 1.3e-137, Identities = 250/509 (49%), Positives = 345/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSE-EYGSTDIRLTTNELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY E+  +D+  + I +  PKG+IL+GG +SV+   S +  + ++DL +P+ GICYG Q M ++ GG+VE  +  E  Y   D+ +  + L + IE           + WMSH D V  +P  F ++AST  C +A   N E+ +YGVQFHPEVT T  G ++L  FV  IC     W P  I  + I  I++ V  D VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E ++V A+  + +G  +   + +  FL+ L G  DPE+KRKIIG+TFI+VF+  + K++   KYL QGTIYPD++ES G+K  K   IKSHHNVGGLPE +  +L+EPL+ LFKDEVR+LGL L +PY  VYR PFPGPGL VR+LGE+ ++  +++R AD +F   I++L K +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LE +S  I N+++ ISRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCELHPFDMDEDAIREFAPKGVILAGGPESVHEANSPRCPQAVFDLGVPVFGICYGMQTMAEQLGGKVEGSELREFGYARVDV-VGKSRLLDGIEDHIDADGLFGLDVWMSHGDKVTKMPSDFHILASTPSCPIAGMFNDERAYYGVQFHPEVTHTKQGGRILSRFVLDICGCEALWTPSKIAEDAIANIRAQVGTDNVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLHEGEQVMAMFAENMGVKVIRANAEDQFLNNLAGEADPEKKRKIIGRTFIDVFDAESCKLD-NIKYLAQGTIYPDVIESAGAKSGKAHVIKSHHNVGGLPEEMNLKLVEPLRELFKDEVRRLGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADLLRRADHIF---IEELRKADWYHKVSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETIDFMTARWAHLPYELLETVSGRIINEIEGISRVTYDVSSKPPATIEWE 525
>gi|88706901|ref|ZP_01104600.1| GMP synthase [gamma proteobacterium KT 71] >gi|88698823|gb|EAQ95943.1| GMP synthase [Congregibacter litoralis KT71] (524 aa)
Score = 1269, Expect = 1.4e-137, Identities = 258/509 (50%), Positives = 346/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE--LFENIE---LDN-----NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VYSEI  +DIS EE+ +  P G+ILSGG +SV  + S +    +++ N P+LGICYG Q M  + GG+V+   D+ E+G   IR T  E  L  +I     D+     + WMSH D V  LPK F  +AST+ C +A+  +  + ++G+QFHPEVT T  G ++L+ FV  IC     W P  I  + I  ++  V  D+VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E  +V  +  + +G  +   D + LFL +L GV DPE+KRKIIG TFIEVF++ A KI    ++L QGTIYPD++ES G+K  K   IKSHHNVGGLPE +  EL+EPL+ LFKDEVRK+GL L +P+  V+R PFPGPGL VR+LGE+     EI+R AD +   YI++L     + K  Q F V    KSVGVVGD R Y Y +ALRAV+++D M+A+W  +P E LEK+S+ I N++  +SRV YD+++KPP TIEWE
  S:     8 RILILDFGSQYTQLIARRVREVGVYSEIRAWDISEEELREFAPSGVILSGGPESVTEEGSPRAPACLFEGNWPLLGICYGMQTMAAQLGGEVQG-SDTSEFGYAQIR-TAGETALLHDIRDHMTDHGDGLLDVWMSHGDKVTALPKDFSCVASTDSCPIAAMAHGSQPWFGIQFHPEVTHTLQGTRILERFVIEICGCEALWTPARIVEDAIARVRETVGGDHVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLHEGDQVMEMFARNMGVKVIRSDSEALFLDRLAGVSDPEEKRKIIGNTFIEVFDEEAAKIE-GVRWLAQGTIYPDVIESAGAKTGKAHVIKSHHNVGGLPEDMALELVEPLRELFKDEVRKIGLELGLPHDMVFRHPFPGPGLGVRILGEVKHAYAEILRRADAI---YIEELRAAGWYEKTSQAFAVFLPVKSVGVVGDARRYEYVIALRAVETVDFMTARWAHLPYELLEKVSNRIINEITGVSRVTYDVSSKPPATIEWE 524
>gi|163766679|ref|ZP_02173702.1| GMP synthase, large subunit [Anaeromyxobacter sp. K] >gi|196171778|gb|ACG72751.1| GMP synthase, large subunit [Anaeromyxobacter sp. K] (518 aa)
Score = 1269, Expect = 1.4e-137, Identities = 253/510 (49%), Positives = 346/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI---NVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KILILDFG QYTQLIARR+R+L VY EI       E I    P+G++LSGG  SV  + S + ++ +++L +P+LGICYG QV+  E GG+V+      E+G   I +  T+ LF+ +    + WMSH D V  LP GF+ IA+T     A+  +R ++FYGVQFHPEV  T  G  +L+NF Y +C  +G W  +      +E+I++ VKD +V+CA+SGGVDS VAA+L  +AIGD+L C+FVD+G+LR  E Q+V  +   +    +  VD  + FL  L GV DPE+KRKIIG  FI VFE+   ++       K+L+QGT+YPD++ES S    S TIKSHHNVGGLPE++   L+EPL+ LFKDEVR+LGL L +P   V RQPFPGPGLA+RVLGE+TE++L ++R AD + +  +    LY+    K WQ F VL   +SVGV+GD R+Y  T A+RAV+S D M+  W ++P E L ++SS I N+V+ I+RVVYDI++KPP TIEWE
  S:     6 EKILILDFGSQYTQLIARRLRELGVYCEIHPCTAKAEAIRAFRPRGVVLSGGPASVLAEGSPRCDRVVFELGVPVLGICYGLQVLAAELGGRVDQAA-HREFGPATIEVKATSPLFQGLPATLDVWMSHGDRVEALPPGFEPIAATASAPYAAVEDRARRFYGVQFHPEVVHTPRGKDVLRNFAYGVCGCSGTWSMRGYAEAAVEQIRAQVKDGHVICALSGGVDSAVAALLVHRAIGDRLRCIFVDNGVLRAGERQQVEDVFGAMFHLPLVTVDASRRFLGALAGVTDPERKRKIIGHEFIAVFEQEVERLAAHGARAKFLVQGTLYPDVIESVSFRGPSATIKSHHNVGGLPEKMNLSLVEPLRELFKDEVRQLGLELGLPEAIVRRQPFPGPGLAIRVLGEVTEERLAVLRRADTIVQEEVRAAGLYE----KLWQGFAVLLPVRSVGVMGDERTYESTCAIRAVESTDGMTGDWARLPYELLARMSSRIINEVRGINRVVYDISSKPPATIEWE 518
>gi|196194534|gb|EDX89493.1| ExsB family [Alcanivorax sp. DG881] (523 aa)
Score = 1269, Expect = 1.4e-137, Identities = 256/509 (50%), Positives = 341/509 (66%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDI-RLTTNELFENIELDN--------NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS-EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY EI  +D++ EE+ +  PKGIILSGG +SV    + +  + ++D  IP+LGICYG Q M ++ GG+V    +  E+G   + +   N L + I +D+        + WMSH D V  +P GF   A+T  C +A   N EK+FYG+QFHPEVT T  G +LL+ FV  +CD    W P NI  + I+ I+  V  D V+  +SGGVDS V A L  +AIGD+L CVFVD+GLLR  E  +V  +    +G  +  VD +  FL KL G  DPE KRKIIG TFI++F++ A K+     +L QGTIYPD++ES  SK  K   IKSHHNVGGLPE ++ +L+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  + +R AD +F   I++L      HK  Q F V    KSVGVVGD R Y Y +ALRAV+++D M+A+W  +P + LE +SS I N++  ISRV YDI++KPP TIEWE
  S:     8 RILILDFGSQYTQLIARRVREIGVYCEIRAFDMTAEELSEFAPKGIILSGGPESVTAAETPRAPQAVFDAGIPVLGICYGMQTMAEQLGGKVIAG-EKHEFGYARVEKADANALLDGI-VDHEEQGKEYLDVWMSHGDRVGEMPAGFVATATTGSCPIAGMANDEKRFYGIQFHPEVTHTLQGGRLLERFVRELCDCEALWTPSNIISDAIDTIREQVGTDEVILGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRHQEGDQVMEMFADNMGVKVIRVDAEDNFLGKLAGEADPELKRKIIGNTFIDIFDEEAGKLENA-NWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPEDMKLKLVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADTLRLADHIF---IEELRAAGLYHKTSQAFAVFLPVKSVGVVGDARRYEYVVALRAVETIDFMTARWAHLPYDFLELVSSRIINEIPGISRVTYDISSKPPATIEWE 523
>gi|116071765|ref|ZP_01469033.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus sp. BL107] >gi|116065388|gb|EAU71146.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus sp. BL107] (528 aa)
Score = 1269, Expect = 1.4e-137, Identities = 244/508 (48%), Positives = 337/508 (66%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARR+R+  V+S ++ Y  + +E+ +  PKGIILSGG  SVY + +   +  IWDL IP+LG+CYG Q+M+Q+ GG VE      EYG   + +    +L   +E  +  WMSH DSV  LP+GF  +A T     A+  N E+K YGVQFHPEV  +T G  L++NFV  IC    DW       E +  ++  V    VL A+SGGVDS   A L  +AIGD+L C+F+D G +RK E + +     +    N+  ++ ++ F+ KLKG+ DPE KRKIIG  FI VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVRK+G +L +P + V R PFPGPGLA+R+LGE+T++KL  +R+AD + R  I    LY    H+ WQ F VL   +SVGV+GD R+Y + + LR V S D M+A W ++P + +E IS+ I N+VK ++RVV DIT+KPPGTIEWE
  S:    14 IVILDFGSQYSELIARRVRETEVFSVVIGYSTTADELRRMAPKGIILSGGPSSVYAEHAPVCDPAIWDLGIPVLGVCYGMQLMVQQLGGAVEAATGKAEYGKAPLVVDDPTDLLNKVESGSTMWMSHGDSVKALPEGFVRLAHTANTPEAAVANLERKLYGVQFHPEVVHSTCGMALIRNFVNHICACEQDWTTNAFIDEAVALVREQVGQKRVLLALSGGVDSSTLAFLLKKAIGDQLTCMFIDQGFMRKGEPEFLMEFFDQKFNINVEYINARKRFIDKLKGITDPEDKRKIIGTEFIRVFEEESKRLG-PFDYLAQGTLYPDVIESAGTNVDPKTGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRNLGLPEEIVRRHPFPGPGLAIRILGEVTDEKLNCLRDADLIVREEIRDAGLY----HEIWQAFAVLLPVRSVGVMGDQRTYAWPIVLRCVSSEDGMTADWSRLPYDLMETISNRIVNEVKGVNRVVMDITSKPPGTIEWE 528
>gi|123967573|ref|YP_001008431.1| bifunctional GMP synthase/glutamine amidotransferase protein [Prochlorococcus marinus str. AS9601] >gi|123197683|gb|ABM69324.1| Glutamine amidotransferase class-I:GMP synthase [Prochlorococcus marinus str. AS9601] (528 aa)
Score = 1269, Expect = 1.4e-137, Identities = 253/508 (49%), Positives = 352/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ILILDFG QY++LIARRIR+ NV+S +V   ISIE+I + NPKGIILSGG +SVY   + + ++ I++L IPILGICYG Q+M++E GG V +     EYG   + +   ++L  ++E  +  WMSH DS+  LP GF  IA T   L A+  N  KK +GVQFHPEV  + FG ++++NFVY I     DW  +    E I  I+  V +  VL A+SGGVDS   A L  +AIG++L C+F+D G +RK E + +     K     +  ++ ++ F++KLKG+ DPEQKRKIIG+ FI VFE+ +N++  PF+YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRK+G +L +P + + R PFPGPGLA+R+LGE+  +KL+ +R+AD++ R  I +  LY +     WQ F VL   K+VGV+GD R+Y + + LR V S D M+A W KIP + LE+I++ I N+V +++RVVYDIT+KPPGTIEWE
  S:    14 ILILDFGSQYSELIARRIRETNVFSLVVSNFISIEDINRINPKGIILSGGPNSVYEQNAPRCDEKIFNLGIPILGICYGMQLMVKELGGTVISATKKAEYGRAPLNIDQESDLLFDVEDKSIMWMSHGDSINCLPDGFNKIAHTENTLHAAISNDVKKLFGVQFHPEVVHSEFGMRVIKNFVYKISCCTADWTTETYIEETIPRIREQVGNKKVLLALSGGVDSSTLAFLLNKAIGNQLTCMFIDQGFMRKGEPEFLMNFFDKKFHIKVEYINARERFIAKLKGITDPEQKRKIIGEEFIRVFEEESNRLG-PFQYLAQGTLYPDVIESAGTNIDPKTGERIAVKIKSHHNVGGLPKDLQFKLVEPLRKLFKDEVRKVGAALGLPDEIIKRHPFPGPGLAIRILGEVNNEKLDCLRDADWIVRDEIKKAGLYNDI----WQAFAVLLPVKTVGVMGDKRTYSWPIVLRCVSSEDGMTADWSKIPFQILERIANRIVNEVISVNRVVYDITSKPPGTIEWE 528
>gi|126175185|ref|YP_001051334.1| GMP synthase, large subunit [Shewanella baltica OS155] >gi|153001511|ref|YP_001367192.1| bifunctional GMP synthase/glutamine amidotransferase protein [Shewanella baltica OS185] >gi|160876247|ref|YP_001555563.1| bifunctional GMP synthase/glutamine amidotransferase protein [Shewanella baltica OS195] >gi|125998390|gb|ABN62465.1| GMP synthase, large subunit [Shewanella baltica OS155] >gi|151366129|gb|ABS09129.1| GMP synthase, large subunit [Shewanella baltica OS185] >gi|160861769|gb|ABX50303.1| GMP synthase, large subunit [Shewanella baltica OS195] (525 aa)
Score = 1269, Expect = 1.4e-137, Identities = 252/509 (49%), Positives = 348/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNEL-FENIELDNN--------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARRIR++ VY E+  +D++  +I +  P GIIL+GG +SV  + S +  + ++   +P+LGICYG Q M ++ GG+V       E+G   I + T+ L F+ IE   N         WMSH D V  +P+GF  +A T+ C  A+  N EK+F+GVQFHPEVT T  G ++L +F   IC  A +W+P +I  + IE +K  + DD V+  +SGGVDS V A+L  +AIG KL CVFVD+GLLR NE+++V  +     G NI  VD +  FL  +KG  DPE KRKIIG+ F+E+F++ + K     K+L QGTIYPD++ES GS   K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+K +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTAENSPRAPEYVFTAGVPVLGICYGMQTMSEQLGGKVIQGVGEGEFGYAQIEMLTDSLLFKGIEDAVNSEGKPLLDVWMSHGDKVSAIPEGFVAVAKTDTCPFAAMANEEKQFFGVQFHPEVTHTRQGMRMLSHFALDICGCAANWKPSSIIEDAIERLKKQIGDDEVILGLSGGVDSSVVAMLLHRAIGKKLTCVFVDNGLLRLNEAEQVMEMFGDHFGLNIIHVDAENRFLDAMKGEADPEAKRKIIGRVFVEIFDEESKKC-ANAKWLAQGTIYPDVIESAGSATGKAHVIKSHHNVGGLPDDMELGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETVDFMTAHWAHLPYDFLGRVSNRIINEVDGISRVVYDISGKPPATIEWE 525
>gi|70732263|ref|YP_262019.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pseudomonas fluorescens Pf-5] >gi|91206820|sp|Q4K6W4|GUAA_PSEF5 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|68346562|gb|AAY94168.1| GMP synthase [Pseudomonas fluorescens Pf-5] (525 aa)
Score = 1269, Expect = 1.5e-137, Identities = 249/509 (48%), Positives = 347/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSE-EYGSTDIRLTTNELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY E+  +D+  E I +  PKG+IL+GG +SV+   S +  + ++DL +P+ GICYG Q M ++ GG+VE  +  E  Y   D+ +  + L + IE           + WMSH D V  +P+ F ++AST  C +A   N + ++YGVQFHPEVT T  G ++L  F+  IC     W P  I  + I +I++ V  D VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E ++V A+  + +G  +   + ++ FL+ L G  DPE+KRKIIG+TFI+VF+  + K+    KYL QGTIYPD++ES G+K  K   IKSHHNVGGLPE +  +L+EPL+ LFKDEVR+LGL L +PY  VYR PFPGPGL VR+LGE+ ++  +++R AD +F   I++L K +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LE +S  I N+++ ISRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFAPKGVILAGGPESVHEANSPRCPQAVFDLGVPVFGICYGMQTMAEQLGGKVEGSELREFGYARVDV-VGKSRLLDGIEDHVDADGLFGLDVWMSHGDKVTKMPEDFHILASTPSCPIAGMFNDDLRYYGVQFHPEVTHTKQGGRILSRFILDICGCEALWTPSKIAEDAIAQIRAQVGTDNVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLHEGEQVMAMFAENMGVKVIRANAEEQFLNNLAGEADPEKKRKIIGRTFIDVFDAESCKLE-NIKYLAQGTIYPDVIESAGAKSGKAHVIKSHHNVGGLPEEMNLKLVEPLRELFKDEVRRLGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADLLRRADHIF---IEELRKADWYHKVSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETIDFMTARWAHLPYELLETVSGRIINEIEGISRVTYDVSSKPPATIEWE 525
>gi|127512230|ref|YP_001093427.1| bifunctional GMP synthase/glutamine amidotransferase protein [Shewanella loihica PV-4] >gi|126637525|gb|ABO23168.1| GMP synthase, large subunit [Shewanella loihica PV-4] (525 aa)
Score = 1269, Expect = 1.7e-137, Identities = 254/509 (49%), Positives = 349/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARRIR++ VY E+  +D+S E+I    P GIIL+GG +SV  D S +  + +++  +P+LGICYG Q M ++ GG+V       E+G   + +   +ELF++IE          LD   WMSH D V  +P+GF  +A T+ C  A+  N EK+FYGVQFHPEVT T  G ++L++F   IC    +W+P +I  + +  IK  V DD V+  +SGGVDS V A+L  +AIG KL CVFVD+GLLR NE+ +V  +     G NI  VD +  FL  L G  +PE KRKIIGK F+++F++ + K  V  K+L QGTIYPD++ES GS   K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+K +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N++  ISRVVYDI+ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRIREIGVYCELWAWDVSEEQIKAFAPNGIILAGGPESVTADNSPRAPEYVFNAGVPVLGICYGMQTMSEQLGGKVIQGVGEGEFGYAQVEVQAASELFKSIEDAVSDSGKALLD--VWMSHGDKVSEIPEGFVTVAKTDTCPYAAMANEEKRFYGVQFHPEVTHTRQGKRMLEHFALDICQCEANWKPSSIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAMLLHRAIGSKLTCVFVDNGLLRLNEADQVLEMFGDHFGLNIVHVDAESRFLDALAGEAEPEAKRKIIGKVFVDIFDEESRKC-VNAKWLAQGTIYPDVIESAGSATGKAHVIKSHHNVGGLPDDMELGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEIDGISRVVYDISGKPPATIEWE 525
>gi|148980239|ref|ZP_01815947.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrionales bacterium SWAT-3] >gi|145961333|gb|EDK26642.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrionales bacterium SWAT-3] (517 aa)
Score = 1269, Expect = 1.7e-137, Identities = 250/509 (49%), Positives = 348/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLY-KNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARRIR++ VY E+  +D+   +I + NP GIILSGG +SV  + S +  + ++D  +P+ GICYG Q M ++ GG+V    +  E+G   +++T  + LF ++E   + WMSH D V+ +P  F  IA T+ C  A+  N EKK++GVQFHPEVT T  G ++L+NFV ++C   G W   +I  + +  IK  V DD V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE+ +V  +     G NI  VD +  FL  L+G  +PE KRKIIG  F+++F++ + K++   K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGEI ++  +++R AD +F   I++L+  +  HK  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L K+S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRIREIGVYCELWSWDVDEADIREFNPDGIILSGGPESVTEENSPRAPQYVFDSGVPVFGICYGMQTMAEQLGGKVATSTE-REFGYAAVQVTGESALFADLESTQDVWMSHGDKVVEIPADFTKIAETDTCPYAAMANEEKKYFGVQFHPEVTHTKNGLKMLENFVLNVCGCEGLWTSASIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAMLAHRAIGDKLTCVFVDNGLLRLNEADQVMEMFGNKFGLNIIKVDAEDRFLKALEGEAEPEAKRKIIGHVFVDIFDEESKKLSNA-KWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRADAIF---IEELHAADLYHKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGKVSNRIINEVDGISRVVYDISGKPPATIEWE 517
>gi|86145604|ref|ZP_01063934.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio sp. MED222] >gi|85836575|gb|EAQ54701.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio sp. MED222] (517 aa)
Score = 1269, Expect = 1.8e-137, Identities = 250/509 (49%), Positives = 346/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLY-KNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARRIR++ VY E+  +D+   +I + NP GIILSGG +SV  + S +  + ++D  +P+ GICYG Q M ++ GG+V    +  E+G   +++T  + LF ++E   + WMSH D V+ +P  F  IA T+ C  A+  N EKK+YGVQFHPEVT T  G ++L+NFV + C   G W   +I  + +  IK  V DD V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE ++V  +     G NI  VD +  FL  L+G  +PE KRKIIG  F+++F++ + K+    K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+  +  HK  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L K+S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRIREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEENSPRAPQYVFDSGVPVFGICYGMQTMAEQLGGKVATSTE-REFGYAAVQVTGESALFTDLETTQDVWMSHGDKVVEIPADFTKIAETDTCPYAAMANEEKKYYGVQFHPEVTHTKNGLKMLENFVLNACGCEGLWTSASIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAMLAHRAIGDKLTCVFVDNGLLRLNEGEQVMEMFGDQFGLNIIKVDAEDRFLDALEGEAEPEAKRKIIGHVFVDIFDEESKKLKNA-KWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHAADLYHKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517
>gi|157376255|ref|YP_001474855.1| bifunctional GMP synthase/glutamine amidotransferase protein [Shewanella sediminis HAW-EB3] >gi|157318629|gb|ABV37727.1| GMP synthase, large subunit [Shewanella sediminis HAW-EB3] (525 aa)
Score = 1268, Expect = 1.8e-137, Identities = 254/509 (49%), Positives = 350/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS-EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARRIR++ VY E+  +D+S  +I    P GIIL+GG +SV  D S +  + +++  +P+LGICYG Q M ++ GG+V       E+G   I +   +ELF++IE          LD   WMSH D V+ +P+GF  +A+T  C  A+  N +KKFYGVQFHPEVT T  G ++L++F   IC+   +W+P +I  + +E +K  + DD V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE+ +V  +     G NI  V+ +  FL  +KG  DPE KRKIIG  F+E+F++ + K     K+L QGTIYPD++ES GS   K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+K    HK  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N++  ISRVVYDI+ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRIREIGVYCELWAWDVSEAQIKGFAPNGIILAGGPESVTADESPRAPEYVFNAGVPVLGICYGMQTMSEQLGGKVIEGIGEGEFGYAQIEIQEPSELFKSIEDAISESGKPLLD--VWMSHGDKVLDIPEGFVTVANTETCPHAAMANEDKKFYGVQFHPEVTHTRQGKRMLEHFALDICECEANWKPTSIIEDAVERLKKQIGDDEVILGLSGGVDSSVVAMLLHRAIGDKLTCVFVDNGLLRLNEADQVMDMFGDHFGLNIVHVNAENRFLDAMKGEADPEAKRKIIGHVFVEIFDEESKKCKNA-KWLAQGTIYPDVIESAGSATGKAHVIKSHHNVGGLPDDMELGLVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRLADAIF---IEELHKAELYHKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEIDGISRVVYDISGKPPATIEWE 525
>gi|152978572|ref|YP_001344201.1| bifunctional GMP synthase/glutamine amidotransferase protein [Actinobacillus succinogenes 130Z] >gi|150840295|gb|ABR74266.1| GMP synthase, large subunit [Actinobacillus succinogenes 130Z] (523 aa)
Score = 1268, Expect = 1.9e-137, Identities = 255/509 (50%), Positives = 353/509 (69%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSE-EYGSTDIRLTTNELFE--NIELDN-----NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS-EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R++ VY E+  +D++ ++I + NP GIILSGG +S   + S +  + ++D  +P+LG+CYG Q M  + GG  E     E  Y   D++  T+ LF   N +LD+     + WMSH D V  LP+GF+V  +T  C +A+  + ++ FYGVQFHPEVT T  G  LL NFV +IC  A +W P+NI  + +  IK+ V DD V+  +SGGVDS V A+L  +AIG  L+CVFVD+GLLR NE  +V  +     G NI  V+ ++ FL  LKG+ DPE KRK+IGK F++VF++ ++K     K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL+L +P + + R PFPGPGL VRVLGEI ++  +++R+AD +F   I++LY +   +K  Q FTV    KSVGV+GD R Y + ++LRAV+++D M+A W ++P + L KIS+ I N+V  ISRVVYD++ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRVREIGVYCELWAWDVTEQQIREFNPTGIILSGGPESTTENDSPRAPEYVFDAGVPVLGVCYGMQTMAMQLGGLTEGSAHREFGYAQVDLQ-ATDSLFAQLNDDLDSAQPKLDVWMSHGDKVTRLPEGFQVTGTTPTCPIAAMSDEKRHFYGVQFHPEVTHTKSGLALLTNFVVNICGCATNWTPENIIEDAVARIKAQVGDDEVILGLSGGVDSSVTALLLHRAIGKNLHCVFVDNGLLRLNEGDQVMEMFGDKFGLNIIRVNAEERFLDALKGIHDPEAKRKMIGKVFVDVFDEESHK-QTSVKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDYMKLGLVEPLRELFKDEVRKIGLALGLPAEMLNRHPFPGPGLGVRVLGEIKKEYCDLLRKADAIF---IEELYNSGWYYKVSQAFTVFLPVKSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAQLPYDLLGKISNRIINEVDGISRVVYDVSGKPPATIEWE 523
>gi|161869294|ref|YP_001598461.1| bifunctional GMP synthase/glutamine amidotransferase protein [Neisseria meningitidis 053442] >gi|161594847|gb|ABX72507.1| GMP synthetase (glutamine-hydrolysing) [Neisseria meningitidis 053442] (521 aa)
Score = 1267, Expect = 2.4e-137, Identities = 260/510 (50%), Positives = 342/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDN----NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHK--PW-----QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKILILDFG Q TQLIARR+R+ +VY E+  +D+ ++EI   NPKGIILSGG +SVY +   + + GI+DL IP+LGICYG Q M    GG+V    +  E+G   ++   + L  +I  D     + WMSH D V  LP GF VI  T  C +A   N EK+FYG+QFHPEVT T  G  LL  FV  IC     W   N   E + +I+  V  D V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR NE + V  +  + +G  +  VD +  F++KL GV DPE+KRKIIG  FIEVF+    K+    K+L QGTIYPD++ES G+K  K   IKSHHNVGGLPE ++ +LLEPL+ LFKDEVR+LG++L +P + VYR PFPGPGL VR+LGE+ ++  +++R+AD +F   I +L   ++     W     Q F V    KSVGV+GD R+Y Y +ALRAV + D M+A W ++P   L ++S+ I N+VK I+RVVYD++ KPP TIEWE
  S:     4 DKILILDFGSQVTQLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVY-ESDYQADIGIFDLGIPVLGICYGMQFMAHHLGGEV-TPGNQREFGYAQVKTIDSGLTRDIYDDAPNTLDVWMSHGDKVSKLPDGFAVIGDTPSCPIAMMENAEKQFYGIQFHPEVTHTKQGRALLNRFVLDICGAQPGWTMPNYIEEAVAKIREQVGSDEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDHGLLRLNEGKMVMDMFARNLGVKVIHVDAEGQFMAKLAGVTDPEKKRKIIGAEFIEVFDAEEKKLTNA-KWLAQGTIYPDVIESAGAKTQKAHAIKSHHNVGGLPENMKLKLLEPLRDLFKDEVRELGVALGLPREMVYRHPFPGPGLGVRILGEVKKEYADLLRQADDIF---IQELRNTTDENGTSWYDLTSQAFAVFLPVKSVGVMGDGRTYDYVVALRAVITSDFMTAHWAELPYSLLGRVSNRIINEVKGINRVVYDVSGKPPATIEWE 521
>gi|157961142|ref|YP_001501176.1| bifunctional GMP synthase/glutamine amidotransferase protein [Shewanella pealeana ATCC 700345] >gi|157846142|gb|ABV86641.1| GMP synthase, large subunit [Shewanella pealeana ATCC 700345] (525 aa)
Score = 1267, Expect = 2.5e-137, Identities = 254/509 (49%), Positives = 350/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSKT--IKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARRIR++ VY E+  +D+S E+I +  P GIIL+GG +SV  + S +  + +++  +P+LGICYG Q M ++ GG+V       E+G   + + T + LF+ IE          LD   WMSH D V  +P+GF  +A T  C  A+  N +K+FYGVQFHPEVT T  G ++L++F   IC    +W+P +I  + IE +K  + DD V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE+Q+V  +     G NI  VD +  FL  + G  +PE KRKIIG+ F+E+F++ + K  V  K+L QGTIYPD++ES GS   K   IKSHHNVGGLP+ +   L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+K +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRIREIGVYCELWAWDVSEEQIREFAPNGIILAGGPESVTAENSPRAPEYVFNAGVPVLGICYGMQTMSEQLGGKVIQGVGEGEFGYAQVEVQTESALFKAIEDAVSETGKPLLD--VWMSHGDKVSAIPEGFVAVAKTETCPFAAMANEDKQFYGVQFHPEVTHTRQGKRMLEHFALEICGCPANWKPSSIIEDAIERLKEQIGDDEVILGLSGGVDSSVVAMLLHRAIGDKLTCVFVDNGLLRLNEAQQVMDMFGDHFGLNIVHVDAENRFLDAMAGEAEPEAKRKIIGRVFVEIFDEESKKC-VNAKWLAQGTIYPDVIESAGSATGKAHCIKSHHNVGGLPDDMAMGLVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRLADAIF---IEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVDGISRVVYDISGKPPATIEWE 525
>gi|86606329|ref|YP_475092.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus sp. JA-3-3Ab] >gi|86554871|gb|ABC99829.1| GMP synthase, glutamine-hydrolyzing [Synechococcus sp. JA-3-3Ab] (538 aa)
Score = 1267, Expect = 2.5e-137, Identities = 250/508 (49%), Positives = 346/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIR-LTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP--WQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+ +VYSEI+ Y  + E++ +  P+GIILSGG +SVY   +   +  IW+L IPILG+CYG Q+M+Q+ GG+VE  +  E YG   +  L   +L  N+   +  WMSH DSV  LP GF  +A T+    A+  +  ++ YGVQFHPEV  +  G  L++NFVY IC     W  +    E I E+++ V D  VL A+SGGVDS   A L  +AIGD+L CVF+D G +RK+E Q +  L ++     +  VD ++ FL +L+GV DPE+KRK IG  FI VFE+ + ++  PF+YL QGT+YPD++ES         G + +  IKSHHNVGGLPE L+F+L+EPL+ LFKDEVR+L  SL +P + V R PFPGPGLA+R++GE+T+++LEI+READ + R  I++    S + P  WQ F V L   +SVGV+GD R+Y   + +R V S D M+A W ++P + L  IS+ I N+V  ++RVVYDIT+KPPGTIEWE
  S:    24 IVILDFGSQYSELIARRIRETHVYSEILSYRTTAEQLRQLRPQGIILSGGPNSVYEPGAPACDLEIWNLGIPILGVCYGMQLMVQQLGGKVEPAQKGE-YGRAALHILDPTDLLTNLPESSIMWMSHGDSVTELPPGFHSLAYTDNTPFAAIADPARRLYGVQFHPEVAHSEAGTFLIRNFVYHICGCEPTWTTEAFLEEAIREVRARVGDKRVLLALSGGVDSSTLAFLLHKAIGDQLTCVFIDQGFMRKDEPQRLLRLFQEQFHIPVHYVDGQERFLRQLQGVTDPEEKRKRIGAEFIRVFEEESQRLG-PFEYLAQGTLYPDVIESANTNVDPVTGERIAVKIKSHHNVGGLPENLRFKLVEPLRKLFKDEVRQLARSLGLPEEIVGRHPFPGPGLAIRIVGEVTKERLEILREADMIVRQEINR----SGYYPKLWQAFAVLLPEVRSVGVMGDKRTYACPVVVRLVTSEDGMTADWARVPYDLLATISNRIVNEVPGVNRVVYDITSKPPGTIEWE 538
>gi|57238122|ref|YP_179372.1| bifunctional GMP synthase/glutamine amidotransferase protein [Campylobacter jejuni RM1221] >gi|81353439|sp|Q5HTL3|GUAA_CAMJR GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|57166926|gb|AAW35705.1| GMP synthase [Campylobacter jejuni RM1221] (511 aa)
Score = 1266, Expect = 3.2e-137, Identities = 255/508 (50%), Positives = 343/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG-SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QYTQLIARR+R+  VY+EI+ +++S+ +I  K PKGIILSGG  SVY   +   +KGI+DLN+PILGICYG Q+M       V      +EYG  +I +   N LF+N+      WMSHSD V  LP+GF+V+A++         N +KKF+ +QFHPEV  + FG  +L+NF    C+    W   +    + E+I+  V +D VLCA+SGGVDS V A L A AI +++  VFVD+GLLR  E ++V  + K  +G ++  +D  ++FLS+L  V DPEQKRKIIG TFIEVFE+ A K +   KYL QGT+Y DI+ES     SKTIKSHHNVGGLPE++  +L+EPLK +FKDEVR LGL L +  + VYR PFPGPGLA+R++GE+    LE++R+AD +    +++L     + K WQ F VL N KSVGV+GDNR+Y   + +R VD+ D M+A +  +P E LE IS  I N+V+ I+RVVYDI++KPP TIEWE
  S:     6 ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLTDIKAKEPKGIILSGGPASVYATDAYFCDKGIFDLNLPILGICYGMQLMAHHYKATVA-PAGHKEYGKANIEIKKDNALFKNLPKKQTVWMSHSDKVENLPQGFEVLATSENSPFCVFGNEDKKFFALQFHPEVQHSEFGKNILKNFAKYACNCESVWNMGSFAKTQAEKIREEVGNDKVLCAVSGGVDSSVVAALLASAIKEQVIVVFVDNGLLRSREKEQVEFMFKNTLGIDLISIDASEIFLSRLANVTDPEQKRKIIGNTFIEVFEEEAKK-HKDVKYLAQGTLYTDIIESSVVGASKTIKSHHNVGGLPEKMNLKLIEPLKEIFKDEVRALGLELGLSKEVVYRHPFPGPGLAIRIMGEVNRPGLELLRKADVIL---LEELKSTGWYDKTWQAFCVLLNVKSVGVMGDNRTYDNAVCIRVVDASDGMTATFSHLPYEVLENISRRIINEVEGINRVVYDISSKPPATIEWE 511
>gi|167627943|ref|YP_001678443.1| bifunctional GMP synthase/glutamine amidotransferase protein [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167597944|gb|ABZ87942.1| GMP synthase (glutamine-hydrolyzing) [Francisella philomiragia subsp. philomiragia ATCC 25017] (516 aa)
Score = 1266, Expect = 3.3e-137, Identities = 259/509 (50%), Positives = 351/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGST--DIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R++ V+ EI  +DI+ + I   + KGIILSGG +SVY D  +K  + +++L +P+LGICYG Q M+ ++GG+V+   D  E+G    +I  ++  +F N++ + + WMSHSD V    + F+VIAS+    VA+  ++ K FYGVQFHPE T T  G Q+++NF  +IC     W  +NI    I+EIK  V  D V+  +SGGVDS V A +  +AIGD+L C+FVD GLLR NE  +V  +  + +  N+  V+ K  FL  LKG+ DPE+KRKIIGK F+++F++ A KI    K+L QGTIY D++ES G+  SK   IKSHHNVGGLP+ ++ +LLEPL+ LFKDEVRKLGL L +PY  +YR PFPGPGL VR+LGEI ++ +E +++AD +F    ++LYK N  H   Q F V    KSVGVVGD R Y Y +ALRAV S+D M+A W  +P + L  +S+ I N+VK +SRVVYD+T KPPGTIEWE
  S:     8 KILILDFGSQYTQLIARRVREVGVFCEIFPHDIADDFIKDYHAKGIILSGGPESVY-DSDVKAPEIVFELGVPVLGICYGMQTMVMQHGGEVKG-ADQSEFGKAIVNILKSSENIFSNLKTEQSVWMSHSDKVTQTGEHFEVIASSTNAPVAAVAHKSKPFYGVQFHPETTHTENGKQIIENFALNICKCDALWNIENIIENDIKEIKKQVGSDRVILGLSGGVDSSVVAAILHEAIGDQLTCIFVDTGLLRLNEGDQVMEVFAEHMDINVIRVNAKNRFLDALKGIGDPEEKRKIIGKLFVDIFDEEAAKIENA-KWLAQGTIYSDVIESAGNSQSKAHVIKSHHNVGGLPKEMKLKLLEPLRELFKDEVRKLGLGLGLPYNMLYRHPFPGPGLGVRILGEIKKEYVETLQKADAIF---TEELYKHNLYHDISQAFGVFLPVKSVGVVGDQRRYEYVIALRAVVSIDFMTATWANLPYDFLSIVSNRIVNEVKQVSRVVYDVTGKPPGTIEWE 516
>gi|84387649|ref|ZP_00990666.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio splendidus 12B01] >gi|84377494|gb|EAP94360.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio splendidus 12B01] (517 aa)
Score = 1266, Expect = 3.3e-137, Identities = 249/509 (48%), Positives = 348/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLY-KNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARRIR++ VY E+  +D+   +I + NP GIILSGG +SV  + S +  + ++D  +P+ GICYG Q M ++ GG+V    +  E+G   +++T  + LF ++E   + WMSH D V+ +P  F  IA T+ C  A+  N +KK+YGVQFHPEVT T  G ++L+NFV + C   G W   +I  + +  IK  V DD V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE ++V  +     G NI  VD ++ FL+ L+G  +PE KRKIIG  F+++F++ + K+    K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+  +  HK  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L K+S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRIREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEENSPRAPQYVFDSGVPVFGICYGMQTMAEQLGGKVATSTE-REFGYAAVQVTGESALFADLETTQDVWMSHGDKVVEIPTDFTKIAETDTCPYAAMANEDKKYYGVQFHPEVTHTKNGLKMLENFVLNACGCEGLWTSASIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAMLAHRAIGDKLTCVFVDNGLLRLNEGEQVMDMFGDKFGLNIIKVDAEERFLNALEGEAEPEAKRKIIGHVFVDIFDEESKKLKNA-KWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHAADLYHKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517
>gi|86608644|ref|YP_477406.1| bifunctional GMP synthase/glutamine amidotransferase protein [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86557186|gb|ABD02143.1| GMP synthase, glutamine-hydrolyzing [Synechococcus sp. JA-2-3B'a(2-13)] (536 aa)
Score = 1266, Expect = 3.5e-137, Identities = 249/508 (49%), Positives = 346/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIR-LTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP--WQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+ +VYSEI+ Y  + E++ +  P+GIILSGG +SVY   +   +  IW+L IP+LG+CYG Q+M+Q+ GG+VE  +  E YG   +  L   +L  N+  ++  WMSH DSV  LP GF  +AST+    A+  +  ++ YGVQFHPEV  +  G  L++NFVY IC     W       E I E+++ V +  VL A+SGGVDS   A L  +AIGD+L CVF+D G +RK+E Q +  L ++     +  VD ++ FL +L+GV DPE+KRK IG  FI VFE+ + ++  PF+YL QGT+YPD++ES         G + +  IKSHHNVGGLPE L+F+L+EPL+ LFKDEVR+L  SL +P + V R PFPGPGLA+R++GE+T+++LE +READ + R  I++    S + P  WQ F V L   +SVGV+GD R+Y   + +R V S D M+A W ++P + L  IS+ I N+V  I+RVVYDIT+KPPGTIEWE
  S:    22 IVILDFGSQYSELIARRIRETHVYSEILSYRTTAEQLRQLQPQGIILSGGPNSVYEPAAPVCDPEIWNLGIPVLGVCYGMQLMVQQLGGKVEAAQKGE-YGRAALHILDPTDLLTNLPENSIMWMSHGDSVTELPPGFHTLASTDNTPCAAIADPRRRLYGVQFHPEVAHSEAGAFLIRNFVYHICGCEPTWTTAAFLEEAIREVRARVGNKKVLLALSGGVDSSTLAFLLHKAIGDQLTCVFIDQGFMRKDEPQRLLRLFQEQFHIPVHYVDGQERFLRQLQGVTDPEEKRKRIGAEFIRVFEEESQRLG-PFEYLAQGTLYPDVIESANTHVDPVTGERIAVKIKSHHNVGGLPENLRFKLVEPLRKLFKDEVRQLARSLGLPEEIVGRHPFPGPGLAIRIVGEVTKERLETLREADMIVRQEINR----SGYYPKLWQAFAVLLPEVRSVGVMGDKRTYACPVVVRLVTSEDGMTADWARVPYDLLATISNRIVNEVPGINRVVYDITSKPPGTIEWE 536
>gi|148926245|ref|ZP_01809930.1| GMP synthase (glutamine-hydrolyzing) [Campylobacter jejuni subsp. jejuni CG8486] >gi|145845416|gb|EDK22509.1| GMP synthase (glutamine-hydrolyzing) [Campylobacter jejuni subsp. jejuni CG8486] (511 aa)
Score = 1266, Expect = 3.7e-137, Identities = 254/508 (50%), Positives = 343/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG-SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QYTQLIARR+R+  VY+EI+ +++S+ +I  K PKGIILSGG  SVY   +   +KGI+DLN+P+LGICYG Q+M       V      +EYG  +I +   N LF+N+      WMSHSD V  LP+GF+V+A++         N +KKF+ +QFHPEV  + FG  +L+NF    C+    W   +    + E+I+  V +D VLCA+SGGVDS V A L A AI +++  VFVD+GLLR  E ++V  + K  +G ++  +D  ++FLS+L  V DPEQKRKIIG TFIEVFE+ A K +   KYL QGT+Y DI+ES     SKTIKSHHNVGGLPE++  +L+EPLK +FKDEVR LGL L +  + VYR PFPGPGLA+R++GE+    LE++R+AD +    +++L     + K WQ F VL N KSVGV+GDNR+Y   + +R VD+ D M+A +  +P E LE IS  I N+V+ I+RVVYDI++KPP TIEWE
  S:     6 ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLADIKAKEPKGIILSGGPASVYATDAYFCDKGIFDLNLPVLGICYGMQLMAHHYKATVA-PAGHKEYGKANIEIKKDNALFKNLPKKQTVWMSHSDKVENLPQGFEVLATSENSPFCVFGNEDKKFFALQFHPEVQHSEFGKNILKNFAKYACNCESVWNMGSFAKTQAEKIREEVGNDKVLCAVSGGVDSSVVAALLASAIKEQVIVVFVDNGLLRSGEKEQVEFMFKNTLGIDLISIDASEIFLSRLANVTDPEQKRKIIGNTFIEVFEEEAKK-HKDVKYLAQGTLYTDIIESSVVGASKTIKSHHNVGGLPEKMNLKLIEPLKEIFKDEVRALGLELGLSKEVVYRHPFPGPGLAIRIMGEVNRASLELLRKADVIL---LEELKSTGWYDKTWQAFCVLLNVKSVGVMGDNRTYDNAVCIRVVDASDGMTATFSHLPYEILENISRRIINEVEGINRVVYDISSKPPATIEWE 511
>gi|169180807|ref|ZP_02841448.1| GMP synthase, large subunit [Thauera sp. MZ1T] >gi|169012038|gb|EDS58793.1| GMP synthase, large subunit [Thauera sp. MZ1T] (521 aa)
Score = 1266, Expect = 3.8e-137, Identities = 253/509 (49%), Positives = 342/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNC--------WMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG---SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG Q +QLIARR+R+  VY E+  +D+S E +     +G+ILSGG +SVY     +  + +++L +P+LGICYG Q M  + GG+VE+     E+G  ++R    ++LF  IE  +N         WMSH D V  LP GFK+I S     +A+  +  + FYGVQFHPEVT T  G +++  FV+ IC    DW   +   E +++I+  V D+ V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR NE + V  +    +   +  VD  + F+  LKGV DPEQKRKIIG+ F+EVF+  A K+    ++L QGTIYPD++ESG   SK + TIKSHHNVGGLPE L  +LLEPL+ LFKDEVR+LG++L +P+  VYR PFPGPGL VR+LGE+ +D  +++R AD +F   ID+L     + K  Q F V    KSVGV+GD R+Y Y +ALRAV + D M+A W ++P   L K+S+ I N+V+ I+RVVYDI+ KPP TIEWE
  S:     5 KILILDFGSQVSQLIARRVREQQVYCELHPFDVSDEFVRNFGAQGVILSGGPNSVYEAEDWRAPQAVFELGVPVLGICYGMQTMASQLGGKVESSA-KREFGYAEMRARGHSKLFTGIEDRSNAEGHGLLDVWMSHGDKVTALPPGFKIIGSNESTPIAAMADEARGFYGVQFHPEVTHTIKGKEMIGRFVHDICGCGHDWNMPDYIEEAVQKIREQVGDEEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDHGLLRLNEGKLVMEMFAGRLHAKVVHVDATEQFMGHLKGVTDPEQKRKIIGREFVEVFQAEARKLPNA-RWLAQGTIYPDVIESGGAKSKKAHTIKSHHNVGGLPETLGLKLLEPLRDLFKDEVRELGVALGLPHDMVYRHPFPGPGLGVRILGEVRQDFADLLRRADAIF---IDELRAADWYDKTSQAFAVFLPVKSVGVMGDGRTYEYVVALRAVQTQDFMTAHWAELPHSLLGKVSNRIINEVRGINRVVYDISGKPPATIEWE 521
>gi|28868657|ref|NP_791276.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pseudomonas syringae pv. tomato str. DC3000] >gi|38257474|sp|Q886X5|GUAA_PSESM GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|28851896|gb|AAO54971.1| GMP synthase [Pseudomonas syringae pv. tomato str. DC3000] (525 aa)
Score = 1266, Expect = 3.9e-137, Identities = 248/509 (48%), Positives = 347/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSE-EYGSTDIRLTTNELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY E+  +D+  E I +  PKG+IL+GG +SV+   S +  + ++DL +P+ GICYG Q M ++ GG+V   +  E  Y   D+ +  + L + IE           + WMSH D V  LP+ F ++AST  C +A   +  + +YGVQFHPEVT T  G ++L  F+  IC     W P  I  + I ++++ V  D VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E ++V A+  + +G  +   + ++ FL+ L+G  DPE+KRKIIG+TFI+VF+  + K++   KYL QGTIYPD++ES G+K  K   IKSHHNVGGLPE +  +L+EPL+ LFKDEVR+LGL L +PY  VYR PFPGPGL VR+LGE+ ++  +I+R AD +F   I++L K +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LE +S  I N+++ ISRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFAPKGVILAGGPESVHEANSPRCPQAVFDLGVPVFGICYGMQTMAEQLGGKVAGSELREFGYARVDV-VGKSRLLDGIEDHIDADGLFGLDVWMSHGDKVTKLPEDFHILASTPSCPIAGMADDARGYYGVQFHPEVTHTKQGGRILSRFILDICGCEALWTPSKIAEDAIAQVRAQVGTDSVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLHEGEQVMAMFAENMGVKVIRANAEEQFLNNLEGESDPEKKRKIIGRTFIDVFDAESCKLD-NIKYLAQGTIYPDVIESAGAKSGKAHVIKSHHNVGGLPEEMNLKLVEPLRELFKDEVRRLGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADILRRADHIF---IEELRKADWYHKVSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETIDFMTARWAHLPYELLETVSGRIINEIEGISRVTYDVSSKPPATIEWE 525
>gi|153833546|ref|ZP_01986213.1| GMP synthase (glutamine-hydrolyzing) [Vibrio harveyi HY01] >gi|156973390|ref|YP_001444297.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio harveyi ATCC BAA-1116] >gi|148870197|gb|EDL69138.1| GMP synthase (glutamine-hydrolyzing) [Vibrio harveyi HY01] >gi|156524984|gb|ABU70070.1| hypothetical protein VIBHAR_01077 [Vibrio harveyi ATCC BAA-1116] (517 aa)
Score = 1265, Expect = 4.6e-137, Identities = 250/509 (49%), Positives = 348/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLY-KNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARR+R++ VY E+  +D+   +I + NP GIILSGG +SV  D S +  + ++D  +P+LG+CYG Q M ++ GG+V    +  E+G   ++++  + LF+++EL  + WMSH D V+ +P  F  +  T+ C  A+  N EKK+YGVQFHPEVT T  G Q+L+NFV  +C     W  ++I  + +  IK  V DD V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE Q+V  +     G NI  VD +  FL  L+G  DPE+KRK IG  F++VF++ + K+    K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGEI ++  +++R AD +F   I++L+  +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L K+S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEDNSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGKVAGSTE-REFGYAQVKVSGESALFKDLELTQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVTHTKGGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAMLVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDQFGLNIIKVDAEDRFLKALEGKSDPEEKRKTIGHVFVDVFDEESKKLKNA-KWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRADAIF---IEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGKVSNRIINEVDGISRVVYDISGKPPATIEWE 517
>gi|59711245|ref|YP_204021.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio fischeri ES114] >gi|75354446|sp|Q5E763|GUAA_VIBF1 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|59479346|gb|AAW85133.1| GMP synthetase (glutamine aminotransferase) [Vibrio fischeri ES114] (517 aa)
Score = 1265, Expect = 4.6e-137, Identities = 250/509 (49%), Positives = 347/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARRIR++ VY E+  +D+   +I   NP GIILSGG +SV  + S +  + ++D  +P+ G+CYG Q M ++ GG+V    +  E+G   +++T  + LF+++E   + WMSH D V+ +P  F  IA T  C  A+  N EKK+YGVQFHPEVT T  G ++L+NFV ++C   G W   +I  + +  IK  V DD V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE+ +V  +     G NI  V+ +Q FL  L+G  DPE KRKIIG  F+++F++ + K+    K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGEI ++  +++R AD +F   I++L+  +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L K+S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRIREIGVYCELWSWDVEESDIRDFNPDGIILSGGPESVTEENSPRAPQYVFDSGVPVFGVCYGMQTMAEQLGGKVATSTE-REFGYAAVQVTGESALFKDLEATQDVWMSHGDKVVEIPSDFVKIAETETCPYAAMANEEKKYYGVQFHPEVTHTKNGMKMLENFVLNVCGCEGLWTSASIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAMLAHRAIGDKLTCVFVDNGLLRLNEADQVMEMFGNKFGLNIVHVNAEQRFLDALEGESDPETKRKIIGHVFVDIFDEESKKLKNA-KWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRADAIF---IEELHNADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517
>gi|15792572|ref|NP_282395.1| bifunctional GMP synthase/glutamine amidotransferase protein [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|86150584|ref|ZP_01068807.1| GMP synthase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88596187|ref|ZP_01099424.1| GMP synthase [Campylobacter jejuni subsp. jejuni 84-25] >gi|13627146|sp|Q9PN49|GUAA_CAMJE GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|85838935|gb|EAQ56201.1| GMP synthase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88191028|gb|EAQ95000.1| GMP synthase [Campylobacter jejuni subsp. jejuni 84-25] >gi|112360566|emb|CAL35363.1| GMP synthase (glutamine-hydrolyzing) [Campylobacter jejuni subsp. jejuni NCTC 11168] (511 aa)
Score = 1265, Expect = 5.0e-137, Identities = 254/508 (50%), Positives = 343/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG-SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QYTQLIARR+R+  VY+EI+ +++S+ +I  K PKGIILSGG  SVY   +   +KGI+DLN+P+LGICYG Q+M       V      +EYG  +I +   N LF+N+      WMSHSD V  LP+GF+V+A++         N +KKF+ +QFHPEV  + FG  +L+NF    C+    W   +    + E+I+  V +D VLCA+SGGVDS V A L A AI +++  VFVD+GLLR  E ++V  + K  +G ++  +D  ++FLS+L  V DPEQKRKIIG TFIEVFE+ A K +   KYL QGT+Y DI+ES     SKTIKSHHNVGGLPE++  +L+EPLK +FKDEVR LGL L +  + VYR PFPGPGLA+R++GE+    LE++R+AD +    +++L     + K WQ F VL N KSVGV+GDNR+Y   + +R VD+ D M+A +  +P E LE IS  I N+V+ I+RVVYDI++KPP TIEWE
  S:     6 ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLADIKAKEPKGIILSGGPASVYATDAYFCDKGIFDLNLPVLGICYGMQLMAHHYKATVA-PAGHKEYGKANIEIKKDNALFKNLPKKQTVWMSHSDKVENLPQGFEVLATSENSPFCVFGNEDKKFFALQFHPEVQHSEFGKNILKNFAKYACNCESIWNMGSFAKTQAEKIREEVGNDKVLCAVSGGVDSSVVAALLASAIKEQIIVVFVDNGLLRSGEKEQVEFMFKNTLGIDLISIDASEIFLSRLVNVTDPEQKRKIIGNTFIEVFEEEAKK-HKDVKYLAQGTLYTDIIESSVVGASKTIKSHHNVGGLPEKMNLKLIEPLKEIFKDEVRALGLELGLSKEVVYRHPFPGPGLAIRIMGEVNRASLELLRKADVIL---LEELKSTGWYDKTWQAFCVLLNVKSVGVMGDNRTYDNAVCIRVVDASDGMTATFSHLPYEILENISRRIINEVEGINRVVYDISSKPPATIEWE 511
>gi|42557756|emb|CAF28730.1| putative GMP synthetase [uncultured crenarchaeote] (510 aa)
Score = 1264, Expect = 5.9e-137, Identities = 248/509 (48%), Positives = 348/509 (68%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSK----TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIE 509
           MDKI++LDFG QY+ LI RRIR+ NVY E++ Y+  I  I K  PKGI+LSGG  SVY + S KP+K I+D+ IP+LGICYG Q+++ E  G+++   D+ EYG  D+ +  N +LF+ I     CWMSH+D+   +P  F ++A TN    A+  NR + FYG+QFHPEV+ T  GN++L+NF +SI +   DW  +      I++I+S V++D VLCAISGG+DS   AVL  +AI   L CVFV++GLLR++E   V  L+ K +G +   +D +Q FLS+L G+ DPEQKRKIIG+ F +VF KV      PF++L QGT+YPD++ESG  FSK     IK+HHNVGGLP+ L  ++LEP + L+KDEVRK+ L LDIP + + R PFPGPGLAVR++GE+T +K+ IVR A  L  S +  +      K WQ +  + +  +VGV+GD R YG+ + +R V+S+DAM+A W +IP E + KIS+ I N+V  ++ V Y +++KPP TIE
  S:     1 MDKIVVLDFGSQYSHLICRRIRESNVYCELLPYNSPISLIKKLEPKGIVLSGGPSSVYLEGSPKPDKKIFDMGIPVLGICYGHQLIVNEFDGKIKR-FDNREYGLADLEIDDNSDLFKGINKKIRCWMSHADAAETIPNDFNILAHTNNSNSAAIANRNRGFYGIQFHPEVSHTEEGNRILRNFSHSISNAKPDWTMEGFVDFSIKDIRSKVQEDRVLCAISGGIDSTTLAVLLNKAISKNLACVFVNNGLLRQDEETLVPELISKHLGIDTITIDAEQRFLSRLNGITDPEQKRKIIGEEFAQVFLKVTKDYG-PFQWLAQGTLYPDVIESG--FSKGPAAVIKTHHNVGGLPDWLNLKVLEPFRSLYKDEVRKIALLLDIPNEFIKRHPFPGPGLAVRIIGEVTNEKIRIVRHASSLVESEL--MAAGWYDKVWQAYAAVGDDLAVGVLGDERVYGHIVTIRIVESLDAMTADWSRIPHELISKISNRITNEVNGVTWVTYSVSSKPPATIE 508
>gi|167457351|ref|ZP_02323565.1| GMP synthase, large subunit [Anaeromyxobacter dehalogenans 2CP-1] >gi|167416502|gb|EDR83216.1| GMP synthase, large subunit [Anaeromyxobacter dehalogenans 2CP-1] (518 aa)
Score = 1264, Expect = 6.1e-137, Identities = 252/510 (49%), Positives = 345/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI---NVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KILILDFG QYTQLIARR+R+L VY EI       E I    P+G++LSGG  SV  + S + ++ +++L +P+LGICYG QV   E GG+V+      E+G   I +  T+ LF+ +    + WMSH D V  LP GF+ IA+T     A+  +R ++FYGVQFHPEV  T  G  +L+NF Y +C  +G W  +      +E+I++ VKD +V+CA+SGGVDS VAA+L  +AIGD+L C+FVD+G+LR  E Q+V  +   +    +  VD  + FL  L GV DPE+KRKIIG  FI VFE+   ++       K+L+QGT+YPD++ES S    S TIKSHHNVGGLPE++   L+EPL+ LFKDEVR+LGL L +P   V RQPFPGPGLA+RVLGE+TE++L ++R AD + +  +    LY+    K WQ F VL   +SVGV+GD R+Y  T A+RAV+S D M+  W ++P + L ++SS I N+V+ I+RVVYDI++KPP TIEWE
  S:     6 EKILILDFGSQYTQLIARRLRELGVYCEIHPCTAKAEAIRAFRPRGVVLSGGPASVLAEGSPRCDRVVFELGVPVLGICYGLQVFAAELGGRVDQAA-HREFGPATIEVKATSPLFQGLPATLDVWMSHGDRVEALPPGFEPIAATASAPYAAVEDRARRFYGVQFHPEVVHTPRGKDVLRNFAYGVCGCSGTWSMRGYAEAAVEQIRAQVKDGHVICALSGGVDSAVAALLVHRAIGDRLRCIFVDNGVLRAGERQQVEDVFGAMFHLPLVTVDASRRFLGALAGVTDPERKRKIIGHEFIAVFEQEVERLAAHGARAKFLVQGTLYPDVIESVSFRGPSATIKSHHNVGGLPEKMNLSLVEPLRELFKDEVRQLGLELGLPEAIVRRQPFPGPGLAIRVLGEVTEERLAVLRRADTIVQEEVRAAGLYE----KLWQGFAVLLPVRSVGVMGDERTYESTCAIRAVESTDGMTGDWARLPYDLLARLSSRIINEVRGINRVVYDISSKPPATIEWE 518
>gi|118594656|ref|ZP_01552003.1| bifunctional GMP synthase/glutamine amidotransferase protein [Methylophilales bacterium HTCC2181] >gi|118440434|gb|EAV47061.1| bifunctional GMP synthase/glutamine amidotransferase protein [Methylophilales bacterium HTCC2181] (521 aa)
Score = 1264, Expect = 6.6e-137, Identities = 258/511 (50%), Positives = 347/511 (67%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNN--------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG---SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +DK+LILDFG QYTQLIARR+R++NVY EI+ YD+    I + NPK II SGG +SVY + + K  K  + L  PILGICYG Q M  +  G+V    +  E+G  +IR    ++LF+ I+   N         WMSH D V+ LP GF+VIAS     +A+  N+EK++YGVQFHPEVT T  G  ++  FV  I   + +W   +     +  IKSIV DD V+  +SGGVDS VAA L  +AIG +L C+FVDHG+LR NE++ V    KK +G  +  VD    F+S L G+ DPE+KRKIIG+ F+EVF++ A K +   K+L QGTIYPD++ES    +K +  IKSHHNVGGLPE L  +LLEPL+ LFKDEVR+LG++L +P   VYR PFPGPGL VR+LGE+  +  +++R+AD +F   +++L  +  + K  Q FTV    KSVGV+GD R+Y Y ++LRAV + D M+A W ++P   L K+S+ I N+VK I+RVVYDI+ KPP TIEWE
  S:     3 VDKVLILDFGSQYTQLIARRVREMNVYCEILPYDVDPGRIEQFNPKAIIFSGGPNSVYAEDTPKAPKIAFALQCPILGICYGMQTMASQLAGKVAT-SNQREFGYAEIRAQGHSDLFKGIQDKTNDQGHGLLDVWMSHGDKVVDLPPGFEVIASNASTPIAAIGNKEKQYYGVQFHPEVTHTKQGKNIISRFVIDIAGCSQEWNMPDYVETAVNHIKSIVGDDEVILGLSGGVDSSVAAALIHRAIGAQLTCIFVDHGMLRLNEAEIVMETFKKNLGVKVIHVDATDKFMSDLVGISDPEEKRKIIGRDFVEVFQEHAEKFH-QVKWLAQGTIYPDVIESAGGKTKKAHNIKSHHNVGGLPETLNLQLLEPLRELFKDEVRELGVALGLPKGMVYRHPFPGPGLGVRILGEVKIEFADLLRKADAIF---MEELKSSGWYDKTSQAFTVFLPVKSVGVMGDGRTYEYVVSLRAVVTSDFMTAHWAELPYSLLGKVSNRIINEVKGINRVVYDISGKPPATIEWE 521
>gi|110834711|ref|YP_693570.1| bifunctional GMP synthase/glutamine amidotransferase protein [Alcanivorax borkumensis SK2] >gi|110647822|emb|CAL17298.1| GMP synthase (glutamine-hydrolysing) [Alcanivorax borkumensis SK2] (523 aa)
Score = 1264, Expect = 6.6e-137, Identities = 253/509 (49%), Positives = 343/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDI-RLTTNELFENIELDN--------NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS-EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY EI  +D++ EE+ +  PKGIILSGG +SV   ++ +  + +++  IP+LGICYG Q M ++ GG+V    +  E+G   + +   N L + I +D+        + WMSH D V  +P GF   A+T  C +A   N EK+FYG+QFHPEVT T  G +LL+ F+  +C+    W P NI  + I+ I+  V  D V+  +SGGVDS V A L  +AIGD+L CVFVD+GLLR  E  +V  +    +G  +  VD +  FL KL G  DPE+KRKIIG TFI++F+  A+K+     +L QGTIYPD++ES  SK  K   IKSHHNVGGLPE ++ +L+EPL+ LFKDEVRK+GL L +PY  VYR PFPGPGL VR+LGE+ ++  + +R AD +F   I++L      HK  Q F V    KSVGVVGD R Y Y +ALRAV+++D M+A+W  +P + LE +SS I N++  ISRV YDI++KPP TIEWE
  S:     8 RILILDFGSQYTQLIARRVREIGVYCEIRAFDMTAEELAEFAPKGIILSGGPESVTAAQTPRAPQAVFEAGIPVLGICYGMQTMAEQLGGKVIAG-EKHEFGYARVEKAEPNALLDGI-VDHEEQGKEFLDVWMSHGDRVGEMPAGFVATATTGSCPIAGMANDEKRFYGIQFHPEVTHTLQGGRLLERFIRELCECEALWTPSNIISDAIDTIREQVGTDEVILGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRHQEGDQVMEMFADNMGVKVIRVDAEDNFLGKLAGEADPEKKRKIIGNTFIDIFDDEASKLQNA-NWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPEDMKLKLVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADTLRLADHIF---IEELRAAGLYHKTSQAFAVFLPVKSVGVVGDARRYEYVVALRAVETIDFMTARWAHLPYDFLELVSSRIINEIPGISRVTYDISSKPPATIEWE 523
>gi|33239490|ref|NP_874432.1| bifunctional GMP synthase/glutamine amidotransferase protein [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|44887938|sp|Q7VEH5|GUAA_PROMA GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|33237015|gb|AAP99084.1| GMP synthase [Prochlorococcus marinus subsp. marinus str. CCMP1375] (528 aa)
Score = 1263, Expect = 7.1e-137, Identities = 251/508 (49%), Positives = 343/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+  VYS ++ Y+ S+EE+ K +P+GIILSGG  SVY +++   +  IWDL+IPILG+CYG QVM+++ GG V       EYG   +++     L  N+E  +  WMSH DSV  LP GF  +A T     A+    +++FYGVQFHPEV  +T G  +++NFV++IC    DW       E I +++  V    VL A+SGGVDS   A L  +AIG++L C+F+D G +RK E + +     K    N+  ++ +  FL KL+GV DPE+KRKIIG  FI VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRK+G SL +P + V R PFPGPGLA+R+LGE+T++KL  +R+AD + R  I    LY    H+ WQ F VL   +SVGV+GD R+Y + + LR V S D M+A W ++P   LEKIS+ I N+V  ++RVV DIT+KPPGTIEWE
  S:    14 IVILDFGSQYSELIARRIRETEVYSMVLGYNSSVEELKKLSPQGIILSGGPSSVYEEKAPLCDPSIWDLDIPILGVCYGMQVMVKQLGGLVGEAIGKAEYGKALLQVDDPTALLTNVENGSTMWMSHGDSVKQLPAGFVRLAHTTNTPDAAIACHDRRFYGVQFHPEVVHSTDGMVIIRNFVHNICRSKPDWTTNTFIDEAINDVQEKVGKKRVLLALSGGVDSSTLAFLLKKAIGNQLTCMFIDQGFMRKGEPEFLMEFFDKKFHINVEYINARDRFLDKLQGVSDPEKKRKIIGTEFIRVFEEESLRLG-PFDYLAQGTLYPDVIESSGTNIDPKTGERIAVKIKSHHNVGGLPKDLQFKLVEPLRTLFKDEVRKVGRSLGLPEEIVNRHPFPGPGLAIRILGEVTKEKLNCLRDADLIVREEIADAGLY----HQIWQAFAVLLPVRSVGVMGDQRTYAWPIVLRCVSSEDGMTADWSRLPNSLLEKISNRIVNEVNGVNRVVLDITSKPPGTIEWE 528
>gi|150020613|ref|YP_001305967.1| bifunctional GMP synthase/glutamine amidotransferase protein [Thermosipho melanesiensis BI429] >gi|149793134|gb|ABR30582.1| GMP synthase, large subunit [Thermosipho melanesiensis BI429] (513 aa)
Score = 1263, Expect = 7.6e-137, Identities = 260/511 (50%), Positives = 355/511 (69%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPF---KYLLQGTIYPDIVESG---SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           M  +++LD+G QYTQLI RR+R+   Y+E++ +D   EE+ + NP  IILSGG  SVY   +    + +  LNIPILGICYG Q ++ + GG+VE  +   E+G   + +  + LFE +    + WMSHSD V  LP+GF VI  +     A+  N+ +  YGVQFHPEVT T FG+++L+NFV  I  +  +WE K+   EKI+EIK IV +D V+  +SGGVDS V A+L  +AIGD L  VFVD GLLR NE +EV    ++L G  IF+VD K+ FL  LK V DPE+KRKIIG TFI+VF + + ++   F   KYL QGT+YPDI+ES     K +  IK+HHNVGGLPE+L F+++EPL+YLFKDEVRK+G  L++P   + R PFPGPGLAVR++G++TE+ + I+++AD++F   I++L KN+ + K WQ F V    KSVGV+GD R+Y   +ALRAV+S D M+A W K+P E L K++  I N+VK ++RVVYDIT+KPP TIEWE
  S:     1 MKTVVVLDYGSQYTQLIVRRVREKGYYAELLPWDAKEEEVKRLNPTAIILSGGPSSVYEKDAPFVPEYVLHLNIPILGICYGLQALVHKFGGRVEKSQ-KREFGHAILEVEEDPLFEGLPKKFDVWMSHSDRVEKLPEGFYVIGRSENSPFAAIRNKNETIYGVQFHPEVTHTQFGSKILENFVSKIAKMEKNWEMKDFVSEKIKEIKGIVGNDKVILGLSGGVDSSVVAMLLHKAIGDNLVPVFVDTGLLRLNEGEEVKENFERL-GIKIFVVDAKKRFLDALKDVEDPEEKRKIIGHTFIDVFYETSMQLLEEFGNIKYLAQGTLYPDIIESKVSERKSAAKIKTHHNVGGLPEKLPFKIIEPLRYLFKDEVRKIGEILELPQSMINRHPFPGPGLAVRIIGKVTEEAISILQKADYIF---IEELKKNNLYDKVWQAFAVFLPIKSVGVMGDYRTYENVIALRAVNSFDGMTADWSKLPHEFLNKVAKRIINEVKGVNRVVYDITSKPPATIEWE 513
>gi|145589603|ref|YP_001156200.1| bifunctional GMP synthase/glutamine amidotransferase protein [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145048009|gb|ABP34636.1| GMP synthase (glutamine-hydrolyzing) [Polynucleobacter sp. QLW-P1DMWA-1] (535 aa)
Score = 1263, Expect = 7.9e-137, Identities = 262/510 (51%), Positives = 343/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIK----KNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV---ENDKDSEEYGSTDIRLT--TNEL-----FENIELDN--NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLF----RSYIDQLYKNSEHK-PWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKILILDFG Q TQLIARR+RD  VYSEI  YD   E I K    +  KGIILSGG +SV  D S +  + +++L +P+LGICYG Q M  + GG V   E+   + E+G +++R    TN L     F   E       WMSH DSV  LP  FK++AST  C +A   + +++FY  QFHPEVT T  G  +++ FV+ IC    DW   +   E +E I+  V D+ V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR NE   V  +  + +G  +  VD    F+ KL GV DPE KRKIIGK F+E+F+  + KI    K+L QGTIYPD++ES   G K + TIKSHHNVGGLPE +  +LLEPL+ LFKDEVR+LG++L +P + VYR PFPGPGL VR+LGE+  +   +++ AD +F    R+ ID++ + S +    Q F V    KSVGV+GD R+Y Y +ALRAV + D M+A W  +P E L K+S+ I N+V+ I+RVVYDI+ KPP TIEWE
  S:     3 DKILILDFGSQVTQLIARRVRDARVYSEIHPYDCDPEFIRKFIQEQGGKGIILSGGPNSVTEDGSPRAPQIVFELGVPVLGICYGMQTMATQLGGAVASAESLGKAREFGYSEVRAHGHTNLLKGIQDFSTSEGHGILKVWMSHGDSVTALPPAFKLMASTESCPIAGMADEDRRFYAFQFHPEVTHTIQGTAIIERFVHEICHCKPDWVMGDYIAEAVEHIRKQVGDEEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDHGLLRLNEGDMVMEMFARNLGVKVIRVDAASTFMGKLTGVADPEAKRKIIGKEFVEIFQSESGKIENA-KWLAQGTIYPDVIESAGKGKKGAHTIKSHHNVGGLPEDMHLKLLEPLRELFKDEVRELGVALGLPREMVYRHPFPGPGLGVRILGEVKAEFASLLQRADAIFIEELRNTIDEVSQKSWYDLTSQAFAVFLPVKSVGVMGDGRTYEYVVALRAVQTQDFMTAHWAHLPHELLGKVSNRIINEVRGINRVVYDISGKPPATIEWE 535
>gi|194682891|emb|CAR43237.1| GMP synthase [glutamine-hydrolyzing] [Proteus mirabilis HI4320] (525 aa)
Score = 1263, Expect = 8.7e-137, Identities = 260/509 (51%), Positives = 347/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSE-EYGSTDIRLTTNELFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFS---KTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARRIR++ VY E+  +D++ E+I + NP GIILSGG +S   D S +  + +++  +P+LGICYG Q M  + GG VE   + E  Y   +IR  T ELF +I+          LD   WMSH D V  +P  F  IAST  C  A   N EK+FYGVQFHPEVT T  G  +L+ FV  IC     W    I  + +  +K  + DD+V+ A+SGGVDS V A+L  +AIG +L CVFVD+GLLR NE+++V A+ K     NI  V+ +  FL+ LKG  DPE+KRKIIG TFIE+F++ A K+    K+L QGTIYPD++ES +  +     IKSHHNVGGLPE ++  L+EPLK LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGEI ++  +++R AD +F   I++L+K +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRIREIGVYCELWAWDVTEEQIREFNPNGIILSGGPESTTEDNSPRAPEYVFNAGVPVLGICYGMQTMSMQLGGDVEVSGEREFGYSQVEIR-ETCELFRDIQDSVSEDGKPLLD--VWMSHGDKVTAIPADFVTIASTETCPFAIMANEEKRFYGVQFHPEVTHTHQGLAILKRFVLDICGCDALWTSAAIIEDTVARLKQQIGDDHVILALSGGVDSSVTALLLNRAIGKRLTCVFVDNGLLRLNEAEQVMAMFKGKFDLNIIHVEAEDRFLTALKGENDPEKKRKIIGHTFIEIFDEEAVKLP-QVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPEDMKLGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRADAIF---IEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETVDFMTAHWAHLPYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 525
>gi|163724743|ref|ZP_02132271.1| GMP synthase, large subunit [Desulfatibacillum alkenivorans AK-01] >gi|161401952|gb|EDQ26192.1| GMP synthase, large subunit [Desulfatibacillum alkenivorans AK-01] (509 aa)
Score = 1262, Expect = 8.9e-137, Identities = 252/508 (49%), Positives = 345/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKF---SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+I+DFG QY QLIARR+R+  V+ +I    +++E++    P GIILSGG  S+Y + S K +  + +L IP+LGICYG Q M+   GG+VE   D  EYG           LFE +     CWMSH DS+  LP+GF +  ST+   VA+  +++KK +G+QFHPEVT T  G ++L+NF++++CD   +W  K+   E ++EIK    DD V+  +SGGVDS VAAVL  +AIG  LY +FVD+GLLRK E+  +  +  + +   +      + FLS LKGV DPE+KRKIIGK F++VFE+ A KI    K+L QGT+YPDI+ES S F   S  IKSHHNVGGLP++++ +L+EPLKYLFKDEVR LG  L +P   V+RQPFPGPGLA+RV+GE+T  +L I+RE D L    I+++ KN  + K WQ F VL   KSVGV+GD R+Y   +A+RAV S DAM+A W ++P + L  +S+ I N++  ++RVVYDI++KPP TIEWE
  S:     2 IIIIDFGSQYNQLIARRVREHKVFCQIEPPTLTVEKVKSLAPDGIILSGGPASIYSENSPKIDPELLNLGIPVLGICYGLQFMVHTQGGKVER-ADKREYGLAMFHPKEAAGLFEGVPEATECWMSHGDSIKELPEGFVITGSTDNTKVAAIAHKKKKLFGLQFHPEVTHTPKGKRMLKNFLFNVCDCKRNWTMKSFVKEAVDEIKEAAGDDKVILGLSGGVDSSVAAVLIHKAIGKNLYPIFVDNGLLRKGEADRLKEVFTQNLNMKVRYAKASRKFLSGLKGVTDPEKKRKIIGKVFMDVFEEEAKKIKGA-KFLAQGTLYPDIIESVSAFGGPSAVIKSHHNVGGLPKKMKLKLIEPLKYLFKDEVRLLGEELGLPGDMVWRQPFPGPGLAIRVIGEVTAKRLSILREVDALI---IEEIRKNDYYRKLWQSFGVLLPIKSVGVMGDQRTYENIIAIRAVTSTDAMTADWARLPHDMLAVMSNRIINEINGVNRVVYDISSKPPSTIEWE 509
>gi|94310405|ref|YP_583615.1| bifunctional GMP synthase/glutamine amidotransferase protein [Ralstonia metallidurans CH34] >gi|93354257|gb|ABF08346.1| GMP synthase (glutamine-hydrolyzing) [Ralstonia metallidurans CH34] (539 aa)
Score = 1262, Expect = 8.9e-137, Identities = 260/510 (50%), Positives = 346/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT--TNEL--FENIELDN-----NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS---KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK---------------NSEHKPW-----QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKILILDFG Q TQLIARR+R+ +VY EI   D++ E + +  PKG+ILSG + S Y D  ++  + +WDL +P+LGICYG Q M  + GG+VE   DS E+G  ++R    TN L   E+   D        WMSH D V  LP GFK++AST  C +A   +  + +YGVQFHPEVT T+ G ++++ FV  IC    DW  ++   E +E+I+  V D+ V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR +E + V  +    +   +  +D  + FL  L GV DPEQKRKIIG+ F+EVF+  A K++   K+L QGTIYPD+VESG    K + TIKSHHNVGGLPE L  +LLEPL+ LFKDEVR+LG++L +P + VYR PFPGPGL VR+LGE+  D  +++R AD +F   I++L K               N   K W     Q F V    KSVGV+GD R+Y Y +ALRAV + D M+A W  +P   L + S+ I N+V+ ++RVVYD++ KPP TIEWE
  S:     3 DKILILDFGSQVTQLIARRVREAHVYCEIHPNDVTDEFVREFAPKGVILSGSHASTYEDHQLRAPQAVWDLGVPVLGICYGMQTMAVQLGGKVEW-SDSREFGYAEVRAHGHTNLLKGIEDFATDEGHGMLKVWMSHGDKVTALPAGFKLMASTPSCPIAGMADEARGYYGVQFHPEVTHTSKGREMIERFVLEICATKADWVMRDHIAEAVEKIREQVGDEEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDHGLLRLDEGKMVMDMFAGRLHAKVVHIDASEQFLGHLTGVTDPEQKRKIIGREFVEVFQAEAKKLSNA-KWLAQGTIYPDVVESGGTKTKKATTIKSHHNVGGLPETLGLKLLEPLRDLFKDEVRELGVALGLPPEMVYRHPFPGPGLGVRILGEVKRDYADLLRRADAIF---IEELRKTIATEQDAAAGLCEANQVGKSWYDLTSQAFAVFLPVKSVGVMGDGRTYDYVVALRAVQTTDFMTAHWAHLPYSLLGRCSNRIINEVRGLNRVVYDVSGKPPATIEWE 539
>gi|71737468|ref|YP_273592.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pseudomonas syringae pv. phaseolicola 1448A] >gi|91206819|sp|Q48LY0|GUAA_PSE14 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|71558021|gb|AAZ37232.1| GMP synthase [Pseudomonas syringae pv. phaseolicola 1448A] (525 aa)
Score = 1262, Expect = 9.0e-137, Identities = 247/509 (48%), Positives = 347/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSE-EYGSTDIRLTTNELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY E+  +D+  E I +  PKG+IL+GG +SV+   S +  + ++DL +P+ GICYG Q M ++ GG+V   +  E  Y   D+ +  + L + IE           + WMSH D V  LP+ F ++AST  C +A   +  + +YGVQFHPEVT T  G ++L  F+  IC     W P  I  + I ++++ V  D VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E ++V A+  + +G  +   + ++ FL+ L+G  DPE+KRKIIG+TFI+VF+  + K++   KYL QGTIYPD++ES G+K  K   IKSHHNVGGLPE +  +L+EPL+ LFKDEVR+LGL L +PY  VYR PFPGPGL VR+LGE+ ++  +++R AD +F   I++L K +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LE +S  I N+++ ISRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFAPKGVILAGGPESVHEANSPRCPQAVFDLGVPVFGICYGMQTMAEQLGGKVAGSELREFGYARVDV-VGKSRLLDGIEDHIDADGLFGLDVWMSHGDKVTKLPEDFHILASTPSCPIAGMADDARGYYGVQFHPEVTHTKQGGRILSRFILDICGCEALWTPSKIAEDAIAQVRAQVGTDNVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLHEGEQVMAMFAENMGVKVIRANAEEQFLNNLEGESDPEKKRKIIGRTFIDVFDAESCKLD-NIKYLAQGTIYPDVIESAGAKSGKAHVIKSHHNVGGLPEEMNLKLVEPLRELFKDEVRRLGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADLLRRADHIF---IEELRKADWYHKVSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETIDFMTARWAHLPYELLETVSGRIINEIEGISRVTYDVSSKPPATIEWE 525
>gi|158317731|ref|YP_001510239.1| bifunctional GMP synthase/glutamine amidotransferase protein [Frankia sp. EAN1pec] >gi|158113136|gb|ABW15333.1| GMP synthase, large subunit [Frankia sp. EAN1pec] (534 aa)
Score = 1262, Expect = 9.0e-137, Identities = 248/510 (48%), Positives = 341/510 (66%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFK-------YLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D +L++DFG QY QLIARR+R+ +VYSEIV +D+ + EI+ + P  +ILSGG  SVY   + + +  ++   +P+LGICYG QVM Q   G V     + EYG+T +R+     LF+ +      WMSH DSV   P GF+V AST    VA+  +  ++ YGVQFHPEV  +  G  +L++F+         W   NI  E +  +++ V +  ++C +SGGVDS VAA L  +A+GD L CVFVDHGLLR  E+++V        G ++  V     F S L GV DPEQKRKIIG+ FI VFE+ A +++   +       +L+QGT+YPD++ESGS  +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVR+LG  L +P   V+RQPFPGPGLAVR++GE+T ++LEIVR AD + R  I +   + E   WQ F V L + +SVGV GD R+YG+ + LRAV S DAM+A W ++P + LE+IS+ + N+V  ++RVVYDIT+KPPGTIEWE
  S:    19 DPVLVIDFGAQYAQLIARRVRECHVYSEIVPWDMPVAEILARRPAALILSGGPKSVYSPGAPRVDPALFAAGVPVLGICYGHQVMAQALDGTVAR-TGTAEYGATRLRVDDPGVLFDGLPTSQQVWMSHGDSVTAAPPGFRVTASTPSTPVAAFEDPTRRLYGVQFHPEVVHSERGMDVLRHFLLVGAGCRPSWTMINIVEEAVTAVRAQVGNGRLICGLSGGVDSAVAAALVQRAVGDTLTCVFVDHGLLRAGEAEQVERDFVASTGVDLVHVKAADRFASALAGVTDPEQKRKIIGREFIRVFEESARELDARAEAEGTHIGFLVQGTLYPDVIESGSPTAAKIKSHHNVGGLPDDLQFDLVEPLRTLFKDEVRRLGEELGLPEDIVWRQPFPGPGLAVRIIGEVTPERLEIVRAADAVVRDEIRRAGLDRE--IWQVFAVLLADVRSVGVQGDERTYGFPVVLRAVTSEDAMTADWARLPYDLLERISNRVVNEVGQVNRVVYDITSKPPGTIEWE 534
>gi|182436538|ref|YP_001824257.1| putative GMP synthase [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178465054|dbj|BAG19574.1| putative GMP synthase [Streptomyces griseus subsp. griseus NBRC 13350] (528 aa)
Score = 1262, Expect = 1.1e-136, Identities = 244/508 (48%), Positives = 342/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT--NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI----NVPFKYLLQGTIYPDIVESGSKF-SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFG QY QLIARR+R+  VYSEIV   + + E++ KNP+ IILSGG  SVY + +   ++ I++  +P+ G+CYGFQ+M    GG V+ D  + EYG T + +T   + LFE    +   WMSH D+    P+GF V AST+   VA+  N EKK YGVQ+HPEV  +T G Q+L++F+Y    +  +W   N+  E+I  I+  V D   +C +SGGVDS VAA L  +AIG +L CV+VDHGL+RK E+++V        G  + +VD ++ FL  L GV DPEQKRKIIG+ FI VFE+   +I         +L+QGT+YPD+VESG    +  IKSHHNVGGLP+ ++FEL+EPL+ LFKDEVR +G  L +P + V RQPFPGPGL +R++GE+T+++L+++R+AD + R  +       +   WQ   V L + +SVGV GD R+YG+ + LR V S DAM+A W ++P E L KIS+ I N+V  ++RVV D+T+KPPGTIEWE
  S:    16 VLVVDFGAQYAQLIARRVREARVYSEIVPSTMPVAEMLAKNPRAIILSGGPSSVYAEGAPSLDRAIFEAGVPVFGMCYGFQLMATALGGTVD-DNGAREYGRTPLHVTKAGSTLFEGTPTEQPVWMSHGDACSAAPEGFAVTASTDVVPVAAFENDEKKLYGVQYHPEVMHSTHGQQVLEHFLYRGAGIEPNWTTTNVVEEQIALIREQVGDKRAICGLSGGVDSAVAAALVQKAIGSQLTCVYVDHGLMRKGETEQVEKDFVAATGAKLKVVDAEKRFLDALAGVSDPEQKRKIIGREFIRVFEQAQLEILQEEGPEVAFLVQGTLYPDVVESGGGTGTANIKSHHNVGGLPDDIEFELVEPLRQLFKDEVRMVGQELGLPDEIVQRQPFPGPGLGIRIVGEVTKERLDLLRDADAIAREELTA--AGLDRDIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWSRLPYETLAKISTRITNEVAEVNRVVLDVTSKPPGTIEWE 528
>gi|169630797|ref|YP_001704446.1| GMP synthase [glutamine-hydrolyzing] [Mycobacterium abscessus] >gi|169242764|emb|CAM63792.1| GMP synthase [glutamine-hydrolyzing] [Mycobacterium abscessus] (526 aa)
Score = 1261, Expect = 1.2e-136, Identities = 242/508 (47%), Positives = 335/508 (65%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI--------NVPFKYLLQGTIYPDIVES-GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFG QY QLIARR+R+  V+SE++ +  S+EEI  +NP+ I+LSGG  SVY + + + + G++DL++P+ GICYGFQ M Q  GG V +   SE YG T++ +   +L E +      WMSH D+V   P+GF V+AS+    VA+  NRE++  GVQ+HPEV  +  G Q+L  F++    +   W   NI    +E++++ + +   LCA+SGGVDS VAA L  +AIGD+L CVFVDHGLLR  E  +V        G  +  VD  + FL +L GV DPE KRKIIG+ FI  FE   + +            ++L+QGT+YPD+VES G   +  IKSHHNVGGLPE L F L+EPL+ LFKDEVR +G  L +P + V RQPFPGPGLA+R++GE+T D+L+ +R AD + R  +       +   WQ   V L + +SVGV GD R+YG+ + LR V S DAM+A W ++P E LE+IS+ I N+V  ++RVV DIT+KPPGTIEWE
  S:    12 VLVIDFGAQYAQLIARRVREARVFSEVIPHSASVEEIKGRNPRAIVLSGGPSSVYEEGAPQLDPGVFDLDVPVFGICYGFQAMAQVLGGTVAHTGTSE-YGRTELTVAGGDLHEGLPDVQPVWMSHGDAVTEAPQGFTVVASSEGAPVAAFENRERRLAGVQYHPEVLHSPHGQQVLSRFLHEFAGIESAWTAANIAETLVEQVRTQIGEGRALCALSGGVDSAVAAALVQRAIGDRLTCVFVDHGLLRSGERAQVEHDFVAATGATLVTVDASETFLGELAGVTDPEAKRKIIGREFIRSFEGAVSDVVGDSRRDDTAGIQFLVQGTLYPDVVESGGGSGTANIKSHHNVGGLPEDLTFTLVEPLRLLFKDEVRAVGRELGLPEEIVGRQPFPGPGLAIRIVGEVTPDRLDTLRRADAIAREELTA--AGQDRNIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWTRLPYEVLERISTRITNEVPEVNRVVLDITSKPPGTIEWE 526
>gi|124483428|emb|CAM32587.1| GMP synthase protein [Herbaspirillum seropedicae] (530 aa)
Score = 1261, Expect = 1.2e-136, Identities = 250/509 (49%), Positives = 341/509 (66%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNC--------WMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLF----RSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG Q TQLIARR+R+  V+SE+  +D++ E +      G+ILSGG +SV    + +  + +++L +P+LGICYG Q M ++ GG+V+N     E+G  ++R   + +L +NI    N         WMSH D V  +P GFK++AST  C +A   + E++FYGVQFHPEVT T  G  +L  FV+ IC    DW   +   E +E I+  V  D V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR +E + V  +  K +G  +  VD    F+  L GV DPE KRKIIG+ F+EVF+  + K+    K+L QGTIYPD++ES   G K + TIKSHHNVGGLPE L  +LLEPL+ LFKDEVR+LG++L +P + VYR PFPGPGL VR+LGE+ ++  +++R AD +F    R+  D+  +    K  Q F V    KSVGV+GD R+Y Y +ALRAV + D M+A W  +P E L ++S+ I N+V+ ++RVVYDI+ KPP TIEWE
  S:     8 KILILDFGSQVTQLIARRVREAGVFSEVFPHDVTDEFVRNYGAAGVILSGGPNSVTEGDTPRAPQAVFELGVPVLGICYGMQTMAEQLGGKVDNGH-LREFGYAEVRAHGHTKLLDNISDFTNAQGHGMLKVWMSHGDKVNEMPAGFKLMASTGNCPIAGMADEERRFYGVQFHPEVTHTVQGKAMLGRFVHEICGCQSDWNMPDYIAEAVEMIRQQVGSDEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDHGLLRLDEGKMVMEMFAKNLGVKVIHVDATAQFMGHLAGVTDPEAKRKIIGREFVEVFQAESAKLTSA-KWLAQGTIYPDVIESAGKGKKTAHTIKSHHNVGGLPETLNLKLLEPLRELFKDEVRELGVALGLPPEMVYRHPFPGPGLGVRILGEVKKEYADLLRRADAIFIEELRNTKDEDGQTWYEKTSQAFAVFLPVKSVGVMGDGRTYEYVVALRAVQTQDFMTAHWAHLPHELLGRVSNRIINEVRGLNRVVYDISGKPPATIEWE 530
>gi|163729428|ref|ZP_02136908.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio fischeri MJ11] >gi|161397244|gb|EDQ21533.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio fischeri MJ11] (517 aa)
Score = 1261, Expect = 1.3e-136, Identities = 250/509 (49%), Positives = 346/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARRIR++ VY E+  +D+   +I   NP GIILSGG +SV  + S +  + ++D  +P+ G+CYG Q M ++ GG+V    +  E+G   +++T  + LF+++E   + WMSH D V+ +P  F  IA T  C  A   N EKK+YGVQFHPEVT T  G ++L+NFV ++C   G W   +I  + +  IK  V DD V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE+ +V  +     G NI  V+ +Q FL  L+G  DPE KRKIIG  F+++F++ + K+    K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGEI ++  +++R AD +F   I++L+  +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L K+S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRIREIGVYCELWSWDVEESDIRDFNPDGIILSGGPESVTEENSPRAPQYVFDSGVPVFGVCYGMQTMAEQLGGKVATSTE-REFGYAAVQVTGESALFKDLEATQDVWMSHGDKVVEIPSDFVKIAETETCPYAVMANEEKKYYGVQFHPEVTHTKNGMKMLENFVLNVCGCEGLWTSASIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAMLAHRAIGDKLTCVFVDNGLLRLNEADQVMEMFGNKFGLNIIHVNAEQRFLDALEGESDPEVKRKIIGHVFVDIFDEESKKLKNA-KWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRADAIF---IEELHNADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517
>gi|54294610|ref|YP_127025.1| bifunctional GMP synthase/glutamine amidotransferase protein [Legionella pneumophila str. Lens] >gi|81368495|sp|Q5WVX4|GUAA_LEGPL GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|53754442|emb|CAH15926.1| hypothetical protein [Legionella pneumophila str. Lens] (525 aa)
Score = 1261, Expect = 1.4e-136, Identities = 252/508 (49%), Positives = 352/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIE----LDN----NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSK----TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSE--HKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +LILDFG QYTQLIARR+R++ VY EI  Y+I+ E+  K NP G+ILSGG  +V  D + +  + +++ ++P+LGICYG Q M  + GGQV +     E+G  ++RL   ++L  NIE    +D     + WMSH D V  LP GFKVI  T    +A   +  ++ YG+QFHPEVT T  G ++LQ FV  IC  + DW P++I  E I +I+  V  + VL  +SGGVDS V A L  +AIG++L CVFVD GLLR NE+++V ++  + +G  I  V+ +  FL+ LKGV  PE+KRKIIG+TFIEVF++ A K+    K+L QGTIYPD++ES +  +      IKSHHNVGGLP+ L  +LLEP++ LFKDEVR++GL L +P+  VYR PFPGPGL VR+L E+ ++  +I+R+AD +F   I++L+ N++  HK  Q F V    KSVGV+GD R Y Y + LRAV+++D M+A W ++P + L K+S+ I N+V+ +SRV YDI+ KPP TIEWE
  S:     9 LLILDFGSQYTQLIARRVREMGVYCEIYPYNINHEQFKKLNPCGVILSGGPSTVTHDANPRAPQWLFESDLPLLGICYGMQTMAVQLGGQVHSST-LREFGYAELRLHGHSQLLSNIEDRTAMDGSALLDVWMSHGDKVTELPPGFKVICETRNAPIAGMADESRQMYGLQFHPEVTHTLQGLRILQRFVVDICKASTDWTPEHIIDEAINKIREQVGTEKVLLGLSGGVDSSVVAALLHRAIGEQLVCVFVDTGLLRLNEAEQVLSMFGRHMGIRIIAVNAEDKFLTALKGVTCPEEKRKIIGRTFIEVFDEEAQKL-TDIKWLAQGTIYPDVIESAATSTNDAAVVIKSHHNVGGLPDTLNLKLLEPIRELFKDEVRQVGLELGLPHDMVYRHPFPGPGLGVRILAEVKKEYADILRKADAIF---IEELH-NAQLYHKISQAFAVFLPVKSVGVMGDGRRYDYVICLRAVETVDFMTAHWSQLPWDFLGKVSNRIINEVEGVSRVTYDISGKPPATIEWE 525
>gi|157412374|ref|YP_001483240.1| bifunctional GMP synthase/glutamine amidotransferase protein [Prochlorococcus marinus str. MIT 9215] >gi|157386949|gb|ABV49654.1| GMP synthase, PP-ATPase domain/subunit [Prochlorococcus marinus str. MIT 9215] (528 aa)
Score = 1260, Expect = 1.5e-136, Identities = 253/508 (49%), Positives = 351/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ILILDFG QY++LIARRIR+ NV+S +V   ISI+EI   NPKGIILSGG +SVY   + K ++ I++L IPILGICYG Q+M++E GG V       EYG   I +   ++L  +++  +  WMSH DS+  LP GF  IA T   L A+  N  KK +GVQFHPEV  + +G  +++NFVY I   A DW  +    E I  I+  V +  VL A+SGGVDS   A L  +AIG++L C+F+D G +RK E + +     K     +  ++ ++ F+SKLKG+ +PEQKRKIIG+ FI VFE+ +N++  PF+YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVR++G +L +P + + R PFPGPGLA+R+LGE+  +KL+ +R+AD++ R  I +  LY    ++ WQ F VL   K+VGV+GD R+Y + + LR V S D M+A W KIP + LE+I++ I N+V +++RVVYDIT+KPPGTIEWE
  S:    14 ILILDFGSQYSELIARRIRETNVFSLVVSNCISIKEINNINPKGIILSGGPNSVYEQNAPKCDEKIFNLGIPILGICYGMQLMVKELGGSVIPATKKAEYGRAPINIDQESDLLSDVQDKSIMWMSHGDSIKCLPVGFNKIAHTENTLHAAISNDLKKLFGVQFHPEVIHSEYGMTVIKNFVYKISCCAADWTTETYIEETIPRIREQVGNKKVLLALSGGVDSSTLAFLLNKAIGNQLTCMFIDQGFMRKGEPEFLMNFFDKKFHIKVEYINARKRFISKLKGITEPEQKRKIIGEEFIRVFEEESNRLG-PFQYLAQGTLYPDVIESAGTNIDPKTGERIAVKIKSHHNVGGLPKDLQFKLVEPLRKLFKDEVRQVGAALGLPAEIIKRHPFPGPGLAIRILGEVNNEKLDCLRDADWIVRDEIKKAGLY----NEIWQAFAVLLPVKTVGVMGDKRTYAWPIVLRCVSSEDGMTADWSKIPFKILERIANRIVNEVISVNRVVYDITSKPPGTIEWE 528
>gi|139438181|ref|ZP_01771734.1| Hypothetical protein COLAER_00722 [Collinsella aerofaciens ATCC 25986] >gi|133776378|gb|EBA40198.1| Hypothetical protein COLAER_00722 [Collinsella aerofaciens ATCC 25986] (532 aa)
Score = 1260, Expect = 1.8e-136, Identities = 247/509 (48%), Positives = 340/509 (66%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINV---PFKYLLQGTIYPDIVESGSK----FSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYID----QLY-----KNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           K+L+LDFG QY QLIARR+RDLNVYSEIV  DIS +EI + N   +ILSGG  SVY + +   +  I+DL +P+LG CYG Q+     GG+V + +  E   +T  R    +LF +  ++   WMSH D+V  +P+GF V AST+ C VA+    E+K +  QFHPEV  + +G QLL NF++ IC +  +W   N+      E +  V DD V+ A+SGGVDS V A L A+A+G ++ CVF++HGLLRK E ++V  +  K    +   V  +  +   L GV +PE+KR+IIG  F + F  VA ++     P KYL QGTIYPDI+ESG++     + TIKSHHN+   PE + F+L+EPL + FKDEVR LGL+L +P   V+RQPFPGPGLA+R++G + ++KLEI++ AD + R  +D    +L+     +NSEH  WQYF VL + KSVGV+GD R+Y   + LRAV+S DAM+A W K+P + L +IS  I  +V   +RV YDIT+KPP TIEWE
  S:     8 KVLVLDFGAQYGQLIARRVRDLNVYSEIVPCDISADEIREMNASALILSGGPASVYAEDAPSIDPAIFDLGLPVLGFCYGHQITAVTLGGKVGHSEVGEYGRATITRTAGAKLFNSTPIEQTVWMSHRDAVSEVPEGFTVTASTDVCPVAAMECVERKIFTTQFHPEVKHSEYGQQLLSNFLFEICGLEPNWSMDNLVETMTAEFREKVGDDRVILALSGGVDSSVVAALGARAVGKQMTCVFINHGLLRKGEPEQVEEVFTKQFDVDFIHVHAEDRYAELLAGVTEPEEKRRIIGTQFWKEFFAVAQQLETDGKPVKYLAQGTIYPDIIESGARKTGGKTATIKSHHNLIPFPEGVHFDLIEPLDHFFKDEVRALGLALGLPGHIVFRQPFPGPGLAIRIIGAVDKEKLEILKNADAIVREELDAYNQRLFEQTGERNSEHSCWQYFAVLPDIKSVGVMGDERTYQRPIILRAVESSDAMTADWAKLPYDVLARISGRIVAEVPGANRVCYDITSKPPATIEWE 532
>gi|109947068|ref|YP_664296.1| bifunctional GMP synthase/glutamine amidotransferase protein [Helicobacter acinonychis str. Sheeba] >gi|109714289|emb|CAJ99297.1| GMP synthase [Helicobacter acinonychis str. Sheeba] (508 aa)
Score = 1259, Expect = 2.0e-136, Identities = 266/508 (52%), Positives = 351/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREK-KFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKL-IGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFK--YLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I++LDFG QYTQLIARR+R+  +Y+EIV +  S E I KK PKG+ILSGG  SVY   +  P++ I+DLN+PILGICYG Q ++   GG V    + +E+G   + +  +  +F+ ++  +  WMSH D VI LPKGF  IA +   L    C  E  K +G+QFHPEV Q+  G ++L+NF   +C     W  +N   +++  +K  + D  VLCA+SGGVDS V A L  +AI D L  VFVDHGLLRKNE ++V A+ K L I  N   +D K++FLSKLKGV +PE KRKIIG+TFIEVFEK A K ++  K  +L QGT+YPD++ES S    SK IKSHHNVGGLPE + F+L+EPL+ LFKDEVR LG  L +    + R PFPGPGLAVR+LGE++E K++ ++EADF+F   I++L K N   K WQ F VL N+ SVGV+GDNR+Y   + LRAVD+ D M+A +  +    LEK+S+ I N+V  I+RVVYDIT+KPPGTIEWE
  S:     2 IVVLDFGSQYTQLIARRLRESGIYAEIVPFFESTENIQKKAPKGLILSGGPASVYAKDAYTPSEKIFDLNLPILGICYGMQYLVDFFGGAVAC-ANEQEFGKAALEIIQDSVIFKGVKAKSLVWMSHMDKVITLPKGFTTIAKSPNSL---HCAIESGKVFGLQFHPEVIQSEEGGKILENFALLVCGCEKTWGMQNFAQKEMTRLKEKISDARVLCAVSGGVDSTVVATLLHRAIKDNLIAVFVDHGLLRKNEKEKVQAMFKDLQIPLNT--IDAKEIFLSKLKGVSEPELKRKIIGETFIEVFEKEAKKHHLKGKIEFLAQGTLYPDVIESVSVKGPSKVIKSHHNVGGLPEWMDFKLIEPLRELFKDEVRLLGKELGVSQDFLMRHPFPGPGLAVRILGEVSESKIKCLQEADFIF---IEELKKANLYDKVWQAFCVLLNAHSVGVMGDNRTYENAICLRAVDASDGMTASFSHLGHSFLEKVSNRITNEVSGINRVVYDITSKPPGTIEWE 508
>gi|53802427|ref|YP_112824.1| bifunctional GMP synthase/glutamine amidotransferase protein [Methylococcus capsulatus str. Bath] >gi|81683037|sp|Q60C21|GUAA_METCA GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|53756188|gb|AAU90479.1| GMP synthase [Methylococcus capsulatus str. Bath] (524 aa)
Score = 1259, Expect = 2.0e-136, Identities = 249/509 (48%), Positives = 344/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDN--------NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R+L VYSEI  YD   + I +  P+GIILSGG +SV G  + +    ++ L +P+LGICYG Q M  + GG+VE   +  E+G   +R    ++L   IE           + WMSH D V+ LP GFK+IAST    +A   + E++FY +QFHPEVT T  G ++L+ FV  +C     W   NI  + I  +++ +  + V+  +SGGVDS V A L   AIG++L CVFVD GLLR NE  +V A   + +G  +  V+ ++ FL  L+G+ DPE KRKIIG+ F+E+F++ A KI    ++L QGTIYPD++ES GSK  K   IKSHHNVGGLPE ++ +L+EPL+ LFKDEVR++GL L +PY+ VYR PFPGPGL VR+LGE+ ++  +++R AD +F   I++LY++  + K  Q F V    KSVGV+GD R Y Y +ALRAV+++D M+A+W  +P + L+ +S  I N++  ISRV YDI+ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRVRELGVYSEIHPYDCGDDFITEFAPQGIILSGGPESVTGTGTPRAPASVFTLGVPVLGICYGMQTMAAQLGGKVEA-VEHREFGYAQVRAHGHSQLLNGIEDHTTPEGHGLLDVWMSHGDQVVGLPPGFKLIASTESAPIAGMADEERRFYALQFHPEVTHTRQGKRILERFVRKLCQCEARWTTGNIVEDAITRVRNRIGAERVVLGLSGGVDSSVVAALLQHAIGEQLTCVFVDTGLLRLNEGDQVMATFAEHMGVRVIRVNAEERFLQALQGIADPEDKRKIIGRLFVEIFDEEAAKIE-DARWLAQGTIYPDVIESAGSKTGKAHVIKSHHNVGGLPETMKLQLVEPLRELFKDEVRQIGLELGLPYEMVYRHPFPGPGLGVRILGEVRKEYADLLRRADAIF---IEELYRHDLYDKVSQAFAVFLPVKSVGVMGDGRRYDYVVALRAVETIDFMTARWAHLPYDFLDLVSRRIINEIPGISRVTYDISGKPPATIEWE 524
>gi|54297636|ref|YP_124005.1| bifunctional GMP synthase/glutamine amidotransferase protein [Legionella pneumophila str. Paris] >gi|81370447|sp|Q5X4I9|GUAA_LEGPA GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|53751421|emb|CAH12839.1| hypothetical protein [Legionella pneumophila str. Paris] (525 aa)
Score = 1259, Expect = 2.4e-136, Identities = 252/508 (49%), Positives = 351/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIE----LDN----NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSK----TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSE--HKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +LILDFG QYTQLIARR+R++ VY EI  Y+I+ E+  K NP G+ILSGG  +V  D + +  + +++ ++P+LGICYG Q M  + GGQV +     E+G  ++RL   ++L  NIE    +D     + WMSH D V  LP GFKVI  T    +A   +  ++ YG+QFHPEVT T  G ++LQ FV  IC  + DW P++I  E I +I+  V  + VL  +SGGVDS V A L  +AIG++L CVFVD GLLR NE+++V ++  + +G  I  V+ +  FL+ LKGV  PE+KRKIIG+TFIEVF++ A K+    K+L QGTIYPD++ES +  +      IKSHHNVGGLP+ L  +LLEP++ LFKDEVR +GL L +P+  VYR PFPGPGL VR+L E+ ++  +I+R+AD +F   I++L+ N++  HK  Q F V    KSVGV+GD R Y Y + LRAV+++D M+A W ++P + L K+S+ I N+V+ +SRV YDI+ KPP TIEWE
  S:     9 LLILDFGSQYTQLIARRVREMGVYCEIYPYNINHEQFKKLNPCGVILSGGPSTVTHDANPRAPQWLFESDLPLLGICYGMQTMAVQLGGQVHSST-LREFGYAELRLHGHSQLLSNIEDRTAMDGSALLDVWMSHGDKVTELPPGFKVICETRNAPIAGMADESRQMYGLQFHPEVTHTLQGLRILQRFVVDICKASTDWTPEHIIDEAINKIREQVGTEKVLLGLSGGVDSSVVAALLHRAIGEQLVCVFVDTGLLRLNEAEQVLSMFGRHMGIRIIAVNAEDKFLTALKGVTCPEEKRKIIGRTFIEVFDEEAQKL-TDIKWLAQGTIYPDVIESAATSTNDAAVVIKSHHNVGGLPDTLNLKLLEPIRELFKDEVRHVGLELGLPHDMVYRHPFPGPGLGVRILAEVKKEYADILRKADAIF---IEELH-NAQLYHKISQAFAVFLPVKSVGVMGDGRRYDYVICLRAVETVDFMTAHWSQLPWDFLGKVSNRIINEVEGVSRVTYDISGKPPATIEWE 525
>gi|66044510|ref|YP_234351.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pseudomonas syringae pv. syringae B728a] >gi|75503069|sp|Q4ZX09|GUAA_PSEU2 GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|63255217|gb|AAY36313.1| GMP synthase, C-terminal:GMP synthase, N-terminal [Pseudomonas syringae pv. syringae B728a] (525 aa)
Score = 1259, Expect = 2.4e-136, Identities = 246/509 (48%), Positives = 346/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSE-EYGSTDIRLTTNELFENIE--------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY E+  +D+  E I +  PKG++L+GG +SV+   S +  + ++DL +P+ GICYG Q M ++ GG+V   +  E  Y   D+ +  + L + IE           + WMSH D V  LP+ F ++AST  C +A   +  + +YGVQFHPEVT T  G ++L  F+  IC     W P  I  + I ++++ V  D VL  +SGGVDS V A L  +AIGD+L CVFVD+GLLR +E ++V A+  + +G  +   + ++ FL+ L G  DPE+KRKIIG+TFI+VF+  + K++   KYL QGTIYPD++ES G+K  K   IKSHHNVGGLPE +  +L+EPL+ LFKDEVR+LGL L +PY  VYR PFPGPGL VR+LGE+ ++  +++R AD +F   I++L K +  HK  Q F V    KSVGVVGD R Y + +ALRAV+++D M+A+W  +P E LE +S  I N+++ ISRV YD+++KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFAPKGVVLAGGPESVHEADSPRCPQAVFDLGVPVFGICYGMQTMAEQLGGKVAGSELREFGYARVDV-VGKSRLLDGIEDHIDADGLFGLDVWMSHGDKVTKLPENFHILASTPSCPIAGMADDARGYYGVQFHPEVTHTKQGGRILSRFILDICGCEALWTPSKIAEDAIAQVRAQVGTDNVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLHEGEQVMAMFAENMGVKVIRANAEEQFLNNLAGESDPEKKRKIIGRTFIDVFDAESCKLD-NIKYLAQGTIYPDVIESAGAKSGKAHVIKSHHNVGGLPEEMNLKLVEPLRELFKDEVRRLGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADLLRRADHIF---IEELRKADWYHKVSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETIDFMTARWAHLPYELLETVSGRIINEIEGISRVTYDVSSKPPATIEWE 525
>gi|86739358|ref|YP_479758.1| bifunctional GMP synthase/glutamine amidotransferase protein [Frankia sp. CcI3] >gi|86566220|gb|ABD10029.1| GMP synthase (glutamine-hydrolyzing) [Frankia sp. CcI3] (556 aa)
Score = 1258, Expect = 2.6e-136, Identities = 249/510 (48%), Positives = 344/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE---LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINV-------PFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D +L++DFG QY QLIARRIR+ +VYSEIV +D+S++EI+ + P  +ILSGG  SVY   + + +  ++   +PILGICYG QVM Q   G V     + EYG+T  RL+ ++   LF+ + +    WMSH DSV   P GF+V AST    VA+  +  ++ YGVQFHPEV  +  G  +L++F+         W   NI  E +  +++ V    ++C +SGGVDS VAA L  +A+GD L CVFVDHGLLR  E+++V        G ++  V     F + L GV DPE+KRKIIG+ FI VFE+ A ++ V          +L+QGT+YPD++ESGS  +  IKSHHNVGGLPE L+F+L+EPL+ LFKDEVR+LG  L +P + V+RQPFPGPGLAVR++GE+T ++L++VR AD + R  I +   + E   WQ F V L + +SVGV GD R+YG+ + LRAV S DAM+A W ++P   LE+IS+ + N+V  ++RVVYDIT+KPPGTIEWE
  S:    41 DTVLVIDFGAQYAQLIARRIRECHVYSEIVPWDMSVDEILARRPSALILSGGPKSVYSPGAPRVDPALFATGVPILGICYGHQVMAQALDGAVAR-TGTAEYGAT--RLSVSDPGVLFDGLPVVQQVWMSHGDSVTAAPPGFRVTASTPSAPVAAFEDPARRLYGVQFHPEVVHSERGMDVLRHFLLVGAGCRPTWTMINIVDEAVAAVRAQVGTGRLICGLSGGVDSAVAAALVHRAVGDALTCVFVDHGLLRAGEAEQVERDFVATTGVDLVHVKAADRFSAALSGVTDPERKRKIIGREFIRVFEESARELEVRAEAEGATIDFLVQGTLYPDVIESGSPTAAKIKSHHNVGGLPEDLRFDLVEPLRTLFKDEVRRLGEELGLPEEIVWRQPFPGPGLAVRIIGEVTPERLDVVRAADAVIREEIRKAGLDRE--IWQVFAVLLADVRSVGVQGDERTYGFPIVLRAVTSEDAMTADWARLPYGLLERISNRVVNEVPQVNRVVYDITSKPPGTIEWE 556
>gi|88855841|ref|ZP_01130504.1| bifunctional GMP synthase/glutamine amidotransferase protein [marine actinobacterium PHSC20C1] >gi|88815165|gb|EAR25024.1| bifunctional GMP synthase/glutamine amidotransferase protein [marine actinobacterium PHSC20C1] (533 aa)
Score = 1258, Expect = 2.6e-136, Identities = 248/508 (48%), Positives = 336/508 (66%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN--ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI-------NVPFKYLLQGTIYPDIVESGSKF-SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFG QY QLIARR+R+ NVYSEIV + I+ EEI  KNP GI+LSGG  SVY   S   + GI  L IP+ GICYGFQVM ++ GG V       EYG+TD+ +  +   L          WMSH D+V   P+GF V+AS++   VA+  ++E+  YGVQ+HPEV  T FG  +L+NF++    +  DW   N+  E++  I+  V    V+C +SGGVDS VAA +  +A+GD+L C+FVDHGLLR++E ++V        G  +  VD    F+  L GV DPE KRKIIG+ FI  FE  A  +       +   K+L+QGT+YPD+VESG    +  IKSHHNVGGLPE LQF+L+EPL+ LFKDEVR +G  L +P   V RQPFPGPGL +R++GE+T D+LE++R+AD + R+ +       +   WQ   V L + +SVGV GD R+YG+ + LR V S DAM+A W ++P + L KIS+ I N+V  ++RVV D+T+KPPGTIEWE
  S:    18 VLVVDFGAQYAQLIARRVREANVYSEIVPHTITAEEIAAKNPAGIVLSGGPSSVYEPGSPDLDPGILQLGIPVFGICYGFQVMARQLGGTVAK-TGLREYGATDMTVQGDGGSLLGKQPNKQTVWMSHGDAVTEAPEGFDVLASSDATPVAAFASKERGLYGVQWHPEVKHTEFGQSVLENFLHDAAGIPADWNSGNVIAEQVARIREQVGSARVICGLSGGVDSAVAAAIVHKAVGDQLVCIFVDHGLLRQDERRQVEEDYVASTGVRLVTVDAVDQFMDALAGVTDPETKRKIIGREFIRSFENAAEALVLETQGSDETVKFLVQGTLYPDVVESGGGTGTANIKSHHNVGGLPEDLQFDLVEPLRTLFKDEVRAIGRELGLPEVIVGRQPFPGPGLGIRIIGEVTFDRLELLRKADAIARAELTA--AGLDDTIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWTRLPYDVLAKISNRITNEVDGVNRVVLDVTSKPPGTIEWE 533
>gi|149190080|ref|ZP_01868357.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio shilonii AK1] >gi|148836110|gb|EDL53070.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio shilonii AK1] (517 aa)
Score = 1258, Expect = 2.6e-136, Identities = 247/509 (48%), Positives = 349/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLY-KNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARR+R++ VY E+  +D+   +I + NP GIILSGG +SV  + S +  + ++D  +P+LG+CYG Q M ++ GG+V    +  E+G   ++++ +  +F+++E   + WMSH D V+ +P  F  +  T+ C  A+  N EKK+YGVQFHPEVT T  G Q+L+NFV   C     W  ++I  + +  IK  V DD V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE Q+V  +     G NI  VD ++ FL+ L+G  DPE+KRK IG  F++VF++ + K+    K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGEI ++  +++R AD +F   I++L+  +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L K+S+ I N+V+ ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEENSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGRVAGSNE-REFGYAQVKVSGDSAIFKDLEATQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVTHTKQGLQMLENFVLGACGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAMLVHRAIGDKLTCVFVDNGLLRLNEGQQVMEMFGDKFGLNIIKVDAEERFLTALEGQSDPEEKRKTIGHVFVDVFDEESKKLKNA-KWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRADAIF---IEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGKVSNRIINEVEGISRVVYDISGKPPATIEWE 517
>gi|188585091|ref|YP_001916636.1| GMP synthase (glutamine-hydrolyzing) [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349778|gb|ACB84048.1| GMP synthase (glutamine-hydrolyzing) [Natranaerobius thermophilus JW/NM-WN-LF] (510 aa)
Score = 1258, Expect = 2.7e-136, Identities = 252/508 (49%), Positives = 345/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +++LDFGGQY++LIARRIR+ NVY EI  Y+ISI ++ + +P  I+LSGG  SVY + S   +  I+++ IP+LGICYG Q+M ++ GG V       EYG   + +   N L E +  D   WMSH DSV  +P GFKV+  T    +A   N +K  YGVQFH EV  T  G ++L+NF+++I D++ DW   +   E +E+IK+  +    +C +SGG+DS VAA+L  +AIGD L C+FV+HGLLRKNE  +V  L ++    N+  VD    FL+KL+GV DPEQKRKIIG+ FI VFE+ A KI     +L+QGT+Y D+VESG++ +  IKSHHNVGGLPE++   L+EPL  LFKDEVR++   L +  + V R PFPGPGLA+RVLGEIT++KL+I+READ +     D+L K    H  WQ FTVL + K+VGV GD RSY Y + LRAV+S D M+A WY+   + LE++S+ + N+V  ++R +YDIT+KPP TIEWE
  S:     6 VIVLDFGGQYSRLIARRIREHNVYCEIYPYNISINKLKQLSPAAIVLSGGPSSVYQEGSPDLDTEIFEIGIPVLGICYGMQLMAKKLGGTVTGST-KREYGKALLEIENPNLLTEGVSSDLLVWMSHGDSVEQVPPGFKVMGKTENTPIAGLFNPDKNLYGVQFHLEVMHTPKGREMLKNFLFNIADLSADWTMGSYIEETVEQIKTEAQGRKAVCGLSGGIDSTVAALLVQKAIGDDLTCIFVNHGLLRKNEQDQVRELFEQEFDINLVYVDASDRFLNKLQGVTDPEQKRKIIGEEFIRVFEEEARKIG-DVDFLVQGTLYTDVVESGTETASVIKSHHNVGGLPEKMDLSLIEPLNSLFKDEVRQVARELGLHREIVERHPFPGPGLAIRVLGEITKEKLDILREADAVVS---DELKKIGLYHDIWQLFTVLPDIKTVGVKGDERSYDYPIILRAVNSEDGMTADWYRFSNDVLERLSNRVVNEVDGVNRFIYDITSKPPATIEWE 510
>gi|157371830|ref|YP_001479819.1| bifunctional GMP synthase/glutamine amidotransferase protein [Serratia proteamaculans 568] >gi|157323594|gb|ABV42691.1| GMP synthase, large subunit [Serratia proteamaculans 568] (525 aa)
Score = 1258, Expect = 2.8e-136, Identities = 250/509 (49%), Positives = 345/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFS---KTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARR+R++ VY E+  +D+S E+I + NP GIILSGG +S     S +  + ++   +P+LG+CYG Q M  + GGQVE   +  E+G   + +TT + L  +IE          LD   WMSH D V  +P  F  +AST+ C  A   N EK+FYGVQFHPEVT T  G ++L+ FV  IC     W P  I  + +E I+  V +D+V+  +SGGVDS V A+L  +AIG +L CVFVD+GLLR NE+++V  +     G NI  V  +  FLS L GV +PE KRKIIG+ F+E+F++ A K     K+L QGTIYPD++ES +  +     IKSHHNVGGLP+ ++  L+EPLK LFKDEVRK+GL L +PY  ++R PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+K +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRVREIGVYCELWAWDVSEEQIREFNPSGIILSGGPESTTEANSPRAPEYVFTAGVPVLGVCYGMQTMAMQLGGQVEGSNE-REFGYAQVEITTESALVRDIEDALSPAGKPLLD--VWMSHGDKVTAIPADFVTVASTDTCPFAIMANEEKRFYGVQFHPEVTHTRQGQRMLERFVLDICQCEALWTPATIIEDAVERIRQQVGEDHVILGLSGGVDSSVTAMLLHRAIGKRLTCVFVDNGLLRLNEAEQVLEMFGDHFGLNIVHVAAEDRFLSALAGVDEPEAKRKIIGRVFVELFDEEACK-QSEVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPKEMKLGLVEPLKELFKDEVRKIGLELGLPYDMLFRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 525
>gi|194540282|ref|YP_002075323.1| GMP synthase (glutamine-hydrolyzing) [Vibrio sp. Ex25] >gi|151938837|gb|EDN57671.1| GMP synthase (glutamine-hydrolyzing) [Vibrio sp. Ex25] (517 aa)
Score = 1258, Expect = 2.9e-136, Identities = 249/509 (48%), Positives = 345/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARR+R++ VY E+  +D+   +I + NP GIILSGG +SV  + S +  + ++D  +P+LG+CYG Q M ++ GG+V    +  E+G   ++++    LF+++E   + WMSH D V+ +P  F  +  T+ C  A+  N EKK+YGVQFHPEVT T  G Q+L+NFV  +C     W  ++I  + +  IK  V DD V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE Q+V  +     G NI  VD +  FL  LKG  DPE+KRK IG  F++VF++ + K+    K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGEI ++  +++R AD +F   I++L+    + K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L K+S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEENSPRAPQYVFDSGVPLLGVCYGMQTMAEQLGGKVAGSNE-REFGYAQVKVSGECALFKDLEATQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVTHTKGGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAMLVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEDRFLEALKGKSDPEEKRKTIGHVFVDVFDEESKKLKNA-KWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDEMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRADAIF---IEELHAADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGKVSNRIINEVDGISRVVYDISGKPPATIEWE 517
>gi|28897391|ref|NP_796996.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio parahaemolyticus RIMD 2210633] >gi|153838554|ref|ZP_01991221.1| GMP synthase (glutamine-hydrolyzing) [Vibrio parahaemolyticus AQ3810] >gi|153839137|ref|ZP_01991804.1| GMP synthase (glutamine-hydrolyzing) [Vibrio parahaemolyticus AQ3810] >gi|31340118|sp|Q87S07|GUAA_VIBPA GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|28805603|dbj|BAC58880.1| GMP synthase [Vibrio parahaemolyticus RIMD 2210633] >gi|149747349|gb|EDM58323.1| GMP synthase (glutamine-hydrolyzing) [Vibrio parahaemolyticus AQ3810] >gi|149748069|gb|EDM58928.1| GMP synthase (glutamine-hydrolyzing) [Vibrio parahaemolyticus AQ3810] (517 aa)
Score = 1258, Expect = 3.0e-136, Identities = 248/509 (48%), Positives = 348/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARR+R++ VY E+  +D+   +I + NP GIILSGG +SV  + S +  + ++D  +P+LG+CYG Q M ++ GG+V    +  E+G   ++++  + +F+++E   + WMSH D V+ +P  F  +  T+ C  A+  N EKK+YGVQFHPEVT T  G Q+L+NFV  +C     W  ++I  + +  IK  V DD V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE Q+V  +     G NI  VD ++ FL  LKG  DPE+KRK IG  F++VF++ + K+    K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGEI ++  +++R AD +F   I++L+    + K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L K+S+ I N+V+ ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEENSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGKVAGSNE-REFGYAQVKVSGESAIFKDLEATQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVTHTKGGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAMLVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEERFLEALKGKSDPEEKRKTIGHVFVDVFDEESKKLKNA-KWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRADAIF---IEELHAADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGKVSNRIINEVEGISRVVYDISGKPPATIEWE 517
>gi|119962972|ref|YP_948566.1| bifunctional GMP synthase/glutamine amidotransferase protein [Arthrobacter aurescens TC1] >gi|119949831|gb|ABM08742.1| GMP synthase (Glutamine amidotransferase) [Arthrobacter aurescens TC1] (529 aa)
Score = 1258, Expect = 3.1e-136, Identities = 239/508 (47%), Positives = 345/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN--ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI-------NVPFKYLLQGTIYPDIVES-GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++D+G QY QLIARR+R+ NVYSEIV +  + E+++ KNP  IILSGG  SVY + +      +++  +P+ GICYGFQ M    GG+V       EYG+T+  +  +   + + +    N WMSH DSV   P+GF+V+AST    VA+  N EK+ YGVQ+HPEV  +  G  +L+NF++    ++ +W   NI  E+++ I+  + D  V+C +SGGVDS VAA L  +A+GD+L CVFVDHGLLR+ E+++V        G N+++ ++++ F S L GV DPE KRKIIG+ FI  FE+    I           K+L+QGT+YPD+VES G + +  IKSHHNVGGLPE LQFEL+EPL+ LFKDEVR +G  L +P + V RQPFPGPGL +R++GE+T+++L+++R+AD + R+ +       ++  WQ   V L + +SVGV GD R+YG+ + LR V S DAM+A W ++P + L +IS+ I N+V  ++RVV D+T+KPPGTIEWE
  S:    14 VLVVDYGAQYAQLIARRVREANVYSEIVPHTFTTEQLLAKNPAAIILSGGPSSVYAEGAPSVGADLFEAGVPVFGICYGFQAMANALGGKVAQ-TGLREYGATEALVVGDARSILDGVPSSQNTWMSHGDSVHEAPEGFEVLASTAGAPVAAFANDEKRLYGVQWHPEVKHSVHGQHVLENFLFKGAGLSPNWTTGNILEEQVDRIRQQIGDSKVICGLSGGVDSAVAAALVQRAVGDQLTCVFVDHGLLREGEAEQVERDFVAATGVNLYVANEQERFQSALAGVSDPETKRKIIGREFIRAFEEAERAIIAQAAAEGEKIKFLVQGTLYPDVVESGGGEGAANIKSHHNVGGLPEDLQFELVEPLRALFKDEVRAVGAQLGLPQEIVGRQPFPGPGLGIRIVGEVTKERLDLLRKADAIARAELTA--AGLDNDVWQMPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWSRLPYDLLARISNRITNEVDGVNRVVLDVTSKPPGTIEWE 529
>gi|153217375|ref|ZP_01951126.1| GMP synthase [Vibrio cholerae 1587] >gi|153800595|ref|ZP_01955181.1| GMP synthase [Vibrio cholerae MZO-3] >gi|153824618|ref|ZP_01977285.1| GMP synthase [Vibrio cholerae MZO-2] >gi|153828256|ref|ZP_01980923.1| GMP synthase [Vibrio cholerae 623-39] >gi|194537805|ref|YP_002072944.1| GMP synthase [Vibrio cholerae V51] >gi|124113606|gb|EAY32426.1| GMP synthase [Vibrio cholerae 1587] >gi|124123884|gb|EAY42627.1| GMP synthase [Vibrio cholerae MZO-3] >gi|125622418|gb|EAZ50738.1| GMP synthase [Vibrio cholerae V51] >gi|148876210|gb|EDL74345.1| GMP synthase [Vibrio cholerae 623-39] >gi|149741836|gb|EDM55865.1| GMP synthase [Vibrio cholerae MZO-2] >gi|150424348|gb|EDN16285.1| GMP synthase [Vibrio cholerae AM-19226] (517 aa)
Score = 1258, Expect = 3.2e-136, Identities = 247/509 (48%), Positives = 348/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLY-KNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARR+R++ VY E+  +D+   +I + NP GIILSGG +SV    S +  + ++D  +P+ G+CYG Q M ++ GG+V    D  E+G   ++++  + LF++++L  + WMSH D V+ +P  F  I  T+ C  A+  N EKK+YGVQFHPEVT T  G Q+L+NFV  +C     W  ++I  + +  IK  V DD V+  +SGGVDS V A+L  +AIG KL CVFVD+GLLR NE ++V  +     G NI  VD ++ FL  L+G+ +PE KRK IG+ F+EVF++ + K++   K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+  +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P E L K+S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEANSPRAPQYVFDSGVPVFGVCYGMQTMAEQLGGRVAT-SDEREFGYAQVKISGESALFKDLDLTQDVWMSHGDKVVEIPADFVKIGETDTCPYAAMANEEKKYYGVQFHPEVTHTKNGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAMLVHRAIGSKLTCVFVDNGLLRLNEGEQVMEMFGDKFGLNIIKVDAEERFLKALEGIDEPEAKRKTIGRVFVEVFDEESKKLSNA-KWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMKMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYEFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517
>gi|118602883|ref|YP_904098.1| bifunctional GMP synthase/glutamine amidotransferase protein [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567822|gb|ABL02627.1| GMP synthase (glutamine-hydrolyzing) [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (521 aa)
Score = 1258, Expect = 3.2e-136, Identities = 254/511 (49%), Positives = 347/511 (67%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDN----NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG-SKF--SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPW-QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +DKILILDFG QYTQLIARR+R++ VY E+  YD+  E I K NPKGIILSGG D+V  D + K    I+DLNIPILGICYG Q M  + GG+  +  +  EYG   +R+  +  L  +I  +     + WMSH   V  LP GFK+IAST+ C +A   N EK +YG+QFHPEVT T  G ++L+ F+  IC    +W   NI  + ++ +K  + +  +L  +SGGVDSLV AVL  QA+G +L CVFVD+GLLR NE  EV  +  + +   +   +  + F   L    +PE KRKIIG+ FIEVFE+ A K++   ++L QGTIYPD++ES  +K+  +K IKSHHNVGGLP  LQF+L+EPLK LFKDEVRK+ + L IP   +YR PFPGPGL VR+LG++ ++   I+R+AD +F   +D+L+KN+ +    Q F V    KSVG+ GD R Y Y +ALRAV+++D M+A+W ++P + L+ +S+ I N++  ISRVVYD++ KPP TIEWE
  S:     7 LDKILILDFGSQYTQLIARRVREIGVYCELFPYDVDSEFIKKLNPKGIILSGGPDTVTLDNAAKAPSIIFDLNIPILGICYGMQTMAIQLGGRATS-ANKHEYGFAKVRVRNHSPLLSDISDEGHGLLDVWMSHGIEVEQLPNGFKLIASTDNCNIAGFANVEKHYYGLQFHPEVTHTKQGERILERFISGICQCEKNWTTDNIIAKLVQNLKDQIGNANILLGLSGGVDSLVVAVLLQQAVGKQLTCVFVDNGLLRFNEGNEVMQIFAQNMDMKVIRANAHKKFYDALLNENEPEAKRKIIGRAFIEVFEEEAKKLD-NIQFLAQGTIYPDVIESADAKYGKAKLIKSHHNVGGLPNDLQFKLVEPLKELFKDEVRKISVKLSIPPHIIYRHPFPGPGLGVRILGQVKQEYANILRQADAIF---MDELHKNNLYDTVNQAFAVFLPIKSVGITGDERRYDYVIALRAVETIDFMTARWARLPYDFLDLVSNRIMNEISRISRVVYDVSGKPPATIEWE 521
>gi|183599368|ref|ZP_02960861.1| hypothetical protein PROSTU_02837 [Providencia stuartii ATCC 25827] >gi|188021606|gb|EDU59646.1| hypothetical protein PROSTU_02837 [Providencia stuartii ATCC 25827] (525 aa)
Score = 1258, Expect = 3.2e-136, Identities = 256/509 (50%), Positives = 342/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIE--LDNN------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFS---KTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS-EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QY+QLIARR+R++ VY E+  +D+S E+I + NP GIILSGG +S   + S +  + +++  IP+LGICYG Q M  + GG VE   +  E+G   + +T   +LF +I+  L+ N       WMSH D V  +P  FK IAST  C  A   N EKKFYGVQFHPEVT T  G  +L+ FV  IC     W P  I  + +  +K  + DD+V+ A+SGGVDS V A+L  +AIG +L CVFVD+GLLR NE+ +V  +       NI  V  +  FLS L G+ DPE KRK IG  FI+VF++ A+K     K+L QGTIYPDI+ES +  +     IKSHHNVGGLPE ++  L+EPLK LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+K    HK  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L ++S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYSQLIARRVREIGVYCELWAWDVSEEQIREFNPNGIILSGGPESTTENDSPRAPEYVFNAGIPVLGICYGMQTMSMQLGGAVEVSGE-REFGYAKVEITEQCDLFRDIQDSLNENGTPVLDVWMSHGDKVTAIPADFKTIASTPNCPFAIMANEEKKFYGVQFHPEVTHTYQGLNILKRFVQDICQCEALWTPAAIIDDTVARLKEQIGDDHVILALSGGVDSSVTALLLNRAIGKRLTCVFVDNGLLRLNEADQVMEMFAGKFDLNIIHVKAEDRFLSALAGIHDPEAKRKAIGHVFIDVFDEEASK-QTQVKWLAQGTIYPDIIESAASATGKAHVIKSHHNVGGLPEDMKLGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHKAELYHKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVDGISRVVYDISGKPPATIEWE 525
>gi|124266815|ref|YP_001020819.1| bifunctional GMP synthase/glutamine amidotransferase protein [Methylibium petroleiphilum PM1] >gi|124259590|gb|ABM94584.1| GMP synthase (glutamine-hydrolyzing) [Methylibium petroleiphilum PM1] (534 aa)
Score = 1258, Expect = 3.3e-136, Identities = 251/510 (49%), Positives = 338/510 (66%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNN--------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVP------FKYLLQGTIYPDIVESG---SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPW-----QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKILILDFG Q TQLIARR+R+ +VY EI   D+S E I +  PKGIILSG + S Y D  ++  + +W+L +P+LGICYG   M+ + GG+VE      E+G  ++R   +  L + IE  +          WMSH D V  LP GFK++AST  C +A   +  + +Y VQFHPEVT T  G  LL+ FV  I     DW  K+   E +  I++ V D+ V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR NE   V  +    +   +  VD  +LF+++L GV DPE KRKIIG+ F++VF+  A K+           +L QGTIYPD++ESG   +K + TIKSHHNVGGLPE+L  +LLEPL+ LFKDEVR+LG++L +P+  VYR PFPGPGL VR+LGE+ +D  +++R AD +F   +      +  K W     Q F V    KSVGV+GD R+Y Y +ALRAV + D M+A W ++P   L++ S  I N+V+ I+RV YD+++KPP TIEWE
  S:     3 DKILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDEFIREFAPKGIILSGSHASTYEDHDLRAPQAVWELGVPVLGICYGMFTMVVQQGGEVEASA-HREFGYAEVRAHGHTRLLQGIEDFSTPEGHGMLKVWMSHGDKVTKLPPGFKLMASTPSCPIAGMADESRGYYAVQFHPEVTHTVQGRALLERFVLEIAKAQPDWVMKDHVAEAVAAIRAQVGDEEVILGLSGGVDSSVAAALIHRAIGDRLTCVFVDHGLLRLNEGDMVMEMFAGKLHAKVVRVDAAELFMNELAGVADPEAKRKIIGRLFVDVFKAEAAKLKASGAGHRGATFLAQGTIYPDVIESGGAKTKKATTIKSHHNVGGLPEQLGLKLLEPLRDLFKDEVRELGVALGLPHDMVYRHPFPGPGLGVRILGEVKKDYADLLRRADAIFIEELRNTVDPASGKTWYELTSQAFAVFLPVKSVGVMGDGRTYDYVVALRAVQTSDFMTADWAELPYALLKRTSGRIINEVRGINRVTYDVSSKPPATIEWE 534
>gi|29830022|ref|NP_824656.1| bifunctional GMP synthase/glutamine amidotransferase protein [Streptomyces avermitilis MA-4680] >gi|44887993|sp|Q82HM9|GUAA_STRAW GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|29607132|dbj|BAC71191.1| putative GMP synthase [Streptomyces avermitilis MA-4680] (525 aa)
Score = 1258, Expect = 3.3e-136, Identities = 244/510 (47%), Positives = 346/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN--ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI----NVPFKYLLQGTIYPDIVESGSKF-SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D +L++DFG QY QLIARR+R+  VYSEIV   + + E++ KNP  IILSGG  SVY + + + ++ I++  +P+ G+CYGFQ+M    GG V+N   + EYG T + ++ +   LFE    +   WMSH D+    P+GF V AST+   VA+  N EK+ YGVQ+HPEV  +T G Q+L++F+Y    +   W   N+  E++E I+  V     +C +SGGVDS VAA L  +AIG +L CV+VDHGL+R+ E+++V        G  + +VD ++ FL+ LKGV DPE+KRKIIG+ FI VFE+   +I         +L+QGT+YPD+VESG    +  IKSHHNVGGLPE L+FEL+EPL+ LFKDEVR +G  L +P + V RQPFPGPGL +R++GE+T+++L+++READ + R  +     + E   WQ   V L + +SVGV GD R+YG+ + LR V S DAM+A W ++P + L KIS+ I N+V +++RVV D+T+KPPGTIEWE
  S:    11 DTVLVVDFGAQYAQLIARRVREARVYSEIVPSTMPVAEMLAKNPAAIILSGGPSSVYAEGAPRLDREIFEAGVPVFGMCYGFQLMATTLGGTVDN-TGAREYGRTPLHVSKSGSTLFEGTPDEQPVWMSHGDACSAAPEGFTVTASTDVVPVAAFENDEKRLYGVQYHPEVMHSTHGQQVLEHFLYRGAGLTPSWTTGNVIDEQVELIREQVGTRRAICGLSGGVDSAVAAALVQKAIGSQLTCVYVDHGLMRQGETEQVEKDFVAATGVQLKVVDAEERFLTALKGVSDPEEKRKIIGREFIRVFEQAQAEIIADEGPEVAFLVQGTLYPDVVESGGGTGTANIKSHHNVGGLPEDLEFELIEPLRKLFKDEVRMVGQELGLPDEIVQRQPFPGPGLGIRIVGEVTKERLDLLREADAIAREELTAAGLDRE--IWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWSRLPYDTLAKISTRITNEVADVNRVVLDVTSKPPGTIEWE 525
>gi|52841950|ref|YP_095749.1| bifunctional GMP synthase/glutamine amidotransferase protein [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|81377336|sp|Q5ZUS0|GUAA_LEGPH GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|52629061|gb|AAU27802.1| GMP synthetase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (525 aa)
Score = 1257, Expect = 3.7e-136, Identities = 253/508 (49%), Positives = 349/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSK----TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSE--HKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +LILDFG QYTQLIARR+R++ VY EI  Y I+ E+  K NP G+ILSGG  +V  D + +  + ++D  +P+LGICYG Q M  + GGQV +     E+G  ++RL   ++L  NIE          LD   WMSH D V  LP GFK+I  T    +A   +  ++ YG+QFHPEVT T  G ++LQ FV  IC  + DW P++I  E I +I+  V  + VL  +SGGVDS V A L  +AIG++L CVFVD GLLR NE+++V ++  + +G  I  V+ +  FL+ LKGV  PE+KRKIIG+TFIEVF++ A K+    K+L QGTIYPD++ES +  +      IKSHHNVGGLP+ L  +LLEP++ LFKDEVR++GL L +P+  VYR PFPGPGL VR+L E+ ++  +I+R+AD +F   I++L+ N++  HK  Q F V    KSVGV+GD R Y Y + LRAV+++D M+A W ++P + L K+S+ I N+V+ +SRV YDI+ KPP TIEWE
  S:     9 LLILDFGSQYTQLIARRVREMGVYCEIYPYHINHEQFKKLNPCGVILSGGPSTVTHDANPRAPQWLFDSGLPLLGICYGMQTMAVQLGGQVHSSA-LREFGYAELRLHGHSQLLNNIEDRILADGSALLD--VWMSHGDKVTELPPGFKIICETRNAPIAGMADESRQMYGLQFHPEVTHTLQGLRILQRFVVDICKASTDWTPEHIIDEAINKIREQVGTEKVLLGLSGGVDSSVVAALLHRAIGEQLVCVFVDTGLLRLNEAEQVLSMFGRHMGIRIIAVNAEDKFLTALKGVTCPEEKRKIIGRTFIEVFDEEAQKL-TEIKWLAQGTIYPDVIESAATSTNDAAVVIKSHHNVGGLPDTLNLKLLEPIRELFKDEVRQVGLELGLPHDMVYRHPFPGPGLGVRILAEVKKEYADILRKADAIF---IEELH-NAQLYHKISQAFAVFLPVKSVGVMGDGRRYDYVICLRAVETVDFMTAHWSQLPWDFLGKVSNRIINEVEGVSRVTYDISGKPPATIEWE 525
>gi|88813489|ref|ZP_01128724.1| GMP synthase [Nitrococcus mobilis Nb-231] >gi|88789279|gb|EAR20411.1| GMP synthase [Nitrococcus mobilis Nb-231] (525 aa)
Score = 1257, Expect = 3.8e-136, Identities = 260/509 (51%), Positives = 340/509 (66%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDN--------NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSKT--IKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLF----RSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARRIR  NVY EI   D    EI    P GI+L+GG +SV+ D + +    ++ L +P+LGICYG Q M ++ GGQVE     +E+G    R    + L  NIE           + WMSH D V  LP+GFKVIAST    +A   + E++FYG+QFHPEVT TT G ++++ FV  IC  +G W   NI    +  I+  V  D VL  +SGGVDS V A L  QAIG++L CVFVD+GLLR NE  +V A   + +G  +  V+ ++ FL++L GVVDPE+KRK+IG+ FI+VF++ A K++   K+L QGTIYPD++ES G+K  K   IKSHHNVGGLPER+   LLEPL+ LFKDEVR +GL L +P + VYR PFPGPGL VR+LGE+ ++  + +R AD +F    R Y  +LY        Q F V    K+VGV GD R Y Y +ALRAV++ D M+A+W  +P E LE++S  I N+ + ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRIRQANVYCEIHPCDWPTAEIEAFAPMGIVLTGGPESVHVDNAPRIPDIVFQLGVPVLGICYGMQAMARQLGGQVEPSA-YKEFGYAQARARGHSRLLRNIEDHTTPEGYGLLDVWMSHGDRVAGLPEGFKVIASTLGAPIAGIGDDERRFYGLQFHPEVTHTTQGQRIIERFVGEICGCSGQWTASNIIEHSVTRIREEVGTDQVLLGLSGGVDSSVVAALLHQAIGEQLTCVFVDNGLLRLNEGAQVMATFARHMGVRVIHVNAEERFLTRLAGVVDPERKRKLIGRIFIDVFDEQAGKLD-GVKWLAQGTIYPDVIESAGAKTGKARLIKSHHNVGGLPERMNLRLLEPLRSLFKDEVRCIGLELGLPTELVYRHPFPGPGLGVRILGEVRKEYADALRRADAIFIEELRHY--ELYDRVS----QAFAVFLPVKTVGVTGDGRRYEYVIALRAVETTDFMTAQWSHLPYELLEEVSRRIINEAEGISRVVYDISGKPPATIEWE 525
>gi|163802484|ref|ZP_02196377.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio campbellii AND4] >gi|159173785|gb|EDP58600.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio campbellii AND4] (517 aa)
Score = 1257, Expect = 4.2e-136, Identities = 248/509 (48%), Positives = 350/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLY-KNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARR+R++ VY E+  +D+   +I + NP GIILSGG +SV  + S +  + ++D  +P+LG+CYG Q M ++ GG+V    +  E+G   ++++  + LF+++EL  + WMSH D V+ +P  F  +  T+ C  A+  N EKK+YGVQFHPEVT T  G Q+L+NFV   C     W  ++I  + +  IK  V +D V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE Q+V  +     G NI  VD ++ FL+ L+G  DPE+KRK IG  F++VF++ + K+    K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGEI ++  +++R AD +F   I++L+  +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L K+S+ I N+V+ ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTENNSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGKVAGSTE-REFGYAQVKVSGESALFKDLELTQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVTHTKGGLQMLENFVLGACGCERLWTSESIIEDAVARIKEQVGEDEVILGLSGGVDSSVVAMLVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEERFLNALEGKSDPEEKRKTIGHVFVDVFDEESKKLENA-KWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRADAIF---IEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGKVSNRIINEVEGISRVVYDISGKPPATIEWE 517
>gi|86150709|ref|ZP_01068925.1| GMP synthase [Campylobacter jejuni subsp. jejuni 260.94] >gi|85841879|gb|EAQ59125.1| GMP synthase [Campylobacter jejuni subsp. jejuni 260.94] (511 aa)
Score = 1257, Expect = 4.2e-136, Identities = 253/508 (49%), Positives = 342/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG-SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QYTQLIARR+R+  VY+EI+ +++S+ +I  K PKGIILSGG  SVY   +   +KGI+DL +PILGICYG Q+M       V      +EYG  +I +  +  LF+N+      WMSHSD V  LP+GF+V+A++         N +KKF+ +QFHPEV  + FG  +L+NF    C+    W   +    + E+I+  V +D VLCA+SGGVDS V A L A AI +++  VFVD+GLLR  E ++V  + K  +G ++  +D  ++FLS+L  V DPEQKRKIIG TFIEVFE+ A K +   KYL QGT+Y DI+ES     SKTIKSHHNVGGLPE++  +L+EPLK +FKDEVR LGL L +  + VYR PFPGPGLA+R++GE+    LE++R+AD +    +++L     + K WQ F VL N KSVGV+GDNR+Y   + +R VD+ D M+A +  +P E LE IS  I N+V+ I+RVVYDI++KPP TIEWE
  S:     6 ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLADIKAKEPKGIILSGGPASVYATDAYFCDKGIFDLGLPILGICYGMQLMAHHYKATVA-PAGHKEYGKANIEVKKDSALFKNLPKKQTVWMSHSDKVENLPQGFEVLATSENSPFCVFGNEDKKFFALQFHPEVQHSEFGKNILKNFAKYACNCESVWNMGSFAKTQAEKIREEVGNDKVLCAVSGGVDSSVVAALLASAIKEQVIVVFVDNGLLRSGEKEQVEFMFKNTLGIDLISIDASEIFLSRLANVRDPEQKRKIIGNTFIEVFEEEAKK-HKDVKYLAQGTLYTDIIESSVVGASKTIKSHHNVGGLPEKMNLKLIEPLKEIFKDEVRALGLELGLSKEVVYRHPFPGPGLAIRIMGEVNRASLELLRKADVIL---LEELKSTGWYDKTWQAFCVLLNVKSVGVMGDNRTYDNAVCIRVVDASDGMTATFSHLPYEVLENISRRIINEVEGINRVVYDISSKPPATIEWE 511
>gi|30248125|ref|NP_840195.1| bifunctional GMP synthase/glutamine amidotransferase protein [Nitrosomonas europaea ATCC 19718] >gi|44887949|sp|Q82XZ6|GUAA_NITEU GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|30180010|emb|CAD84005.1| guaA; GMP synthetase [Nitrosomonas europaea ATCC 19718] (519 aa)
Score = 1256, Expect = 4.9e-136, Identities = 250/508 (49%), Positives = 341/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNN--------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSK---TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ILILDFG QYT+LIARRIR+ NVY E+  +D+S + I +  P GIILSGG  S + + + +  + +++L +P+LGICYG Q M  + GG+VE D  + E+G  ++     +LF  I+   N         WMSH D V  LP GF  IAS      A+  +  + FYGVQFHPEVT T  G  +L +FV+ IC    DW   +   E I  I++ V +D V+  +SGGVDS VAA L  +AIGD+L CVFVD+GLLR NE++++     + +  N+  +D  + FL +LKG+ DPEQKR+ IG+ F+E+F++ A KI    K+L QGTIYPD++ES    +K    IKSHHNVGGLPE L  +LLEPL+ LFKDEVR+LGL+L +P+  V+R PFPGPGL VR+LGE+  +  E++R+AD +F   I++L     + K  Q F V    KSVGV+GDNRSY Y +ALRAV + D M+A W ++P   L +IS+ I N+++ I+RVVYDI+ KPP TIEWE
  S:     5 ILILDFGSQYTRLIARRIRETNVYCELHPFDVSPQFIREFAPIGIILSGGPASTFTEDAPRVPQIVFELGVPVLGICYGMQAMAAQLGGEVE-DAQTREFGYAELLTAPCKLFHGIQDRINSDGKPALDVWMSHGDRVNKLPPGFTAIASNAATPFAAMADETRNFYGVQFHPEVTHTRQGKAILDHFVHDICSAGYDWNMPDYVEEAIGRIRARVGNDKVVLGLSGGVDSSVAAALIHRAIGDQLVCVFVDNGLLRLNEAKQIMETFSRNLAVNVIYIDAGRQFLEQLKGITDPEQKRRTIGREFVEIFQQEAEKIENA-KWLAQGTIYPDVIESAGSHTKKAGVIKSHHNVGGLPETLHLKLLEPLRELFKDEVRELGLALGLPHDLVFRHPFPGPGLGVRILGEVKYEYTELLRQADAIF---IEELRNAGWYEKTSQAFAVFLPIKSVGVMGDNRSYEYVVALRAVQTEDFMTAHWAELPYTLLSRISNRIINEIRGINRVVYDISGKPPATIEWE 519
>gi|91225130|ref|ZP_01260352.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio alginolyticus 12G01] >gi|91190073|gb|EAS76344.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio alginolyticus 12G01] (517 aa)
Score = 1256, Expect = 5.5e-136, Identities = 248/509 (48%), Positives = 347/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLY-KNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARR+R++ VY E+  +D+   +I + NP GIILSGG +SV  + S +  + ++D  +P+LG+CYG Q M ++ GG+V    +  E+G   ++++    LF+++E   + WMSH D V+ +P  F  +  T+ C  A+  N EKK+YGVQFHPEVT T  G Q+L+NFV  +C     W  ++I  + +  IK  V DD V+  +SGGVDS V A+L  +AIGDKL CVFVD+GLLR NE Q+V  +     G NI  VD ++ FL  L+G  DPE+KRK IG  F++VF++ + K+    K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGEI ++  +++R AD +F   I++L+  +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P + L K+S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEENSPRAPQYVFDSGVPLLGVCYGMQTMAEQLGGKVAGSNE-REFGYAQVKVSGECALFKDLEATQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVTHTKGGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAMLVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDQFGLNIIKVDAEERFLKALEGKSDPEEKRKTIGHVFVDVFDEESKKLKNA-KWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRADAIF---IEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGKVSNRIINEVDGISRVVYDISGKPPATIEWE 517
>gi|74317769|ref|YP_315509.1| bifunctional GMP synthase/glutamine amidotransferase protein [Thiobacillus denitrificans ATCC 25259] >gi|91206837|sp|Q3SI29|GUAA_THIDA GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|74057264|gb|AAZ97704.1| GMP synthase [Thiobacillus denitrificans ATCC 25259] (520 aa)
Score = 1256, Expect = 5.5e-136, Identities = 252/509 (49%), Positives = 345/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSK---TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R+  VY E+   D+S + + +  P+GIILSGG +SVY D + +    ++ L +P+LGICYG Q M  + GG VE+     E+G  +IR   + +L  +I+          LD   WMSH D V  LP+GFK++AS     +A   +  ++FYGVQFHPEVT T  G  +L  FV+ IC    DW   +   E I +++S V  D V+  +SGGVDS V A L  +A+GD+L CVFVD+GLLR NE+++V     + +G  +  VD  + F+ +L GV DPEQKRKIIG+ F+ VF++ A K+    K+L QGTIYPD++ES S  +K   TIKSHHNVGGLPE L  +LLEPL+ LFKDEVR+LG++L +P+  VYR PFPGPGL VR+LG++  +  +++R AD +F   I++L  +  + K  Q FTV    KSVGV+GD R+Y Y +ALRAV + D M+A W ++P   L K+S+ I N+V+ I+RVVYD++ KPP TIEWE
  S:     4 KILILDFGSQYTQLIARRVREAGVYCELHPNDVSEDFVREFAPQGIILSGGPNSVYEDETPRAPDVVFTLGVPVLGICYGMQTMAAQLGGAVESAA-KREFGYAEIRARGHTQLLRDIQDRVTGEGHGMLD--VWMSHGDKVTALPEGFKLMASNAATPIAGMADEARRFYGVQFHPEVTHTLQGKHILNRFVHDICGCGSDWNMPDYVEEAIGKVRSEVGSDEVILGLSGGVDSSVVAALLHRAVGDQLTCVFVDNGLLRLNEAEQVMETFAQNLGVKVIHVDATERFMRELAGVSDPEQKRKIIGREFVHVFQEEAEKLPKA-KWLAQGTIYPDVIESASAKTKKAHTIKSHHNVGGLPETLHLQLLEPLRELFKDEVRELGIALGLPHDMVYRHPFPGPGLGVRILGKVKREYADLLRRADAIF---IEELRASGWYEKTSQAFTVFLPVKSVGVMGDGRTYDYVVALRAVQTQDFMTAHWAELPYTLLGKVSNRIINEVRGINRVVYDVSGKPPATIEWE 520
>gi|50122130|ref|YP_051297.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pectobacterium atrosepticum SCRI1043] >gi|81644335|sp|Q6D288|GUAA_ERWCT GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|49612656|emb|CAG76106.1| GMP synthase [glutamine-hydrolyzing] [Erwinia carotovora subsp. atroseptica SCRI1043] (525 aa)
Score = 1255, Expect = 6.2e-136, Identities = 249/509 (48%), Positives = 344/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFS---KTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARR+R+L VY E+  +D++  +I   NP GIILSGG +S     S +  + +++  +P+LG+CYG Q M  + GG VE   +  E+G   + + TN  L  +I+          LD   WMSH D V  +P+GF+ +AST+ C  A   N EK+FYGVQFHPEVT T  G ++L+ FV  IC     W P  I  + +  I+  V +D V+  +SGGVDS V A+L  +AIGD+L CVFVD+GLLR NE+ +V  +     G NI  V  +  FL++L G  +PE KRKIIG+ F+EVF++ ANK     K+L QGTIYPD++ES +  +     IKSHHNVGGLP+ ++  L+EPLK LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+K +  +K  Q FTV    +SVGV+GD R Y + +ALRAV+++D M+A W  +P + L ++S+ I N+V  ISRVVYD++ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRGFNPNGIILSGGPESTTEFGSPRAPEYVFNAGVPVLGVCYGMQTMAMQLGGHVEGSNE-REFGYAQVEVKTNSALVRDIQDALSATGAPLLD--VWMSHGDKVTAIPEGFETVASTDTCPFAIMANEEKRFYGVQFHPEVTHTRQGQRMLERFVLDICQCEALWTPAKIIDDAVNRIREQVGNDSVILGLSGGVDSSVTAMLLHRAIGDRLTCVFVDNGLLRLNEADQVLEMFGDNFGLNIVHVAAEDRFLNELAGEDEPEAKRKIIGRVFVEVFDEEANK-QAEVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPKEMKLGLVEPLKELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVALRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVDGISRVVYDVSGKPPATIEWE 525
>gi|119468953|ref|ZP_01611978.1| bifunctional GMP synthase/glutamine amidotransferase protein [Alteromonadales bacterium TW-7] >gi|119447605|gb|EAW28872.1| bifunctional GMP synthase/glutamine amidotransferase protein [Alteromonadales bacterium TW-7] (525 aa)
Score = 1255, Expect = 6.8e-136, Identities = 257/509 (50%), Positives = 342/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFS---KTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS-EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARRIR++ V+ E+  +D++ E+I + NP+GIILSGG +S   + S +  + +++  +P+LGICYG Q M  + GG+V +  D +E+G   +    N  LF+ IE          LD   WMSH D V+ +P  F   A T  C  A+  N EK+FYGVQFHPEVT T  G +LL+ F   IC     W P  I  + IE IK  V DD V+  +SGGVDS V A+L  +AIGD+L CVFVD+GLLR NE Q+V  +     G NI  VD ++ FL+ L G  DPE KRK IG TFI VF++ A K+    K+L QGTIYPD++ES +  +     IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGEI ++  +++R AD +F   I++L+K    HK  Q FTV    KSVGV+GD R Y + ++LR V+++D M+A+W  +P E L  +S+ I N++  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRIREIGVFCELWAWDVTEEQIREFNPQGIILSGGPESTTLENSPRAPEYVFNAGVPVLGICYGMQTMAIQLGGRVHS-SDKKEFGYAQVEKVGNCALFDAIEDHITDGGNGVLD--VWMSHGDKVMEVPASFSTTAKTPTCPHAAMSNEEKRFYGVQFHPEVTHTHQGQRLLERFAIDICGCEKLWTPAKIIDDAIERIKETVGDDEVILGLSGGVDSSVVAMLIHRAIGDRLTCVFVDNGLLRLNEGQQVMDMFGNKFGLNIVKVDAEEQFLADLAGKSDPEDKRKAIGHTFINVFDEQAKKLKNA-KWLGQGTIYPDVIESAASATGKAHVIKSHHNVGGLPDDMKMGLVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRADAIF---IEELHKAELYHKVSQAFTVFLPVKSVGVMGDARKYDWVVSLRCVETIDFMTARWSHLPYEFLGVVSNRIINEIDGISRVVYDISGKPPATIEWE 525
>gi|152993480|ref|YP_001359201.1| bifunctional GMP synthase/glutamine amidotransferase protein [Sulfurovum sp. NBC37-1] >gi|151425341|dbj|BAF72844.1| GMP synthase (glutamine-hydrolyzing) [Sulfurovum sp. NBC37-1] (513 aa)
Score = 1255, Expect = 6.9e-136, Identities = 250/508 (49%), Positives = 345/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL--TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAI-GDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QYTQLIAR++R+  VY+E+V Y  SIE+I  + P+GIILSGG  SVY + + KP++GIWDL +PILGICYG Q++ Q  GG V    D  EYG   + +    + +F+++  D+  WMSH D    LP+GF+V+ ++     A+  N  K  Y  QFHPEV  +  G  +L+NF   IC     W   +   EKI +I++ V +  VLC +SGGVDS V A +  +A+  ++L CVFVD GLLRK+E+++V  +  KL+   +  +D K+ F+  L GV DPEQKRK IG+ FIEVF+K A K +    +L QGT+Y D++ES S    SKTIKSHHNVGGLP+ + FEL+EPL+ +FKDEVRKLGL L +P   + R PFPGPGLA+RV+GE+ E+ L ++RE+D + +   ++L     + K WQ FTVL N +SVGV+GDNR+Y  T+ +R V+S+D M+A +  IP + LE IS  I N++  I+RVVYDI++KPP TIEWE
  S:     6 ILVLDFGSQYTQLIARKLRESGVYTEVVPYRESIEDIKARKPQGIILSGGPASVYAEDAYKPDEGIWDLGLPILGICYGMQLITQHFGGSVIA-ADHHEYGKAKLHIENENSPIFKDVAQDSIVWMSHGDRAERLPEGFEVVGTSENSPYAAIANESKHIYAFQFHPEVHHSVEGTHMLKNFAKYICGCESTWNMGSFAKEKIAQIRAQVGEKKVLCGVSGGVDSSVVAAMLHEALPKEQLICVFVDQGLLRKDEAEQVQDMF-KLLDIPLITIDAKKEFMEALAGVTDPEQKRKAIGEKFIEVFDKEAGK-HTDVSFLAQGTLYTDVIESVSVKGPSKTIKSHHNVGGLPDWMTFELVEPLREIFKDEVRKLGLELGLPKHMIGRHPFPGPGLAIRVMGEVNEEALRLLRESDAIMQ---EELRSTGYYDKVWQAFTVLLNVQSVGVMGDNRTYDNTVCVRMVESVDGMTATFAHIPHDVLEGISRRIINEIDGINRVVYDISSKPPATIEWE 513
>gi|15645037|ref|NP_207207.1| bifunctional GMP synthase/glutamine amidotransferase protein [Helicobacter pylori 26695] >gi|3122166|sp|O25165|GUAA_HELPY GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|2313515|gb|AAD07477.1| GMP synthase (guaA) [Helicobacter pylori 26695] (508 aa)
Score = 1255, Expect = 7.2e-136, Identities = 268/508 (52%), Positives = 351/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREK-KFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKL-IGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFK--YLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QYTQLIARR+R+  +Y+EIV +  SIE I KK PKG+ILSGG  SVY   + KP+  I+DLN+PILGICYG Q ++   GG V    + +E+G   + +T N  +FE +++ +  WMSH D VI LPKGF  +A +     +  C  E  K +G+QFHPEV Q+  G ++L+NF   +C     W  ++    +I  +K  + +  VLCA+SGGVDS V A L  +AI D L  VFVDHGLLRKNE + V A+ K L I  N   +D K++FLSKLKGV +PE KRKIIG+TFIEVFEK A K ++  K  +L QGT+YPD++ES S    SK IK+HHNVGGLPE + F+L+EPL+ LFKDEVR LG  L +    + R PFPGPGLAVR+LGEI+E K++ ++EADF+F   I++L K N   K WQ F VL N  SVGV+GDNR+Y   + LRAV++ D M+A +  +    LEK+S+ I N+V  I+RVVYDIT+KPPGTIEWE
  S:     2 ILVLDFGSQYTQLIARRLRERGIYTEIVPFFESIENIQKKAPKGLILSGGPASVYAKDAYKPSGKIFDLNVPILGICYGMQYLVDFFGGVVVG-ANEQEFGKAVLEITQNSVIFEGVKIKSLVWMSHMDKVIELPKGFTTLAKSPN---SPHCAIENGKIFGLQFHPEVVQSEEGGKILENFALLVCGCEKTWGMQHFAQREIARLKEKIANAKVLCAVSGGVDSTVVATLLHRAIKDNLIAVFVDHGLLRKNEKERVQAMFKDLKIPLNT--IDAKEVFLSKLKGVSEPELKRKIIGETFIEVFEKEAKKHHLKGKIEFLAQGTLYPDVIESVSVKGPSKVIKTHHNVGGLPEWMDFKLIEPLRELFKDEVRLLGKELGVSQDFLMRHPFPGPGLAVRILGEISESKIKRLQEADFIF---IEELKKANLYDKVWQAFCVLLNVNSVGVMGDNRTYENAICLRAVNASDGMTASFSFLEHSFLEKVSNRITNEVSGINRVVYDITSKPPGTIEWE 508
>gi|108563408|ref|YP_627724.1| bifunctional GMP synthase/glutamine amidotransferase protein [Helicobacter pylori HPAG1] >gi|107837181|gb|ABF85050.1| GMP synthase [Helicobacter pylori HPAG1] (508 aa)
Score = 1255, Expect = 7.4e-136, Identities = 268/508 (52%), Positives = 351/508 (69%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREK-KFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKL-IGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFK--YLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYK-NSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QYTQLIARR+R+  +Y+EIV +  SIE I KK PKG+ILSGG  SVY   + KP++ I+DLN+PILGICYG Q ++   GG V    + +E+G   + +T +  +FE ++  +  WMSH D VI LPKGF  +A +     +  C  E  K +G+QFHPEV Q+  G ++L+NF   +CD    W  ++    +I  +K  + +D VLCA+SGGVDS V A L  +AI D L  VFVDHGLLRKNE + V A+ K L I  N   +D K +FLSKLKGV +PE KRKIIG+TFIEVFEK A K ++  K  +L QGT+YPD++ES S    SK IK+HHNVGGLPE + F+L+EPL+ LFKDE R LG  L I    + R PFPGPGLAVR+LGE++E K++ ++EADF+F   I++L K N   K WQ F VL N  SVGV+GDNR+Y   + LRAV++ D M+A +  +    LEK+S+ I N+V  I+RVVYDIT+KPPGTIEWE
  S:     2 ILVLDFGSQYTQLIARRLRESGIYAEIVPFFESIENIQKKAPKGLILSGGPASVYAKDAYKPSEKIFDLNVPILGICYGMQYLVDFFGGVVAG-ANEQEFGKAVLEITQDSVIFEGVKTKSLVWMSHMDKVIELPKGFITLAKSPN---SPHCAIENGKIFGLQFHPEVIQSEEGGKILENFALLVCDCEKTWGMQHFAQREIARLKEKIANDKVLCAVSGGVDSTVVATLLYRAIKDNLIAVFVDHGLLRKNEKERVQAMFKDLQIPLNT--IDAKGIFLSKLKGVSEPELKRKIIGETFIEVFEKEAKKHHLKGKIEFLAQGTLYPDVIESVSVKGPSKVIKTHHNVGGLPEWMDFKLIEPLRELFKDEARLLGKELGISQDFLMRHPFPGPGLAVRILGEVSESKIKRLQEADFIF---IEELKKANLYDKVWQAFCVLLNVNSVGVMGDNRTYENAICLRAVNASDGMTASFSFLEHSFLEKVSNRITNEVSGINRVVYDITSKPPGTIEWE 508
>gi|86158770|ref|YP_465555.1| bifunctional GMP synthase/glutamine amidotransferase protein [Anaeromyxobacter dehalogenans 2CP-C] >gi|85775281|gb|ABC82118.1| GMP synthase (glutamine-hydrolyzing) [Anaeromyxobacter dehalogenans 2CP-C] (518 aa)
Score = 1255, Expect = 7.4e-136, Identities = 249/510 (48%), Positives = 345/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI---NVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KILILDFG QYTQLIARR+R+L VY EI       E I    P+G++LSGG  SV  + S + ++ +++L +P+LGICYG QV   E GG+V+      E+G   I +  T+ LF+ +    + WMSH D V  LP GF+ IA++     A+  +R ++FYGVQFHPEV  T  G  +L+NF Y +C  +G W  +      +E+I++ VKD +V+CA+SGGVDS VAA+L  +AIGD+L C+FVD+G+LR  E ++V  +   +    +  VD  + FL  L GV DPE+KRKIIG  FI VFE+   ++       ++L+QGT+YPD++ES S    S TIKSHHNVGGLPE++   L+EPL+ LFKDEVR+LGL L +P   V RQPFPGPGLA+RVLGE+TE++L ++R AD + +  +    LY+    K WQ F VL   +SVGV+GD R+Y  T A+RAV+S D M+  W ++P + L ++SS I N+V+ I+RVVYDI++KPP TIEWE
  S:     6 EKILILDFGSQYTQLIARRLRELGVYCEIHPCTAKAEAIRAFRPRGVVLSGGPASVLAEGSPRCDRVVFELGVPVLGICYGLQVFAAELGGRVDQAA-HREFGPATIEVKATSPLFQGLPATLDVWMSHGDRVEALPPGFEPIAASPSAPFAAVEDRARRFYGVQFHPEVVHTPRGKDVLRNFAYGVCGCSGTWSMRGYAEAAVEQIRAQVKDGHVICALSGGVDSAVAALLVHRAIGDRLRCIFVDNGVLRAGERKQVEDVFGAMFHLPLVTVDASRRFLGALAGVTDPERKRKIIGHEFIAVFEQEVERLAAHGARARFLVQGTLYPDVIESVSFRGPSATIKSHHNVGGLPEKMNLALVEPLRELFKDEVRELGLELGLPEAIVRRQPFPGPGLAIRVLGEVTEERLSVLRRADTIVQEEVRAAGLYE----KLWQGFAVLLPVRSVGVMGDERTYESTCAIRAVESTDGMTGDWARLPYDLLGRMSSRIINEVRGINRVVYDISSKPPATIEWE 518
>gi|160901537|ref|YP_001567118.1| bifunctional GMP synthase/glutamine amidotransferase protein [Petrotoga mobilis SJ95] >gi|160359181|gb|ABX30795.1| GMP synthase, large subunit [Petrotoga mobilis SJ95] (507 aa)
Score = 1254, Expect = 7.9e-136, Identities = 259/511 (50%), Positives = 351/511 (68%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNEL-FENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKT--IKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           M+KIL++D+G QYTQL+A+RIRDL V+SE++ YD   + I   N KGIILSGG DSVY   +   +  I +  +PILGICYG Q++ ++ GG+VE  +   EYG T I +T   L F+ I    N WMSH D V  +P+ FK+ + T+  +++S  N  +  Y +QFHPEV  T FG  +L+NF+  IC + G W   +    KI+EIK  + D   + A+SGGVDS VAAVLT +AIG+ L  +FV+HG LR NE +EV +  +  +G N+  VD ++ FLSKLKGV DPEQKRKIIG+ FI VFE+ A K     +YL+QGTIY D++ES     KT  IKSHHNVGGLPE +  +++EPLK LFKDEVR +G  L +P + +YR PFPGPGLA+R++GEI ++KL I+++ D +F   I+ L +   + K WQ F VL   K+VG+ GD RSYGY  ALR+VDS++ M+A W K+P E L+ +SS I N+V+ I+RVVYDI++KPP TIEWE
  S:     1 MEKILVIDYGSQYTQLLAKRIRDLGVFSEVIQYD---DNISLSNVKGIILSGGPDSVYNIDAPDISDEILNAELPILGICYGMQLIAKKLGGKVEQ-RGIAEYGKTKINITDQSLLFKKIPSTFNVWMSHKDMVTKVPEKFKITSLTSNNIISSFENESENIYCIQFHPEVRHTEFGIDILKNFIQGICGLKGSWTLMDFVENKIKEIKDTIGDKKAIIALSGGVDSSVAAVLTHRAIGNNLKAIFVNHGFLRMNEVEEVESTFRDYMGLNLTTVDAQERFLSKLKGVTDPEQKRKIIGEEFIRVFEQEAKK-EEGCEYLIQGTIYSDVIESAKSGKKTFKIKSHHNVGGLPEDIDLKIVEPLKELFKDEVRSVGEILGLPREILYRHPFPGPGLAIRIMGEINDEKLTILKKVDNIF---INTLKETGWYDKVWQAFAVLIPVKTVGITGDKRSYGYVAALRSVDSVEGMTADWSKVPFEILDLVSSRITNEVEEITRVVYDISSKPPATIEWE 507
>gi|78223495|ref|YP_385242.1| bifunctional GMP synthase/glutamine amidotransferase protein [Geobacter metallireducens GS-15] >gi|91206808|sp|Q39TA7|GUAA_GEOMG GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|78194750|gb|ABB32517.1| GMP synthase (glutamine-hydrolyzing) [Geobacter metallireducens GS-15] (520 aa)
Score = 1254, Expect = 8.0e-136, Identities = 250/510 (49%), Positives = 344/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL--TTNELFEN--IELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +KILILDFG QYTQLIARR+R+ +VY E+  +D+ +  I    P+GIILSGG  SVY + +    + +++L +P+LGICYG Q+M +  GGQV       E+G  D+    T   LF+   +E  +  WMSH D V  +P GF+V+  T    V +  +  +  YGVQFHPEV  T  G  L+  FV  IC  +G W P +I  + +  I++ V +D V+  +SGGVDS VAA L  +AIGD+L CVFVD+GLLR +E  +V A   + +G  +  VD +  FL+ L G  DPE+KRKIIGK F+++FE+ +NKI    ++L QGTIYPD++ES G+K  K   IKSHHNVGGLP+ ++ +LLEPL+ LFKDEVR +G  L +P+Q V+R PFPGPGL VR+LGE+ ++  +I+R AD +   YI++LY    + K  Q F V    KSVGV+GD R+Y Y +ALRAV++ D M+A WY +P E + +ISS I N+VK ++RVVYDI++KPP TIEWE
  S:     8 EKILILDFGSQYTQLIARRVREAHVYCELHPFDMDLAAIRAFAPRGIILSGGPKSVYEEGAPAVEEALFELGVPVLGICYGMQLMSRHFGGQVV-PAGKREFGHADLLAVGTPGPLFDGFFVEGKSPVWMSHGDHVSLVPAGFQVVGETANAPVCAIQDLARNLYGVQFHPEVNHTPRGELLIDTFVRKICGCSGQWTPGHIIDDAVSRIRAQVGNDRVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDNGLLRLSEGDQVMATFAENLGVKVIRVDAEDRFLTALAGESDPEKKRKIIGKLFVDIFEEESNKI-TDARWLAQGTIYPDVIESAGAKTGKAHNIKSHHNVGGLPDYMKLKLLEPLRELFKDEVRAIGEELGLPHQMVWRHPFPGPGLGVRILGEVKKEYADILRRADAI---YIEELYAAGHYDKISQAFAVFLPVKSVGVMGDGRTYEYVVALRAVETKDFMTAGWYPLPYEDMARISSRIINEVKGVNRVVYDISSKPPATIEWE 520
>gi|15640787|ref|NP_230417.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121585763|ref|ZP_01675558.1| GMP synthase [Vibrio cholerae 2740-80] >gi|121726010|ref|ZP_01679309.1| GMP synthase [Vibrio cholerae V52] >gi|147675501|ref|YP_001216253.1| bifunctional GMP synthase/glutamine amidotransferase protein [Vibrio cholerae O395] >gi|153220670|ref|ZP_01951781.1| GMP synthase [Vibrio cholerae MAK 757] >gi|153817288|ref|ZP_01969955.1| GMP synthase [Vibrio cholerae NCTC 8457] >gi|153821377|ref|ZP_01974044.1| GMP synthase [Vibrio cholerae B33] >gi|194533612|ref|YP_002069028.1| GMP synthase [Vibrio cholerae MO10] >gi|13627138|sp|Q9KTW2|GUAA_VIBCH GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|9655215|gb|AAF93933.1| GMP synthase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121550126|gb|EAX60142.1| GMP synthase [Vibrio cholerae 2740-80] >gi|121631492|gb|EAX63862.1| GMP synthase [Vibrio cholerae V52] >gi|124120234|gb|EAY38977.1| GMP synthase [Vibrio cholerae MAK 757] >gi|125619664|gb|EAZ48191.1| GMP synthase [Vibrio cholerae MO10] >gi|126512204|gb|EAZ74798.1| GMP synthase [Vibrio cholerae NCTC 8457] >gi|126521087|gb|EAZ78310.1| GMP synthase [Vibrio cholerae B33] >gi|146317384|gb|ABQ21923.1| GMP synthase [Vibrio cholerae O395] (517 aa)
Score = 1254, Expect = 8.1e-136, Identities = 246/509 (48%), Positives = 348/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLY-KNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARR+R++ VY E+  +D+   +I + NP GIILSGG +SV    S +  + ++D  +P+ G+CYG Q M ++ GG+V    D  E+G   ++++  + LF++++L  + WMSH D V+ +P  F  I  T+ C  A+  N EKK+YGVQFHPEVT T  G Q+L+NFV  +C     W  ++I  + +  IK  V +D V+  +SGGVDS V A+L  +AIG KL CVFVD+GLLR NE ++V  +     G NI  VD ++ FL  L+G+ +PE KRK IG+ F+EVF++ + K++   K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+  +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P E L K+S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEANSPRAPQYVFDSGVPVFGVCYGMQTMAEQLGGRVAT-SDEREFGYAQVKISGESALFKDLDLTQDVWMSHGDKVVEIPADFVKIGETDTCPYAAMANEEKKYYGVQFHPEVTHTKNGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGNDEVILGLSGGVDSSVVAMLVHRAIGSKLTCVFVDNGLLRLNEGEQVMEMFGDKFGLNIIKVDAEERFLKALEGIDEPEAKRKTIGRVFVEVFDEESKKLSNA-KWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMKMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYEFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517
>gi|194536554|ref|YP_002071712.1| GMP synthase [Vibrio cholerae RC385] >gi|150421348|gb|EDN13630.1| GMP synthase [Vibrio cholerae RC385] (517 aa)
Score = 1254, Expect = 8.7e-136, Identities = 245/509 (48%), Positives = 349/509 (68%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLT-TNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLY-KNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQL+ARR+R++ VY E+  +D+   +I + NP GIILSGG +SV    S +  + ++D  +P+ G+CYG Q M ++ GG+V    D  E+G   ++++  + LF++++L  + WMSH D V+ +P  F  I  T+ C  A+  N EKK+YGVQFHPEVT T  G Q+L+NFV  +C     W  ++I  + +  IK  V +D V+  +SGGVDS V A+L  +AIG++L CVFVD+GLLR NE ++V  +     G NI  VD ++ FL  L+G+ +PE KRK IG+ F+EVF++ + K++   K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   I++L+  +  +K  Q FTV    +SVGV+GD R Y + ++LRAV+++D M+A W  +P E L K+S+ I N+V  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEANSPRAPQYVFDSGVPVFGVCYGMQTMAEQLGGRVAT-SDEREFGYAQVKISGESALFKDLDLTQDVWMSHGDKVVEIPADFVKIGETDTCPYAAMANEEKKYYGVQFHPEVTHTKNGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGNDEVILGLSGGVDSSVVAMLVHRAIGNRLTCVFVDNGLLRLNEGEQVMEMFGDKFGLNIIKVDAEERFLKALEGIDEPEAKRKTIGRVFVEVFDEESKKLSNA-KWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMKMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYEFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517
>gi|73748640|ref|YP_307879.1| bifunctional GMP synthase/glutamine amidotransferase protein [Dehalococcoides sp. CBDB1] >gi|91206805|sp|Q3ZXH7|GUAA_DEHSC GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|73660356|emb|CAI82963.1| GMP synthase [Dehalococcoides sp. CBDB1] (533 aa)
Score = 1254, Expect = 9.3e-136, Identities = 252/510 (49%), Positives = 340/510 (66%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIR--LTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVE---SGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + I+I DFG QY+ LIARRIR+++VY E+V +D   E+I   NP+G ILSGG  SVY   +      I++  +P+LGICYG Q + Q+ GG VE+  D  EYG   +   +   EL  ++   +  WMSH D +  LP GFK +A T  C VA   N E   YG+QFHPEV  +  G  +L+NFV++IC    +W   N   E I+ I+  V D  V+CA+SGGVDS V A L  +AIGD+L C++V++GLLR+ E+     + K  +G  I  VD    FL  L G+ DPEQKRK+IG  FI+VFE  A K+     +L QGT+YPD++E   S SK S  IKSHHNVGGLP  ++ +L+EPL+YLFKDEVR LG  L +P + ++RQPFPGPGLA+R++GE+T +KLEI+R AD++  S I +      H+ WQ F +LT+ KSVGV+GD R+YGY +A+RAV S DAM+A W K+P + L  IS+ I N+VK ++RVVYDI++KPP TIEWE
  S:    24 ESIVIFDFGSQYSLLIARRIREMHVYCELVSHDTPWEKIAHLNPRGFILSGGPSSVYEPEAPLAPAYIFESKLPVLGICYGMQAITQQLGGVVEH-SDKREYGHALLHSNVINTELLADMPEPSPVWMSHGDRIEKLPAGFKSLAYTENCPVAVMGN-ESDIYGLQFHPEVVHSPHGKIILKNFVFNICKCHANWTMGNYIQESIQNIREQVGDGQVICALSGGVDSAVVASLIHKAIGDQLTCIYVNNGLLRREEADRTLHVFKNHMGMKIIYVDAIDRFLESLGGITDPEQKRKVIGSEFIKVFEDEACKLG-QIDFLAQGTLYPDVIESVSSVSKASAKIKSHHNVGGLPAHMKLKLIEPLRYLFKDEVRLLGKELGLPDEMIWRQPFPGPGLAIRIIGEVTREKLEILRSADWIVMSEIKK--AKMYHQVWQSFAILTDVKSVGVMGDFRTYGYLVAIRAVTSEDAMTADWAKLPYDLLSIISNRIVNEVKEVNRVVYDISSKPPSTIEWE 533
>gi|147669399|ref|YP_001214217.1| bifunctional GMP synthase/glutamine amidotransferase protein [Dehalococcoides sp. BAV1] >gi|146270347|gb|ABQ17339.1| GMP synthase (glutamine-hydrolyzing) [Dehalococcoides sp. BAV1] (560 aa)
Score = 1253, Expect = 1.0e-135, Identities = 252/510 (49%), Positives = 340/510 (66%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIR--LTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVE---SGSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + I+I DFG QY+ LIARRIR+++VY E+V +D   E+I   NP+G ILSGG  SVY   +      I++  +P+LGICYG Q + Q+ GG VE+  D  EYG   +   +   EL  ++   +  WMSH D +  LP GFK +A T  C VA   N E   YG+QFHPEV  +  G  +L+NFV++IC    +W   N   E I+ I+  V D  V+CA+SGGVDS V A L  +AIGD+L C++V++GLLR+ E+     + K  +G  I  VD    FL  L G+ DPEQKRK+IG  FI+VFE  A K+     +L QGT+YPD++E   S SK S  IKSHHNVGGLP  ++ +L+EPL+YLFKDEVR LG  L +P + ++RQPFPGPGLA+R++GE+T +KLEI+R AD++  S I +      H+ WQ F +LT+ KSVGV+GD R+YGY +A+RAV S DAM+A W K+P + L  IS+ I N+VK ++RVVYDI++KPP TIEWE
  S:    51 ESIVIFDFGSQYSLLIARRIREMHVYCELVSHDTPWEKIAHLNPRGFILSGGPSSVYEPEAPLAPAYIFESKLPVLGICYGMQAITQQLGGVVEH-SDKREYGHALLHSNVINTELLADMPEPSPVWMSHGDRIEKLPAGFKSLAYTENCPVAVMGN-ESDIYGLQFHPEVVHSPHGKIILKNFVFNICKCHANWTMGNYIQESIQNIREQVGDGQVICALSGGVDSAVVASLIHKAIGDQLTCIYVNNGLLRREEADRTLHVFKNHMGMKIIYVDAIDRFLESLGGITDPEQKRKVIGSEFIKVFEDEACKLG-QIDFLAQGTLYPDVIESVSSVSKASAKIKSHHNVGGLPAHMKLKLIEPLRYLFKDEVRLLGKELGLPDEMIWRQPFPGPGLAIRIIGEVTREKLEILRSADWIVMSEIKK--AKMYHQVWQSFAILTDVKSVGVMGDFRTYGYLVAIRAVTSEDAMTADWAKLPYDLLSIISNRIVNEVKEVNRVVYDISSKPPSTIEWE 560
>gi|157415511|ref|YP_001482767.1| bifunctional GMP synthase/glutamine amidotransferase protein [Campylobacter jejuni subsp. jejuni 81116] >gi|157386475|gb|ABV52790.1| bifunctional GMP synthase/glutamine amidotransferase protein [Campylobacter jejuni subsp. jejuni 81116] (511 aa)
Score = 1253, Expect = 1.0e-135, Identities = 253/508 (49%), Positives = 341/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG-SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QYTQLIARR+R+  VY+EI+ +++S+ +I  K PKGIILSGG  SVY   +   +KGI+DL +PILGICYG Q+M       V      +EYG  +I +  +  LF+N+      WMSHSD V  LP+GF+V+A++         N +KKF+ +QFHPEV  + FG  +L+NF    C+    W   +    + E+I+  V  D VLCA+SGGVDS V A L A AI +++  VFVD+GLLR  E ++V  + K  +G ++  +D  ++FLS+L  V DPEQKRKIIG TFIEVFE+ A K +   KYL QGT+Y DI+ES     SKTIKSHHNVGGLPE++  +L+EPLK +FKDEVR LGL L +  + VYR PFPGPGLA+R++GE+    LE++R+AD +    +++L     + K WQ F VL N KSVGV+GDNR+Y   + +R VD+ D M+A +  +P E LE IS  I N+V+ I+RVVYDI++KPP TIEWE
  S:     6 ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLADIKAKEPKGIILSGGPASVYATDAYFCDKGIFDLGLPILGICYGMQLMAHHYKATVA-PAGHKEYGKANIEVKKDSALFKNLPKKQTVWMSHSDKVENLPQGFEVLATSENSPFCVFGNEDKKFFALQFHPEVQHSEFGKNILKNFAKYACNCESVWNMGSFAKTQAEKIREEVGSDKVLCAVSGGVDSSVVAALLASAIKEQVIVVFVDNGLLRSGEKEQVEFMFKNTLGIDLISIDASEIFLSRLANVRDPEQKRKIIGNTFIEVFEEEAKK-HKDVKYLAQGTLYTDIIESSVVGASKTIKSHHNVGGLPEKMNLKLIEPLKEIFKDEVRALGLELGLSKEVVYRHPFPGPGLAIRIMGEVNRPSLELLRKADVIL---LEELKSTGWYDKTWQAFCVLLNIKSVGVMGDNRTYDNAVCIRVVDASDGMTATFSHLPYEVLENISRRIINEVEGINRVVYDISSKPPATIEWE 511
>gi|158425329|ref|YP_001526621.1| bifunctional GMP synthase/glutamine amidotransferase protein [Azorhizobium caulinodans ORS 571] >gi|158332218|dbj|BAF89703.1| putative GMP synthase [Azorhizobium caulinodans ORS 571] (515 aa)
Score = 1253, Expect = 1.0e-135, Identities = 252/510 (49%), Positives = 340/510 (66%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNN---CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS---KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKP-WQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           D +LI+DFG Q TQLIARR+R+  VYSE+V +  + E + +  P+ +ILSGG  SV    S +  + +++  IP+LGICYG Q M  + GG+VE      E+G  ++ +     LFE +  +      WMSH D V  LP GF+VIA +     A+  +  +KFYGVQFHPEV  T  G QLL+NFV  +  + GDW     + E I +I++ V D  VLC +SGGVDS VAAVL  +AIGD+L CVFVDHGL+R  E+++V +L +      +  VD  +LFL +L GV DPE+KRK IGK FI+VFE  A KI     +L QGT+YPD++ES S     S TIKSHHNVGGLPER+  +L+EPL+ LFKDEVR LG  L +P   V R PFPGPGLA+R  GEIT +KLEI+R+AD +   Y++++     +   WQ F VL   ++VGV+GD R+Y + LALRAV S+D M+A +Y   ++ L + ++ I N+V+ I+RVVYD+T+KPPGTIEWE
  S:     3 DTVLIIDFGSQVTQLIARRVREEGVYSEVVPFQKAAEAMDRLKPRAVILSGGPASVIEGESPRAPQAVFEAGIPVLGICYGEQAMADQLGGKVEAGH-HREFGRAEVEVVKPAALFEGVWQEGQRYLVWMSHGDRVTQLPAGFEVIAQSENAPFAAIADESRKFYGVQFHPEVVHTPQGAQLLRNFVRKVAGLQGDWTMGAFREESIRKIRAQVGDKRVLCGLSGGVDSAVAAVLIHEAIGDQLTCVFVDHGLMRLGEAEQVVSLFRNTYNIPLVHVDASELFLKELDGVSDPEKKRKTIGKLFIDVFEAEAKKIGGA-DFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLVEPLRELFKDEVRALGRELGLPESFVGRHPFPGPGLAIRCPGEITPEKLEILRQADAI---YLEEIRAAGLYDVIWQAFAVLLPVRTVGVMGDGRTYDHVLALRAVTSIDGMTADFYPFQMDFLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE 515
>gi|160945133|ref|ZP_02092359.1| hypothetical protein FAEPRAM212_02652 [Faecalibacterium prausnitzii M21/2] >gi|158442864|gb|EDP19869.1| hypothetical protein FAEPRAM212_02652 [Faecalibacterium prausnitzii M21/2] (521 aa)
Score = 1253, Expect = 1.1e-135, Identities = 252/510 (49%), Positives = 343/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALL----KKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG-SKFSKTIKSHHNVGGLPERLQF-ELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           + +++LDFGGQY QLIARR+R+ NVY EI  Y   +  I  KNPKGII +GG +SVY + S   +  I+   +P+LGICYG Q+MM   GG V    +  EYG T++ + T ++LF +++    CWMSH+D +     GF++ A T  C VA+  N EK  Y VQFHPEV  T  G ++L+NFVY++C  +GDW+  +     ++ ++  + +  VLCA+SGGVDS V A + A+AIG +L CVFVDHGLLRKNE +EVC++           N   VD +  + SKLKGV +PE+KRKIIG+ FI VFE+ A KI     +L QGTIYPD+VESG    S  IKSHHNVGGLP+ + F EL+EPL+ LFKDEVR+ G  L +P   V RQPFPGPGL +R++GE+T +K+ IV++AD ++R  I +   + E    QY+  LTN  SVGV+GD R+Y Y +ALRAV + D M+A+ Y +P + L  ++S I N+VK+++RV YD T KPP TIE E
  S:     9 ETVIVLDFGGQYNQLIARRVRENNVYCEIYSYKTDLSVIKAKNPKGIIFTGGPNSVYLEDSPTIDPEIFSWGVPVLGICYGSQLMMHLLGGHVCRAPE-REYGKTEVFVNTESKLFTDVQPSTICWMSHNDYIEQAAPGFQITAHTANCPVAAVENAEKGLYAVQFHPEVLHTAEGKKMLRNFVYNVCGCSGDWKMDSFVENNVKALRERIGEGKVLCALSGGVDSSVLAAMLAKAIGKQLTCVFVDHGLLRKNEKEEVCSVFGPGNANGFDINFICVDARDRYFSKLKGVTEPERKRKIIGEEFIRVFEEEAKKIG-KVDFLAQGTIYPDVVESGLGGESTVIKSHHNVGGLPDTVDFKELVEPLRNLFKDEVRQAGRELGLPEYLVSRQPFPGPGLGIRIIGEVTPEKVTIVQDADAIWREEIAKAGLDKEIS--QYYAALTNMHSVGVMGDERTYDYAVALRAVTTTDFMTAESYDMPWDVLGTVTSRIVNEVKHVNRVFYDCTGKPPATIELE 521
>gi|108798144|ref|YP_638341.1| bifunctional GMP synthase/glutamine amidotransferase protein [Mycobacterium sp. MCS] >gi|119867240|ref|YP_937192.1| bifunctional GMP synthase/glutamine amidotransferase protein [Mycobacterium sp. KMS] >gi|126433803|ref|YP_001069494.1| bifunctional GMP synthase/glutamine amidotransferase protein [Mycobacterium sp. JLS] >gi|108768563|gb|ABG07285.1| GMP synthase (glutamine-hydrolyzing) [Mycobacterium sp. MCS] >gi|119693329|gb|ABL90402.1| GMP synthase (glutamine-hydrolyzing) [Mycobacterium sp. KMS] >gi|126233603|gb|ABN97003.1| GMP synthase (glutamine-hydrolyzing) [Mycobacterium sp. JLS] (519 aa)
Score = 1253, Expect = 1.2e-135, Identities = 237/508 (46%), Positives = 333/508 (65%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI----NVPFKYLLQGTIYPDIVES-GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFG QY QLIARR+R+  V+SE+V +  ++EEI  K+P+ I+LSGG  SVY D + + +  ++DL++P+ GICYGFQ M Q  GG V +   + EYG T++++   EL  ++      WMSH D+V   P GF+V+A++    VA+  NR ++  GVQ+HPEV  +  G Q+L  F++    +   W P NI    +E+++  + D   +C +SGGVDS VAA L  +AIGD+L CVFVDHGLLR  E  +V        G N+  VD    FL +L GV +PE KRKIIG+ FI  F+     I      P ++L+QGT+YPD+VES G   +  IKSHHNVGGLP  L+F+L+EPL+ LFKDEVR +G  L +P   V RQPFPGPGL +R++GE+T  +LE +R AD + R  +       +++ WQ   V L + +SVGV GD R+YG+ + LR V S DAM+A W ++P E LE+IS+ I N+V  ++RVV D+T+KPPGTIEWE
  S:     9 VLVVDFGAQYAQLIARRVREARVFSEVVPHTATVEEIKAKDPQAIVLSGGPASVYADGAPQLDPALFDLDVPVFGICYGFQAMAQALGGTVTH-TGTREYGRTELKVAGGELHSDLPAVQPVWMSHGDAVTEAPSGFEVVATSAGAPVAAFENRARRLAGVQYHPEVLHSPHGQQVLSRFLHEFAGIGAKWTPANIADALVEQVREQIGDGRAICGLSGGVDSAVAAALVQRAIGDRLTCVFVDHGLLRSGERAQVQRDFVAATGANLVTVDVADRFLQELSGVTNPEGKRKIIGREFISAFDDAVVDIVGDSGAPVEFLVQGTLYPDVVESGGGSGTANIKSHHNVGGLPADLKFKLVEPLRLLFKDEVRAVGRELGLPEDIVARQPFPGPGLGIRIVGEVTRGRLETLRHADAIAREELTA--AGLDNQIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWTRVPYEVLERISTRITNEVPEVNRVVLDVTSKPPGTIEWE 519
>gi|54022864|ref|YP_117106.1| bifunctional GMP synthase/glutamine amidotransferase protein [Nocardia farcinica IFM 10152] >gi|81375915|sp|Q5Z1E9|GUAA_NOCFA GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|54014372|dbj|BAD55742.1| putative GMP synthase [Nocardia farcinica IFM 10152] (524 aa)
Score = 1252, Expect = 1.6e-135, Identities = 241/508 (47%), Positives = 336/508 (66%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI----------NVPFKYLLQGTIYPDIVESGSKF-SKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++DFG QY QLIARR+R+ +VYSE+V +  ++EEI  K P  +ILSGG  SVY + + + +  ++DLN+P+ GICYGFQ M Q  GG V +   + EYG T++ +    L   +      WMSH D+V   P+GF+V  +T    VA+  +R ++  GVQ+HPEV  +  G Q+L  F++ +  +   W P NI    +E++++ V D + +C +SGGVDS VAA L  +AIGD+L CVFVDHGLLR  E ++V        G  +  VD    FL +LKGV DPE+KRKIIG+ FI  FE    +I              ++L+QGT+YPD+VESG    +  IKSHHNVGGLPE L+FEL+EPL+ LFKDEVR +G  L +P + V RQPFPGPGLA+R++GE+T D+L  +R+AD + R  +       + + WQ   V L + +SVGV GD R+YG+ + LR V S DAM+A W ++P E LE+IS+ I N+V  ++RVV D+T+KPPGTIEWE
  S:     8 VLVVDFGAQYAQLIARRVREASVYSEVVPHTATVEEIAAKKPLAVILSGGPASVYAEGAPQLDPRLFDLNLPVFGICYGFQAMAQALGGTVAH-TGTREYGRTELNIDGGVLHGGLPTIQPVWMSHGDAVTDAPEGFEVTGTTAGAPVAAFEDRARRLAGVQYHPEVLHSPHGQQVLSRFLHELAGIPASWTPSNIADVLVEQVRAQVGDGHAICGLSGGVDSAVAAALVQRAIGDRLTCVFVDHGLLRAGEREQVQQDFVASTGAKLVTVDAVDKFLGELKGVTDPEEKRKIIGREFIRSFEDAVRQIVDEQGAAEGKQPEVEFLVQGTLYPDVVESGGGTGTANIKSHHNVGGLPEDLEFELVEPLRLLFKDEVRAVGRELGLPEEIVARQPFPGPGLAIRIIGEVTADRLATLRQADAIAREELTA--AGLDRQIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWTRLPYEVLERISTRITNEVAEVNRVVLDVTSKPPGTIEWE 524
>gi|57168146|ref|ZP_00367285.1| GMP synthase [Campylobacter coli RM2228] >gi|57020520|gb|EAL57189.1| GMP synthase [Campylobacter coli RM2228] (511 aa)
Score = 1252, Expect = 1.6e-135, Identities = 252/508 (49%), Positives = 342/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGS-KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QYTQLIARR+R+  VY+EI+ +++S+ +I  K PKGIILSGG  SVY   +   +K +++L +PILGICYG Q+M       V      +EYG   I +  + +LF+N+      WMSHSD V  LP+GF+V+A++         N EKKF+ +QFHPEV  + FG  +L+NF    C+    W   +    + E+I+  V  D VLCA+SGGVDS V A L A AI D++  VFVD+GLLR +E ++V  + K  +G N+  +D  ++FL +L GV DPEQKRKIIG TFIE+FE+ A K +   K+L QGT+Y DI+ES     SKTIKSHHNVGGLPE++  +L+EPLK +FKDEVR LG+ L +  + VYR PFPGPGLA+R++GE+    LE++R+AD +    +++L     + K WQ F VL N KSVGV+GDNR+Y  T+ +R VD+ D M+A +  IP E LE IS  I N+V+ I+RVVYDI++KPP TIEWE
  S:     6 ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLADIKAKEPKGIILSGGPASVYATDAYFCDKEVFNLGLPILGICYGMQLMAHHYKANVA-PAGHKEYGKASIEIQKDSDLFKNLPKKQIVWMSHSDKVENLPQGFEVLATSENSPYCVFANEEKKFFALQFHPEVQHSEFGKSILKNFAKYACNCESIWNMGSFAKTQAEKIREEVGKDKVLCAVSGGVDSSVVAALLANAIKDQVIVVFVDNGLLRSDEKEQVEFMFKNTLGINLISIDASKIFLDRLAGVTDPEQKRKIIGNTFIEIFEEEAKK-HKDVKFLAQGTLYTDIIESSVIGASKTIKSHHNVGGLPEKMNLKLVEPLKEIFKDEVRALGIELGLSKEIVYRHPFPGPGLAIRIMGEVNRPSLELLRKADVIL---LEELRSTGWYNKTWQAFCVLLNVKSVGVMGDNRTYDNTICVRVVDASDGMTATFSHIPYEILENISRRIINEVEGINRVVYDISSKPPATIEWE 511
>gi|171463294|ref|YP_001797407.1| GMP synthase, large subunit [Polynucleobacter necessarius STIR1] >gi|171192832|gb|ACB43793.1| GMP synthase, large subunit [Polynucleobacter necessarius STIR1] (535 aa)
Score = 1252, Expect = 1.7e-135, Identities = 261/510 (51%), Positives = 342/510 (67%)
  Q:     2 DKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIK----KNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQV---ENDKDSEEYGSTDIRLT--TNEL-----FENIELDN--NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLF----RSYIDQLYKNSEHK-PWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           DKILILDFG Q TQLIARR+RD  VYSEI  YD   E I K    +  KGIILSGG  SV  + S +  + +++L +P+LGICYG Q M  + GG V   E+   + E+G +++R    TN L     F   E       WMSH DSV  LP  FK++AST  C +A   + E+ FY  QFHPEVT T  G  +++ FV+ IC    DW   +   E +E I+  V D+ V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR NE   V  +  + +G  +  VD K+ F+ +L GV DPE KRKIIGK F+E+F+  + KI    K+L QGTIYPD++ES   G K + TIKSHHNVGGLPE +  +LLEPL+ LFKDEVR+LG++L +P + VYR PFPGPGL VR+LGE+  +   +++ AD +F    R+ ID++ + S +    Q F V    KSVGV+GD R+Y Y +ALRAV + D M+A W  +P E L K+ + I N+V+ I+RVVYDI+ KPP TIEWE
  S:     3 DKILILDFGSQVTQLIARRVRDGRVYSEIHPYDCDPELIRKFIQEQGGKGIILSGGPSSVTEEGSPRAPQIVFELGVPVLGICYGMQTMATQLGGAVASAESLGKAREFGYSEVRAHGHTNLLKGIQDFSTSEGHGILKVWMSHGDSVTTLPSSFKLMASTESCPIAGMADEERSFYAFQFHPEVTHTIQGTAIIERFVHEICKCKPDWVMGDYIAEAVENIRKQVGDEEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDHGLLRLNEGDMVMEMFARNLGVKVIRVDAKETFMGELAGVSDPEAKRKIIGKEFVEIFQAESGKIKNA-KWLAQGTIYPDVIESAGKGKKGAHTIKSHHNVGGLPEDMHLKLLEPLRELFKDEVRELGVALGLPREMVYRHPFPGPGLGVRILGEVKAEFASLLQRADAIFIEELRNTIDEVSQKSWYDLTSQAFAVFLPVKSVGVMGDGRTYEYVVALRAVQTQDFMTAHWAHLPHELLGKVFNRIINEVRGINRVVYDISGKPPATIEWE 535
>gi|114777702|ref|ZP_01452662.1| bifunctional GMP synthase/glutamine amidotransferase protein [Mariprofundus ferrooxydans PV-1] >gi|114551918|gb|EAU54452.1| bifunctional GMP synthase/glutamine amidotransferase protein [Mariprofundus ferrooxydans PV-1] (515 aa)
Score = 1251, Expect = 1.8e-135, Identities = 251/511 (49%), Positives = 342/511 (66%)
  Q:     1 MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDN----NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           MDKILILDFG QYTQLIARR+R+  V+SE+  +D+S +EI   NP GIILSGG +SVY + + K    +++L +P+LGICYG Q M  + GG VE    + E+G  ++  + N  L   IE       + WMSH D V  LP GF VI S +   +A   +  + FY +QFHPEVT T  G  +L  FV+ IC    DW   N   E +  I+  V ++ V+  +SGGVDS VAA L  +AIG++L CVFVD+GLLR +E+++V       +G  +  VD    FL  L GV DPE KRKIIG+ F+EVF++ + K+    ++L QGTIYPD++ES GSK  K  TIKSHHNVGGLP+ L  +LLEPL+ LFKDEVR+LG++L +P + VYR PFPGPGL VR+LGE+ ++  +++R AD +F   I++L+ +  + K  Q F V    KSVGV+GD R+Y + +ALRAV + D M+A W ++P   L K+S+ I N+V+ I+RVVYD++ KPP TIEWE
  S:     1 MDKILILDFGSQYTQLIARRVREAGVFSELHPWDMSADEIRACNPSGIILSGGPNSVYDEETPKAASLVFELGVPVLGICYGMQTMAAQLGGGVETGV-TREFGYAEVVTSGNSALLSGIEDKEYGGLDVWMSHGDKVTMLPDGFHVICSNDSTPIAGMADETRHFYALQFHPEVTHTHQGKAILSRFVHKICGCGSDWTMPNYIDEAVARIREQVGEEEVILGLSGGVDSSVAAALLHRAIGEQLTCVFVDNGLLRLHEAEQVMQTFADNLGVKVIHVDASDEFLKHLAGVTDPEAKRKIIGREFVEVFQQESAKLPQA-RWLAQGTIYPDVIESAGSKTKKAHTIKSHHNVGGLPDTLHLKLLEPLRELFKDEVRELGVALGLPREMVYRHPFPGPGLGVRILGEVKKEYADLLRRADAIF---IEELHASGWYEKTSQAFVVFLPVKSVGVMGDGRTYEWVVALRAVQTQDFMTAHWAELPHALLGKVSNRIINEVRGINRVVYDVSGKPPATIEWE 515
>gi|52424827|ref|YP_087964.1| bifunctional GMP synthase/glutamine amidotransferase protein [Mannheimia succiniciproducens MBEL55E] >gi|81387319|sp|Q65UI1|GUAA_MANSM GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|52306879|gb|AAU37379.1| GuaA protein [Mannheimia succiniciproducens MBEL55E] (523 aa)
Score = 1251, Expect = 1.8e-135, Identities = 251/509 (49%), Positives = 346/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRL-TTNELFENIELDNN-------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNS-EHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG QYTQLIARR+R++ VY E+  +D++ ++I + NP GIILSGG +S   D S +  + +++  +P+LGICYG Q M  + GG  E      E+G   + L  +  LF  +  D N        WMSH D V  LP+GF++  +T+ C +A+  +  + FYGVQFHPEVT T  G  LL NFV +IC    +W P+NI  + +  IK+ V DD V+  +SGGVDS V A+L  +AIG  L+CVFVD+GLLR NE  +V  +     G NI  V+ +  FL  LKG+ +PE KRK+IGK F++VF++ ++K     K+L QGTIYPD++ES  SK  K   IKSHHNVGGLP+ ++  L+EPL+ LFKDEVRK+GL+L +P + + R PFPGPGL VRVLGEI ++  +++R+AD +F   I++LY +   +K  Q FTV    KSVGV+GD R Y + ++LRAV+++D M+A W  +P + L KIS+ I N+V  ISRVVYD++ KPP TIEWE
  S:     8 KILILDFGSQYTQLIARRVREIGVYCELWAWDVTEQQIREFNPTGIILSGGPESTTEDNSPRAPEYVFNAGVPVLGICYGMQTMAMQLGGLTE-PSSHREFGYASVSLENSTALFAQLNDDLNSSLPKLDVWMSHGDKVTRLPEGFQLTGTTSTCPIAAMSDESRHFYGVQFHPEVTHTKSGLALLTNFVVNICGCTTNWTPENIIEDAVARIKAQVGDDEVILGLSGGVDSSVTALLLHRAIGKNLHCVFVDNGLLRLNEGDQVMEMFGDKFGLNIIRVNAEDRFLDALKGIDEPESKRKMIGKVFVDVFDEESHK-QTSVKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDYMKLGLVEPLRELFKDEVRKIGLALGLPAEMLNRHPFPGPGLGVRVLGEIKKEYCDLLRKADAIF---IEELYNSGWYYKVSQAFTVFLPVKSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDLLGKISNRIINEVDGISRVVYDVSGKPPATIEWE 523
>gi|152980120|ref|YP_001353722.1| bifunctional GMP synthase/glutamine amidotransferase protein [Janthinobacterium sp. Marseille] >gi|151280197|gb|ABR88607.1| GMP synthase (glutamine-hydrolysing) [Janthinobacterium sp. Marseille] (539 aa)
Score = 1251, Expect = 2.1e-135, Identities = 258/509 (50%), Positives = 343/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVY-GDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIR-------------LTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKN--------SE-------HKPW-----QYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KILILDFG Q TQLIARR+RD  V+SE+  YD+S E +      G+ILSGG +SV  GD S +  + +++L +P++GICYG Q M ++ GG+VEN K   E+G  ++R              TT E    +++    WMSH D V  +P GFK++AST  C +A   + E++ Y  QFHPEVT T  G  ++  FV+ IC    DW   +   E +E+I+  V  D V+  +SGGVDS VAA L  +AIGD+L CVFVDHGLLR +E + V  +  + +G N+  +D    F+  L GV DPE KRKIIG+ F+EVF+  A K     K+L QGTIYPD++ES  K  K  TIKSHHNVGGLPE L  +LLEPL+ LFKDEVRKLG++L +P+  VYR PFPGPGL VR+LGE+ ++  +++R AD +F   I++L K         SE       H+ W     Q F V    KSVGV+GD R+Y Y +ALRAV + D M+A W  +P E L  +S+ I N+V+ I+RVVYDI+ KPP TIEWE
  S:     4 KILILDFGSQVTQLIARRVRDSGVFSEVFPYDVSDEFVRNYGAAGVILSGGPNSVIEGDESPRVPQAVFELGVPVMGICYGMQAMAEQLGGKVENGK-VREFGYAEVRAHGHTALLKDISDFTTPEGHGMLKV----WMSHGDKVNEMPPGFKLMASTPNCPIAGMADEERRMYAFQFHPEVTHTVQGKAIIARFVHDICGCKSDWNMPDYIAEAVEKIRQQVGSDEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDHGLLRLDEGKMVMEMFAESLGVNVIHIDAVDQFMGHLAGVSDPEAKRKIIGREFVEVFQVEAGKRKNA-KWLAQGTIYPDVIESAGKGKKGHTIKSHHNVGGLPETLNLQLLEPLRELFKDEVRKLGVALGLPHDMVYRHPFPGPGLGVRILGEVKKEFADLLRRADAIF---IEELRKTPFVATPGASEATDNGIPHRNWYDATSQAFAVFLPVKSVGVMGDGRTYEYVVALRAVQTQDFMTAHWAHLPHELLGNVSNRIINEVRGINRVVYDISGKPPATIEWE 539
>gi|169835698|ref|ZP_02868886.1| bifunctional GMP synthase/glutamine amidotransferase protein [candidate division TM7 single-cell isolate TM7a] (516 aa)
Score = 1250, Expect = 2.2e-135, Identities = 267/509 (52%), Positives = 352/509 (69%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEII--KKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE--LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI--NVPFKYLLQGTIYPDIVESGS--KFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           KI+I+DFG QY+QLIARRIR++ VY EIV   I IE+I   K+  KGII SGG  SVY   +   N  +++LN+PILGICYG Q++   NGG+VE   DS E+G   + +  N+  LF  ++  +N WMSH+D +  LPKGF+VIA T+  + A   N     Y +QFHPEV  +  G Q+L+NFV++IC    +W+  +   EK + IK  V D++VL A+SGGVDS VAAVL   AIG +L C+FVD GLLRK+E ++V    K+    NI  VD K  FL+KLKGV +PE KRKIIG  FIEVF +   K+      K+L QGTIYPD++ES S    S TIKSHHNVGGLPE LQFELLEPLK LFKDEVRK+G  L +P   + R PFPGPGL +RV+GE+T DK++I++EAD +F + +  + K    K  Q F  L   K+VGV+GD R+Y +  A+R+V+++D M+A W K+P E LE++S+ I NKV  I+R+VYDI++KPPGTIEWE
  S:     6 KIIIIDFGSQYSQLIARRIREMEVYCEIVPL-IDIEKIKSGKEKVKGIIFSGGPASVYEKDAPTVNPEVFNLNLPILGICYGMQLITHLNGGKVEK-ADSREFGKAVLEVGNNDNPLFTGVKKSSNIWMSHNDHITELPKGFEVIAKTDSSIAAITNN--NGIYALQFHPEVVHSECGTQILENFVFNICKCEKNWKISSFIAEKTKFIKETVGDEHVLLALSGGVDSSVAAVLINNAIGHQLTCMFVDTGLLRKDEGKKVLEYYKEHFDLNIVFVDAKDRFLNKLKGVDEPEAKRKIIGNEFIEVFNEEIRKLKGQEGAKFLAQGTIYPDVIESQSIKGPSHTIKSHHNVGGLPEDLQFELLEPLKELFKDEVRKVGHELGLPDTIIKRHPFPGPGLGIRVIGEVTPDKVKILQEADDIFITEL--MEKGLYDKVDQAFVTLLPVKTVGVMGDQRTYEFVAAIRSVNTIDFMTATWSKLPYEFLEEVSNKIINKVNGINRIVYDISSKPPGTIEWE 516
>gi|118470807|ref|YP_885988.1| bifunctional GMP synthase/glutamine amidotransferase protein [Mycobacterium smegmatis str. MC2 155] >gi|118172094|gb|ABK72990.1| glutamine-hydrolyzing GMP synthase [Mycobacterium smegmatis str. MC2 155] (520 aa)
Score = 1250, Expect = 2.3e-135, Identities = 240/508 (47%), Positives = 335/508 (65%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEK-----VANKINVPFKYLLQGTIYPDIVES-GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEHKPWQYFTV-LTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +L++D+G QY QLIARR+R+  VYSE+V +   +EEI  K+P+ I+LSGG  SVY + + + + G++DL++P+ GICYGFQ M Q  GG VE    SE +G T++++T  +L   +      WMSH D+V   P+GF V+AS+    VA   NR ++  GVQ+HPEV  +  G Q+L  F++    +   W P NI  + IE ++  + D   +C +SGGVDS VAA L  +AIGD+L CVFVDHGLLR  E  +V        G  +  VD    FL  L GV +PE KRKIIG+ FI  FE      V ++ +    +L+QGT+YPD+VES G   +  IKSHHNVGGLP+ L+F+L+EPL+ LFKDEVR +G  L +P + V RQPFPGPGL +R++GE+T ++LE +R AD + R  +       +++ WQ   V L + +SVGV GD R+YG+ + LR V S DAM+A W ++P E LE+IS+ I N+V+ ++RVV DIT+KPPGTIEWE
  S:     9 VLVIDYGAQYAQLIARRVREARVYSEVVPHTAGVEEIKAKDPQAIVLSGGPASVYSEGAPQLDPGLFDLDVPVFGICYGFQAMAQALGGTVERTGTSE-FGRTELQVTGGDLHSELPATQPVWMSHGDAVTAAPEGFDVVASSAGAPVAGFENRARRLAGVQYHPEVLHSPHGQQVLSRFLHDFAGIDATWTPANIADQLIEAVREQIGDGRAICGLSGGVDSAVAAALVQRAIGDRLTCVFVDHGLLRAGERAQVQRDFVAATGAKLVTVDVADRFLEALTGVTNPEGKRKIIGREFIRAFEGAVRDLVEDEGSGDIDFLVQGTLYPDVVESGGGSGTANIKSHHNVGGLPDDLKFKLVEPLRLLFKDEVRAVGRELGLPEEIVARQPFPGPGLGIRIVGEVTAERLETLRRADAIAREELTA--AGLDNQIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWTRVPYEVLERISTRITNEVREVNRVVLDITSKPPGTIEWE 520
>gi|148359261|ref|YP_001250468.1| bifunctional GMP synthase/glutamine amidotransferase protein [Legionella pneumophila str. Corby] >gi|148281034|gb|ABQ55122.1| GMP synthetase [Legionella pneumophila str. Corby] (525 aa)
Score = 1250, Expect = 2.3e-135, Identities = 251/508 (49%), Positives = 350/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIE----LDN----NCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSK----TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSE--HKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +LILDFG QYTQLIARR+R++ VY EI  Y I+ E+  K NP G+ILSGG  +V  D + +  + +++ ++P+LGICYG Q M  + GGQV +     E+G  ++RL   ++L  NIE    +D     + WMSH D V  LP GFKVI  T    +A   +  ++ YG+QFHPEVT T  G ++LQ FV  IC    +W P++I  E I +I+  V  + VL  +SGGVDS V A L  +AIG++L CVFVD GLLR NE+++V ++  + +G  I  V+ +  FL+ LKGV  PE+KRKIIG+TFIEVF++ A K+    K+L QGTIYPD++ES +  +      IKSHHNVGGLP+ L  +LLEP++ LFKDEVR++GL L +P+  VYR PFPGPGL VR+L E+ ++  +I+R+AD +F   I++L+ N++  HK  Q F V    KSVGV+GD R Y Y + LRAV+++D M+A W ++P + L K+S+ I N+V+ +SRV YDI+ KPP TIEWE
  S:     9 LLILDFGSQYTQLIARRVREMGVYCEIYPYHINHEQFKKLNPCGVILSGGPSTVTHDANPRAPQWLFESDLPLLGICYGMQTMAVQLGGQVHSSA-LREFGYAELRLHGHSQLLSNIEDRTAVDGSALLDVWMSHGDKVTELPPGFKVICETRNAPIAGMADESRQMYGLQFHPEVTHTLQGLRILQRFVVDICKAPTEWTPEHIIDEAINKIREQVGTEKVLLGLSGGVDSSVVAALLHRAIGEQLVCVFVDTGLLRLNEAEQVLSMFGRHMGIRIIAVNAEDKFLTALKGVTCPEEKRKIIGRTFIEVFDEEAQKL-TDIKWLAQGTIYPDVIESAATSTNDAAVVIKSHHNVGGLPDTLNLKLLEPIRELFKDEVRQVGLELGLPHDMVYRHPFPGPGLGVRILAEVKKEYADILRKADAIF---IEELH-NAQLYHKISQAFAVFLPVKSVGVMGDGRRYDYVICLRAVETVDFMTAHWSQLPWDFLGKVSNRIINEVEGVSRVTYDISGKPPATIEWE 525
>gi|114332211|ref|YP_748433.1| bifunctional GMP synthase/glutamine amidotransferase protein [Nitrosomonas eutropha C91] >gi|114309225|gb|ABI60468.1| GMP synthase (glutamine-hydrolyzing) [Nitrosomonas eutropha C91] (519 aa)
Score = 1250, Expect = 2.3e-135, Identities = 252/508 (49%), Positives = 346/508 (68%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIELDNN--------CWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI-NVPFKYLLQGTIYPDIVESG---SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           ILILDFG QY +LIARRIR+ +VY E+  +D+S + I + +P GIILSGG  S++ + + +  + +++L +P+LGICYG Q M  + GG+VEN + + E+G  ++      LF++I+   N         WMSH D V  LP GF  IA       A+  +  ++FYGVQFHPEVT T  G  +L  FV+ ICD   DW   +   E I  I++ V  D V+  +SGGVDS VAA L  +AIGD+L CVFVD+GLLR NE+++      + +  N+  VD  + FL +LKG+ DPEQKR+ IG+ F+E+F++ A KI NV  K+L QGTIYPD++ES    +K S  IKSHHNVGGLPE L+ +LLEPL+ LFKDEVR+LGL+L +P   V+R PFPGPGL VR+LGE+  +  E++R+AD +F   I++L     + K  Q F V    KSVGV+GDNRSY Y +ALRAV + D M+A+W ++P   L +IS+ I N+++ I+RVVYDI+ KPP TIEWE
  S:     5 ILILDFGSQYARLIARRIRETSVYCELHPFDVSPQFIREFSPVGIILSGGPASIFTNDAPRVPQIVFELGVPVLGICYGMQAMAAQLGGEVENAQ-TREFGYAELLTEPCRLFQDIKDRINSDGKPALDVWMSHGDRVNKLPPGFTAIAFNAATPFAAMADETRRFYGVQFHPEVTHTLQGKAILDRFVHDICDAGYDWNMPDYVEEAIGRIRARVGGDKVILGLSGGVDSSVAAALIHRAIGDQLVCVFVDNGLLRLNEAKQTMETFSRNLAVNVIYVDASRQFLEQLKGITDPEQKRRTIGREFVEIFQQEAAKIENV--KWLAQGTIYPDVIESAGSHTKKSGLIKSHHNVGGLPETLRLKLLEPLRELFKDEVRELGLALGLPRDLVFRHPFPGPGLGVRILGEVKYEYTELLRQADAIF---IEELRNAGWYEKTSQAFAVFLPIKSVGVMGDNRSYEYVIALRAVQTEDFMTAQWAELPYTLLARISNRIINEIRGINRVVYDISGKPPATIEWE 519
>gi|72383200|ref|YP_292555.1| bifunctional GMP synthase/glutamine amidotransferase protein [Prochlorococcus marinus str. NATL2A] >gi|91206818|sp|Q46I26|GUAA_PROMT GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase) (GMP synthetase) >gi|72003050|gb|AAZ58852.1| GMP synthase (glutamine-hydrolyzing) [Prochlorococcus marinus str. NATL2A] (528 aa)
Score = 1250, Expect = 2.6e-135, Identities = 248/508 (48%), Positives = 340/508 (66%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES---------GSKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQ--LYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           I+ILDFG QY++LIARRIR+  VYS ++ Y  S +++    PKGIILSGG  SVY + +   +  I++L IP+LG+CYG Q+M+ E GG V+      EYG   + +     L  N+   +  WMSH DSV  LPKGF  +A T+  L A+    +K FYGVQFHPEV  +T G  +++NFVY IC    DW       E + +++  V D  VL A+SGGVDS   A L  +AIG +L C+F+D G +RK E + + +   +    N+  ++ ++ F+S+LKGV DPEQKRKIIG+ FI VFE+ + ++  PF YL QGT+YPD++ES         G + +  IKSHHNVGGLP+ LQF+L+EPL+ LFKDEVRK+G SL +P + V R PFPGPGLA+R+LGE+T +KL  +R+AD + R  I+   LY    +K WQ F VL    SVGV+GD R+Y + + +R V S D M+A W ++P   LEKIS+ I N+V+ ++RVV DIT+KPPGTIEWE
  S:    14 IVILDFGSQYSELIARRIRETEVYSLVMSYTTSADQLRSLKPKGIILSGGPGSVYEEGAPYCDPEIFNLGIPVLGVCYGMQLMVHELGGSVKPAAGKAEYGKAPLEVDDPTALLTNVISGSTMWMSHGDSVQKLPKGFVRLAHTSNTLEAAIALHDKSFYGVQFHPEVVHSTHGMVVIRNFVYDICSCEPDWTTNLFIDEAVSQVQQHVGDKKVLLALSGGVDSSTLAFLLNKAIGPQLTCMFIDQGFMRKGEPEFLMSFFDEKFKINVEYINARERFISQLKGVTDPEQKRKIIGREFIRVFEEESLRLG-PFDYLAQGTLYPDVIESSGTNIDPKTGERIAVKIKSHHNVGGLPKDLQFKLVEPLRRLFKDEVRKVGKSLGLPDEIVRRHPFPGPGLAIRILGEVTHEKLNCLRDADLIVREEINNAGLY----NKIWQAFAVLLPVYSVGVMGDQRTYAWPIVVRCVSSEDGMTADWSRLPYAVLEKISNRIVNEVEGVNRVVLDITSKPPGTIEWE 528
>gi|153870888|ref|ZP_02000191.1| bifunctional GMP synthase/glutamine amidotransferase protein [Beggiatoa sp. PS] >gi|152072646|gb|EDN69809.1| bifunctional GMP synthase/glutamine amidotransferase protein [Beggiatoa sp. PS] (533 aa)
Score = 1250, Expect = 2.6e-135, Identities = 262/509 (51%), Positives = 345/509 (67%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVY-GDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTT-NELFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKI-------NVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R+  VY EI  YDI  + I    PKGIILSG   SV   + + +  + I+ L+IPILG+CYG   M  + GGQVE   +  E+G   I     ++L  +IE          LD   WMSH D V  LP GFK IAST    VA   +  + FYG+QFHPEVT T  G ++LQ F++ IC     W P +I  + IE I++ V D+ VL A+SGGVDS V A L  +AIG +L CVFVD+GLLR  E+++V     K IG  +  VD +  FL  L G+ DPEQKRK+IG  FIE+FE+ + +I       +   K+L QGTIYPD++ES G+K  K   IKSHHNVGGLPE++  +LLEPL+ LFKDEVRK+G+ L +P++ VYR PFPGPGL VR+LGE+ ++  +I+R+AD +F   +++L K+  + K  Q F V    KSVGV+GD R Y Y +ALRAV+++D M+A+W ++P E LE +S  I N+V  ISRV YDI+ KPP TIEWE
  S:     8 RILILDFGSQYTQLIARRVREAGVYCEIYPYDIEEQTIHDFQPKGIILSGSPKSVNDSNANFRAPEAIFTLDIPILGLCYGMHTMALQLGGQVEA-SNLREFGYAQITARGHSQLLRDIEDHVSTDGYGLLD--VWMSHGDKVSELPPGFKTIASTQNAPVAGMADESRHFYGLQFHPEVTHTLQGARILQRFIHKICGCDALWTPAHIIEDSIERIRAEVGDNKVLLALSGGVDSSVVAALLHRAIGKQLICVFVDNGLLRLYEAEQVITTFTKHIGLRVRCVDAEAQFLKALVGITDPEQKRKMIGNLFIEIFEQESEQIHSQELSLSTEKKFLAQGTIYPDVIESAGAKTGKAHVIKSHHNVGGLPEKMNLKLLEPLRELFKDEVRKIGIELGLPHEIVYRHPFPGPGLGVRILGEVKKEYADILRQADAIF---LEELRKHGWYDKVSQAFAVFLPVKSVGVMGDARHYDYVVALRAVETVDFMTARWAQLPYELLETLSHRIINEVVGISRVTYDISGKPPATIEWE 533
>gi|109899424|ref|YP_662679.1| bifunctional GMP synthase/glutamine amidotransferase protein [Pseudoalteromonas atlantica T6c] >gi|109701705|gb|ABG41625.1| GMP synthase (glutamine-hydrolyzing) [Pseudoalteromonas atlantica T6c] (525 aa)
Score = 1250, Expect = 2.6e-135, Identities = 254/509 (49%), Positives = 341/509 (66%)
  Q:     3 KILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTN-ELFENIE----------LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVES-GSKFSK--TIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           +ILILDFG QYTQLIARR+R++ VY E+  +D++ E+I + NP GIILSGG +SV+   S +  + ++D  +P+ GICYG Q M ++ GG V    D  E+G   + +     L  NIE          LD   WMSH D V  +P GF   A T+ C  A+  + EK+FYGVQFHPEVT T  G ++L +FV  IC     W P  I  + +  +K  + DD V+  +SGGVDS V A+L  +AIG  L CVFVD+GLLR NE Q+V  +     G NI  +D ++ FLS L G  +PE KRKIIG+ F+EVF++ + K+    K+L QGTIYPD++ES GS   K   IKSHHNVGGLP+ +   L+EPL+ LFKDEVRK+GL L +PY  +YR PFPGPGL VRVLGE+ ++  +++R AD +F   ID+L+K+  + K  Q FTV    KSVGV+GD R Y + ++LRAV+++D M+A W  +P E L K+S+ I N++  ISRVVYDI+ KPP TIEWE
  S:     9 RILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPNGIILSGGPESVHAKDSPRAPQYVFDAGVPVFGICYGMQTMAEQLGGAVLG-SDMREFGYAQVEVVEQMALLNNIEDHVSPNGNALLD--VWMSHGDKVAAVPDGFITAAKTDSCPFAAIVHPEKQFYGVQFHPEVTHTRQGQRMLSHFVLDICQCEKLWTPDAIIEDAVARMKKQIGDDEVILGLSGGVDSSVVAMLLHRAIGKNLTCVFVDNGLLRLNEGQQVMDMFGDHFGLNIIKIDAEERFLSALAGTDEPEAKRKIIGRVFVEVFDEESKKLKNA-KWLAQGTIYPDVIESAGSATGKAHVIKSHHNVGGLPDDMAMGLVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF---IDELHKHDLYNKVSQAFTVFLPVKSVGVMGDARKYDWVVSLRAVETIDFMTAHWAHLPYEFLGKVSNRIINEIDGISRVVYDISGKPPATIEWE 525
>gi|86152664|ref|ZP_01070869.1| GMP synthase (glutamine-hydrolyzing) [Campylobacter jejuni subsp. jejuni HB93-13] >gi|85843549|gb|EAQ60759.1| GMP synthase (glutamine-hydrolyzing) [Campylobacter jejuni subsp. jejuni HB93-13] (511 aa)
Score = 1250, Expect = 2.8e-135, Identities = 252/508 (49%), Positives = 341/508 (67%)
  Q:     4 ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNE-LFENIELDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLLQNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDKLYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKTFIEVFEKVANKINVPFKYLLQGTIYPDIVESG-SKFSKTIKSHHNVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYIDQLYKNSEH-KPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPPGTIEWE 511
           IL+LDFG QYTQLIARR+R+  VY+EI+ +++S+ +I  K PKGIILSGG  SVY   +   +KGI+DL +PILGICYG Q+M       V      +EYG  +I +  +  LF+N+      WMSHSD V  LP+GF+V+A++         N +KKF+ +QFHPEV  + FG  +L+NF    C+    W   +    + E+I+  V +D VLCA+SGGVDS V A L A AI +++  VFVD+GLLR  E ++V  + K  +G ++  +D  ++FLS+L  V DPEQKRKIIG TFIEVFE+ A K +   KYL QGT+Y DI+ES     SKTIKSHHNVGGLPE++  +L+EPLK +FKDEVR LGL L +  + VYR PFPGPGLA+R++GE+    LE++R+ D +    +++L     + K WQ F VL N KSVGV+GDNR+Y   + +R VD+ D M+A +  +P E LE IS  I N+V+ I+RVVYDI++KPP TIEWE
  S:     6 ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLADIKAKEPKGIILSGGPASVYATDAYFCDKGIFDLGLPILGICYGMQLMAHHYKATVA-PAGHKEYGKANIEVKKDSALFKNLPKKQTVWMSHSDKVENLPQGFEVLATSENSPFCVFGNEDKKFFALQFHPEVQHSEFGKNILKNFAKYACNCESVWNMGSFAKTQAEKIREEVGNDKVLCAVSGGVDSSVVAALLASAIKEQVIVVFVDNGLLRSGEK