>gi|26553577|ref|NP_757511.1| adenine-specific DNA methyltransferase [Mycoplasma penetrans HF-2] >gi|26453583|dbj|BAC43915.1| adenine-specific DNA methyltransferase [Mycoplasma penetrans HF-2] (353 aa)
Score = 1555, Expect = 6.9e-171, Identities = 352/353 (99%), Positives = 353/353 (100%)
  Q:     1 LENNNLKQINIELKKFENDKESINNCNGVLSKYIFGTRILSLRQKVEINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDINKK 353
           +ENNNLKQINIELKKFENDKESINNCNGVLSKYIFGTRILSLRQKVEINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDINKK
  S:     1 MENNNLKQINIELKKFENDKESINNCNGVLSKYIFGTRILSLRQKVEINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDINKK 353
>gi|167751315|ref|ZP_02423442.1| hypothetical protein EUBSIR_02301 [Eubacterium siraeum DSM 15702] >gi|167655822|gb|EDR99951.1| hypothetical protein EUBSIR_02301 [Eubacterium siraeum DSM 15702] (293 aa)
Score = 797, Expect = 4.6e-83, Identities = 163/297 (54%), Positives = 208/297 (70%)
  Q:    51 NLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISN 347
           N + VKPF+KW GGK+QLLNEI+  YP     I KY EPFVGGGAVL DVL+    KE+ I+DINAELI  Y  I+  + +++ +L  +++ F  ++   RK  Y+ K+ RFN+L          VE A L IFLNKTCFNGLYRVN KG FNV +G YK P ICD  NL  IS  LKNV + +GDY K + FID  TFVY DPPYRP+ +TSSFT+Y ++ F D+ Q EL  ++++++ KG K+++SNSDPKNSD++DSFFD++YS+Y I RV AKRMINS  S RG INELLI N
  S:     2 NYKTVKPFIKWAGGKSQLLNEIRAKYP---ETIDKYCEPFVGGGAVLLDVLANCHPKEVLINDINAELIVTYKQIRDNIDDVVALLAELQERFWEKDDAARKEMYMAKRERFNQLISANST---GVETAVLFIFLNKTCFNGLYRVNGKGAFNVPIGSYKKPPICDEENLRKISDLLKNVTVQFGDYSKCKSFIDSQTFVYIDPPYRPLNATSSFTSYTENGFGDKEQIELGKFVDEISAKGAKVVVSNSDPKNSDESDSFFDDLYSSYTIMRVSAKRMINSKASGRGSINELLICN 292
>gi|125974024|ref|YP_001037934.1| DNA adenine methylase [Clostridium thermocellum ATCC 27405] >gi|125714249|gb|ABN52741.1| DNA adenine methylase [Clostridium thermocellum ATCC 27405] (313 aa)
Score = 729, Expect = 3.7e-75, Identities = 153/301 (50%), Positives = 211/301 (70%)
  Q:    50 NNLQVVKPFLKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDI 350
           N+    KPF+KW GGK QLL+  ++YYP       I +Y EPFVGGGAVLF++L KY+V+E +I DIN +LIN Y VIK  V  L+  L  +E  +L  +   RK  Y   ++ +N    K +    DVE+AA  IFLN+TCFNGLYRVN+ G FNV  G YKNP ICD  NL A+S  L+ V+I  GDY++   ++DK++FVYFDPPYRP+  TSSFT+Y+K  F D++Q +LA + +++N+ G  ++LSNSDPKN + +D+FFDE+Y  + I R+KAKR INS+GS RG I+ELL++N+++
  S:    11 NSTVCAKPFVKWAGGKGQLLDTFRQYYPSTLIKGYIRRYIEPFVGGGAVLFEILQKYKVEEAFIFDINEDLINTYVVIKNDVHNLVEYLSDLECKYLNLDEKSRKDMYYDIRDAYNSRALKNNQP--DVERAAQFIFLNRTCFNGLYRVNRAGHFNVPSGDYKNPTICDEKNLYAVSSLLQRVHIFVGDYRECAGYVDKDSFVYFDPPYRPLNVTSSFTSYSKFDFTDEDQIQLAKFFSEMNDTGALLMLSNSDPKNENPDDNFFDELYKEFFIHRIKAKRAINSNGSRRGLISELLVTNYEV 311
>gi|78045191|ref|YP_361026.1| DNA adenine methylase [Carboxydothermus hydrogenoformans Z-2901] >gi|77997306|gb|ABB16205.1| DNA adenine methylase [Carboxydothermus hydrogenoformans Z-2901] (309 aa)
Score = 726, Expect = 8.3e-75, Identities = 154/298 (51%), Positives = 213/298 (71%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFH--NNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDI 350
           +  +PF+KW GGK QLLN +++YYP      +I +Y EPFVGGGAVLF++L K+ ++E YI DIN +LIN Y VIK+ V EL+  L+ +EK +   + D+RK  Y   ++ +N   +  + + +D+E+AA  IFLN+TCFNGLYRVNK+G FNV  G YKNP ICD  NL  ++  L+ V I  GDY++S ++I K++FVYFDPPYRP+  TS+FT+Y+K  F D++Q ELA +  ++N  G  +LLSNSDPKN D ND+FFD++Y  +NI RV A+R INSDG  RG I ELLI+N+ +
  S:    11 EYARPFVKWAGGKGQLLNTLERYYPLKLLQGEIKRYIEPFVGGGAVLFNILQKFNIEEAYIFDINVDLINAYKVIKFNVDELVYYLKSLEKRYYNLDNDNRKKMYYEIRDEYNS--KVSNTKHIDIERAAKFIFLNRTCFNGLYRVNKEGKFNVPYGDYKNPTICDERNLYLVNSLLQKVQIFAGDYRESAKYISKDSFVYFDPPYRPLNKTSNFTSYSKSDFTDKDQIELARFYAQMNELGAFLLLSNSDPKNEDPNDNFFDDLYKNFNIYRVMARRSINSDGQGRGLIKELLITNYKV 308
>gi|126178467|ref|YP_001046432.1| DNA adenine methylase [Methanoculleus marisnigri JR1] >gi|125861261|gb|ABN56450.1| DNA adenine methylase [Methanoculleus marisnigri JR1] (332 aa)
Score = 696, Expect = 2.7e-71, Identities = 136/296 (45%), Positives = 194/296 (65%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFN-ELKEKEDNQFLD--VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +  +PFLKW GGK QLL+      P       +  + EPF+GGGAV F   S +  +E ++ DIN EL+  YSV+K  V  LI  L+ +E+ FL ++   R+ YY   ++ FN E KE +  ++ +  VE+A   IFLN+TCFNGL+RVN +G FNV  G YK PKI     L A S   +N  I  GD+ ++E +I ++TFVYFDPPYRP+  TSSFT Y+K+ F+D+ Q+ LA++    + KG +++LSNSDPKN+D  D FFD++Y+ Y I RV A+R IN DG+ RGE+ E+++ N+
  S:    29 RTARPFLKWAGGKAQLLDAFTARVPRELAEGTLPVFVEPFMGGGAVYFHFNSTFAFRECHLFDINEELVLAYSVVKNDVSGLIEYLRDVEEKFLSKDDSGRREYYYAVRDTFNRERKEVDFTRYGEAWVERAGRFIFLNRTCFNGLFRVNSRGGFNVPFGRYKKPKILHEEVLRADSLAFRNTTIHLGDFTQAEPYISESTFVYFDPPYRPLNRTSSFTQYSKNRFSDEEQRRLAEFYACCDAKGARLMLSNSDPKNADPEDGFFDDLYAGYRIDRVPARRAINCDGTKRGEVREIIVMNY 329
>gi|150020211|ref|YP_001305565.1| DNA adenine methylase [Thermosipho melanesiensis BI429] >gi|149792732|gb|ABR30180.1| DNA adenine methylase [Thermosipho melanesiensis BI429] (310 aa)
Score = 686, Expect = 3.8e-70, Identities = 166/300 (55%), Positives = 212/300 (70%)
  Q:    49 NNNLQVVKPFLKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           + N +  KPFLKW GGKTQ+L+EI K  P    N +  +Y EPFVG GAVLF +LS Y +++ YI DIN  LIN+Y VIK  V +LI  L+I+E+ FL  N ++RK  Y  K+  FN+LK  +        KAAL+IFLN+TC+NGLYRVN KG FNV  G YKNPKI D  NL  +S  LKNV I+  D++ S+ FID+NTFVY DPPYRP+++TS+FT+Y  + F+D  Q  L ++ + + NKG KILLSNSDPKN+D ND+FFDE+Y  Y I+R+ AKRMINS GS RG I ELLI N+
  S:    13 STNSKKAKPFLKWAGGKTQILSEIDKRLPRELKNGKKMRYIEPFVGSGAVLFHLLSNYNIEKAYIIDINENLINLYKVIKNNVCDLIEYLKILERKFLNSNGEERKKIYYSKRKEFNKLKNNKIK------KAALLIFLNRTCYNGLYRVNSKGEFNVPFGRYKNPKILDEENLINVSLALKNVEILCDDFEISKNFIDENTFVYIDPPYRPLSNTSNFTSYFNNTFDDNEQIRLKNFFDFITNKGAKILLSNSDPKNTDPNDNFFDELYKNYIIERILAKRMINSKGSKRGYIYELLIRNY 308
>gi|84488972|ref|YP_447204.1| putative type II restriction-modification system, adenine-specific DNA methyltransferase [Methanosphaera stadtmanae DSM 3091] >gi|84372291|gb|ABC56561.1| putative type II restriction-modification system, adenine-specific DNA methyltransferase [Methanosphaera stadtmanae DSM 3091] (312 aa)
Score = 677, Expect = 3.9e-69, Identities = 157/300 (52%), Positives = 211/300 (70%)
  Q:    49 NNNLQVVKPFLKWVGGKTQLLNEIKKYYPFH---NNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFN-ELKEKEDNQFLD--VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           N+N+   KPF+KW+GGK QL+ EI+K  P H   + +I  Y EPF+GGGA+ F ++S Y +K+ YISDIN ELI +Y+ IK   K++I  L+ ME +FL  + D RK YYL  +  FN +LK  +   + +  +++A   +F+NKT FNGL+R+NKKG FNV  G YKNPKICD  N+  + K LKNV I    Y  SE++I+K + VY DPPYRPI+ TSSFT+Y+ + FND++Q ELA Y  +++NKG   LLSNSDP N+D ND FFD +YS Y I R+ AKR INS G+ RG +NELLI N+
  S:     7 NDNIVEGKPFMKWLGGKRQLIPEIEKRLPEHIKISKKIDSYFEPFIGGGALFFYLMSNYHIKKAYISDINKELILIYNAIKNDDKKVITYLKEMESEFLKLDNDKRKAYYLNVREEFNNQLKTYDFKNYSEETIKRAVKSMFMNKTGFNGLFRLNKKGEFNVPFGRYKNPKICDETNIHNVHKILKNVTIKNKPYDYSEKYIEKGSLVYLDPPYRPISKTSSFTSYSDNEFNDEHQIELAHYYERISNKGAYALLSNSDPHNNDPNDDFFDLLYSKYCIDRIPAKRSINSKGNKRGPVNELLIKNY 312
>gi|147921567|ref|YP_684616.1| N6 adenine-specific DNA-methyltransferase [uncultured methanogenic archaeon RC-I] >gi|56295585|emb|CAH04827.1| site-specific DNA-methyltransferase [uncultured archaeon] >gi|110620012|emb|CAJ35290.1| N6 adenine-specific DNA-methyltransferase [uncultured methanogenic archaeon RC-I] (310 aa)
Score = 674, Expect = 8.3e-69, Identities = 140/300 (46%), Positives = 193/300 (64%)
  Q:    49 NNNLQVVKPFLKWVGGKTQLLNEIKKYYP---FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD---VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           N  L   KPFLKW GGKTQLL+E+ K  P        I +Y EPFVGGGA+ F +  ++EVKE ++ DIN EL+  Y  I+   ++LI  L+ +E ++L +    R+  +   ++ +N   E  + +      V++ A MIFLNKTC+NGL+R N KG FNV  G YKNP IC   N+ A+S  LKN  I  GD+ KS   I+  T VY DPPYRPI++TSSFT+Y KD F+D +Q+ LA Y  +++ K   ++LSNSDPKN + +D FF+++Y+ Y I R  A RMIN D   RG I EL+I+N+
  S:     5 NQQLASAKPFLKWAGGKTQLLDELGKRLPANIIEKGVIDRYIEPFVGGGAMFFYLKGRFEVKEAFLYDINPELVLGYKTIQKSPQKLISRLKELEDEYLSKAEQQRQEMFYSIRSSYNSQAETFNYKKYSAAWVDRVAYMIFLNKTCYNGLFRQNSKGGFNVPFGRYKNPSICGAENILAVSHALKNTRIELGDFIKSAAHIEAGTLVYLDPPYRPISTTSSFTSYAKDGFDDDDQRRLAKYFREMDEKKAFLMLSNSDPKNENPSDDFFEQLYAGYRIDRALASRMINCDAKKRGHIYELIITNY 310
>gi|16330320|ref|NP_441048.1| adenine-specific DNA metylase [Synechocystis sp. PCC 6803] >gi|1652809|dbj|BAA17728.1| adenine-specific DNA metylase [Synechocystis sp. PCC 6803] (309 aa)
Score = 668, Expect = 4.9e-68, Identities = 140/295 (47%), Positives = 196/295 (66%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFH--NNQITKYAEPFVGGGAVLFDVLSKY-EVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEK---EDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           + KPFLKW GGK +L+ ++   +P      Q+TKYAEPF+GGGA+ F V   Y ++++ +ISD N +L+  Y  I+  V +LI  L+ +++ +   N D+RK ++  ++ +FN+       E    L +E+  L+IFLN+TCFNGL+RVN KG FNV  G YKNPKICD  NL+ ++  L    I +GD+  S  FID +TFVYFDPPYRP+  TSSF +Y K  FND  Q  LA+Y   LNNK  K++LSNSDPKN + +D+FFD++Y  + I R+ A RMINS    RG I E+L+ N+
  S:     7 IAKPFLKWAGGKGKLIEQLVNCFPLEITTGQLTKYAEPFIGGGALYFHVAQNYPQIEKFFISDCNQQLVLAYQTIQQNVDDLIDFLRRLQQKYYCFNQDERKDFFYQQRLKFNQNVTGINLEKFSKLWIEQTGLLIFLNRTCFNGLFRVNSKGEFNVPFGDYKNPKICDAENLKLVANLLARTEIRFGDFTSSNNFIDASTFVYFDPPYRPLNKTSSFNSYGKANFNDNEQLRLAEYYQSLNNKNAKLMLSNSDPKNINSDDNFFDDLYRGFQIARIDALRMINSQADKRGAIKEILVVNY 307
>gi|154150546|ref|YP_001404164.1| DNA adenine methylase [Candidatus Methanoregula boonei 6A8] >gi|153999098|gb|ABS55521.1| DNA adenine methylase [Candidatus Methanoregula boonei 6A8] (309 aa)
Score = 662, Expect = 2.1e-67, Identities = 125/294 (42%), Positives = 190/294 (64%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYP---FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD---VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           V+PFLKW GGK+QLL +I +  P    +  +IT+Y EPFVGGGAV F ++ +    E  I DIN EL+  Y VI+  +  L   L  +   +   +   ++ YY   ++ FN  ++  D    +   + +AA +IFLN TC+NGL+RVN+ G FNV  G Y+NP+I    NLE  +  L    I+ GD+ +     D  TFVY DPPYRP+ +TSSFT+Y++  F++ +Q+ LA +   L+ KG +++LSNSDP + + +D+FFDE+Y+ + I+RV A+R+IN +G+ RG ++ELLI+N+
  S:    10 VRPFLKWAGGKSQLLGDIARCLPPGAGNGGKITRYIEPFVGGGAVFFSLVPRCSFNESVICDINEELVLTYRVIRTSLPRLAGELAGIASAYRALSGPGQEAYYYEIRDAFNRERKSIDFTRYNERWIRRAAQIIFLNHTCYNGLFRVNQSGGFNVPFGRYRNPEISGYKNLEGAAALLSRTRILCGDFTRCRSMADDQTFVYLDPPYRPLNATSSFTSYSRGGFSENDQERLAAFFRDLDRKGAQVMLSNSDPASENPDDAFFDELYNGFTIRRVPARRLINCNGARRGTVSELLITNY 309
>gi|160888273|ref|ZP_02069276.1| hypothetical protein BACUNI_00683 [Bacteroides uniformis ATCC 8492] >gi|156862219|gb|EDO55650.1| hypothetical protein BACUNI_00683 [Bacteroides uniformis ATCC 8492] (310 aa)
Score = 654, Expect = 1.8e-66, Identities = 141/301 (46%), Positives = 203/301 (67%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKY-EVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDINKK 353
           +  KPF+KWVGGKTQLL +I++  P  F   +   Y EPFVGGGAVLF +L ++  +++  I+DIN  LI  Y VIK +  +LI  L+ +++ ++    +DRK YYL K++ +N       +   ++E AAL IFLN+TCFNGLYRVN KG FNV  G Y NP+ICD   + A SK L+ V+I+ GD++K+  +   +   YFDPPY+P++ TSSF +Y KD F+D  Q  L D+ +K+    T  +LSNSD K  D+ND+FFDEIY+ Y+I+RV A RM+N++   RG+++EL+ISN  +N +
  S:    13 RTAKPFVKWVGGKTQLLGDIERTLPSDFSQKKNVIYVEPFVGGGAVLFWILQQFPNIQKAVINDINPHLITTYKVIKEQPYKLIEQLKELQEKYIPLGEEDRKEYYLNKRDIYNA------SSLSEIETAALFIFLNRTCFNGLYRVNSKGKFNVPHGKYANPRICDEDTILADSKILQKVDILCGDFEKTIAYASPDALFYFDPPYKPLSKTSSFNSYAKDEFDDNEQIRLRDFCHKIVQYKTNFILSNSDVKGKDENDNFFDEIYNEYHIQRVMATRMVNANPEKRGKLSELMISNISMNYR 310
>gi|88603197|ref|YP_503375.1| DNA adenine methylase [Methanospirillum hungatei JF-1] >gi|88188659|gb|ABD41656.1| DNA adenine methylase [Methanospirillum hungatei JF-1] (324 aa)
Score = 652, Expect = 2.9e-66, Identities = 133/296 (44%), Positives = 193/296 (65%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDR-KWYYLIKKNRFNELKEKEDNQFLD--VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +  KPF KW GGK+QLL E    +P       + +Y EPFVGGGAV F ++  Y +KE  I D+N+ELI  + V+K  VK LI +LQ ++  +  R   +R   +Y ++ +   E    + N + D  +++A+ ++FLN+TCFNGL+R+N KG FNV  G YKNP I    NL   S  L +  I+ GD+    E++D+++FVY DPPYRP+  TSSFT+Y+++ F++Q+Q  L D+   + N G K++LSNSDP+N D  D FFD++Y  + I+RV AKR INS G  RG+INEL+I N+
  S:    22 EYAKPFFKWAGGKSQLLYEFDPRFPKTLETGDLVRYVEPFVGGGAVFFYIVQLYPIKEAVICDVNSELILTWKVVKQDVKTLIRLLQELQDAYDTRTEAERLNLFYQVRDDLNREKPSFDYNTYGDHTIQRASQLLFLNRTCFNGLFRLNSKGEFNVPFGKYKNPNIVQEKNLLMASNLLTHTTIIQGDFTTCLEYVDRSSFVYLDPPYRPLNKTSSFTSYSQEGFSEQDQLRLRDFYGAVANTGAKVMLSNSDPRNEDPADHFFDDLYKDFLIERVLAKRFINSVGEKRGDINELIIRNY 322
>gi|37522278|ref|NP_925655.1| site-specific DNA-methyltransferase [Gloeobacter violaceus PCC 7421] >gi|35213278|dbj|BAC90650.1| site-specific DNA-methyltransferase [Gloeobacter violaceus PCC 7421] (311 aa)
Score = 649, Expect = 6.5e-66, Identities = 125/293 (42%), Positives = 181/293 (61%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD---VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +PFLKW GGKTQLL++I + +P    + QI +Y EPF+GGGAV   V  +Y V++  + DIN ELI  Y  ++    +LI  L+ +   +   + D+R+ ++   + RFN L  + D    D   VE+ A +IFLN+TC+NGL+R+N K  FNV  G Y+NP IC   NL+A++  L    I +GD+          TF+YFDPPYRP++ T+ FTAY+   F+D  Q  LA     L+  G K++LSN DP N+D  D FF+  Y+ + I+RV A R++N   + RG I ELLI+N+
  S:     8 RPFLKWAGGKTQLLDQIAERFPAVLKHGQIDRYVEPFIGGGAVFLYVAQRYAVEQFVLFDINRELILAYRTLQRAADDLIEKLEALGLHYHALDGDERRGFFYRVRERFNTLAGEIDYDHFDGRWVERTAQIIFLNRTCYNGLFRMNTKAQFNVPFGRYRNPSICMPENLKAVAALLARARIEWGDFTDCAALAGPGTFMYFDPPYRPLSKTARFTAYSAFGFDDAEQLRLAQLYRTLDAAGAKLMLSNCDPLNTDPADDFFERAYAGFEIRRVHASRLVNCRAARRGVITELLITNY 305
>gi|67921484|ref|ZP_00515002.1| N6 adenine-specific DNA methyltransferase, D12 class [Crocosphaera watsonii WH 8501] >gi|67856596|gb|EAM51837.1| N6 adenine-specific DNA methyltransferase, D12 class [Crocosphaera watsonii WH 8501] (324 aa)
Score = 628, Expect = 2.2e-63, Identities = 142/292 (48%), Positives = 192/292 (65%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKED-NQFLD--VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           P LKW GGKTQLL EIKK YP      +I  Y EPF GGGAV FD+   +E+++ Y+ D N ELI +Y VI+  V  LI  L I+E  +L  +T++RK +Y   ++ +N   ++ D N +    + +AA  IFLNKTCFNGLYRVN KG FNV MG YK PKI +  NL A+ +  K V I + D+ +   + D++TF+Y+DPPYRPI+ TS+F +Y+   FND  QK L D   K + +G   +LSNSDP N   +D FFDE+Y  +NI R+ A RMINS G  RG+I E+L++N+
  S:    29 PVLKWAGGKTQLLPEIKKQYPQQLQQGKIKTYIEPFFGGGAVFFDIYHNFEIEQAYLFDKNIELIILYKVIQNDVNALIEELSILESKYLTLDTENRKEFYYQLRDDYNTFDKQTDANNYRQEWINRAAYTIFLNKTCFNGLYRVNSKGYFNVPMGRYKKPKILNQDNLIAVHESFKIVEIQHTDFAEVLNYADESTFIYYDPPYRPISETSNFNSYSSLEFNDDEQKRLRDVFTKTSKQGALQILSNSDPTNY-IDDPFFDELYQDFNISRILASRMINSKGKKRGKIREILVNNY 324
>gi|167038172|ref|YP_001665750.1| DNA adenine methylase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167039119|ref|YP_001662104.1| DNA adenine methylase [Thermoanaerobacter sp. X514] >gi|166853359|gb|ABY91768.1| DNA adenine methylase [Thermoanaerobacter sp. X514] >gi|166857006|gb|ABY95414.1| DNA adenine methylase [Thermoanaerobacter pseudethanolicus ATCC 33223] (317 aa)
Score = 627, Expect = 2.3e-63, Identities = 153/298 (51%), Positives = 214/298 (71%)
  Q:    52 LQVVKPFLKWVGGKTQLLNEIKKYYP---FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKED--NQFLD-VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           L   KPFLKW GGKTQLL+E+ K  P     + +I +Y EPFVGGGA  F +   ++ KE ++ DIN ELI  Y VI+  V ELI  L  ME+ +L  + + RK +Y   ++ +N  K+  D  N  LD V++AA +IFLNKTCFNGLYR+NKKG FNV  G YKNP ICD  NL  +SK L+N  ++  D+++S+++I KNT VY DPPYRP+ +TS+FT+YN++ F+D +Q+ LA +  +++ KG  ++LSNSDPKN D +D+FFDE+Y+ + I+RVKAKR INS+G  RG+I+EL+I N++
  S:    14 LNNAKPFLKWAGGKTQLLDELYKRLPSSLIQSGEIERYVEPFVGGGAFFFFLKRNFKFKESFLIDINKELIIGYKVIQNNVNELIDELSSMEEKYLKLSEEQRKDFYYNIRDEYNRQKDNFDYVNYNLDWVKRAADLIFLNKTCFNGLYRLNKKGEFNVPFGKYKNPTICDADNLIEVSKALENTEVICADFEESKKYIHKNTLVYLDPPYRPLNNTSNFTSYNENGFDDDDQRRLAQFFKEMDKKGAYLILSNSDPKNEDVDDNFFDELYAGFIIERVKAKRYINSNGDKRGDISELIIRNYE 317
>gi|15668778|ref|NP_247580.1| modification methylase, type II R/M system 2 [Methanocaldococcus jannaschii DSM 2661] >gi|2500160|sp|Q58015|MTM3_METJA Modification methylase MjaIII (M.MjaIII) (Adenine-specific methyltransferase MjaIII) >gi|1591307|gb|AAB98590.1| modification methylase, type II R/M system 2 [Methanocaldococcus jannaschii DSM 2661] (289 aa)
Score = 621, Expect = 1.3e-62, Identities = 151/294 (51%), Positives = 198/294 (67%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGE-INELLISNF 348
           VKPFLKW GGKTQ+L++I++  P       I KY EPFVGGGAVLF +L KYE K++ ISDIN +L+  Y V+K  V  LI  L  +  +FL  + + RK +Y   ++ FN+ K   D    +V++ A  IFLNKTC+NGLYRVNKKG FNV  G YKNPKI D  NL+ +SK LKNV I+ GD++  +E++D  +FVYFDPPY+P+  TSSFT+Y K  FND +Q  LA +  KL+ +G K++LSNS       N  FF ++Y  +NIK+V AKRMIN  G  R + I ELLI N+
  S:     3 VKPFLKWAGGKTQILSQIEENLPKELKEGNIKKYIEPFVGGGAVLFYLLQKYEFKKVIISDINEDLMLCYKVVKNDVDRLIEELSSLRDEFLSLDEEKRKEFYYKVRDDFNKNKNDCD----EVKRVAQFIFLNKTCYNGLYRVNKKGEFNVPYGRYKNPKIFDEQNLKNVSKLLKNVKILCGDFEIVDEYVDAESFVYFDPPYKPLNKTSSFTSYTKYDFNDDDQIRLAKFYRKLDKRGAKLMLSNS------YNVDFFGKLYEGFNIKKVVAKRMINCKGDKRKDGIYELLIMNY 289
>gi|166364635|ref|YP_001656908.1| adenine-specific DNA metylase [Microcystis aeruginosa NIES-843] >gi|166087008|dbj|BAG01716.1| adenine-specific DNA metylase [Microcystis aeruginosa NIES-843] (304 aa)
Score = 621, Expect = 1.4e-62, Identities = 148/292 (50%), Positives = 207/292 (70%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITK-----YAEPFVGGGAVLFDVLSKYE-VKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFL-LRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISN 347
           KPFLKW GGKTQL+  I       N+QI++     Y EPFVGGGAVLF VL+ +  V+++ I+DIN +LI  Y+VIK  VKELI  L+ +++DF  L+N ++++ ++L K+  FN     +D     +EK  L++FLNKTCFNGLYRVN KGLFNV  G Y  P IC+  NL A++  L+ V I+ GD+ ++  + +  T  YFDPPY+PI  TS+FT+Y K+ FND+ Q  L  +I++++  G K +LSNSD KN D +++FFD++Y  YNI+RVKA+R INS G++RGEI ELLI+N
  S:    14 KPFLKWAGGKTQLVPNI---LSLINSQISQNCQFNYIEPFVGGGAVLFSVLNNFSSVQKVIINDINPDLIMAYNVIKNNVKELIVKLKKIQQDFYELKNLEEQQKFFLDKRIEFNSRSCDDD-----LEKTVLLLFLNKTCFNGLYRVNSKGLFNVPFGKYVKPLICNEENLLAVNHHLQKVTILQGDFVQTLNYANNKTLFYFDPPYKPIKKTSAFTSYTKEDFNDEEQIRLKQFIDQVDQAGYKFILSNSDLKNFDSDNNFFDDLYKDYNIQRVKARRNINSQGNNRGEIWELLINN 304
>gi|34763538|ref|ZP_00144476.1| DNA adenine methylase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886787|gb|EAA23922.1| DNA adenine methylase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (255 aa)
Score = 619, Expect = 1.9e-62, Identities = 144/240 (60%), Positives = 176/240 (73%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFH-NNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKI 295
           KPF+KWVGGK QLL+EI K YP      I KYAE F+GGGAVLFD+LSKY++ E+YISD N ELIN Y  I+  V  LI  L+ ME+ ++  N +DRK YY  K+  +N LK   +++  ++EKA L IFLNKTCFNGLYRVNKKG FNV MG YK PKICD  NL+ +S  L+NV IVY DY++SE+FID  TFVY DPPYRP+  TSSFT+Y ++ FND+ Q EL +YIN LN KG KI
  S:    15 KPFIKWVGGKGQLLSEINKLYPVELGKNINKYAEIFLGGGAVLFDILSKYKLDEVYISDKNLELINTYKSIRDNVDILIKSLKEMEEQYIPLNNEDRKIYYYEKREEYNSLKI--NSEVNNIEKAILFIFLNKTCFNGLYRVNKKGKFNVPMGAYKKPKICDEENLKNVSLTLRNVKIVYADYRESEKFIDDKTFVYIDPPYRPLNITSSFTSYTENDFNDKEQIELVEYINVLNKKGAKI 253
>gi|159028284|emb|CAO88095.1| unnamed protein product [Microcystis aeruginosa PCC 7806] (304 aa)
Score = 619, Expect = 2.4e-62, Identities = 148/292 (50%), Positives = 208/292 (71%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITK-----YAEPFVGGGAVLFDVLSKYE-VKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFL-LRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISN 347
           KPFLKW GGKTQL+  I       N+QI++     Y EPFVGGGAVLF VL+ +  V+++ I+DIN +LI  Y+VIK  VKELI  L+ +++DF  L+N ++++ ++L K+  FN  +  +D     +EK  L++FLNKTCFNGLYRVN KGLFNV  G Y  P IC+  NL A++  L+ V I+ GD+ ++  + +  T  YFDPPY+PI  TS+FT+Y K+ FND+ Q  L  +I++++  G K +LSNSD KN D +++FFD++Y  YNI+RVKA+R INS G++RGEI ELLI+N
  S:    14 KPFLKWAGGKTQLVPNI---LSLINSQISQDCQFNYIEPFVGGGAVLFSVLNNFSPVQKVIINDINPDLIMAYNVIKNNVKELIVKLKQIQQDFYELKNLEEQQKFFLDKRIEFNS-RSCDDC----LEKTVLLLFLNKTCFNGLYRVNSKGLFNVPFGKYVKPLICNEENLLAVNHHLQKVTILQGDFVQTLNYANNKTLFYFDPPYKPIKKTSAFTSYTKEDFNDEEQIRLKQFIDQVDRAGYKFILSNSDLKNFDSDNNFFDDLYKDYNIQRVKARRNINSQGNNRGEIWELLINN 304
>gi|172037242|ref|YP_001803743.1| N6 adenine-specific DNA methyltransferase, D12 class [Cyanothece sp. ATCC 51142] >gi|171698696|gb|ACB51677.1| N6 adenine-specific DNA methyltransferase, D12 class [Cyanothece sp. ATCC 51142] (336 aa)
Score = 612, Expect = 1.5e-61, Identities = 142/297 (47%), Positives = 199/297 (67%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD---VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDINKK 353
           P LKW GGKTQLL  IKK YP      +I  Y EPF GGGAV FD+ S +++++ Y+ D N ELI +Y VI+  V++LI  L I+E  +L  N + RK +Y   ++ +N+L +K D        +++AA  IFLNKTCFNGLYRVN KG FNV MG YKNPKI +  NL A+++  K   I + D+ +  +  + +TF+Y+DPPYRPI+ T++F AY+   FND  Q+ L D   K++++G   +LSNSDP N   +D FFD++Y  +NI R+ A RMINS G  RG+I E+L++N++ NKK
  S:    29 PVLKWAGGKTQLLPAIKKQYPQQLQQGKIKTYIEPFFGGGAVFFDIYSNFKIEKAYLFDKNPELIILYKVIQNNVEDLIKELSILETQYLDLNNEQRKEFYYKVRDDYNKLDKKIDANDYKKEWIKRAAYTIFLNKTCFNGLYRVNTKGYFNVPMGRYKNPKILNEKNLLAVNQAFKIAEIKHTDFAEVLKCSNNSTFIYYDPPYRPISETANFNAYSSLEFNDDEQRRLKDMFVKISSQGALQMLSNSDPTNY-VDDPFFDKLYQDFNISRILASRMINSKGGKRGKIREILVTNYE-NKK 328
>gi|126659415|ref|ZP_01730549.1| DNA adenine methylase [Cyanothece sp. CCY0110] >gi|126619251|gb|EAZ89986.1| DNA adenine methylase [Cyanothece sp. CCY0110] (324 aa)
Score = 604, Expect = 1.1e-60, Identities = 141/292 (48%), Positives = 197/292 (67%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRK-WYYLIKK--NRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           P LKW GGKTQLL EIKK YP      +IT Y EPF GGGAV FD+   ++V++ Y+ D N ELI +Y VI+  V+ LI  L I+E  +L  +T+ RK +YY +++  NRF++     D +   +++A+  +FLNKTCFNGLYRVN KG FNV +G YK PKI +  NL A++K  +   I + D+ +   + D+ TF+Y+DPPYRPI+ T++F AY+   FND  QK L D   K +N+G   +LSNSDP N   +D FFDE+Y  +NI R+ A RMINS  ++RG+I E+L++N+
  S:    29 PVLKWAGGKTQLLPEIKKQYPQKLQQGKITTYIEPFFGGGAVFFDIYYNFKVEKAYLFDKNPELIILYKVIQNNVENLIKELSILETQYLDLDTEKRKKFYYHVREDYNRFDKKTNPNDYKKEWIKRASYTVFLNKTCFNGLYRVNSKGYFNVPVGRYKKPKILNKSNLLAVNKAFEIAEIKHTDFAEVLNYADEFTFIYYDPPYRPISETANFNAYSSLEFNDDEQKRLRDIFVKASNQGVLQMLSNSDPTNY-IDDLFFDELYQDFNISRILASRMINSRSNNRGKIREILVTNY 324
>gi|134045884|ref|YP_001097370.1| DNA adenine methylase [Methanococcus maripaludis C5] >gi|132663509|gb|ABO35155.1| DNA adenine methylase [Methanococcus maripaludis C5] (306 aa)
Score = 601, Expect = 2.3e-60, Identities = 138/293 (47%), Positives = 201/293 (68%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKW-YYLIKKNRFNELKEKEDNQFLD-VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEF--IDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           KPFLKW GGK +LLN+ + +YP      +I KY EPF+GGGAV F + S+Y+ K++ ++DIN EL+  Y V++  ++ELI +L+ +E++F   N + +K  YY I+K    E  + + N+  D V   A  IFLNKTCFNGLYR+NKKG+FNV  G Y  P+I D   L A++K LKNV I+  DY+  E++  ID+NTF+Y DPPYRP+  + SFT+Y+K+ F + +Q EL+++   L+  G  ++LSNSDP N+D  D FF+E Y+ + I +V A R+INS  + R +I EL+I N+
  S:     6 KPFLKWAGGKRRLLNQFEDHYPEELRTGKIKKYVEPFLGGGAVFFGLQSRYKFKKVVLNDINHELMLSYKVVQNNIEELISILKPIEENFNKMNFESQKVEYYRIRKEYNIEKLKIDKNEPADLVGNVAKFIFLNKTCFNGLYRLNKKGMFNVPFGRYIRPRIFDEPKLRAVNKALKNVIIMCEDYRNVEKYVDIDENTFLYIDPPYRPLPESVSFTSYSKEDFLENDQIELSNWFKYLDEMGAYLMLSNSDPTNTDPKDRFFEEHYAGFKIDKVSAGRIINSRVNGRRKITELVIKNY 304
>gi|150403669|ref|YP_001330963.1| site-specific DNA-methyltransferase (adenine-specific) [Methanococcus maripaludis C7] >gi|150034699|gb|ABR66812.1| Site-specific DNA-methyltransferase (adenine-specific) [Methanococcus maripaludis C7] (306 aa)
Score = 597, Expect = 8.8e-60, Identities = 138/293 (47%), Positives = 195/293 (66%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKW-YYLIKKNRFNELKEKEDNQFLDV-EKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFID--KNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           KPFLKW GGK +LL + + +YP      +I KY EPF+GGGAV F + SKY+ K++ ++DIN EL+  Y V++  +KELI +LQ +E+ F       +K  YY I+K+   E  + + N+  D+ E  A  IFLNKTCFNGLYR+NKKG+FNV  G Y  P+I D   L  ++K LK V ++  DYK  E  ID    TF+Y DPPYRP+  T SFT+Y+K+ F +++Q EL+++   L+ KG  ++LSNSDP N+D  D FF+E Y+ + I +V A R+INS  + R +I EL+I N+
  S:     6 KPFLKWAGGKRRLLTQFENHYPDELRAGKIKKYVEPFLGGGAVYFSLQSKYKFKKVILNDINHELMLSYKVVQNNIKELISILQPIEEKFNKMTFRLQKLEYYKIRKDYNLEKLKIDKNEPADIIENVAKFIFLNKTCFNGLYRINKKGMFNVPFGRYIRPRIFDEPTLRGVNKALKGVKLMCEDYKNVENCIDIDDETFIYIDPPYRPLPETVSFTSYSKEDFLEKDQVELSNWFKDLDEKGAYLMLSNSDPTNTDPEDRFFEEHYNGFKIDKVFAGRIINSRVNGRRKITELVIKNY 304
>gi|159904544|ref|YP_001548206.1| DNA adenine methylase [Methanococcus maripaludis C6] >gi|159886037|gb|ABX00974.1| DNA adenine methylase [Methanococcus maripaludis C6] (306 aa)
Score = 592, Expect = 3.3e-59, Identities = 132/296 (44%), Positives = 196/296 (66%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRK--WYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFID--KNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           Q  KPFLKW GGK +LL + + +YP      +I KY EPF+GGGAV F + S+Y+ K++ ++DIN EL+  Y V++  ++ELI +L+ +E+ F     + +K  +Y + K+  F +LK  ++     +E  A  IFLNKTCFNGLYR+NKKG+FNV  G Y  P+I D   L  ++K LK V ++  DY+  E +ID    TFVY DPPYRP+  T SFT+Y+K+ F +++Q  L+++   L+ KG  ++LSNSDP N+D  D FF++ Y+ + I +V A R+INS  + R +I EL+I N+
  S:     3 QNAKPFLKWAGGKRRLLTQFENHYPDELMTGKIKKYVEPFLGGGAVYFGLQSRYKFKKVVLNDINHELMLSYKVVQNNIEELISILKPIEEKFNKMKFESQKLEYYRIRKEYNFEKLKIDKNEHTDIIENVAKFIFLNKTCFNGLYRLNKKGMFNVPFGRYLRPRIFDEPTLRGVNKALKGVTLMCEDYRNVENYIDIDDETFVYIDPPYRPLPKTVSFTSYSKEDFLEKDQIHLSNWFKYLDEKGAYLMLSNSDPTNTDPKDCFFEKHYNGFKIDKVCAGRIINSRVNGRRKITELVIKNY 304
>gi|167730271|emb|CAO81183.1| Modification methylase MjaIII (Adenine-specific methyltransferase MjaIII) (M.MjaIII) [Candidatus Cloacamonas acidaminovorans] (325 aa)
Score = 587, Expect = 1.2e-58, Identities = 127/293 (43%), Positives = 184/293 (62%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYP---FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQF--LDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           KPFLKW GGK QL+ E+    P     +  I  Y EPF+GGGA  F + S +++ + +I DIN +LI  Y VIKY V+ LI +L  ++  +   +  +R   Y   + +FN  K+  D  +  L +  +A MIFLN+TCFNGLYR NK G FNV  G Y  P IC   NL   +K L N  I+ GD+  +  ++++NT +Y+DPPYRP+T TS+F +Y K+ F D++Q  LA++  +++      +LSNSDP+ ++  D FFD +Y  Y I R++AKRMINSD   RG I E+L++N+
  S:    28 KPFLKWAGGKGQLIPELVDRLPDKFKKSMHIPVYIEPFIGGGAFFFYLQSCFQIDKSFIIDINRDLIITYQVIKYAVENLIALLSELDNKYNNASQTERTTLYYDIRKKFNYSKKHLDTTYNELWIRHSAYMIFLNRTCFNGLYRENKNGEFNVPHGRYDKPSICQAENLWDANKALSNTKILQGDFSLAANYVEENTLIYYDPPYRPLTKTSNFNSYAKEGFADKDQIRLANFFQEMDRPDVYQILSNSDPRVTNPKDDFFDNLYKEYKISRIQAKRMINSDAEKRGNITEILVTNY 325
>gi|45358298|ref|NP_987855.1| N-6 adenine-specific DNA methylase:N6 adenine-specific DNA methyltransferase, D12 class [Methanococcus maripaludis S2] >gi|44921056|emb|CAF30291.1| N-6 Adenine-specific DNA methylase:N6 adenine-specific DNA methyltransferase, D12 class [Methanococcus maripaludis S2] (306 aa)
Score = 584, Expect = 2.5e-58, Identities = 133/293 (45%), Positives = 192/293 (65%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD--VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFI--DKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           KPFLKW GGK +LL + + +YP    N +I KY EPF+GGGAV   + SKY+ K++ ++DIN EL+  Y  ++  + ELI +L+ +E++F   N + +K  Y   +N +N  K   D    +  +E  A  IFLNKTCFNGLYR+NKKG+FNV  G Y  P+I D   L  ++K LK V ++  DYK  E+ I  D+ TFVY DPPYRP+  T SFT+Y+K+ F +++Q  L+++   L+ KG  ++LSNSDP N++  D FF+E Y  + I +V A R+INS  + R +I EL+I N+
  S:     6 KPFLKWAGGKRRLLTQFEDHYPEGLKNGKIKKYVEPFLGGGAVYLSLQSKYKFKKVVLNDINHELMLSYKTVQNNIDELISILKPIEENFNKMNFESQKMQYYKIRNEYNIEKSNIDKNKSENIIENVARFIFLNKTCFNGLYRLNKKGMFNVPFGRYLRPRIFDEPTLRGVNKALKGVKLLCDDYKNVEKHISIDEETFVYIDPPYRPLPETVSFTSYSKEDFLEKDQVGLSNWFKYLDKKGAYLMLSNSDPTNTNPKDRFFEEHYGGFKIDKVCAGRIINSRVNGRRKITELVIKNY 304
>gi|462632|sp|P34720|MT1A_MORBO Modification methylase MboIA (M.MboIA) (M.MboI A) (Adenine-specific methyltransferase MboIA) >gi|303628|dbj|BAA03071.1| MboI methyltransferase A [Moraxella bovis] (294 aa)
Score = 558, Expect = 2.7e-55, Identities = 131/293 (44%), Positives = 193/293 (65%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYP-FHNNQITKYAEPFVGGGAVLFDVLSKY-EVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDF-LLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN--TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISN 347
           +KPF+KW GGK  LL+EI+K  P F ++Q     EPFVGGGAV    LS    +K++ I+D NA+LINVY VIK    +LI  ++ ++  +  L + + +K Y+  K++ FN+          D+E+A L IFLNK+ FNGLYRVNK   FNV +G+YK P   D  N+  ISKKL+N  I+ GD++     +  N     Y DPPYRPI+ T+SFT+Y+ + F+D  QK LA++  K++  G   LLSNSDPKN++ +D FFDE+Y  + I+R++A R I+++ + R ++NE+++SN
  S:     1 MKPFIKWAGGKNSLLDEIQKRLPDFVHSQDFCLVEPFVGGGAVSLWALSDLPHLKQLVINDCNADLINVYQVIKNNPDDLIGYIENLQSHYDKLTDLESKKPYFYHKRDVFNQRTSN------DIEQAGLFIFLNKSAFNGLYRVNKNNQFNVPIGNYKKPTFVDKENILNISKKLQNTKILSGDFELVLAHLPNNFPCLFYLDPPYRPISDTASFTSYSDNGFDDNEQKRLANFCKKIDKLGHYFLLSNSDPKNTNSSDEFFDELYQDFKIERIQANRTISANSNGRKKVNEIIVSN 292
>gi|86610141|ref|YP_478903.1| D12 class N6 adenine-specific DNA methyltransferase [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86558683|gb|ABD03640.1| D12 class N6 adenine-specific DNA methyltransferase [Synechococcus sp. JA-2-3B'a(2-13)] (326 aa)
Score = 556, Expect = 4.9e-55, Identities = 115/290 (39%), Positives = 166/290 (57%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEV--KEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLI 345
           +PFLKW GGK QLL++   Y PF       Y EPF+GGGAV F +        +   +SDIN EL+NVY  ++ +V+E+I +L   +          R +YY I+  RF +            ++AA +++LNKTCFNGLYR N +G FNV +G Y+NP+ICD  NL A+++ L+ V I    + +  E      FVY DPPY P++++SSFTAY++  F +  Q  L +    L ++G ++LLSNSD         F  E+Y  Y I+ + A R IN+ G  RG I E+L+
  S:    38 RPFLKWAGGKGQLLSQ---YEPFFPRAWNTYHEPFLGGGAVFFHLAQGIPSGSRHFVLSDINPELVNVYCCVRDQVEEIIALLSHHQAH------HSRDYYYTIRAARFED----------PAQRAARLLYLNKTCFNGLYRENSRGEFNVPLGRYRNPRICDAENLRAVARVLQGVEIAVQPFWQVLERAKPGDFVYLDPPYYPLSASSSFTAYSRFAFGEAEQIRLREVFGTLADRGVQVLLSNSDC-------PFVRELYRDYPIQTISASRAINAQGHKRGPITEVLV 303
>gi|148322589|gb|EDK87839.1| site-specific DNA-methyltransferase (adenine-specific) [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (284 aa)
Score = 543, Expect = 1.4e-53, Identities = 139/296 (46%), Positives = 183/296 (61%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           V+ P +KWVGGK QLL +I    P      T Y EPFVGGGAVLFD+    + K+  I+D N ELIN+Y +I+    +LI  LQ  E+       +  +++Y I+     E    + ++  DVEKAA +I+LNKTC+NGL+RVN+ G FN   G YKNP I +   + A+SK     NV I+ GDYK   + + K  FVYFDPPY PI+S+SSFT Y ++ F+ Q Q EL +  +KLN KG K LLSNSD         F  E+Y  Y I  VKAKR INS+G+ RGEINE+L+ N+D
  S:    11 VLSPIVKWVGGKRQLLEDIIPLIP---KTFTTYVEPFVGGGAVLFDI----QPKKAIINDFNHELINIYKIIRDNPNDLISALQEHER------LNSEEYFYKIRALDRTE----QYDEISDVEKAARIIYLNKTCYNGLFRVNQAGQFNSPYGKYKNPNIVNMPVVLAMSKYFNESNVKIIDGDYKTILKNLRKGAFVYFDPPYMPISSSSSFTGYTENGFDKQQQVELKEECDKLNAKGIKFLLSNSD-------HPFIRELYRDYEIITVKAKRSINSNGNKRGEINEVLVRNYD 284
>gi|28210142|ref|NP_781086.1| putative adenine-specific DNA methyltransferase [Clostridium tetani E88] >gi|28202578|gb|AAO35023.1| putative adenine-specific DNA methyltransferase [Clostridium tetani E88] (280 aa)
Score = 541, Expect = 2.5e-53, Identities = 138/300 (46%), Positives = 191/300 (63%)
  Q:    50 NNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKK-NRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           N + +  P LKWVGGK QL+ EIKK  P      T Y EPF+GGGAVLF++     V    I+D+N ELIN+Y++IKY V+ LI  L+        ++ +  +++Y I++ +R  E  EK  N    VEKA+ +I+LNKTCFNGL+RVNK G FN   G YKNP I D + L A++K     N+ I+ GD+++S + I K  FVY DPPY P++S+++FT Y+K  FN   Q  L +  +KL+ KG K LLSNS          F  E+Y  YNIK VKAKR INS+G+SRG ++E+L+ N++
  S:     4 NKIILAAPVLKWVGGKRQLMGEIKKVLP---KTYTAYYEPFIGGGAVLFELQPNKAV----INDVNGELINLYNIIKYDVESLIEDLR--------KHENTSEYFYRIREIDRSKEEYEKLTN----VEKASRIIYLNKTCFNGLFRVNKAGEFNSPFGKYKNPNIVDEVTLRAVNKYFNKANIKILNGDFEQSLKRIRKGAFVYLDPPYDPVSSSANFTGYDKGGFNRAEQIRLKNLCDKLDKKGVKFLLSNS-------ATDFIKELYKDYNIKVVKAKRTINSNGNSRGAVDEVLVRNYE 280
>gi|158336217|ref|YP_001517391.1| DNA adenine methylase [Acaryochloris marina MBIC11017] >gi|158306458|gb|ABW28075.1| DNA adenine methylase [Acaryochloris marina MBIC11017] (277 aa)
Score = 540, Expect = 3.0e-53, Identities = 115/293 (39%), Positives = 175/293 (59%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +PFLKW GGK +L+ +   ++P        Y EPF+GGGA+ F +    + ++  +SD+N EL+NVY+ ++ ++ +   VL+ +E        D   +YY I+            N  L  E+AA  I+LN+TCFNGLYR N KG FNV MG YK PKICD + L+A+S+ L+ V I    ++   E       FVYFDPPY PI++TS FTAY+K  F  ++Q +LA    +L ++G +++LSNSD        SF  ++Y ++NI  ++A R INS+   RG+I E+L++++
  S:    14 RPFLKWAGGKGRLITQYGPHFP---QNFGAYYEPFLGGGAIFFHL----QPEQAVLSDVNPELVNVYTCVRDRIDD---VLKYLETHACQHGHD---YYYQIRAL----------NPSLPAERAARFIYLNRTCFNGLYRENSKGQFNVPMGRYKKPKICDVVLLKAVSEVLQAVQIHQQPFETILEVAQSAQDFVYFDPPYHPISATSDFTAYSKGAFTAKDQTKLAQVFAELASRGVQVMLSNSDC-------SFIRDLYQSFNIYSIQAARAINSNPQKRGKITEVLVTSW 277
>gi|160946234|ref|ZP_02093445.1| hypothetical protein PEPMIC_00196 [Peptostreptococcus micros ATCC 33270] >gi|158447757|gb|EDP24752.1| hypothetical protein PEPMIC_00196 [Peptostreptococcus micros ATCC 33270] (293 aa)
Score = 535, Expect = 1.3e-52, Identities = 141/296 (47%), Positives = 189/296 (63%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           V+ P +KWVGGK QLL++I    P      + Y EPFVGGGAV+FD+    + K+  I+D N+ELIN+Y VIK K  ELI  L+  E+       +  +++Y ++    NE K  E N   D+EKAA +I+LNKTC+NGL+RVN+ G FN   G YKNP I +   + A+SK     N+ I+ GDYK S + + K  FVYFDPPY PI+S+SSFT Y ++ F+ + Q EL +  +KLN+KG K LLSNSD         F  E+Y  Y I  VKAKR INS+G+ RGEINE+L+ N+D
  S:    20 VLSPVVKWVGGKRQLLSDIVPLIP---KTFSTYVEPFVGGGAVIFDI----QPKKAIINDFNSELINIYKVIKEKPNELILALENHER------LNSEEYFYEVRALDRNE-KYGEIN---DIEKAARIIYLNKTCYNGLFRVNQAGQFNSPYGKYKNPNIVNMPVVLAMSKYFNENNIKIMNGDYKNSLKNLRKGAFVYFDPPYMPISSSSSFTGYTENGFDTKQQIELKEECDKLNSKGVKFLLSNSD-------HPFIRELYKDYEIITVKAKRSINSNGNKRGEINEVLVRNYD 293
>gi|152977650|ref|YP_001377167.1| DNA adenine methylase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152026402|gb|ABS24172.1| DNA adenine methylase [Bacillus cereus subsp. cytotoxis NVH 391-98] (280 aa)
Score = 533, Expect = 2.0e-52, Identities = 132/300 (44%), Positives = 191/300 (63%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD-VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKL--KNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDINK 352
           ++ +PFLKW GGK QLL EI+KY P    +I  Y EPF+G GAVLFD+  K  V    I+DIN+EL +VY+VIK  V ELI  L+        ++ +D+ ++Y I+     +L  +E+ + L  V++A+ +I+LNKTCFNGL+RVN +G FNV  G YKNP+I + + L A+   L   NV I+ GD++ + E   K  FVYFDPPY P++ TSSFT Y+ D FN  +Q+ L     +L+ +G  +LLSNS          F  E+Y  +NI+ V A R IN++ S RG+I+E+L+ N++ N+
  S:     5 KLAQPFLKWAGGKRQLLPEIRKYVP---KRINTYYEPFIGAGAVLFDIQPKRAV----INDINSELASVYNVIKNNVDELIEDLK--------KHENDKDYFYEIR-----DLDRQEEYKNLSPVQRASRIIYLNKTCFNGLFRVNSQGQFNVPFGKYKNPQIVNEIVLRAVHNYLSSNNVTILNGDFETAVEKAKKGDFVYFDPPYDPVSDTSSFTGYSLDGFNKDDQRRLKYLFVELDKRGVNVLLSNS-------ATDFIQELYEGFNIQIVSASRNINANASGRGKIDEVLVMNYEPNR 280
>gi|118575600|ref|YP_875343.1| site-specific DNA methylase [Cenarchaeum symbiosum A] >gi|118194121|gb|ABK77039.1| site-specific DNA methylase [Cenarchaeum symbiosum A] (286 aa)
Score = 528, Expect = 7.3e-52, Identities = 112/294 (38%), Positives = 174/294 (59%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYG--DYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++PF+KW GGK Q++  ++ ++P       +Y EPF+GGGAVLF +LS     + + SD+N EL+  Y V++  V++LI  L+   + +   N D    YY        E++  E     D+ + + MIFLN+TCFNGLYRVNK+G FNV +G Y NP I +  NL A+S  L++  +  G  D+  S E   +  FVYFDPPY+P++ T+SFT+Y +  F  ++   LA    +L+ +G  ++LSNS   N+ +  S F    +++  ++V+A R INSD   R    EL+I+N+
  S:    13 IRPFVKWAGGKRQIIPVLQGFFP---RAFGEYHEPFLGGGAVLFHMLSGGRRHKCHASDLNGELVLAYEVVRDSVEDLISALEEHARAY---NADKSGHYY--------EVRAAEPRG--DLARVSRMIFLNRTCFNGLYRVNKRGRFNVPLGRYSNPGIVNAENLRAVSATLRSGRVSIGCHDFVDSAEDAKRGDFVYFDPPYQPVSRTASFTSYTRADFGAEDLARLAGLCRRLDARGCHVMLSNS---NTPEVRSHFG---NSWKTRKVRANRAINSDSGGRSGHTELVITNY 286
>gi|156740889|ref|YP_001431018.1| DNA adenine methylase [Roseiflexus castenholzii DSM 13941] >gi|156232217|gb|ABU57000.1| DNA adenine methylase [Roseiflexus castenholzii DSM 13941] (294 aa)
Score = 524, Expect = 2.2e-51, Identities = 112/294 (38%), Positives = 172/294 (58%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKE-IYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKR--VKAKRMINSDGSSRGEINELLISNF 348
           V+PF+KW GGK QL+ E+ + +P H     +Y EPFVGGGA+ F + +   +++   +SD N EL+  Y VI+  V+ LI  L+   +  L     D  ++  ++    N  ++ +  Q   +E+AA  IFLN+TC+NGLYR+N+KG FN   G+YKNP I D  NL  +S  L+NV +  GD+ +   +     FVYFDPPY P ++T+SFT Y    F  ++Q+ LA+   +L+ +G  ++LSNS       +     E+Y+A  +    V A R IN DGS RG + EL++ ++
  S:    13 VRPFIKWAGGKGQLIPELARRFPPH---FRRYHEPFVGGGALFFHLYNHGLLRDGAVLSDYNPELMVCYEVIRDDVESLITALRWHHRHRL-----DPHYFLEVR----NWDRQPDFAQRSKIERAARTIFLNRTCYNGLYRLNRKGQFNAPFGYYKNPMIYDPQNLRLVSAALRNVELRVGDFSEVLRYAAPGDFVYFDPPYVPTSATASFTHYTGQTFGPEDQRRLAEVFAELSERGVYVMLSNS-------STPLTRELYAARAVSSSVVYASRKINCDGSKRGYVEELIVCSY 290
>gi|89892980|ref|YP_516467.1| hypothetical protein DSY0234 [Desulfitobacterium hafniense Y51] >gi|89332428|dbj|BAE82023.1| hypothetical protein [Desulfitobacterium hafniense Y51] (282 aa)
Score = 523, Expect = 2.8e-51, Identities = 120/296 (40%), Positives = 175/296 (59%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYG--DYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++V P +KWVGGK QLL ++   +P    ++  Y EPF GGGAVLF    K +    +++DIN+ELI +Y VI+  V+ELI  L          + ++ + YY ++   ++  KEK  N    V+KAA +I+LNKTC+NGL+RVN  G FN   GHYK P I +   L A+S   +   I +   DY +    + K TFVY DPPY P++ST++FT Y K  F+   Q  L +  ++L+ +G K +LSNS  +       F  E Y AY I  VKAKR INS+ + RG+I+E+++ N+
  S:     9 RLVAPVVKWVGGKRQLLEDLTPLFP---KRVMSYCEPFCGGGAVLF----KLQPDTAWVNDINSELIRMYEVIRDDVEELIRALG--------EHPNEEEHYYRVRD--WDRDKEKYGN-LSKVQKAARVIYLNKTCYNGLFRVNNAGEFNTPFGHYKTPNIVNEHTLRAVSAYFQRAQITFSSTDYAEVLAGVAKGTFVYLDPPYDPVSSTANFTGYAKGGFDRAEQIRLRECCDELDRRGIKFMLSNSATE-------FIKEQYGAYQITIVKAKRAINSNAAKRGQIDEVVVRNY 281
>gi|109647708|ref|ZP_01371611.1| DNA adenine methylase [Desulfitobacterium hafniense DCB-2] >gi|109640798|gb|EAT50353.1| DNA adenine methylase [Desulfitobacterium hafniense DCB-2] (278 aa)
Score = 522, Expect = 4.4e-51, Identities = 120/296 (40%), Positives = 176/296 (59%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYG--DYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++V P +KWVGGK QLL ++   +P    ++  Y EPF GGGAVLF    K +    +++DIN+ELI +Y VI+  V+ELI  L          + ++ + +Y ++   ++  KEK  N    V+KAA +I+LNKTC+NGL+RVN  G FN   GHYKNP I +   L A+S   +   I +   DY +    + K TFVY DPPY P++ST++FT Y K  F+   Q  L +  ++L+ +G K +LSNS  +       F  E Y AY I  VKAKR INS+ + RG+I+E+++ N+
  S:     5 RLVAPVVKWVGGKRQLLEDLTPLFP---KRVMSYCEPFCGGGAVLF----KLQPDTAWVNDINSELIRMYEVIRDDVEELIRALG--------EHPNEEEHFYRVRD--WDRDKEKYGN-LSKVQKAARVIYLNKTCYNGLFRVNNAGEFNTPFGHYKNPNIVNEHTLRAVSAYFQRAQITFSSTDYAEVLAGVAKGTFVYLDPPYDPVSSTANFTGYAKGGFDRAEQIRLRECCDELDRRGIKFMLSNSATE-------FIKEQYGAYQITIVKAKRAINSNAAKRGQIDEVVVRNY 277
>gi|148654414|ref|YP_001274619.1| DNA adenine methylase [Roseiflexus sp. RS-1] >gi|148566524|gb|ABQ88669.1| DNA adenine methylase [Roseiflexus sp. RS-1] (293 aa)
Score = 520, Expect = 6.1e-51, Identities = 111/297 (37%), Positives = 170/297 (57%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKE-IYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKR--VKAKRMINSDGSSRGEINELLISNFDI 350
           + +PF+KW GGK QL+ E+ +  P    +  +Y EPFVGGGA+ F + +   +++   +SD N EL+  Y VI+  V+ LI  L+   +  L     D  ++  ++    N  ++ +  Q   +E+AA  IFLN+TC+NGLYR+N+KG FN   G+YKNP ICD  NL  +S  L+NV +  GD+       +    VYFDPPY P+++T+SFT Y    F   +Q+ LAD   +L  +G  ++LSNS       +     E+Y+A  +    V A R IN DGS RG + EL++ ++ +
  S:    12 LARPFIKWAGGKGQLIPELARRLP---PRFRRYHEPFVGGGALFFHLFNHGLLRDGAVLSDYNPELMVCYEVIRDDVESLITALRWHHRHRL-----DPHYFLEVR----NWDRQPDFAQRSKIERAARTIFLNRTCYNGLYRLNRKGQFNAPFGYYKNPLICDPENLRLVSAALRNVELCVGDFSDVLHRAEPGDLVYFDPPYVPMSATASFTHYTGQTFGPDDQRRLADVFAELGERGVYVMLSNS-------STPLTRELYAARAVSSSVVYASRKINCDGSKRGHVEELIVCSYPV 292
>gi|163783223|ref|ZP_02178217.1| DNA adenine methylase [Hydrogenivirga sp. 128-5-R1-1] >gi|159881557|gb|EDP75067.1| DNA adenine methylase [Hydrogenivirga sp. 128-5-R1-1] (274 aa)
Score = 518, Expect = 1.1e-50, Identities = 129/296 (43%), Positives = 178/296 (60%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMIN--SDGSSRGEINELLISNF 348
           Q  KPF+KW GGK QLL  + K  P   N    Y EPFVGGGA+LF +L    +    I D N ELIN YSVIK  V+ELI  L+        R+ +D  +YY        E++  + +    VE+A+  I+LNKTC+NGLYR N KG+FNV  G YKNPKI D  NL A+S+ L   NV I+  DY+++ +   +  FVY DPPY P++ T+SFT Y+++ F++++Q+ LA+   +L+ KG  ++LSNS       N  F   +Y  Y I+ ++A R IN   DG  R +I ELLI N+
  S:     6 QKPKPFVKWAGGKRQLLEVLLKNVPARFNT---YIEPFVGGGALLFALLPDRAI----IGDANCELINAYSVIKDNVEELITSLE--------RHRNDEDYYY--------EIRNLDPSTLSPVERASRFIYLNKTCYNGLYRENSKGMFNVPFGRYKNPKILDRDNLRAVSEFLNSSNVLILCQDYRETCKLAGEGDFVYLDPPYHPLSRTASFTKYSRNDFSEEDQERLAEVFRELDRKGCYVMLSNS-------NTEFIKSLYRGYYIQELEASRAINCKGDGRRRRKI-ELLIKNY 274
>gi|118045283|ref|ZP_01513945.1| DNA adenine methylase [Chloroflexus aggregans DSM 9485] >gi|117998311|gb|EAV12491.1| DNA adenine methylase [Chloroflexus aggregans DSM 9485] (292 aa)
Score = 513, Expect = 4.8e-50, Identities = 111/293 (37%), Positives = 170/293 (58%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKE-IYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKK-NRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +PFLKW GGK+QLL E+ +  P H     +Y EPFVGGGA  F + +   +++   +SD+NAELI+ Y  ++ +V+ LI +LQ +          DR ++Y I+  +R      +       VE+AA  IFLN+TC+NGLYR+N KG FN   G+YKNP+I D+ NL  +S+ L+ V +   D+    +      F+YFDPPY P++ T+SFT Y +  F++  Q+ LA   ++L  +   ++LSNS   ++D     + +   A  +  V A R IN DG+ RG + EL+  +F
  S:     4 RPFLKWAGGKSQLLPELARRIPDH---FGRYHEPFVGGGAFFFYLWNHGHLRQGAILSDLNAELIDCYIAVRDEVETLIELLQRLRP-----YATDRDFFYEIRAWDRQPNFARRPR-----VERAARTIFLNRTCYNGLYRLNNKGQFNAPFGYYKNPQIVDSDNLREVSRALRAVELRVADFATVLDHAQPGDFIYFDPPYVPVSPTASFTGYTRRGFDEAEQRRLAQVFHQLAARNCYVMLSNS---STDLARQLYAD---AETVDVVLASRKINCDGTRRGFVEELIACSF 279
>gi|163846726|ref|YP_001634770.1| DNA adenine methylase [Chloroflexus aurantiacus J-10-fl] >gi|187600595|ref|ZP_02986826.1| DNA adenine methylase [Chloroflexus sp. Y-400-fl] >gi|163668015|gb|ABY34381.1| DNA adenine methylase [Chloroflexus aurantiacus J-10-fl] >gi|187487064|gb|EDU25034.1| DNA adenine methylase [Chloroflexus sp. Y-400-fl] (292 aa)
Score = 512, Expect = 5.0e-50, Identities = 112/293 (38%), Positives = 176/293 (60%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKE-IYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKK-NRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYS-AYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +PFLKW GGK+QLL E+ +  P    +  +Y EPFVGGGA+ F + +   ++    +SD+NAELI+ Y  ++ +V++LI +L  +          DR ++Y I+  +R  +   +       VE+AA  IFLN+TC+NGLYR+N KG FN   G+YKNP+I D+ NL  +S+ L+NV++   D+    +      FVYFDPPY P++ST+SFT+Y +  F++  Q+ LA   ++L  +   ++LSNS       + +   ++Y+ A  +  V A R IN +GS RG + EL+  +F
  S:     4 RPFLKWAGGKSQLLPELSRRIP---ERFGRYHEPFVGGGALFFYLWNNGLLRHGAMLSDLNAELIDCYIAVRDEVEDLIELLHRLRP-----YATDRDFFYDIRSWDRQPDFARRSR-----VERAARTIFLNRTCYNGLYRLNNKGQFNAPFGYYKNPQIVDSDNLREVSRALRNVDLRVADFAAVLDEAQAGDFVYFDPPYVPVSSTASFTSYTRRGFDEGEQRRLALVFHQLAARNCFVMLSNS-------STTLAHQLYANACRVDVVLASRKINCNGSRRGLVEELIACSF 279
>gi|116332724|ref|YP_794251.1| site-specific DNA methylase [Lactobacillus brevis ATCC 367] >gi|116098071|gb|ABJ63220.1| Site-specific DNA methylase [Lactobacillus brevis ATCC 367] (341 aa)
Score = 509, Expect = 1.2e-49, Identities = 125/294 (42%), Positives = 176/294 (59%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKN-VNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYN---IKRVKAKRMINSDGSSRGEINELLISNF 348
           + PF+KWVGGK QLL++I    P    +  +Y EPFVGGGAV  ++  K+ V    I+D N ELIN + ++++  ++L+ VL+I E      N + +++Y  ++    N   E+      DVE+AA  I++NKT FNGL+RVN+KG  NV  G YKNPKI D   L A     KN + I+ GDY+ + +       VYFDPPY P+  TSSFT+Y K+ F  Q Q EL D   KL  KG K++LSN+D           +E+Y   +   I  VKA+R INS GS RG++ E+LI+N+
  S:    68 LSPFIKWVGGKRQLLHDINALIPV---EFGRYYEPFVGGGAVFLNLAPKHAV----INDFNPELINTWKIVQFNPQKLLDVLKIHE------NNNSKEYYLHLRATDRNGQLERMS----DVERAARFIYMNKTGFNGLWRVNQKGQNNVPYGRYKNPKIQDERILLAAEYLQKNDIKILCGDYRDAIQSARLGDLVYFDPPYAPVNPTSSFTSYTKNEFGLQQQIELRDTFVKLTQKGVKVILSNADV-------PLIEELYKNIDDAVIHHVKARRAINSVGSKRGKVGEVLITNY 341
>gi|153954932|ref|YP_001395697.1| DNA methylase [Clostridium kluyveri DSM 555] >gi|146347790|gb|EDK34326.1| Predicted DNA methylase [Clostridium kluyveri DSM 555] (278 aa)
Score = 509, Expect = 1.2e-49, Identities = 132/296 (44%), Positives = 186/296 (62%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKK-NRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++V+P +KW GGK QLL E+KKY P     I+ Y EPF+GG AVLFD+  K  V    +SDIN ELIN+Y  I+  V ELI  L+        +NT D  ++Y I+  +R   +  K       VE+A+ + +LNKTC+NGL+RVN  G FN   G+YKNP I + + + A+SK L   N+ + Y DY+++ + I K  FVYFDPPY P++++S+FT Y K  FN   Q  L +  +KLN+KG K LLSNS       +  F  ++Y  YN K ++AKR INS+G+ RGEI+E+L+ N+
  S:     5 KLVEPVVKWAGGKRQLLPELKKYIP---KNISTYYEPFLGGAAVLFDIQPKKAV----VSDINEELINLYMAIRDNVDELIEDLKKH------KNTPD--YFYKIRGLDRETSIYSK----LTKVERASRIHYLNKTCYNGLFRVNMAGQFNSPFGNYKNPNITNEITIRAVSKYLNEANIKLKYCDYEETLKSIRKGAFVYFDPPYDPVSNSSNFTGYAKGGFNRDEQWRLRNVCDKLNSKGIKFLLSNS-------STDFILDLYKDYNTKIIQAKRFINSNGNKRGEIDEVLVRNY 277
>gi|125974955|ref|YP_001038865.1| DNA adenine methylase [Clostridium thermocellum ATCC 27405] >gi|125715180|gb|ABN53672.1| DNA adenine methylase [Clostridium thermocellum ATCC 27405] (280 aa)
Score = 508, Expect = 1.8e-49, Identities = 124/296 (41%), Positives = 184/296 (62%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVY--GDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           +V P LKW GGK QLL +IKK+ P    + + Y EPF+GGGAVLF++     V    ++DIN EL+NVY VI+  V+ELI  L+  E+       +  ++YY I++    +  +++  Q  ++EKAA +I+LNKTC+NGL+RVN +G FNV  G YKNP I + + L A+S       I +  GD++++ +   + +FVYFDPPY P++ TSSFT Y+ + F+ + Q  L +  +KLN KG K LLSNS          F  ++Y  YNI  V+A R INS    RG+++E+L+ N++
  S:     6 LVAPVLKWAGGKRQLLKDIKKHIP---EKFSTYYEPFLGGGAVLFELQPSKAV----VNDINEELMNVYLVIRDHVEELIEELKKHER------KNSEEYYYEIREL---DRDKRKYEQLSNIEKAARIIYLNKTCYNGLFRVNSQGQFNVPYGRYKNPDIVNEVTLRAVSNYFNKAKITFKCGDFEEAVKGAREGSFVYFDPPYDPVSDTSSFTGYDINGFDKEEQIRLKELCDKLNKKGVKFLLSNS-------ATDFILDLYKDYNITIVQANRAINSKADKRGKVDEVLVKNYE 280
>gi|154495843|ref|ZP_02034539.1| hypothetical protein BACCAP_00123 [Bacteroides capillosus ATCC 29799] >gi|150275041|gb|EDN02089.1| hypothetical protein BACCAP_00123 [Bacteroides capillosus ATCC 29799] (280 aa)
Score = 506, Expect = 2.8e-49, Identities = 113/292 (38%), Positives = 166/292 (56%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFL-DVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVY--GDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           P +KWVGGK QLL +I    P    ++T Y EPF+GGGAVLF +    + K   ++D+N +LI VY VIK     LI        + L R+ +  +++Y I+    +  ++K     L DVEKA+ +++LNKTC+NGL+RVN  G FN   GHY+ P I +   +  +S+     +I +  GD+    E + K  FVY DPPY P++ T+SFT YN+  F  + Q  L +  + L  +G K LLSNS          F  E+Y +Y +  V+A+R +NS  S RG I E+L+ N+
  S:     9 PVVKWVGGKRQLLPQILPLIP---KRMTAYCEPFLGGGAVLFAL----QPKRALVNDLNQDLITVYRVIKEDADALI--------EHLSRHENTPEYFYRIR----DLDRDKAAYAALSDVEKASRLLYLNKTCYNGLFRVNASGAFNSPYGHYRRPNIVNEQTIRGVSRYFNACDITFFSGDFASVLEQVPKGGFVYLDPPYDPVSDTASFTGYNRGGFGREEQVRLKECCDALTARGVKFLLSNS-------ATPFIRELYGSYRVSIVQARRAVNSVASRRGAIEEVLVRNY 277
>gi|186681200|ref|YP_001864396.1| DNA adenine methylase [Nostoc punctiforme PCC 73102] >gi|14594719|gb|AAK68651.1| adenine-specific DNA methyltransferase [Nostoc punctiforme] >gi|186463652|gb|ACC79453.1| DNA adenine methylase [Nostoc punctiforme PCC 73102] (285 aa)
Score = 504, Expect = 5.1e-49, Identities = 121/293 (41%), Positives = 180/293 (61%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKS-EEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIK--RVKAKRMINSDGSSRGEINELLISNF 348
           +PFLKW GGK++L   I++Y P+       Y EPF+GGGAV F +    + K   ++DINAELIN Y  ++ +V+ELI +L    K+  +R+  D  +YY ++ N              D+EKAA +I+LNKTCFNGLYRVN +G FNV +G Y+NP IC  + L+A S+ L    I   D+ +        + FV+FDPPY PI+ TS FTAY+++ F+ ++Q+ L D   +L ++G K+++ NSD +       F   IY+  N +  ++KA R INS+  +RG I+ELLI++F
  S:    12 RPFLKWAGGKSRL---IQQYIPYFPKSYKNYYEPFLGGGAVFFYL----QPKAATLTDINAELINTYCCVRDRVEELISLL----KEHKIRHNKD--YYYSVRNNSGGT----------DLEKAARLIYLNKTCFNGLYRVNSQGKFNVPLGRYENPNICSEVLLQAASEALYYAEIKQADFTEVLNHATSSDDFVFFDPPYHPISETSYFTAYSQNCFSKKDQEVLRDTCAELASRGVKVMVCNSDSE-------FIRNIYTDINFEAYKIKAARSINSNIKNRGMIDELLITSF 277
>gi|22299183|ref|NP_682430.1| putative site-specific DNA-methyltransferase [Thermosynechococcus elongatus BP-1] >gi|22295365|dbj|BAC09192.1| tlr1640 [Thermosynechococcus elongatus BP-1] (304 aa)
Score = 503, Expect = 5.6e-49, Identities = 121/302 (40%), Positives = 175/302 (57%)
  Q:    51 NLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYS--AYNIKRVKAKRMINSDGSSRGEINELLISNFDINK 352
           +L V +PFLKW GGKTQL + + ++ P + N    Y EPFVG GA+ F +  + +V+   +SDINAELI+ Y  I+ +V E+I +L          +++D  +YY        E++ K+  +    E+AA MI+LNKT +NGLYRVN++G FNV  G YK PK  D  NL A+S  L+NV I+   +    E      +VYFDPPY PI+ TS+FT+Y  D F  Q+Q+ L D    L+     I +SNSD        +    +Y    + I  V A R IN +G+ RG+I EL+I+N+ +N+
  S:     3 DLSVPRPFLKWAGGKTQLADALLEHKPVYFNT---YHEPFVGSGAIFFRLYRENQVRRAILSDINAELIDTYLAIRDRVAEVIVLLSEFP------HSED--FYY--------EIRAKDPWKLSLSERAARMIYLNKTGYNGLYRVNRQGKFNVPFGRYKAPKYLDKDNLLAVSHALRNVEILCAPFDTVTERAKPGDWVYFDPPYVPISQTSNFTSYYADGFGLQDQERLRDICITLSQNNVYITVSNSD-------TAIVRSLYKFPHFAIDEVLANRTINCNGARRGKITELVITNYPVNQ 280
>gi|147678271|ref|YP_001212486.1| site-specific DNA methylase [Pelotomaculum thermopropionicum SI] >gi|146274368|dbj|BAF60117.1| site-specific DNA methylase [Pelotomaculum thermopropionicum SI] (293 aa)
Score = 502, Expect = 7.7e-49, Identities = 114/293 (38%), Positives = 166/293 (56%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           KP +KW GGK QL+ +     P   N    Y EPFVGGGAV F +L     K I I D N ELIN Y  ++  +++L+  L+  E      NT D  +YY        +++  +  +   VE+A+  ++LNKT +NGL+RVN  G  NV  G YKNP+I D  NL  +S+ LK   +++GD+ +  +     +FVYFDPPY P++ T+SFT Y  + F+  +Q+ LA    +L+  G  ++LSNSD         F  E+YS Y++K V+A+R IN     RG +NEL+I N+
  S:    29 KPPVKWAGGKGQLIPQFDPLLP--KNDYHLYIEPFVGGGAVFFHLLPS---KAILI-DNNKELINFYLAVRDNLEQLLHSLKKHE------NTAD--YYY--------QVRALDAEKLSPVERASRFLYLNKTAYNGLWRVNSSGKHNVPFGRYKNPRIADEHNLRLVSEVLKQAELIHGDFSRVLDCAGPGSFVYFDPPYHPLSETASFTGYTPESFSAGDQRRLAAVFRELDRMGCTVMLSNSD-------TPFIRELYSGYDVKVVRARRAINCRADKRGPVNELVIRNY 292
>gi|168207670|ref|ZP_02633675.1| modification methylase lladchia [Clostridium perfringens E str. JGS1987] >gi|170660982|gb|EDT13665.1| modification methylase lladchia [Clostridium perfringens E str. JGS1987] (280 aa)
Score = 502, Expect = 8.8e-49, Identities = 133/300 (44%), Positives = 192/300 (64%)
  Q:    50 NNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           N + +  P LKWVGGK QL++EI+K  P      T Y EPF+GGGAVLF++  K  V    I+D+N ELIN+Y+VIK  V+ LI  L+        ++ +  +++Y I++   +  K+K +N   +VEKA+ +++LNKTCFNGL+RVNK G FN   G YKNP I D + L A+SK     ++ I+ GD++ S + I K  FVY DPPY P++++++FT Y+K  FN   Q  L    +KL+ KG K LLSNS          F  ++Y  YNIK VKAKR INS+G++RGE++E+L+ N++
  S:     4 NKIILAAPVLKWVGGKRQLMSEIEKVLP---KTYTTYYEPFIGGGAVLFELQPKKAV----INDVNGELINLYNVIKDDVELLIEDLK--------KHENTPEYFYSIRE--LDRKKDKYEN-LSNVEKASRIVYLNKTCFNGLFRVNKAGEFNSPFGKYKNPNIVDEVTLRAVSKYFNKADIKILNGDFEASLKGIRKGAFVYLDPPYDPVSNSANFTGYDKGGFNRDEQIRLKKLCDKLDKKGVKFLLSNS-------ATDFIKDLYKDYNIKIVKAKRAINSNGNARGEVDEVLVRNYE 280
>gi|138895695|ref|YP_001126148.1| putative adenine-specific DNA methyltransferase [Geobacillus thermodenitrificans NG80-2] >gi|196250945|ref|ZP_03149628.1| DNA adenine methylase [Geobacillus sp. G11MC16] >gi|134267208|gb|ABO67403.1| Putative adenine-specific DNA methyltransferase [Geobacillus thermodenitrificans NG80-2] >gi|196209509|gb|EDY04285.1| DNA adenine methylase [Geobacillus sp. G11MC16] (280 aa)
Score = 499, Expect = 1.7e-48, Identities = 126/300 (42%), Positives = 189/300 (63%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD-VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDINK 352
           ++ +PFLKW GGK QLL EI+KY P    +I  Y EPF+G GAVLFD+  K  V    I+DIN ELIN Y  I+  V ELI  L+        ++ ++++++Y I+     +L  KE+ + L  VE+A+ +I+LNKTCFNGL+RVN +G FNV  G YKNP+I + + L A+   L   ++ I+  D++K+ E   K  F+YFDPPY P++ TSSFT Y+   F+  +Q  L D   +L+ +G K+LLSNS          F  ++Y  ++I+ V A R IN++ S RG+I+E+L+ N++ ++
  S:     5 KLAQPFLKWAGGKRQLLPEIRKYIP---KKINTYYEPFLGAGAVLFDIQPKKAV----INDINTELINTYIAIRDHVDELINDLK--------KHKNEKEYFYAIR-----DLDRKEEFKKLSLVERASRIIYLNKTCFNGLFRVNSQGHFNVPFGKYKNPQIVNEIVLRAVHNYLNSNDITILNVDFEKAVENAKKGDFIYFDPPYDPVSDTSSFTGYSLYGFDKDDQIRLRDLFVELDKRGCKVLLSNS-------ATDFIKDLYKDFHIEVVSANRNINANASRRGKIDEVLVMNYEPDR 280
>gi|119509686|ref|ZP_01628832.1| site-specific DNA-methyltransferase [Nodularia spumigena CCY9414] >gi|119465705|gb|EAW46596.1| site-specific DNA-methyltransferase [Nodularia spumigena CCY9414] (275 aa)
Score = 495, Expect = 5.9e-48, Identities = 115/293 (39%), Positives = 164/293 (55%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKS-EEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +PFLKW GGK++L+ +   Y P    Q   Y EPF+GGGA+ F +     +    ++DINAELI  Y  ++  V+ELI +L+  +K        ++ +YY ++                D+E+AA  I+LNKTCFNGLYRVN +G FNV +G YKNP IC    L A S  L    I   D+          + FVYFDPPY P++ TS FTAY+   F +  Q  L D   +L ++G K++LSNSD        +F  E+YS +NI  + A R INS+   RG+I E+L++++
  S:    12 RPFLKWAGGKSRLIPQYINYLP---KQYKTYYEPFLGGGAIFFHLHPPAAI----LTDINAELITTYRCVRNHVEELIGLLEEHQK------RHNKDYYYDVRAYPGGS----------DLEQAARFIYLNKTCFNGLYRVNSQGKFNVPLGRYKNPNICPDNILRAASAGLATSEIKQADFTDVLNHATSSDDFVYFDPPYYPVSETSYFTAYSTYCFTENKQFLLRDIFAQLADRGVKVMLSNSDC-------TFIRELYSKFNIYTISAARSINSNAKKRGKITEVLVTSY 275
>gi|160884888|ref|ZP_02065891.1| hypothetical protein BACOVA_02878 [Bacteroides ovatus ATCC 8483] >gi|156109923|gb|EDO11668.1| hypothetical protein BACOVA_02878 [Bacteroides ovatus ATCC 8483] (281 aa)
Score = 492, Expect = 1.1e-47, Identities = 123/297 (41%), Positives = 185/297 (62%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVN--IVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           ++V PF+KWVGGK Q+L+EI+KY P   ++   Y EPF+GGGA+LF +  K  +    I+D NAELIN+Y+VIK    ELI  L+        ++ ++  ++Y I+    +  +EK  +   ++E+A+ +IFLNKTC+NGL+RVN  G FN   G YKNP I + + ++A+S  L N N  I+ GD++++   + K  FVY DPPY P++++SSFT Y +  F+   Q+ L +  + L+ K  K LLSNS        D   D +Y  YNI  +KA R INSD   RG+++E+LI N++
  S:     8 KLVVPFVKWVGGKRQILSEIEKYLP---SKFATYYEPFIGGGALLFHIQPKNAI----INDFNAELINLYTVIKENPLELIADLK--------KHKNEADYFYEIRS--LDRDREKF-SALTNIERASRIIFLNKTCYNGLFRVNSSGEFNTPFGRYKNPNIVNEITIKAVSLYLNNSNVLIMNGDFEEALHNVSKGDFVYLDPPYDPLSNSSSFTGYTQGGFDRTEQERLRNVCDWLHAKKAKFLLSNS------CTDLILD-LYKNYNITEIKAIRSINSDAEKRGQVSEVLIRNYE 281
>gi|77412903|ref|ZP_00789107.1| putative DNA adenine methylase [Streptococcus agalactiae 515] >gi|77161043|gb|EAO72150.1| putative DNA adenine methylase [Streptococcus agalactiae 515] (289 aa)
Score = 490, Expect = 1.9e-47, Identities = 138/304 (45%), Positives = 193/304 (63%)
  Q:    44 QKVEINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKED-NQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISN 347
           QK E      +V P +KWVGGK QLL EIKKY P   ++I+ Y EPF+GGGAVLF++    + K+  ++D N+ELINVY VIK   +ELI  L+  ++   L N D   +YY I+      L   E  +   +VEKA+ +++LNKTC+NGL+RVN+ G FN   G YKNP I + + + A+SK L   ++ ++ GDYK++ + + K  FVYFDPPY PI+S+SSFT Y ++ F+   Q EL D   KL  +G   LLSNS   +S+  D + D+  S + I+ VKA R +NS    RGEINE+LI+N
  S:     2 QKEESYKKNILVSPVVKWVGGKRQLLPEIKKYIP---SKISTYVEPFLGGGAVLFEL----QPKKAIVNDFNSELINVYQVIKDNPEELIFSLENHKQ---LNNED---YYYKIRG-----LDRTEGFDDLTNVEKASRILYLNKTCYNGLFRVNRSGQFNTPYGKYKNPNIVNEVTIRAMSKYLNKNSIKLMNGDYKEALKNLRKGAFVYFDPPYLPISSSSSFTGYTENGFDIDKQIELRDECKKLAKRGINFLLSNS--YSSEILDLYSDK--SLFEIEVVKATRNVNSVSEKRGEINEVLITN 286
>gi|86605658|ref|YP_474421.1| D12 class N6 adenine-specific DNA methyltransferase [Synechococcus sp. JA-3-3Ab] >gi|86554200|gb|ABC99158.1| D12 class N6 adenine-specific DNA methyltransferase [Synechococcus sp. JA-3-3Ab] (316 aa)
Score = 489, Expect = 2.9e-47, Identities = 116/303 (38%), Positives = 173/303 (57%)
  Q:    50 NNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSA--YNIKRVKAKRMINSDGSSRGEINELLISNFDINK 352
           ++L + +PFLKW GGKTQL + + +  P +      Y EPFVG GA+ F +  + ++K+  +SDINAELI+ Y  I+  V E+I +L     +F      +  +YY        +++EK+      V +AA MI+LNKT +NGLYRVN++G FNV  G YK PK  D  NL A S  L+NV I+   +    E      +VYFDPPY P++ TS+FT+Y+   F  ++Q+ L D    L+     I+LSNSD        +    +Y+   + I  V+A R IN  G+ RG+I EL+I+N+ + +
  S:     2 SDLLLPRPFLKWAGGKTQLTDALLERMPVY---FRTYHEPFVGSGALFFRLYRECKIKQAILSDINAELIDTYLAIRDHVWEVIQLLS----EF----PHNESFYY--------QIREKDPWSMGLVGRAARMIYLNKTGYNGLYRVNRQGKFNVPFGRYKAPKYLDKDNLLAASLALQNVEILCVPFDTVVERAKPGDWVYFDPPYVPVSQTSNFTSYHASGFGLEDQERLRDICIDLSKNKVYIMLSNSD-------TAIIRSLYAMPFFAIDEVQANRAINCKGTKRGKITELVITNYPVER 280
>gi|81096498|ref|ZP_00874840.1| N6 adenine-specific DNA methyltransferase, D12 class [Streptococcus suis 89/1591] >gi|12082201|dbj|BAB20828.1| DNA adenine methylase M.SsuMA [Streptococcus suis] >gi|15281319|dbj|BAB63413.1| DNA adenine methylase M.Ssu11318IA [Streptococcus suis] >gi|15281325|dbj|BAB63418.1| DNA adenine methylase M.Ssu4961IA [Streptococcus suis] >gi|15281331|dbj|BAB63423.1| DNA adenine methylase M.Ssu8074IA [Streptococcus suis] >gi|15281337|dbj|BAB63428.1| DNA adenine methylase M.Ssu2479IA [Streptococcus suis] >gi|80977446|gb|EAP40987.1| N6 adenine-specific DNA methyltransferase, D12 class [Streptococcus suis 89/1591] (276 aa)
Score = 488, Expect = 3.2e-47, Identities = 117/294 (39%), Positives = 176/294 (59%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +KPF KW GGK +LL ++ ++ PF  N   +Y EPFVGGGA+ FD+  +  V    I+D N ELIN Y  I+   + L+ +L I +++       + K YYL  ++     ++       DVE+AA ++++ +  FNGLYRVN K  FNV  G YKNPKI D+  + ++S+ L   N+ I+ GD+  + E  D   FVYFDPPY PIT+TSSFT+Y  + F+DQ+Q+ L D    L+ +G  ++LSNS       +    +E+Y+ +NI RV   R   +  SSRG+I E+++ N+
  S:     3 LKPFTKWTGGKRKLLTQLHEHLPFEYN---RYFEPFVGGGALFFDLAPENAV----INDFNEELINTYLQIRDNPEALLDLLHIHQEN-------NSKEYYLDVRSVD---RDGRIETMSDVERAARILYMLRVDFNGLYRVNSKNQFNVPYGRYKNPKIVDSELILSVSRYLNDNNILIMQGDFVTAVEEADAGDFVYFDPPYVPITATSSFTSYTHEGFSDQDQRRLRDTFIDLDRRGVNVMLSNS-------SSPVVEELYAGFNISRVDVSRTNGASNSSRGKIQEIIVRNY 274
>gi|15281344|dbj|BAB63434.1| DNA adenine methylase M.Ssu4109IA [Streptococcus suis] (276 aa)
Score = 488, Expect = 3.5e-47, Identities = 118/294 (40%), Positives = 175/294 (59%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVY--GDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +KPF KW GGK +LL ++ ++ PF  N   +Y EPFVGGGA+ FD+  +  V    I+D N ELIN Y  I+   + L+ +L I +++       + K YYL   N  +  ++       DVE+AA ++++ +  FNGLYRVN K  FNV  G YKNPKI DT  ++ +S+ L N NI+   GD+  + E      FVYFDPPY P+T+TSSFT+Y  + F+DQ+Q+ L D    L+ +G  ++LSNS       +    +E+Y+ +NI RV   R   +  SSRG+I E+++ N+
  S:     3 LKPFTKWTGGKRKLLTQLHEHLPFEYN---RYFEPFVGGGALFFDLAPENAV----INDFNEELINTYLQIRDNPEALLDLLHIHQEN-------NSKEYYL---NVRSVDRDGRIEIMSDVERAARILYMLRVNFNGLYRVNSKNQFNVPYGRYKNPKIVDTELIQRVSRYLNNNNILIMQGDFATAVEEAVAGDFVYFDPPYVPLTATSSFTSYTHEGFSDQDQRRLRDTFVALDRRGVNVMLSNS-------SSPVVEELYAGFNISRVDVSRTNGASNSSRGKIQEIIVRNY 274
>gi|188995767|ref|YP_001930019.1| putative adenine-specific DNA methyltransferase [Porphyromonas gingivalis ATCC 33277] >gi|150846|gb|AAA16106.1| methylase >gi|188595447|dbj|BAG34422.1| putative adenine-specific DNA methyltransferase [Porphyromonas gingivalis ATCC 33277] (279 aa)
Score = 487, Expect = 4.6e-47, Identities = 124/297 (41%), Positives = 180/297 (60%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKN--VNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           +++ PFLKWVGGK QL+ EIK   P        Y EPF+GGGA+LF++    + K   I+D N ELINVY VI+    ELI  L+        ++ +  +++Y I+    N L         D+E+A+ +I+LNKTC+NGLYRVN  G FN   G YKNP I +   ++A+SK L    + I  GDY+   + I +++FVY DPPY PI+ +++FT Y +  +++++Q  L +  N LN +G K LLSNS       +  F  EIYS YNI  V+A R +NSD S RG+++E LI+N++
  S:     5 KLIAPFLKWVGGKRQLIPEIKNLLP-KGILSHPYYEPFIGGGALLFEL----QPKNATINDYNEELINVYKVIRDNPHELIEDLK--------KHKNTAEYFYEIRAIDRNPLFI----NLTDIERASRIIYLNKTCYNGLYRVNNAGEFNSPFGKYKNPNIVNEPVIKAVSKYLNTAKIQIFNGDYQTILKDIPRSSFVYLDPPYHPISQSANFTGYVQGGWDEKDQIRLRNVCNTLNERGIKFLLSNS-------SSDFIKEIYSDYNIYVVQATRAVNSDSSKRGQVSEFLINNYE 279
>gi|89209831|ref|ZP_01188225.1| DNA adenine methylase [Halothermothrix orenii H 168] >gi|89160483|gb|EAR80137.1| DNA adenine methylase [Halothermothrix orenii H 168] (306 aa)
Score = 486, Expect = 5.7e-47, Identities = 127/293 (43%), Positives = 186/293 (63%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEV--KEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIK-----KNRFNELKEKE---DNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYK--KSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           KPF+KW GGK QL+ ++    P   + I +Y EPFVG GA+ F++ +   +  ++  I D+N +LIN Y VIK  V+ LI  L+  EK+      ++  +YY ++     K R   L  KE    N+  +++KAA  I+LNKTC+NGLYR+N KG FNV  G+YKNP+ICD  NL  +S+ L+NV I+  D++  K +       FVYFDPPY P++ TS+FT+Y K+ F  ++Q+ L +  N ++ +G K +LSNS       N     ++YS +NIK VKA R IN  G+ RG I EL+I+N+
  S:    18 KPFVKWAGGKRQLIPDLFNSLP---DNIERYFEPFVGAGALFFELANNNVISGRKSIIVDLNDDLINAYKVIKNSVESLINELKKHEKN------NNEIYYYKVRGLWTRKARELGLSRKELWSVNELNNIQKAARFIYLNKTCYNGLYRLNNKGQFNVPYGNYKNPRICDEDNLRTVSQLLQNVTIIKNDFEIIKDKYRFTPADFVYFDPPYVPLSDTSNFTSYTKNGFTKEDQERLYELFNYIDMQGGKCMLSNS-------NSPLIKKLYSKFNIKEVKAIRAINCIGNKRGAIKELIITNY 306
>gi|609184|emb|CAA84628.1| pgi methylase [Porphyromonas gingivalis] (288 aa)
Score = 486, Expect = 6.4e-47, Identities = 124/297 (41%), Positives = 180/297 (60%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKN--VNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           +++ PFLKWVGGK QL+ EIK   P        Y EPF+GGGA+LF++    + K   I+D N ELINVY VI+    ELI  L+        ++ +  +++Y I+    N L         D+E+A+ +I+LNKTC+NGLYRVN  G FN   G YKNP I +   ++A+SK L    + I  GDY+   + I +++FVY DPPY PI+ +++FT Y +  +++++Q  L +  N LN +G K LLSNS       +  F  EIYS YNI  V+A R +NSD S RG+++E LI+N++
  S:    14 KLIAPFLKWVGGKRQLIPEIKNLLP-KGILSHPYYEPFIGGGALLFEL----QPKNATINDYNEELINVYKVIRDNPHELIEDLK--------KHKNTAEYFYEIRAIDRNPLFI----NLTDIERASRIIYLNKTCYNGLYRVNNAGEFNSPFGKYKNPNIVNEPVIKAVSKYLNTAKIQIFNGDYQTILKDIPRSSFVYLDPPYHPISQSANFTGYVQGGWDEKDQIRLRNVCNTLNERGIKFLLSNS-------SSDFIKEIYSDYNIYVVQATRAVNSDSSKRGQVSEFLINNYE 288
>gi|169636470|ref|YP_001716011.1| putative type IIs modification methyltransferase [Geobacillus stearothermophilus] >gi|169403010|emb|CAP08221.1| putative type IIs modification methyltransferase [Geobacillus stearothermophilus] (632 aa)
Score = 479, Expect = 4.0e-46, Identities = 116/282 (41%), Positives = 160/282 (56%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKS-EEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSR 337
           KP LKW GGK Q+L+ +    P    Q  +Y EPF GGGA+ F +  K    +  I+D N ELIN+Y V+   V+ELI +L+ M+        +D  +YY        E++  + +    VE+AA  I+LN+TC+NGLYRVN+KG FNV  G YKNPKICD  NL A S  L++V IV GDYK    E    + F++ DPPY P+   S F  Y K+ F +++  ELA  +++L+  G  ++L+NS       N     E+Y  Y I   K +R INSD S R
  S:    16 KPILKWAGGKQQMLDVLLPQVP---KQYNRYIEPFFGGGALFFALTPK----DAIIADSNPELINLYRVVADNVEELISILKEMK--------NDESFYY--------EIRGLDPDLLSPVERAARTIYLNRTCYNGLYRVNRKGQFNVPYGKYKNPKICDEENLRAASNALQDVLIVEGDYKDVLREHARPDDFIFLDPPYLPVGKYSDFKRYTKEQFYEEDHIELAQEVDRLHELGCYVILTNS-------NHPLVHELYGKYAISVHKTRRNINSDASKR 268
>gi|22299121|ref|NP_682368.1| putative adenine specific methyl transferase [Thermosynechococcus elongatus BP-1] >gi|22295303|dbj|BAC09130.1| tlr1578 [Thermosynechococcus elongatus BP-1] (285 aa)
Score = 479, Expect = 4.2e-46, Identities = 105/293 (35%), Positives = 169/293 (57%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEI-----YISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNS--DPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +PFLKW GGK+QLL+++  Y P    Q   YAEPF G  A+ + +  + +  +      ++SD N ELIN Y +++ +V++LI   Q+ E     R      +YY         ++  +  Q   + +AA +I+LNKTCFNGLYRVN+ G FNV MG Y+NP+I D   L   S  L++V +   D+++   +     F+YFDPPY P++ T+SFT+Y    F +  Q  LA+ + +L  +G  ++LSN+  +P           ++Y ++    +KA R+INS+   RG+++ELL+  +
  S:    10 RPFLKWAGGKSQLLSQMAPYLP---RQCRCYAEPFCGSAALYWYLFGQAQQGQFQFQQAWLSDRNPELINCYQIVRDRVEDLIQ--QLTE----YRQQHSEAFYY--------HIRSWDQRQLDPLTRAARLIYLNKTCFNGLYRVNRAGQFNVPMGRYRNPQIFDPEALRQASIALQDVILSVADFQEVLTWATAGDFIYFDPPYYPLSKTASFTSYTDQPFGEAEQIALANVVAELAQRGCYVMLSNAWVEP---------MLQLYRSWRCIELKASRVINSNRHKRGKVSELLVVTY 283
>gi|56410445|ref|YP_145819.1| type IIs modification methyltransferase [Geobacillus kaustophilus HTA426] >gi|56378342|dbj|BAD74251.1| type IIs modification methyltransferase [Geobacillus kaustophilus HTA426] (632 aa)
Score = 478, Expect = 5.0e-46, Identities = 116/282 (41%), Positives = 159/282 (56%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKS-EEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSR 337
           KP LKW GGK Q+L+ +    P    Q  +Y EPF GGGA+ F +  K    +  I+D N ELIN+Y V+   V+ELI +L+ M+        +D  +YY        E++  + +    VE+AA  I+LN+TC+NGLYRVN+KG FNV  G YKNPKICD  NL A S  L++V IV GDYK    E      F++ DPPY P+   S F  Y K+ F +++  ELA  +++L+  G  ++L+NS       N     E+Y  Y I   K +R INSD S R
  S:    16 KPILKWAGGKQQMLDVLLPQVP---KQYNRYIEPFFGGGALFFALTPK----DAIIADSNPELINLYRVVADNVEELISILKEMK--------NDESFYY--------EVRGLDPDLLSPVERAARTIYLNRTCYNGLYRVNRKGQFNVPYGKYKNPKICDEENLRAASNALQDVLIVEGDYKDVLREHARPGDFIFLDPPYLPVGKYSDFKRYTKEQFYEEDHIELAQEVDRLHELGCYVILTNS-------NHPLVHELYGKYAISVHKTRRNINSDASKR 268
>gi|83590572|ref|YP_430581.1| DNA adenine methylase [Moorella thermoacetica ATCC 39073] >gi|83573486|gb|ABC20038.1| DNA adenine methylase [Moorella thermoacetica ATCC 39073] (270 aa)
Score = 477, Expect = 5.7e-46, Identities = 112/294 (38%), Positives = 163/294 (55%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           V+PFLKW GGK QLL +++          ++Y EP VGGGA+ F +   Y +    ++D+N ELINVY V++  V+ELI  L+        R+ + R++YY I+          +  +   V +A+  I+LN+TC+NGLYRVN+   FNV  G YKNP I +   L A S  L+  ++  GD+    E+     F+YFDPPY+P+  TS FT+Y    F +  QK LA    +L  +G  ++LSNSD            E+Y  + I+ V+A+R INS    RG I EL+I N+
  S:     7 VRPFLKWAGGKGQLLEQLQPLL---PQNYSRYLEPMVGGGALFFYLQPAYAI----LADLNDELINVYRVVRDNVEELIADLR--------RHRNIREYYYAIRGT--------DPARLPPVARASRFIYLNRTCYNGLYRVNRLNKFNVPFGRYKNPDIVNAAGLRAASWALQAADLRAGDFSLVLEYARPGDFIYFDPPYQPLNRTSRFTSYTAGNFGEGEQKRLARVFRELTRRGCLVMLSNSD-------TPLIRELYRGFRIETVQARRAINSRPDRRGSITELVILNY 270
>gi|161529007|ref|YP_001582833.1| DNA adenine methylase [Nitrosopumilus maritimus SCM1] >gi|160340308|gb|ABX13395.1| DNA adenine methylase [Nitrosopumilus maritimus SCM1] (280 aa)
Score = 476, Expect = 7.6e-46, Identities = 116/293 (39%), Positives = 179/293 (61%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKN--VNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           KPF+KW GGK QL+  + +  P        Y EPF+GGGA+LF +L++   ++  ISD+N++L+  Y+ I+ ++ +LI  L+  EK++   + D + +YY ++          E N   ++EK + ++FLN+TCFNGLYRVN KG FNV +G Y NP I +  NL ++S  L++  V+I   D+        K   VYFDPPY+P++ T++FT+Y    F D++ + LAD  NKL++KG K+LLSNSD K    +D F  +   ++ + +V+A R INS+   R    ELLI N+
  S:     7 KPFVKWAGGKRQLIPILNENLP---KTFGTYYEPFIGGGALLFHILTERNNQKCSISDLNSDLVLAYTTIRNRIDDLISSLKNHEKNY---HKDSKSYYYSVR----------ESNPRSEIEKTSRLLFLNRTCFNGLYRVNSKGKFNVPLGRYTNPNIVNEENLRSVSAILQSSKVSIKCRDFGAVLRDAKKGDLVYFDPPYQPVSDTANFTSYTNKDFTDKDLERLADLCNKLDSKGCKVLLSNSDSKQV--SDMFSGK---SWKVNKVQANRSINSNSKKRTGHFELLIKNY 280
>gi|162451049|ref|YP_001613416.1| site-specific DNA-methyltransferase [Sorangium cellulosum 'So ce 56'] >gi|161161631|emb|CAN92936.1| site-specific DNA-methyltransferase [Sorangium cellulosum 'So ce 56'] (295 aa)
Score = 476, Expect = 7.9e-46, Identities = 104/293 (35%), Positives = 160/293 (54%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +PFLKW GGK QLL   +++ P       +Y EPF+GG A+ F +    + K   ++D+NAELI+ Y  ++ +V E+I  L         R+  +   YY        ++++ +       E+AA  IFLNKT FNGLYRVN  G FNV  G Y  P IC+   L A S  L+ V +   D+++  +   +  FVY DPPY P++ST++FT+Y+   F  ++Q+ LA    +L+ +G +++LSNSD             +Y  + I RV A R IN+   +RG + E++I N+
  S:    18 RPFLKWAGGKGQLL---RQFQPLLPASYGRYFEPFMGGAALFFCL----QPKRATLTDVNAELIDCYRAVRDRVDEVIAALG--------RHAYEEAHYY--------KVRDVDPASLTLPERAARTIFLNKTGFNGLYRVNSAGRFNVPFGRYVKPAICNPPQLRACSAALQGVELEVRDFERVLDHAQEGDFVYLDPPYSPVSSTANFTSYSARGFGFRDQERLAALFAELDGRGVQVMLSNSDVPE-------IPPLYKRFKIDRVAALRSINAKSDARGRVGEIVIRNY 280
>gi|177664397|ref|ZP_02940199.1| DNA adenine methylase [Cyanothece sp. PCC 8801] >gi|196244763|ref|ZP_03143489.1| DNA adenine methylase [Cyanothece sp. PCC 8802] >gi|172076233|gb|EDT61645.1| DNA adenine methylase [Cyanothece sp. PCC 8801] >gi|196207507|gb|EDY02300.1| DNA adenine methylase [Cyanothece sp. PCC 8802] (279 aa)
Score = 474, Expect = 1.6e-45, Identities = 125/296 (42%), Positives = 180/296 (60%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVK--AKRMINSDGSSRGEINELLISNFD 349
           ++KPFLKW GGK QL+ EI +  P   N    Y E F+GGGA+ F +    +  +  I+D N ELIN Y VI+     LI  L+        ++ ++  ++Y I+    N+   K+ NQ  DVEKA+ +I+LNKTC+NGL+RVN +G FNV  G YKNP I +   ++A+S  LK   +NI+ GD+  +     K  FVY DPPY PI+ T+SFT Y+ + FN Q QK L   +++L+++G KILLSNS          F  E+Y+    K+VK  A R INS G+ RG+++E+L+ N+D
  S:     5 IIKPFLKWAGGKRQLIPEITQNMPKTYNN---YYEVFIGGGALFFSL----QPSQAVINDSNRELINCYQVIRDHPDALIEDLK--------KHQNNEDYFYQIRGLDRNK---KKYNQLSDVEKASRIIYLNKTCYNGLFRVNSQGQFNVPFGRYKNPDILNEAVIKAVSNYLKKNQINILNGDFATALSSAKKGDFVYLDPPYDPISDTASFTGYDINGFNQQEQKRLKQVVDELHDRGCKILLSNS-------YTDFICELYNDDYYKQVKISAIRAINSQGNKRGKVDEILVKNYD 279
>gi|119489480|ref|ZP_01622241.1| putative adenine-specific DNA methyltransferase [Lyngbya sp. PCC 8106] >gi|119454559|gb|EAW35706.1| putative adenine-specific DNA methyltransferase [Lyngbya sp. PCC 8106] (293 aa)
Score = 462, Expect = 3.5e-44, Identities = 121/308 (39%), Positives = 181/308 (58%)
  Q:    42 LRQKVEINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKN--VNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIK-RVKAKRMINSDGSSRGEINELLISNFD 349
           L  +V  +    +V+PFLKW GGK QLL  +K++ P    +   Y EPFVGGGA LF++    + K++ I+D N ELIN Y VI+  V+ELI        + L R+ +   +YY ++        EK+      VE+A+ +I+LNKTC+NGL+RVN +G FNV  G YKNP I D   L+A+SK L +  V I+  D++ + +   K  F+YFDPPY P++ T+SFT Y+ + FN   Q+ L   +++L  KG  +LLSN+          F  ++Y  Y    +V A R INS+   RG ++E+L+ N++
  S:     8 LENRVSPSAKNPLVRPFLKWAGGKRQLLQVLKEHLP--PKKYKTYYEPFVGGGAFLFNL----QPKQVVINDSNRELINCYRVIRDSVEELI--------EDLGRHKNQEDYYYDMRGLDRKRSFEKKT----PVERASRIIYLNKTCYNGLFRVNSRGQFNVPFGRYKNPNILDISVLKAVSKYLNDNQVKILNKDFETAVKTAKKGDFIYFDPPYDPVSDTASFTGYDINGFNRNEQERLKATVDELTQKGCYVLLSNA-------YTDFIVDLYKDYKPHIKVSAIRAINSNAKKRGRVDEILVKNYE 293
>gi|152983140|ref|YP_001355137.1| DNA adenine methylase [Janthinobacterium sp. Marseille] >gi|151283217|gb|ABR91627.1| DNA adenine methylase [Janthinobacterium sp. Marseille] (634 aa)
Score = 452, Expect = 5.2e-43, Identities = 111/284 (39%), Positives = 156/284 (54%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIK---YKVKELIPVLQIMEKDF-LLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKS-EEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSR 337
           V +P LKW GGKTQLLN++    P       +Y EPF+GGGA+ F +     V    I+D N EL+N+Y  +      V+E +  L+  E+DF +LR  D   W  L                    + AA  IFLN+TCFNGLYRVNKKG FNV  G YKNPK+ D   LEA S+ L++  IV GDYK   +       F++ DPPY PI++ + F  Y K+ F +++  EL + + +L + G  ++L+NS       N     EIY  Y ++ +  KR I+S+G +R
  S:    15 VCRPLLKWAGGKTQLLNQLLPKVP---KSYGRYIEPFIGGGALFFSLAPSGAV----IADSNPELVNLYRTVGNDLLGVREHLATLKNTEEDFYILRALD---WTTLTP-----------------AQAAARTIFLNRTCFNGLYRVNKKGQFNVPFGRYKNPKLIDETTLEATSRLLRDTEIVCGDYKTVLQTHARTGDFIFLDPPYLPISAYADFKRYTKEQFYEEDHIELGNEVARLQDLGCHVVLTNS-------NHPLVHEIYGKYEVEVIPTKRYISSNGKNR 269
>gi|149006495|ref|ZP_01830194.1| Site-specific DNA-methyltransferase, putative [Streptococcus pneumoniae SP18-BS74] >gi|147761793|gb|EDK68756.1| Site-specific DNA-methyltransferase, putative [Streptococcus pneumoniae SP18-BS74] (295 aa)
Score = 451, Expect = 6.4e-43, Identities = 117/295 (39%), Positives = 178/295 (60%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD----VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKN--VNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           ++PF KW GGK QLL  I++  P   N   +Y EPFVGGGA+ FD+  K  V    I+D NAELIN Y  IK   +ELI +L++ ++        + K YYL       +L+  + ++ +D    V++AA ++++ +  FNGLYRVN K  FNV  G YKNPKI D   + AIS  L N  + I  GD++K+   +    FVYFDPPY P++ TS+FT+Y  + F+  +Q  L D   +L++ G  ++LSNS       + +  +E+Y  +NI  V+A R   +  SSRG+I+E++++N++
  S:    22 LQPFTKWTGGKRQLLPVIRELIPKTYN---RYFEPFVGGGALFFDLAPKDAV----INDFNAELINCYQQIKDNPQELIEILKVHQEY-------NSKEYYL-------DLRSADRDERIDMMSEVQRAARILYMLRVNFNGLYRVNSKNQFNVPYGRYKNPKIVDEELISAISVYLNNNQLEIKVGDFEKAIVDVRTGDFVYFDPPYIPLSETSAFTSYTHEGFSFADQVRLRDAFKRLSDTGAYVMLSNS-------SSALVEELYKDFNIHYVEATRTNGAKSSSRGKISEIIVTNYE 294
>gi|148998714|ref|ZP_01826152.1| Site-specific DNA-methyltransferase, putative [Streptococcus pneumoniae SP11-BS70] >gi|147755408|gb|EDK62457.1| Site-specific DNA-methyltransferase, putative [Streptococcus pneumoniae SP11-BS70] (295 aa)
Score = 449, Expect = 1.2e-42, Identities = 116/295 (39%), Positives = 178/295 (60%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD----VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKN--VNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           ++PF KW GGK QLL  I++  P   N   +Y EPFVGGGA+ FD+  K  V    I+D NAELIN Y  IK   +ELI +L++ ++        + K YYL       +L+  + ++ +D    V++AA ++++ +  FNGLYRVN K  FNV  G YKNPKI D   + AIS  + N  + I  GD++K+   +    FVYFDPPY P++ TS+FT+Y  + F+  +Q  L D   +L++ G  ++LSNS       + +  +E+Y  +NI  V+A R   +  SSRG+I+E++++N++
  S:    22 LQPFTKWTGGKRQLLPVIRELIPKTYN---RYFEPFVGGGALFFDLAPKDAV----INDFNAELINCYQQIKDNPQELIEILKVHQEY-------NSKEYYL-------DLRSADRDERIDMMSEVQRAARILYMLRVNFNGLYRVNSKNQFNVPYGRYKNPKIVDEELISAISVYINNNQLEIKVGDFEKAIVDVRTGDFVYFDPPYIPLSETSAFTSYTHEGFSFADQVRLRDAFKRLSDTGAYVMLSNS-------SSALVEELYKDFNIHYVEATRTNGAKSSSRGKISEIIVTNYE 294
>gi|169832516|ref|YP_001695217.1| modification methylase DpnIIA [Streptococcus pneumoniae Hungary19A-6] >gi|183603607|ref|ZP_02715977.2| modification methylase DpnIIA (Adenine-specificmethyltransferase DpnIIA) (M.DpnIIA) (M.DpnII 1) [Streptococcus pneumoniae CDC0288-04] >gi|183603772|ref|ZP_02720924.2| modification methylase DpnIIA (Adenine-specificmethyltransferase DpnIIA) (M.DpnIIA) (M.DpnII 1) [Streptococcus pneumoniae MLV-016] >gi|127388|sp|P04043|MTD21_STRPN Modification methylase DpnIIA (M.DpnIIA) (Adenine-specific methyltransferase DpnIIA) (M.DpnII 1) >gi|6729829|pdb|2DPM|A Chain A, Dpnm Dna Adenine Methyltransferase From Streptoccocus Pneumoniae Complexed With S-Adenosylmethionine >gi|153609|gb|AAA88580.1| DNA adenine methyltransferase [Streptococcus pneumoniae] >gi|153613|gb|AAA26872.1| DpnII DNA methylase >gi|168995018|gb|ACA35630.1| modification methylase DpnIIA [Streptococcus pneumoniae Hungary19A-6] >gi|183573872|gb|EDT94400.1| modification methylase DpnIIA (Adenine-specificmethyltransferase DpnIIA) (M.DpnIIA) (M.DpnII 1) [Streptococcus pneumoniae CDC0288-04] >gi|183578704|gb|EDT99232.1| modification methylase DpnIIA (Adenine-specificmethyltransferase DpnIIA) (M.DpnIIA) (M.DpnII 1) [Streptococcus pneumoniae MLV-016] (284 aa)
Score = 449, Expect = 1.3e-42, Identities = 116/295 (39%), Positives = 178/295 (60%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD----VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKN--VNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           ++PF KW GGK QLL  I++  P   N   +Y EPFVGGGA+ FD+  K  V    I+D NAELIN Y  IK   +ELI +L++ ++        + K YYL       +L+  + ++ +D    V++AA ++++ +  FNGLYRVN K  FNV  G YKNPKI D   + AIS  + N  + I  GD++K+   +    FVYFDPPY P++ TS+FT+Y  + F+  +Q  L D   +L++ G  ++LSNS       + +  +E+Y  +NI  V+A R   +  SSRG+I+E++++N++
  S:    11 LQPFTKWTGGKRQLLPVIRELIPKTYN---RYFEPFVGGGALFFDLAPKDAV----INDFNAELINCYQQIKDNPQELIEILKVHQEY-------NSKEYYL-------DLRSADRDERIDMMSEVQRAARILYMLRVNFNGLYRVNSKNQFNVPYGRYKNPKIVDEELISAISVYINNNQLEIKVGDFEKAIVDVRTGDFVYFDPPYIPLSETSAFTSYTHEGFSFADQVRLRDAFKRLSDTGAYVMLSNS-------SSALVEELYKDFNIHYVEATRTNGAKSSSRGKISEIIVTNYE 283
>gi|153165326|ref|ZP_01926277.1| hypothetical protein LMHG_01182 [Listeria monocytogenes FSL N1-017] >gi|133728359|gb|EBA30057.1| hypothetical protein LMHG_01182 [Listeria monocytogenes FSL N1-017] (289 aa)
Score = 445, Expect = 3.5e-42, Identities = 120/300 (40%), Positives = 177/300 (59%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKK-NRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKSEEFIDKNTFVYFDPPYRP-ITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAY--NIKRVKAKRMINSDGSSRGEINELLISNFDINKK 353
           +VKPF+KWVGGK QL++ I  Y P       +Y EPFVGGG+V       ++  +  I+D N ELINVY V++  V+ LI  L++        + + +++YY +++ +R   ++EK       +E+AA  I+LNKTC+NGL+RVN +G FNV  G YKNP I +   L A SK LK   + I+ GD++ + +   K  FVYFDPPY P +  T SF  Y  + F  + Q  L D   KL+ KG  ++LSNS  K          E+Y+ Y    + V A RM+NS  S RG+++E+LI N++  ++
  S:     9 LVKPFVKWVGGKKQLMDYINLYKP---KSFGRYYEPFVGGGSVFM----TFQHPKTTINDFNNELINVYEVVRDNVEILIQELKVHA------DNNSKEYYYELREWDRTGVMEEKNA-----IERAARFIYLNKTCYNGLFRVNSQGQFNVPYGQYKNPNIVNEEILRADSKFLKKSTIKIINGDFELAVKNAKKGDFVYFDPPYAPLVEDTQSFVGYTLNGFGYEEQARLRDLFVKLDKKGCYVMLSNSSSK-------IIHELYTDYAETTEIVGANRMVNSKSSGRGKVDEVLIMNYNYREQ 289
>gi|14327901|ref|NP_116733.1| LlaDCHIA [Lactococcus lactis] >gi|20981699|sp|P50179|MTL21_LACLC Modification methylase LlaDCHIA (M.LlaDCHIA) (M.LlaDCHI A) (Adenine-specific methyltransferase LlaDCHIA) (M.LlaII A) >gi|14251222|gb|AAK57808.1|U16027_3 LlaDCHIA [Lactococcus lactis] (284 aa)
Score = 439, Expect = 1.6e-41, Identities = 114/309 (36%), Positives = 185/309 (59%)
  Q:    40 LSLRQKVEINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKN--VNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++L QK +IN     ++PF KW GGK QLL  I+   P   N    + EPF+GGGA+ F++  +  V    I+D N+ELIN Y  +K   ++LI +L   +++       + K YYL  ++     ++   ++  +VE+AA ++++ +  FNGLYRVN K  FNV  G YKNPKI D   +E+IS+ L N  + I+ GD++K+ +      FVYFDPPY P++ TS+FT+Y  + F+ ++Q  L D   +L++KG  ++LSNS       +    +E+Y  +NI +++A R   +  SSRG+I E++++N+
  S:     1 MNLLQKNKIN-----LRPFTKWTGGKRQLLPHIQYLMPEKYNH---FFEPFIGGGALFFELAPQKAV----INDFNSELINCYRQMKDNPEQLIELLTNHQRE-------NSKEYYLDLRS---SDRDGRIDKMSEVERAARIMYMLRVDFNGLYRVNSKNQFNVPYGRYKNPKIVDKELIESISEYLNNNSIKIMSGDFEKAVKEAQDGDFVYFDPPYIPLSETSAFTSYTHEGFSYEDQVRLRDCFKQLDSKGVFVMLSNS-------SSPLAEELYKDFNIHKIEATRTNGAKSSSRGKITEIIVTNY 282
>gi|17227557|ref|NP_484105.1| site-specific DNA-methyltransferase [Nostoc sp. PCC 7120] >gi|17135039|dbj|BAB77585.1| site-specific DNA-methyltransferase [Nostoc sp. PCC 7120] (277 aa)
Score = 436, Expect = 3.8e-41, Identities = 113/293 (38%), Positives = 169/293 (57%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIK-KNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEF-IDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYS--AYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +PFLKW GGK++L+ +   + P        Y EPF+GGGA+ F +     +    ++DIN+ELI  Y  ++  ++ELI +L    KD   ++  +R +YY ++ K   NEL+E           AA  I+LNKTC+NGLYRVN +G FNV +G Y NP IC    L A S  L    I   D+ +  ++      FV+FDPPY PI+STS FT Y+K+ F +++Q  L +   +L ++G K+++ NSD +       F   IY    +NI  ++AKR INS+   RG + ELLI+++
  S:    12 RPFLKWAGGKSRLIPQYLSHLP---KNYRTYHEPFLGGGALFFYLQPSKSI----LTDINSELITTYRCVRDCIEELIGLL----KDH--KSQHNRDYYYSVRGKTVDNELEE-----------AARFIYLNKTCYNGLYRVNSQGRFNVPLGKYNNPNICQEDLLRAASNVLATSEIKQADFTQVLDYATGSEDFVFFDPPYYPISSTSYFTGYSKNSFGEKDQLILRNTCVELASRGVKVVVCNSDCE-------FIKNIYQEIGFNIYFIEAKRSINSNIKKRGLVKELLITSY 277
>gi|75908875|ref|YP_323171.1| DNA adenine methylase [Anabaena variabilis ATCC 29413] >gi|75702600|gb|ABA22276.1| DNA adenine methylase [Anabaena variabilis ATCC 29413] (277 aa)
Score = 432, Expect = 1.2e-40, Identities = 111/293 (37%), Positives = 165/293 (56%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIK-KNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEF-IDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYS--AYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +PFLKW GGK++L+ +   + P        Y EPF+GGGA+ F +     +    ++DIN+ELI  Y  ++ +++ELI +L+        +   +R +YY ++ K   NEL           E+AA  I+LNKTC+NGLYRVN +G FNV  G Y NP IC    L A S  L    I   D+ +   +      FV+FDPPY PI+STS FT Y+K+ F +++Q  L +   +L ++G K+ + NSD +       F   IY    +NI  ++AKR INS+   RG + ELLI+++
  S:    12 RPFLKWAGGKSRLIPQYLSHLP---KNYRTYHEPFLGGGALFFYLQPSKSI----LTDINSELITTYRCVRDRIEELISLLKEH------KGQHNRDYYYSVRGKTVDNEL-----------EQAARFIYLNKTCYNGLYRVNSQGQFNVPFGKYNNPNICQEDLLRAASNVLATSEIKQADFTEVLNYATGSEDFVFFDPPYYPISSTSYFTGYSKNSFGEKDQLILRNTCVELASRGVKVAVCNSDSE-------FIKNIYQEIGFNIYFIEAKRSINSNIKKRGLVKELLITSY 277
>gi|163813860|ref|ZP_02205254.1| hypothetical protein COPEUT_00013 [Coprococcus eutactus ATCC 27759] >gi|158450730|gb|EDP27725.1| hypothetical protein COPEUT_00013 [Coprococcus eutactus ATCC 27759] (639 aa)
Score = 431, Expect = 1.5e-40, Identities = 107/282 (37%), Positives = 156/282 (55%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKS-EEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSR 337
           KP +KW GGKTQ+L +I    P    +  KY EPF+GGGA+ F +     +    I+D N ELIN+Y  +   V+ +I         +L +  + ++ +Y ++   + +LK++E         AA  I+LNKTCFNGLYRVNKKG FNV  G YK P  CD  NL A S  LK   I  GDY    +E+ ++  F++ DPPY PI+  S F  Y K+ F +++  ELA  + +L   G  ++L+NS       N     E+Y+ Y I+ ++ KR I+ +GS R
  S:    14 KPIMKWAGGKTQMLGDIMPKIP---QKYGKYIEPFIGGGALFFALSPDKAI----IADSNPELINMYRQVADNVETVI--------SYLKKYKNTKEDFYEVRSLDWLKLKKEE--------AAARTIYLNKTCFNGLYRVNKKGQFNVPFGKYKAPNFCDEENLYAASDVLKKATITCGDYLSVLKEYAEQGDFIFLDPPYLPISEYSDFKRYTKEQFYEEDHVELAKEVKRLQELGCHVILTNS-------NHPLVHELYADYKIEVIQTKRYISCNGSKR 266
>gi|13541680|ref|NP_111368.1| site-specific DNA methylase [Thermoplasma volcanium GSS1] >gi|14325080|dbj|BAB60005.1| DNA adenine modification methylase [Thermoplasma volcanium GSS1] (277 aa)
Score = 429, Expect = 2.5e-40, Identities = 104/293 (35%), Positives = 165/293 (56%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           KP LKW GGK QL+  I +Y P    +   Y EPF+GG AVL  + SK  + +  +SD+N +L  +Y  IK +  ELI V++ +       N  +++  Y   ++ FNE  + +        ++AL+I+LNK  +NGLYR+N  GLFNV  G ++N       ++ ++S  L +  I+  D++K+    +   FVYFDPPY P++ TS+FT+Y +  F  ++Q  L D   +L+N+G  ++ +NSD +N         ++Y A+ I  V A+R INS+ S R    EL+I N+
  S:     9 KPVLKWAGGKRQLIPYIMRYVP---ERFKTYYEPFLGGAAVLIHLYSKGRISKAVVSDVNRDLYMLYKEIKERPIELISVMRSL-------NFQNKREDYYRARDLFNETSDYK-------LRSALLIYLNKHGYNGLYRLNSLGLFNVPFGRHRNTSFPSDQDILSLSNMLSSCTILNEDFEKAVAGAESGDFVYFDPPYVPLSKTSNFTSYTESGFTHKDQVRLKDVFIELSNRGVFVMETNSDTEN-------VRDLYKAFEIIGVPARRNINSNASRRNGATELIIRNY 277
>gi|160940912|ref|ZP_02088252.1| hypothetical protein CLOBOL_05804 [Clostridium bolteae ATCC BAA-613] >gi|158436156|gb|EDP13923.1| hypothetical protein CLOBOL_05804 [Clostridium bolteae ATCC BAA-613] (284 aa)
Score = 429, Expect = 2.5e-40, Identities = 113/293 (38%), Positives = 169/293 (57%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDD-RKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNP--KICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +PF+KW GGK QLL +IK   P H N    Y EPFVGGGAV FD+  +  +    I+DIN  LIN Y  IK   +E    +   +K    R  D  +++YY +++N  +++   E     D+E A L +FLNK CFNGLYRVN +GLFNV    Y N   + C   ++ A+S+ L+ V I+ GD++ + +  +K  FV+ D PY P+  T SF +Y K+ F+ ++ + LAD   +L  +G   +L+N        N  F +++Y+ +N   V  KRMINSD  +R    E++I+N+
  S:    16 QPFVKWAGGKRQLLEQIKARLPEHFN---GYMEPFVGGGAVYFDLQPEKSI----INDINESLINAYLQIKISPEEFADAISEYDK----RIADGGKEYYYKVRENYNDKMMRAE----YDMELAVLFVFLNKHCFNGLYRVNGRGLFNVP---YNNSVRESCSKESIMAVSQSLQKVKIMKGDFQNACDLAEKGDFVFIDSPYAPLNPT-SFESYTKEGFDIESHRRLADVFRELTERGCYCMLTN-------HNTDFINQLYADFNKVVVDVKRMINSDAKNRVG-QEIIITNY 284
>gi|125718517|ref|YP_001035650.1| site-specific DNA-methyltransferase, putative [Streptococcus sanguinis SK36] >gi|125498434|gb|ABN45100.1| Site-specific DNA-methyltransferase, putative [Streptococcus sanguinis SK36] (286 aa)
Score = 425, Expect = 6.9e-40, Identities = 113/295 (38%), Positives = 168/295 (56%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           ++PF KW GGK QLL E++ Y P       +Y EPFVGGGA+ FD+  +  V    I+D N ELIN Y  IK    ELI +L       +    ++ K YYL  ++     ++   ++   VE+AA ++++ +  FNGLYRVN K  FNV  G YKNPKI D   L  IS+ L   +V I+  D+ ++ +      FVYFDPPY P+  TSSFT+Y  + F+ + Q  L +   +L  +G   +LSNS       +    +E+Y  +NI  V+A+R   +  SSRG+I+E++++N+D
  S:    14 LQPFTKWTGGKRQLLGELRSYMP---ETFGRYFEPFVGGGALFFDLAPEKAV----INDFNEELINAYRQIKNNPAELINLL-------IKHKENNSKDYYLELRS---ADRDGRISRMTGVERAARILYMLRVDFNGLYRVNSKNQFNVPYGRYKNPKIVDVDLLYQISEYLNENDVEILQTDFAEAVKDAQTGDFVYFDPPYIPLNETSSFTSYTHEGFSYEEQVRLRNTFKELTERGVYAMLSNS-------SSPLVEELYKDFNIYFVEAQRTNGAKSSSRGKISEIIVTNYD 286
>gi|167760090|ref|ZP_02432217.1| hypothetical protein CLOSCI_02462 [Clostridium scindens ATCC 35704] >gi|167662215|gb|EDS06345.1| hypothetical protein CLOSCI_02462 [Clostridium scindens ATCC 35704] (639 aa)
Score = 423, Expect = 1.0e-39, Identities = 105/282 (37%), Positives = 156/282 (55%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKS-EEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSR 337
           KP +KW GGKTQ+L +I    P    +  KY EPF+GGGA+ F +     +    I+D N ELIN+Y  +   V+ +I         +L +  + ++ +Y ++   + +LK++E         AA  I+LNKTCFNGLYRVNKKG FNV  G YK P  CD   L A S+ LK   I  GDY    +E+++   F++ DPPY PI+  S F  Y K+ F +++  ELA  + +L   G  ++L+NS       N     E+Y+ Y I+ ++ KR I+ +G+ R
  S:    14 KPIMKWAGGKTQMLGDIMPKIP---QKYGKYIEPFIGGGALFFALSPDKAI----IADSNPELINMYRQVADNVENVIA--------YLKKYKNTKEDFYEVRSLDWLKLKKEE--------AAARTIYLNKTCFNGLYRVNKKGQFNVPFGKYKAPNFCDEEALYAASEVLKKATITCGDYLSVLKEYVEPGDFIFLDPPYLPISEYSDFKRYTKEQFYEEDHVELAKEVKRLQELGCHVILTNS-------NHPLVHELYADYKIEVIQTKRYISCNGNKR 266
>gi|14590870|ref|NP_142942.1| modification methylase (adenine-specific) [Pyrococcus horikoshii OT3] >gi|3257446|dbj|BAA30129.1| 330aa long hypothetical modification methylase (adenine-specific) [Pyrococcus horikoshii OT3] (330 aa)
Score = 423, Expect = 1.2e-39, Identities = 112/294 (38%), Positives = 176/294 (59%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELK---------------EKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISN 347
           + +P LKW GGK Q+L+ I    P  + +  ++ EPF GGGAV F +    E KE  I+DIN +LIN Y +++   +ELI   ++        + ++R++YY +++  +N+L                E E ++   +  A+L+++LNKT +NGLYR N+KG FNV  G YKNP+I D   L   S+ L+N+ I   D+    +   +   VYFDPPY+PI+ T+SFT Y+K+ F  ++Q  L D   +L+ +G   +LSNS      K    + +I   ++I  VKAKR+INS    RG ++E+L++N
  S:     1 MAEPVLKWAGGKRQILHYIVSLMP-SDYKDRRFHEPFFGGGAVTFWL----EPKEGTINDINPKLINFYIILRDYPEELIEDAKM--------HKNEREYYYRMRR-EYNKLALSSWFRDFVRRGFKVESEQDRRNAIRLASLLLYLNKTAYNGLYRENRKGEFNVPFGRYKNPRIVDEKRLREASRVLRNLEIYNTDFSYVLDKAKEGDLVYFDPPYQPISQTASFTDYSKEGFTYKDQIRLRDVCLELHRRGVYFILSNSSAPEIVK---LYKDI-PEFDIIIVKAKRVINSKADRRGPVDEILVTN 291
>gi|81427753|ref|YP_394752.1| putative adenine-specific DNA methyltransferase [Lactobacillus sakei subsp. sakei 23K] >gi|78609394|emb|CAI54440.1| Putative adenine-specific DNA methyltransferase [Lactobacillus sakei subsp. sakei 23K] (287 aa)
Score = 422, Expect = 1.6e-39, Identities = 113/300 (37%), Positives = 167/300 (55%)
  Q:    50 NNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKL--KNVNIVYGDYKKSEEFIDKNTFVYFDPPYRP-ITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKR--VKAKRMINSDGSSRGEINELLISNFD 349
           N   +VKPF+KW GGK QL+ +I KY P       +Y EPFVGGGAV F +    +  +  I+D N EL   Y+ ++  + ELI  L+I E +          +YY +++   N + + + N    VE+AA  IFLNKT FNGL+RVN +   N   G YKNP I + + L  +SK L    + I+ GD++ + +   +  F+YFDPPY P +    SF  Y  + F    Q+ L D +++L  KG K++LSNS       +  +  EIY+ Y      V A R INS  + RG+++E+LI N++
  S:     2 NKNPLVKPFVKWAGGKRQLIPQITKYMP---KTFGRYYEPFVGGGAVFFQL----QYNKSTINDFNTELFLAYNAVRDNIDELISNLKIHEAN------TSSDYYYEVREWDRNGIIDTKSN----VERAARFIFLNKTGFNGLFRVNSQNQINTPYGKYKNPAIVNEIVLRHVSKFLNKSTIKIINGDFEDAVKGARRGDFIYFDPPYAPMVNDRQSFVGYTLNGFGADEQERLRDLVDRLTAKGVKVMLSNS-------SVPYIHEIYANYKDTTVIVPASRSINSKATGRGKVDEVLIMNYN 282
>gi|167772754|ref|ZP_02444807.1| hypothetical protein ANACOL_04136 [Anaerotruncus colihominis DSM 17241] >gi|167665232|gb|EDS09362.1| hypothetical protein ANACOL_04136 [Anaerotruncus colihominis DSM 17241] (645 aa)
Score = 422, Expect = 1.6e-39, Identities = 113/302 (37%), Positives = 162/302 (53%)
  Q:    36 GTRILSLRQKVEINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKS-EEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSR 337
           G  + +L +K  I       KP LKW GGKTQ+LN++    P   +   +Y EPF GGGA+ F +  +  +    I+D N ELIN+Y  +   V ++I  L+  E      NT +R          F  ++ +E     + E AA  IFLN+TCFNGLYRVN+KG FNV  G YKNPKICD   L A ++ LK   IV  DY    E +     FV+ DPPY PI+  + F  Y K+ F +++  ELA  +  L+ +G  +LL+NS       N     E+Y+ + I  ++ KR I+ +G++R
  S:    14 GREVRTLAEKAGIQ-----AKPILKWAGGKTQMLNDLLPKVP---DSYGRYIEPFFGGGAMFFALHPENAI----IADSNPELINLYRQVAGHVDDVIAYLEKYE------NTPER----------FYSVRGQEWLALPEAEAAARTIFLNRTCFNGLYRVNRKGQFNVPYGKYKNPKICDREGLYAAAEALKAAEIVCSDYLPVLEHYARPGDFVFLDPPYLPISEYADFKRYTKEQFYEEDHVELAKMVIHLHERGCHVLLTNS-------NHPLVHELYAPFTIDVIQTKRHISCNGNTR 281
>gi|152991005|ref|YP_001356727.1| adenine-specific DNA methyltransferase [Nitratiruptor sp. SB155-2] >gi|151422866|dbj|BAF70370.1| adenine-specific DNA methyltransferase [Nitratiruptor sp. SB155-2] (286 aa)
Score = 420, Expect = 2.4e-39, Identities = 105/293 (35%), Positives = 163/293 (55%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSK--YEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD-VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSN-SDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           KPF+KW GGK  +  ++ +  P       +Y EPF+GGGA  F++ ++   E K++++SD N+EL+N + V++ +++ LI  L    KDF      +   YY I+          ED   +D V +AA  I+LNKTC+NGLYRVN KG FNV MG +K P ICD   L    + L+ V I   D+ K+ E +   +FVY DPPY      + F +Y K LF  ++ ++LA   + L++K    + SN + PK  D        +Y  Y I  +K   +IN++   R ++ E++I+N+
  S:     6 KPFVKWAGGKKTIAKKLAQMVPL---DFCEYHEPFLGGGAFFFELYNQGILEGKKVFLSDRNSELVNAFQVVQKRIEPLIETL----KDF--SKMHNEALYYEIR-----SWDRSEDFFSIDPVTRAARFIYLNKTCYNGLYRVNSKGHFNVPMGKHKKPNICDKETLYKAHEALQGVVIECCDFTKALEKVGPKSFVYLDPPYLSQGHNAGFASYTKQLFLYESHQKLAHICHALDSKKVYWMQSNIAHPKIID--------LYEKYGITMIKKSHIINANAKKREKVQEIVITNY 280
>gi|124515924|gb|EAY57433.1| Site-specific DNA methylase [Leptospirillum sp. Group II UBA] (634 aa)
Score = 414, Expect = 1.3e-38, Identities = 95/282 (33%), Positives = 148/282 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSR 337
           +P LKW GGKTQLL EI+   P    +  +Y EPFVGGGA+ F +     V    I+D N ELIN+Y  +   V+ +I  L+        +  +D + +Y ++   +  +   E         AA  +FLN+T +NGLYRVN+ G FNV  G YKNP + D   LEA    L +  I+  D+++    I +   F++ DPPY P++  + F  Y  D F+  +   LA+ I +L+ +G  ++L+N+       N  F  E Y A+ ++ +  +R I++ G  R
  S:    16 RPLLKWAGGKTQLLGEIRARMP---ARYRRYIEPFVGGGALFFSLRPAGGV----IADKNPELINLYRAVSRDVRGIIRQLR--------QYRNDEEEFYAVRLQNWQAMSPSE--------AAARTLFLNRTGYNGLYRVNRAGRFNVPFGRYKNPLVVDEEALEAAKALLSDTTILCADFREVLSDIARPGDFLFLDPPYLPVSRYADFRRYTPDPFSLDDHAALANEIERLHARGCHVILTNA-------NHPFVHEAYRAFTVEVLPTRRSISAVGKGR 268
>gi|16082545|ref|NP_394115.1| site-specific DNA methylase [Thermoplasma acidophilum DSM 1728] (280 aa)
Score = 414, Expect = 1.5e-38, Identities = 110/295 (37%), Positives = 166/295 (56%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDI 350
           +P LKW GGK QLL  + KY P   N    Y EPF+GG A+L  + S  ++K   +SD N +L N+Y  +K    +LI  L    KD   +N  +R+ YY   ++ FN  ++        V+++AL+I+LN+  +NGLYRVN +  FNV  G Y NP++  + N+ A S  LK+  I+  D++ +     +  FVYFDPPY P+  TS FT Y    F++++Q+ L     +L+ +G  ++ SNS  +       F  E+Y  + I  V AKR INS G+ R  I EL+I+N+D+
  S:    10 RPILKWAGGKRQLLPILLKYSPAKFN---TYYEPFIGGAALLISLYSLNKIKSAVVSDTNKDLYNLYKTMKENPLKLIAAL----KDLKFKN--NREDYYE-ARSLFNSTEDP-------VKRSALLIYLNRHGYNGLYRVNSENKFNVPFGRYSNPRMPSSENIMAFSNILKSCTILNLDFEMAVSHATRGDFVYFDPPYMPLNRTSYFTEYTNSGFDEKDQERLFRVYYELSKRGVYVMESNSSTE-------FIKELYKDFCIIEVDAKRNINSIGNRRNGIKELIITNYDV 280
>gi|119953253|ref|YP_945462.1| adenine-specific methyltransferase [Borrelia turicatae 91E135] >gi|119862024|gb|AAX17792.1| adenine-specific methyltransferase [Borrelia turicatae 91E135] (283 aa)
Score = 413, Expect = 1.5e-38, Identities = 116/294 (39%), Positives = 167/294 (56%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++P LKW GGK  LL+ I    P   N    Y EPFVGGGA+ F +     VK   I+DIN+ LIN Y  I Y + + +  L+I + +    N    K YY+  +N FN      +    ++EKA + ++LNKTC+NGLYR N  G FN   G +K   + +  NL+  SK L+ V ++  D+    +FI K+ FVY DPPY P + TS+FT+Y+K  F+ +  ++L  + +K++ KG K LLSNS+  +S        E+Y  YN+  V AKR INS+   RG I E+L+ NF
  S:    16 IRPILKWAGGKKNLLSSILDNIPLAFNN---YIEPFVGGGALFFAL----NVKNSIINDINSNLINFYREIAYNLDDFL--LEIEKYN----NAPLTKEYYVHIRNSFN------NENLTNLEKACIFLYLNKTCYNGLYRENGNGKFNTPFGKHKKISLYEIKNLQLASKLLREVKVLNLDFFCLLDFIKKDDFVYLDPPYIPYSKTSNFTSYSKYGFDFRMHEKLLQFCDKIDKKGAKFLLSNSNTASS-------LELYKNYNVTFVDAKRFINSNPIRRGSIREILVKNF 283
>gi|146295677|ref|YP_001179448.1| DNA adenine methylase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409253|gb|ABP66257.1| DNA adenine methylase [Caldicellulosiruptor saccharolyticus DSM 8903] (290 aa)
Score = 413, Expect = 1.5e-38, Identities = 110/296 (37%), Positives = 179/296 (60%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKE----DNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           Q V P +KW GGK Q++  + +  P H    + Y EPF+GGGA+L ++ +K  +K   +SDIN ELIN+Y+ IK    E++  +    K+   +N +D    Y   +  +N +K K     +N+  ++ KA L+++LN+ C+NGLYRVN KG FNV  G YKNPK+  +  + A S+ L++V I++ D++++ +   +  FVYFDPPY P++ T++FT Y    F+   Q  L +  + L+ KG  +++SNSD +       F  ++Y  YNI+ ++AKR+INS    R    E++I+N+
  S:    10 QKVVPIVKWAGGKRQIIKSLLEKLPSH---FSTYFEPFLGGGALLIELYNKGILKNAVVSDINLELINLYTAIKNCPDEVVYYI----KNLDFKNAEDD---YYKARELYNSIKIKNMGTIENE--NLLKAVLLLYLNRHCYNGLYRVNSKGEFNVPFGRYKNPKMPTSEEIFAFSEMLQSVEILHADFEEAVKKASEFDFVYFDPPYMPVSKTANFTDYTVAGFSKVEQVRLKNVCDNLSKKGCFVMISNSDSE-------FIRDLYRNYNIEVIEAKRLINSTAEKRTGHKEVIITNY 290
>gi|5420082|emb|CAB46541.1| putative adenine specific methyl transferase [Streptococcus thermophilus] (290 aa)
Score = 413, Expect = 1.8e-38, Identities = 119/303 (39%), Positives = 171/303 (56%)
  Q:    51 NLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDN----QFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKL--KNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAY--NIKRVKAKRMINSDGSSRGEINELLISNFDINKK 353
           N   +KPF KWVGGK QLL  +    P   ++   Y EPFVGGGA+ F++  K  V    I+D N EL+  Y VIK  V+ LI  L+  ++        + K YYL       EL+  + +    +  DVE+AA ++++ +  FNGLYRVN K  FNV  G YKNP+I D  NL  I+K L   ++ I+  D++++ +   K   VYFDPPY P+++T +FT+Y  D F    Q  L D   +L  +   ++L+NS  +          E+Y  Y   I  V A RMINS+   RG+INELLI+NF++  +
  S:     7 NKTTLKPFTKWVGGKRQLLANLLSLIP---SKFNNYFEPFVGGGALFFELAPKKAV----INDNNEELVLAYQVIKTDVELLIDELEKHKEK-------NSKEYYL-------ELRAADRDGRIEKMSDVERAARILYMLRVNFNGLYRVNSKNQFNVPYGKYKNPRILDEDNLRNINKYLNENDIAILNSDFEEATKTAKKGDLVYFDPPYVPLSATEAFTSYTADGFGYDEQVRLRDLFIELTEREVYVILANSSAE-------LVYELYEPYAKTILEVGATRMINSNAQKRGKINELLITNFEVQNE 289
>gi|67458515|ref|YP_246139.1| site-specific DNA adenine methylase [Rickettsia felis URRWXCal2] >gi|67004048|gb|AAY60974.1| Site-specific DNA adenine methylase [Rickettsia felis URRWXCal2] (299 aa)
Score = 412, Expect = 2.3e-38, Identities = 117/295 (39%), Positives = 157/295 (53%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++KPF+KW GGK  L+ E+    P   N    Y EPFVG GA+ F ++    +    ISDIN +LI  Y VIK + + LI +L     +        + +YY ++KN         DN    +E AA  I+LNKTC+NGLYRVN KG FNV MG Y NP I D  N+ A SK L+N  I+Y D+           FVY +PPY+PI  T SFT Y K  F + +Q +L +   +L+  G   +LSNSD         F   +Y +++I  V A R IN    SR   NE+LI N+
  S:    37 ILKPFIKWAGGKRSLIKELCLRLPASYNN---YYEPFVGEGALFFALVPDKTI----ISDINLDLIITYKVIKDEARALIELLAKHNAN------HSQDYYYAVRKN------ANSDNP---IEIAARFIYLNKTCYNGLYRVNSKGEFNVPMGAYINPNILDENNIIACSKALQNAEIIYQDFGNISP--KPKDFVYINPPYQPINHT-SFTKYTKLDFTEADQIKLYEKCRELHKNGVYFMLSNSD-------SDFIKNLYKSFSIDIVNAPRSINCKSDSRQRTNEVLIRNY 299
>gi|78224331|ref|YP_386078.1| DNA adenine methylase [Geobacter metallireducens GS-15] >gi|78195586|gb|ABB33353.1| DNA adenine methylase [Geobacter metallireducens GS-15] (638 aa)
Score = 408, Expect = 6.2e-38, Identities = 102/287 (35%), Positives = 148/287 (51%)
  Q:    51 NLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKS-EEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSR 337
           +L   +P LKW GGK+QLL ++    P    +  +Y EPF GGGA+ F V    + ++  I+D N EL+N+Y  +   V  +I  L+        R+ +    +Y ++   + +L             AA  IFLN+TCFNGLYRVNK G FN   G Y NP+I D   L A S  L    IV GDYK    E      FV+ DPPY P+++ + F  Y K+ F +++  ELA  I +L+  G  ++L+NS       N+    E+Y  Y +  V+ KR I+ +G  R
  S:    15 DLSGCRPLLKWAGGKSQLLGQLLPKMP---KKYGRYIEPFFGGGALFFAV----KPEDAIIADSNPELVNLYQSVADNVDNVIRCLK--------RHNNTEDDFYKVRAQDWTKLSP--------ASAAARTIFLNRTCFNGLYRVNKSGQFNSPYGRYVNPRILDEEGLRAASYLLSKATIVLGDYKDVLREHARSGDFVFLDPPYLPVSAYADFKRYTKEQFYEEDHVELATEIARLHELGCYVILTNS-------NNPLVHELYGRYEMYVVETKRHISCNGQGR 272
>gi|47459180|ref|YP_016042.1| adenine-specific DNA methyltransferase [Mycoplasma mobile 163K] >gi|47458509|gb|AAT27831.1| adenine-specific DNA methyltransferase [Mycoplasma mobile 163K] (361 aa)
Score = 408, Expect = 6.5e-38, Identities = 118/294 (40%), Positives = 162/294 (55%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKL--KNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +KPF+KW GGKTQLLN ++K  P + N    Y EPFVGGGA+   +   + V    ISD N +LI+ Y   + K      V ++++     +N  +  +YY I+    N  KE   ++ L   KAA MI+LNK+CFNGLYRVN KG FNV  G YK     D    + +++      V I+  DYKK         FVY DPPY  +    +FT Y K+ F    QK LA+    L+ +G K++LSN        N  F +E+Y  YNIK + A+R INS  S RG+I E+LI+N+
  S:    86 LKPFVKWAGGKTQLLNVLEKEIPKNFN---TYFEPFVGGGALFLKLQPLHAV----ISDSNIDLISTYKSFQSKKNYKKMVHELLKH----QNNHNENYYYKIR----NLDKELNFDKELKYIKAARMIYLNKSCFNGLYRVNSKGFFNVPSGKYKRVNAYDEFLYKNLNEYFLKSKVKILNQDYKKVISLAKAGDFVYLDPPYDTLDEKKNFTTYTKNAFGKNEQKHLAETFKDLDKRGVKVMLSN-------HNTHFINELYKDYNIKVIHARRSINSSSSGRGKIEEVLITNY 359
>gi|52549266|gb|AAU83115.1| Site-specific DNA methylase [uncultured archaeon GZfos26F9] (280 aa)
Score = 407, Expect = 9.0e-38, Identities = 104/295 (35%), Positives = 167/295 (56%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIY-SAYNIKRVKAKRMINSDGSSRGEINELLISNFDI 350
           KPFL+W GGK +L+  + K+ P  F NN   +Y EPF+G G++ F    + +  +  +SD N +LI  Y  I+ +   +   L    +  LL N ++   YY   + R+N+         L + KAAL I+LN+TCFNG++RVN+ G FNV  G  + P +    +L  +S+ L    I++ DYK+  + + +  F+YFDPPY P+  TS FT Y K+ FN ++  ELA  +N LN KG  I++SN+D         +   +Y   +NI  ++  R I +DG  R ++ E++I+N+++
  S:    11 KPFLRWAGGKRRLVPFLVKHIPPDFSNNN--RYYEPFLGAGSLFF----RLKPFKAALSDNNQDLIECYRAIQKRPDLIAKYL----RQHLLNNCEN---YYYNMRKRYNKSP-------LSIAKAALFIYLNRTCFNGIWRVNESGEFNVPYGRIEIPPLPSKEDLLNVSQTLTKATIIHSDYKQVVKHVSEGDFIYFDPPYPPLNGTSFFTHYTKERFNKKDHAELASLVNMLNKKGCYIMVSNAD-------TPYIRGLYGDTFNIYELEVVRWIRTDG-KRYKVQEIVITNYEV 280
>gi|10639810|emb|CAC11782.1| probable site-specific DNA-methyltransferase (adenine-specific) [Thermoplasma acidophilum] (268 aa)
Score = 402, Expect = 3.4e-37, Identities = 108/292 (36%), Positives = 164/292 (56%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDI 350
           +KW GGK QLL  + KY P   N    Y EPF+GG A+L  + S  ++K   +SD N +L N+Y  +K    +LI  L    KD   +N  +R+ YY   ++ FN  ++        V+++AL+I+LN+  +NGLYRVN +  FNV  G Y NP++  + N+ A S  LK+  I+  D++ +     +  FVYFDPPY P+  TS FT Y    F++++Q+ L     +L+ +G  ++ SNS  +       F  E+Y  + I  V AKR INS G+ R  I EL+I+N+D+
  S:     1 MKWAGGKRQLLPILLKYSPAKFN---TYYEPFIGGAALLISLYSLNKIKSAVVSDTNKDLYNLYKTMKENPLKLIAAL----KDLKFKN--NREDYYE-ARSLFNSTEDP-------VKRSALLIYLNRHGYNGLYRVNSENKFNVPFGRYSNPRMPSSENIMAFSNILKSCTILNLDFEMAVSHATRGDFVYFDPPYMPLNRTSYFTEYTNSGFDEKDQERLFRVYYELSKRGVYVMESNSSTE-------FIKELYKDFCIIEVDAKRNINSIGNRRNGIKELIITNYDV 268
>gi|187918330|ref|YP_001883893.1| modification methylase LlaDCHIA [Borrelia hermsii DAH] >gi|119861178|gb|AAX16973.1| modification methylase LlaDCHIA [Borrelia hermsii DAH] (272 aa)
Score = 400, Expect = 5.4e-37, Identities = 110/294 (37%), Positives = 162/294 (55%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++P LKW GGK  LL  I    P   N    Y EPFVGGGA+ F +     +K   I+DIN+ LIN Y  I Y +   +  L++ + +    N    K +Y+  +N FN      +    ++EKA + ++LNKTC+NGLYR N  G FN   G YK   + +  NL+  SK L+ V ++  D+    +FI K+ FVY DPPY P + TS+FT Y++  F+ +  ++L  +  +++ KG K LLSNS       N +F   +Y  YN+  V +KR IN++   RG I E+L+ NF
  S:     5 IRPVLKWAGGKKNLLKVILNNIPLSFNN---YIEPFVGGGALFFAL----NLKNSIINDINSNLINFYREIAYNLDNFL--LEVEKYN----NAPLTKEHYVHIRNSFN------NEDLTNLEKACIFLYLNKTCYNGLYRENGDGRFNTPFGKYKKISLYEIKNLQLASKLLREVKVLSLDFFCLLDFIKKDDFVYLDPPYIPYSKTSNFTNYSRYGFDVRMHEKLLHFCEEIDKKGAKFLLSNS-------NTAFSLGLYKNYNVAFVDSKRFINANPGGRGSIREILVKNF 272
>gi|166032269|ref|ZP_02235098.1| hypothetical protein DORFOR_01972 [Dorea formicigenerans ATCC 27755] >gi|166027992|gb|EDR46749.1| hypothetical protein DORFOR_01972 [Dorea formicigenerans ATCC 27755] (277 aa)
Score = 397, Expect = 1.1e-36, Identities = 111/294 (37%), Positives = 168/294 (57%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIY--SAYNIKRVKAKRMINSDGSSR-GEINELLISNF 348
           V PF+KW GGK QL+ +IK+  P    Q   Y EPFVGGGAV F++L    +    I+DIN  LIN Y  I    +  +  +  ++K+      D +K+YY ++++  ++L + E     DVE AAL +F+NK CFNGLYRVN KGLFNV   + +   + + + +E  SK L+ V I+ GD++ + +   K  F++ D PY P+  T SF +Y K+ F+ ++ + LA   ++L  +    +L+N        N    +E+Y    Y I  V  KRMINSD S+R GE  E++I N+
  S:     6 VAPFVKWAGGKRQLIPQIKERMP---KQYKDYYEPFVGGGAVAFELLPTNAL----INDINKALINAYKQICNAPEAFLRAVNKLDKEMW---EDGKKYYYSLREHYNDKLMKAE----YDVELAALFVFINKHCFNGLYRVNGKGLFNVPYNNSRRASVDEEVIMET-SKYLQGVTIIDGDFEVACKDAKKGDFIFIDSPYAPLNPT-SFESYTKEGFDIESHRRLAKLYDELTARDCYCMLTN-------HNTELINELYGNKGYKIDVVSVKRMINSDASNRVGE--EVIICNY 277
>gi|162447938|ref|YP_001621070.1| DNA methylase, N6 adenine-specific [Acholeplasma laidlawii PG-8A] >gi|161986045|gb|ABX81694.1| DNA methylase, N6 adenine-specific [Acholeplasma laidlawii PG-8A] (275 aa)
Score = 393, Expect = 3.5e-36, Identities = 116/293 (39%), Positives = 169/293 (57%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIK--YKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD-VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFID---KNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           P LKWVGGK Q+L+ IK+  P+H N    Y EPFVG GAVLF+    +     YI+D+N +LI+VY  ++   + K+L+  L   EK+       +  +YY ++     E+   E    L+  EKAA +I+LNK  FNGLYRVNKKG +NV  G     K+ D  N+ +I   L++ N VY +    EE +    K+ FVYFDPPY P    +SFT+Y +  FN ++Q  L +    L+ +G K++LSN        N  F   +Y  Y I  V AKR++NS+ + RG + E++I N++
  S:     3 PVLKWVGGKRQMLSHIKELMPYHFN---AYYEPFVGAGAVLFE----FAPNVAYINDVNKDLISVYISLQDNEQFKKLLLKLDHHEKN------HNETYYYEVR-----EMDRLEGYSALEPFEKAARVIYLNKAGFNGLYRVNKKGFYNVPSGKRDKVKLYDLDNITSIHYYLRS-NEVYINNLDFEEVVKDAKKDDFVYFDPPYDPWEDKNSFTSYAQGDFNKEDQIRLFETFKALDKRGVKVMLSN-------HNTDFIRNLYKDYKIHVVPAKRVVNSNPNGRGNVEEVIIINYE 275
>gi|24378988|ref|NP_720943.1| putative site-specific DNA-methyltransferase [Streptococcus mutans UA159] >gi|24376879|gb|AAN58249.1|AE014896_5 putative site-specific DNA-methyltransferase [Streptococcus mutans UA159] (285 aa)
Score = 388, Expect = 1.3e-35, Identities = 108/295 (36%), Positives = 161/295 (54%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           ++PF KW GGK QLL  ++ Y P   N    Y EPF+GGGA+ FD++ +  V    I+D N EL+N Y  IK     LI +L         +  + +++Y  ++    NE   +      DVE+AA ++++ +  FNGLYRVN K  FNV  G YKNPKI D   +  IS  L   ++ I+  +++++     K  FVYFDPPY P+  TSSFT+Y  + F  + Q  L +   +LN KG  ++LSNS       +     ++Y  YNI  V A R   +   SR +I E++++N+D
  S:    12 LQPFTKWTGGKRQLLPILRSYMPEKYNC---YFEPFIGGGALFFDLVPEKAV----INDFNEELMNTYRQIKNNPTALIELLTEH------KEKNSKEYYLKVRAADRNETITRMS----DVERAARLMYMLRVDFNGLYRVNSKNQFNVPYGKYKNPKIIDRELIYQISDYLNENDIQILNTNFEEAVSNAKKGDFVYFDPPYIPLNETSSFTSYTHEGFTYEEQLRLRNVFEQLNRKGIYVMLSNS-------SSPLALDLYQDYNIHFVDAVRTNGAKTESRKKIKEIIVTNYD 284
>gi|153894635|ref|ZP_02015219.1| DNA adenine methylase [Halorubrum lacusprofundi ATCC 49239] >gi|151587233|gb|EDN50656.1| DNA adenine methylase [Halorubrum lacusprofundi ATCC 49239] (306 aa)
Score = 385, Expect = 2.9e-35, Identities = 102/294 (34%), Positives = 162/294 (55%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELI--------------PVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIY--SAYNIKRVKAKRMINSDGSSRGEINELLISN 347
           + +P LKW GGK QLL+E+   +P       +Y EPFVGGGAV FD+    E  +  ++D N  L+N Y  ++ + + LI              P L   E+    R+ +    YY  ++ RFN  +   + +F  +E+AAL+++LN+TC+NGLYR N  G FNV +G Y NP       +   S  L +  I   D+    +  +    VYFDPPY P+++T+SF  Y+ + F+  +Q+ L D   +L+  G +++LSNS             E Y  + +++    A R INSD  +R E++E++ +N
  S:     1 MAEPILKWAGGKRQLLDELYARFP---ATYGRYHEPFVGGGAVFFDL----EPTDATVNDANPRLVNFYERVRDEPEALIERLESFDDPDADPGPALPYAEETARDRDVES---YYYQQRARFN--RRPYEGEFDSLEEAALLLYLNRTCYNGLYRENADGGFNVPVGRYANPDWVQRDRIRRASDALTDATIRNDDFAYVLDAAEPGDLVYFDPPYEPMSATASFNEYSAEGFDRDDQRRLLDVAAELDEAGVRVVLSNS---------GVMYEPYAEAGFSVDIEGATRAINSDAGNRDEVDEIVATN 289
>gi|148508076|gb|ABQ75872.1| modification methylase (adenine-specific) [uncultured haloarchaeon] (309 aa)
Score = 384, Expect = 4.1e-35, Identities = 113/291 (38%), Positives = 164/291 (56%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIME---------KDFLLRNTDDR--KWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISN 347
           P LKW GGK QLL+E+ K +P    + T Y EPF GGGA+ FD+    E     I+D N+ LIN Y+ ++   ++LI  LQ  +         +DF   N   R  K Y+  ++  FN     +D  +  +E+AAL+++LN+TC+NGLYR N+ G FNV +G Y NP       +   S  L   +I   D+    +  +    VYFDPPY P++ T++FT Y+ D F   +Q+EL D   KL+  G  I+LSNS       ND+ F       NI+   A R INSDG +R E++E++ +N
  S:     4 PVLKWAGGKRQLLDELYKRFP---QEYTHYHEPFFGGGALFFDL----EPVNGTINDTNSRLINFYTQVRNHPEDLIERLQEFDDPESDPNPKRDFSKTNRKGREIKNYFYQQRELFNNRPYGDD--YDPLEEAALLLYLNRTCYNGLYRENRSGGFNVPIGRYSNPDWVRADEIRNASDILSGTDIHNTDWSYVIDEAEPGDLVYFDPPYEPMSPTANFTDYSADGFGKDDQQELCDAAVKLSENGVNIILSNSGVMYEMYNDAGF-----TVNIE--GATRAINSDGENRDEVDEIIATN 289
>gi|12082215|dbj|BAB20839.1| DNA adenine methylase M.SsuMA [Streptococcus suis] (208 aa)
Score = 379, Expect = 1.6e-34, Identities = 93/221 (42%), Positives = 135/221 (61%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKL--KNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFND 275
           +KPF KW GGK +LL ++ ++ PF  N   +Y EPFVGGGA+ FD+  +  V    I+D N ELIN Y  I+   + L+ +L I +++       + K YYL  ++     ++       DVE+AA ++++ +  FNGLYRVN K  FNV  G YKNPKI D+  + ++S+ L   N+ I+ GD+  + E  D   FVYFDPPY PIT+TSSFT+Y  + F+D
  S:     3 LKPFTKWTGGKRKLLTQLHEHLPFEYN---RYFEPFVGGGALFFDLAPENAV----INDFNEELINTYLQIRDNPEALLDLLHIHQEN-------NSKEYYLDVRSVD---RDGRIETMSDVERAARILYMLRVDFNGLYRVNSKNQFNVPYGRYKNPKIVDSELILSVSRYLNDNNILIMQGDFVTAVEEADAGDFVYFDPPYVPITATSSFTSYTHEGFSD 208
>gi|157953891|ref|YP_001498782.1| hypothetical protein AR158_C701R [Paramecium bursaria Chlorella virus AR158] >gi|156068539|gb|ABU44246.1| hypothetical protein AR158_C701R [Paramecium bursaria Chlorella virus AR158] (345 aa)
Score = 374, Expect = 6.2e-34, Identities = 115/284 (40%), Positives = 158/284 (55%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVL-SKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSD--GSSRGEI 340
           PFLKWVGGK +L+++I K++P   N I  Y EPF+GGG+VL  VL S   +K+I  +D+NA L+  Y  I+   +ELI  L+       L+N DD    Y   +  FNELK+  +NQF  V+ +AL I+LNKTCF GLYR    G FNV  GHYKNP   +   L   S K++NV      Y+     + ++ FVY DPPY P   T SFT YN   F D  Q  L   + KL     + ++SNS  +++          ++ + I  + A+R INS   GS+  EI
  S:    85 PFLKWVGGKQKLIDDIIKHFP---NNIDTYYEPFLGGGSVLLAVLNSDIRIKKIRANDLNAYLVQTYIDIRDNTEELISSLK------ELKNIDD----YYENRKLFNELKK--ENQF-SVKASALFIYLNKTCFRGLYREGPNG-FNVPFGHYKNPNWINADLLRVWSDKIRNVEFSCLPYQDFLNDVGEHDFVYLDPPYAPENKT-SFTKYNVSDFLDHEQ--LFSVVKKL----PRFVMSNSKTEHTLY-------AFAEFEIHEIVARRSINSKKPGSTTTEI 340
>gi|157148970|ref|YP_001456289.1| DNA adenine methylase [Citrobacter koseri ATCC BAA-895] >gi|157086175|gb|ABV15853.1| hypothetical protein CKO_04808 [Citrobacter koseri ATCC BAA-895] (278 aa)
Score = 372, Expect = 1.0e-33, Identities = 96/289 (33%), Positives = 161/289 (55%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  LL++IK++ P    +     EPFVG G+V  +   S+Y      ++DIN++LI++Y+++K + +E +       ++     T+  + YY +++  FN  +E          +A L ++LN+  +NGL R N +G FNV  G YK P   +T  L   +KK +N       Y++  +  D N+ VY DPPY P+++T++FTAY+ + F+ + Q  LA+   KL +K   +L+SN D  ++        E Y A    +VK +R I+S+G +R +++ELL
  S:     5 RAFLKWAGGKYPLLDDIKRHLP----KGECLVEPFVGAGSVFLNTDFSRY-----ILADINSDLISLYNIVKSRTEEYVRA----SRELFTPETNQAEVYYQLRE-EFNTSREP-------FRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPET-ELYHFAKKAQNAEFHCLSYEECMDRADSNSVVYCDPPYAPLSATANFTAYHTNSFSPKEQARLAEMAEKLVSKRIPVLISNHDTPDT-------REWYKAAKHFQVKVRRSISSNGGTRKKVDELL 265
>gi|157953078|ref|YP_001497970.1| hypothetical protein NY2A_B774R [Paramecium bursaria Chlorella virus NY2A] >gi|155123305|gb|ABT15173.1| hypothetical protein NY2A_B774R [Paramecium bursaria Chlorella virus NY2A] (345 aa)
Score = 371, Expect = 1.2e-33, Identities = 115/284 (40%), Positives = 157/284 (55%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVL-SKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSD--GSSRGEI 340
           PFLKWVGGK +L+++I K++P   N I  Y EPF+GGG+VL  VL S   +K+I  +D+NA L+  Y  I+   +ELI  L+       L+N DD    Y   +  FNELK+  +NQF  V+ +AL I+LNKTCF GLYR    G FNV  GHYKNP   +   L   S K+KNV      Y+     + ++ FVY DPPY P   T SFT YN   F D  Q      + KL     + ++SNS  +++          ++ + I  + A+R INS   GS+  EI
  S:    85 PFLKWVGGKQKLIDDIIKHFP---NNIDTYYEPFLGGGSVLLAVLNSDIRIKKIRANDLNAYLVQTYIDIRDNTEELISSLK------ELKNIDD----YYENRKLFNELKK--ENQF-SVKASALFIYLNKTCFRGLYREGPNG-FNVPFGHYKNPNWINADLLRVWSDKIKNVEFSCLPYQDFLNDVGEHDFVYLDPPYAPENKT-SFTKYNVSDFLDHEQ--FFSVVKKL----PRFVMSNSKTEHTLY-------AFAEFEIHEIVARRSINSKKPGSTTTEI 340
>gi|161613262|ref|YP_001587227.1| hypothetical protein SPAB_00972 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|161362626|gb|ABX66394.1| hypothetical protein SPAB_00972 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] (289 aa)
Score = 370, Expect = 1.7e-33, Identities = 97/291 (33%), Positives = 148/291 (50%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYS--AYNIKRVKAKRMINSDGSSRGEINELLIS 346
           +PFLKW GGK  LL E+ +  P     I    EPFVGGG+V  +   K+E     ++D+NA+LIN+Y ++      ++P   I E     R+ +D + Y +I++  FN  K          E+AA  ++LN+ CFNGL R N  G FNV  G YK P   +   + A  KK +    +   ++++         VY DPPY PI  T+ FT+Y    F+  +Q  LA+     + +G K+ +SNS             E+Y    + + RV A+R I+S GS+R   N+++ S
  S:    21 RPFLKWAGGKYSLLPELDRLIPAGKRLI----EPFVGGGSVFLNS-DKHE--RFLLADVNADLINLYQMLA-----VVPDSVIAEAIKAFRHLNDAENYTVIRE-AFNAKKLNA------TERAAAFLYLNRHCFNGLMRYNLDGFFNVGWGKYKAPYFPEE-EIRAFRKKSRACVFMTAGFERTLRLAGDGDVVYCDPPYEPIPGTTGFTSYASGGFSWDSQVALAESCVAAHQRGAKVFISNSTAPR-------VIELYERHGFTLHRVNARRSISSKGSTRETANDIVAS 286
>gi|16519218|gb|AAL25125.1|AF431889_1 type IIs modification methyltransferase M.AlwI [Acinetobacter lwoffii] (608 aa)
Score = 369, Expect = 1.9e-33, Identities = 106/269 (39%), Positives = 144/269 (53%)
  Q:    85 KYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKS-EEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSR-GEINELLISNFDINKK 353
           KY EPF GGGAV F +  +  V    I+D N ELIN+Y  +   V  +I  L+  E      NT++           F E++ ++      VE AA  I+LNKTCFNGLYRVNKKG FNV  G YKNPKI D  NL A S  L    IV  DY    E F   N  ++ DPPY PI+  S F  Y K+ F  ++ + LA     L++KG+ + L+NS       N S  + +Y  +  + ++ KR I+ D  +R GE  +++ISN   N+K
  S:    15 KYIEPFFGGGAVFFALQPENAV----IADSNPELINLYRTVADDVDAVIVELKKFE------NTEEM----------FYEVRSQDRENLSSVEAAARTIYLNKTCFNGLYRVNKKGQFNVPFGKYKNPKILDEDNLRAASILLSKAQIVCSDYLDVLENFAGPNDLIFLDPPYVPISEYSDFKRYTKEQFYLEDHENLAKAYKALSDKGSHVFLTNS-------NHSIVENLYHGFKYEVIQTKRHISCDSKTRKGE--DVIISNTQKNEK 256
>gi|46401691|ref|YP_006537.1| Dmt [Enterobacteria phage P1] >gi|33338718|gb|AAQ14041.1| Dmt [Enterobacteria phage P1] (754 aa)
Score = 361, Expect = 1.9e-32, Identities = 97/302 (32%), Positives = 151/302 (50%)
  Q:    43 RQKVEINNNLQVVKP-------FLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIY--SAYNIKRVKAKRMINSDGSSRGEINELL 344
           RQK       + VKP         KW GGK  +L +I +Y P    +  +  EPFVGGGAV     +    +E  ++D+NA+LIN Y  ++ +   LI +     +D+   NT +    YL  +N FN+        + D+ +AA  +FLN+ CFNGL R N+ G FNV  G YK P       +EA          V GD+    E   +   ++ DPPY P+ +T  FT Y+   F  + QK L   +   + +G K+L++NS   N         E+Y  S + ++ + A+R ++  G +RG  +++L
  S:   468 RQKEGSETKERKVKPAAEFERSIFKWAGGKFGVLEQIFRYLP----EGKRLIEPFVGGGAVF----TNAGYQENLLNDVNADLINFYKTLQREAHSLITLAHRFFQDY---NTQEG---YLAVRNAFNK------QVYDDLHRAAAFLFLNRHCFNGLTRYNQAGEFNVGYGKYKTPYF-PLQEMEAFLGAEGRSEFVCGDFAAVIEAAGEGDVIFCDPPYEPLPNTEGFTNYSGHDFKFEEQKRLVSLLTDAHRRGAKVLITNSGAPN-------IRELYHDSGFRVEPLFARRSVSCKGDTRGVAHDVL 750
>gi|16759876|ref|NP_455493.1| putative DNA methylase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29142351|ref|NP_805693.1| putative DNA methylase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|25314632|pir||AF0617 probable DNA methylase STY1014 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16502169|emb|CAD05408.1| putative DNA methylase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29137981|gb|AAO69542.1| putative DNA methylase [Salmonella enterica subsp. enterica serovar Typhi Ty2] (293 aa)
Score = 357, Expect = 4.7e-32, Identities = 95/291 (32%), Positives = 146/291 (50%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYS--AYNIKRVKAKRMINSDGSSRGEINELLIS 346
           +PFLKW GGK  LL E+ +  P     I    EPFVGGG+V  +   K+E     ++D+NA+LIN+Y ++      ++P   I E     R+ +D + Y +I++  FN  K          E+AA  ++LN+ CFNGL R N  G FNV  G YK P   +   + A  +K      +   ++++         VY DPPY P+  T+ FT Y    F+  +Q  LA+     + +G K+ +SNS             E+Y    + + RV A+R I+S GS+R   N+++ S
  S:    25 RPFLKWAGGKYSLLPELDRLIPAGKRLI----EPFVGGGSVFLNS-DKHE--RFLLADVNADLINLYQMLA-----VVPDSVIAEAMKAFRHLNDAENYTVIRE-AFNAQKLNA------TERAAAFLYLNRHCFNGLMRYNLDGFFNVGWGKYKAPYFPEE-EIRAFRQKSHACVFMTAGFERTLRLAGDGDVVYCDPPYEPMPGTAGFTNYASGGFSWDSQVALAESCVAAHQRGAKVFISNSTAPR-------VIELYERHGFTLHRVNARRSISSKGSTRETANDIVAS 290
>gi|94987094|ref|YP_595027.1| DNA adenine methylase [Lawsonia intracellularis PHE/MN1-00] >gi|94731343|emb|CAJ54706.1| DNA adenine methylase [Lawsonia intracellularis PHE/MN1-00] (271 aa)
Score = 356, Expect = 6.7e-32, Identities = 99/293 (33%), Positives = 152/293 (51%)
  Q:    52 LQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYG--DYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +Q+VKPFLKW GGK +LL+ I  + P    Q  +  EPFVG GAV  +       KE  I D + +LI ++ V++ + +  I + Q     F  R  +   +Y L  +  FN       +     E+A L ++LN+  FNGL R N  GLFNV  G Y NP       +EA  KK+K  +I +   D++ + + +     VY DPPY P+++TS+FT Y+  +F+  +QK+LA+   K + +G  ++LSN D   +        E+YS   I     +R I+ +G  R    EL+
  S:     1 MQLVKPFLKWPGGKFRLLDRILYHLP----QGERLIEPFVGSGAVFLNA----SFKEFCIYDSSPDLIGLFQVLQQEGEFFIKICQTF---FTTRYNNANTYYTL--RTIFN-------HSIHPFERAVLFLYLNRHSFNGLVRYNSMGLFNVPFGRYNNPYFPKK-EMEAFLKKMKETSITFAVCDFRDAFKNLYPGDVVYCDPPYLPLSNTSNFTTYSGTVFSYDDQKDLANLAYKASEQGIPVVLSNHDTPVT-------RELYSMAKIDCFSVQRFISCNGKDRRAAPELM 267
>gi|168262797|ref|ZP_02684770.1| putative phage gene [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] (286 aa)
Score = 354, Expect = 1.1e-31, Identities = 91/291 (31%), Positives = 155/291 (53%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNP-----KICDTLNLEAISKKLKNVNIVYGDYKKSEEFI-DKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLI 345
           VK  LKWVG K +L+ +++ + P    +  +  EPF G  AV+ +     +  E  I+D+N +L+N+Y  + Y    L+  L+I+     L + + R  +Y   ++ FN+  +   ++   VE AA  ++LN+ CFNGL R N++G FNV  G YK P     +IC      A ++K K    +   Y ++ + + D N  VY DPPY  +T + +FTAY++  F+  +Q  LA  + +L  +G +++ SNSD +           +Y+ +N  RV A R + +  +S     EL++
  S:     3 VKTPLKWVGSKARLMPQLRPHLP----EGKRLVEPFAGSCAVMMNT----DYDEYLIADVNPDLVNLYKAMAYHTDALLNELEILFNAGSLGDEESRAVFYYAVRDAFNQSGKSFGSE--SVEAAARFLYLNRHCFNGLCRYNRRGQFNVPFGKYKKPYFPADEIC------AFAEKAKRATFITAHYSETLDLVRDGNDVVYCDPPY--LTDSDNFTAYHERGFSHMDQGRLARKLRRLAERGIQVVASNSDLE-------MVHYLYAGFNSVRVNAPRSVGAAAASPKMAAELIL 274
>gi|33323568|gb|AAQ07538.1|AF503408_62 Dam [Enterobacteria phage P7] (672 aa)
Score = 354, Expect = 1.2e-31, Identities = 97/302 (32%), Positives = 154/302 (50%)
  Q:    43 RQKVEINNNLQVVKP-------FLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIY--SAYNIKRVKAKRMINSDGSSRGEINELL 344
           RQK       + VKP         KW GGK  +L +I +Y P    +  +  EPFVGGGAV  +  + Y+  E  ++D+NA+LIN Y  ++ +   LI    +  + FL  NT +    +L  +N FN+        + D+ +AA  +FLN+ CFNGL R N+ G FNV  G YK P       +EA          V GD+    E   +   ++ DPPY P+ +T  FT Y+   F  + QK L   +   + +G K+L++NS   N         E+Y  S + ++ + A+R ++  G++RG  ++++
  S:   386 RQKEGSETKERKVKPAAEFERSIFKWAGGKFGVLEQIFRYLP----EGKRLIEPFVGGGAVFMN--AGYQ--ENLLNDVNADLINFYKTLQREAHSLI---TLAHRFFLDYNTLEG---FLAVRNAFNK------QVYDDLHRAAAFLFLNRHCFNGLTRYNQAGEFNVGYGKYKTPYF-PLQEMEAFLGAEGRSEFVCGDFAAVIEAAGEGDVIFCDPPYEPLPNTEGFTNYSGHDFKFEEQKRLVSLLTDAHRRGAKVLITNSGAPN-------VRELYQDSGFRVEPLFARRSVSCKGNTRGVAHDVM 668
>gi|168228855|ref|ZP_02654086.1| hypothetical protein Sententeric_24002 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] (289 aa)
Score = 354, Expect = 1.2e-31, Identities = 98/291 (33%), Positives = 150/291 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVY--GDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYS--AYNIKRVKAKRMINSDGSSRGEINELLIS 346
           +PFLKW GGK  LL E+ +  P     I    EPFVGGG+V  +   K+E     ++DINA+LIN+Y ++      ++P   I E     R+ +D + Y +I++  FN  K          E+AA  ++LN+ CFNGL R N  G FNV  G YK P   +    E  + +LK+   V+    ++++         VY DPPY P+  T+ FT+Y    F+  +Q  LA+     + +G K+ +SNS             E+Y    + + RV A+R I+S GS+R   N+++ S
  S:    21 RPFLKWAGGKYSLLPELDRLIPAGKRLI----EPFVGGGSVFLNS-DKHEY--FLLADINADLINLYQMLV-----VVPDSVIAEAMKAFRHLNDVENYTVIRE-AFNAQKLNA------TERAAAFLYLNRHCFNGLMRYNLDGFFNVGWGKYKAPYFPEE---EIRAFRLKSHACVFMTAGFERTLRLAGDGDVVYCDPPYEPMPGTAGFTSYASGGFSWDSQVALAESCVAAHQRGAKVFISNSTAPR-------VIELYEQHGFTLHRVNARRSISSKGSTRETANDIVAS 286
>gi|16762803|ref|NP_458420.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16766772|ref|NP_462387.1| DNA adenine methylase [Salmonella typhimurium LT2] >gi|29144290|ref|NP_807632.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|62181986|ref|YP_218403.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161616520|ref|YP_001590485.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167541656|ref|ZP_02337232.1| hypothetical protein Sentent_00180 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167549316|ref|ZP_02343075.1| hypothetical protein Sentente_02315 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167555280|ref|ZP_02348298.1| hypothetical protein Sententeri_00170 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167994589|ref|ZP_02575680.1| hypothetical protein Sententer_01000042_0100024289 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168220408|ref|ZP_02645640.1| hypothetical protein Senterenterica_08446 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168228756|ref|ZP_02653987.1| hypothetical protein Sententeric_23507 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168232617|ref|ZP_02657675.1| hypothetical protein Sententerica_16664 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168235074|ref|ZP_02660132.1| hypothetical protein Senteenterica_02724 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168241621|ref|ZP_02666553.1| hypothetical protein Senterienterica_08327 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168260799|ref|ZP_02682772.1| hypothetical protein Salmentericaenterica_06905 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168465252|ref|ZP_02699144.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168473511|ref|ZP_02702534.1| hypothetical protein Salmoentericaenterica_02530 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168818707|ref|ZP_02830707.1| hypothetical protein Salentericaenterica_04931 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194442408|ref|YP_002042734.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194448269|ref|YP_002047508.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194469016|ref|ZP_03075000.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194734864|ref|YP_002116427.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|61222551|sp|P0A291|DMA_SALTY DNA adenine methylase (M.StyDam) (Deoxyadenosyl-methyltransferase) (DNA adenine methyltransferase) >gi|61222552|sp|P0A292|DMA_SALTI DNA adenine methylase (M.StyDam) (Deoxyadenosyl-methyltransferase) (DNA adenine methyltransferase) >gi|25286095|pir||AF1000 site-specific DNA-methyltransferase (adenine-specific) (EC 2.1.1.72) - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16422042|gb|AAL22346.1| DNA adenine methylase [Salmonella typhimurium LT2] >gi|16505109|emb|CAD08130.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139927|gb|AAO71492.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|62129619|gb|AAX67322.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161365884|gb|ABX69652.1| hypothetical protein SPAB_04335 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194401071|gb|ACF61293.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194406573|gb|ACF66792.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194455380|gb|EDX44219.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194710366|gb|ACF89587.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195632094|gb|EDX50578.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Newport str. SL317] (278 aa)
Score = 352, Expect = 2.2e-31, Identities = 91/289 (31%), Positives = 154/289 (53%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  LL++IK++ P     +    EPFVG G+V  +   S+Y      ++DIN++LI++Y+++K +  E +       ++  +  T+  + YY +++  FN  ++          +A L ++LN+  +NGL R N +G FNV  G YK P   +   L   ++K +N       Y  S    DK++ VY DPPY P+++T++FTAY+ + F+   Q  LA+    L +    +L+SN D        +   E Y    +  VK +R I+S+G +R +++ELL
  S:     5 RAFLKWAGGKYPLLDDIKRHLPKGECLV----EPFVGAGSVFLNTDFSRY-----ILADINSDLISLYNIVKLRTDEYVQA----SRELFMPETNQAEVYYQLRE-EFNTCQDP-------FRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKRPYFPEA-ELYHFAEKAQNAFFYCESYADSMARADKSSVVYCDPPYAPLSATANFTAYHTNSFSLTQQAHLAEIAENLVSNRIPVLISNHD-------TALTREWYQLAKLHVVKVRRSISSNGGTRKKVDELL 265
>gi|56415400|ref|YP_152475.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|56129657|gb|AAV79163.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (278 aa)
Score = 352, Expect = 2.2e-31, Identities = 91/289 (31%), Positives = 154/289 (53%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  LL++IK++ P     +    EPFVG G+V  +   S+Y      ++DIN++LI++Y+++K +  E +       ++  +  T+  + YY +++  FN  ++          +A L ++LN+  +NGL R N +G FNV  G YK P   +   L   ++K +N       Y  S    DK++ VY DPPY P+++T++FTAY+ + F+   Q  LA+    L +    +L+SN D        +   E Y    +  VK +R I+S+G +R +++ELL
  S:     5 RAFLKWAGGKYPLLDDIKRHLPKGECLV----EPFVGAGSVFLNTDFSRY-----ILADINSDLISLYNIVKLRTDEYVQA----SRELFMPETNQAEVYYQLRE-EFNTCQDP-------FRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKRPYFPEA-ELYHFAEKAQNAFFYCESYADSMARADKSSVVYCDPPYAPLSATANFTAYHTNSFSLTQQAHLAEIAENLVSNRIPVLISNHD-------TALTREWYQLAKLHVVKVRRSISSNGGTRKKVDELL 265
>gi|121634195|ref|YP_974440.1| putative DNA adenine methylase [Neisseria meningitidis FAM18] >gi|120865901|emb|CAM09637.1| putative DNA adenine methylase [Neisseria meningitidis FAM18] (270 aa)
Score = 351, Expect = 2.7e-31, Identities = 97/289 (33%), Positives = 149/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           KPFLKW GGK +L+  I+   P    +  +  EPF G  A+   +    + +   ++DINA+LI ++ ++K +    I   +     F+  N  D ++Y L  + +FN  K          E++AL I+LN+  FNGL R N KG+FNV  G YK+P       +E   +K   V ++ GD++      D    VY DPPY P++ T+SFT Y K+ FN  NQ  LA    ++      +L+SN D +       F  +IYS   +K ++ +R I + GSSR ++ ELL
  S:     4 KPFLKWAGGKHKLVPFIEHNLPTPTRK--RLIEPFCGSAALSLAL----DFEHYLLNDINADLIGLFRILKEEKSGFIDYARSF---FISENNSDSRFYEL--REQFNFSKNLH-------ERSALFIYLNRHAFNGLCRYNSKGVFNVPFGRYKSPYFPQQ-EMEGFIQKSDRVELMCGDFQMILSQTDNTDTVYCDPPYAPLSPTASFTTYAKESFNLDNQIRLAQSAQQIAPDSQGVLISNHDTE-------FTRDIYSFAILKTIEVQRNIAAKGSSRKKVGELL 266
>gi|27364779|ref|NP_760307.1| site-specific DNA methylase [Vibrio vulnificus CMCP6] >gi|27360924|gb|AAO09834.1|AE016801_153 Site-specific DNA methylase [Vibrio vulnificus CMCP6] (275 aa)
Score = 348, Expect = 5.6e-31, Identities = 97/289 (33%), Positives = 154/289 (53%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKL-NNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +I+K+ P       K  EPFVG G+V  +  + YE     ++DIN +LIN+Y+++K +     P L I E        ++RK  YL  ++ FN+    +D  F    ++   +++N+  FNGL R NKKG FNV  G YK P   +   LE  ++K +    V   Y+++     K   VY DPPY P+++T++FT+Y  + F   +Q  LAD   K  + +G  +L+SN D K + +       +Y    +  VK KR I+ +G  R +++EL+
  S:     5 RAFLKWAGGKYGLVEDIQKHLP----PARKLVEPFVGAGSVFLN--TDYE--HYLLADINPDLINLYNLLKEQ-----PELYISEAKRWFTQENNRKDAYLSIRSEFNK---TDDVMF----RSLAFLYMNRFGFNGLCRYNKKGGFNVPFGSYKQPYFPEA-ELEFFAEKAQKATFVCEGYQETFRRARKGCVVYCDPPYAPLSNTANFTSYAGNGFTLDDQAALADIAEKTASERGIPVLISNHDTKLTRR-------LYHGAELNVVKVKRTISRNGGGRNKVDELM 266
>gi|24114650|ref|NP_709160.1| DNA adenine methylase [Shigella flexneri 2a str. 301] >gi|30065329|ref|NP_839500.1| DNA adenine methylase [Shigella flexneri 2a str. 2457T] >gi|110807219|ref|YP_690739.1| DNA adenine methylase [Shigella flexneri 5 str. 8401] >gi|24053854|gb|AAN44867.1| DNA adenine methylase [Shigella flexneri 2a str. 301] >gi|30043591|gb|AAP19311.1| DNA adenine methylase [Shigella flexneri 2a str. 2457T] >gi|110616767|gb|ABF05434.1| DNA adenine methylase [Shigella flexneri 5 str. 8401] (278 aa)
Score = 348, Expect = 6.6e-31, Identities = 93/289 (32%), Positives = 151/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  LL++IK++ P     +    EPFVG G+V  +   S+Y      ++DIN++LI++Y+++K +  E +       ++  +  T+  + YY     +F E   K  + F    +A L ++LN+  +NGL R N +G FNV  G YK P   +   L   ++K +N       Y  S E  D  + VY DPPY P+++T++FTAY+ + F  + Q  LA+    L  +   +L+SN D            E Y    +  VK +R I+S+G +R +++ELL
  S:     5 RAFLKWAGGKYPLLDDIKRHLPKGECLV----EPFVGAGSVFLNTDFSRY-----ILADINSDLISLYNIVKMRTDEYVQA----ARELFVPETNCAEVYY-----QFREEFNKSQDPF---RRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEA-ELYHFAEKAQNAFFYCESYADSMERADDASVVYCDPPYAPLSATANFTAYHTNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTM-------LTREWYQRAKLHVVKVRRSISSNGGTRKKVDELL 265
>gi|37681170|ref|NP_935779.1| site-specific DNA methylase [Vibrio vulnificus YJ016] >gi|37199921|dbj|BAC95750.1| site-specific DNA methylase [Vibrio vulnificus YJ016] (275 aa)
Score = 347, Expect = 6.8e-31, Identities = 97/289 (33%), Positives = 154/289 (53%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKL-NNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +I+K+ P       K  EPFVG G+V  +  + YE     ++DIN +LIN+Y+++K +     P L I E        ++RK  YL  ++ FN+    +D  F    ++   +++N+  FNGL R NKKG FNV  G YK P   +   LE  ++K +    V   Y+++     K   VY DPPY P+++T++FT+Y  + F   +Q  LAD   K  + +G  +L+SN D K + +       +Y    +  VK KR I+ +G  R +++EL+
  S:     5 RAFLKWAGGKYGLVEDIQKHLP----PARKLVEPFVGAGSVFLN--TDYE--HYLLADINPDLINLYNLLKEQ-----PELYIREAKRWFTQENNRKDAYLSIRSEFNK---TDDVMF----RSLAFLYMNRFGFNGLCRYNKKGGFNVPFGSYKKPYFPEA-ELEFFAEKAQKATFVCEGYQETFRRARKGCVVYCDPPYAPLSNTANFTSYAGNGFTLDDQAALADIAEKTASERGIPVLISNHDTKLTRR-------LYHGAELNVVKVKRTISRNGGGRNKVDELM 266
>gi|161505950|ref|YP_001573062.1| DNA adenine methylase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160867297|gb|ABX23920.1| hypothetical protein SARI_04131 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (278 aa)
Score = 347, Expect = 7.2e-31, Identities = 91/289 (31%), Positives = 154/289 (53%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  LL++IK++ P  +  +    EPFVG G+V  +   S+Y      ++DIN++LI++Y+++K +  E +       ++  +  T+  + YY +++  FN  ++          +A L ++LN+  +NGL R N +G FNV  G YK P   +   L   ++K +N       Y  S    DK++ VY DPPY P+++T++FTAY+ + F+   Q  LA+    L +    +L+SN D            E Y    +  VK +R I+S+G +R +++ELL
  S:     5 RAFLKWAGGKYPLLDDIKRHLPKGDCLV----EPFVGAGSVFLNTDFSRY-----ILADINSDLISLYNIVKSRTDEYVQA----SRELFMPETNQAEVYYQLRE-EFNTCQDP-------FRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEA-ELYHFAEKAQNAFFYCESYADSMARADKSSVVYCDPPYAPLSATANFTAYHTNSFSLTQQAHLAEIAENLVSNRIPVLISNHD-------TVLTREWYQLAKLHVVKVRRSISSNGGTRKKVDELL 265
>gi|151567801|pdb|2ORE|D Chain D, Binary Structure Of Escherichia Coli Dna Adenine Methyltransferase And S-Adenosylhomocysteine >gi|151567802|pdb|2ORE|E Chain E, Binary Structure Of Escherichia Coli Dna Adenine Methyltransferase And S-Adenosylhomocysteine >gi|151567803|pdb|2ORE|F Chain F, Binary Structure Of Escherichia Coli Dna Adenine Methyltransferase And S-Adenosylhomocysteine (298 aa)
Score = 347, Expect = 8.6e-31, Identities = 92/289 (31%), Positives = 150/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  LL++IK++ P    +     EPFVG G+V  +   S+Y      ++DIN++LI++Y+++K +  E +       ++  +  T+  + YY     +F E   K  + F    +A L ++LN+  +NGL R N +G FNV  G YK P   +   L   ++K +N       Y  S    D  + VY DPPY P+++T++FTAY+ + F  + Q  LA+    L  +   +L+SN D            E Y    +  VK +R I+S+G +R +++ELL
  S:    25 RAFLKWAGGKYPLLDDIKRHLP----KGECLVEPFVGAGSVFLNTDFSRY-----ILADINSDLISLYNIVKMRTDEYVQA----ARELFVPETNCAEVYY-----QFREEFNKSQDPF---RRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEA-ELYHFAEKAQNAFFYCESYADSMARADDASVVYCDPPYAPLSATANFTAYHTNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTM-------LTREWYQRAKLHVVKVRRSISSNGGTRKKVDELL 285
>gi|153825105|ref|ZP_01977772.1| DNA adenine methylase [Vibrio cholerae MZO-2] >gi|183179607|ref|ZP_02957818.1| DNA adenine methylase [Vibrio cholerae MZO-3] >gi|149741251|gb|EDM55293.1| DNA adenine methylase [Vibrio cholerae MZO-2] >gi|183013018|gb|EDT88318.1| DNA adenine methylase [Vibrio cholerae MZO-3] (277 aa)
Score = 345, Expect = 1.3e-30, Identities = 89/289 (30%), Positives = 152/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKL-NNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +I+++ P    +  +  EPFVG G+V  +     + +   ++DIN +LIN Y+++K +     P   I E        ++RK  YL  + +FN+    +D  F    ++   +++N+  FNGL R NKKG FNV  G YK P   +   LE  ++K +    +   Y ++      ++ +Y DPPY P+++T++FT+Y  + F   +Q  LAD   K    +G  +L+SN D  ++ +       +Y    +  VKA R I+ +G+ R +++ELL
  S:     5 RAFLKWAGGKYSLVEDIQRHLP----EARELVEPFVGAGSVFLNT----DFERYLLADINPDLINFYNLLKTE-----PQAYIHEAKRWFVPENNRKEVYLDIRKQFNQ---SDDAMF----RSLAFLYMNRFGFNGLCRYNKKGGFNVPFGSYKKPYFPEQ-ELEFFAEKAQRATFICASYGETFARAQSDSVIYCDPPYAPLSTTANFTSYAGNGFTLDDQAALADIAEKTAKERGISVLISNHDTTHTRR-------LYRGAQLNVVKANRTISRNGAGRNKVDELL 266
>gi|148827347|ref|YP_001292100.1| DNA adenine methylase [Haemophilus influenzae PittGG] >gi|148718589|gb|ABQ99716.1| DNA adenine methylase [Haemophilus influenzae PittGG] (286 aa)
Score = 345, Expect = 1.4e-30, Identities = 98/289 (33%), Positives = 149/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNN-KGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +PFLKW GGK +L ++I K +P   N +    EPFVG GAV  +  S +E     ++DIN +LIN+++++K  V+  I       K     +  +   YY  K+ RFN   +         E++ + ++LN+  FNGL R N K  FNV  G YK     +   L   + K ++   +  D++K+ EF DK++ +Y DPPY P+   ++FT Y  + F    Q+ LAD    +   K   IL+SN D K       F  EIYS    KRVK +R I+ +   R ++ EL+
  S:    16 RPFLKWAGGKFRLTDDINKAFPNKKNCLI---EPFVGAGAVFLN--SNFE--RYILADINPDLINLFNIVKENVEGYIEAC----KPIFFADDANTPDYYYAKRRRFNASTDP-------FERSIIFLYLNRFGFNGLCRYNSKNEFNVPFGAYKTHYFPED-ELRYFAHKAQSAVFLCCDFQKTFEFADKDSVIYCDPPYAPLQQETNFTGYAGNEFGLAQQRVLADLAKSIQKEKQISILISNHDTK-------FTREIYSGAKFKRVKVQRSISQNPEKRVKVKELI 279
>gi|119389532|pdb|2G1P|A Chain A, Structure Of E. Coli Dna Adenine Methyltransferase (Dam) >gi|119389533|pdb|2G1P|B Chain B, Structure Of E. Coli Dna Adenine Methyltransferase (Dam) (278 aa)
Score = 344, Expect = 1.7e-30, Identities = 92/289 (31%), Positives = 151/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  LL++IK++ P     +    EPFVG G+V  +   S+Y      ++DIN++LI++Y+++K +  E +       ++  +  T+  + YY     +F E   K  + F    +A L ++LN+  +NGL R N +G FNV  G YK P   +   L   ++K +N       Y  S    D ++ VY DPPY P+++T++FTAY+ + F  + Q  LA+    L  +   +L+SN D            E Y    +  VK +R I+S+G +R +++ELL
  S:     5 RAFLKWAGGKYPLLDDIKRHLPKGECLV----EPFVGAGSVFLNTDFSRY-----ILADINSDLISLYNIVKMRTDEYVQA----ARELFVPETNCAEVYY-----QFREEFNKSQDPF---RRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEA-ELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSATANFTAYHTNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTM-------LTREWYQRAKLHVVKVRRSISSNGGTRKKVDELL 265
>gi|15642621|ref|NP_232254.1| DNA adenine methylase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121588094|ref|ZP_01677842.1| DNA adenine methylase [Vibrio cholerae 2740-80] >gi|121729033|ref|ZP_01682034.1| DNA adenine methylase [Vibrio cholerae V52] >gi|147675035|ref|YP_001218119.1| DNA adenine methylase [Vibrio cholerae O395] >gi|153214884|ref|ZP_01949682.1| DNA adenine methylase [Vibrio cholerae 1587] >gi|153819029|ref|ZP_01971696.1| DNA adenine methylase [Vibrio cholerae NCTC 8457] >gi|153821562|ref|ZP_01974229.1| DNA adenine methylase [Vibrio cholerae B33] >gi|153830064|ref|ZP_01982731.1| DNA adenine methylase [Vibrio cholerae 623-39] >gi|194533127|ref|YP_002068546.1| DNA adenine methylase [Vibrio cholerae MO10] >gi|194536465|ref|YP_002071624.1| DNA adenine methylase [Vibrio cholerae RC385] >gi|172044580|sp|P0C6Q8|DMA_VIBCH DNA adenine methylase (M.VchADam) (Deoxyadenosyl-methyltransferase) (DNA adenine methyltransferase) >gi|172047542|sp|A5F520|DMA_VIBC3 DNA adenine methylase (M.VchADam) (Deoxyadenosyl-methyltransferase) (DNA adenine methyltransferase) >gi|10799034|gb|AAG23174.1|AF274317_1 DNA adenine methylase [Vibrio cholerae] >gi|9657216|gb|AAF95767.1| DNA adenine methylase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|33359234|gb|AAQ17039.1| DNA adenine methylase [Vibrio cholerae] >gi|121547637|gb|EAX57734.1| DNA adenine methylase [Vibrio cholerae 2740-80] >gi|121628681|gb|EAX61152.1| DNA adenine methylase [Vibrio cholerae V52] >gi|124115043|gb|EAY33863.1| DNA adenine methylase [Vibrio cholerae 1587] >gi|125619179|gb|EAZ47709.1| DNA adenine methylase [Vibrio cholerae MO10] >gi|126510410|gb|EAZ73004.1| DNA adenine methylase [Vibrio cholerae NCTC 8457] >gi|126520947|gb|EAZ78170.1| DNA adenine methylase [Vibrio cholerae B33] >gi|146316918|gb|ABQ21457.1| DNA adenine methylase [Vibrio cholerae O395] >gi|148874463|gb|EDL72598.1| DNA adenine methylase [Vibrio cholerae 623-39] >gi|150421259|gb|EDN13542.1| DNA adenine methylase [Vibrio cholerae RC385] >gi|150424002|gb|EDN15941.1| DNA adenine methylase [Vibrio cholerae AM-19226] (277 aa)
Score = 344, Expect = 1.8e-30, Identities = 89/289 (30%), Positives = 152/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKL-NNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +I+++ P    +  +  EPFVG G+V  +     + +   ++DIN +LIN Y+++K +     P   I E        ++RK  YL  + +FN+    +D  F    ++   +++N+  FNGL R NKKG FNV  G YK P   +   LE  ++K +    +   Y ++      ++ +Y DPPY P+++T++FT+Y  + F   +Q  LAD   K    +G  +L+SN D  ++ +       +Y    +  VKA R I+ +G+ R +++ELL
  S:     5 RAFLKWAGGKYSLVEDIQRHLP----EARELVEPFVGAGSVFLNT----DFERYLLADINPDLINFYNLLKTE-----PQAYIHEAKRWFVPENNRKEVYLDIRKQFNQ---SDDAMF----RSLAFLYMNRFGFNGLCRYNKKGGFNVPFGSYKKPYFPEQ-ELEFFAEKAQRATFICASYGETFARAQSDSVIYCDPPYAPLSTTANFTSYAGNGFTLDDQAALADIAEKTAKERGISVLISNHDTTHTRR-------LYRGAQLNVVKANRTISRNGAGRNKVDELL 266
>gi|1675388|gb|AAB19116.1| adenine methylase [Salmonella typhimurium] (278 aa)
Score = 344, Expect = 1.8e-30, Identities = 90/289 (31%), Positives = 153/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  LL++IK++ P    +     EPFVG G+V  +   S+Y      ++DIN++LI++Y+++K +  E +       ++  +  T+  + YY +++  FN  ++          +A L ++LN+  +NGL R N +G FNV  G YK P   +   L   ++K +N       Y  S    DK++ VY DPPY P+++T++FTAY+ + F+   Q  LA+    L +    +L+SN D        +   E Y    +  VK +  I+S+G +R +++ELL
  S:     5 RAFLKWAGGKYPLLDDIKRHLP----KGECLVEPFVGAGSVFLNTDFSRY-----ILADINSDLISLYNIVKLRTDEYVQA----SRELFMPETNQAEVYYQLRE-EFNTCQDP-------FRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKRPYFPEA-ELYHFAEKAQNAFFYCESYADSMARADKSSVVYCDPPYAPLSATANFTAYHTNSFSLTQQAHLAEIAENLVSNRIPVLISNHD-------TALTREWYQLAKLHVVKVRPSISSNGGTRKKVDELL 265
>gi|153223458|ref|ZP_01953881.1| DNA adenine methylase [Vibrio cholerae MAK 757] >gi|124118184|gb|EAY36927.1| DNA adenine methylase [Vibrio cholerae MAK 757] (277 aa)
Score = 344, Expect = 1.9e-30, Identities = 89/289 (30%), Positives = 152/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKL-NNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +I+++ P    +  +  EPFVG G+V  +     + +   ++DIN +LIN Y+++K +     P   I E        ++RK  YL  + +FN+    +D  F    ++   +++N+  FNGL R NKKG FNV  G YK P   +   LE  ++K +    +   Y ++      ++ +Y DPPY P+++T++FT+Y  + F   +Q  LAD   K    +G  +L+SN D  ++ +       +Y    +  VKA R I+ +G+ R +++ELL
  S:     5 RAFLKWAGGKYSLVEDIQRHLP----EARELVEPFVGAGSVFLNT----DFERYLLADINPDLINFYNLLKTE-----PQAYIHEAKRWFVPENNRKEVYLDIRKQFNQ---SDDAMF----RSLAFLYMNRFGFNGLCRYNKKGGFNVPFGSYKKPYFPEQ-ELEFFAEKAQRATFICASYGETFARAQSDSVIYCDPPYAPLSTTANFTSYACNGFTLDDQAALADIAEKTAKERGISVLISNHDTTHTRR-------LYRGAQLNVVKANRTISRNGAGRNKVDELL 266
>gi|13274350|gb|AAK17899.1|AF263926_1 DNA-adenine methyltransferase [Actinobacillus actinomycetemcomitans] (284 aa)
Score = 344, Expect = 1.9e-30, Identities = 94/289 (32%), Positives = 152/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDV-EKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYI-NKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +PFLKW GGK +L++EI +  P     +    EPFVG GAV  +       K   ++DIN +LIN+++++K  V+  I   Q  +  F     +   +YY          K KE NQ  DV ++A L ++LN+  FNGL R N K  FNV  G YK     +   L   + K ++   +  D++++ E  D+N+ +Y DPPY P++  S+FT Y  + F+  +Q++LA+   + +  +  ++L+SN D         F  EIY    I+R+K +R I+     R ++ EL+
  S:    14 RPFLKWAGGKYRLMDEINRLLPKRKQCLV---EPFVGAGAVFLNS----NFKRYILADINPDLINLFNIVKLDVERYI---QACKPIFFHPEANTEIYYYG---------KRKEFNQSTDVFQRAVLFLYLNRFGFNGLCRYNSKNEFNVPFGDYKTHYFPEE-ELRFFAAKAQSAVFICADFQQTFEMADENSVIYCDPPYAPLSQDSNFTNYAGNEFSIGHQRDLANLAKHTMEQRNIQVLISNHD-------TPFTREIYQGAKIRRLKVQRSISQAPHKRIKVRELI 277
>gi|52842289|ref|YP_096088.1| DNA adenine methylase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52629400|gb|AAU28141.1| DNA adenine methylase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (278 aa)
Score = 343, Expect = 2.0e-30, Identities = 93/290 (32%), Positives = 146/290 (50%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVL-QIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           ++PFLKW GGK Q++N+I+   P    +  +  EPFVG GAV  +        +  ++DINA+LIN++  +K++  + I    Q    +F      ++K  +L  +  FN   +          KAAL I+LN+  FNGL R N  G+FN + G YK P   +   L  I K  K       DY        K   VY DPPY P++++++FT Y+   F  ++Q+ L +   +L  KG  ++LSN D        +F   +Y   +I   + +R I+ +GS+RG   E+L
  S:    13 IRPFLKWAGGKFQIINKIRASLP----KGARLIEPFVGSGAVFLNT----NYNKFILADINADLINLFEHLKFEKHDFIHFCKQFFTAEF------NKKSTFLSLRTEFNSTTDSH-------LKAALFIYLNRHAFNGLMRYNSSGMFNTAFGDYKKPYFPENEMLVFIQKAEK-AEFKCADYSVIMGEAIKGDVVYCDPPYVPLSASANFTKYHSTAFGQEDQRRLVELAKELAAKGIPVILSNHD-------TAFTQNLYQGSSIISFEVQRNISCNGSTRGRAREML 274
>gi|26249981|ref|NP_756021.1| DNA adenine methylase [Escherichia coli CFT073] >gi|91212859|ref|YP_542845.1| DNA adenine methylase [Escherichia coli UTI89] >gi|110643621|ref|YP_671351.1| DNA adenine methylase [Escherichia coli 536] >gi|117625655|ref|YP_858978.1| DNA adenine methylase [Escherichia coli APEC O1] >gi|170683954|ref|YP_001745630.1| DNA adenine methylase [Escherichia coli SMS-3-5] >gi|188492230|ref|ZP_02999500.1| DNA adenine methylase [Escherichia coli 53638] >gi|191171505|ref|ZP_03033053.1| DNA adenine methylase [Escherichia coli F11] >gi|26110410|gb|AAN82595.1|AE016768_13 DNA adenine methylase [Escherichia coli CFT073] >gi|91074433|gb|ABE09314.1| DNA adenine methylase [Escherichia coli UTI89] >gi|110345213|gb|ABG71450.1| DNA adenine methylase [Escherichia coli 536] >gi|115514779|gb|ABJ02854.1| DNA adenine methylase [Escherichia coli APEC O1] >gi|170521672|gb|ACB19850.1| DNA adenine methylase [Escherichia coli SMS-3-5] >gi|188487429|gb|EDU62532.1| DNA adenine methylase [Escherichia coli 53638] >gi|190908132|gb|EDV67723.1| DNA adenine methylase [Escherichia coli F11] (278 aa)
Score = 343, Expect = 2.1e-30, Identities = 92/289 (31%), Positives = 151/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  LL++IK++ P     +    EPFVG G+V  +   S+Y      ++DIN++LI++Y+++K +  E +       ++  +  T+  + YY     +F E   K  + F    +A L ++LN+  +NGL R N +G FNV  G YK P   +   L   ++K +N       Y  S    D  + VY DPPY P+++T++FTAY+ + F  + Q  LA+    L ++   +L+SN D            E Y    +  VK +R I+S+G +R +++ELL
  S:     5 RAFLKWAGGKYPLLDDIKRHLPKGECLV----EPFVGAGSVFLNTDFSRY-----ILADINSDLISLYNIVKMRTDEYVQA----ARELFVPETNCAEVYY-----QFREEFNKSQDPF---RRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEA-ELYHFAEKAQNAFFYCESYADSMARADDASVVYCDPPYAPLSATANFTAYHTNSFTLEQQAHLAEIAEGLVDRHIPVLISNHDTM-------LTREWYQRAKLHVVKVRRSISSNGGTRKKVDELL 265
>gi|113477350|ref|YP_723411.1| DNA adenine methylase [Trichodesmium erythraeum IMS101] >gi|110168398|gb|ABG52938.1| DNA adenine methylase [Trichodesmium erythraeum IMS101] (235 aa)
Score = 343, Expect = 2.1e-30, Identities = 96/238 (40%), Positives = 140/238 (58%)
  Q:   111 ISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDN--QFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKN--VNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYN--IKRVKAKRMINSDGSSRGEINELLISNF 348
           I+D N ELIN Y V++  + +LI  L+  EK       ++  ++Y I+     +L    +N      V++AA +I+LNKTC+NGL+RVN +G FNV  G YK P I D   L+++S  LK   V I+  D+ ++ +   K  F+Y DPPY P+++TSSFT Y+ + FN   QK L +  ++LN KG  ++LSNS          F   +Y  Y   IK V+A R INS G  RG INE+++ NF
  S:     8 INDQNKELINCYEVVRDSLDDLIEELREHEKH------NNADYFYEIR-----DLDRSPENYKSLSAVKRAARIIYLNKTCYNGLFRVNSQGQFNVPFGRYKKPNILDEAVLKSVSLYLKKTKVKILDKDFAEAVKNAKKGDFIYLDPPYDPLSNTSSFTGYDINGFNRNEQKRLREVFDELNEKGCLVILSNS-------QTDFIMGLYQDYQDKIKVVRAARSINSKGLKRGRINEIIVLNF 233
>gi|157372834|ref|YP_001480823.1| DNA adenine methylase [Serratia proteamaculans 568] >gi|157324598|gb|ABV43695.1| DNA adenine methylase [Serratia proteamaculans 568] (270 aa)
Score = 343, Expect = 2.2e-30, Identities = 92/289 (31%), Positives = 155/289 (53%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L++EI+++ P  +  I    EPFVG G+V  +     E     ++DIN++LIN+Y+++K +  + +       +D  L  TD+       K  +F  L+E+ +       +A L ++LN+ C+NGL R N +G FNV  G YK P   +   L   ++K +N   V   Y+ +    ++ T VY DPPY P+++T++FTAY+ + F+  +Q+ LA   ++L       +L+SN D +          + Y   ++  VKA+R I+ +   R ++NELL
  S:     5 RAFLKWAGGKYPLVDEIRRHLPAGDCLI----EPFVGAGSVFLNT----EYDAYILADINSDLINLYNIVKLRTDDFV-------RDARLLFTDE-----FNKSEQFYLLREEFNMSADAYRRALLFLYLNRHCYNGLCRYNLRGEFNVPFGRYKKPYFPED-ELYWFAEKSRNATFVCEHYRDTMAKAERGTVVYCDPPYAPLSATANFTAYHTNSFSMADQQSLALMAHQLAVESQVPVLISNHDTE-------LTRDWYQHASLYVVKARRTISRNILGRSKVNELL 266
>gi|170766576|ref|ZP_02901029.1| DNA adenine methylase [Escherichia albertii TW07627] >gi|170124014|gb|EDS92945.1| DNA adenine methylase [Escherichia albertii TW07627] (278 aa)
Score = 343, Expect = 2.3e-30, Identities = 92/289 (31%), Positives = 153/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  LL++IK++ P    +     EPFVG G+V  +   S+Y      ++DIN +LI++Y+++K + +E +  +    ++  +  T+  + YY     +F E   K  + F    +A L ++LN+  +NGL R N +G FNV  G YK P   +   L   ++K +N       Y  S    D ++ VY DPPY P+++T++FTAY+ + F  + Q  LA+    L ++   +L+SN D            E Y    +  VK +R I+S+G +R +++ELL
  S:     5 RAFLKWAGGKYPLLDDIKRHLP----KGECLVEPFVGAGSVFLNTDFSRY-----ILADINNDLISLYNIVKTRTEEYVQAV----RELFVPETNCAEVYY-----QFREEFNKSQDPF---RRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEA-ELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSATANFTAYHTNSFTLEQQAHLAEIAEGLVDRQIPVLISNHDTM-------LTREWYQRAKLHVVKVRRSISSNGGTRKKVDELL 265
>gi|15803890|ref|NP_289926.1| DNA adenine methylase [Escherichia coli O157:H7 EDL933] >gi|15833483|ref|NP_312256.1| DNA adenine methylase [Escherichia coli O157:H7 str. Sakai] >gi|16131265|ref|NP_417846.1| DNA adenine methylase [Escherichia coli str. K-12 substr. MG1655] >gi|82545742|ref|YP_409689.1| DNA adenine methylase [Shigella boydii Sb227] >gi|89110623|ref|AP_004403.1| DNA adenine methylase [Escherichia coli W3110] >gi|157155134|ref|YP_001464841.1| DNA adenine methylase [Escherichia coli E24377A] >gi|157162863|ref|YP_001460181.1| DNA adenine methylase [Escherichia coli HS] >gi|168708989|ref|ZP_02741266.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4045] >gi|168734819|ref|ZP_02767096.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4115] >gi|168751802|ref|ZP_02776824.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4113] >gi|168753136|ref|ZP_02778143.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4401] >gi|168759408|ref|ZP_02784415.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4501] >gi|168765731|ref|ZP_02790738.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4486] >gi|168772725|ref|ZP_02797732.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4196] >gi|168779467|ref|ZP_02804474.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4076] >gi|168785188|ref|ZP_02810195.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC869] >gi|168791468|ref|ZP_02816475.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4042] >gi|168797154|ref|ZP_02822161.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC508] >gi|170018377|ref|YP_001723331.1| DNA adenine methylase [Escherichia coli ATCC 8739] >gi|170082904|ref|YP_001732224.1| DNA adenine methylase [Escherichia coli str. K12 substr. DH10B] >gi|187730578|ref|YP_001882062.1| DNA adenine methylase [Shigella boydii CDC 3083-94] >gi|191167910|ref|ZP_03029714.1| DNA adenine methylase [Escherichia coli B7A] >gi|193061744|ref|ZP_03042841.1| DNA adenine methylase [Escherichia coli E22] >gi|193068753|ref|ZP_03049713.1| DNA adenine methylase [Escherichia coli E110019] >gi|194427062|ref|ZP_03059614.1| DNA adenine methylase [Escherichia coli B171] >gi|194439504|ref|ZP_03071579.1| DNA adenine methylase [Escherichia coli 101-1] >gi|195934875|ref|ZP_03080257.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4024] >gi|83305819|sp|P0AEE8|DMA_ECOLI DNA adenine methylase (M.EcoDam) (Deoxyadenosyl-methyltransferase) (DNA adenine methyltransferase) >gi|83305818|sp|P0AEE9|DMA_ECO57 DNA adenine methylase (Deoxyadenosyl-methyltransferase) (DNA adenine methyltransferase) >gi|12518007|gb|AAG58487.1|AE005560_13 DNA adenine methylase [Escherichia coli O157:H7 EDL933] >gi|41227|emb|CAA79668.1| unnamed protein product [Escherichia coli] >gi|41230|emb|CAA23530.1| unnamed protein product [Escherichia coli] >gi|145706|gb|AAA23664.1| DNA adenine methylase >gi|606321|gb|AAA58184.1| DNA adenine methylase [Escherichia coli] >gi|1789789|gb|AAC76412.1| DNA adenine methylase [Escherichia coli str. K-12 substr. MG1655] >gi|13363703|dbj|BAB37652.1| DNA adenine methylase [Escherichia coli O157:H7 str. Sakai] >gi|81247153|gb|ABB67861.1| DNA adenine methylase [Shigella boydii Sb227] >gi|85676654|dbj|BAE77904.1| DNA adenine methylase [Escherichia coli W3110] >gi|157068543|gb|ABV07798.1| DNA adenine methylase [Escherichia coli HS] >gi|157077164|gb|ABV16872.1| DNA adenine methylase [Escherichia coli E24377A] >gi|169753305|gb|ACA76004.1| DNA adenine methylase [Escherichia coli ATCC 8739] >gi|169890739|gb|ACB04446.1| DNA adenine methylase [Escherichia coli str. K12 substr. DH10B] >gi|187427570|gb|ACD06844.1| DNA adenine methylase [Shigella boydii CDC 3083-94] >gi|187771540|gb|EDU35384.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4196] >gi|188014219|gb|EDU52341.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4113] >gi|189002487|gb|EDU71473.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4076] >gi|189359276|gb|EDU77695.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4401] >gi|189364494|gb|EDU82913.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4486] >gi|189369482|gb|EDU87898.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4501] >gi|189374291|gb|EDU92707.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC869] >gi|189379959|gb|EDU98375.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC508] >gi|190902083|gb|EDV61828.1| DNA adenine methylase [Escherichia coli B7A] >gi|192932534|gb|EDV85131.1| DNA adenine methylase [Escherichia coli E22] >gi|192957829|gb|EDV88272.1| DNA adenine methylase [Escherichia coli E110019] >gi|194415023|gb|EDX31293.1| DNA adenine methylase [Escherichia coli B171] >gi|194421590|gb|EDX37602.1| DNA adenine methylase [Escherichia coli 101-1] (278 aa)
Score = 342, Expect = 3.1e-30, Identities = 92/289 (31%), Positives = 150/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  LL++IK++ P     +    EPFVG G+V  +   S+Y      ++DIN++LI++Y+++K +  E +       ++  +  T+  + YY     +F E   K  + F    +A L ++LN+  +NGL R N +G FNV  G YK P   +   L   ++K +N       Y  S    D  + VY DPPY P+++T++FTAY+ + F  + Q  LA+    L  +   +L+SN D            E Y    +  VK +R I+S+G +R +++ELL
  S:     5 RAFLKWAGGKYPLLDDIKRHLPKGECLV----EPFVGAGSVFLNTDFSRY-----ILADINSDLISLYNIVKMRTDEYVQA----ARELFVPETNCAEVYY-----QFREEFNKSQDPF---RRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEA-ELYHFAEKAQNAFFYCESYADSMARADDASVVYCDPPYAPLSATANFTAYHTNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTM-------LTREWYQRAKLHVVKVRRSISSNGGTRKKVDELL 265
>gi|91789170|ref|YP_550122.1| DNA adenine methylase [Polaromonas sp. JS666] >gi|91698395|gb|ABE45224.1| DNA adenine methylase [Polaromonas sp. JS666] (271 aa)
Score = 341, Expect = 3.4e-30, Identities = 93/294 (31%), Positives = 151/294 (51%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLL--RNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           V PFLKW GGK  L   I+K+      + T++ EPFVGGGAV F +     +    + D N +LI VY+ IK   + +        +D L+  +N    ++YY I+   +   + +           A +I+LN+TC+NGLYRVNKKG FNV +G  K   I  T N E ++  LK   ++ GD+  +     +N FV+ DPPY    + + F  YN+++F+  +Q  L D +    ++G K+L++N+  ++  +  +   E+ +      V    +I    S+RG   E++I  F
  S:     8 VTPFLKWAGGKRWL---IEKHPYLLGGKFTRFIEPFVGGGAVFFSLQPDSAI----LCDKNEKLIEVYATIKSNWQRV--------EDLLVEHQNKHSPEYYYEIRSKDYRTPETR----------TAQLIYLNRTCWNGLYRVNKKGEFNVPVG-TKQTVILQTDNFEGVASILKRAELICGDFDVAMSKAGENDFVFVDPPYTVKHNYNGFVKYNENIFSWDDQLRLRDAVKAAISRGAKVLVTNACHESIKRIYAGIGEMCT------VDRASVIAGKASARGRYEEVIIKCF 271
>gi|152972266|ref|YP_001337412.1| DNA adenine methylase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|90990834|dbj|BAE92860.1| DNA adenine methylase [Klebsiella pneumoniae] >gi|150957115|gb|ABR79145.1| DNA adenine methylase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (275 aa)
Score = 341, Expect = 3.4e-30, Identities = 96/289 (33%), Positives = 153/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIY-SAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  LL++IKK+ P     I    EPFVG G+V  +   S+Y      ++DIN++LI +Y+++K +  E +   + M   F   N    ++Y  + ++ FN+ ++        + +A L ++LN+  +NGL R N +G FNV  G YK P   +   L   ++K +N       Y++  +  D  T VY DPPY P+T+T++FTAY+ + FN + Q  LA     L  K   +L+SN              E Y +A     VK +R I+S+G +R +++ELL
  S:     5 RAFLKWAGGKFPLLDDIKKHLPEGECLI----EPFVGAGSVFLNTDFSRY-----ILADINSDLIGLYNIVKLRTDEYVAAAREM---FTPENNVAERYY--LYRDEFNQSQDP-------LRRAVLFLYLNRHGYNGLCRYNLRGEFNVPFGRYKKPYFPEA-ELYHFAEKAQNAEFYCESYEECMQRADSRTVVYCDPPYAPLTATANFTAYHTNSFNLEQQVLLAQKAESLMKKRIPVLISN-------HRTPLTQEWYKNAAETHIVKVRRSISSNGGTRKKVDELL 266
>gi|167629797|ref|YP_001680296.1| DNA adenine methylase [Heliobacterium modesticaldum Ice1] >gi|167592537|gb|ABZ84285.1| DNA adenine methylase [Heliobacterium modesticaldum Ice1] (268 aa)
Score = 341, Expect = 3.7e-30, Identities = 89/289 (30%), Positives = 141/289 (48%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +PFLKW G K ++++ I+   P  N  I    EPFVG  AV  +       KE  ++D N +LI +Y  +K   ++ I       + F     +  + YY ++     E+    D+  L   K+AL I+LN+  +NGL R N  G FN   G YK P   +   L     K ++   +  D+ ++         VY DPPY P++ TS+FT Y+   F +  Q +LA+   +L ++G  +L+SN D         F  + Y A  I+R   +R ++ DG++RG+  ELL
  S:     4 RPFLKWAGNKYRIIHRIRAVLPAGNRLI----EPFVGSAAVFLNT----SFKENLLADCNGDLIRLYQTVKTGGEDFIAYC----RSFFTEENNRPERYYALR-----EIFNTTDDGDL---KSALFIYLNRHSYNGLCRYNASGKFNAPAGRYKKPYFPER-ELRFFMAKARDAVFLCQDFTQTMGEARPGDVVYCDPPYVPLSRTSNFTGYSAGGFGEAEQWKLAELARQLADRGVSVLISNHD-------TDFTQKAYDAARIERFPVQRFVSCDGANRGKAGELL 264
>gi|82778798|ref|YP_405147.1| DNA adenine methylase [Shigella dysenteriae Sd197] >gi|81242946|gb|ABB63656.1| DNA adenine methylase [Shigella dysenteriae Sd197] (278 aa)
Score = 341, Expect = 3.7e-30, Identities = 92/289 (31%), Positives = 151/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  LL++IK++ P     +    EPFVG G+V  +   S+Y      ++DIN++LI++Y+++K +  E +       ++  +  T+  + YY     +F E   K  + F    +A L ++LN+  +NGL R N +G FNV  G YK P   +   L   ++K +N       Y  S    D  + VY DPPY P+++T++FTAY+ + F  + Q  LA+    L  +   +L+SN D   + K        Y    +  VK +R I+S+G +R +++ELL
  S:     5 RAFLKWAGGKYPLLDDIKRHLPKGECLV----EPFVGAGSVFLNTDFSRY-----ILADINSDLISLYNIVKMRTDEYVQA----ARELFVPETNCAEVYY-----QFREEFNKSQDPF---RRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEA-ELYHFAEKAQNAFFYCESYADSMARADDASVVYCDPPYAPLSATANFTAYHTNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTRK-------WYQRAKLHVVKVRRSISSNGGTRKKVDELL 265
>gi|168476686|ref|ZP_02705709.1| putative phage gene [Salmonella enterica subsp. enterica serovar Virchow str. SL491] (286 aa)
Score = 341, Expect = 4.1e-30, Identities = 89/291 (30%), Positives = 154/291 (52%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNP-----KICDTLNLEAISKKLKNVNIVYGDYKKSEEFI-DKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLI 345
           VK  LKWVG K +L+ +++++ P    +  +  EPF G  AV+ +     +  E  I+D+N +L+N+Y  + Y    L+  L+ +     L + + R  +Y   ++ FN   +   ++   VE AA  ++LN+ CFNGL R N++G FNV  G YK P     +IC      A ++K K    +  DY ++ + + D N  VY DPPY  +T + +FTAY++  F+  +Q  LA  + +L  +G +++ SNSD +           +Y+ +   +V A R + +  +S     EL++
  S:     3 VKTPLKWVGSKARLMPKLRQHLP----EGKRLVEPFAGSCAVMMNT----DYDEYLIADVNPDLVNLYKAMAYHTDALLNELESLFTAGSLGDEESRAVFYYAVRDAFNLSGKSFGSE--SVEAAARFLYLNRHCFNGLCRYNRRGQFNVPFGKYKKPYFPADEIC------AFAEKAKRATFITADYSETLDLVRDGNDVVYCDPPY--LTDSDNFTAYHERGFSHMDQGRLARKLRRLAERGVQVVASNSDLE-------MVHYLYAGFEALKVNAPRSVGAAAASPKMAAELIL 274
>gi|125620694|gb|EAZ49055.1| DNA adenine methylase [Vibrio cholerae V51] (277 aa)
Score = 341, Expect = 4.2e-30, Identities = 89/289 (30%), Positives = 152/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKL-NNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +I+++ P    +  +  EPFVG G+V  +     + +   ++DIN +LIN Y+++K +     P   I E        ++RK  YL  + +FN+    +D  F    ++   +++N+  FNGL R NKKG FNV  G YK P   +   LE  ++K +    +   Y ++      ++ +Y DPPY P+++T++FT+Y  + F   +Q  LAD   K    +G  +L+SN D  ++ +       +Y    +  VKA R I+ +G+ R +++ELL
  S:     5 RAFLKWAGGKYSLVEDIQRHLP----EARELVEPFVGAGSVFLNT----DFERYLLADINPDLINFYNLLKTE-----PQAYIHEAKRWFVPENNRKEVYLDIRKQFNQ---SDDAMF----RSLAFLYMNRFGFNGLCRYNKKGGFNVPFGSYKKPYFPEQ-ELEFFAEKAQRATFICASYGETFARAQSDSVIYCDPPYAPLSTTANFTSYAGNGFTLDDQAALADIAEKTAKERGISVLISNHDTTHTRR-------LYRGAQLNVVKANRTISRNGAGRNKVDELL 266
>gi|90580856|ref|ZP_01236658.1| putative DNA adenine methylase [Vibrio angustum S14] >gi|90437927|gb|EAS63116.1| putative DNA adenine methylase [Vibrio angustum S14] (285 aa)
Score = 340, Expect = 4.3e-30, Identities = 95/289 (32%), Positives = 151/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINK-LNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +IK++ P       K  EPFVG G+V  +     +     ++DIN +LIN+Y+++K++     P   I +   L     + K  YL  +  FN      D+ +L   ++   +++N+  FNGL R NKKG FNV  G YK P   +   +   S+K K    V   Y ++     K   VY DPPY P++ST++FT+Y+ + F+  +Q  LAD   K    +   +L+SN D   + +       +Y+  ++  VKAKR I+ +GS R +++ELL
  S:     5 RAFLKWAGGKYSLVEDIKRHLP----PARKLVEPFVGAGSVFLNT----DYDHYLLADINPDLINLYNILKHE-----PERYIEDARKLFTPEYNNKEAYLKIREEFN----ASDDPYL---RSLYFLYMNRHGFNGLCRYNKKGGFNVPFGSYKKPYFPEA-EMYYFSEKAKRATFVCEGYLQTFSRARKGCVVYCDPPYAPLSSTANFTSYSGNGFSLDDQATLADVAEKAAAERDIAVLISNHDTALTRR-------LYTGADLSVVKAKRTISRNGSGRNKVDELL 266
>gi|28899516|ref|NP_799121.1| DNA adenine methylase [Vibrio parahaemolyticus RIMD 2210633] >gi|28807752|dbj|BAC61005.1| DNA adenine methylase [Vibrio parahaemolyticus RIMD 2210633] (279 aa)
Score = 340, Expect = 4.4e-30, Identities = 92/289 (31%), Positives = 149/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKL-NNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +I+++ P       K  EPFVG G+V  +     +     ++DIN +LIN+Y+++K + +E I      E        ++RK  YL  +  FN+  +        + ++   +++N+  FNGL R NKKG FNV  G YK P   +   LE  ++K K    V   Y ++     K + VY DPPY P+++T++FT+Y  + F   +Q  LAD   +    +G  +L+SN D        +    +Y   ++  VK KR I+ +GS R +++ELL
  S:     5 RAFLKWAGGKYGLVEDIQRHLP----PARKLVEPFVGAGSVFLNT----DYDHYLLADINPDLINLYNLLKERPEEYIS-----EAKRWFVAENNRKEAYLSIRAEFNKTDDV-------MYRSLAFLYMNRFGFNGLCRYNKKGGFNVPFGSYKKPYFPEA-ELEFFAEKAKKATFVCEGYPETFRRARKGSVVYCDPPYAPLSNTANFTSYAGNGFTLDDQAALADMAERTATERGIPVLISNHD-------TTLTRRLYHGADLSVVKVKRTISRNGSGRNKVDELL 266
>gi|37524113|ref|NP_927457.1| DNA adenine methylase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36783536|emb|CAE12382.1| DNA adenine methylase (Deoxyadenosyl-methyltransferase) [Photorhabdus luminescens subsp. laumondii TTO1] (270 aa)
Score = 340, Expect = 5.0e-30, Identities = 87/289 (30%), Positives = 156/289 (53%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNN-KGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+++IK++ P  +  I    EPFVG G+V  +     +     ++DIN++LIN+Y+ +K +  E I    +  +    +  +  + +Y        +L+E+ +       ++ L ++LN+ C+NGL R N  G FNV  G YK P   +   L   ++K +N   +   Y+ +     K++ +Y DPPY P+++T++FTAY+ + FN  +Q+ LA+   KL++ +   +L+SN D   + K        Y   ++  VKA+R I+ +  +R +++ELL
  S:     5 RAFLKWAGGKYPLVDDIKRHLPAGSRLI----EPFVGAGSVFLNT----DYDSYILADINSDLINLYNTVKLRADEFI----VHTRPLFTQEYNTAEHFY--------QLREQFNQSTDPFHRSVLFLYLNRHCYNGLCRYNSHGKFNVPFGRYKKPYFPEE-ELHWFAEKAQNATFICEHYQHTLNEAHKDSVIYCDPPYAPLSATANFTAYHTNSFNIADQENLANIAFKLSSERAIPVLISNHDTPMTRK-------WYYQASLHIVKARRTISRNILARSKVDELL 266
>gi|16272172|ref|NP_438378.1| DNA adenine methylase [Haemophilus influenzae Rd KW20] >gi|1169355|sp|P44431|DMA_HAEIN DNA adenine methylase (M.HindIV) (Deoxyadenosyl-methyltransferase) (DNA adenine methyltransferase) >gi|1573168|gb|AAC21877.1| DNA adenine methylase (dam) [Haemophilus influenzae Rd KW20] (286 aa)
Score = 340, Expect = 5.0e-30, Identities = 98/289 (33%), Positives = 148/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNN-KGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +PFLKW GGK +L +EI K +P   N +    EPFVG GAV  +  S +E     ++DIN +LIN+++++K  V   I       K     +  +   YY  K+ +FN   E         E++ + ++LN+  FNGL R N K  FNV  G YK     +   L   + K ++   +  D++K+ EF DK++ +Y DPPY P+   ++FT Y  + F    Q+ LAD    +   K   IL+SN D K       F  EIY+    KRVK +R I+ +   R ++ EL+
  S:    16 RPFLKWAGGKFRLTDEINKAFPNKKNCLI---EPFVGAGAVFLN--SNFE--RYILADINPDLINLFNIVKXNVDGYIEDC----KPIFFADDANTPDYYYAKRRQFNASTEP-------FERSIIFLYLNRFGFNGLCRYNSKNEFNVPFGAYKTHYFPED-ELRYFAHKAQSAVFLCCDFQKTFEFADKDSVIYCDPPYAPLQQETNFTGYAGNEFGLAQQRALADLAKSIQKEKQISILISNHDTK-------FTREIYNGAKFKRVKVQRSISQNPEKRVKVKELI 279
>gi|117924581|ref|YP_865198.1| DNA adenine methylase [Magnetococcus sp. MC-1] >gi|117608337|gb|ABK43792.1| DNA adenine methylase [Magnetococcus sp. MC-1] (288 aa)
Score = 340, Expect = 5.1e-30, Identities = 100/298 (33%), Positives = 148/298 (49%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDINKK 353
           KPF+KW GGK  L  ++  Y+P    +   Y EPF+GGG+V F +  K  +    +SD N  L+N +  I+   K  + V Q + +   + NT          K  F  ++  +        +AA  I+LNKTCF GL+RVNKKG FNV  G Y+  +  D  NL A++  ++ V+I   D++ +     K  FVY DPPY      S F  Y    FN+ +   LA    +L+ KG     SNS       N  F   +Y+  +I  + A+R IN +  +R  I ELLI+N+++  K
  S:    16 KPFIKWAGGKQALAQKLIDYFP---EKFNVYYEPFLGGGSVFFYIRPKSAL----LSDYNEWLVNTFQAIQ---KNWVTVYQNLVE---IENT----------KETFLHVRSIDPFSVDLFTRAAYFIYLNKTCFRGLFRVNKKGGFNVPYGSYQR-RYADPDNLHAVANSIQGVDIQAVDFEMALGNTKKGDFVYLDPPYYKFGGYSDFNRYTDQQFNEGDHYRLASVCYELSRKGVYWAQSNS-------NTPFIRSLYAEDSIIEIPARREINLNSGAR-NITELLITNYEVANK 281
>gi|79835551|gb|ABB52100.1| Mod [Arthrospira platensis] (176 aa)
Score = 338, Expect = 7.6e-30, Identities = 74/173 (42%), Positives = 111/173 (64%)
  Q:   176 VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +++AA +I+LNKTCFNGLYR N++G FNV MG YKNPKIC    L   SK L++  +    ++    E      FVYFDPPY P++ TS+FT+Y++  F    Q++LA+    L+ +G K++LSNSD +          ++Y  +NI  ++A R INS+  +RG+I ELLI+++
  S:    10 LDQAARLIYLNKTCFNGLYRENRQGQFNVPMGKYKNPKICPRELLITASKTLQSATLKVQSFEAIVNEANSAADFVYFDPPYHPLSPTSNFTSYSRHKFGVDKQEKLAEIFGILHKRGVKVMLSNSDTE-------LIRDLYKDFNIHPIQAGRAINSNPQNRGKITELLITSY 176
>gi|194538509|ref|YP_002073593.1| DNA adenine methylase subfamily [Vibrio sp. Ex25] >gi|151937064|gb|EDN55941.1| DNA adenine methylase subfamily [Vibrio sp. Ex25] (275 aa)
Score = 338, Expect = 7.9e-30, Identities = 92/289 (31%), Positives = 149/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKL-NNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +I+++ P       K  EPFVG G+V  +     +     ++DIN +LIN+Y+++K + +E I      E        ++RK  YL  +  FN+  +        + ++   +++N+  FNGL R NKKG FNV  G YK P   +   LE  ++K K    V   Y ++     K + VY DPPY P+++T++FT+Y  + F   +Q  LAD   +    +G  +L+SN D        +    +Y   ++  VK KR I+ +GS R +++ELL
  S:     5 RAFLKWAGGKYGLVEDIQRHLP----PARKLVEPFVGAGSVFLNT----DYDHYLLADINPDLINLYNLLKERPEEYIS-----EAKRWFVAENNRKEAYLHIRAEFNKTDDV-------MYRSLAFLYMNRFGFNGLCRYNKKGGFNVPFGSYKKPYFPEA-ELEFFAEKAKKATFVCEGYPETFRRARKGSVVYCDPPYAPLSNTANFTSYAGNGFTLDDQAALADIAERTATERGIPVLISNHD-------TTLTRRLYHGADLNVVKVKRTISRNGSGRNKVDELL 266
>gi|33151643|ref|NP_872996.1| DNA adenine methylase [Haemophilus ducreyi 35000HP] >gi|33147864|gb|AAP95385.1| DNA adenine methylase [Haemophilus ducreyi 35000HP] (278 aa)
Score = 338, Expect = 8.3e-30, Identities = 98/297 (32%), Positives = 152/297 (51%)
  Q:    48 INNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDV-EKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNT---FVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +NNN    + FLKW GGK +L  EI+K+ P  + Q   + EPFVG G+V  +           ++DIN++LIN+++ IK  V+  I   +++   FL  N +   +YY          K +E N   D+  ++ L ++LN+  FNGL R NKK  +NV  G YK P   +   L   + K +    +  D++   E+I +N     VY DPPY P+   S+FT Y    F+   Q+ L  +  +   K   +L+SN D        +F  +IY    IK++K +R I  +  SR ++NELL
  S:     1 MNNNQ---RAFLKWAGGKYRLSIEIRKFLPPQSTQGVCFVEPFVGAGSVFLNT----HYDRYLLADINSDLINLFNTIKQDVERYITQSKLI---FLSPNANTALYYY---------AKRQEFNHSTDIFHRSVLFLYLNRFGFNGLCRYNKKNEYNVPFGRYKKPYFPEK-ELRFFAAKAQKAQFICADFEHIFEYIYQNPDNYIVYCDPPYAPLEQESNFTHYASGGFSLAQQELLVKHAKQAQQKQIPVLISNHD-------TAFTRKIYHGAQIKKIKVQRSIGKNAKSRIKVNELL 274
>gi|156936454|ref|YP_001440370.1| DNA adenine methylase [Enterobacter sakazakii ATCC BAA-894] >gi|156534708|gb|ABU79534.1| hypothetical protein ESA_04355 [Enterobacter sakazakii ATCC BAA-894] (272 aa)
Score = 338, Expect = 9.5e-30, Identities = 90/289 (31%), Positives = 156/289 (53%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKS--EEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  LL++IK++ P     I    EPFVG G+V  +   S+Y      +SDIN++LI++Y+ +K K  + +   +++   F   +     +Y L  +  FN+ ++       +  +A L ++LN+  +NGL R N +G FNV  G YK P   +T  L   +++ +N   +   Y  S      + +  VY DPPY P+++T++FTAY+ + FN + Q+ LA     L ++   +L+SN D +          + Y    + +V+ +R I+S+G +R +++ELL
  S:     5 RAFLKWAGGKYPLLDDIKRHLPEGECLI----EPFVGAGSVFLNTDYSRY-----VLSDINSDLISLYTTVKDKTDDYVSEARLL---FTAEHNQAEVYYQL--REEFNQSRD-------EFRRALLFLYLNRHGYNGLCRYNLRGEFNVPFGRYKKPYFPET-ELYHFAERAQNALFICESYDASMARAQQENSAVVYCDPPYAPLSATANFTAYHTNSFNLEQQRHLAQLAEGLQSQRIPVLISNHDTE-------LTRQWYQQAKLHKVRVRRSISSNGGTRRKVDELL 267
>gi|77973267|ref|ZP_00828817.1| COG0338: Site-specific DNA methylase [Yersinia frederiksenii ATCC 33641] (279 aa)
Score = 337, Expect = 9.9e-30, Identities = 89/295 (30%), Positives = 150/295 (50%)
  Q:    52 LQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSD-PKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLIS 346
           +++ +  LKW G K +++  + ++ P       +  EPF G  +V+ +     +  E  I+DIN++LIN Y + K +  ELI V   +   FL  N+ ++  YY+ +K  FN   +  D    D+ +AA+ ++LN+ CFNG+ R N++G FNV  G YK P   +   +   ++K K    +  D+ ++ E       +Y DPPY P++ST+ FT Y+ + FN   Q  LA  + +    G  ++ SNSD P   D        +YS Y +  + A R I+     R  I E++ +
  S:     6 MKINRSPLKWAGSKARIMPILLQHLPTGK----RLVEPFAGSCSVMLNT----DYDEYLITDINSDLINFYEIAKRETSELINVASSL---FLTANSHEQ--YYIFRK-IFN--AQNHD----DISRAAIFLYLNRHCFNGICRYNQQGQFNVPYGKYKAPYFPEA-EIRFFAEKAKKATFLCCDFSEALEMTVAGDVIYCDPPYIPVSSTADFTHYHTEGFNADQQFRLARLLARAGENGCHVVASNSDTPITRD--------LYSRYTLHSITAPRSISCKSDGRKSIGEIIAT 272
>gi|145628517|ref|ZP_01784317.1| DNA adenine methylase [Haemophilus influenzae 22.1-21] >gi|144978987|gb|EDJ88673.1| DNA adenine methylase [Haemophilus influenzae 22.1-21] (286 aa)
Score = 336, Expect = 1.6e-29, Identities = 96/289 (33%), Positives = 149/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNN-KGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +PFLKW GGK +L +EI K +P   N +    EPFVG GA+  +  S +E     ++DIN +LIN+++++K  V+  I       K     +  +   YY  K+ +FN   +         E++ + ++LN+  FNGL R N K  FNV  G YK     +   L   + K ++   +  D++K+ EF DK++ +Y DPPY P+   ++FT Y  + F    Q+ LAD    +   K   IL+SN D K       F  EIY+    KRVK +R I+ +   R ++ EL+
  S:    16 RPFLKWAGGKFRLTDEINKAFPNKKNCLI---EPFVGAGAIFLN--SNFE--RYILADINPDLINLFNIVKENVEGYIEDC----KPIFFADDANTPDYYYAKRRQFNASTDP-------FERSIIFLYLNRFGFNGLCRYNSKNEFNVPFGAYKTHYFPED-ELRYFAHKAQSAVFLCCDFQKTFEFADKDSVIYCDPPYAPLQQETNFTGYAGNEFGLAQQRALADLAKSIQKEKQISILISNHDTK-------FTREIYNGAKFKRVKVQRSISQNPEKRVKVKELI 279
>gi|156972405|ref|YP_001443312.1| DNA adenine methylase [Vibrio harveyi ATCC BAA-1116] >gi|156523999|gb|ABU69085.1| hypothetical protein VIBHAR_00025 [Vibrio harveyi ATCC BAA-1116] (279 aa)
Score = 335, Expect = 1.7e-29, Identities = 92/289 (31%), Positives = 148/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINK-LNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +I+++ P       K  EPFVG G+V  +     +     ++DIN +LIN+Y+++K + +E I      E        ++RK  YL  +  FN+  +        + ++   +++N+  FNGL R NKKG FNV  G YK P   +   LE  ++K K    V   Y ++     K + VY DPPY P+++T++FT+Y  + F   +Q  LAD   +    +G  +L+SN D        +    +Y    +  VK KR I+ +GS R +++ELL
  S:     5 RAFLKWAGGKYGLVEDIQRHLP----PARKLVEPFVGAGSVFLNT----DYDHYLLADINPDLINLYNLLKERPEEYIS-----EAKRWFVAENNRKEAYLDIRAEFNKTDDV-------MYRSLAFLYMNRFGFNGLCRYNKKGGFNVPFGSYKKPYFPEA-ELEFFAEKAKKATFVCEGYPETFSRARKGSVVYCDPPYAPLSNTANFTSYAGNGFTLDDQAALADIAERAATERGIPVLISNHD-------TTLTRRLYHGAELNVVKVKRTISRNGSGRNKVDELL 266
>gi|56414727|ref|YP_151802.1| putative phage gene [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|56128984|gb|AAV78490.1| putative phage gene [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (270 aa)
Score = 335, Expect = 1.7e-29, Identities = 82/247 (33%), Positives = 137/247 (55%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNP-----KICDTLNLEAISKKLKNVNIVYGDYKKSEEFI-DKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSD 301
           VK  LKWVG K +L+ +++++ P    +  +  EPF G  AV+ +     +  E  I+D+N +L+N+Y  + Y    L+  L+ +     L + + R  +Y   ++ FN   +   ++   VE AA  ++LN+ CFNGL R N++G FNV  G YK P     +IC      A ++K K    +  DY ++ + + D N  VY DPPY  +T + +FTAY++  F+  +Q  LA  + +L  +G +++ SNSD
  S:     3 VKTPLKWVGSKARLMPKLRQHLP----EGKRLVEPFAGSCAVMMNT----DYDEYLIADVNPDLVNLYKAMAYHTDALLNELESLFTAGSLGDEESRAVFYYAVRDAFNLSGKSFGSE--SVEAAARFLYLNRHCFNGLCRYNRRGQFNVPFGKYKKPYFPADEIC------AFAEKAKRATFITADYSETLDLVRDGNDVVYCDPPY--LTDSDNFTAYHERGFSHMDQGRLARKLRRLAERGVQVVASNSD 237
>gi|42629123|ref|ZP_00154672.1| COG0338: Site-specific DNA methylase [Haemophilus influenzae R2846] (286 aa)
Score = 335, Expect = 1.7e-29, Identities = 97/289 (33%), Positives = 148/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNN-KGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +PFLKW GGK +L +EI K +P   N +    EPFVG GAV  +  S +E     ++DIN +LIN+++++K  V   I       K     +  +   YY  K+ +FN   +         E++ + ++LN+  FNGL R N K  FNV  G YK     +   L   + K ++   +  D++K+ EF DK++ +Y DPPY P+   ++FT Y  + F    Q+ LAD    +   K   IL+SN D K       F  EIY+    KRVK +R I+ +   R ++ EL+
  S:    16 RPFLKWAGGKFRLTDEINKAFPNKKNCLI---EPFVGAGAVFLN--SNFE--RYILADINPDLINLFNIVKENVDGYIEDC----KPIFFADDANTPDYYYAKRRQFNASTDP-------FERSIIFLYLNRFGFNGLCRYNSKNEFNVPFGAYKTHYFPED-ELRYFAHKAQSAVFLCCDFQKTFEFADKDSVIYCDPPYAPLQQETNFTGYAGNEFGLAQQRALADLAKSIQKEKQISILISNHDTK-------FTREIYNGAKFKRVKVQRSISQNPEKRVKVKELI 279
>gi|86132271|ref|ZP_01050866.1| modification methylase, type II R/M system 2 [Cellulophaga sp. MED134] >gi|85817190|gb|EAQ38373.1| modification methylase, type II R/M system 2 [Dokdonia donghaensis MED134] (289 aa)
Score = 335, Expect = 2.1e-29, Identities = 99/304 (32%), Positives = 159/304 (52%)
  Q:    45 KVEINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           KV +    + +KPF++W GGK +L+NEI  +     N I ++ EPF+GG +       K + K  ++SD+N  LIN Y  IK   + +   L     +F    TD    YY I+    +E      +Q L  E+A   IFLN+T FNG+YRVNK G +NV  G   NP      +L+ +S+KL++  + +  Y   E+F  +   +Y DPPY  ++ T+ F  Y  D F+  +Q++LA++    ++KG K+++SN+D ++          +Y  + I    A R I+     R ++ EL+I NF
  S:    13 KVNLEKENKSLKPFIRWAGGKQKLINEI--FSNLDLNNIDRFFEPFLGGASFFL----KSDFKHSFLSDLNPNLINCYEQIKNDPQSIFNELT----EFKTPVTDSM--YYDIR----DEFNRHSGDQTL--EQAVRFIFLNRTSFNGIYRVNKSGKYNVPFGK-ANPAFSSLDHLKDVSQKLQSATLSFDYYDSIEDFTQQGDLIYLDPPYPKLSDTAYFNHYTLDKFDQNSQEDLANFAKIQSDKGCKVVISNADLED-------IRSMYKDWEIIECSAYRFISCK-KERIKVKELIIKNF 289
>gi|148979187|ref|ZP_01815366.1| site-specific DNA methylase [Vibrionales bacterium SWAT-3] >gi|145961945|gb|EDK27235.1| site-specific DNA methylase [Vibrionales bacterium SWAT-3] (281 aa)
Score = 334, Expect = 2.3e-29, Identities = 95/289 (32%), Positives = 150/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINK-LNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +I+++ P       K  EPFVG G+V  +  + YE  +  ++DIN +LIN+Y+++K       P   I E        ++RK  +L  + +FN+     DN      ++   +++N+  FNGL R NKKG FNV  G YK P   +   LE  ++K K    V   Y ++     K   VY DPPY P+++T++FT+Y  + F+  +Q  LAD   K    +G  +L+SN D        +    +Y    +  VK KR I+ +G+ R +++ELL
  S:     5 RAFLKWAGGKYGLVEDIQRHLP----PARKLVEPFVGAGSVFLN--TDYE--QYLLADINPDLINLYNLLKTD-----PETYIAEAKRWFCPENNRKEVFLDIRAQFND----TDNVMY---RSLAFLYMNRFGFNGLCRYNKKGGFNVPFGSYKKPYFPEA-ELEFFAEKAKKATFVCEGYHETFSRARKGCVVYCDPPYAPLSNTANFTSYAGNGFSLDDQAALADVAEKAATERGIPVLISNHD-------TTLTRRLYHGAELNVVKVKRTISRNGAGRNKVDELL 266
>gi|126506729|gb|ABO14793.1| DNA adenine methylase [Vibrio harveyi] (279 aa)
Score = 334, Expect = 2.5e-29, Identities = 93/289 (32%), Positives = 148/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINK-LNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +I+++ P       K  EPFVG G+V  +     +     ++DIN +LIN+Y+++K + +E I      E        ++RK  YL  +  FN+  +        + ++   +++N+  FNGL R NKKG FNV  G YK P   +   LE  ++K K    V   Y ++     K + VY DPPY P+++T++FT+Y  + F   +Q  LAD   K    +G  +L+SN D        +    +Y    +  VK KR I+ +GS R +++ELL
  S:     5 RAFLKWAGGKYGLVEDIQRHLP----PARKLVEPFVGAGSVFLNT----DYDHYLLADINPDLINLYNLLKERPEEYIS-----EAKRWFVAENNRKEAYLNIRAEFNKTDDV-------MYRSLAFLYMNRFGFNGLCRYNKKGGFNVPFGSYKKPYFPEA-ELEFFAEKAKKATFVCEGYPETFSRARKGSVVYCDPPYAPLSNTANFTSYAGNGFTLDDQAALADIAEKAATERGIPVLISNHD-------TTLTRRLYHGAELNVVKVKRTISRNGSGRNKVDELL 266
>gi|68248814|ref|YP_247926.1| DNA adenine methylase [Haemophilus influenzae 86-028NP] >gi|68057013|gb|AAX87266.1| DNA adenine methylase [Haemophilus influenzae 86-028NP] (286 aa)
Score = 334, Expect = 2.7e-29, Identities = 96/289 (33%), Positives = 149/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNN-KGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +PFLKW GGK +L +EI K +P   N +    EPFVG GA+  +  S +E     ++DIN +LIN+++++K  V+  I       K     +  +   YY  K+ +FN   +         E++ + ++LN+  FNGL R N K  FNV  G YK     +   L   + K ++   +  D++K+ EF DK++ +Y DPPY P+   ++FT Y  + F    Q+ LAD    +   K   IL+SN D K       F  EIY+    KRVK +R I+ +   R ++ EL+
  S:    16 RPFLKWAGGKFRLTDEINKAFPNKKNCLI---EPFVGAGAIFLN--SNFE--RYILADINPDLINLFNIVKENVEGYIEDC----KPIFFADDANTPDYYYAKRRQFNASTDP-------FERSIIFLYLNRFGFNGLCRYNSKNEFNVPFGAYKTHYFPED-ELRYFAHKAQSAVFLCCDFQKTFEFADKDSVIYCDPPYAPLQQETNFTGYAGNEFGLVQQRALADLAKSIQKEKQISILISNHDTK-------FTREIYNGAKFKRVKVQRSISQNPEKRVKVKELI 279
>gi|168243783|ref|ZP_02668715.1| hypothetical protein Senterienterica_19232 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|194448051|ref|YP_002045004.1| retron EC67 DNA adenine methylase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194406355|gb|ACF66574.1| retron EC67 DNA adenine methylase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (289 aa)
Score = 333, Expect = 2.9e-29, Identities = 88/291 (30%), Positives = 145/291 (49%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD-VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYS--AYNIKRVKAKRMINSDGSSRGEINELLIS 346
           +PFLKW GGK  +L ++ +  P     I    EPFVGGG+V    L+  +     ++D+N +LIN+Y ++      ++P   I     +    +D + Y          L+E+ + Q +D  E+AA  +FLN+ CFNGL R N    FNV  G Y +P   +   + A ++   N   +   ++++     +   VY DPPY P+  T+ FT+Y    F+  +Q  LA+     + +G K+ +SNS             E+Y    + + RV A+R I+S GS+R   N+++ S
  S:    21 RPFLKWAGGKYSMLPDLYQIIPAGMRLI----EPFVGGGSVF---LNSDKHACFLLADVNTDLINLYQMLA-----VVPDTVIRHARVMFDRLNDAESYM--------ALREEFNAQVMDGPERAAAFLFLNRHCFNGLIRYNSNNQFNVGWGKYPSPYFPEE-EIRAFTEMAHNCVFMAAGFRQTLALAGEGDVVYCDPPYEPMPGTAGFTSYASGGFSWDSQVALAESCVAAHQRGAKVFISNSTAPR-------VIELYERHGFTLHRVNARRSISSKGSTRETANDIVAS 286
>gi|42630512|ref|ZP_00156051.1| COG0338: Site-specific DNA methylase [Haemophilus influenzae R2866] >gi|145639732|ref|ZP_01795334.1| GTP cyclohydrolase II [Haemophilus influenzae PittII] >gi|145271100|gb|EDK11015.1| GTP cyclohydrolase II [Haemophilus influenzae PittII] (286 aa)
Score = 333, Expect = 3.2e-29, Identities = 96/289 (33%), Positives = 149/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNN-KGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +PFLKW GGK +L +EI K +P   N +    EPFVG GA+  +  S +E     ++DIN +LIN+++++K  V+  I       K     +  +   YY  K+ +FN   +         E++ + ++LN+  FNGL R N K  FNV  G YK     +   L   + K ++   +  D++K+ EF DK++ +Y DPPY P+   ++FT Y  + F    Q+ LAD    +   K   IL+SN D K       F  EIY+    KRVK +R I+ +   R ++ EL+
  S:    16 RPFLKWAGGKFRLTDEINKAFPNKKNCLI---EPFVGAGAIFLN--SNFE--RYILADINPDLINLFNIVKENVEGYIEDC----KPIFFADDANTPDYYYAKRRQFNASTDP-------FERSIIFLYLNRFGFNGLCRYNSKNEFNVPFGAYKTHYFPED-ELRYFAYKAQSAVFLCCDFQKTFEFADKDSVIYCDPPYAPLQQETNFTGYAGNEFGLAQQRALADLAKSIQKEKQISILISNHDTK-------FTREIYNGAKFKRVKVQRSISQNPEKRVKVKELI 279
>gi|74313892|ref|YP_312311.1| DNA adenine methylase [Shigella sonnei Ss046] >gi|194434647|ref|ZP_03066902.1| DNA adenine methylase [Shigella dysenteriae 1012] >gi|73857369|gb|AAZ90076.1| DNA adenine methylase [Shigella sonnei Ss046] >gi|194417106|gb|EDX33220.1| DNA adenine methylase [Shigella dysenteriae 1012] (278 aa)
Score = 333, Expect = 3.2e-29, Identities = 91/289 (31%), Positives = 149/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  LL++IK++ P     +    EPFVG G+V  +   S+Y      ++DIN++LI++Y+++K +  E +       ++  +  T+  + YY     +F E   K  + F    +A L ++LN+  +NGL R N +G FNV  G YK     +   L   ++K +N       Y  S    D  + VY DPPY P+++T++FTAY+ + F  + Q  LA+    L  +   +L+SN D            E Y    +  VK +R I+S+G +R +++ELL
  S:     5 RAFLKWAGGKYPLLDDIKRHLPKGECLV----EPFVGAGSVFLNTDFSRY-----ILADINSDLISLYNIVKMRTDEYVQA----ARELFVPETNCAEVYY-----QFREEFNKSQDPF---RRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKTYFPEA-ELYHFAEKAQNAFFYCESYADSMARADDASVVYCDPPYAPLSATANFTAYHTNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTM-------LTREWYQRAKLHVVKVRRSISSNGGTRKKVDELL 265
>gi|92113494|ref|YP_573422.1| DNA adenine methylase [Chromohalobacter salexigens DSM 3043] >gi|91796584|gb|ABE58723.1| DNA adenine methylase [Chromohalobacter salexigens DSM 3043] (270 aa)
Score = 333, Expect = 3.5e-29, Identities = 90/294 (30%), Positives = 155/294 (52%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLIS 346
           Q+V PFLKW GGK  L+ +  + +P    +   Y EPF+G G+V F +    + ++  +SD N ELI  Y  ++ + +    +++ + K +  +++++  +YY ++     +   K++      E AA MI+LN+TC+NGLYRVN  G FNV  G   N  + DT N    +K L+   I + D+++  +   +N FV+ DPPY    + + F  YN+ LF+  +Q  L   I++  ++G K+LL+N++      +DS  D      N   +    +++     RG+  EL IS
  S:     4 QIVLPFLKWAGGKRWLVRDHPEIFP---TEFNTYIEPFLGSGSVFFHL----QPQQALLSDANQELITTYRALRNRNR----MVENLLKSYHEQHSEE--FYYFMRA----QTPTKQE------EIAARMIYLNRTCWNGLYRVNLSGKFNVPKGTKSN-VVLDTDNFRETAKLLRRSVITHSDFEEIVDAAQENDFVFVDPPYTVKHNCNGFVKYNEKLFSWDDQVRLKHAIDRATDRGAKVLLTNAN------HDSILDLYKDYVNHSTLTRSSVLSGKSEHRGKYEELTIS 267
>gi|146313432|ref|YP_001178506.1| DNA adenine methylase [Enterobacter sp. 638] >gi|145320308|gb|ABP62455.1| DNA adenine methylase Dam [Enterobacter sp. 638] (288 aa)
Score = 332, Expect = 3.9e-29, Identities = 95/289 (32%), Positives = 150/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD-VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  LL++IKK+ P     I    EPFVG G+V  +   S+Y      ++DIN++LI++Y+++K +  E +       +      T+  + YY ++          E NQ  D   +A L ++LN+  +NGL R N +G FNV  G YK P       L   ++K +N   +   Y  S    D  + VY DPPY P+T+T++FTAY+ + FN + Q  LA+    L  K   +L+SN D + + +        Y       V+ +R I+S+G +R +++ELL
  S:    22 RAFLKWAGGKFPLLDDIKKHLPKGECLI----EPFVGAGSVFLNTDFSRY-----ILADINSDLISLYNIVKDRTDEYVD----EARKLFTPETNQSEVYYQLRV---------EFNQSSDPFRRALLFLYLNRHGYNGLCRYNLRGEFNVPFGRYKRPYFPQA-ELYHFAEKAQNALFICESYADSMARADHQSVVYCDPPYAPLTATANFTAYHTNSFNLKEQVHLAEIAEGLVKKRIPVLISNHDTEMTREWYQLATHRYV------VQVRRSISSNGGTRKKVDELL 283
>gi|77163875|ref|YP_342400.1| DNA adenine methylase [Nitrosococcus oceani ATCC 19707] >gi|76882189|gb|ABA56870.1| DNA adenine methylase [Nitrosococcus oceani ATCC 19707] (277 aa)
Score = 332, Expect = 3.9e-29, Identities = 87/289 (30%), Positives = 136/289 (47%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +PFLKW G K +LL  I    P     I    EPF G  A+  +     E +  +++DIN +LI +Y +++ + KE I     +   F   N   + +Y L  + RFN   +         EKAAL ++LN+  +NGL R +  G+FNV  G Y+ P    +  + A   K +       D++K    I + T VY DPPY P++ T+ FT Y+ + F  + QK L     +L  +G  +L+SN D  +         + Y    +      R+I+  G+ R   NE+L
  S:    13 RPFLKWAGNKYRLLTRIISVLPPGKRLI----EPFAGSAALFLNA----EYERYWVNDINPDLIALYQILQKEGKEFIHYAGCL---FTPHNNTPKAYYRL--RARFNTTADV-------AEKAALFVYLNRHGYNGLCRYSGSGIFNVPFGRYQRPYF-PSKEMMAFHIKARRARFTCLDFRKVLARIRRGTIVYADPPYTPLSQTACFTHYSGNGFGPEEQKALTQSAQRLAKRGIPVLISNHDTPS-------VRQAYRNAQLTGFSVTRLISCKGTQRTPANEVL 273
>gi|145633782|ref|ZP_01789506.1| GTP cyclohydrolase II [Haemophilus influenzae 3655] >gi|145635645|ref|ZP_01791342.1| DNA adenine methylase [Haemophilus influenzae PittAA] >gi|144985353|gb|EDJ92183.1| GTP cyclohydrolase II [Haemophilus influenzae 3655] >gi|145267118|gb|EDK07125.1| DNA adenine methylase [Haemophilus influenzae PittAA] (286 aa)
Score = 331, Expect = 5.6e-29, Identities = 96/289 (33%), Positives = 147/289 (50%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNN-KGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +PFLKW GGK +L ++I K +P   N +    EPFVG GAV  +  S +E     ++DIN +LIN+++++K  V   I       K     +  +   YY  K+  FN   +         E++ + ++LN+  FNGL R N K  FNV  G YK     +   L   + K ++   +  D++K+ EF DK++ +Y DPPY P+   ++FT Y  + F    Q+ LAD    +   K   IL+SN D K       F  EIY+    KRVK +R I+ +   R ++ EL+
  S:    16 RPFLKWAGGKFRLTDDINKAFPNKKNCLI---EPFVGAGAVFLN--SNFE--RYILADINPDLINLFNIVKENVDGYIEDC----KPIFFADDANTPDYYYTKRREFNASTDP-------FERSIIFLYLNRFGFNGLCRYNSKNEFNVPFGAYKTHYFPED-ELRYFAHKAQSAVFLCCDFQKTFEFADKDSVIYCDPPYAPLQQETNFTGYAGNEFGLMQQRALADLAKSIQKEKQIPILISNHDTK-------FTREIYNGAKFKRVKVQRSISQNPEKRVKVKELI 279
>gi|89075211|ref|ZP_01161642.1| putative DNA adenine methylase [Photobacterium sp. SKA34] >gi|89049033|gb|EAR54600.1| putative DNA adenine methylase [Photobacterium sp. SKA34] (285 aa)
Score = 331, Expect = 5.7e-29, Identities = 93/289 (32%), Positives = 150/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINK-LNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +IK++ P       K  EPFVG G+V  +     +     ++DIN +LIN+Y+++K++     P   + +   L     + K  YL  +  FN      D+ +L   ++   +++N+  FNGL R NKKG FNV  G YK P   +   +   S+K K    V   Y ++     K   VY DPPY P++ST++FT+Y+ + F+  +Q  LAD   K    +   +L+SN D   + +       +Y+  ++  VK KR I+ +GS R +++ELL
  S:     5 RAFLKWAGGKYSLVEDIKRHLP----PARKLVEPFVGAGSVFLNT----DYDHYLLADINPDLINLYNILKHE-----PERYVEDARKLFTPEYNNKEAYLKIREEFN----ASDDPYL---RSLYFLYMNRHGFNGLCRYNKKGGFNVPFGSYKKPYFPEA-EMYYFSEKAKRATFVCEGYLQTFSRARKGCVVYCDPPYAPLSSTANFTSYSGNGFSLDDQATLADVAEKAAAERDIAVLISNHDTALTRR-------LYTGADLSVVKVKRTISRNGSGRNKVDELL 266
>gi|91227279|ref|ZP_01261704.1| DNA adenine methylase [Vibrio alginolyticus 12G01] >gi|91188673|gb|EAS74962.1| DNA adenine methylase [Vibrio alginolyticus 12G01] (279 aa)
Score = 330, Expect = 6.3e-29, Identities = 91/289 (31%), Positives = 149/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKL-NNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +I+++ P       K  EPFVG G+V  +     +     ++DIN +LIN+Y+++K + +E I      E        ++RK  YL  +  FN+  +        + ++   +++N+  FNGL R NKKG FNV  G YK P   +   LE  ++K K    V   Y ++     K + VY DPPY P+++T++FT+Y  + F   +Q  LAD   +    +G  +L+SN D        +    +Y   ++  VK KR I+ +G+ R +++ELL
  S:     5 RAFLKWAGGKYGLVEDIQRHLP----PARKLVEPFVGAGSVFLNT----DYDHYLLADINPDLINLYNLLKERPEEYIS-----EAKRWFVAENNRKEAYLHIRAEFNKTDDV-------MYRSLAFLYMNRFGFNGLCRYNKKGGFNVPFGSYKKPYFPEA-ELEFFAEKAKKATFVCEGYPETFRRARKGSVVYCDPPYAPLSNTANFTSYAGNGFTLDDQAALADIAERTATERGIPVLISNHD-------TTLTRRLYHGADLNVVKVKRTISRNGNGRNKVDELL 266
>gi|84390815|ref|ZP_00991507.1| site-specific DNA methylase [Vibrio splendidus 12B01] >gi|84376618|gb|EAP93495.1| site-specific DNA methylase [Vibrio splendidus 12B01] (282 aa)
Score = 330, Expect = 6.9e-29, Identities = 92/289 (31%), Positives = 147/289 (50%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +I+++ P       K  EPFVG G+V  +     + ++  ++DIN +LIN+Y+++K       P   I E        ++R+  +L  +  FN      DN      ++   +++N+  FNGL R NKKG FNV  G YK P   +   LE  ++K K    V   Y ++     K   VY DPPY P++ST++FT+Y  + F+  +Q  LAD   +    +G  +L+SN D        +    +Y    +  VK KR I+ +G+ R +++ELL
  S:     5 RAFLKWAGGKYGLVEDIQRHLP----PARKLVEPFVGAGSVFLNT----DFEQYLLADINPDLINLYNLLKTD-----PETYITEAKRWFCPENNRREVFLDVRAEFN----GTDNVMY---RSLAFLYMNRFGFNGLCRYNKKGGFNVPFGSYKKPYFPEA-ELEFFAEKAKKATFVCEGYSETFSRARKGCVVYCDPPYAPLSSTANFTSYAGNGFSLDDQAALADVAERAAMERGIPVLISNHD-------TTLTRRLYHGAELNVVKVKRTISRNGAGRNKVDELL 266
>gi|1169356|sp|P45454|DMA_SERMA DNA adenine methylase (M.SmaII) (Deoxyadenosyl-methyltransferase) (DNA adenine methyltransferase) >gi|498768|emb|CAA55177.1| Deoxyadenosyl-methyltransferase [Serratia marcescens] (270 aa)
Score = 329, Expect = 8.6e-29, Identities = 90/289 (31%), Positives = 154/289 (53%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKG-TKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L++EI+++ P  +  I    EPFVG G+V  +     +     ++DIN++LIN+Y+++K +  + +   + +  D    N+D    +YL+++  FN   E          +A L ++LN+ C+NGL R N +G FNV  G YK P   +   L   ++K +N   V   Y+ +         VY DPPY P+++T++FTAY+ + F+  +Q+ LA   ++L+ +    +L+SN D +          + Y    +  VKA+R I+ +   R ++NELL
  S:     5 RAFLKWAGGKYPLVDEIRRHLPAGDCLI----EPFVGAGSVFLNT----DYDAYILADINSDLINLYNIVKLRTDDFVRDARTLFAD-EFNNSDQ---FYLLRE-EFNTSTEP-------YRRALLFLYLNRHCYNGLCRYNLRGEFNVPFGRYKKPYFPEE-ELYWFAEKSRNATFVCEHYRDTMAKAAAGAVVYCDPPYAPLSATANFTAYHTNSFSIADQQSLAHLAHQLSVESRVPVLISNHDTE-------LTRDWYQHAALYVVKARRTISRNILGRSKVNELL 266
>gi|117617792|ref|YP_857677.1| DNA adenine methylase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117559199|gb|ABK36147.1| DNA adenine methylase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (290 aa)
Score = 329, Expect = 8.7e-29, Identities = 93/293 (31%), Positives = 144/293 (49%)
  Q:    52 LQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYI-NKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           ++  + FLKW GGK  L+ EI +  P     +    EPFVG G+V  +     +     ++DIN +LI +Y+ +K     L P   I E   L     + K  Y   + +FN+     D  F   E+A L +FLN+  FNGL R NKKG FNV  G YK P   +   L A ++K +    +   Y  + +  +++  +Y DPPY P+++T+SFT Y+   F   +Q  LA    +    KG  +L+SN D +          E+Y    +  +  KR I+ +G +R ++ ELL
  S:     1 MKKTRAFLKWAGGKYSLVEEIAERLPAGRVLL----EPFVGAGSVFLNT----DYDAYVLNDINPDLIGLYNHLK-----LTPDRFIAESRKLFVTEHNHKAAYYRLRTQFNQ----TDTSF---ERALLFLFLNRHGFNGLCRYNKKGGFNVPFGSYKKPYFPEK-ELWAFAEKAQKATFICESYADAIQRAEEDWVIYCDPPYAPLSTTASFTTYSAGGFTLDDQAVLARLARHTAARKGVPVLISNHDIE-------LTRELYRGARLDEILVKRTISRNGGTRNKVAELL 266
>gi|50123010|ref|YP_052177.1| DNA adenine methylase [Pectobacterium atrosepticum SCRI1043] >gi|49613536|emb|CAG76987.1| DNA adenine methylase [Erwinia carotovora subsp. atroseptica SCRI1043] (270 aa)
Score = 329, Expect = 8.7e-29, Identities = 89/289 (30%), Positives = 152/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ EI++Y P  +  I    EPFVG G+V  +     E     ++DIN++LIN+Y+++K    E +   + +  D      +  + +YL+++  FN  ++          +A L ++LN+ C+NGL R N +G FNV  G YK P   +   +   + K +N   +   Y+ + E  +K + +Y DPPY P+++T++FTAY+ + F+  +Q+ LA    +L+      +L+SN D            E Y    +  VKA+R I+ +   R +++ELL
  S:     5 RAFLKWAGGKYPLVEEIRRYLPAGDCLI----EPFVGAGSVFLNT----EYDRYILADINSDLINLYNIVKSNADEFVTDARKLFTD----EVNTSETFYLLRE-EFNLCRDA-------YRRALLFLYLNRHCYNGLCRYNMRGEFNVPFGRYKKPYFPEE-EIRWFALKAQNATFICEHYQDTLEKAEKGSVIYCDPPYAPLSATANFTAYHTNNFSRADQQSLALLARRLSVESQIPVLISNHD-------TLLTREWYQEAVLYVVKARRTISRNILGRSKVSELL 266
>gi|77361627|ref|YP_341202.1| DNA adenine methylase [Pseudoalteromonas haloplanktis TAC125] >gi|76876538|emb|CAI87760.1| DNA adenine methylase [Pseudoalteromonas haloplanktis TAC125] (285 aa)
Score = 329, Expect = 9.3e-29, Identities = 94/292 (32%), Positives = 148/292 (50%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           Q  + FLKW GGK  L+ +I       + Q     EPFVG G+V  +     + K   ++DINA+LIN+Y  +K    E I   + +  D  L N  D  + Y ++ N+ +++           E+A L +++N+  +NGL R N KG+FNV  G YK P   +   +   +KK +       DY    + + KN  +Y DPPY P++ T+SFT+Y K  FN  +Q  LA+   +      T +L+SN D   + K       IYS   + +++ KR I+  G SR +++EL+
  S:     3 QKSRAFLKWAGGKYSLVEDINARLKQASQQADTLVEPFVGAGSVFLNS----DFKHYILNDINADLINLYKELKNSPDEFISDAKKLFVD--LNNHPDAYYEYRVQFNQSSDI----------YERAMLFLYMNRHGYNGLCRYNLKGIFNVPFGKYKKPYFPEK-EMYFFAKKAQQATFTCLDYDDIFKLVPKNAVIYCDPPYVPLSKTASFTSYAKGGFNLDDQANLANLAEQAAFENDTPVLISNHDTVWTRK-------IYSQATLDQIQVKRTISPKGGSRNKVSELM 271
>gi|54307504|ref|YP_128524.1| putative DNA adenine methylase [Photobacterium profundum SS9] >gi|46911924|emb|CAG18722.1| putative DNA adenine methylase [Photobacterium profundum SS9] (278 aa)
Score = 328, Expect = 1.2e-28, Identities = 91/289 (31%), Positives = 155/289 (53%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIP-VLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINK-LNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ EI+++ P       K  EPFVG G+V  +     + ++  ++DIN +LIN+Y+++K   ++ I  V ++   +F      ++K  YL  +  FN+ ++          ++   +++N+  FNGL R NKKG FNV  G YK P   +   +   ++K K    V   Y+++     K   VY DPPY P++ST++FT+Y  + F+  +Q +LAD   K    +   +L+SN D K + +       +Y   ++  VK +R I+ +GS R +++ELL
  S:     5 RAFLKWAGGKYSLVEEIQRHLP----PARKLVEPFVGAGSVFLNT----DFEQYLLADINPDLINLYNILKDDPEKYIEDVRKLFTPEF------NQKEEYLKIREEFNKTQDP-------YVRSLYFLYMNRHGFNGLCRYNKKGGFNVPFGSYKKPYFPEK-EMYFFAEKAKRATFVCEGYQQTFSRARKGCVVYCDPPYAPLSSTANFTSYTGNGFSLDDQADLADVAEKAATEREIPVLISNHDTKLTRR-------LYHGADLSVVKVRRTISRNGSGRNKVDELL 266
>gi|149191615|ref|ZP_01869860.1| DNA adenine methylase [Vibrio shilonii AK1] >gi|148834573|gb|EDL51565.1| DNA adenine methylase [Vibrio shilonii AK1] (274 aa)
Score = 328, Expect = 1.3e-28, Identities = 91/289 (31%), Positives = 149/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +I+K+ P       K  EPFVG G++  +     +  +  ++DIN +LIN+Y+++K       P   + E   L     +RK  YL  + +FN+    +D  F    ++   +++N+  FNGL R NKKG FNV  G YK P   +   L   ++K K    V   Y  + +   K + +Y DPPY P+++T++FT+Y  + F+  +Q  LAD       ++G  +L+SN D        +    +Y    +  VK KR I+ +G+ R +++ELL
  S:     5 RAFLKWAGGKYGLVEDIQKHLP----DARKLVEPFVGAGSIFLNT----DYDQYLLADINPDLINLYNLLKTD-----PETYVAEAKRLFTAEHNRKEVYLDIRAQFNQ---TDDVLF----RSVAFLYMNRFGFNGLCRYNKKGGFNVPFGSYKKPYFPEN-ELIFFAEKAKKATFVCEGYHDTFKRARKGSVIYCDPPYAPLSNTANFTSYAGNGFSLDDQAALADVAEHAAFDRGIPVLISNHD-------TTLTRRLYHGAQLNVVKVKRTISRNGAGRNKVDELL 266
>gi|88861006|ref|ZP_01135641.1| DNA adenine methylase [Pseudoalteromonas tunicata D2] >gi|88816934|gb|EAR26754.1| DNA adenine methylase [Pseudoalteromonas tunicata D2] (271 aa)
Score = 327, Expect = 1.5e-28, Identities = 94/292 (32%), Positives = 150/292 (51%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           Q  + FLKW GGK  L++EI    P    +     EPFVG G+V  +    + V    ++DINA+LIN+Y  +K+   E I   + +  D  L N  D  + Y ++   FN  ++         E+A L ++LN+  +NGL R N KG+FNV  G YK P   +   L   ++K +        Y      + +++ VY DPPY P++ T+SFTAY K  F+  +Q +LA++  +    +G  +L+SN D   + K       IY+  ++  ++ KR I+  G SR ++ EL+
  S:     3 QKTRAFLKWAGGKYSLVDEITARLP----EAETLVEPFVGAGSVFLNTDYSHYV----LNDINADLINLYKELKHAPDEFISDAKKLFVD--LNNYSDAYYQYRVQ---FNASQDA-------YERAVLFLYLNRHGYNGLCRYNLKGIFNVPFGKYKKPYFPEK-ELYFFAEKSQKATFTCKGYADVFNDLPRSSVVYCDPPYVPLSKTASFTAYAKGGFDLDDQAQLANFAERAAFEQGIPVLISNHDTVWTRK-------IYTQASLDMIQVKRTISPKGGSRNKVGELM 267
>gi|9632131|ref|NP_048937.1| hypothetical protein PBCV1_A581R [Paramecium bursaria Chlorella virus 1] >gi|2447073|gb|AAC96931.1| PBCV-1 M.CviAI methylase [Paramecium bursaria Chlorella virus 1] (265 aa)
Score = 327, Expect = 1.8e-28, Identities = 107/284 (37%), Positives = 150/284 (52%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVL-SKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSD--GSSRGEI 340
           PFLKWVGGK + +N I  ++P     I  Y EPF+GGG+VL  VL S  ++K+I  +D+NA LI  Y  +K   +ELI  L+       L+N+++    Y   +  FN LK++       V+ +AL I+LNKTCF GLYR    G FNV  GHYKNP   +   L   S K+KNV      Y+     + ++ FVY DPPY P   T SFT YN   F D  Q  L   +  L     + ++SNS  + +          ++++ I  +  +R INS   GS+  EI
  S:     4 PFLKWVGGKQKFVNNIITHFP---KNIDTYHEPFLGGGSVLLAVLNSDIQIKKIRANDLNAYLIQTYIDVKDNTEELIEELKS------LKNSEED---YYENRKIFNSLKKE---GHFSVKASALFIYLNKTCFRGLYREGPNG-FNVPFGHYKNPNWINADLLRGWSDKIKNVEFSCLPYQDFLNDVGEHDFVYLDPPYAPENKT-SFTKYNVSDFLDHEQ--LFSIVKSL----PQFVMSNSKTEKTLN-------AFASFEILEITTRRAINSKKPGSTTTEI 260
>gi|170717279|ref|YP_001784394.1| DNA adenine methylase [Haemophilus somnus 2336] >gi|168825408|gb|ACA30779.1| DNA adenine methylase [Haemophilus somnus 2336] (287 aa)
Score = 326, Expect = 2.1e-28, Identities = 95/296 (32%), Positives = 152/296 (51%)
  Q:    49 NNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           ++NL   +PFLKW GGK +L  EI K  P +    T   EPFVG G+V  +   ++ +    + DIN +LI++++++K  V+  I       K     +  +   YY  ++  FN       N F   E+A L ++LN+  FNGL R N K  FNV  G YK     ++  L   ++K +    +  D++++   I+ ++ +Y DPPY P+   S+FT+Y+ + F+  +Q+ LA        N G  +L+SN D K       F  EIY    IKR+K +R I+     R ++NEL+
  S:     7 SSNLVKYRPFLKWAGGKFRLTEEINKLLPKNK---TCLIEPFVGAGSVFLNTHFEHYI----LVDINPDLIHLFNIVKQDVEHYIAAC----KPIFFHDQANTANYYYHRRAEFN----LSQNIF---ERAVLFLYLNRYGFNGLCRYNAKNEFNVPFGSYKTHYFPES-ELRYFAQKAQRAVFICADFQQAFSMINNDSVIYCDPPYAPLKQNSNFTSYSGNEFSLSHQQNLAQLAKDTALNHGVPVLISNHDTK-------FTREIYKDAKIKRLKVQRSISKSSHKRIKVNELI 277
>gi|90413591|ref|ZP_01221581.1| putative DNA adenine methylase [Photobacterium profundum 3TCK] >gi|90325364|gb|EAS41853.1| putative DNA adenine methylase [Photobacterium profundum 3TCK] (278 aa)
Score = 324, Expect = 4.0e-28, Identities = 89/289 (30%), Positives = 155/289 (53%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIP-VLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINK-LNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ EI+++ P       K  EPFVG G+V  +     + ++  ++DIN +LIN+Y+++K   ++ +  V ++   +F      ++K  YL  +  FN+ ++          ++   +++N+  FNGL R NKKG FNV  G YK P   +   +   ++K K    V   Y+++     K   VY DPPY P+++T++FT+Y  + F+  +Q +LAD   K    +   +L+SN D K + +       +Y   ++  VK +R I+ +GS R +++ELL
  S:     5 RAFLKWAGGKYSLVEEIQRHLP----PARKLVEPFVGAGSVFLNT----DFEQYLLADINPDLINLYNILKDDPEKYVEDVRKLFTPEF------NQKEEYLKIREEFNKTQDP-------YVRSLYFLYMNRHGFNGLCRYNKKGGFNVPFGSYKKPYFPEK-EMYFFAEKAKRATFVCEGYQQTFSRARKGCVVYCDPPYAPLSTTANFTSYAGNGFSLDDQADLADVAEKAATEREIPVLISNHDTKLTRR-------LYHGADLSVVKVRRTISRNGSGRNKVDELL 266
>gi|160877301|ref|YP_001556617.1| DNA adenine methylase [Shewanella baltica OS195] >gi|160862823|gb|ABX51357.1| DNA adenine methylase [Shewanella baltica OS195] (279 aa)
Score = 323, Expect = 4.1e-28, Identities = 86/289 (29%), Positives = 148/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L++++  Y P  +    +  EPFVG G+V  +     +     + DIN +LI +Y ++K++ +  I   + M  D      + +  YY ++ + FN+ ++         +++   ++LN+  FNGL R N+KG FNV  G YK P   +   + A S+K +        Y+K+ E       VY DPPY P+++TSSFT Y    F+  +Q  LA +       +G  +L+SN D            E+Y   ++ R++ +R I+ +GS R +++EL+
  S:     6 RAFLKWAGGKFKLVDDLASYLPTGD----RLVEPFVGAGSVFLNT----DYPSYLLCDINQDLIELYQIVKHQPEAYIAAAKAMFVD----EMNQKDAYYQVRTD-FNKCRDP-------FQRSVYFLYLNRHGFNGLCRYNRKGGFNVPFGSYKKPYFPEK-EIWAFSEKAQRAEFKCIGYEKAFEQTRSGDVVYCDPPYAPLSTTSSFTTYVGAGFSLDDQALLARHSRHTALERGIPVLISNHDI-------PLTRELYRGAHLARIQVQRNISQNGSGRNKVDELM 267
>gi|85060284|ref|YP_455986.1| DNA adenine methylase [Sodalis glossinidius str. 'morsitans'] >gi|84780804|dbj|BAE75581.1| DNA adenine methylase Dam [Sodalis glossinidius str. 'morsitans'] (270 aa)
Score = 323, Expect = 4.8e-28, Identities = 88/289 (30%), Positives = 150/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKG-TKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +I+++ P  +  I    EPFVG G+V  +     +     ++DIN++LIN+++++K +  + I   + +       + +  + YYL++ + FN   +          +A L ++LN+ C+NGL R N +G FNV  G YK P   + L L   ++K      V   Y+++       + VY DPPY P+++T++FTAY+ + F+   QK LA   +KL  +    +L+SN D        +   + Y    +  V A+R I+S+   R  +NELL
  S:     5 RAFLKWAGGKYPLIEDIRRHLPEGDCLI----EPFVGAGSVFLNT----DYDRYILADINSDLINLFNIVKERPNDFIRDARAL----FAADANISEVYYLLR-SEFNLCTDAH-------RRAVLFLYLNRHCYNGLCRYNLRGEFNVPFGRYKKPYFPE-LELHRFAEKASRAMFVCEHYQQTLSRAVPGSVVYCDPPYVPLSTTANFTAYHTNSFSLTEQKNLARLASKLARESRIPVLISNHD-------TALTRQWYGDAVLHHVTARRTISSNIFGRSSVNELL 266
>gi|113461258|ref|YP_719327.1| DNA adenine methylase Dam [Haemophilus somnus 129PT] >gi|112823301|gb|ABI25390.1| DNA adenine methylase Dam [Haemophilus somnus 129PT] (277 aa)
Score = 322, Expect = 5.5e-28, Identities = 93/289 (32%), Positives = 148/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +PFLKW GGK +L  EI K  P +    T   EPFVG G+V  +   ++ +    + DIN +LI++++++K  V+  I       K     +  +   YY  ++  FN       N F   E+A L ++LN+  FNGL R N K  FNV  G YK     ++  L   ++K +    +  D++++   I+ ++ +Y DPPY P+   S+FT+Y+ + F+  +Q+ LA        N G  +L+SN D K       F  EIY    IKR+K +R I+     R ++NEL+
  S:     4 RPFLKWAGGKFRLTEEINKLLPKNK---TCLIEPFVGAGSVFLNTHFEHYI----LVDINPDLIHLFNIVKQDVEHYIAAC----KPIFFHDQANTANYYYHRRAEFN----LSQNIF---ERAVLFLYLNRYGFNGLCRYNAKNEFNVPFGSYKTHYFPES-ELRYFAQKAQRAVFICADFQQAFSMINNDSVIYCDPPYAPLKQNSNFTSYSGNEFSLSHQQNLAQLAKDTALNHGVPVLISNHDTK-------FTREIYKDAKIKRLKVQRSISKSSHKRIKVNELI 267
>gi|165975648|ref|YP_001651241.1| DNA adenine methylase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|165875749|gb|ABY68797.1| DNA adenine methylase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] (277 aa)
Score = 321, Expect = 7.1e-28, Identities = 89/289 (30%), Positives = 148/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK---NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L  EI+K+ P  + Q   + EPFVG G+V  +  + YE     ++DIN +LIN++++IK+ V+  I   + +   FL    +   +YY  ++  FN   +K         ++ L ++LN+  FNGL R N+K  +NV  G YK     +   L   ++K +    +  D+++    + +   N  VY DPPY P+   ++FT Y    F+   Q++LA    +       +L+SN D        +F  +IY    IK++K +R I     SR +++ELL
  S:     5 RAFLKWAGGKYRLTTEIRKHLPPKSAQGACFVEPFVGAGSVFLN--TDYE--RYLLADINPDLINLFNIIKHDVEHYIKETKTL---FLASEANTASFYY-ARRQEFNRSSDK-------FRRSVLFLYLNRFGFNGLCRYNQKHEYNVPFGAYKTHYFPEN-ELRFFAEKAQKAEFICADFEQVFARLYQAPDNYIVYCDPPYAPLQQDTNFTHYAGGGFSLVQQEKLAQLARQAQTNNIPVLISNHD-------TAFTRQIYHGAKIKKIKVQRSIGQRADSRIKVDELL 273
>gi|86147332|ref|ZP_01065646.1| site-specific DNA methylase [Vibrio sp. MED222] >gi|85834897|gb|EAQ53041.1| site-specific DNA methylase [Vibrio sp. MED222] (286 aa)
Score = 320, Expect = 1.0e-27, Identities = 91/289 (31%), Positives = 146/289 (50%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +I+++ P       K  EPFVG G+V  +     + ++  ++DIN +LIN+Y+++K       P   I E        ++R+  +L  +  FN      DN      ++   +++N+  FNGL R NKKG FNV  G YK P   +   LE  ++K K    V   Y ++     K   VY DPPY P+++T++FT+Y  + F+  +Q  LAD   K    +   +L+SN D        +    +Y    +  VK KR I+ +G+ R +++ELL
  S:     5 RAFLKWAGGKYGLVEDIQRHLP----PARKLVEPFVGAGSVFLNT----DFEQYLLADINPDLINLYNLLKTD-----PETYITEAKRWFCPENNRREVFLDVRAEFN----GTDNVMY---RSLAFLYMNRFGFNGLCRYNKKGGFNVPFGSYKKPYFPEA-ELEFFAEKAKKATFVCEGYHETFSRARKGCVVYCDPPYAPLSNTANFTSYAGNGFSLDDQAALADVAEKAAMERDIPVLISNHD-------TTLTRRLYHGAELNVVKVKRTISRNGAGRNKVDELL 266
>gi|119776497|ref|YP_929237.1| site-specific DNA-methyltransferase (adenine-specific) [Shewanella amazonensis SB2B] >gi|119768997|gb|ABM01568.1| Site-specific DNA-methyltransferase (adenine-specific) [Shewanella amazonensis SB2B] (280 aa)
Score = 320, Expect = 1.1e-27, Identities = 89/289 (30%), Positives = 151/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L+++++++ P    +  +  EPFVG G+V  +  ++Y+     + DIN +LI +Y ++K + +E I   + +  D +  N  D   YY I+ +RFN+ K+          +A   ++LN+  FNGL R N+KG FNV  G YK P   +   + A S K +        Y+++ E       +Y DPPY P+++T+SFT Y    F   +Q  LA +   +   +G  +L+SN D   +         +Y    ++ VK +R I+  GS R +++EL+
  S:     6 RAFLKWAGGKFKLMDDLRRHLP----EGKRLVEPFVGAGSVFLN--TQYDA--YLLCDINQDLIGLYKIVKAQPEEYIRAARALFCDEM--NAKDA--YYDIR-SRFNKSKDP-------FSRAVYFLYLNRHGFNGLCRYNRKGEFNVPFGSYKKPYFPEQ-EIRAFSIKAQRAEFRCISYEQAFELATSGDVIYCDPPYAPLSTTASFTTYVGAGFTLDDQALLARHSRHIAVERGIPVLISNHDIPLTRG-------LYLGAKLETVKVQRNISQKGSGRNKVDELM 267
>gi|24371887|ref|NP_715929.1| DNA adenine methylase [Shewanella oneidensis MR-1] >gi|24345713|gb|AAN53374.1|AE015477_4 DNA adenine methylase [Shewanella oneidensis MR-1] (279 aa)
Score = 320, Expect = 1.2e-27, Identities = 89/289 (30%), Positives = 150/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L++E+  Y P       +  EPFVG G+V  +     +     + DIN +LIN+Y+++K +  E I       K   +   + ++ YY ++ + FN    K ++ FL   ++   ++LN+  FNGL R N+KG FNV  G YK P   +   + A SKK +        Y+K+ E I     +Y DPPY P+++T+SFT Y    F+  +Q  LA Y   +   +   +++SN D            E+Y   ++ +++ +R I+ +GS R +++EL+
  S:     6 RAFLKWAGGKFKLVDELANYLPTGE----RLVEPFVGAGSVFLNT----DYPRYLLCDINQDLINLYNIVKERPVEYIAA----AKKLFVDEMNQKEAYYRVRTD-FN----KSNDPFL---RSVYFLYLNRHGFNGLCRYNRKGGFNVPFGSYKKPYFPEK-EILAFSKKAQRAEFKCISYEKAFEQIRAGDVIYCDPPYAPLSTTASFTTYVGAGFSLDDQALLARYSRHMALEQRIPVVISNHDI-------PLTRELYRGAHLAKIQVQRNISQNGSGRNKVDELI 267
>gi|126176295|ref|YP_001052444.1| DNA adenine methylase [Shewanella baltica OS155] >gi|125999500|gb|ABN63575.1| DNA adenine methylase [Shewanella baltica OS155] (279 aa)
Score = 319, Expect = 1.3e-27, Identities = 85/289 (29%), Positives = 148/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L++++  Y P  +    +  EPFVG G+V  +     +     + DIN +LI +Y ++K++ +  I   + M  D      + +  YY ++ + FN+ ++         +++   ++LN+  FNGL R N+KG FNV  G YK P   +   + A S+K +        Y+K+ E       VY DPPY P+++TSSFT Y    F+  +Q  LA +       +G  +L+SN D            E+Y   ++ +++ +R I+ +GS R +++EL+
  S:     6 RAFLKWAGGKFKLVDDLASYLPAGD----RLVEPFVGAGSVFLNT----DYPSYLLCDINQDLIELYQIVKHQPEAYIAAAKAMFVD----EMNQKDAYYQVRTD-FNKCRDP-------FQRSVYFLYLNRHGFNGLCRYNRKGGFNVPFGSYKKPYFPEK-EIWAFSEKAQRAEFKCIGYEKAFEQTRSGDVVYCDPPYAPLSTTSSFTTYVGAGFSLDDQALLARHSRHTALERGIPVLISNHDI-------PLTRELYRGAHLAKIQVQRNISQNGSGRNKVDELM 267
>gi|163730269|ref|ZP_02137744.1| DNA adenine methylase [Vibrio fischeri MJ11] >gi|161396421|gb|EDQ20715.1| DNA adenine methylase [Vibrio fischeri MJ11] (276 aa)
Score = 319, Expect = 1.4e-27, Identities = 87/289 (30%), Positives = 145/289 (50%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ EI+++ P       K  EPFVG G+V  +     +     ++DIN +LIN+Y+ +K + +  I      +   L +   ++K  YL  +  FN+  +          ++ L +++N+  FNGL R NKKG FNV  G YK P   +   +   ++K K    V   Y  + +   K   VY DPPY P+++T++FT+Y  + F+  +Q  LAD   K    +   +L+SN D        +    +Y    +  +K KR I+ +G+ R +++EL+
  S:     5 RAFLKWAGGKYSLVEEIQRHLP----DARKLIEPFVGAGSVFLNT----DYDHYLLADINPDLINLYNHLKDEPQRFIE-----DARALFQPEYNKKEVYLALRVEFNQCTDT-------YRRSLLFLYMNRHGFNGLCRYNKKGGFNVPFGSYKKPYFPEK-EMVFFAEKAKKATFVCEGYMDTFKRARKGAVVYCDPPYAPLSTTANFTSYAGNGFSLDDQAALADVAEKAAFERDIPVLISNHD-------TTLTRRLYHGATLNTIKVKRTISRNGAGRNKVDELM 266
>gi|153002580|ref|YP_001368261.1| DNA adenine methylase [Shewanella baltica OS185] >gi|151367198|gb|ABS10198.1| DNA adenine methylase [Shewanella baltica OS185] (279 aa)
Score = 319, Expect = 1.5e-27, Identities = 85/289 (29%), Positives = 148/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L++++  Y P  +    +  EPFVG G+V  +     +     + DIN +LI +Y ++K++ +  I   + M  D      + +  YY ++ + FN+ ++         +++   ++LN+  FNGL R N+KG FNV  G YK P   +   + A S+K +        Y+K+ E       VY DPPY P+++TSSFT Y    F+  +Q  LA +       +G  +L+SN D            E+Y   ++ +++ +R I+ +GS R +++EL+
  S:     6 RAFLKWAGGKFKLVDDLASYLPTGD----RLVEPFVGAGSVFLNT----DYPSYLLCDINQDLIELYQIVKHQPEAYIAAAKAMFVD----EMNQKDAYYQVRTD-FNKCRDP-------FQRSVYFLYLNRHGFNGLCRYNRKGGFNVPFGSYKKPYFPEK-EIWAFSEKAQRAEFKCIGYEKAFEQTRSGDVVYCDPPYAPLSTTSSFTTYVGAGFSLDDQALLARHSRHTALERGIPVLISNHDI-------PLTRELYRGAHLAKIQVQRNISQNGSGRNKVDELM 267
>gi|149114338|ref|ZP_01841092.1| DNA adenine methylase [Shewanella baltica OS223] >gi|146866035|gb|EDK51303.1| DNA adenine methylase [Shewanella baltica OS223] (279 aa)
Score = 319, Expect = 1.5e-27, Identities = 85/289 (29%), Positives = 148/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L++++  Y P  +    +  EPFVG G+V  +     +     + DIN +LI +Y ++K++ +  I   + M  D      + +  YY ++ + FN+ ++         +++   ++LN+  FNGL R N+KG FNV  G YK P   +   + A S+K +        Y+K+ E       VY DPPY P+++TSSFT Y    F+  +Q  LA +       +G  +L+SN D            E+Y   ++ +++ +R I+ +GS R +++EL+
  S:     6 RAFLKWAGGKFKLVDDLASYLPTGD----RLVEPFVGAGSVFLNT----DYPSYLLCDINQDLIELYQIVKHQPEAYIAAAKAMFVD----EMNQKDAYYQVRTD-FNKCRDP-------FQRSVYFLYLNRHGFNGLCRYNRKGGFNVPFGSYKKPYFPEK-EIWAFSEKAQRAEFKCIGYEKAFEQTRSGDVVYCDPPYAPLSTTSSFTTYVGAGFSLDDQALLARHSRHTALERGIPVLISNHDI-------PLTRELYRGAHLAKIQVQRNISQNGSGRNKVDELM 267
>gi|59712896|ref|YP_205672.1| DNA adenine methylase [Vibrio fischeri ES114] >gi|59480997|gb|AAW86784.1| DNA adenine methylase [Vibrio fischeri ES114] (276 aa)
Score = 318, Expect = 1.6e-27, Identities = 87/289 (30%), Positives = 145/289 (50%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ EI+++ P       K  EPFVG G+V  +     +     ++DIN +LIN+Y+ +K + +  I      +   L +   ++K  YL  +  FN+  +          ++ L +++N+  FNGL R NKKG FNV  G YK P   +   +   ++K K    V   Y  + +   K   VY DPPY P+++T++FT+Y  + F+  +Q  LAD   K    +   +L+SN D        +    +Y    +  +K KR I+ +G+ R +++EL+
  S:     5 RAFLKWAGGKYSLVEEIQRHLP----DARKLIEPFVGAGSVFLNT----DYDHYLLADINPDLINLYNHLKDEPERFIE-----DARALFQPEYNKKEVYLALRVEFNQCTDT-------YRRSLLFLYMNRHGFNGLCRYNKKGGFNVPFGSYKKPYFPEK-EMVFFAEKAKKATFVCEGYMDTFKRARKGAVVYCDPPYAPLSTTANFTSYAGNGFSLDDQAALADIAEKAAFERDIPVLISNHD-------TTLTRRLYHGATLNTIKVKRTISRNGAGRNKVDELM 266
>gi|90416552|ref|ZP_01224483.1| site-specific DNA-methyltransferase [marine gamma proteobacterium HTCC2207] >gi|90331751|gb|EAS46979.1| site-specific DNA-methyltransferase [marine gamma proteobacterium HTCC2207] (279 aa)
Score = 318, Expect = 1.9e-27, Identities = 90/292 (30%), Positives = 147/292 (50%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLI 345
           +  PFLKW GGK  L+    + +P + N   +Y EPF+G GAV F +  K  V    + D N+ LI+ Y+ IK   + +   L   ++        +R++YY ++   F    +K          AA  I+LN+TC+NGLYR+N KG FNV +G  K   I  + N + +S  L+N  +   D+ K  +  ++N F++ DPPY    + + F  YN  LF+  +Q  L D ++    +G K+LL+NSD ++  +      E+ S      +    +I    + RG  +EL++
  S:    13 ITVPFLKWAGGKRWLITSHPELFPQNYN---RYLEPFLGSGAVYFYMQPKSAV----LGDTNSALIDTYTAIKDDWEPIAKALTSYDR------RHNREFYYEVRDRTFRSPSKK----------AAQFIYLNRTCWNGLYRLNLKGKFNVPVG-TKERVILASDNFKGVSNSLQNTELHTVDFHKIVDSAERNDFLFIDPPYTVKHNLNGFVKYNDKLFSWDDQVRLRDCVDNAVARGVKVLLTNSDHESVRELYKGMGEMLS------LNRPSVIAGKANGRGTFSELVV 274
>gi|53728907|ref|ZP_00134629.2| COG0338: Site-specific DNA methylase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126207680|ref|YP_001052905.1| DNA adenine methylase [Actinobacillus pleuropneumoniae L20] >gi|190149463|ref|YP_001967988.1| DNA adenine methylase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|126096472|gb|ABN73300.1| DNA adenine methylase [Actinobacillus pleuropneumoniae L20] >gi|189914594|gb|ACE60846.1| DNA adenine methylase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (277 aa)
Score = 317, Expect = 2.1e-27, Identities = 88/289 (30%), Positives = 147/289 (50%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK---NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L  EI+K+ P  + Q   + EPFVG G+V  +  + YE     ++DIN +LIN++++IK+ V+  I   + +   FL    +   +YY  ++  FN   +K         ++ L ++LN+  FNGL R N+K  +NV  G YK     +   L   ++K +    +  D+++    + +   N  VY DPPY P+   ++FT Y    F+   Q++LA    +       +L+SN D        +F  +IY    IK++K +R I     SR +++EL 
  S:     5 RAFLKWAGGKYRLTTEIRKHLPPKSAQGACFVEPFVGAGSVFLN--TDYE--RYLLADINPDLINLFNIIKHDVEHYIKETKTL---FLASEANTASFYY-ARRQEFNRSSDK-------FRRSVLFLYLNRFGFNGLCRYNQKHEYNVPFGAYKTHYFPEN-ELRFFAEKAQKAEFICADFEQVFARLYQAPDNYIVYCDPPYAPLQQDTNFTHYAGGGFSLVQQEKLAQLARQAQTNNIPVLISNHD-------TAFTRQIYHGAKIKKIKVQRSIGQRADSRIKVDELF 273
>gi|120600629|ref|YP_965203.1| DNA adenine methylase [Shewanella sp. W3-18-1] >gi|124548499|ref|ZP_01707140.1| DNA adenine methylase [Shewanella putrefaciens 200] >gi|146294786|ref|YP_001185210.1| DNA adenine methylase [Shewanella putrefaciens CN-32] >gi|120560722|gb|ABM26649.1| DNA adenine methylase [Shewanella sp. W3-18-1] >gi|124508431|gb|EAY52527.1| DNA adenine methylase [Shewanella putrefaciens 200] >gi|145566476|gb|ABP77411.1| DNA adenine methylase [Shewanella putrefaciens CN-32] (279 aa)
Score = 317, Expect = 2.1e-27, Identities = 91/298 (30%), Positives = 154/298 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLI---SNFDINKK 353
           + FLKW GGK +L++E+  Y P  +    +  EPFVG G+V  +     +     + DIN +LI +Y ++K K  E I   + M  D      + +  YY ++   FN+ ++     F+   ++   ++LN+  FNGL R N+KG FNV  G YK P   +   + A S+K +        Y+K+ E I     +Y DPPY P+++T+SFT Y    F+  +Q  LA +       +G  +L+SN D            E+Y   ++ +++ +R I+ +GSSR +++EL+     N+D+  +
  S:     6 RAFLKWAGGKFKLVDELTNYLPAGD----RLVEPFVGAGSVFLNT----DYPSYLLCDINQDLIELYKIVKEKPAEYISAARKMFVD----EMNQKDAYYRVR-TEFNKTRDP----FI---RSVYFLYLNRHGFNGLCRYNRKGGFNVPFGSYKKPYFPEK-EIWAFSEKAQRAEFKCIGYEKAFEQIRTGDVIYCDPPYAPLSTTASFTTYVGAGFSLDDQALLARHSRHTALERGIPVLISNHDI-------PLTRELYRGAHLAKLQVQRNISQNGSSRNKVDELMALYDENYDLQDE 279
>gi|4959232|gb|AAD34292.1|AF091142_1 putative DNA adenine methylase [Neisseria meningitidis] (271 aa)
Score = 317, Expect = 2.4e-27, Identities = 97/289 (33%), Positives = 144/289 (49%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITS-TSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           KPFLKW GGK +L+  I+  +   N       EPF G  A+   +    + +   ++DINA+LI ++ ++K +    I   +     F+  N  D ++Y L  + +FN  K          E++AL I+LN+  FNGL R N KG FNV  G YK+P        E   +K   V ++ GD +      D    VY DPPY P+   T+SFT Y K+ FN  NQ  LA    ++      +L+SN D +       F  +IYS   +K ++ +R I + GSSR ++ ELL
  S:     4 KPFLKWAGGKHKLVPFIE--HNLGNPTRKCLIEPFSGSAALSLAL----DFEHYLLNDINADLIGLFRILKEEKSGFIDYARSF---FISENNSDSRFYEL--REQFNFSKNLH-------ERSALFIYLNRHAFNGLCRYNSKGEFNVPFGRYKSPYFPQQ-EREGFIQKSDRVELMCGDLRMILSQTDNTDTVYCDPPYAPLEGPTASFTTYAKESFNLDNQIRLAQSAQQIAPDSQGVLISNHDTE-------FTRDIYSFAILKTIEVQRNIAAKGSSRKKVGELL 267
>gi|117922323|ref|YP_871515.1| DNA adenine methylase [Shewanella sp. ANA-3] >gi|117614655|gb|ABK50109.1| DNA adenine methylase [Shewanella sp. ANA-3] (279 aa)
Score = 317, Expect = 2.5e-27, Identities = 89/289 (30%), Positives = 148/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L++E+  Y P       +  EPFVG G+V  +     +     + DIN +LIN+Y+++K +  E I       K   +   + +  YY ++ + FN    K  + FL   ++   ++LN+  FNGL R N+KG FNV  G YK P   +   + A SKK +        Y+K+ E I     +Y DPPY P+++T+SFT Y    F+  +Q  LA Y   +   +   +++SN D            E+Y   ++ +++ +R I+ +GS R +++EL+
  S:     6 RAFLKWAGGKFKLVDELANYLPTGE----RLVEPFVGAGSVFLNT----DYPSYLLCDINQDLINLYNIVKERPAEYIAA----AKKLFVDEMNQKDAYYRVRTD-FN----KSRDPFL---RSVYFLYLNRHGFNGLCRYNRKGGFNVPFGSYKKPYFPEK-EILAFSKKAQRAEFKCIGYEKAFEQIRTGDVIYCDPPYAPLSTTASFTTYVGAGFSLDDQALLARYSRHMALEQRIPVVISNHDI-------PLTRELYRGAHLAKIQVQRNISQNGSGRNKVDELI 267
>gi|145298156|ref|YP_001140997.1| DNA adenine methyltransferase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142850928|gb|ABO89249.1| DNA adenine methyltransferase [Aeromonas salmonicida subsp. salmonicida A449] (290 aa)
Score = 316, Expect = 2.8e-27, Identities = 91/293 (31%), Positives = 144/293 (49%)
  Q:    52 LQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYI-NKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           ++  + FLKW GGK  L+ EI +  P     +    EPFVG G+V  +     +     ++DIN +LI +Y+ +K     ++P   I E   L     + K  Y   + +FN+ +          E+A L +FLN+  FNGL R NKKG FNV  G YK P   +   L A ++K +    +   Y  + +  +++  +Y DPPY P+++T+SFT Y+   F   +Q  LA    +    KG  +L+SN D        +   E+Y    +  +  KR I+ +G SR ++ ELL
  S:     1 MKKTRAFLKWAGGKYSLVEEIAERLPAGRVLL----EPFVGAGSVFLNT----DYDAYVLNDINPDLICLYNHLK-----VMPDNFITEARKLFVAEHNHKAAYYRLRTQFNQTETT-------FERAMLFLFLNRHGFNGLCRYNKKGGFNVPFGSYKKPYFPEK-ELWAFAEKAQKATFICESYADAIKRAEEDWVIYCDPPYAPLSNTASFTTYSAGGFTLDDQAILARLARHTAARKGVPVLISNHDI-------ALTRELYRGARLDEILVKRTISRNGGSRNKVAELL 266
>gi|163724234|ref|ZP_02131765.1| DNA adenine methylase [Desulfatibacillum alkenivorans AK-01] >gi|161402435|gb|EDQ26672.1| DNA adenine methylase [Desulfatibacillum alkenivorans AK-01] (298 aa)
Score = 316, Expect = 3.1e-27, Identities = 89/298 (29%), Positives = 153/298 (51%)
  Q:    48 INNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLI 345
           + +N  +V PFLKW GGK   + +     P       +Y EPF+G GAV F +    + +  Y+ D N +LI+ Y  I+   K ++  L+  +K         R++YY ++      L+ K          AA  I+LN+TC+NGLYRVN +G FNV +G  +N  I DT + E +S+ L+   ++ GD+++     ++N  ++ DPPY    + + F  YN+ LF+ ++QK L   +++  ++G  I+ +N+       +    D    A++ K V    +I+ +  SR +  EL+I
  S:    24 MTSNNGIVSPFLKWAGGKRWFVAKHADLLP---RTFNRYFEPFLGSGAVYFHL----QPENAYLGDSNKDLIDTYIAIQKNWKLVLRHLKEHKKAHC------REYYYRVRAQTPRSLQAK----------AARFIYLNRTCWNGLYRVNLQGKFNVPIG-TRNSVIFDTDDFEKVSQALQGAFLLSGDFEELVNMAEENDLLFVDPPYTVRHNNNGFLKYNETLFSWEDQKRLFRSLDRARDRGASIVATNA------CSQCVMDLYTDAFSTKEVSRNSLISPNLDSRKKFKELVI 291
>gi|15639797|ref|NP_219247.1| DNA adenine methyltransferase (dam) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189026035|ref|YP_001933807.1| DNA adenine methyltransferase [Treponema pallidum subsp. pallidum SS14] >gi|6014980|sp|O33844|DMA_TREPA DNA adenine methylase (M.TpaI) (Deoxyadenosyl-methyltransferase) (DNA adenine methyltransferase) >gi|2218170|gb|AAB82782.1| DNA adenine methyltransferase [Treponema pallidum] >gi|3323123|gb|AAC65779.1| DNA adenine methyltransferase (dam) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018610|gb|ACD71228.1| DNA adenine methyltransferase [Treponema pallidum subsp. pallidum SS14] (303 aa)
Score = 316, Expect = 3.2e-27, Identities = 93/293 (31%), Positives = 152/293 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVK--EIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYK-----------NPKIC-------------DTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSD-PKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +PF+KW GGK  L   +  + P        Y EPFVGGGA+ + + +   V+  +IY+SDIN  L+  Y+ ++ +V+ELI    +     +  +T     YY + + +F   +         +E AAL ++LN++C+NGLYRVNK G FNV +G               P+               D  NL + ++ L N  +    +   +    +  FVY DPPY       +F+AY+K  F+    + LA +   L+ +G   +LSNSD P+            Y  + ++++ A R I     +RG+  E+LI+N+
  S:     8 RPFVKWAGGKRALAPTLFAHMP---QTFGSYFEPFVGGGALFWHLCACTRVRLHDIYLSDINWPLLCAYAAVRDRVEELI----VRVGQHIACHTPT---YYRLARRKFAVCEHP-------LEVAALFLYLNRSCYNGLYRVNKAGQFNVPLGRAAPASPFLNTTAPTPRSTQPAAQVGHLAIRIDEENLRSCARALANTTLNCQHFSCIQP--ARGDFVYLDPPY-----LGTFSAYDKTGFDRAAHESLAAFCMHLDARGVLFMLSNSDCPE--------VRAWYRPFRVQQLNAPRCIARSAHARGKRCEVLITNY 295
>gi|15603087|ref|NP_246159.1| hypothetical protein PM1222 [Pasteurella multocida subsp. multocida str. Pm70] >gi|15705892|gb|AAL05864.1|AF411317_2 DNA adenine methylase [Pasteurella multocida] >gi|12721577|gb|AAK03306.1| Dam [Pasteurella multocida subsp. multocida str. Pm70] (301 aa)
Score = 316, Expect = 3.3e-27, Identities = 87/289 (30%), Positives = 144/289 (49%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKL-NNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +PFLKW GGK +L +EI K  P  N  +    EPFVG GAV  +       +   ++DIN +LIN+++ +K  V+  I       K        +   +Y  K+ +FN  K+         E++ + ++LN+  FNGL R N K  FNV  G YK     +   L   ++K +N   +  D++++    D+ + +Y DPPY P+   S+FT+Y  + F+  +Q+ LA+   K    +   +++SN D         F  +IY    IK +K +R I+   + R ++ EL+
  S:    28 RPFLKWAGGKFRLSDEINKLLPKTNQCLI---EPFVGAGAVFLNT----NFERYILADINPDLINLFNFVKNDVEHYINA----SKPLFFHPEANTSTFYYAKRTQFNLSKDP-------FERSVIFLYLNRFGFNGLCRYNSKNEFNVPFGTYKRHYFPEN-ELRYFAEKAQNAEFICADFQQTFSLADEKSIIYCDPPYAPLIQDSNFTSYAGNEFSSLHQQMLAELARKTAEERQISVVISNHD-------TPFTRQIYQNAKIKALKVQRSISHQSARRIKVAELI 291
>gi|77958287|ref|ZP_00822323.1| COG0338: Site-specific DNA methylase [Yersinia bercovieri ATCC 43970] (270 aa)
Score = 315, Expect = 3.5e-27, Identities = 90/289 (31%), Positives = 156/289 (53%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIM-EKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGT-KILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+++I+++ P  +  I    EPFVG G+V  +     E +   ++DIN++LIN+Y+++K +  + +   +I+   DF   N+D    +YL+++    E     D       +A L ++LN+ C+NGL R N  G FNV  G YK P   +   L   ++K ++   V   Y+++     +   VY DPPY P+++T++FTAY+ + F   +Q+ LA    +L+ +    +L+SN D +          + Y   ++  VKA+R I+ +   R ++NELL
  S:     5 RAFLKWAGGKYPLVDDIRRHLPAGDCLI----EPFVGAGSVFLNT----EYESYILADINSDLINLYNIVKERTDDFVRDARILFTGDF--NNSDS---FYLLRQ----EFNSSSDT----YRRALLFLYLNRHCYNGLCRYNLSGEFNVPFGRYKKPYFPEA-ELYWFAEKSQHAVFVCEHYQETLLKAVQGAVVYCDPPYAPLSATANFTAYHTNNFGIADQQNLARLAYQLSAESQIPVLISNHDTE-------LTRDWYHQASLHVVKARRTISRNILGRSKVNELL 266
>gi|113972022|ref|YP_735815.1| DNA adenine methylase [Shewanella sp. MR-4] >gi|113886706|gb|ABI40758.1| DNA adenine methylase [Shewanella sp. MR-4] (279 aa)
Score = 315, Expect = 3.6e-27, Identities = 89/289 (30%), Positives = 148/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L++E+  Y P       +  EPFVG G+V  +     +     + DIN +LIN+Y+++K +  E I       K   +   + +  YY ++ + FN    K  + FL   ++   ++LN+  FNGL R N+KG FNV  G YK P   +   + A SKK +        Y+K+ E I     +Y DPPY P+++T+SFT Y    F+  +Q  LA Y   +   +   +++SN D            E+Y   ++ +++ +R I+ +GS R +++EL+
  S:     6 RAFLKWAGGKFKLVDELANYLPTGE----RLVEPFVGAGSVFLNT----DYPSYLLCDINQDLINLYNIVKERPAEYIEA----AKKLFVDEMNQKDAYYRVRTD-FN----KSRDPFL---RSVYFLYLNRHGFNGLCRYNRKGGFNVPFGSYKKPYFPEK-EILAFSKKAQRAEFKCIGYEKAFEQIRTGDVIYCDPPYAPLSTTASFTTYVGAGFSLDDQALLARYSRHMALEQRIPVVISNHDI-------PLTRELYRGAHLAKIQVQRNISQNGSGRNKVDELI 267
>gi|167560612|ref|ZP_02353615.1| putative DNA methylase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] (293 aa)
Score = 315, Expect = 3.8e-27, Identities = 85/289 (29%), Positives = 144/289 (49%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD-VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSD-PKNSDKNDSFFDEIYS--AYNIKRVKAKRMINSDGSSRGEINELL 344
           +PFLKW GGK  +L ++ +  P     I    EPFVGGG+V    L+  +     ++D+N +LIN+Y ++      ++P   I     +    +D + Y          L+E+ + Q +D  E+AA  +FLN+ CFNGL R N+   FNV  G Y +P   +   + A ++   N   +   ++++     +   VY DPPY P+  T+ FT Y    F   +   LA+     + +G ++++ NS  P+  D        +YS   + I+ + A+R I+S GS+R    +L+
  S:    27 RPFLKWAGGKYSMLPDLYQIIPAGMRLI----EPFVGGGSVF---LNSDKHACFLLADVNTDLINLYQMLA-----VVPDTVIRHARVMFDRLNDAESYM--------ALREEFNAQVMDGPERAAAFLFLNRHCFNGLIRYNRNNQFNVGWGKYPSPYFPEE-EIRAFTRMAHNCVFMAAGFRRTLALAGEGDVVYCDPPYEPMPGTAGFTHYAAGGFTWDDHIALAECCVTAHQRGARVVIGNSTAPRVID--------LYSQHGFEIRYISARRSISSKGSTRETAKDLV 290
>gi|67483065|gb|AAY68018.1| DNA adenine methyltransferase [Aeromonas hydrophila] (290 aa)
Score = 315, Expect = 3.8e-27, Identities = 90/293 (30%), Positives = 144/293 (49%)
  Q:    52 LQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYI-NKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           ++  + FLKW GGK  L+ EI +  P     +    EPFVG G+V  +     +     ++DIN +LI +Y+ +K      I   +   K F+  +     +Y L  + +FN+     D  F   E+A L +FLN+  FNGL R NKKG FNV  G YK P   +   L A ++K +    +   Y  + +  +++  +Y DPPY P+++T+SFT Y+   F   +Q  LA    +    KG  +L+SN D +          E+Y    +  +  KR I+ +G +R ++  LL
  S:     1 MKKTRAFLKWAGGKYSLVEEIAERLPAGRVLL----EPFVGAGSVFLNT----DYDAYVLNDINPDLIGLYNHLKRTPDSFIAEAR---KLFVAEHNHKAAYYRL--RTQFNQ----ADTSF---ERALLFLFLNRHGFNGLCRYNKKGGFNVPFGSYKKPYFPEK-ELWAFAEKAQKATFICESYADAIQRAEEDWVIYCDPPYAPLSTTASFTTYSAGGFTLDDQAVLARLARHTAARKGVPVLISNHDIE-------LTRELYRGARLDEILVKRTISRNGGTRNKVAGLL 266
>gi|114045762|ref|YP_736312.1| DNA adenine methylase [Shewanella sp. MR-7] >gi|113887204|gb|ABI41255.1| DNA adenine methylase [Shewanella sp. MR-7] (279 aa)
Score = 314, Expect = 4.9e-27, Identities = 89/289 (30%), Positives = 148/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L++E+  Y P       +  EPFVG G+V  +     +     + DIN +LIN+Y+++K +  E I       K   +   + +  YY ++ + FN    K  + FL   ++   ++LN+  FNGL R N+KG FNV  G YK P   +   + A SKK +        Y+K+ E I     +Y DPPY P+++T+SFT Y    F+  +Q  LA Y   +   +   +++SN D            E+Y   ++ +++ +R I+ +GS R +++EL+
  S:     6 RAFLKWAGGKFKLVDELSNYLPTGE----RLVEPFVGAGSVFLNT----DYPSYLLCDINQDLINLYNIVKERPVEYITA----AKKLFVDEMNQKDAYYRVRTD-FN----KSRDPFL---RSVYFLYLNRHGFNGLCRYNRKGGFNVPFGSYKKPYFPEK-EILAFSKKAQRAEFKCIGYEKAFEQIRTGDVIYCDPPYAPLSTTASFTTYVGAGFSLDDQALLARYSRHMALEQRIPVVISNHDI-------PLTRELYRGAHLAKIQVQRNISQNGSGRNKVDELI 267
>gi|71280623|ref|YP_267233.1| DNA adenine methylase [Colwellia psychrerythraea 34H] >gi|71146363|gb|AAZ26836.1| DNA adenine methylase [Colwellia psychrerythraea 34H] (273 aa)
Score = 314, Expect = 5.8e-27, Identities = 90/286 (31%), Positives = 149/286 (52%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDP-------KNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           LKW GGK +++ EI K  P    +  +  EPFVGGG+V  ++    +  E  + D+N +LI+++++IK +  + I   Q+    +   + +  + YY ++K +FNE  +         +++ L ++LN+  +NGL R NK G +NV  G YK+P       L+  SKK +    V GD++K+   +  +  +Y DPPY PI  TS+FTAY  + F D++Q  L     K   KG   ++SN          KN+DK + F             + +R I+  G  R ++ E+L
  S:     9 LKWAGGKKRVVGEILKVLPVKGKK--RLVEPFVGGGSVFLNI----DFDEYLLIDMNKDLISLFNIIKNQSTQFIADAQM----YFAGDYNHPEKYYELRK-QFNESNDS-------YQRSVLFLYLNRHGYNGLCRYNKSGGYNVPFGRYKHPYFPKA-ELDFFSKKAQKATFVQGDFEKAFSQLKSDDVIYCDPPYSPINRTSNFTAYAGNSFTDEDQIRLVACAEKAKQKGVATIISNHHVDFTRELYKNADKREFF-------------QVQRSISPKGQGRVKVKEVL 269
>gi|152983022|ref|YP_001352268.1| DNA adenine methylase [Janthinobacterium sp. Marseille] >gi|151283099|gb|ABR91509.1| DNA adenine methylase [Janthinobacterium sp. Marseille] (276 aa)
Score = 313, Expect = 6.7e-27, Identities = 97/276 (35%), Positives = 140/276 (50%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSD-PKNSDKNDSF-------FDEIYSAYNIKRVKAKRMINS 332
           P +KW GGK  LL  I  Y P   N   +Y EPF GGGA+ F +       +  +SD N ELIN+YS +K + + LI  L+        +N++D   YY     R  EL+  +      VE AA +++L    FNG++RVN KG FNV  G   +   C    +  IS  LKNV +   D+  S        FVYFDPPY     T+ F  YN  +F   +Q  L++   KL + G  +++SN+D P  +D    F       F  I ++ N +RV ++++  S
  S:    17 PLIKWPGGKRALLKHITPYIP---NTYGRYYEPFFGGGALFFAL----NPDKASLSDKNFELINLYSQVKEQPRSLIKKLKT------FKNSEDD--YY-----RIRELRPADP-----VESAARLMYLCNLSFNGIHRVNLKGDFNVPYGRKTHIDPCPEERILQISSALKNVTLRCDDFATSVSRAKAGDFVYFDPPYTVAHGTNGFIKYNDKIFLWADQIRLSELAKKLMDSGVHVIVSNADHPSVNDLYTDFKAVKIDRFSIIAASSNKRRVISEKIFIS 275
>gi|77962690|ref|ZP_00826507.1| COG0338: Site-specific DNA methylase [Yersinia mollaretii ATCC 43969] (270 aa)
Score = 310, Expect = 1.7e-26, Identities = 87/289 (30%), Positives = 155/289 (53%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIM-EKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGT-KILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+++I+++ P  +  I    EPFVG G+V  +     E +   ++DIN++LIN+Y+++K +  + +   +++   DF     ++ + +YL++    +E     D       +A L ++LN+ C+NGL R N  G FNV  G YK P   +   L   ++K ++   V   Y+++         VY DPPY P+++T++FTAY+ + F   +Q+ LA    +L+ +    +L+SN D +          + Y   ++  VKA+R I+ +   R ++NELL
  S:     5 RAFLKWAGGKYPLVDDIRRHLPAGDCLI----EPFVGAGSVFLNT----EYESYILADINSDLINLYNIVKERTDDFVRDARVLFTGDF-----NNSESFYLLR----HEFNSSNDT----YRRALLFLYLNRHCYNGLCRYNLSGEFNVPFGRYKKPYFPEA-ELYWFAEKSQHAVFVCEHYQETLLKAVHGAVVYCDPPYAPLSATANFTAYHTNNFGIADQQNLARLAYQLSAESQIPVLISNHDTE-------LTRDWYHQASLHVVKARRTISRNILGRSKVNELL 266
>gi|170023137|ref|YP_001719642.1| DNA adenine methylase [Yersinia pseudotuberculosis YPIII] >gi|169749671|gb|ACA67189.1| DNA adenine methylase [Yersinia pseudotuberculosis YPIII] (290 aa)
Score = 308, Expect = 2.3e-26, Identities = 83/288 (28%), Positives = 140/288 (48%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLIS 346
           LKW G K +++  ++ + P       +  EPF G  +V+ +     +  E  I+DINA LIN Y++ + +  +LI +   +   F   NT ++   Y I +N FN     E      +  A + ++LN+ CFNGL R NK G FNV  G YK+P   +   +   ++K K    +  D+ ++ E       +Y DPPY P + T++FT Y+ D FN+  Q  L+  + +    G   + SNSD   S        ++Y  + +  + A R +N  G  R  ++E++ +
  S:    11 LKWAGSKARIMPVLRPHLPAGK----RLVEPFAGSCSVMLNT----DYDEYLIADINAHLINFYNMARCETNDLINMASSL---FFTANTPEQ---YYIFRNIFNSGNRDE------LSMAVIFLYLNRHCFNGLCRYNKLGGFNVPYGKYKSPYFPEA-EIRFFAEKAKKAIFICCDFSEALEMTLPGDVIYCDPPYIPASITANFTGYHADGFNNDQQYRLSVLLARAAENGCHAIASNSDTHIS-------RDLYHNFTLHDIVAPRSVNCKGEGRSSVSEIIAT 270
>gi|77978177|ref|ZP_00833609.1| COG0338: Site-specific DNA methylase [Yersinia intermedia ATCC 29909] (270 aa)
Score = 307, Expect = 3.8e-26, Identities = 88/289 (30%), Positives = 155/289 (53%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIM-EKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGT-KILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+++I+++ P  +  I    EPFVG G+V  +     E     ++DIN++LIN+Y+++K +  + +   +++   DF     ++ + +YL+++  FN   +          +A L ++LN+ C+NGL R N  G FNV  G YK P   + + L   ++K +N   V   Y+++         VY DPPY P+++T++FTAY+ + F   +Q+ LA    +L+ +    +L+SN D +            Y   ++  VKA+R I+ +   R ++NELL
  S:     5 RAFLKWAGGKYPLVDDIRRHLPAGDCLI----EPFVGAGSVFLNT----EYASYILADINSDLINLYNIVKERTDDFVRDARVLFTGDF-----NNSEQFYLLRQ-EFNASTDA-------YRRALLFLYLNRHCYNGLCRYNLSGEFNVPFGRYKKPYFPE-IELYWFAEKSQNAVFVCEHYQETLLKAVHGAVVYCDPPYAPLSATANFTAYHTNNFGIVDQQNLARLAYQLSAENKIPVLISNHDTE-------LTRNWYHQASLHVVKARRTISRNILGRSKVNELL 266
>gi|50121554|ref|YP_050721.1| phage DNA adenine methylase [Pectobacterium atrosepticum SCRI1043] >gi|49612080|emb|CAG75530.1| phage DNA adenine methylase [Erwinia carotovora subsp. atroseptica SCRI1043] (282 aa)
Score = 306, Expect = 3.8e-26, Identities = 78/291 (26%), Positives = 143/291 (49%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVY--GDYKKS-EEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +++PF+KW GGKT+    +         +     EPFVGG +V  +     +     ++DIN +LIN Y V       LI   ++      L    + K  Y  ++  FN   ++       +E+AAL ++LN+  +NG+ R N++G FN+  G Y+ P   +   +   ++K  +   ++   D+K++   + + +T +Y DPPY P++ T++FT Y+   F  ++ ++LA Y+  +       +++SNSD   +        EIY  Y    V   R + +  +SR +  EL+
  S:     1 MIRPFIKWAGGKTR----VLPDLLPLLPKGDCLVEPFVGGASVFLNT----DYPSYVLADINPDLINCYRVATTDTDALISTAKV------LFQHGNNKAEYETRRRSFN--YQRSTGYGTGIEQAALFLYLNRHGYNGMCRYNREGGFNIPFGKYRAPYFPEQ-EIRQFAEKANDTGAIFVCADFKETLRVYAEPDTVIYCDPPYLPVSDTANFTQYHHSAFTHEHHRQLAKYLKHVRYETDAAVVISNSDTPAT-------REIYQHYQFHEVSVSRSLGAAVASRKKARELI 271
>gi|169826091|ref|YP_001696249.1| modification methylase DpnIIA [Lysinibacillus sphaericus C3-41] >gi|168990579|gb|ACA38119.1| Modification methylase DpnIIA [Lysinibacillus sphaericus C3-41] (279 aa)
Score = 306, Expect = 4.6e-26, Identities = 81/247 (32%), Positives = 139/247 (56%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSD 301
           + PFL W GGK  L+N   + +P   +    Y EPF+G G+V F +  +  +    +SDIN +LIN Y  +K   + +   L+I ++    +++ D  +YY I+     +L+ K          AA  ++LN+TCFNG+YRVNK+G FNV +G  +N  I +T + + IS +LK+V I+  DY+       ++ F++ DPPY    + + F  YN+ LF+  +Q  L + + +  ++G KI+++N++
  S:    14 ILPFLTWAGGKRWLVNNYPEIFP---SDFNVYIEPFLGSGSVFFHLKPQKAI----LSDINEDLINTYIALKTDWQNVYKHLKIHQR----KHSPD--YYYKIRDYTPRKLETK----------AARFLYLNRTCFNGIYRVNKQGKFNVPIGSKQN-VILNTDDFKEISDRLKSVLILNHDYEAIINMATRDDFIFVDPPYTVNHNDNGFIQYNEKLFSWADQVRLCEALGRARDRGAKIIVTNAN 236
>gi|119470434|ref|ZP_01613162.1| DNA adenine methylase [Alteromonadales bacterium TW-7] >gi|119446359|gb|EAW27635.1| DNA adenine methylase [Alteromonadales bacterium TW-7] (289 aa)
Score = 305, Expect = 5.0e-26, Identities = 88/292 (30%), Positives = 146/292 (50%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           Q  + FLKW GGK  L+++I       ++      EPFVG G+V  +     + K   ++DINA+LIN+Y  ++    E I   + +  D  L N  D  + Y ++ N+  ++           E++ L +++N+  +NGL R N KG+FNV  G YK P   +   +   ++K +        Y    + +  N  +Y DPPY P++ T+SFT+Y K  FN  +Q  LA+   K      T +L+SN D   + K       IYS  ++ +++ KR I+  G +R ++ EL+
  S:     3 QKSRAFLKWAGGKYSLVDDINARLNQASSHADTLVEPFVGAGSVFLNS----DFKHYILNDINADLINLYKELRNSPDEFISDAKKLFVD--LNNHPDAYYEYRVQFNQSRDV----------YERSMLFLYMNRFGYNGLCRYNLKGIFNVPFGKYKKPYFPEK-EMYFFAEKAQQATFTCLGYDDVFKLVPNNAVIYCDPPYVPLSKTASFTSYAKGGFNLDDQANLANLAEKAAFENNTPVLISNHDTVWTRK-------IYSQASLDQIQVKRTISPKGGTRNKVGELM 271
>gi|16120497|ref|NP_403810.1| DNA adenine methylase [Yersinia pestis CO92] >gi|22127807|ref|NP_671230.1| DNA adenine methylase [Yersinia pestis KIM] >gi|45440018|ref|NP_991557.1| DNA adenine methylase [Yersinia pestis biovar Microtus str. 91001] >gi|51598037|ref|YP_072228.1| DNA adenine methylase [Yersinia pseudotuberculosis IP 32953] >gi|108809306|ref|YP_653222.1| DNA adenine methylase [Yersinia pestis Antiqua] >gi|108814071|ref|YP_649838.1| DNA adenine methylase [Yersinia pestis Nepal516] >gi|145597404|ref|YP_001161479.1| DNA adenine methylase [Yersinia pestis Pestoides F] >gi|150260836|ref|ZP_01917564.1| DNA adenine methylase [Yersinia pestis CA88-4125] >gi|153949277|ref|YP_001402911.1| DNA adenine methylase [Yersinia pseudotuberculosis IP 31758] >gi|162419515|ref|YP_001608040.1| DNA adenine methylase [Yersinia pestis Angola] >gi|165928027|ref|ZP_02223859.1| DNA adenine methylase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936109|ref|ZP_02224678.1| DNA adenine methylase [Yersinia pestis biovar Orientalis str. IP275] >gi|166010488|ref|ZP_02231386.1| DNA adenine methylase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213357|ref|ZP_02239392.1| DNA adenine methylase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167399440|ref|ZP_02304964.1| DNA adenine methylase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167419029|ref|ZP_02310782.1| DNA adenine methylase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167425665|ref|ZP_02317418.1| DNA adenine methylase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167470759|ref|ZP_02335463.1| DNA adenine methylase [Yersinia pestis FV-1] >gi|170022489|ref|YP_001718994.1| DNA adenine methylase [Yersinia pseudotuberculosis YPIII] >gi|186897236|ref|YP_001874348.1| DNA adenine methylase [Yersinia pseudotuberculosis PB1/+] >gi|10799036|gb|AAG23175.1|AF274318_1 DNA adenine methylase [Yersinia pseudotuberculosis] >gi|21960938|gb|AAM87481.1|AE013998_5 DNA adenine methylase [Yersinia pestis KIM] >gi|45434873|gb|AAS60434.1| DNA adenine methylase [Yersinia pestis biovar Microtus str. 91001] >gi|51591319|emb|CAH22985.1| DNA adenine methylase [Yersinia pseudotuberculosis IP 32953] >gi|108777719|gb|ABG20238.1| DNA adenine methylase Dam [Yersinia pestis Nepal516] >gi|108781219|gb|ABG15277.1| DNA adenine methylase Dam [Yersinia pestis Antiqua] >gi|115345976|emb|CAL18840.1| DNA adenine methylase [Yersinia pestis CO92] >gi|145209100|gb|ABP38507.1| DNA adenine methylase Dam [Yersinia pestis Pestoides F] >gi|149290244|gb|EDM40321.1| DNA adenine methylase [Yersinia pestis CA88-4125] >gi|152960772|gb|ABS48233.1| DNA adenine methylase [Yersinia pseudotuberculosis IP 31758] >gi|162352330|gb|ABX86278.1| DNA adenine methylase [Yersinia pestis Angola] >gi|165915723|gb|EDR34331.1| DNA adenine methylase [Yersinia pestis biovar Orientalis str. IP275] >gi|165919976|gb|EDR37277.1| DNA adenine methylase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165990578|gb|EDR42879.1| DNA adenine methylase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205655|gb|EDR50135.1| DNA adenine methylase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166963023|gb|EDR59044.1| DNA adenine methylase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167051944|gb|EDR63352.1| DNA adenine methylase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167055355|gb|EDR65149.1| DNA adenine methylase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169749023|gb|ACA66541.1| DNA adenine methylase [Yersinia pseudotuberculosis YPIII] >gi|186700262|gb|ACC90891.1| DNA adenine methylase [Yersinia pseudotuberculosis PB1/+] (271 aa)
Score = 305, Expect = 5.4e-26, Identities = 87/289 (30%), Positives = 153/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKG-TKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+++I+++ P  +  I    EPFVG G+V  +     E +   ++DIN +LIN+Y+++K +  + +       +D  +  T D     L     F +L+++ +       +A L ++LN+ C+NGL R N  G FNV  G YK P   +   L   ++K +N   V   Y+++     +   VY DPPY P+++T++FTAY+ + F   +Q+ LA    +L+ +    +L+SN D + +       +  + A ++  V A+R I+ +   R ++NELL
  S:     5 RAFLKWAGGKYPLVDDIRRHLPAGDCLI----EPFVGAGSVFLNT----EFESYILADINNDLINLYNIVKLRTDDFV-------RDARVLFTGDFNHSEL-----FYQLRQEFNASTDAYRRALLFLYLNRHCYNGLCRYNLSGEFNVPFGRYKKPYFPEA-ELYWFAEKSQNAVFVCEHYQETLLKAVQGAVVYCDPPYAPLSATANFTAYHTNNFGIADQQNLARLAYQLSTESKVPVLISNHDTELTR------NWYHQAASLHVVTARRTISRNILGRSKVNELL 267
>gi|123444147|ref|YP_001008117.1| DNA adenine methylase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122091108|emb|CAL13991.1| DNA adenine methylase [Yersinia enterocolitica subsp. enterocolitica 8081] (270 aa)
Score = 305, Expect = 5.7e-26, Identities = 87/289 (30%), Positives = 151/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGT-KILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+++I+++ P  +  I    EPFVG G+V  +     E +   ++DIN++LIN+Y+++K +  + +       +D  +  T D          +F +L+++ +       +A L ++LN+ C+NGL R N  G FNV  G YK P   +   L   ++K +N   V   Y+++         VY DPPY P+++T++FTAY+   F   +Q+ LA    +L+ +    +L+SN D +          + Y   ++  VKA+R I+ +   R ++NELL
  S:     5 RAFLKWAGGKYPLVDDIRRHLPAGDCLI----EPFVGAGSVFLNT----EYESYILADINSDLINLYNIVKDRTDDFV-------RDARVLFTGD-----FNNSEQFYQLRQEFNASTDAYRRALLFLYLNRHCYNGLCRYNLSGEFNVPFGRYKRPYFPEN-ELYWFAEKSQNAIFVCEHYQETLLKAVHGAVVYCDPPYAPLSATANFTAYHTSNFGLADQQNLARLAYQLSAENKIPVLISNHDTE-------LTRDWYHQASLHVVKARRTISRNILGRSKVNELL 266
>gi|77975038|ref|ZP_00830575.1| COG0338: Site-specific DNA methylase [Yersinia frederiksenii ATCC 33641] (270 aa)
Score = 305, Expect = 5.8e-26, Identities = 88/289 (30%), Positives = 156/289 (53%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIM-EKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGT-KILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+++I+++ P  +  I    EPFVG G+V  +     E +   ++DIN++LIN+Y+++K +  + +   +++   DF     ++ + +YL+++  FN       N +    +A L ++LN+ C+NGL R N  G FNV  G YK P   +   L   ++K ++   V   Y+++         VY DPPY P+++T++FTAY+   F   +Q+ LA    +L+ +    +L+SN D +          + Y   ++  VKA+R I+ +   R ++NELL
  S:     5 RAFLKWAGGKYPLVDDIRRHLPAGDCLI----EPFVGAGSVFLNT----EYESYILADINSDLINLYNIVKNRTDDFVRDARVLFTGDF-----NNSEQFYLLRQ-EFN----ASTNAY---RRALLFLYLNRHCYNGLCRYNLSGEFNVPFGRYKKPYFPEA-ELYWFAEKSQHAVFVCEHYQETLLKAVHGAVVYCDPPYAPLSATANFTAYHTSNFGLADQQNLARLAYQLSAENKIPVLISNHDTE-------LTRDWYHQASLHVVKARRTISRNILGRSKVNELL 266
>gi|52426022|ref|YP_089159.1| Dam protein [Mannheimia succiniciproducens MBEL55E] >gi|52308074|gb|AAU38574.1| Dam protein [Mannheimia succiniciproducens MBEL55E] (281 aa)
Score = 304, Expect = 6.6e-26, Identities = 88/289 (30%), Positives = 144/289 (49%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINK-LNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L + I   +P     +    EPFVG G+V  +  S++E     ++DINA+LIN+++ +K  V   I  L    K        +   YY  +++ FN       N      ++ L ++LN+  FNGL R N    FNV  G YK+    +   L   ++K K+   +  D+ ++ +  D  + +Y DPPY P+   S+FT Y  + F+  +Q+ LA+   + +N +   +L+SN D        +F  EIY     KR+K +R I+     R ++NEL+
  S:    14 RSFLKWAGGKYRLTDNINNLFPKRRKCLV---EPFVGAGSVFLN--SQFE--RYILADINADLINLFNTVKTDVDAYIEAL----KPVFFHAEANSAGYYYARRDDFN-------NSTDPFFRSVLFLYLNRFGFNGLCRYNSLNEFNVPFGAYKSHYFPEK-ELRYFAEKAKSAVFICADFNETFKLADDESVIYCDPPYAPLLQDSNFTKYAGNDFSVTHQQALAELAKQTVNERNIPVLISNHD-------TAFTREIYHGAKFKRIKVQRTISQAAERRVKVNELI 277
>gi|149909437|ref|ZP_01898092.1| putative DNA adenine methylase [Moritella sp. PE36] >gi|149807547|gb|EDM67496.1| putative DNA adenine methylase [Moritella sp. PE36] (270 aa)
Score = 304, Expect = 7.0e-26, Identities = 88/293 (30%), Positives = 149/293 (50%)
  Q:    52 LQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNN-KGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +Q  + FLKW GGK  L++ +++  P       +  EPFVG G+V  +     +  E  ++DIN +LIN+Y ++++K ++ I   Q     F     +D++ YY I++ +FN    K  N +   +++ + +++N+  FNGL R NK G FNV  G YK P       L   ++K K    +   Y    + +  +  VY DPPY P++ T+SFT+Y+   F+  +Q  LA    + +  +   IL+SN D            E+Y     + V+ KR I+ +   R +++ELL
  S:     1 MQKTRAFLKWAGGKYSLVDHLREKLPAGK----RLVEPFVGAGSVFLNT----DYDEYLLNDINPDLINMYKILQHKPEQFIADAQ----RFFTPEFNDKERYYKIRE-KFN----KTSNPY---QRSLMFLYMNRHGFNGLCRYNKSGGFNVPFGSYKKPYF-PLKELRFFAEKSKKATFICESYSDVYKRLGSDDVVYCDPPYAPLSRTASFTSYSASGFSLDDQALLAKVSRETSQERNIPILISNHDI-------PLTRELYHGSTFEVVQVKRTISRNAGKRNKVDELL 266
>gi|196155330|ref|YP_002124819.1| DNA adenine methylase [Alteromonas macleodii 'Deep ecotype'] >gi|88775059|gb|EAR06310.1| DNA adenine methylase [Alteromonas macleodii 'Deep ecotype'] >gi|196111109|gb|ACG64825.1| DNA adenine methylase [Alteromonas macleodii 'Deep ecotype'] (293 aa)
Score = 302, Expect = 1.4e-25, Identities = 85/289 (29%), Positives = 142/289 (49%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNK-GTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+  I+   P    Q  K  EPFVG G+V  +     + K   ++DIN +LIN+Y+ +K +   LI       + F     ++ K YY +++    E    ED  +    +A L ++LN+  +NGL R + +G FNV  G YK P   +   +   S+K +        ++K      +   +Y DPPY PI+ T++FT+Y    F  ++Q++LA+   + + K G  +L+SN D             +Y   +   +  KR I+ +G+ R  ++E+L
  S:     7 RAFLKWAGGKYSLVEHIQARLP----QANKLIEPFVGAGSVFLNT----QYKRYLLNDINPDLINLYNFLKAQPDALIN----DARSFFDGKRNEEKMYYALRE----EFNATEDEYY----RAILFLYLNRHGYNGLCRYSLQGRFNVPFGRYKKPYFPED-EMFVFSEKSQKATFTCLPFEKVFSRARRGNVIYCDPPYAPISKTAAFTSYAARSFGQESQEKLAELATRASKKRGIPVLISNHDL-------PLTRALYQGADFSMLSVKRSISQNGAKRQPVDEIL 268
>gi|147679030|ref|YP_001213245.1| hypothetical protein PTH_2695 [Pelotomaculum thermopropionicum SI] >gi|146275127|dbj|BAF60876.1| hypothetical protein [Pelotomaculum thermopropionicum SI] (240 aa)
Score = 300, Expect = 2.1e-25, Identities = 87/293 (29%), Positives = 138/293 (47%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           KP +KW GGK QL+++ +  +P    + T Y EPF+GGGAV F +       E  + D N ELIN Y V++  ++ L+  L+        ++ +++++YY         +   + ++   V +A+  ++LNKT +NGL+RVNKKG  NV  G YKNP+I D  NL  +S+ L+   I+ GD                               ++K L                      ++LSNSD         F  E+Y  Y++K V A+R IN     RG ++EL++ N+
  S:    29 KPPVKWAGGKGQLISQFEPLFP--KQEFTLYIEPFLGGGAVFFHI----SPLEAILIDNNPELINFYIVVRDNLQALLADLE--------KHQNNKEYYY--------SMCALDPDKMDAVSRASRFLYLNKTGYNGLWRVNKKGKHNVPFGQYKNPRIVDKENLRQVSRVLQRAEIILGD-------------------------------FSKGL----------------------VMLSNSD-------TPFIRELYEGYDLKVVYARRAINCCAEKRGPVSELVVRNY 239
>gi|146328707|ref|YP_001210044.1| DNA adenine methylase [Dichelobacter nodosus VCS1703A] >gi|146232177|gb|ABQ13155.1| DNA adenine methylase [Dichelobacter nodosus VCS1703A] (275 aa)
Score = 299, Expect = 2.7e-25, Identities = 79/289 (27%), Positives = 141/289 (48%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +PFLKW G K++L+  I +  P       +  EPF G  A+   +    + +   ++DIN +LI++Y  +K +    I       + F     +        ++NRF +L+ + ++     E++AL ++LN+  FNGL R N+ G FNV  G Y+ P   +   +    +K +   ++ GD++ +    +++  +Y DPPY P+++T+SFTAY +  F    Q++LA    +   +   IL+SN D         F   +Y          +R I + G+ R ++ ELL
  S:     5 RPFLKWAGSKSKLIPWIARAIP---QTARRLIEPFAGSAALSLAL----DFEAYVLNDINRDLIHLYQTLKIEKTAFID----YARSFFTAEHN--------QENRFYDLRAQFNDSDDIFERSALFLYLNRHGFNGLCRYNRAGQFNVPFGRYRAPYFPEA-EMRHFIEKSERFTLLCGDFQTAFHQANRDDIIYCDPPYVPLSATASFTAYAQKGFTLNEQRQLAQMAQQTAPRVKSILISNHD-------TDFTRTLYHGARFNCFSVRRSIAAQGNCRKKVKELL 266
>gi|157960070|ref|YP_001500104.1| DNA adenine methylase [Shewanella pealeana ATCC 700345] >gi|157845070|gb|ABV85569.1| DNA adenine methylase [Shewanella pealeana ATCC 700345] (279 aa)
Score = 298, Expect = 3.3e-25, Identities = 87/289 (30%), Positives = 142/289 (49%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L+  + ++ P    +  +  EPFVG G+V  +  S Y   +  + DIN +LIN+Y ++K +    I       K   +   +D++ YY I+   FN  ++          ++   +++N+  FNGL R N+KG FNV  G YK P   +   + A S K +N       Y+++ +       VY DPPY P++ST+SFT Y    F+  +Q  LA         +G  +L+SN D            E+Y       ++ +R I+  GSSR +++EL+
  S:     6 RAFLKWAGGKFKLIEALAEHLP----EGDRLVEPFVGAGSVFLN--SNYS--QYLLCDINHDLINLYKIVKKEPDRYIEA----AKALFVPEMNDKEAYYKIR-TAFNATQDP-------FTRSVYFLYMNRHGFNGLCRYNRKGGFNVPFGSYKKPYFPEK-EILAFSLKAQNAEFHCIGYEQAIDMTKSGDVVYCDPPYAPLSSTASFTTYVGSGFSLDDQALLARKARHTAIERGIPVLISNHDI-------PLTRELYHGARFGTIQVQRNISQKGSSRKKVDELM 267
>gi|152977947|ref|YP_001343576.1| DNA adenine methylase [Actinobacillus succinogenes 130Z] >gi|150839670|gb|ABR73641.1| DNA adenine methylase [Actinobacillus succinogenes 130Z] (288 aa)
Score = 298, Expect = 3.4e-25, Identities = 87/289 (30%), Positives = 153/289 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L ++I    P     +    EPFVG G+V  +  S YE     ++DIN +LIN+++V+K  V+  I  L+ +   F   N +   +YY  ++  FN+      + FL   ++ L ++LN+  FNGL R N    FNV  G +K     +   +   ++K ++   + GD++++    D+++ +Y DPPY P+   S+FT Y  + F+ ++QK LAD  ++    +   +++SN D +       F  EIY    +K+++ +R I+     R ++NEL+
  S:    14 RSFLKWAGGKYRLTDDINSLLPKKKKCLV---EPFVGAGSVFLN--SHYE--RYILADINPDLINLFNVLKQDVECYIAALKPV---FFHPNANTPDYYY-ARREEFNQ----SGDVFL---RSVLFVYLNRFGFNGLCRYNANNEFNVPFGSHKTHYFPEN-EMRYFAQKAQSAVFICGDFQETFLLADEHSVIYCDPPYAPLHQDSNFTKYAGNNFSLEHQKALADLAHQTRIERRIPVVISNHDTR-------FTREIYQKAELKKIRVQRSISRKSERRLKVNELI 277
>gi|168467807|ref|ZP_02701644.1| Dmt [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|195629099|gb|EDX48473.1| Dmt [Salmonella enterica subsp. enterica serovar Newport str. SL317] (819 aa)
Score = 298, Expect = 3.8e-25, Identities = 78/276 (28%), Positives = 131/276 (47%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYS--AYNIKRVKAKRMIN 331
           KPFLKW GGK ++++++  + P     I    EPF GGG+V  +        E+  SD   +LI  Y V++ +     P+  I +   + R  +   ++  IK  RFN+       +   +E+AA  I+LN+ C+NGL R N +G FNV  G Y+ P       LEA +           D   +     +   V+ DPPY P+   S FT Y+   F   +Q  LA  +   + +G  ++++NS             E+Y+   ++++ ++A+R I+
  S:   565 KPFLKWAGGKYRVIDDVLAHLPSGRRLI----EPFAGGGSVFLNA----GFSEVIASDACDDLILTYQVMQRE-----PLATIDKAAMMFREGNYSDYFAKIKA-RFNK------REMTQLERAAAFIYLNRHCYNGLMRYNLQGEFNVGFGKYRQPYF-PLAELEAFAAVASRCTFAVADCNDTVALAGEGDVVFCDPPYEPMPGKSGFTNYSGQSFRFDDQVRLAQSLKAAHQRGASVVITNSGAPA-------IRELYTCMGFDVRPLRARRSIS 814
>gi|114561566|ref|YP_749079.1| DNA adenine methylase [Shewanella frigidimarina NCIMB 400] >gi|114332859|gb|ABI70241.1| DNA adenine methylase [Shewanella frigidimarina NCIMB 400] (278 aa)
Score = 297, Expect = 4.3e-25, Identities = 82/289 (28%), Positives = 145/289 (50%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKL-NNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L++E+ K+ P  N  I    EPFVG G+V  +     +  +  + DIN +LIN+Y +++ +  + I   + M  D      +D+  YY ++   FN   +     F+   ++   +++N+  FNGL R N+KG FNV  G YK P   +   +   S K +        Y+++ +  +    +Y DPPY P+++T+SFT Y    F+  +Q  LA +   + + +   +L+SN D            E+Y   +   +  +R I+  G SR +++E++
  S:     6 RAFLKWAGGKYKLVDELAKHLPAGNRLI----EPFVGAGSVFLNT----QFDDYLLCDINQDLINLYQIVQQQPDKYIKAAKAMFVD----EMNDKDAYYRVRA-EFNLCSDP----FI---RSVYFLYMNRHGFNGLCRYNRKGGFNVPFGSYKKPYFPEA-EIRYFSLKAQKATFKCISYEQAFDMANSGDVIYCDPPYAPLSTTASFTTYAGPGFSLDDQALLARHSRLIAHERNIPVLISNHDI-------PLTRELYRGASCSTISVQRNISPKGGSRNKVDEIM 267
>gi|148284594|ref|YP_001248684.1| site-specific DNA adenine methylase [Orientia tsutsugamushi str. Boryong] >gi|146740033|emb|CAM80136.1| site-specific DNA adenine methylase [Orientia tsutsugamushi Boryong] (267 aa)
Score = 297, Expect = 4.5e-25, Identities = 98/293 (33%), Positives = 150/293 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLF--NVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           KPFL WVGGK +++N++ ++ P  +     Y EPF+GGGA+ F V  ++  K+ ++SDIN +LI  Y  +K    E+  +L +  K+          +YY I+ N ++       N   D+   A  I+LNK  F G+YR+N+ G      S   Y    IC  +N    SK L +V+I   D+   E    K  FVY DPPY      S    Y +  F+++ Q  L D++ +LNNKG KI+LSN+       N +F  ++Y  + I  +     IN     R  +NEL+I+N+
  S:    10 KPFLHWVGGKRRIVNKLIEHLP--SGPYYNYYEPFLGGGALFFQV--RHLFKQCFLSDINLDLITSYHAVKKNPNEVNRLLNLYHKN------HSENYYYKIRDNYYS-------NDPNDI--TAKFIYLNKYSFRGIYRLNRDGTSAQTFSDKRYLKLHICSRIN--KCSKLLTDVSICAMDFSFIEP--KKGDFVYLDPPYH----QSGERFYTRVPFDEKEQIRLRDFVYELNNKGVKIMLSNN-------NTAFIKDLYKDFFITHIPVTYSIN---QQRNTVNELIITNY 267
>gi|167855591|ref|ZP_02478351.1| DNA adenine methylase [Haemophilus parasuis 29755] >gi|167853282|gb|EDS24536.1| DNA adenine methylase [Haemophilus parasuis 29755] (272 aa)
Score = 296, Expect = 6.2e-25, Identities = 89/289 (30%), Positives = 144/289 (49%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNT---FVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L +EI ++ P    Q     EPFVG G+V  +       +   ++DIN +LIN+++VIK  V+  I   Q +  D      +  K+YY  ++  FN  ++        + ++AL ++LN+  FNGL R N+K  FNV  G YK     +   L   ++K +    +  D+ +  +++  N     VY DPPY P+   ++FT Y    F+ + Q  LAD   +       +L+SN D +       F  +IY    IK++K +R I     SR +++EL 
  S:     4 RAFLKWAGGKFRLTDEINRHLP----QKACLVEPFVGAGSVFLNT----HFERYILADINPDLINLFNVIKADVESYIQQSQALFND---PQANTAKFYYE-RRKEFNACQDL-------LRRSALFLYLNRFGFNGLCRYNQKNEFNVPFGDYKTYYFPEK-ELRFFAEKAQKAVFICADFHQVFQYLLDNPDDYAVYCDPPYAPLKQETNFTHYAGGGFSLEQQIALADRAKQAQQAKIPVLISNHDTE-------FTRQIYRGAKIKKLKVQRHIGQSIDSRIKVDELF 268
>gi|91791632|ref|YP_561283.1| DNA adenine methylase [Shewanella denitrificans OS217] >gi|91713634|gb|ABE53560.1| DNA adenine methylase [Shewanella denitrificans OS217] (279 aa)
Score = 295, Expect = 7.6e-25, Identities = 83/289 (28%), Positives = 147/289 (50%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELA-DYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L++E+ K  P    +  +  EPFVG G+V  +     +  +  + DIN +LIN+Y++IK   +  I       K   +   +D++  YL  + +FN+ ++          ++   +++N+  FNGL R N+KG FNV  G YK P   +   +   S+K +        Y+++    +K+  +Y DPPY P+++T+SFT Y    F+  +Q  LA +  +    KG  +L+SN D            E+Y    +  +  +R I+ +G SR +++E++
  S:     6 RAFLKWAGGKFKLVDELAKQLP----KGKRLIEPFVGAGSVFLNT----DYDDYLLCDINPDLINLYNIIKQTPEAYITA----AKALFIPEMNDKQ-AYLDVREKFNQTQDP-------FARSVYFLYMNRHGFNGLCRYNRKGGFNVPFGTYKKPYFPEN-EIRYFSEKAQRAEFKCIGYEEAFALAEKDDVIYCDPPYAPLSTTASFTTYVGPGFSLDDQAILARESRHTALVKGIPVLISNHDI-------PLTRELYRGAKLGSISVQRNISQNGGSRKKVDEIM 267
>gi|188492135|ref|ZP_02999405.1| DNA adenine methylase [Escherichia coli 53638] >gi|188487334|gb|EDU62437.1| DNA adenine methylase [Escherichia coli 53638] (320 aa)
Score = 295, Expect = 8.5e-25, Identities = 81/286 (28%), Positives = 138/286 (48%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDN-QFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDT-LNLEAISKKLKNVNIVYGDYKKSEEF---------IDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELAD-YINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           LKW GGK  ++ ++++Y P    +     EPFVGGG+V  +    + V    + D N  LIN Y  +     EL      M++ + L         Y   +  FN +    D  +   +E AAL ++LN+ CFNGL+R N+KG FNV  G ++ P   D  + L A   +      ++ D++ +            +     +Y DPPY P     +FT YN   F  ++ ++LA   +N     G + ++SNSD   +        +IYS++ +  +  +R + +  S+R +  E++
  S:    11 LKWAGGKFSIMPQLREYLP----KAACLIEPFVGGGSVFMNTDYDHYV----LCDSNPALINFYQQLTTNTMEL------MDRAWSLFKDGGTPEAYKRHRGAFNTIALATDRLRGESLEWAALFLYLNRYCFNGLHRTNQKGEFNVPFGKHRTPYFPDQEMRLFADKARETRTRFIHADFRTAFTMPAEIRRFSSVHGGIAIYCDPPYLPPDGKEAFTHYNGRAFTRKDHRDLAALMMNAWQRYGIRPVVSNSDTTET-------RQIYSSFELHTLSVRRSVAASSSARQQAKEVI 287
>gi|148284129|ref|YP_001248219.1| site-specific DNA adenine methylase [Orientia tsutsugamushi str. Boryong] >gi|146739568|emb|CAM79311.1| site-specific DNA adenine methylase [Orientia tsutsugamushi Boryong] (276 aa)
Score = 293, Expect = 1.5e-24, Identities = 99/293 (33%), Positives = 150/293 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLF--NVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           KPFL WVGGK +++N++ ++ P  +     Y EPF+GGGA+ F V  ++  K+ ++SDIN +LI  Y  +K    E+  +L +  K+          +YY I+ N ++       N   D+   A  I+LNK  F G+YR+N+ G      S   Y    IC  +N    SK L +V+I   D+   E    K  FVY DPPY      S    Y +  F+++ Q  L D++ +LNNKG KI+LSN+       N +F  +IY  + I  +     IN     R  +NEL+I+N+
  S:    10 KPFLHWVGGKRRIVNKLIEHLP--SGPYYNYYEPFLGGGALFFQV--RHLFKQCFLSDINLDLITSYHAVKKNPNEVNRLLNLYHKN------HSENYYYKIRDNYYS-------NDPNDI--TAKFIYLNKYSFRGIYRLNRDGTSAQTFSDKRYLKLHICSRIN--KCSKLLTDVSICAMDFSFIEP--KKGDFVYLDPPYH----QSGERFYTRVPFDEKEQIRLRDFVYELNNKGVKIMLSNN-------NTAFIRDIYKDFFITHIGVTYSIN---QKRNLVNELIITNY 267
>gi|127511150|ref|YP_001092347.1| DNA adenine methylase [Shewanella loihica PV-4] >gi|126636445|gb|ABO22088.1| DNA adenine methylase [Shewanella loihica PV-4] (279 aa)
Score = 293, Expect = 1.6e-24, Identities = 82/289 (28%), Positives = 148/289 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L++ + ++ P    +  +  EPFVG G+V  +       K   + DIN +LIN+Y +++   ++ I   + M     +   +D++ YY ++ + FN+ ++     FL   ++   +++N+  FNGL R N KG FNV  G YK P   +   ++A + K +        Y+++ +       VY DPPY P+++T+SFT Y    F+  +Q  LA        ++G  +L+SN D            E+Y       ++ +R I+ +G+SR +++EL+
  S:     6 RAFLKWAGGKFKLVDALTQHLP----EGDRLVEPFVGAGSVFLNT----HYKRYLLCDINQDLINLYQIVQSTPEKYITEAKAM----FVEAKNDKEAYYQVR-SEFNQTQDP----FL---RSVYFLYMNRHGFNGLCRYNSKGGFNVPFGSYKKPYFPEE-EIKAFADKAQVAEFKCIGYEEAFDLTQPGDVVYCDPPYAPLSTTASFTTYVGSGFSLDDQALLARKSRHTAIDRGIPVLISNHDI-------PLTRELYHGARFDTIQVQRNISQNGNSRKKVDELM 267
>gi|85711539|ref|ZP_01042597.1| DNA adenine methylase [Idiomarina baltica OS145] >gi|85694691|gb|EAQ32631.1| DNA adenine methylase [Idiomarina baltica OS145] (289 aa)
Score = 291, Expect = 2.4e-24, Identities = 87/289 (30%), Positives = 133/289 (46%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADY-INKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+  IK   P    +  K  EPFVG G+V  +     +     ++DIN +LI +Y  +K + K  I   + +   F  RN     +Y L K   FNE  +          ++ L ++LN+  +NGL R N +G+FNV  G Y+ P   +   +E  ++K K    V   +++      K   +Y DPPY P+   S+FT+Y    F+   Q ELA + I     +   +L+SN D             +Y    I  +K  R I+  G +R  + ELL
  S:     5 RAFLKWAGGKYGLVEPIKACLP----EGRKLIEPFVGAGSVFLNT----DYDRYLLNDINPDLITLYQFVKRRPKTFIADARRL---FTARNNQSDAYYALRKS--FNESNDP-------YYRSLLFLYLNRHGYNGLCRYNSRGIFNVPFGDYRKPYFPEA-EIEVFAEKAKRAKFVCSSFEQVFRRARKGDVIYCDPPYAPLVQASNFTSYATGGFSLDEQSELARHAIRAACKRHIPVLISNHD-------TPLTRALYERAKISSLKVARNISQKGDARKPVAELL 266
>gi|167625984|ref|YP_001676278.1| DNA adenine methylase [Shewanella halifaxensis HAW-EB4] >gi|167356006|gb|ABZ78619.1| DNA adenine methylase [Shewanella halifaxensis HAW-EB4] (279 aa)
Score = 291, Expect = 2.4e-24, Identities = 82/289 (28%), Positives = 138/289 (47%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L+  + ++ P    +  +  EPFVG G+V  +           + DIN +LIN+Y +++ +    I       K   +   +D++ YY ++   FN  K+          ++   +++N+  FNGL R N+KG FNV  G YK P   +   +   S+K +N       Y+++ +       VY DPPY P++ST+SFT Y    F+  +Q  LA         +G  +L+SN D            E+Y       ++ +R I+  GS R +++EL+
  S:     6 RAFLKWAGGKFKLIEVLSEHLP----EGDRLVEPFVGAGSVFLNT----HYSNYLLCDINHDLINLYKIVQKEPDRYIEA----AKALFVPEMNDKEAYYKVR-TAFNATKDP-------FTRSVYFLYMNRHGFNGLCRYNRKGGFNVPFGSYKKPYFPEK-EIRGFSEKAQNAEFHCIGYEQAIDMTQTGDVVYCDPPYAPLSSTASFTTYVGSGFSLDDQALLARKARHTAIERGIPVLISNHDI-------PLTRELYHGARFDTIQVQRNISQKGSGRKKVDELI 267
>gi|109896991|ref|YP_660246.1| DNA adenine methylase [Pseudoalteromonas atlantica T6c] >gi|109699272|gb|ABG39192.1| DNA adenine methylase Dam [Pseudoalteromonas atlantica T6c] (277 aa)
Score = 290, Expect = 3.4e-24, Identities = 87/289 (30%), Positives = 142/289 (49%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L+ +I  + P    +  K  EPFVG G+V  +     +     +SDIN +LIN+Y +++ + +  I   Q +   F  +N D   +Y +  +  FN  ++         E+A L ++LN+  +NGL R N  G FNV  G YK P       L   ++K K    V   Y+K+       + VY DPPY PI+ T++F +Y K  F+   Q  LA    K    +   +L+SN D  ++ +       +Y+   +  ++  R I+  G+ R +++ELL
  S:     7 RAFLKWAGGKYRLVEQINHHLP----EAKKLVEPFVGAGSVFLNT----DFSSYLLSDINPDLINLYKILQQQPERYIEDAQGL---FTAQNNDSDAYYAM--RALFNASEDI-------YERAVLFLYLNRFGYNGLCRYNLSGKFNVPFGKYKAPYFPKE-ELYFFAEKSKKAQFVCESYEKTFSRARAGSVVYCDPPYAPISKTANFASYAKGGFSMAEQSNLALISAKTAFERDIPVLISNHDTDDTRR-------LYALAQLSELQVSRFISQKGNGRKKVSELL 268
>gi|163751645|ref|ZP_02158865.1| DNA adenine methylase [Shewanella benthica KT99] >gi|161328471|gb|EDP99626.1| DNA adenine methylase [Shewanella benthica KT99] (279 aa)
Score = 289, Expect = 3.6e-24, Identities = 85/289 (29%), Positives = 142/289 (49%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L+  + K+ P    +  +  EPFVG G+V  +     +     + DIN +LIN+Y +++ +    I   + M     +   +D++ YY ++   FN  ++     F+   ++   +++N+  FNGL R N+KG FNV  G YK P   +   L A S K +        Y+++ E   +   VY DPPY P+ S  SFT Y    F+  +Q  LA        ++G  +L+SN D            E+Y   +   +K +R I+  GS+R +++EL+
  S:     6 RAFLKWAGGKFKLIEALSKHLP----EGDRLVEPFVGAGSVFLNT----DYATYLLCDINQDLINLYKLVQTEPDRYIAAAKAM----FVPEMNDKEAYYKVR-TEFNLTQDP----FI---RSVYFLYMNRHGFNGLCRYNRKGGFNVPFGSYKKPYFPEK-ELWAFSAKAQAAEFKCIGYEEAFELTIQGDVVYCDPPYAPLPSKVSFTTYVGAGFSLDDQALLARKSRHTAIDRGIPVLISNHD-------TPLTRELYHGASFDTIKVQRNISQKGSARKKVDELM 267
>gi|114770899|ref|ZP_01448367.1| DNA adenine methylase [alpha proteobacterium HTCC2255] (280 aa)
Score = 288, Expect = 5.3e-24, Identities = 87/296 (29%), Positives = 147/296 (49%)
  Q:    49 NNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTD-DRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVK--AKRMINSDGSSRGEINELL 344
           +NNL   + FLKW GGK +++  I+   P    +  +  EPFVGGG+V  ++    +  E  + D+N +LI +++++K     +I      EK  +  N + +    Y   + +FN   +        +E+A L I+LN+  +NGL R N+KG +NV  G YK+P   +   +   +++ +    V GD+  +   +     VY DPPY PI  T++FTAY  + F D  Q  L         +G   ++SN           F   +Y   + K+VK   +R I+  G++RG++ E+L
  S:     5 HNNLH--RSFLKWAGGKKKVIPHIQAILPSEGKR--RLVEPFVGGGSVFLNL----DFDEYLLVDMNHDLITLFNLLKTSCDVII------EKSRMYFNGEYNHADAYYALRAQFNSATDP-------IERATLFIYLNRHGYNGLCRYNQKGGYNVPFGRYKHPYFPEK-EMRFFAQRAQTATFVQGDFATAFAQLSIGDVVYCDPPYSPINRTANFTAYAGNGFGDDEQARLVACAQHAQLQGVATVISNHLV-------PFTKALYKDAS-KQVKFAVQRNISQKGNARGKVKEVL 273
>gi|148377521|ref|YP_001256397.1| hypothetical protein MAG2550 [Mycoplasma agalactiae PG2] >gi|148291567|emb|CAL58953.1| Pseudogene of Adenine-specific DNAmethyltransferase (N-terminal part) [Mycoplasma agalactiae PG2] (196 aa)
Score = 288, Expect = 5.4e-24, Identities = 84/200 (42%), Positives = 114/200 (56%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEI-YISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPY 256
           PF+KW GGK QLL+EI    PF  N    Y EPFVG GA+LF +    ++ ++ YI+DIN  LI+ Y ++K    EL+  L  ++  F  ++       Y   +N FNE   K  N   DV  AAL I+LNK CFNGLYRVN KGLFNV   + +N +  D  N+   S+ L+N  I   D++ + +   K  FV+FD PY
  S:     9 PFVKWAGGKRQLLDEILNKIPFKFNN---YYEPFVGAGALLFSL----KINQVSYINDINKSLIHTYKIVKDSPNELLNKLSELDNKFTSKSD------YYECRNLFNE---KIQNGKYDVLHAALFIYLNKRCFNGLYRVNSKGLFNVPFNNKENIRSFDKDNILKASEWLQNKVITNTDFEMAVKTASKGDFVFFDSPY 193
>gi|153091139|gb|EDN73144.1| site-specific DNA-methyltransferase (adenine-specific) [Mannheimia haemolytica PHL213] (275 aa)
Score = 287, Expect = 6.4e-24, Identities = 82/289 (28%), Positives = 142/289 (49%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTF----VYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L+ +I+ + P    +     EPFVG G+V  +     + +   ++DIN +LIN+++V+K  V+E I       K   L    + + +Y  ++  FN  K+          ++ + ++LN+  +NGL R N+K  +NV  G YK     +   L   ++K +    V  D+++  E + KN      +Y DPPY P+   ++FT Y    F+ + Q  LA    ++   G  +L+SN D         F   IY + +I +++ +R I     SR ++ EL 
  S:     7 RAFLKWAGGKYRLIPDIQTHLP----KKACLVEPFVGAGSVFLNT----DFERYILADINPDLINLFNVVKADVEEYIA----QTKQLFLHPQANTEAFYKARRAEFNRSKDI-------FRRSVIFLYLNRFGYNGLCRYNQKKGYNVPFGRYKTHYFPEK-ELRFFAEKAQKATFVCADFEQVFE-LAKNQLTDYVIYCDPPYAPLAQETNFTQYAGGGFSLEQQGRLATLALEMKGLGVPVLISNHD-------TDFTRRIYQSADITQIQVQRSIGQKVGSRVKVGELF 271
>gi|170724713|ref|YP_001758739.1| DNA adenine methylase [Shewanella woodyi ATCC 51908] >gi|169810060|gb|ACA84644.1| DNA adenine methylase [Shewanella woodyi ATCC 51908] (279 aa)
Score = 287, Expect = 7.1e-24, Identities = 83/289 (28%), Positives = 143/289 (49%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L+  + ++ P    +  +  EPFVG G+V  +     +     + DIN +LIN+Y +I+ + ++ I   + M     +   ++++ YY ++   FN       + FL   ++   +++N+  FNGL R N+KG FNV  G YK P   +   + A S+K +        Y+ + E       VY DPPY P+++T+SFT Y    F+  +Q  LA        + G  +L+SN D            E+Y       ++ +R I+  GS+R +++EL+
  S:     6 RAFLKWAGGKFKLIEALTEHLP----EGQRLVEPFVGAGSVFLNT----DYPSYLLCDINKDLINLYKIIQKEPEKYIAAAKAM----FVPEMNEKEAYYRVRA-EFN----LSTDPFL---RSVYFLYMNRHGFNGLCRYNRKGGFNVPFGSYKKPYFPEN-EIRAFSEKAQKAEFKCIGYEDAFELTTSGDVVYCDPPYAPLSTTASFTTYVGTGFSLDDQALLARKSRHTAIDNGIPVLISNHDI-------PLTRELYHGARFDTIQVQRNISQKGSARKKVDELM 267
>gi|71893972|ref|YP_279418.1| DNA adenine methylase [Mycoplasma hyopneumoniae J] >gi|71852099|gb|AAZ44707.1| DNA adenine methylase [Mycoplasma hyopneumoniae J] (549 aa)
Score = 287, Expect = 7.8e-24, Identities = 103/297 (34%), Positives = 160/297 (53%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYK--NPKICDTLNLEAISKKL--KNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSR-GEINELLISNFDIN 351
           +KPF+KWVGGKTQL+N I    P + N    Y EPF+GGGA+      K + +   ++DIN+EL+N +  IK  +  L   L+I       ++   ++++Y ++    +E+ E        ++KAA  I+LNKTCFNGLYRVN KG FNV   + +  N  I D  NL  IS  L   ++ I   +Y +      +N FV+ DPPY    + +SFT Y+++ +  Q+  EL D + KLN K  K + +N        + S        ++I ++   R INS+   R    NE++I N+ ++
  S:     6 LKPFVKWVGGKTQLINVILSLLPKNFNS---YIEPFLGGGALFL----KLQPENAIVNDINSELVNSWKQIKINLDTLTKQLEIY------KSLHSKEFFYKLR----SEIPENS------IKKAARFIYLNKTCFNGLYRVNSKGEFNVPFNNAEIINSTIFDFKNLNNISSFLNENSIEIYNKNYLEILSLAKENDFVFIDPPYDS-ENDNSFTNYDRNGWKKQDTLELIDTLKKLNAKKVKWMFTN-------HSTSLVLNNLKEFSIFQIPVNRFINSNSQDRILAANEVIIINYKVD 276
>gi|194442233|ref|YP_002041988.1| retron EC67 DNA adenine methylase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194400896|gb|ACF61118.1| retron EC67 DNA adenine methylase [Salmonella enterica subsp. enterica serovar Newport str. SL254] (277 aa)
Score = 285, Expect = 1.1e-23, Identities = 82/291 (28%), Positives = 149/291 (51%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFI-DKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLI 345
           VK  LKWVG K +L+ +++ + P    +  +  EPF G  AV+ +     +  E  I+D+N++LI++Y  I+       P + I E   L    ++   YY I++ +FN   +  +     + +A   ++LN+  + GL R N++G FNV  G+YK P   +   + + +KK K    +   Y ++ + + D N  VY DPPY  +T + +FTAY++  F+  +Q  LA  + +L  +G +++ SNSD +           +Y+ +   +V A R + +  +S     EL++
  S:     3 VKTPLKWVGSKARLMPKLRPHLP----EGKRLVEPFAGSCAVMMNT----DYDEYLIADVNSDLIHMYRAIQEA-----PDMFIWEAKGLFELGNNASVYYDIRE-QFNTSTDATE-----LWRAVAFLYLNRHGYRGLCRYNQRGAFNVPYGNYKKPYFPED-EIMSFAKKAKRATFITAHYSETLDLVRDGNDVVYCDPPY--LTDSDNFTAYHERGFSHMDQGRLARKLRRLAERGIQVVASNSDLE-------MVHYLYAGFEALKVNAPRSVGAAAASPKMAAELIL 265
>gi|148285068|ref|YP_001249158.1| site-specific DNA adenine methylase [Orientia tsutsugamushi str. Boryong] >gi|146740507|emb|CAM81073.1| site-specific DNA adenine methylase [Orientia tsutsugamushi Boryong] (268 aa)
Score = 284, Expect = 1.7e-23, Identities = 97/294 (32%), Positives = 148/294 (50%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLF--NVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           KPFL WVGGK +++N++ ++ P  +     Y EPF+GGGA+ F V  ++  K+ ++SDIN +LI  Y  +K    E+  +L +  K+          +YY I+ N ++       N   D+   A  I+LNK  F G+YR+N+ G      S   Y    IC  +N    SK L +V+I   D+   E    K  FVY DPPY      S    Y +  F+++ Q  L D++ +LNNKG KI+LSN+       N +F   +Y    I  +     IN     R  +N L+I+N++
  S:    10 KPFLHWVGGKRRIVNKLIEHLP--SGPYYNYYEPFLGGGALFFQV--RHLFKQCFLSDINLDLITSYHAVKKNPNEVNRLLNLYHKN------HSENYYYKIRDNYYS-------NDPNDI--TAKFIYLNKYSFRGIYRLNRDGTSAQTFSDKRYLKLHICSRIN--KCSKLLTDVSICAMDFSFIEP--KKGDFVYLDPPYH----QSGERFYTRVPFDEKEQIRLRDFVYELNNKGVKIMLSNN-------NTTFIKALYKDLFITHIGVTYSIN---EQRNLVNGLIITNYN 268
>gi|170024545|ref|YP_001721050.1| DNA adenine methylase [Yersinia pseudotuberculosis YPIII] >gi|169751079|gb|ACA68597.1| DNA adenine methylase [Yersinia pseudotuberculosis YPIII] (272 aa)
Score = 283, Expect = 2.1e-23, Identities = 74/288 (25%), Positives = 139/288 (48%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLIS 346
           LKW G K +++  ++++ P       +  EPF G  +V+ +     +  E  I+DIN +LIN Y  ++   + +I    I+ K+  L   D+ +  Y + +  FNE       +  D  +AA+ ++LN+    G+ R N+KG FNV  G YK P   +   +   ++K +    V  D+ ++         VY DPPY P ++T+ FT+Y+   F+   Q  L++ +  + ++G  ++ SNSD  +          +Y +++I  + A R  +     R  + E++ +
  S:     8 LKWAGSKGRIMPTLRQHLPVGK----RLVEPFAGSCSVMLNT----DYDEYLIADINGDLINFYQQLQRDCESII----ILAKE--LFKFDNSEANYYLNRQHFNE------RELSDEYRAAMFLYLNRHSHGGICRYNQKGEFNVPYGRYKAPYFPEA-EIRYFAEKSQKATFVCCDFFEALTMTVPGDVVYCDPPYIPTSATADFTSYHTGGFSSNEQFWLSEILTIIADQGCHVIASNSDTPHGRY-------LYESFDIHSITAPRSASCKAGGRKAVGEIIAT 267
>gi|54020632|ref|YP_116149.1| DNA adenine methylase [Mycoplasma hyopneumoniae 232] >gi|53987805|gb|AAV28006.1| putative methylase [Mycoplasma hyopneumoniae 232] (549 aa)
Score = 283, Expect = 2.1e-23, Identities = 102/297 (34%), Positives = 160/297 (53%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYK--NPKICDTLNLEAISKKL--KNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSR-GEINELLISNFDIN 351
           +KPF+KWVGGKTQL+N I    P + N    Y EPF+GGGA+      K + +   ++DIN+EL+N +  IK  +  L   L+I       ++   ++++Y ++    +E+ E        ++KAA  I+LNKTCFNGLYRVN KG FNV   + +  N  I D  NL  IS  L   ++ I   +Y +      +N FV+ DPPY    + +SFT Y+++ +  Q+  EL + + KLN K  K + +N        + S        ++I ++   R INS+   R    NE++I N+ ++
  S:     6 LKPFVKWVGGKTQLINVILSLLPKNFNS---YIEPFLGGGALFL----KLQPENAIVNDINSELVNSWKQIKINLDTLTKQLEIY------KSLHSKEFFYKLR----SEIPENS------IKKAARFIYLNKTCFNGLYRVNSKGEFNVPFNNAEIINSTIFDFKNLNNISSFLNENSIEIYNKNYLEILSLAKENDFVFIDPPYDS-ENDNSFTNYDRNGWKKQDTLELINTLKKLNAKKVKWMFTN-------HSTSLILNNLKEFSIFQIPVNRFINSNSQDRILATNEVIIINYKVD 276
>gi|21233716|ref|NP_640014.1| dam methylase [Proteus vulgaris] >gi|21202900|dbj|BAB93616.1| dam methylase [Proteus vulgaris] (273 aa)
Score = 283, Expect = 2.2e-23, Identities = 82/288 (28%), Positives = 143/288 (49%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNK-KGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLIS 346
           LKWVGGK  ++ ++K   P    + T+  EPF G GAV+ +      V    ++DINA++IN Y  I+   + +I  L       L      R+ Y  I+K  FN            V  AA+ I++N+  + GL R NK KG FNV  G Y+ P + +   +  ++ +L+N +++   ++++ +   +   VY DPPY    +   FT Y+   F++  Q+ L D +N L  KG  ++ S+ D +N         ++Y+ + +K   A R +  +G+  G+  + +I+
  S:     5 LKWVGGKQGVMAQLKLALP----KGTRLIEPFCGSGAVMMNTAYSNYV----LADINADVINTYDTIRNAAESVIAALTE-----LYETCRTREHYDAIRK-EFNARTADP------VRMAAMFIYMNRHGYRGLCRYNKRKGEFNVPWGDYRKPYLPEK-EIRYMADRLENADLLCAGFEETLKLAGEGDVVYCDPPY---VNPGKFTGYHSSGFSEAQQRALVDILNTLPEKGVHVVASSHDAEN-------IRQMYAGFTVKGFSAPRSV-YNGTGEGKKAKEIIA 261
>gi|51596198|ref|YP_070389.1| putative DNA adenine methylase [Yersinia pseudotuberculosis IP 32953] >gi|51589480|emb|CAH21102.1| putative DNA adenine methylase [Yersinia pseudotuberculosis IP 32953] (272 aa)
Score = 283, Expect = 2.3e-23, Identities = 74/288 (25%), Positives = 139/288 (48%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLIS 346
           LKW G K +++  ++++ P       +  EPF G  +V+ +     +  E  I+DIN +LIN Y  ++   + +I    ++ K+  L   D+ +  Y   +  FNE       +  D  +AA+ ++LN+ C  G+ R N+KG FNV  G YK P   +   +   ++K +    V  D+ ++         VY DPPY P ++T+ FT+Y+   F+   Q  L++ +  + ++G  ++ SNSD  +          +Y +++I  + A R  +     R  + E++ +
  S:     8 LKWAGSKGRIMPTLRQHLPAGK----RLVEPFAGSCSVMLNT----DYDEYLIADINDDLINFYQQLQRDCESII----VLAKE--LFKFDNSEANYYSNRQHFNE------RELSDEYRAAIFLYLNRHCHGGICRYNQKGEFNVPYGRYKAPYFPEA-EIRYFAEKSQKATFVCCDFFEALTMTMPGDVVYCDPPYIPTSATADFTSYHTGGFSSNEQFWLSEILTIIADQGCHVIASNSDTPHGRY-------LYESFDIHSITAPRSASCKADGRKAVGEIIAT 267
>gi|72080950|ref|YP_288008.1| DNA adenine methylase [Mycoplasma hyopneumoniae 7448] >gi|71914074|gb|AAZ53985.1| DNA adenine methylase [Mycoplasma hyopneumoniae 7448] (549 aa)
Score = 282, Expect = 2.5e-23, Identities = 102/297 (34%), Positives = 160/297 (53%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYK--NPKICDTLNLEAISKKL--KNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSR-GEINELLISNFDIN 351
           +KPF+KWVGGKTQL+N I    P + N    Y EPF+GGGA+      K + +   ++DIN+EL+N +  IK  +  L   L+I       ++   ++++Y ++    +E+ E        ++KAA  I+LNKTCFNGLYRVN KG FNV   + +  N  I D  NL  IS  L   ++ I   +Y +      +N FV+ DPPY    + +SFT Y+++ +  Q+  EL + + KLN K  K + +N        + S        ++I ++   R INS+   R    NE++I N+ ++
  S:     6 LKPFVKWVGGKTQLINVILSLLPKNFNS---YIEPFLGGGALFL----KLQPENAIVNDINSELVNSWKQIKINLDTLTKQLEIY------KSLHSKEFFYKLR----SEIPENS------IKKAARFIYLNKTCFNGLYRVNSKGEFNVPFNNAEIINSTIFDFKNLNNISSFLNENSIEIYNKNYLEILSLAKENDFVFIDPPYDS-ENDNSFTNYDRNGWKKQDTLELINTLKKLNAKKVKWMFTN-------HSTSLVLNNLKEFSIFQIPVNRFINSNSQDRILATNEVIIINYKVD 276
>gi|148284463|ref|YP_001248553.1| site-specific DNA adenine methylase [Orientia tsutsugamushi str. Boryong] >gi|148284867|ref|YP_001248957.1| site-specific DNA adenine methylase [Orientia tsutsugamushi str. Boryong] >gi|148284896|ref|YP_001248986.1| site-specific DNA adenine methylase [Orientia tsutsugamushi str. Boryong] >gi|146739902|emb|CAM79883.1| site-specific DNA adenine methylase [Orientia tsutsugamushi Boryong] >gi|146740306|emb|CAM80695.1| site-specific DNA adenine methylase [Orientia tsutsugamushi Boryong] >gi|146740335|emb|CAM80751.1| site-specific DNA adenine methylase [Orientia tsutsugamushi Boryong] (268 aa)
Score = 281, Expect = 3.2e-23, Identities = 99/304 (32%), Positives = 152/304 (50%)
  Q:    46 VEINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLF--NVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           + I+N L   KPFL WVGGK +++N++ ++ P  +     Y EPF+G GA+ F V  ++  K+ ++SDIN +LI  Y  +K    E+  +L +  K+          +YY I+ N ++       N   D+   A  I+LNK  F G+YR+N+ G      S   Y    IC  +N    S  L  V+I   D+   E    K  FVY DPPY      S    Y +  F+D+ Q  L D++ +LNNKG KI++SN+       N +F  ++Y    I  +     IN     R  +NEL+I+N++
  S:     3 IAISNEL---KPFLHWVGGKRRIVNKLIEHLP--SGPYYNYYEPFLGCGALFFQV--RHLFKQCFLSDINLDLITSYHAVKKNPNEVNRLLNLYHKN------HSENYYYKIRDNYYS-------NDPNDI--TAKFIYLNKYSFRGIYRLNRDGTSAQTFSDKRYLKLHICSRIN--KCSNLLAGVSICAMDFSFIEP--KKGDFVYLDPPYH----QSGERFYTRVPFDDKEQIRLRDFVYELNNKGVKIMISNN-------NTAFIRDLYKELFITHIGVTYSIN---EQRNLVNELIITNYN 268
>gi|54296677|ref|YP_123046.1| DNA adenine methylase [Legionella pneumophila str. Paris] >gi|53750462|emb|CAH11856.1| DNA adenine methylase [Legionella pneumophila str. Paris] (272 aa)
Score = 280, Expect = 4.7e-23, Identities = 79/290 (27%), Positives = 134/290 (46%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           ++PFLKW G K   LNEI    P     I    EPF G G V  +           +++ N++L+N+Y +++   +  I   Q     +     + ++ YY        EL+ + +N     +K+A+ ++LN+  +NGL R N KG +NV  G Y+ P       +    KK  +   ++GD++ +    +    +Y DPPY P+T  +    YN+ LF+ ++Q ELA+   +  +KG  +++SN D +       F    Y    IK     R I+     R  + EL+
  S:     4 IRPFLKWAGSKYNCLNEIISSLPTGQRLI----EPFAGSGVVFMNT----SYSSYLLAESNSDLVNIYRILQLNGESFIDYCQ----QYFTPEANCKEKYY--------ELRSEFNNLMDSNQKSAVFLYLNRHGYNGLCRYNSKGKYNVPFGLYEKPYF-PRKEMMLFYKKCLSAQFIHGDFRNTFALAEPGDVIYCDPPYVPLTENNQTLPYNQKLFSLEDQIELAELAQETASKGIPVIISNHDTE-------FTRHHYKKAQIKSFYVPRWISCRSQMRLPVKELV 265
>gi|148285090|ref|YP_001249180.1| site-specific DNA adenine methylase [Orientia tsutsugamushi str. Boryong] >gi|146740529|emb|CAM81108.1| site-specific DNA adenine methylase [Orientia tsutsugamushi Boryong] (270 aa)
Score = 280, Expect = 4.8e-23, Identities = 98/293 (33%), Positives = 146/293 (49%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLF--NVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           KPFL WVGGK +++N++ ++ P  +     Y EPF+GGGA+ F V  K+  K+ ++SDIN +LI  Y  +K    E+  +L +  ++           YY I+ N ++       N   D+   A  I+LNK  F G+YR+N+ G      S   Y    IC  +N    SK L   +I   D+   E    K  FVY DPPY      S    Y +  F+++ Q  L D++ +LNNKG KI+LSN+       N +F  +IY  + I  +     IN     R  +NEL+I N+
  S:    10 KPFLHWVGGKRRIVNKLIEHLP--SGPYYNYYEPFLGGGALFFQV--KHLFKQCFLSDINLDLITSYHAVKKNPNEVNRLLNLYHEN------HSENHYYKIRDNYYS-------NDPNDI--TAKFIYLNKYSFRGIYRLNRDGTSAQTFSDKQYLKLHICSRIN--KCSKLLTGTSIYAMDFSFIEP--KKGDFVYLDPPYH----QSGERFYTRVPFDEKEQIRLRDFVYELNNKGVKIMLSNN-------NTAFIRDIYKNFFITHIPVTYSIN---QKRNLVNELIIINY 267
>gi|16766042|ref|NP_461657.1| DNA adenine methylase-like protein [Salmonella typhimurium LT2] >gi|169936055|ref|YP_001718754.1| DNA adenine methylase-like protein [Enterobacteria phage Fels-2] >gi|16421276|gb|AAL21616.1| Fels-2 prophage protein [Salmonella typhimurium LT2] (285 aa)
Score = 278, Expect = 7.6e-23, Identities = 77/270 (28%), Positives = 127/270 (47%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKR 328
           LKW G KT ++ E+KK+ P    +  +  EPF G  AV+ +     +     ++DIN +LIN+Y VIK  V+  I      E  +L    +D + YY  ++    E   +       +E+A   ++LN+  + GL R N  G FNV  G+YK P   +   + A ++K K    +   Y ++   +     VY DPPY       +F  Y+   F + +Q  LA  + + +++G  +++SNSD        S    +Y  +   R+ AKR
  S:     5 LKWAGNKTAIMAELKKHLP----EGPRLVEPFAGSCAVMIET----DYPHYLVADINPDLINLYQVIKNDVEYFIK-----EGRYLFEARNDPEAYYKTRQ----EFNLRHGGA---IERALYFLYLNRHGYRGLCRYNLDGYFNVPYGNYKKPYFPEN-EIRAFAEKAKRATFICASYDETLALLQTGDVVYCDPPY-----DGTFNGYHTAGFTENDQFHLASILERRSSEGHPVIVSNSD-------TSLTRSLYRDFTRHRITAKR 241
>gi|54293637|ref|YP_126052.1| DNA adenine methylase [Legionella pneumophila str. Lens] >gi|53753469|emb|CAH14924.1| DNA adenine methylase [Legionella pneumophila str. Lens] (272 aa)
Score = 278, Expect = 8.3e-23, Identities = 80/290 (27%), Positives = 133/290 (45%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           ++PFLKW G K   LNEI    P     I    EPF G G V  +           +++ N++L+N+Y +++   +  I   Q     +     + ++ YY        EL+ + +N     +K+A+ ++LN+  +NGL R N KG +NV  G Y+ P       +    KK  +   ++GD++ +         +Y DPPY P+T  +    YNK LF+ ++Q ELA+   +  +KG  +++SN D +       F    Y    IK     R I+     R  + EL+
  S:     4 IRPFLKWAGSKYNCLNEIISSLPTGQRLI----EPFAGSGVVFMNT----SYSSYLLAESNSDLVNIYRILQLNGESFIDYCQ----QYFTPEANCKEKYY--------ELRSEFNNLMDSNQKSAVFLYLNRHGYNGLCRYNSKGKYNVPFGLYEKPYF-PRKEMMLFYKKCLSAQFIHGDFRNTFALAKPGDIIYCDPPYVPLTENNQTLPYNKKLFSLEDQIELAELAQETASKGIPVIISNHDTE-------FTRYHYKKAQIKSFYVPRWISCRSQMRLPVKELV 265
>gi|91789207|ref|YP_550159.1| DNA adenine methylase [Polaromonas sp. JS666] >gi|91698432|gb|ABE45261.1| DNA adenine methylase [Polaromonas sp. JS666] (274 aa)
Score = 277, Expect = 9.3e-23, Identities = 85/293 (29%), Positives = 133/293 (45%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGH--YKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +P L+W G K ++   +  Y P    +  +Y EPFVG GA+ F +         +I D+N E+ + Y  +K    ++   L  + K      T D   Y L+++ R  +L           ++AA +IFL K+CFNG+YR N  G FNV  G   YK P    +  L+++S  LK   +  GDYK   +      F+Y DPPY   +       Y+  +F D   +EL      L N+G K++LS        KN+         + I  +   R +N++   R    E+L  N+
  S:    14 QPVLRWAGSKRRITPILSAYAP---PKYERYFEPFVGSGALFFCLRPPLA----FIGDVNPEVTSTYQALKDAPSQVAQHLTEIPK------TKDA--YLLLRQLRPADLTT--------AQRAARLIFLMKSCFNGVYRTNASGQFNVPFGSTIYKLPT---SEELQSVSDALKLTQVRTGDYKSWLDIAGVGDFIYLDPPYSCSSRYRGEYGYDA-IFGDVQLEELLTCCKALQNRGAKVMLSY-------KNNKQVVNALKDWRILNLAVPRSVNANSMGRTPAAEILAMNY 274
>gi|18466476|ref|NP_569284.1| putative DNA modification methylase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|160431920|ref|YP_001552034.1| putative DNA modification methylase [Salmonella enterica subsp. enterica serovar Choleraesuis] >gi|16505792|emb|CAD09670.1| putative DNA modification methylase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|145848927|emb|CAM91474.1| putative DNA adenine methylase [Salmonella enterica] >gi|159885461|dbj|BAF93065.1| putative DNA modification methylase [Salmonella enterica subsp. enterica serovar Choleraesuis] (274 aa)
Score = 277, Expect = 9.8e-23, Identities = 86/288 (29%), Positives = 148/288 (51%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD--VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYS--AYNIKRVKAKRMINSDGSSRGEINELL 344
           P +KW GGKT+L+  + K++P  +++  ++ EPF+GGGAV  ++ +     E  ++D N +LIN+Y  I+      I  +Q++ +    R+ ++  +Y L  +N FN         F D  +++AA+   +N+  +NGL R N K  F+V  G      + D   ++ +S +L +V +   D+ ++ EF      +Y DPPY  I+ T SF +Y+   F+     +LAD +   N KG  + +SNS          F  E+Y    ++I    A R + S   SR +  E+L
  S:     6 PIIKWAGGKTKLMPFLSKHFP--HDKSRRWVEPFIGGGAVFLNMFAT----EALLADSNPDLINLYRNIQRNKPAFIREVQLLAE----RHFEEEDYYVL--RNTFNS------TSFDDAPLQRAAIFYAMNRLGYNGLCRYNLKRKFSVPWGKRYQFSL-DIQKVDYLSFRLSSVELKTADFGQTLEFAGGGDQIYCDPPYDKISKT-SFVSYDGIPFDKSAHVKLADMLVDANRKGASVAISNS-------MTPFTLELYEERGFDIHTHNAYRSVGSQSKSRKKEIEIL 270
>gi|168227879|ref|ZP_02653110.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] (285 aa)
Score = 277, Expect = 1.0e-22, Identities = 85/282 (30%), Positives = 137/282 (48%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMIN---SDGSSRGEI 340
           LKW G KT ++ E+ K+ P       +  EPF G  AV+       +     ++DIN +LIN+Y +I+   K+   V+QI  + F   N+D +  YY ++++ FN     E      VEKAA  ++LN+  + GL R N+KG +N   GHYK P   +   +   + K K    +   ++++   +     VY DPPY       +F+ Y+   F   +Q  LA  + + +++G  +++SNSD        S    IY  +   R+ AKR +     DG S  EI
  S:     5 LKWAGNKTAIMPELIKHLPAG----PRLVEPFAGSCAVMMAT----DYHHYLVADINPDLINLYLMIQ---KDHEAVIQIARELFKGFNSDVQ--YYRVRQH-FNYSISNE------VEKAAYFLYLNRHGYRGLCRYNQKGEYNNPYGHYKKPYFPEN-EIRTFAVKAKRAMFICASFEETLALLQAGDVVYCDPPY-----DGTFSGYHTAGFTVDDQYHLASILERRSSEGHPVIVSNSD-------TSLTRSIYRNFTRHRIIAKRSMGVAAGDGKSAAEI 256
>gi|167558042|ref|ZP_02351052.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] (285 aa)
Score = 277, Expect = 1.0e-22, Identities = 79/281 (28%), Positives = 132/281 (46%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGE 339
           LKW G KT +++E+KK+ P       +  EPF G  AV+ +     +     ++DIN +LIN+Y  +    +  I   +++   F + N   R+  Y   +  FN   E       D  KA   ++LN+  + GL R NK G FN+  G+YKNP   +   + A ++K +    +   + ++   +     VY DPPY       +F+ Y+ D F + +Q  LA  +   +++G  +++SNSD        S    +Y  +    +KAKR I   G + GE
  S:     5 LKWAGNKTTIMSELKKHLPAG----PRLVEPFAGSCAVMMET----DYPSYLVADINPDLINLYKKVAADCESFISRARVL---FEIAN---REVAYYNIRQEFNYSTE-----ITDFMKAVYFLYLNRHGYRGLCRYNKSGHFNIPYGNYKNPYFPEK-EIRAFAEKAQRATFICASFDETLAMLKAGDVVYCDPPY-----DGTFSGYHTDGFTEDDQYHLASVLEHRSSEGHPVIVSNSD-------TSLIRSLYRNFTHHYIKAKRSI---GVAAGE 250
>gi|126179423|ref|YP_001047388.1| DNA adenine methylase [Methanoculleus marisnigri JR1] >gi|125862217|gb|ABN57406.1| DNA adenine methylase [Methanoculleus marisnigri JR1] (283 aa)
Score = 277, Expect = 1.0e-22, Identities = 83/302 (27%), Positives = 146/302 (48%)
  Q:    39 ILSLRQKVEINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEI 340
           +L L Q   I  N+ +    L++ GGK + +       P     I  Y EPF+GGG+V F V  +  +    ++DIN ELI++Y  I+ K  +++        +   R   ++  YY I+         ++D   L  E+AA  ++LN+TCF G++R N  G FNV  G  +   +    +L A++++L++  ++  D++++     +  F+Y DPPYRP         Y    FN ++ K LA  + +   +G + +++NS   +     + +D+ YS Y + R          GSS G+I
  S:     1 MLMLTQTASIEKNISL----LRYPGGKQRYVCHFSHLLPLEPQSIRTYVEPFLGGGSVFFHVNPEKAI----LADINRELIDLYLGIR-KNPDVV-------WELYSRYPANKAGYYKIRS------LNRDDLHLL--ERAARTLYLNRTCFKGMWRHNNNGEFNVGYGGQERRWVIGPDDLCAVAQRLQHAVLLCCDFEETIASCREGDFLYLDPPYRPGEREQLHAHYMFGEFNFEDHKRLASCLREATERGVQWVMTNSSHPDI---LALYDD-YSMYRLDR--------GTGSSPGQI 266
>gi|94968122|ref|YP_590170.1| DNA adenine methylase [Acidobacteria bacterium Ellin345] >gi|94550172|gb|ABF40096.1| DNA adenine methylase [Acidobacteria bacterium Ellin345] (286 aa)
Score = 277, Expect = 1.1e-22, Identities = 82/293 (27%), Positives = 134/293 (45%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAAL-MIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISN 347
           VKPFL+W G K + L+ +    P+ + +  +Y EPF G   + FD+     V    + D N ELI +Y V++   + L   L  +++D            YL  +N        ++   LD E  AL  ++LN+ CFNG+YR N +G FNV MG  +  +     +L   S+ L+   +V GD+  + + +    FVY DPPY  + S   F  Y   LF  ++     + ++ +  +G   L+S +D K +         +   +   R+  KR +      R    E +ISN
  S:    19 VKPFLRWAGSKRKQLSRLA---PYWSGEHKRYVEPFAGSACLFFDLAPPSAV----LGDSNEELIQLYRVVRDSPERLHRRLCRIKRDVAT---------YLRWRN--------QNPTTLDPETRALRFLYLNRNCFNGIYRTNLQGGFNVPMGK-RVGEYFSKEDLLRCSRLLQTAELVAGDFSATLDLVKVGDFVYLDPPY-AVLSRRIFKEYGSKLFGTEDMPRFEESLHAIVGRGADFLVSYADCKEARA-------LARKWCSVRLPVKRHVAGFAGDRKTAYEWVISN 279
>gi|168476727|ref|ZP_02705750.1| DNA adenine methylase-like protein [Salmonella enterica subsp. enterica serovar Virchow str. SL491] (285 aa)
Score = 276, Expect = 1.3e-22, Identities = 77/270 (28%), Positives = 126/270 (46%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKR 328
           LKW G KT ++ E+KK+ P       +  EPF G  AV+ +     +     ++DIN +LIN+Y VIK  V+  I      E  +L    +D + YY  ++    E   +       +E+A   ++LN+  + GL R N  G FNV  G+YK P   +   + A ++K K    +   Y ++   +     VY DPPY       +F  Y+   F + +Q  LA  + + +++G  +++SNSD        S    +Y  +   R+ AKR
  S:     5 LKWAGNKTAIMAELKKHLPAG----PRLVEPFAGSCAVMIET----DYPHYLVADINPDLINLYQVIKNDVEYFIK-----EGRYLFEARNDPEAYYKTRQ----EFNLRHGGA---IERALYFLYLNRHGYRGLCRYNLDGYFNVPYGNYKKPYFPEN-EIRAFAEKAKRATFICASYDETLALLQTGDVVYCDPPY-----DGTFNGYHTAGFTENDQFHLASILERRSSEGHPVIVSNSD-------TSLTRSLYRDFTRHRITAKR 241
>gi|52840891|ref|YP_094690.1| DNA adenine methylase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52628002|gb|AAU26743.1| DNA adenine methylase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (272 aa)
Score = 276, Expect = 1.4e-22, Identities = 79/290 (27%), Positives = 133/290 (45%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           ++PFLKW G K   LNEI    P     I    EPF G G V  +           +++ N++L+N+Y +++   +  I   Q     +     + ++ YY        EL+ + +N     +K+A+ ++LN+  +NGL R N KG +NV  G Y+ P       +    KK  +   ++GD++ +         +Y DPPY P+T  +    YN+ LF+ ++Q ELA+   +  +KG  +++SN D +       F    Y    IK     R I+     R  + EL+
  S:     4 IRPFLKWAGSKYNCLNEIISSLPTGQRLI----EPFAGSGVVFMNT----SYSSYLLAESNSDLVNIYRILQLNGESFIDYCQ----QYFTPEANCKEKYY--------ELRSEFNNLMDSNQKSAVFLYLNRHGYNGLCRYNSKGKYNVPFGLYEKPYF-PRKEMMLFYKKCLSAQFIHGDFRNTFALAKPGDVIYCDPPYVPLTENNQTLPYNQKLFSLEDQIELAELAQETASKGIPVIISNHDTE-------FTRHHYKKAQIKSFYVPRWISCRSKMRLPVKELV 265
>gi|34335030|gb|AAQ65005.1| unknown [synthetic construct] (285 aa)
Score = 275, Expect = 1.5e-22, Identities = 84/282 (29%), Positives = 137/282 (48%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMIN---SDGSSRGEI 340
           LKW G KT ++ E+ K+ P       +  EPF G  AV+       +     ++DIN +LIN+Y +I+   K+   ++QI  + F   N+D +  YY ++++ FN     E      VEKAA  ++LN+  + GL R N+KG +N   GHYK P   +   +   + K K    +   ++++   +     VY DPPY       +F+ Y+   F   +Q  LA  + + +++G  +++SNSD        S    IY  +   R+ AKR +     DG S  EI
  S:     5 LKWAGNKTAIMPELIKHLPAG----PRLVEPFAGSCAVMMAT----DYHHYLVADINPDLINLYLMIQ---KDHEAIIQIARELFKGFNSDVQ--YYRVRQH-FNYSISNE------VEKAAYFLYLNRHGYRGLCRYNQKGEYNNPYGHYKKPYFPEN-EIRTFAVKAKRAMFICASFEETLALLQAGDVVYCDPPY-----DGTFSGYHTAGFTVDDQYHLASILERRSSEGHPVIVSNSD-------TSLTRSIYRNFTRHRIIAKRSMGVAAGDGKSAAEI 256
>gi|160872747|ref|ZP_02062879.1| DNA adenine methylase (Deoxyadenosyl-methyltransferase)(DNA adenine methyltransferase) (M.EcoDam) [Rickettsiella grylli] >gi|159121546|gb|EDP46884.1| DNA adenine methylase (Deoxyadenosyl-methyltransferase)(DNA adenine methyltransferase) (M.EcoDam) [Rickettsiella grylli] (266 aa)
Score = 275, Expect = 1.7e-22, Identities = 86/290 (29%), Positives = 140/290 (48%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +KPFLKW G K ++ ++IK Y    N  I    EPF+G  AV  +       +   + D N +LI +Y  ++ + +  I   +   K     NT D   +Y +++  FN  K+         ++AAL+++LNK CFNGL R N+KG FN     YKNP   +   ++   K       ++GD+  +   + +   VY DPPY  +++T++FT Y    F+   Q  LA     L +KG ++++SN D +       F   IY    +     +R I+S   +R +  E+L
  S:     1 MKPFLKWAGNKHRIFHKIKPYLLKSNRLI----EPFLGSAAVFLNT----SYQSYLLGDNNFDLIQLYKYLQKEGQFFIDYCRFFFKKKF--NTTDE--FYRLRR-VFNNTKKCR-------QRAALLLYLNKHCFNGLARFNQKGEFNTPFSPYKNPYFPEK-EMQYFYKHANKATFIHGDFLSTLASVKQGDIVYCDPPYVGLSNTANFTQYTSQGFSRSQQLSLAKTAKYLASKGIRVIISNHDTE-------FTRYIYREARLISFSVQRNISSKSVTRKKTKEIL 262
>gi|188997010|ref|YP_001931261.1| DNA adenine methylase [Sulfurihydrogenibium sp. YO3AOP1] >gi|188932077|gb|ACD66707.1| DNA adenine methylase [Sulfurihydrogenibium sp. YO3AOP1] (264 aa)
Score = 275, Expect = 1.7e-22, Identities = 81/245 (33%), Positives = 127/245 (51%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSN 299
           ++PFLKW G K +++ +IK+  P  N  I    EPFVG GAV  +     + K   ++DIN +LIN+Y  +    K+ I       K F     +         K R+ EL++  +     V K+AL ++LN+ C+NGL R N+KG FN   G Y+ P   +   ++    KLK  +V +    Y+++ + +     +Y DPPY PI+ TS+FT Y ++ F   +Q +L   +  L  KG   +LSN
  S:     1 MRPFLKWAGNKYKIVEDIKRLLPVGNRLI----EPFVGSGAVFLNA----DYKSYLLADINEDLINLYRTLGDYGKDFIS----FTKTFFTPENN--------TKERYMELRDVFNTTNDKVLKSALFVYLNRHCYNGLIRYNQKGEFNTPFGRYQKPYFPEE-EMQLFYNKLKKTDVELRVSSYEETLKDVFYGDVIYCDPPYIPISKTSNFTQYYQEKFTILDQLKLIQILKDLAKKGIPSVLSN 226
>gi|157160336|ref|YP_001457654.1| retron EC67 DNA adenine methylase [Escherichia coli HS] >gi|157066016|gb|ABV05271.1| retron EC67 DNA adenine methylase [Escherichia coli HS] (285 aa)
Score = 274, Expect = 2.3e-22, Identities = 79/282 (28%), Positives = 132/282 (46%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMIN---SDGSSRGEI 340
           LKW G KT +++E+KK+ P       +  EPF G  AV+ +     +     ++DIN +LIN+Y  +    +  I   +++   F + N   R+  Y   +  FN   E       D  KA   ++LN+  + GL R NK G FN+  G+YKNP   +   + A ++K +    +   + ++   +     VY DPPY       +F+ Y+ D F + +Q  LA  +   +++G  +++SNSD        S    +Y  +    +K KR I     +G S  EI
  S:     5 LKWAGNKTAIMSELKKHLPAG----PRLVEPFAGSCAVMMET----DYPSYLVADINPDLINLYKKVAADCESFISRARVL---FEIAN---REVAYYNIRQEFNYSTE-----ITDFMKAVYFLYLNRHGYRGLCRYNKSGHFNIPYGNYKNPYFPEK-EIRAFAEKAQRATFICASFDETLAMLKAGDVVYCDPPY-----DGTFSGYHTDGFTEDDQYHLASVLEHRSSEGHPVIVSNSD-------TSLIRSLYRNFTHHYIKVKRSIGVAAGEGKSATEI 257
>gi|168219066|ref|ZP_02644298.1| DNA adenine methylase-like protein [Salmonella enterica subsp. enterica serovar Agona str. SL483] (285 aa)
Score = 273, Expect = 2.5e-22, Identities = 77/270 (28%), Positives = 126/270 (46%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKR 328
           LKW G KT ++ E+KK+ P       +  EPF G  AV+ +     +     ++DIN +LIN+Y VIK  V+  I      E  +L    +D + YY  ++    E   +       +E+A   ++LN+  + GL R N  G FNV  G+YK P   +   + A ++K K    +   Y ++   +     VY DPPY       +F  Y+   F + +Q  LA  + + +++G  +++SNSD        S    +Y  +   R+ AKR
  S:     5 LKWAGNKTAIMAELKKHLPAG----PRLVEPFAGSCAVMIET----DYPHYLVADINPDLINLYQVIKNDVEYFIK-----EGRYLFEARNDPEAYYKTRQ----EFNLRHGGA---IERALYFLYLNRHGYRGLCRYNLDGYFNVPYGNYKKPYFPEN-EIRAFAEKAKRATFICASYDETLALLQTGDVVYCDPPY-----DGTFNGYHTAGFTENDQFHLASILERRSSEGHPVIVSNSD-------TSLTRLLYRDFTRHRITAKR 241
>gi|157377394|ref|YP_001475994.1| site-specific DNA-methyltransferase (adenine-specific) [Shewanella sediminis HAW-EB3] >gi|157319768|gb|ABV38866.1| Site-specific DNA-methyltransferase (adenine-specific) [Shewanella sediminis HAW-EB3] (279 aa)
Score = 273, Expect = 2.8e-22, Identities = 80/289 (27%), Positives = 140/289 (48%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN-NKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK +L+  + ++ P    +  +  EPFVG G+V  +           + DIN +LIN+Y +++ + +  I   + M     +   ++++ YY ++   FN       + FL   ++   +++N+  FNGL R N+KG FNV  G YK P   +   +   S+K +        Y+++ +       VY DPPY P+++T+SFT Y    F+  +Q  LA         +G  +L+SN D            E+Y       ++ +R I+  GS R +++EL+
  S:     6 RAFLKWAGGKFKLIEALSEHLP----EGKRLVEPFVGAGSVFLNT----NYSSYLLCDINQDLINLYKIVQTEPERYIAAAKAM----FVPEMNEKEAYYRVRA-EFN----LSSDPFL---RSVYFLYMNRHGFNGLCRYNRKGGFNVPFGTYKKPYFPEK-EIRFFSEKAQCAEFRCIGYEEAFDLTTDGDVVYCDPPYAPLSTTASFTTYVGAGFSLDDQALLARKSRHTAIERGFPVLISNHDI-------PLTRELYHGARFDTIQVQRNISQKGSGRKKVDELM 267
>gi|148284723|ref|YP_001248813.1| site-specific DNA adenine methylase [Orientia tsutsugamushi str. Boryong] >gi|146740162|emb|CAM80384.1| site-specific DNA adenine methylase [Orientia tsutsugamushi Boryong] (269 aa)
Score = 272, Expect = 3.9e-22, Identities = 91/293 (31%), Positives = 141/293 (48%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           KPFL W+G K +++N++ ++ P        Y EPF+GGGA+ F V  ++  K+ ++SDIN +LI  Y+ +K    E+  +L +  K         + +YY +K    N   E            A  I+LNK  F G+YRV K G    +       K+     +   S  L  V+I   D+   E    +N FVYFDPPY      S    Y +  F +++Q  L D++ KL +KG K+++SN+       N  F  ++Y  +NI  V     IN     R  +NEL+I+N+
  S:    10 KPFLHWIGSKRRIVNKLIEHLP--QGSHYNYYEPFLGGGALFFQV--RHLFKQCFLSDINLDLITSYNAVKNNPNEVNRLLSLYHKH------HSKDYYYKVKNKYSNNPNEI----------TAKFIYLNKYSFRGIYRVYKNGQSAQTFSGECYIKLHIASRINQCSNLLYGVSIYATDFSFIEP--QQNDFVYFDPPYH----KSGERFYTRLPFGEKDQIRLLDFVQKLTSKGVKVMISNN-------NTPFIRDLYKDFNINIVTVVYSIN---EQRNPVNELIITNY 266
>gi|89900610|ref|YP_523081.1| DNA adenine methylase [Rhodoferax ferrireducens T118] >gi|89345347|gb|ABD69550.1| DNA adenine methylase [Rhodoferax ferrireducens T118] (273 aa)
Score = 272, Expect = 4.2e-22, Identities = 87/300 (28%), Positives = 136/300 (45%)
  Q:    49 NNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           NN    + P L+W G K  L   +   +P     + +Y EPF G  ++ F  LS  E     +SDIN+ELIN   +IK + K       +MEK   L   DDR+ YYL++          E      VE+AA  ++LN+ CFNGLYR NK G FNV     +N K+     +   S+ L N  +   D+K +     +  F+Y DPPY      + F  Y+   F  ++ + L   +N  + +G K +LS ++     +           +N   ++ +R I      R    E+++ N+
  S:     5 NNISNQMTPILRWAGSKRYLAKYLLPQFP---QVMHRYIEPFCGSASLFF--LS--EPASSVLSDINSELINALDLIKSRNK------SVMEKYESL--PDDREIYYLVR--------SLEPQALTKVERAARFLYLNRLCFNGLYRTNKSGQFNVPYSGQRNSKLLSREEVSDASRLLNNCELRNDDFKTTISRTKRGDFLYVDPPYAS-KEHNEFCEYDASSFGLRDIQNLWVELNAADRRGVKFMLSYTECAEISR-------FSKRWNSTTIQVRRNIAGFAGHRKMAAEVVVKNY 273
>gi|158520838|ref|YP_001528708.1| DNA adenine methylase [Desulfococcus oleovorans Hxd3] >gi|158509664|gb|ABW66631.1| DNA adenine methylase [Desulfococcus oleovorans Hxd3] (251 aa)
Score = 270, Expect = 5.8e-22, Identities = 86/277 (31%), Positives = 139/277 (50%)
  Q:    72 IKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +K+Y     ++   Y EPFVG GAV F +  +  +    +SD N ELIN Y  IK   + +   L+   K+        + +YY I+ ++             +  KAA +I+LN+TC+NGLYRVN KG FNV +G   N  I DT N   IS  L N  ++  D++   +    + F++ DPPY      + F  YN+ LF+ ++Q  L + + + N++  KILL+N++ K      S  +   + +NI+ +  K +I      R    EL+ +N+
  S:     2 VKRYENLFPSEYRTYIEPFVGSGAVFFHLNPEAAI----LSDKNKELINSYHAIKKDWRLVYAHLKNHNKN------HSKDYYYKIRGSKPRS----------EFTKAARLIYLNRTCWNGLYRVNCKGEFNVPIGTKTN-VILDTDNFHLISVTLSNTELLSDDFQNVIDKAQTDDFLFVDPPYTVKHKNNGFLKYNETLFSWEDQVRLKESLLQANSRKAKILLTNANHK------SIINLYKNYFNIRTLTRKSIIAGQPRFRNNCEELVATNY 251
>gi|16762241|ref|NP_457858.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29143730|ref|NP_807072.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|25286094|pir||AB0926 site-specific DNA-methyltransferase (adenine-specific) (EC 2.1.1.72) - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16504545|emb|CAD09428.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139365|gb|AAO70932.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Typhi Ty2] (285 aa)
Score = 270, Expect = 5.8e-22, Identities = 79/281 (28%), Positives = 132/281 (46%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGE 339
           LKW G KT +++E+KK+ P       +  EPF G  AV+ +     +     ++DIN +LIN+Y  +    +  I   +++   F + N   R+  Y   +  FN   E       D  KA   ++LN+  + GL R NK G FN+  G+YKNP   +   + A ++K +    +   + ++   +     VY DPPY       +F+ Y+ + F + +Q  LA  +   +++G  +++SNSD        S    +Y  +    +KAKR I   G S GE
  S:     5 LKWAGNKTAIMSELKKHLPAG----PRLVEPFAGSCAVMMET----DYPSYLVADINPDLINLYKKVAADCESFISRARVL---FEIAN---REVAYYNIRQEFNYSTE-----ITDFMKAVYFLYLNRHGYRGLCRYNKSGHFNIPYGNYKNPYFPEK-EIRAFAEKAQQATFICASFDETLAMLQVGDVVYCDPPY-----DGTFSGYHTNGFTEDDQYHLASVLEYRSSEGHPVIVSNSD-------TSLIRSLYRNFTHHYIKAKRSI---GVSAGE 250
>gi|148360693|ref|YP_001251900.1| DNA adenine methylase [Legionella pneumophila str. Corby] >gi|148282466|gb|ABQ56554.1| DNA adenine methylase [Legionella pneumophila str. Corby] >gi|158512148|gb|ABW69108.1| DNA adenine methylase [Legionella pneumophila] (272 aa)
Score = 270, Expect = 6.4e-22, Identities = 78/290 (26%), Positives = 132/290 (45%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           ++PFLKW G K   LNEI    P     I    EPF G G V  +           +++ N +L+N+Y +++   +  I   Q     +     + ++ YY        EL+ + +N     +K+A+ ++LN+  +NGL R N KG +NV  G Y+ P       +    KK  +   ++ D++ +    +    +Y DPPY P+T  +    YN+ LF+ ++Q ELA+   +  +KG  +++SN D +       F    Y    IK     R I+     R  + EL+
  S:     4 IRPFLKWAGSKYNCLNEIISSLPTGQRLI----EPFAGSGVVFMNT----SYSSYLLAESNPDLVNIYRILQLNGESFIDYCQ----QYFTPEANCKEKYY--------ELRTEFNNLMDSNQKSAVFLYLNRHGYNGLCRYNSKGKYNVPFGLYEKPYF-PRKEMMLFYKKCLSAQFIHDDFRNTFALAEPGDVIYCDPPYVPLTENNQTLPYNQKLFSLEDQIELAELAQETASKGIPVIISNHDTE-------FTRHHYKKAQIKSFYVPRWISCRSQMRLPVKELV 265
>gi|41203480|ref|NP_957740.1| DNA adenine methylase [Emiliania huxleyi] >gi|33114166|gb|AAP94722.1| DNA adenine methylase [Emiliania huxleyi] (324 aa)
Score = 269, Expect = 7.5e-22, Identities = 92/260 (35%), Positives = 137/260 (52%)
  Q:    41 SLRQKVEINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLS-----KYEVKE-IYISDINAELINVYSVIKYKVKELIPVLQIMEKDFL-----LRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNS 300
           +LR+K + N   +++   L WVG K+++ N I    P   N I  Y EPF+G G+VL  VL      K  +K  I+ SD N +LIN + V++    EL     I    F+     L N + +K +Y   ++ FN      +    ++E++A  +FLNKT F GL+RVN KG FNV  GH K PK      L  + K +KNV+  +  +   +  + K  F Y DPPY  +T T SF  Y  D F++ +   L ++  +L  +     LSNS
  S:    30 TLRKK-QCNKINEIITTPLTWVGNKSKVCNSIFATLP---NSIVNYYEPFLGSGSVLLHVLQQQSEGKITIKSNIFASDFNKDLINFFIVLQQTPIELC---SIFTNSFVSLYNNLENDEAKKKFYYDVRSDFNL-----NLGVFNLEQSARFLFLNKTSFGGLFRVNSKGFFNVPFGHRKKPKFPKESLLLEVHKLIKNVHFSHQRFNH-QIALQKGDFFYLDPPYAKVTKT-SFVNYLPDGFSNNDCLLLLEFCKRLEKEACFFTLSNS 286
>gi|163803107|ref|ZP_02196991.1| 3-dehydroquinate synthase [Vibrio campbellii AND4] >gi|159173099|gb|EDP57931.1| 3-dehydroquinate synthase [Vibrio campbellii AND4] (233 aa)
Score = 269, Expect = 7.7e-22, Identities = 70/218 (32%), Positives = 112/218 (51%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLF 273
           + FLKW GGK  L+ +I+++ P       K  EPFVG G+V  +     +     ++DIN +LIN+Y+++K + +E I      E        ++RK  YL  +  FN+  +        + ++   +++N+  FNGL R NKKG FNV  G YK P   +   LE  ++K      V   Y ++     K   VY DPPY P+++T++FT+Y  + F
  S:     5 RAFLKWAGGKYGLVEDIQRHLP----PARKLVEPFVGAGSVFLNT----DYDHYLLADINPDLINLYNLLKERPEEYIS-----EAKRWFVAENNRKEAYLAIRAEFNKTDDV-------MHRSLAFLYMNRFGFNGLCRYNKKGGFNVPFGSYKKPYFPEA-ELEFFAEKASKATFVCEGYPETFSRARKGCVVYCDPPYAPLSNTANFTSYAGNGF 201
>gi|26246831|ref|NP_752871.1| DNA adenine methylase [Escherichia coli CFT073] >gi|26107231|gb|AAN79414.1|AE016758_18 DNA adenine methylase [Escherichia coli CFT073] (285 aa)
Score = 269, Expect = 8.0e-22, Identities = 80/281 (28%), Positives = 128/281 (45%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGE 339
           LKW G KT ++ E+KKY P       +  EPF G  AV+ +     +     ++DIN +LIN+Y  +    +  I   +      L    +    YY I++  FN   E       D  KA   ++LN+  + GL R NK G FN+  G+YKNP   +   +   ++K +    +   + ++   +     VY DPPY       +F+ Y+ D F + +Q  LA  +   +++G  +++SNSD        S    +Y  +    +KAKR I   G S GE
  S:     5 LKWAGNKTAIMPELKKYLPAG----PRLVEPFAGSCAVMIET----DYPSYLVADINPDLINLYKKVAADCEAFISRARA-----LFEEANREVAYYNIRQ-EFNYSTE-----ITDFMKAVYFLYLNRHGYRGLCRYNKSGHFNIPYGNYKNPYFPEK-EIRKFAEKAQRATFICASFDETLAMLKAGDVVYCDPPY-----YGTFSGYHTDGFTEDDQYHLASVLEHRSSEGHPVIVSNSD-------TSLIRSLYRNFTHHYIKAKRSI---GVSAGE 250
>gi|21233794|ref|NP_640092.1| Dam methylase [Proteus vulgaris] >gi|21202978|dbj|BAB93694.1| Dam methylase [Proteus vulgaris] (275 aa)
Score = 268, Expect = 1.1e-21, Identities = 82/292 (28%), Positives = 139/292 (47%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVN-KKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLIS 346
           ++  LKWVGGK+ L+  I +  P  N  I    EPF G  AV  +  + Y+     ++DIN +LI +Y +++     L+ ++    +DF        ++Y L  ++ FN+    +  Q      AAL ++LN+  + GL R + KKG FNV  GHYK P   +   +  +S+KL+   ++   ++++         VY DPPY        FT Y+   FN  + +EL   +  +  KG  ++ S+        N+    +IY+ ++   + A R I   G      +ELL+S
  S:     1 MRSVLKWVGGKSTLMGSINRILPEGNRLI----EPFTGSCAVTMN--TSYD--SYIVADINQDLIGMYRMVRDAPDTLVAIV----RDFFSHANSADEYYRL--RDIFNQRTSDKPTQ------AALFLYLNRHGYRGLCRYSKKKGTFNVPYGHYKAPLFPEK-EIYHLSEKLQKATLLCASFQETLLLAQPGDVVYCDPPY---VEKGRFTDYHSSGFNMSHLRELVGILESMLEKGVSVVASS-------HNEKAIRDIYARFSQTELTAYRSIGVKGGKGKRADELLLS 262
>gi|193062810|ref|ZP_03043903.1| retron EC67 DNA adenine methylase [Escherichia coli E22] >gi|192931453|gb|EDV84054.1| retron EC67 DNA adenine methylase [Escherichia coli E22] (296 aa)
Score = 268, Expect = 1.2e-21, Identities = 77/291 (26%), Positives = 147/291 (50%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD------VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVY--GDYKKSEE-FIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNN-KGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +++  +KW GGK +++ ++    P    +     EPFVGG +V  +     E +   + DIN +LIN+Y  I      +I   + + K +   + D  KW       R  +L     + F D      + +AA  ++LN+  +NG+ R N++G +NV  G +K P       +   S+K  +   ++   D++ + +  I  +  +Y DPPY P + T++FT Y+   F  +  ++LA  +  +N   G+ ++LSNSD   +        EIY ++N + +   R ++++  +RG  +E++
  S:     1 MIRSLVKWPGGKGRVMPDLLPILP----KADCLVEPFVGGASVFLNT----EYRRYILGDINPDLINLYRQITRWPDAVIDAARPLFKVY--GDKDGYKWIRDDFNARARDLLSLR-SVFEDGPDAGKILRAAQFLYLNRHGYNGVVRYNQQGGYNVPFGRHKTPPYFPEEQIRLFSEKANDTKAIFVCCDFQSTLKIMIGSDAVIYCDPPYLPTSETANFTQYHTAPFGIKEHRQLAAALLDINRLTGSPVILSNSDTPAT-------CEIYRSFNFQEISVNRSVSANAITRGAASEVI 283
>gi|118679|sp|P21311|DMA7_ECOLX Retron EC67 DNA adenine methylase (M.Eco67Dam) (ORF1-EC67 DAM) >gi|145150|gb|AAA23396.1| Dam methylase [Escherichia coli] (285 aa)
Score = 267, Expect = 1.5e-21, Identities = 80/281 (28%), Positives = 130/281 (46%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGE 339
           LKW G KT +++E+KK+ P       +  EPF G  AV+       +     ++DIN +LIN+Y  I    +  I   +++   F + N   R+  Y   +  FN   E       D  KA   ++LN+  + GL R NK G FN+  G+YKNP   +   +   ++K +    +   + ++   +     VY DPPY       +F+ Y+ D F + +Q  LA  +   +++G  +++SNSD        S    +Y  +    +KAKR I   G S GE
  S:     5 LKWAGNKTAIMSELKKHLPAG----PRLVEPFAGSCAVMMAT----DYPSYLVADINPDLINLYKKIAADCEAFISRARVL---FEIAN---REVAYYNIRQEFNYSTE-----ITDFMKAVYFLYLNRHGYRGLCRYNKSGHFNIPYGNYKNPYFPEK-EIRKFAEKAQRATFICASFDETLAMLQVGDVVYCDPPY-----DGTFSGYHTDGFTEDDQYHLASVLEYRSSEGHPVIVSNSD-------TSLIRSLYRNFTHHYIKAKRSI---GVSAGE 250
>gi|119943953|ref|YP_941633.1| DNA adenine methylase [Psychromonas ingrahamii 37] >gi|119862557|gb|ABM02034.1| DNA adenine methylase [Psychromonas ingrahamii 37] (275 aa)
Score = 267, Expect = 1.6e-21, Identities = 83/289 (28%), Positives = 140/289 (48%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L  +I +  P    +  +  EPFVG G+V  +  S ++  E  ++DIN +LI +Y ++K K K+ I      +  +  ++  + +  Y   ++ FN  K+         +++ L ++LN+  +NGL R NK G FNV  G YK P   +   L   S+K K        Y+K  +++  +  +Y DPPY  ++ ++SFT+Y  D F+  +Q  LA    +       +L+SN D            E+Y      +++  R I+S  S+R  + EL 
  S:     6 RAFLKWAGGKFTLTEQINQRLP----EGRRLIEPFVGAGSVFLN--SNFD--EYLLNDINPDLIEMYKIVKRKPKQFI-----CDAKYYFQDAFNNEAIYYQLRSEFNNCKDV-------YKRSLLFLYLNRFGYNGLCRYNKSGGFNVPFGRYKKPYFPEK-ELLIFSEKSKKATFTCKPYQKLFQYLRDDDVLYCDPPYVALSKSASFTSYASDGFSLDDQANLAKLARE---SKCSVLVSNHD-------TILTQELYRDAFCDKIQVSRTISSKSSTRQPVGELF 263
>gi|90407247|ref|ZP_01215434.1| DNA adenine methylase [Psychromonas sp. CNPT3] >gi|90311670|gb|EAS39768.1| DNA adenine methylase [Psychromonas sp. CNPT3] (272 aa)
Score = 266, Expect = 1.7e-21, Identities = 88/289 (30%), Positives = 146/289 (50%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNR---FNELKEKEDNQFLDV-EKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           + FLKW GGK  L+ +I +  P     I    EPFVG G+V  +  S +E     ++DIN +LI +Y +IK K  + I               +D + Y+  K N    + +++  E N   DV ++A L +++N+  +NGL R N+KG FNV  G YK P   +   L   ++K K    V   Y+K  +++  +  +Y DPPY P++ +++FT+Y +  F  ++Q++LA       N    +L+SN D        +   E+Y+      +   R I+S  SSR  ++E+ 
  S:     6 RAFLKWAGGKYSLIEQINQRLPGSKRLI----EPFVGAGSVFLN--SDFE--SYLLNDINPDLIEMYKIIKRKPLQFI---------------NDARHYFQPKYNNEAIYYQMR-TEFNATSDVYQRALLFLYMNRHGYNGLCRYNQKGGFNVPFGRYKKPYFPEK-ELIFFAEKAKKATFVCKSYEKLFQYLRDDDVLYCDPPYVPLSDSANFTSYARTGFLRKDQEKLALLA---ENSKCCVLISNHD-------TALTRELYANAECDFINVARTISSKASSRKSVSEVF 263
>gi|16763099|ref|NP_458716.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29144581|ref|NP_807923.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56414695|ref|YP_151770.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|25286097|pir||AH1038 site-specific DNA-methyltransferase (adenine-specific) (EC 2.1.1.72) - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16505407|emb|CAD06757.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29140219|gb|AAO71783.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56128952|gb|AAV78458.1| DNA adenine methylase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (286 aa)
Score = 263, Expect = 3.9e-21, Identities = 82/282 (29%), Positives = 128/282 (45%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMIN---SDGSSRGEI 340
           LKW G KT ++ E+ K+ P       +  EPF G  AV+       +     ++DIN +LIN+Y  I    +  I   + +   F + N   R+  Y   ++ FN   E       D  KA   ++LN+  + GL R N  G FNV  G+YKNP   +   + A +KK +    +   Y ++   +     VY DPPY       +F+ Y+   F   +Q  LA  + + +++G  I++SNSD        S    +Y  +   R+ AKR +     DG S  EI
  S:     5 LKWAGNKTAIMPELIKHLPAGQ----RLVEPFAGSCAVMMAT----DYPHYLVADINPDLINLYKKIALDCEAFISRAKNI---FAIAN---REVAYYNIRHEFNHSSE-----ITDFMKAVYFLYLNRHGYRGLCRYNLSGHFNVPYGNYKNPYFPEN-EIRAFAKKAQRATFICASYDETLAMLRAGDVVYCDPPY-----DGTFSGYHTASFTGDDQYHLASILERRSSEGHPIIVSNSD-------TSLTRSLYRNFTRHRIIAKRSMGVAAGDGKSATEI 257
>gi|157412232|ref|YP_001481575.1| DNA adenine methylase [Escherichia coli APEC O1] >gi|99867257|gb|ABF67902.1| DNA adenine methylase [Escherichia coli APEC O1] (270 aa)
Score = 263, Expect = 4.6e-21, Identities = 81/288 (28%), Positives = 150/288 (52%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQ-IMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYS--AYNIKRVKAKRMINSDGSSRGEINELL 344
           P +KW GGKT+L+  I  +YP  ++   ++ EPF+GGGAV  ++ ++  +    ++D N +LIN+Y  I+ +    I  +Q + +K F+ ++       Y   ++RFN  K     Q L  ++AAL   LN+  +NG+ R N + +++V  G +   K+ D   ++ +S +L  + ++   ++++     +   +Y DPPY   TS +SF +Y+   F+  +   LA+ +   + KG  + +SNS         SF   +Y    + I R+ A R + S  ++R    E+L
  S:     2 PIIKWAGGKTKLMPFISHHYP--HDHSCRWVEPFIGGGAVFLNMFAQNAL----LADSNPDLINLYRTIQRQKTNFINQVQNLADKTFVEKD-------YYEMRDRFN--KTCISGQSL--QRAALFYSLNRLGYNGMCRYNSERIYSVPWGKHTELKL-DLNKIDYLSFRLSGIELITAGFEETLAATGEGDQIYCDPPYDK-TSKTSFVSYDGKPFSQSDHVLLANMLVDAHRKGAAVAISNS-------LTSFTLGLYEERGFVIHRLSAYRSVGSKPNTRKTETEIL 266
>gi|38348117|ref|NP_941366.1| DNA adenine methylase [Serratia marcescens] >gi|38259594|emb|CAE51823.1| DNA adenine methylase [Serratia marcescens] (277 aa)
Score = 259, Expect = 1.1e-20, Identities = 80/288 (27%), Positives = 152/288 (52%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQ-IMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           P +KW GGKT+L+  I  +YP  ++   ++ EPF+GGGAV  ++ ++  +    ++D N +LIN+Y  I+ +    I  +Q + +K F+ ++      YY + ++RFN  K     Q L  ++AAL   LN+  +NG+ R N + +++V  G +   K+ D   ++ +S +L  + ++   ++++     +   +Y DPPY   TS +SF +Y+   F+  +   LA+ +   + KG  + +SNS    +      ++E    + I R+ A R + S  ++R    E+L
  S:     9 PIIKWAGGKTKLMPFISHHYP--HDHSCRWVEPFIGGGAVFLNMFAQNAL----LADSNPDLINLYRTIQRQKTNFINQVQNLADKTFVEKD------YYEM-RDRFN--KTCISGQPL--QRAALFYSLNRLGYNGMCRYNSERIYSVPWGKHTELKL-DFNKIDYLSFRLSGIELITAGFEETLAATGEGDQIYCDPPYDK-TSKTSFVSYDGKPFSQSDHVLLANMLVDAHRKGAAVAISNS---LTPFTLGLYEE--RGFVIHRLSAYRSVGSKPNTRKTETEIL 273
>gi|167471841|ref|ZP_02336545.1| Site-specific DNA adenine methylase [Rickettsia africae ESF-5] (270 aa)
Score = 259, Expect = 1.1e-20, Identities = 83/277 (29%), Positives = 134/277 (48%)
  Q:    51 NLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAK 327
           NL   +PFL+WVGGK ++++++ K+ P    ++  Y EPF+GGGA+ F V  K+  K+ Y+SDIN EL+  Y+ +K     +  +L         +    ++ YY ++ N         ++    ++  A  I+ N+  F G+Y++N  G    +       K      L+  S  L   +I   D+   E    ++ FVYFDPPY      S    Y +  F++  Q  L D+  +LNNK  KI++SNSD         F   +Y  +NIK +K K
  S:     5 NLDKPQPFLQWVGGKRKIVDQLVKFIP---ERLNNYYEPFLGGGALFFHVRDKF--KQCYLSDINLELVTSYNAVKTNPDAVSKLLDSH------KAKHSKEHYYQVRAN---------NDSSDPIKITARFIYFNRYSFKGIYQINIDGKPAQTFSGRNYSKSDIASRLKQCSSLLAGTSICAIDFSFIEP--QQDDFVYFDPPYH----KSGEKFYTRLPFDENEQTRLRDFALELNNKNVKIMISNSD-------TPFIRNLYKNFNIKIIKVK 248
>gi|170020787|ref|YP_001725741.1| DNA adenine methylase [Escherichia coli ATCC 8739] >gi|169755715|gb|ACA78414.1| DNA adenine methylase [Escherichia coli ATCC 8739] (284 aa)
Score = 259, Expect = 1.2e-20, Identities = 78/281 (27%), Positives = 130/281 (46%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGE 339
           LKW G KT +++E+KK+ P       +  EPF G  AV+ +     +     ++DIN +LIN+Y  +    +  I   +      L    +    YY I++  FN   E       D  KA   ++LN+  + GL R NK G FN+  G+YKNP   +   + A ++K +    +   + ++   +     VY DPPY       +F+ Y+ D F + +Q  LA  +   +++G  +++SNS       N S    +Y  +    ++AKR I   G + GE
  S:     5 LKWAGNKTAIMSELKKHLPAG----PRLVEPFAGSCAVMMET----DYPSYLVADINPDLINLYKKVAADCEAFISRARA-----LFEEANREVAYYNIRQ-EFNYSTE-----ITDFMKAVYFLYLNRHGYRGLCRYNKSGHFNIPYGNYKNPYFPEK-EIRAFAEKAQWATFICASFDETLAMLKVGDVVYCDPPY-----DGTFSGYHTDGFTEDDQYHLASILEHRSSEGHPVIVSNS-------NTSLTRSLYRNFTHHYIRAKRSI---GVAAGE 250
>gi|157964621|ref|YP_001499445.1| site-specific DNA adenine methylase [Rickettsia massiliae MTU5] >gi|157844397|gb|ABV84898.1| Site-specific DNA adenine methylase [Rickettsia massiliae MTU5] (266 aa)
Score = 257, Expect = 1.9e-20, Identities = 88/299 (29%), Positives = 143/299 (47%)
  Q:    50 NNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           NN    +PFL+WVGGK ++ +++ K+ P   + +  Y EPF+GGGA+ F V  K+  K+ Y+SDIN EL+  Y+ +K    ++  +L         +    ++ YY +  N  +    K   +F         I+LN+  F G+YR+N  G    +       K      L+  S+ L   +I   D+   E    K+ FVYFDPPY      S    Y +  F++  Q  L D+  +LN+K  KI++SNS       N  F   +Y  +NI  +K K  +     +    +E++I+N+
  S:     4 NNSNKAQPFLQWVGGKRKITDQLIKFLP---SLLNNYYEPFLGGGALFFQVRDKF--KQCYLSDINLELVTSYNAVKRNPDKVSKLLDSY------KEKHSKEHYYQVSSNNDSNDPAKITARF---------IYLNRYSFKGIYRINVDGKPAQTFSGRNYSKSDIASRLKQCSQLLAGTSICAMDFSFIEP--QKDDFVYFDPPYH----KSGEKFYTRLPFDENEQTRLKDFALELNDKNVKIMISNS-------NTPFIRNLYKNFNISIIKVKYSMPEHNKTS---DEVIITNY 266
>gi|56461575|ref|YP_156856.1| DNA adenine methylase [Idiomarina loihiensis L2TR] >gi|56180585|gb|AAV83307.1| DNA adenine methylase [Idiomarina loihiensis L2TR] (290 aa)
Score = 257, Expect = 1.9e-20, Identities = 89/297 (29%), Positives = 139/297 (46%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNK-GTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL-ISNFDINK 352
           + FLKW GGK  L+  I    P    Q  K  EPFVG G+V  +     +     ++DIN +LI +Y  +K + K  I   Q   K F+ RN     +Y L  +  FN      D  F    ++ L +++N+  +NGL R N KG+FNV  G Y+ P   +   LE  ++K +    +   +++      +   +Y DPPY P+  TS+FT+Y    F   +Q ELA    ++  K    +L+SN D             +Y   +I  +   R I+  G  R  + ELL + + ++NK
  S:     5 RAFLKWAGGKYSLIEPITARLP----QGKKLIEPFVGAGSVFLNT----DYDSYLLNDINQDLITLYQFVKRRPKTFI---QDARKLFVDRNNQADAYYAL--RAAFNA---SSDPYF----RSLLFLYMNRHGYNGLCRYNSKGIFNVPFGDYRKPYFPEK-ELEHFAEKARKAKFICRPFEQVFRRARQGDVIYCDPPYAPLDQTSNFTSYATGGFGLTDQDELARRAVQVAKKRHIPVLISNHD-------TDLTRALYKHADISSLSVSRSISQKGDGRKPVAELLALYDSEVNK 275
>gi|12082209|dbj|BAB20835.1| DNA adenine methylase M.SsuM [Streptococcus suis] (152 aa)
Score = 257, Expect = 2.1e-20, Identities = 66/163 (40%), Positives = 96/163 (58%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDT 217
           +KPF KW GGK +LL ++ ++ PF  N   +Y EPFVGGGA+ FD+  +  V    I+D N ELIN Y  I+   + L+ +L I +++       + K YYL  ++     ++       DVE+AA ++++ +  FNGLYRVN K  FNV  G YKNPKI D+
  S:     3 LKPFTKWTGGKRKLLTQLHEHLPFEYN---RYFEPFVGGGALFFDLAPENAV----INDFNEELINTYLQIRDNPEALLDLLHIHQEN-------NSKEYYLDVRSVD---RDGRIETMSDVERAARILYMLRVDFNGLYRVNSKNQFNVPYGRYKNPKIVDS 148
>gi|91205230|ref|YP_537585.1| site-specific DNA adenine methylase [Rickettsia bellii RML369-C] >gi|157827433|ref|YP_001496497.1| site-specific DNA adenine methylase [Rickettsia bellii OSU 85-389] >gi|91068774|gb|ABE04496.1| Site-specific DNA adenine methylase [Rickettsia bellii RML369-C] >gi|157802737|gb|ABV79460.1| Site-specific DNA adenine methylase [Rickettsia bellii OSU 85-389] (270 aa)
Score = 257, Expect = 2.1e-20, Identities = 82/272 (30%), Positives = 133/272 (48%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAK 327
           +PFL+WVGGK ++ +++ K+ P   + +  Y EPF+GGGA+ F +  K+  K+ Y+SDIN EL+  Y+ IK    ++  +L         +    ++ YY ++ N  +    K   +F         I+LN+  F G+YR+N  G    +       K      L+  S+ L + +I   D+   E    ++ FVYFDPPY      S    Y +  F++  Q  L D+  +LN+K  KI++SNS       N  F   +Y  +NI  +K K
  S:    10 QPFLQWVGGKRKIADQLIKFLP---STLNNYYEPFLGGGALFFQIRDKF--KQCYLSDINLELVTSYNAIKKNPDKVSKLLDSH------KEKHSKEHYYQVRSNNDSNDPAKITARF---------IYLNRYSFKGIYRINIDGKPAQTFSGRNYSKSDIASRLKQCSQLLADTSICAMDFSFIEP--QQDDFVYFDPPYH----KSGEKFYTRLPFDENEQTRLKDFATELNDKNVKIMVSNS-------NTPFIRNLYKNFNISTIKVK 248
>gi|159901051|ref|YP_001547298.1| DNA adenine methylase [Herpetosiphon aurantiacus ATCC 23779] >gi|159894090|gb|ABX07170.1| DNA adenine methylase [Herpetosiphon aurantiacus ATCC 23779] (264 aa)
Score = 248, Expect = 2.0e-19, Identities = 71/234 (30%), Positives = 115/234 (49%)
  Q:    52 LQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYI 285
           L ++ P LKW GGK  L+  +  ++   N Q     EPFVGG A+   +    + ++  ++DIN  +IN Y  +++           +  DF L N  D+ +YY  + ++FN+L      Q    E A L  +LN+T +NGL R N++GLFNV  G YK  + C   +    ++ L+      G + + +  I     +Y DPPY        F AY++  FN   Q +LA+++
  S:     6 LPLLNPPLKWAGGKRWLIPRLSDFW--QNYQDYTLVEPFVGGLAIALGL----QPQQALLNDINPHVINFYHWLQHG----------LVIDFELHN--DQTYYYRYR-DQFNQLIRAGAEQ--TAEAAGLFYYLNRTGYNGLCRFNQRGLFNVPFGRYKRIRYC--YDFSHYAETLRQWRFQRGHFIEMQ--IPAQALIYADPPY-----DVPFRAYSQQGFNWSEQVQLAEWL 209
>gi|94314402|ref|YP_587611.1| DNA adenine methylase Dam [Ralstonia metallidurans CH34] >gi|93358254|gb|ABF12342.1| DNA adenine methylase Dam [Ralstonia metallidurans CH34] (265 aa)
Score = 242, Expect = 1.3e-18, Identities = 71/284 (25%), Positives = 125/284 (44%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKN-VNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINE 342
           +KW GGKTQLL  ++K  P  N    +  EPF+GG +V        +     + D + +LI +Y  +  + + +I + + +               Y   ++ ++ ++E  +       +AA  ++LNK  FNGL R + KG FNV  G           ++   S++ ++   IV GD+  + +       +Y DPPY  +    SFT Y  + F  + Q+ELAD       +G  +++SN     +        E+Y       V+ +R + +   SR  + E
  S:     1 MKWPGGKTQLLPTLRKLLPVGN----RLVEPFLGGASVFLGT----DFPNYLLLDAHVDLIGMYKQMVQRPERIIELARPLFSQ------------YAANEDIYSHVREAFNRAAPADVRAAYFLYLNKFGFNGLTRYSAKGNFNVPWGRSVKAPALPEESIRVFSERARDKAVIVQGDFTDAFKLAVPGDVIYCDPPYVDLVDAQSFTKYTAEGFPRERQQELADLARATAARGIPVVISNHLTAET-------RELYRGAECHEVEVRRSVAAQAHSRKMVAE 258
>gi|266581|sp|Q01511|MTC1_PBCVC Modification methylase CviBI (M.CviBI) (Adenine-specific methyltransferase CviBI) >gi|320305|pir||JH0768 site-specific DNA-methyltransferase (adenine-specific) (EC 2.1.1.72) CviBI - Chlorella virus CV-NC1A >gi|323326|gb|AAA88829.1| mcvibi (260 aa)
Score = 240, Expect = 1.9e-18, Identities = 89/294 (30%), Positives = 134/294 (45%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAY-NIKRVKAKRMINSDGSSRGEIN--ELLISNF 348
           +KP +KW GGKT  L   + Y P   +  + + EPF GG A  F V +++E K   +SD++ EL+ +Y  I     + I        DF+  + +D K YY        E++  +   ++DV  A+   +L KTCF G+ R NK G FNV  G YK     D +N E     LK+  I+   +    E + D + FV+ DPPY      S FT Y    F  +    L+++     NK   ++ +            F  E+Y  Y + +  K  R     G    EIN   L+I N+
  S:     1 MKPIVKWSGGKTDELKRFEDYIP---SDCSTFIEPFAGGAATFFHVGNQFENK--VLSDVHVELVALYRAIANGKSQAI-------YDFMKSHANDEKTYY--------EVRSWKPEDYVDV--ASRFYYLRKTCFRGMMRYNKNGGFNVPFGRYKTYNFEDIIN-EEYYNILKDTIILEKSFDYIFETYNDSSNFVFLDPPY-----DSVFTDYGYCSFGKEEHVRLSNFFKTTKNKCLMVIGAT----------DFIRELYDGYIHTEYEKKYRFKLHSGRVGDEINTTHLVIKNY 260
>gi|40067368|emb|CAD92748.1| putative adenine methyltransferase [Pasteurella multocida] (283 aa)
Score = 240, Expect = 2.0e-18, Identities = 94/294 (31%), Positives = 143/294 (48%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIK---YKVKELIPVLQIM------EKDFLLRNT------DDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKK----LKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +KP LK+ GGK++ L+EIKKY PF      +Y EPF GGGA+ FD+    E +   I+DIN  L++ Y  I+     VK  +  +Q+       E DFL + T      D  +  Y   ++ FN       N   D++ A +  ++NKT ++G+ R NK G FNV  G YKN       N E I+K+    LK   I   +YK      ++  F++ DPPY  + S        KD F +   ++LA    +LN K   ++                +E+Y    +        +N     + E   +LI+NF
  S:     1 MKPMLKYRGGKSRELSEIKKYIPFFEG---RYIEPFFGGGALFFDL----EPQNAIINDINISLMDFYRGIRNDFLNVKSELKKIQVEYEKNREEFDFLKKTTLKKHVDDKNEAIYYKMRDIFN------GNTKSDLQVATVYYYINKTAYSGMIRYNKDGKFNVPYGRYKN------FNTEIITKEHSELLKKSEIYSVNYKDIFAMANEGDFLFLDPPYDCVFSDYG-NIETKDGFTEDMHRQLAQDFRRLNAKALMVI----------SKTPLIEELYGDMIVHEYDKAYSVNIRNRFKSEAKHVLITNF 283
>gi|157953536|ref|YP_001498427.1| hypothetical protein AR158_C346R [Paramecium bursaria Chlorella virus AR158] >gi|156068184|gb|ABU43891.1| hypothetical protein AR158_C346R [Paramecium bursaria Chlorella virus AR158] (260 aa)
Score = 239, Expect = 2.3e-18, Identities = 91/294 (30%), Positives = 132/294 (44%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKY-KVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAK-RMINSDGSSRGEIN--ELLISNF 348
           +KP +KW GGK+  L   ++Y P   N  + + EPF GG A  F V  ++E +   ISD++ ELI +YS I   K +E+         DF+  + +D K YY ++  R  +           V  A    +L KTCF G+ R N+ G FNV  G YK     D L+ E     LK+  I+   +    E + D + FV+ DPPY      S FT Y    F  +    LA++     NK   I+ +            F  ++Y  Y +     K R     G    EIN   L+I N+
  S:     1 MKPIIKWSGGKSDELKRFEEYIP---NDCSTFIEPFAGGAATFFHVGERFENR--VISDVHTELIALYSAIANGKSREIY--------DFMKTHANDEKTYYEVRNWRPEDY----------VGVANRFYYLRKTCFRGMMRYNRNGGFNVPFGRYKTYNFEDILD-EKYHILLKDTTILEKSFDYIFETYNDIDNFVFLDPPY-----DSVFTDYGYCSFGKEEHIRLANHFKSTKNKCLMIIGAT----------DFIRDLYDGYIVDEYDKKYRFKLHSGRVGDEINTKHLIIKNY 260
>gi|161507580|ref|YP_001577534.1| putative N6 adenine-specific DNA methyltransferase [Lactobacillus helveticus DPC 4571] >gi|160348569|gb|ABX27243.1| putative N6 adenine-specific DNA methyltransferase [Lactobacillus helveticus DPC 4571] (166 aa)
Score = 232, Expect = 1.7e-17, Identities = 65/166 (39%), Positives = 100/166 (60%)
  Q:   183 IFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYS--AYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           I+LNK  +NGL+RVN KG  NV  G +K   + + + ++  SK LK  NV I+  +Y ++     +  FVYFDPPY P+  T++FT Y  + F    QK L D   +L +KG  ++LSN+D   + K       +YS   + I  V+AKR INS+G+ RG++ E++I+ +
  S:     5 IYLNKAGYNGLWRVNSKGQNNVPYGSHKKINVPEKVIIQD-SKYLKENNVKILNQNYTEAITSAKEGDFVYFDPPYIPVNQTANFTNYTPNGFGLVQQKILRDTALQLASKGVNVMLSNADLPLTAK-------LYSNPEFKIHHVQAKRSINSNGTKRGKVGEVIITTY 166
>gi|2454658|gb|AAC03126.1| DNA adenine methyltransferase [Chlorella virus NY2A] (261 aa)
Score = 231, Expect = 2.1e-17, Identities = 89/294 (30%), Positives = 129/294 (43%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNI--KRVKAKRMINSDGSSRGEIN--ELLISNF 348
           +KP +KW GGK+  L   ++Y P   +  + + EPF GG A  F V  ++E + I  SD++ ELI +Y  I       I        DF+  + +D K YY ++  R  +           V  A    +L KTCF G+ R N+ G FNV  G YK     D L+ E     LK+  I+   +    E + D + FV+ DPPY      S FT Y    F  +    LA++     NK   I+ S            F  ++Y  Y +  +  K  R     G    EIN   L+I N+
  S:     1 MKPIVKWSGGKSDELKRFEEYIP---SDCSTFIEPFAGGAATFFHVGERFENRAI--SDVHTELIALYRAIADGRSREI-------YDFMKTHANDEKTYYEVRNWRPEDY----------VGVANRFYYLRKTCFRGMMRYNRNGGFNVPFGRYKTYNFEDILD-EKYHILLKDTTILEKSFDYIFETYNDIDNFVFLDPPY-----DSVFTDYRYASFGKEEHIRLANHFKPTKNKCLMIIGST----------DFIRDLYDGYFVAPRYDKKYRFKLHSGRFGDEINTKHLIIKNY 261
>gi|170078228|ref|YP_001734866.1| adenine-specific DNA methylase [Synechococcus sp. PCC 7002] >gi|169885897|gb|ACA99610.1| adenine-specific DNA methylase [Synechococcus sp. PCC 7002] (272 aa)
Score = 230, Expect = 2.6e-17, Identities = 74/235 (31%), Positives = 116/235 (49%)
  Q:    51 NLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYI 285
           N + +KP LKW GGK  L+ +++  +   + Q  +  EPF GG A+   ++ +  +    ++D+N  LIN Y  +K  +K  I          L+ N  D    Y   ++RFNEL E  +NQ    E A L  +LN+T FNGL R N +G FNV  G Y++    D  +  A  K  +     +GD++K    +  ++F+Y DPPY        F  Y    F+  +Q+ LA ++
  S:     5 NSEQLKPPLKWAGGKRWLVPKLRLIW--QDYQDYQLIEPFCGGLAIALGLVPQKAI----LNDVNFHLINFYQQLKKGLKSSI----------LMANDAD---LYYQCRDRFNELIE--NNQSETQEAAILFYYLNRTGFNGLCRFNSQGKFNVPFGRYRSINYRD--DFFAYKKLFQAWQFQWGDFEKIP--VADHSFIYADPPY-----DVEFRQYAAGGFSWADQERLATWL 209
>gi|157952703|ref|YP_001497595.1| hypothetical protein NY2A_B399R [Paramecium bursaria Chlorella virus NY2A] >gi|155122930|gb|ABT14798.1| hypothetical protein NY2A_B399R [Paramecium bursaria Chlorella virus NY2A] (260 aa)
Score = 230, Expect = 3.0e-17, Identities = 88/294 (29%), Positives = 128/294 (43%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAK-RMINSDGSSRGEIN--ELLISNF 348
           +KP +KW GGK+  L   ++Y P   +  + + EPF GG A  F V  ++E +   ISD++ ELI +Y  I       I        DF+  + +D K YY ++  R  +           V  A    +L KTCF G+ R N+ G FNV  G YK     D L+ E     LK+  I+   +    E + D + FV+ DPPY      S FT Y    F  +    LA++     NK   I+ +            F  ++Y  Y +     K R     G    EIN   L+I N+
  S:     1 MKPIVKWSGGKSDELKRFEEYIP---SDCSTFIEPFAGGAATFFHVGERFENR--VISDVHTELIALYRAIADGRSREI-------YDFMKTHANDEKTYYEVRNWRPEDY----------VGVANRFYYLRKTCFRGMMRYNRNGGFNVPFGRYKTYNFEDILD-EKYHILLKDTTILEKSFDYIFETYNDIDNFVFLDPPY-----DSVFTDYGYCSFGKEEHIRLANHFKSTKNKCLMIIGAT----------DFIRDLYDGYIVDEYDKKYRFKLHSGRVGDEINTKHLIIKNY 260
>gi|10957230|ref|NP_058254.1| putative DNA adenine methylase (dam) [Salmonella typhi] >gi|7800283|gb|AAF69879.1|AF250878_40 putative DNA adenine methylase (dam) [Salmonella typhi] (257 aa)
Score = 227, Expect = 5.6e-17, Identities = 78/273 (28%), Positives = 137/273 (50%)
  Q:    72 IKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLD--VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYS--AYNIKRVKAKRMINSDGSSRGEINELL 344
           + K++P  +++  ++ EPF+GGGAV  ++ +     E  ++D N +LIN+Y  I+      I  +Q++ +    R+ ++  +Y L  +N FN         F D  +++AA+   +N+  +NGL R N K  F+V  G      + D   ++ +S +L +V +   D+ ++ EF      +Y DPPY  I+ T SF +Y+   F+     +LAD +   N KG  + +SNS          F  E+Y    ++I    A R + S   SR +  E+L
  S:     4 LSKHFP--HDKSRRWVEPFIGGGAVFLNMFAT----EALLADSNPDLINLYRNIQRNKPAFIREVQLLAE----RHFEEEDYYVL--RNTFNS------TSFDDAPLQRAAIFYAMNRLGYNGLCRYNLKRKFSVPWGKRYQFSL-DIQKVDYLSFRLSSVELKTADFGQTLEFAGGGDQIYCDPPYDKISKT-SFVSYDGIPFDKSAHVKLADMLVDANRKGASVAISNS-------MTPFTLELYEERGFDIHTHNAYRSVGSQSKSRKKEIEIL 253
>gi|19347661|gb|AAL86023.1| BsmIMB [Geobacillus stearothermophilus] (270 aa)
Score = 218, Expect = 7.0e-16, Identities = 79/253 (31%), Positives = 119/253 (47%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAI--SKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKN 308
           +P +KW G K      I K +P    +  +Y EPFVGG ++ + +     +      DI   LI ++ +IK    + + ++   +K ++L        YY I+ N FN+ +   D           + FL +TC NGL R NK GLFN S  H +     D L+   +  S +LKN+   +GDY+ + E I KN F+Y DPPY      +    Y    FN     E  +++  LN++G K  LS  D K  D N
  S:     7 QPAIKWSGSKRSQAWNIIKLFP----KFDRYYEPFVGGASITYALNPNRGI----CGDICKPLIEIWKIIK---SDPLSIVNEYKKRWILLQEQGHTVYYEIRDN-FNKTQNPYD-----------LFFLTRTCVNGLIRFNKDGLFNNSFHHTRKGIHPDKLHKIILNWSYRLKNIEFRHGDYRVTTEDITKNDFIYLDPPY----FNTRGRYYGTIDFN-----EFLEFLYSLNSRGIKFALS-FDGKREDVN 228
>gi|12082221|dbj|BAB20843.1| DNA adenine methylase M.SsuMA [Streptococcus suis] >gi|12082227|dbj|BAB20847.1| DNA adenine methylase M.SsuMA [Streptococcus suis] (154 aa)
Score = 214, Expect = 1.8e-15, Identities = 61/160 (38%), Positives = 88/160 (55%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKI 214
           +KPF KW GGK  LL +  ++ PF  N   KY EP VGGGA  F++  +  V    + D + +L N Y  I   +  L PVL ++     +   ++ K YYL  ++   + + K      DVE+AA ++++ +  FNGLYRVN K  FNV  G YKNP+I
  S:     3 LKPFTKWTGGKRMLLTQPHEHLPFDYN---KYFEPVVGGGAGPFEMSPEIAV----MVDWSGDLKNTYVQI---LDNLEPVLDLLH----IHQENNSKEYYLDVRSVDRDGRIK---TMSDVERAARILYMLRVDFNGLYRVNSKNQFNVPYGRYKNPQI 145
>gi|145631338|ref|ZP_01787110.1| DNA adenine methylase [Haemophilus influenzae 22.4-21] >gi|144983123|gb|EDJ90623.1| DNA adenine methylase [Haemophilus influenzae R3021] (162 aa)
Score = 214, Expect = 2.1e-15, Identities = 57/162 (35%), Positives = 84/162 (51%)
  Q:   183 IFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNN-KGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           ++LN+  FNGL R N K  FNV  G YK     +   L   + K ++   +  D++K+ EF DK++ +Y DPPY P+   ++FT Y  + F    Q+ LAD    +   K   IL+SN D K       F  EIY+    KRVK +R I+     R ++ EL+
  S:     1 MYLNRFGFNGLCRYNSKNEFNVPFGAYKTHYFPED-ELRYFAYKAQSAVFLCCDFQKTFEFADKDSVIYCDPPYAPLQQETNFTGYAGNEFGLAQQRALADLAKSIQKEKQISILISNHDTK-------FTREIYNGAKFKRVKVQRSISQTPEKRVKVKELI 155
>gi|153806194|ref|ZP_01958862.1| hypothetical protein BACCAC_00449 [Bacteroides caccae ATCC 43185] >gi|149130871|gb|EDM22077.1| hypothetical protein BACCAC_00449 [Bacteroides caccae ATCC 43185] (301 aa)
Score = 214, Expect = 2.2e-15, Identities = 90/296 (30%), Positives = 158/296 (53%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVI---KYKVKELIPVLQIMEKDFLLRNT--DDR---------KWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYK-NPKICDTLN---LEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++V+    +VG K +L+ EI  Y+P   + I K+ EPFVGGG+V  ++    + ++ Y++DI+  +I ++  +     K  E    ++ +  ++ L  +  +DR         K  Y  K N+    + K D     V    ++  L    FN + R NK G FN+ +G+   N  + + L    ++ ISKK K  NI Y D+ +     +K+ FVY DPPY       +F+ YNK L+N+Q++ EL   ++ LN +  +  +SN        N+ F D     YN+  +K+  +   D S++ +I+E+LI+N+
  S:     4 KIVRSPFFYVGDKYKLIEEISSYFP---DDIEKFVEPFVGGGSVFMNI----DARKFYLNDIDVNVIALHKFLCKSANKRTEFFSRIESLIAEYGLSYSYKEDRIPIELRQQYKKTYYAKYNKEAYGQMKRDFNESSVADLYVLYLLLIYGFNRMLRFNKNGDFNLPVGNVDFNANVVNALEAYFMQVISKKPKWFNIDYKDFLQKIRLSEKD-FVYLDPPY-----LITFSEYNK-LWNEQDEIELLQLLDSLNKRRIRFAISNVTHYKGRCNNLFIDWA-CKYNVHPIKSNYISYHDNSTK-QISEVLITNY 301
>gi|85059186|ref|YP_454888.1| putative DNA adenine methylase [Sodalis glossinidius str. 'morsitans'] >gi|85059867|ref|YP_455569.1| putative DNA adenine methylase [Sodalis glossinidius str. 'morsitans'] >gi|84779706|dbj|BAE74483.1| putative DNA adenine methylase [Sodalis glossinidius str. 'morsitans'] >gi|84780387|dbj|BAE75164.1| putative DNA adenine methylase [Sodalis glossinidius str. 'morsitans'] (230 aa)
Score = 211, Expect = 4.4e-15, Identities = 61/214 (28%), Positives = 101/214 (47%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEF---IDKNTFVYFDPPYRPITSTSSFTAY 268
           +KP LKW GGK++L+  ++ + P  +  +    EPFVGG +V        +     ++DIN +LIN Y  +   V     V+Q     F   NT    + Y   +  F + +         +++AA+ ++LN+  +NGL R N +G FN+   HYK P       +   ++K ++ +I +      E     +D++  VY DP Y P      FT Y
  S:     3 MKPILKWAGGKSRLMPRLRPFLPAADCLV----EPFVGGASVFLAT----DYPRYVLADINPDLINFYQAV---VDSPESVIQAALPLFRHANTSVDYFRY---RTNFAQWRATRG-----IKRAAVFLYLNRHGYNGLCRYNLRGEFNIPYEHYKKPYF-PAAEIRLFAEKARDTHIRFVCLPFEETLALHVDEHYAVYTDPSYFPPEDRDGFTGY 199
>gi|85058450|ref|YP_454152.1| putative DNA adenine methylase [Sodalis glossinidius str. 'morsitans'] >gi|84778970|dbj|BAE73747.1| putative DNA adenine methylase [Sodalis glossinidius str. 'morsitans'] (228 aa)
Score = 211, Expect = 4.4e-15, Identities = 61/214 (28%), Positives = 101/214 (47%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEF---IDKNTFVYFDPPYRPITSTSSFTAY 268
           +KP LKW GGK++L+  ++ + P  +  +    EPFVGG +V        +     ++DIN +LIN Y  +   V     V+Q     F   NT    + Y   +  F + +         +++AA+ ++LN+  +NGL R N +G FN+   HYK P       +   ++K ++ +I +      E     +D++  VY DP Y P      FT Y
  S:     1 MKPILKWAGGKSRLMPRLRPFLPAADCLV----EPFVGGASVFLAT----DYPRYVLADINPDLINFYQAV---VDSPESVIQAALPLFRHANTSVDYFRY---RTNFAQWRATRG-----IKRAAVFLYLNRHGYNGLCRYNLRGEFNIPYEHYKKPYF-PAAEIRLFAEKARDTHIRFVCLPFEETLALHVDEHYAVYTDPSYFPPEDRDGFTGY 197
>gi|190410470|ref|YP_001965973.1| dam [Klebsiella pneumoniae] >gi|146151264|gb|ABQ03030.1| dam [Klebsiella pneumoniae] (257 aa)
Score = 208, Expect = 9.7e-15, Identities = 71/273 (26%), Positives = 139/273 (50%)
  Q:    72 IKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQ-IMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           I  +YP  ++   ++ EPF+GGGAV  ++ ++  +    ++D N +LIN+Y  I+ +    I  +Q + +K F+ ++       Y   ++RFN  K     Q L  ++AAL   LN+  +NG+ R N + +++V  G +   K+ D   ++ +S +L  + ++   ++++     +   +Y DPPY   TS +SF +Y+   F+  +   LA+ +   + KG  + +SNS    +      ++E    + I R+ A R + S  ++R    E+L
  S:     4 ISHHYP--HDHSCRWVEPFIGGGAVFLNMFAQNAL----LADSNPDLINLYRTIQRQKTNFINQVQNLADKTFVEKD-------YYEMRDRFN--KTCISGQPL--QRAALFYSLNRLGYNGMCRYNSERIYSVPWGKHTELKL-DFNKIDYLSFRLSGIELITAGFEETLAATGEGDQIYCDPPYDK-TSKTSFVSYDGKPFSQSDHVLLANMLVDAHRKGAAVAISNS---LTPFTLGLYEE--RGFVIHRLSAYRSVGSKPNTRKTETEIL 253
>gi|68480349|gb|AAY97905.1| Mva1269I methyltransferase [Kocuria varians] (626 aa)
Score = 208, Expect = 1.0e-14, Identities = 82/256 (32%), Positives = 123/256 (48%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISK----KLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKN 308
           + +   LKW G K +    I +  P       +Y EPF GGGAV +  L+  +VK I+ +D+   LI  + ++KY   ELI    +  K++ L   D   ++Y ++ +RFN      D           + FL +TC NG+ R NK+G FN S+  + + +     N E+I      KL+N +    DYK+  +   K   +Y DPPY       S   Y  DL  +    EL    +KLN+KG K +LS  D K  DK+
  S:   357 ESIPSILKWTGSKRKQAAYIAREIP---EGTERYIEPFFGGGAVSY--LAANKVKNIWANDLYKPLIEFWEMVKYSPNELI---NLYLKEWTLLQEDFPNYFYTVR-DRFNTAPNGVD-----------LAFLTRTCVNGIVRFNKEGDFNNSI--HLSRRGMKPSNFESIVDKWHLKLQNFHFTSLDYKEVLDQTTKGDLIYLDPPY-----AGSANRYIADLDVESFFLEL----DKLNSKGVKWMLS-FDGKRGDKD 584
>gi|91789573|ref|YP_550525.1| DNA adenine methylase [Polaromonas sp. JS666] >gi|91698798|gb|ABE45627.1| DNA adenine methylase [Polaromonas sp. JS666] (274 aa)
Score = 206, Expect = 1.7e-14, Identities = 77/301 (25%), Positives = 129/301 (42%)
  Q:    48 INNNLQV-VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           INN + +   P + WVGGK +L   I   +P H    + Y EPF G  A+ F    K  V+   ++D+N++L+ +Y V+ + + E I       + F        +W  L  +  FN L+E       D+++AA   +L K  F G  +    G    +       ++ +  +L A+  +L  V I + D+ K  E  D+ ++  Y DPPY           Y  D F  +    +A+ +  +  KG   +  N  P+          + +   +IKR+     +   G  R    ELLI+NF
  S:    10 INNAMHIQASPLVPWVGGKRRLAQFILPMFPDH----SCYVEPFCGAAALFF---MKPPVRVEVLNDVNSDLVRLYRVVTHHLDEFI-------RQF--------RW-ALNSRELFNWLQETPPATLTDIQRAARFYYLQKCAFGGKVKGQSFGTATTAKASINLLRMEE--DLSAVHLRLHQVFIEHLDWAKCVEKYDRPHSLFYLDPPYW------GTEGYGVD-FGLEQYDRMAELLRTM--KGKAAVSVNDIPE--------MRQAFKGLSIKRLVTSYTLGRSGEGRQAKGELLITNF 270
>gi|24372281|ref|NP_716323.1| type II DNA modification methyltransferase, putative [Shewanella oneidensis MR-1] >gi|24346211|gb|AAN53768.1|AE015515_1 type II DNA modification methyltransferase, putative [Shewanella oneidensis MR-1] (253 aa)
Score = 205, Expect = 2.4e-14, Identities = 82/293 (27%), Positives = 126/293 (43%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQN--QKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           KP + W+GGK +L+ EI   +P H+     Y EPF GG A+ F   SK E +   ++D+N +L+N+Y VIK+ ++E I       + F        KW  LI +  F   K        D+++A+   +L K  F G       G            +I + L++  +  +L    I   D+ +     DK  T  Y DPPY       S   Y  +   +Q     ELA  I     KG  ++  N  P+          E+++   +K +  K  +   G S GE  ELLI N+
  S:     3 KPIIPWMGGKRRLVKEILPLFPEHHT----YVEPFCGGAAMFF---SKDEARVEVVNDMNGDLVNLYRVIKHHLEEFI-------RHF--------KW-ALISREEFLWQKNTNPETLTDIQRASRFYYLQKLAFGGKVSSQNFGSSASRPAGLNLLRIEEDLSIAHL--RLARTYIERLDWAECVRRYDKPETLFYLDPPYW------STAGYGVEFGLEQYALMAELAKTI-----KGKMVISVNDIPE--------MREVFAGLQMKTLGIKYTVGGSGRS-GEQQELLIWNW 253
>gi|8927567|gb|AAF82121.1|AF276982_2 DNA-adenine-methylase [Integrative vector pNLE1] (181 aa)
Score = 204, Expect = 2.6e-14, Identities = 62/196 (31%), Positives = 97/196 (49%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVY 251
           KPFLKW GGK +L+  I+   P    +  +  EPF G  A+   +    + +   ++DINA+LI ++ ++K   +E    +      F+  N  D ++Y L  + +FN  K          E++AL I+LN+  FNGL R N KG+FNV  G YK+P       +E   +K   V ++ GD++      D    VY
  S:     4 KPFLKWAGGKHKLVPFIEHNLPTPTRK--RLIEPFCGSAALSLAL----DFEHYLLNDINADLIGLFRILK---EEKSGFIDYARSFFISENNSDSRFYEL--REQFNFSKNLH-------ERSALFIYLNRHAFNGLCRYNSKGVFNVPFGRYKSPYFPQQ-EMEGFIQKSDRVELMCGDFQMILSQTDNTDTVY 180
>gi|163848883|ref|YP_001636927.1| DNA adenine methylase [Chloroflexus aurantiacus J-10-fl] >gi|187599694|ref|ZP_02985927.1| DNA adenine methylase [Chloroflexus sp. Y-400-fl] >gi|163670172|gb|ABY36538.1| DNA adenine methylase [Chloroflexus aurantiacus J-10-fl] >gi|187487983|gb|EDU25951.1| DNA adenine methylase [Chloroflexus sp. Y-400-fl] (307 aa)
Score = 204, Expect = 3.1e-14, Identities = 67/204 (32%), Positives = 101/204 (49%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVI---KYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSM----GHYKNPKICDTLN-LEAISKKLKNVNIVY--GDYKKSEEFIDKNTFVYFDPPY 256
           +V+ P +K  G KT+L   I     +H     ++ EPF+G GAVLF+V   Y +    ++DIN  +I +Y +I   K   + +   L    K  LL+  D    YY   + RFN+  +  D            IFLN++CFNG+ R NKKG FNV        ++   I   +N +  I   +K     +  GD++     +  + FVY DPPY
  S:    12 RVIVPPIKCQGIKTKLTKFILSNISWHGQ--GRWIEPFLGSGAVLFNVQPDYAI----VNDINPHIIRLYQMIYEGKIFPETVRKYLTEEGKKLLLKGED----YYYFVRERFNKSGDPLD-----------FIFLNRSCFNGVMRFNKKGEFNVPFCRKTDRFRQAYITKIVNQITQIRNIMKGKAWEFRIGDWRDCLHHVTPDDFVYLDPPY 204
>gi|81300599|ref|YP_400807.1| DNA adenine methylase [Synechococcus elongatus PCC 7942] >gi|81169480|gb|ABB57820.1| DNA adenine methylase [Synechococcus elongatus PCC 7942] (263 aa)
Score = 203, Expect = 3.4e-14, Identities = 68/231 (29%), Positives = 99/231 (42%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYI 285
           +KP LKW GGK  L  ++++          +  EPF GG AV   +    + K   ++DIN  LIN Y  +K  ++  IP          L N  D  + Y   +  FN+       +      A    +LN+T FNGL R N KG FNV  G YK   I    +    S+  ++     GD+   +  + K   +Y DPPY        F  Y K+ F   +Q  LA ++
  S:     9 LKPPLKWAGGKRWLAPKLQEL--VQGITYDRLVEPFCGGLAVTLSL----QPKRALLNDINPHLINFYQQVKAGLEITIP----------LENDSDLYYQY---RQAFNQ------TELPSALSAQYFYYLNRTGFNGLCRFNSKGEFNVPFGRYKT--IHYRYDFSDYSQLFQDYQFYLGDF--DQLVVGKQDLIYADPPY-----DVEFRQYAKEGFTWDDQVRLAQWL 205
>gi|85058806|ref|YP_454508.1| putative methyltransferase [Sodalis glossinidius str. 'morsitans'] >gi|84779326|dbj|BAE74103.1| putative methyltransferase [Sodalis glossinidius str. 'morsitans'] (256 aa)
Score = 203, Expect = 3.7e-14, Identities = 78/292 (26%), Positives = 130/292 (44%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           P + W+GGK +L   I   +P H    T Y EPF G  A+ F    SK EV    I+DIN EL+N+Y V+K+ ++E I       + F        KW  L+ +  +  L++  +    D+++AA   +L K  F G    +  G    S   +   +I + L++  +  +L    I + D+ +  E  D+ +T  Y DPPY     T  +       F  +N   +AD   ++  KG  I+  N  P+          ++++  N++ V     +   G    +  EL+I NF
  S:     7 PIVPWIGGKRRLAKHILPLFPAH----TCYVEPFCGAAALYFLKTPSKTEV----INDINGELVNLYRVVKHHLEEFI-------RQF--------KW-ALVSRQIYKWLQDTPEETLTDIQRAARFYYLQKQAFGGKVADHTFGTSTTSAPRFNLLRIEEELSMAHL--RLSRTLIEHLDWHQCIERYDRPHTLFYCDPPY---WGTEGYGVE----FGLENYDHMADLARRI--KGKMIISVNDIPE--------MRQVFNGLNMQSVDISYNLKVTGKPSPK-KELVICNF 256
>gi|145641551|ref|ZP_01797129.1| DNA adenine methylase [Haemophilus influenzae R3021] >gi|145273842|gb|EDK13710.1| DNA adenine methylase [Haemophilus influenzae 22.4-21] (190 aa)
Score = 201, Expect = 5.9e-14, Identities = 59/193 (30%), Positives = 97/193 (50%)
  Q:    91 VGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELAD 283
           +G GAV  +  S +E     ++DIN +LIN+++++K  V   I       K     +  +   YY  K+ +FN   +         E++ + ++LN+  FNGL R N K  FNV  G YK     +   L   + K ++   +  D++K+ EF DK++ +Y DPPY P+   ++FT Y  + F    Q+ LAD
  S:     1 MGAGAVFLN--SNFE--RYILADINPDLINLFNIVKENVDGYIEDC----KPIFFADDANTPDYYYAKRRQFNASTDP-------FERSIIFLYLNRFGFNGLCRYNSKNEFNVPFGAYKTHYFPED-ELRYFAHKAQSAVFLCCDFQKTFEFADKDSVIYCDPPYAPLQQETNFTGYAGNEFGLMQQRALAD 177
>gi|108804666|ref|YP_644603.1| DNA adenine methylase [Rubrobacter xylanophilus DSM 9941] >gi|108765909|gb|ABG04791.1| DNA adenine methylase [Rubrobacter xylanophilus DSM 9941] (302 aa)
Score = 201, Expect = 6.0e-14, Identities = 61/224 (27%), Positives = 111/224 (49%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQIT-KYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSM-GHYKNPK-ICDTLNLEAISKKLKN--VNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQ 278
           V+PFL+W GGK  L + +    P   +++   Y EPF+G GA+ F V  +    +  +SD+NA+L+  +  +  +  EL+  ++ +  +         + YY          K + D     +++A   ++LN+TC+ G+YR NK+G+FN    G  + P  + +   +E  S  L+   + +   D++ S +   +   VY DP YR  T  + F  Y   +F  ++Q
  S:    18 VEPFLRWAGGKRWLASTLA---PIIKSRLRGTYIEPFLGSGAMFFAVAPE----KALLSDLNADLVGAFRAVAERPDELLEEVRALPVN--------AETYY----------KLRADEPLDPLQRAVRFVYLNRTCYGGIYRENKRGVFNTPYGGGSRTPAPLWERALIERCSPLLRKGGITLEVSDFELSLDAAGEGDVVYCDPAYRAATR-AHFDRYGAVVFGWEDQ 220
>gi|168694978|ref|ZP_02727255.1| DNA adenine methylase [Clostridium difficile QCD-37x79] >gi|168712282|ref|ZP_02744559.1| DNA adenine methylase [Clostridium difficile QCD-63q42] (276 aa)
Score = 201, Expect = 6.7e-14, Identities = 68/201 (33%), Positives = 105/201 (52%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVL-SKYEVKEIYISDINAELINVYSVIKYKVKELI----PVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYK---NPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPY 256
           +P +KW G K     EI   +P   + I  Y EPF+GGG+V+F +L S  +VK    SDIN +LI++++ IK   + L      +   + KD    + + +K YY   +N +N  ++ E           L +FL++TC NGL R N K  FN S+   +   NPK    + +   SK L + N+V+      + +   N F+Y DPPY
  S:     6 QPVIKWSGSKRSQSEEIVNKFP---DIIDTYYEPFIGGGSVMFQLLNSNKKVKRYICSDINEDLISLWNAIKSDTESLCLKYEKLWNELNKD---EDIERKKKYYYSIRNSYNSTRKPE-----------LFLFLSRTCVNGLIRYNSKNEFNTSLHFSRNGINPKKLKEI-IYQWSKILNDKNVVFLKQSYEKVYPKSNDFIYLDPPY 196
>gi|156742208|ref|YP_001432337.1| DNA adenine methylase [Roseiflexus castenholzii DSM 13941] >gi|156233536|gb|ABU58319.1| DNA adenine methylase [Roseiflexus castenholzii DSM 13941] (314 aa)
Score = 194, Expect = 4.0e-13, Identities = 64/204 (31%), Positives = 101/204 (49%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVI---KYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSM----GHYKNPKICDTLNLEAISKKL---KNVNIVYGDYKKSEEFIDKNTFVYFDPPY 256
           QV+ P +K  G KT+L+  I     +  N   ++ EPF+G G VLF+V    + +   ++DIN  +I +Y +I       +E+   L    K  L+   D    YY   + RFN+  +  D            IFLN++CFNG+ R N KG FNV        ++       +N  +  +K+   K+     GD++   E + ++ FVY DPPY
  S:    13 QVIVPPIKCQGIKTKLVKFILSNVSW--NGKGRWIEPFLGSGVVLFNV----QPERALVNDINPHIIRLYQMIYDGSLSPEEVRTYLTAEGKKLLVSGED----YYYAVRERFNKSGDPLD-----------FIFLNRSCFNGIMRFNSKGEFNVPFCRKPDRFRQSYATKIVNQISQIRKIMQSKDWEFCVGDWRHILENVTEDDFVYLDPPY 205
>gi|160893958|ref|ZP_02074737.1| hypothetical protein CLOL250_01513 [Clostridium sp. L2-50] >gi|156864336|gb|EDO57767.1| hypothetical protein CLOL250_01513 [Clostridium sp. L2-50] (306 aa)
Score = 194, Expect = 4.2e-13, Identities = 70/237 (29%), Positives = 114/237 (48%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVL-----------------QIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN 289
           + ++P LK+ GGK + +   +   P      T Y EPF GGGAV FD     E  +  I+DIN  LIN Y  +     +L+  L                 + +  +  + N ++  +Y L  ++ +N L     + +LD     L  F+NKT ++G+ R N +G +NV  G YK+ ++ + L     S  L+N  I+  D++      + N F++ DPPY  I         N   F +   + LA  I  +N
  S:    24 EYMEPLLKYRGGKRREIPNFRNLIP---QNYTTYIEPFFGGGAVFFD----QEPVQSIINDINHPLINFYQQVANNYPQLMQELTELHVLYEQNETVYARQKTLHPEARVPNNNEPLYYQL--RDMYNGLTP---STYLD---GTLYYFINKTAYSGMIRYNAQGQYNVPFGRYKHFRVNNILPQH--STLLQNAQILQTDFENIFALANANDFMFLDPPYDCIFHDYGNMTTN---FGEDEHRRLASAIQNVN 257
>gi|193066156|ref|ZP_03047210.1| DNA adenine methylase [Escherichia coli E22] >gi|192926168|gb|EDV80808.1| DNA adenine methylase [Escherichia coli E22] (254 aa)
Score = 194, Expect = 4.4e-13, Identities = 78/292 (26%), Positives = 127/292 (43%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           P + W+GGK +L   I   +P H    T Y EPF G  A+ F    SK EV    I+DIN EL+N+Y V+K+ ++E +       + F        KW  L+ +  +  L+   +    D+++AA   +L K  F G    +  G    S   +   +I + L+  A   +L    I + D+ +  +  D+ +T  Y DPPY           Y  D F ++N   LA+    +  +G  I+  N  P+           +++  NI+ V     +    + R    EL+I NF
  S:     7 PIVPWIGGKRRLAKHILPQFPLH----TCYVEPFCGAAALYFLKTPSKIEV----INDINGELVNLYRVVKHHLEEFV-------RQF--------KW-ALVSRQIYKWLQITPEETLTDIQRAARFYYLQKQAFGGKVAEHSFGTSTTSPPRFNLLRIEEELS--AAHLRLSRTVIEHMDWHQCIKRYDRPHTLFYCDPPYL------GTEGYGVD-FPEENYTLLAELARCI--RGKMIISVNDIPQ--------MRRVFTELNIQTVNINYSLAGKPTPR---RELVICNF 254
>gi|67920550|ref|ZP_00514070.1| N6 adenine-specific DNA methyltransferase, D12 class [Crocosphaera watsonii WH 8501] >gi|67858034|gb|EAM53273.1| N6 adenine-specific DNA methyltransferase, D12 class [Crocosphaera watsonii WH 8501] (229 aa)
Score = 194, Expect = 4.5e-13, Identities = 63/238 (26%), Positives = 116/238 (48%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNK 291
           ++K  L++ GGK++ + +I++ +P      ++Y EPFVGGG+V   +   Y   +I+I+D+N EL   + + +  +K L+  L+ ++K+      D R+         F EL+E +  +  D E+A     LN+  F+G   +   G    S          D   LE + + L  + I   DY++  +   +NTF++ DPPY   T  S     + DL    N ++ A+ + K +++
  S:     1 MIKSPLRYPGGKSRAIKQIQEQFP-RRFTFSEYREPFVGGGSVFIYLKQIYPNIDIWINDLNPELYLFWKIAQSDLKALVTELRQIKKN----RKDGREL--------FQELRELDVGKISDFERAVRFFILNRITFSG--TIESGGYSEKSFQTRFTESSID--RLEKLGQILPGIRITNLDYREVVKQKGENTFIFLDPPYLTATK-SRLYGKDGDLHTSFNHQDFANTMKKCDHQ 220
>gi|33338827|gb|AAQ14149.1| Dmt, incomplete [Enterobacteria phage P1] (638 aa)
Score = 191, Expect = 1.0e-12, Identities = 54/153 (35%), Positives = 80/153 (52%)
  Q:    43 RQKVEINNNLQVVKP-------FLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYR 195
           RQK       + VKP         KW GGK  +L +I +Y P    +  +  EPFVGGGAV     +    +E  ++D+NA+LIN Y  ++ +   LI +     +D+   NT +    YL  +N FN+        + D+ +AA  +FLN+ CFNGL R
  S:   468 RQKEGSETKERKVKPAAEFERSIFKWAGGKFGVLEQIFRYLP----EGKRLIEPFVGGGAVF----TNAGYQENLLNDVNADLINFYKTLQREAHSLITLAHRFFQDY---NTQEG---YLAVRNAFNK------QVYDDLHRAAAFLFLNRHCFNGLTR 607
>gi|32470122|ref|NP_863581.1| MEcoRV [Escherichia coli] >gi|127449|sp|P04393|MTE5_ECOLX Modification methylase EcoRV (M.EcoRV) (Adenine-specific methyltransferase EcoRV) >gi|10504552|gb|AAG18132.1|AF251289_7 MEcoRV [Escherichia coli] >gi|41326|emb|CAA25209.1| unnamed protein product [Escherichia coli] (298 aa)
Score = 191, Expect = 1.0e-12, Identities = 83/295 (28%), Positives = 149/295 (50%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTD-----DRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKN-------PKICDTLNL--EAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFN---DQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISN 347
           +V  P +K  G KT+L+  IK+  P + N +  + EPF+G G V F+V  K    +  + D N  LI+ Y+ +K K      +   + KDFL R  +     + ++YY +++ RFN  KE  D            +FLN++CFNG+ R N KG FNV      N        KI + ++   E ISK   N   +   ++K+   ++++  VY DPPY            + D FN   +++++ L + ++ LN       ++++   N  + + +  +++S++ I   +    + +   +R  + E LI+N
  S:     4 KVFVPPIKSQGIKTKLVPCIKRIVPKNFNGV--WVEPFMGTGVVAFNVAPK----DALLCDTNPHLISFYNALKNK-----DITGDLVKDFLYREGEKLLLSNGEYYYEVRE-RFNNYKEPLD-----------FLFLNRSCFNGMIRFNSKGGFNVPFCKKPNRFAQAYITKISNQVDRISEIISK--GNYTFLCQSFEKTIGMVNRDDVVYCDPPY---------IGRHVDYFNSWGERDERLLFETLSSLN----ATFITSTWHHNDYRENKYVRDLWSSFRILTKEHFYHVGASEKNRSPMVEALITN 277
>gi|12831158|gb|AAK08495.1|AF329098_2 N.BstNBI methyltransferase [Geobacillus stearothermophilus] >gi|62632225|gb|AAX89133.1| M1.BstSEI [Geobacillus stearothermophilus] >gi|125396998|gb|ABN42184.1| adenine methyltransferase M.BspD6I [Bacillus sp. D6] (301 aa)
Score = 190, Expect = 1.1e-12, Identities = 89/299 (29%), Positives = 146/299 (48%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYK----VKELIPVLQIMEKD--------------FLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKK----LKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDINKK 353
           +KP LK+ GGK     EI  +     N I  Y EPFVGGGAV F +    E ++  I+DIN++L   Y  +K+      K+L  + +I EK+                + N ++  +Y L  +N FN        ++LD   A +  F+NKT ++G+ R N KG +NV  G YKN       N + I+K+    L+   I   D+ +  +    N F++ DPPY  I S      +  D F+++  + LA+    L  +   +++S ++       D   DE + +Y+         +N     + E    +I N+D  +K
  S:     1 MKPILKYRGGKKA---EIPFFIDHIPNDIETYFEPFVGGGAVFFHL----EHEKSVINDINSKLYKFYLQLKHNFDEVTKQLNELQEIYEKNQKEYEEKKALAPAGVRVENKNEELYYEL--RNEFN----YPSGKWLD---AVIYYFINKTAYSGMIRYNSKGEYNVPFGRYKN------FNTKIITKQHHNLLQKTEIYNKDFSEIFKMAKPNDFMFLDPPYDCIFSDYGNMEFTGD-FDEREHRRLAEEFKNLKCRAL-MIISKTELTTELYKDYIVDEYHKSYS---------VNIRNRFKNEAKHYIIKNYDYVRK 288
>gi|170022442|ref|YP_001718947.1| D12 class N6 adenine-specific DNA methyltransferase [Yersinia pseudotuberculosis YPIII] >gi|169748976|gb|ACA66494.1| D12 class N6 adenine-specific DNA methyltransferase [Yersinia pseudotuberculosis YPIII] (251 aa)
Score = 190, Expect = 1.1e-12, Identities = 86/292 (29%), Positives = 127/292 (43%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE----AISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQ--NQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           P + WVGGK +L   I   +P H    T Y EPF GG A+ F    SK EV    I+D+N ELIN+Y VIK  ++E +       + F        KW  L  +  F   K        D+++AA   +L  T F G  +V+ +  F  S      P   + L LE    A   +L    I +  +    E  D+ ++  Y DPPY           Y  +   DQ     +LA  I     KG+ I+  N  P+  D        ++   ++  V  K    S G ++ +++EL+I NF
  S:     4 PIIPWVGGKRRLAKHILPLFPAH----TCYIEPFCGGAALYFLKETSKVEV----INDVNGELINLYRVIKNHLEEFV-------RQF--------KW-ALTSRQVFEWTKATPTEVLTDIQRAARFYYLQTTAFGG--KVDGQ-TFGTST---TRPTGLNLLRLEETLSAAHLRLSRTMIEHMGWADCVEKYDRPHSLFYLDPPYWQT------CGYGVEFGLDQYTQMAQLARSI-----KGSMIISVNDIPEMRD--------VFKGLHMDTVSLKY---SLGDNKKQVSELIIRNF 251
>gi|188495753|ref|ZP_03003023.1| DNA adenine methylase [Escherichia coli 53638] >gi|188490952|gb|EDU66055.1| DNA adenine methylase [Escherichia coli 53638] (254 aa)
Score = 190, Expect = 1.2e-12, Identities = 78/292 (26%), Positives = 125/292 (42%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           P + W+GGK +L   I   +P H      Y EPF G  A+ F     + EV    I+DIN EL+N+Y V+K+ ++E +       + F        KW  L+ +  +  L+   +    D+++AA   +L K  F G    +  G    S   +   +I + L+  A   +L    I + D+++  E  D  +T  Y DPPY           Y  D F + N   LA+    +  KG  I+  N  P+          E+++  NI+ V     +    + R    EL+I NF
  S:     7 PIVPWIGGKRRLAKHILPLFPAHEC----YVEPFCGAAALYFLKSPGRIEV----INDINGELVNLYRVVKHHLEEFV-------RQF--------KW-ALVSRQIYKWLQITPEETLTDIQRAARFYYLQKQAFGGKVAEHSFGTSTTSPPRFNLLRIEEELS--AAHLRLSRTVIEHMDWQQCIERYDHPHTLFYCDPPYL------GTEGYGVD-FPEGNYSRLAELARCI--KGKMIISVNDIPQ--------MREVFTELNIQTVNINYSLAGKPTPR---RELVICNF 254
>gi|83718143|ref|YP_439265.1| DNA adenine methylase [Burkholderia thailandensis E264] >gi|83651968|gb|ABC36032.1| DNA adenine methylase [Burkholderia thailandensis E264] (262 aa)
Score = 190, Expect = 1.3e-12, Identities = 79/296 (26%), Positives = 131/296 (44%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTS---SFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRG-EINELLISNFD 349
           +  P + W+GGK +L + I   +P H+     Y E F GG A+ F    +K EV    I+DIN EL+N+Y V+++ ++E +       + F        KW  L  +  F  LK        D+++AA   +L K+CF G       G    ++      +I + L+   I  +L N  I   D+    +  D+ +T  Y DPPY           FT Y K          +A+ +  +  KG  I+  N  P+           +++ ++I+ V  +  I   G  +G E  EL+I ++D
  S:     1 MANPIIPWIGGKRRLADHIIPRFPKHDC----YVEVFAGGAALYFMRPPAKVEV----INDINGELVNLYRVVQHHLEEFV-------RQF--------KW-ALTSRQVFEWLKHTVPETLTDIQRAARFYYLQKSCFGGKLEGQTFGTATTTVPGLNLLRIEEELSAAHI--RLANAYIERLDWATCIDRYDRPHTLFYLDPPYFETEGYGVAFPFTEYEK----------MAERLRSI--KGRAIVSLNDHPE--------IRRVFAGFHIESVPIQYTI---GGGKGVERRELIIFSWD 253
>gi|33602582|ref|NP_890142.1| modification methylase [Bordetella bronchiseptica RB50] >gi|33577024|emb|CAE35580.1| modification methylase [Bordetella bronchiseptica RB50] (263 aa)
Score = 189, Expect = 1.6e-12, Identities = 74/297 (24%), Positives = 132/297 (44%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF--DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRG-EINELLISNFDI 350
           +  P + W+GGK +L + +  Y+P H      Y EPF GG A+ F   V +  EV    ++D+N EL+N+Y V+K+ ++E +       + F        KW  L  +  F  L+   +    D+++AA   +L  + F G       G+   +       +I +  NL     +L +  I    ++      D++ TF + DPPY     T  +       F     ++LAD + KL  KG  ++  N  P           E++ A+ I+    +  +   G  RG + +E++I ++D+
  S:     1 MASPIIPWIGGKRRLADRLLPYFPSHQC----YVEPFAGGAAMFFLRPVPADVEV----LNDVNGELVNLYRVVKHHLEEFV-------RQF--------KW-ALSSRQVFKWLQVTPEETLTDIQRAARFFYLQHSAFGGRVDGQTYGVATTAPPGLNLLRIEE--NLSTAHLRLASAYIENLPWQDCIRRYDRSHTFFFMDPPY---WETEGYGVE----FGWSQYEQLADMLGKL--KGKAVVTLNDHPD--------IRELFKAFTIESTDIRYTV---GGGRGIDRSEVVIFSWDV 255
>gi|82543305|ref|YP_407252.1| putative DNA adenine methylase [Shigella boydii Sb227] >gi|81244716|gb|ABB65424.1| putative DNA adenine methylase [Shigella boydii Sb227] (182 aa)
Score = 189, Expect = 1.7e-12, Identities = 47/163 (28%), Positives = 79/163 (48%)
  Q:   178 KAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMIN---SDGSSRGEI 340
           KA   ++LN+  + GL R NK G FN+  G+YKNP   +   + A ++K +    +   + ++   +     VY DPPY       +F+ Y+ D F + +Q  LA  +   +++G  +++SNSD        S    +Y  +    +K KR I     +G S  EI
  S:     2 KAVYFLYLNRHGYRGLCRYNKSGHFNIPYGNYKNPYFPEK-EIRAFAEKAQRATFICASFDETLAMLKAGDVVYCDPPY-----DGTFSGYHTDGFTEDDQYHLASVLEHRSSEGHPVIVSNSD-------TSLIRSLYRNFTHHYIKVKRSIGVAAGEGKSATEI 154
>gi|17975188|ref|NP_536383.1| DNA adenine methylase [Burkholderia phage phiE125] >gi|38707916|ref|NP_945057.1| gp26 [Burkholderia phage phi1026b] >gi|76810659|ref|YP_333100.1| hypothetical protein BURPS1710b_1697 [Burkholderia pseudomallei 1710b] >gi|161369765|ref|ZP_02109334.1| gp27 [Burkholderia pseudomallei 1710a] >gi|17484049|gb|AAL40300.1|AF447491_27 gp27 [Bacteriophage phiE125] >gi|38505408|gb|AAR23177.1| gp26 [Bacteriophage phi1026b] >gi|76580112|gb|ABA49587.1| gp27 [Burkholderia pseudomallei 1710b] (262 aa)
Score = 187, Expect = 2.7e-12, Identities = 78/296 (26%), Positives = 131/296 (44%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTS---SFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRG-EINELLISNFD 349
           +  P + W+GGK +L + I   +P H+     Y E F GG A+ F    ++ EV    I+DIN EL+N+Y V+++ ++E +       + F        KW  L  +  F  LK        D+++AA   +L K+CF G       G    ++      +I + L+   I  +L N  I   D+    +  D+ +T  Y DPPY           FT Y K          +A+ +  +  KG  I+  N  P+           +++ ++I+ V  +  I   G  +G E  EL+I ++D
  S:     1 MANPIIPWIGGKRRLADHIIPRFPKHDC----YVEVFAGGAALYFMRPPARVEV----INDINGELVNLYRVVQHHLEEFV-------RQF--------KW-ALTSRQVFEWLKHTVPETLTDIQRAARFYYLQKSCFGGKLEGQTFGTATTTVPGLNLLRIEEELSAAHI--RLANAYIERLDWATCIDRYDRPHTLFYLDPPYFETEGYGVAFPFTEYEK----------MAERLRSI--KGRAIVSLNDHPE--------IRRVFAGFHIESVPIQYTI---GGGKGVERRELIIFSWD 253
>gi|194508401|ref|YP_002020935.1| gp27 [Burkholderia pseudomallei Pasteur 52237] >gi|157938380|gb|EDO94050.1| gp27 [Burkholderia pseudomallei Pasteur 52237] (262 aa)
Score = 185, Expect = 4.1e-12, Identities = 79/296 (26%), Positives = 130/296 (43%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTS---SFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRG-EINELLISNFD 349
           +  P + W+GGK +L + I   +P H+     Y E F GG A+ F    +K EV    I+DIN EL+N+Y V+++ ++E +       + F        KW  L  +  F  LK        D+++AA   +L K+CF G       G    ++      +I + L+   I  +L N  I   D+    +  D+  T  Y DPPY           FT Y K          +A+ +  +  KG  I+  N  P+           +++ ++I+ V  +  I   G  +G E  EL+I ++D
  S:     1 MANPIIPWIGGKRRLADHIIPRFPKHDC----YVEVFAGGAALYFMRPPAKVEV----INDINGELVNLYRVVQHHLEEFV-------RQF--------KW-ALTSRQVFEWLKHTIPETLTDIQRAARFYYLQKSCFGGKLEGQTFGTATTTVPGLNLLRIEEELSAAHI--RLANAYIERLDWATCIDRYDRPYTLFYLDPPYFETEGYGVAFPFTEYEK----------MAERLRTI--KGRAIVSLNDHPE--------IRRVFAGFHIESVPIQYTI---GGGKGVERRELIIFSWD 253
>gi|13448812|gb|AAK27214.1|AF355461_1 adenine methyltransferase M.PleI [Paucimonas lemoignei] (283 aa)
Score = 184, Expect = 5.5e-12, Identities = 76/242 (31%), Positives = 123/242 (50%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKV----KELIPVLQIMEKDFLLRNT-----------DDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKK----LKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKIL 296
           +KP +K+ GGK++ +  + K+ P       +Y EPF GGGA+ F +    E ++  I+DIN +LI+ Y  +K        EL  +  I EK+ +   T           D  + +Y   +N FN  K+  D        + L  ++NKT ++G+ R N KG FNV  G YKN      LN + ++ +    ++   I   DY +  +   K+ F++ DPPY  + S      Y KD FN     +L++   KL  K   ++
  S:     1 MKPLVKYRGGKSKEIPYLIKHIPEFKG---RYIEPFFGGGALFFYI----EPEKSIINDINKKLIDFYRDVKDNFVQLRHELDEIECIYEKNRVEYETRKKLNPTERVDDGNEDFYYFMRNEFN--KDFSDRYL----SSTLYFYINKTAYSGMIRYNSKGEFNVPFGRYKN------LNTKLVANEHHLLMQGAQIFNEDYSEIFKMARKDDFIFLDPPYDCVFSDYGNEEY-KDGFNVDAHVKLSEDFKKLKCKAMMVI 241
>gi|194517611|ref|YP_002053155.1| gp27 [Burkholderia pseudomallei S13] >gi|169651833|gb|EDS84526.1| gp27 [Burkholderia pseudomallei S13] (262 aa)
Score = 184, Expect = 6.4e-12, Identities = 77/296 (26%), Positives = 132/296 (44%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRG-EINELLISNFD 349
           +  P + W+GGK +L + I   +P H+     Y E F GG A+ F    +K EV    I+DIN EL+N+Y V+++ ++E +       + F        KW  L  +  F  LK        D+++AA   +L K+CF G       G    ++      +I + L+   I  +L N  I   D+    +  D+  T  Y DPPY     T  +       F  +  +++A+ +  +  KG  I+  N  P+           +++ ++I+ V  +  I   G  +G E  EL+I ++D
  S:     1 MANPIIPWIGGKRRLADHIIPRFPKHDC----YVEVFAGGAALYFMRPPAKVEV----INDINGELVNLYRVVQHHLEEFV-------RQF--------KW-ALTSRQVFEWLKHTVPETLTDIQRAARFYYLQKSCFGGKLEGQTFGTATTTVPGLNLLRIEEELSAAHI--RLANAYIERLDWATCIDRYDRPYTLFYLDPPY---FETEGYGV----AFPFEEYEKMAERLRSI--KGRAIVSLNDHPE--------IRRVFAGFHIESVPIQYTI---GGGKGVERRELIIFSWD 253
>gi|194514871|ref|YP_002051132.1| gp27 [Burkholderia pseudomallei S13] >gi|169654479|gb|EDS87172.1| gp27 [Burkholderia pseudomallei S13] (262 aa)
Score = 184, Expect = 6.5e-12, Identities = 77/296 (26%), Positives = 132/296 (44%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRG-EINELLISNFD 349
           +  P + W+GGK +L + I   +P H+     Y E F GG A+ F    +K EV    I+DIN EL+N+Y V+++ ++E +       + F        KW  L  +  F  LK        D+++AA   +L K+CF G       G    ++      +I + L+   I  +L N  I   D+    +  D+  T  Y DPPY     T  +       F  +  +++A+ +  +  KG  I+  N  P+           +++ ++I+ V  +  I   G  +G E  EL+I ++D
  S:     1 MANPIIPWIGGKRRLADHIIPRFPKHDC----YVEVFAGGAALYFMRPPAKVEV----INDINGELVNLYRVVQHHLEEFV-------RQF--------KW-ALTSRQVFEWLKHTVPETLTDIQRAARFYYLQKSCFGGKLEGQTFGTATTTVPGLNLLRIEEELSAAHI--RLANAYIERLDWATCIDRYDRPYTLFYLDPPY---FETEGYGV----AFPFEEYEKMAERLRSI--KGRAIVSLNDHPE--------IRRVFAGFHIESVPIQYTI---GGGKGVERRELIILSWD 253
>gi|77956201|ref|ZP_00820326.1| COG0338: Site-specific DNA methylase [Yersinia bercovieri ATCC 43970] (251 aa)
Score = 183, Expect = 7.6e-12, Identities = 87/292 (29%), Positives = 125/292 (42%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE----AISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQ--NQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           P + WVGGK +L   I   +P H    T Y EPF GG A+ F    SK EV    I+DIN ELIN+Y VIK  ++E +       + F        KW  L  +  F   K        D+++AA   +L  T F    RV+ +  F  S      P   + L LE    A   +L    I +  +    E  D+ ++  Y DPPY           Y  +   DQ  +  +LA  I     +G  I+  N  P+  D        ++   +I  V  K    S G ++ + +EL+I NF
  S:     4 PIIPWVGGKRRLAKHILPLFPSH----TCYVEPFCGGAALYFLKETSKVEV----INDINGELINLYRVIKNHLEEFV-------RQF--------KW-ALTSRQVFEWTKATPTEVLTDIQRAARFYYLQTTAFGA--RVDGQ-TFGTST---TRPAGLNLLRLEETLSAAHLRLSRTMIEHLGWADCIEKYDRPHSLFYLDPPYWQT------CGYGVEFGLDQYSHMAQLARSI-----QGNMIISVNDIPEMRD--------VFKGLHIDTVSLKY---SLGDNKKQASELIIRNF 251
>gi|194570162|ref|YP_002105163.1| gp27 [Burkholderia pseudomallei 406e] >gi|157808374|gb|EDO85544.1| gp27 [Burkholderia pseudomallei 406e] (262 aa)
Score = 183, Expect = 8.2e-12, Identities = 78/296 (26%), Positives = 133/296 (44%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE----AISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRG-EINELLISNFD 349
           +  P + W+GGK +L + I   +P H+     Y E F GG A+ F    +K EV    I+DIN EL+N+Y V+++ ++E +       + F        KW  L  +  F  LK        D+++AA   +L K+CF G       G         ++P   + L +E    A   +L N  I   D+    +  D+ +T  Y DPPY     T  +       F  +  +++A+ +  +  KG  I+  N  P+           +++ ++I+ V  +  I   G  +G E  EL+I ++D
  S:     1 MANPIIPWIGGKRRLADHIIPRFPKHDC----YVEVFAGGAALYFMRPPAKVEV----INDINGELVNLYRVVQHHLEEFV-------RQF--------KW-ALTSRQVFEWLKHTVPETLTDIQRAARFYYLQKSCFGGKLEGQTFGT------RTEHPPGLNLLRIEEELSAAHIRLANAYIERLDWATCIDRYDRPHTLFYLDPPY---FETEGYGV----AFPFEEYEKMAERLRSI--KGRAIVSLNDHPE--------IRRVFAGFHIESVPIQYTI---GGGKGVERRELIIFSWD 253
>gi|83719768|ref|YP_442453.1| DNA adenine methylase [Burkholderia thailandensis E264] >gi|83653593|gb|ABC37656.1| DNA adenine methylase [Burkholderia thailandensis E264] (323 aa)
Score = 183, Expect = 8.2e-12, Identities = 78/296 (26%), Positives = 133/296 (44%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE----AISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRG-EINELLISNFD 349
           +  P + W+GGK +L + I   +P H+     Y E F GG A+ F    +K EV    I+DIN EL+N+Y V+++ ++E +       + F        KW  L  +  F  LK        D+++AA   +L K+CF G       G         ++P   + L +E    A   +L N  I   D+    +  D+ +T  Y DPPY     T  +       F  +  +++A+ +  +  KG  I+  N  P+           +++ ++I+ V  +  I   G  +G E  EL+I ++D
  S:    62 MANPIIPWIGGKRRLADHIIPRFPKHDC----YVEVFAGGAALYFMRPPAKVEV----INDINGELVNLYRVVQHHLEEFV-------RQF--------KW-ALTSRQVFEWLKHTVPETLTDIQRAARFYYLQKSCFGGKLEGQTFGT------RTEHPPGLNLLRIEEELSAAHIRLANAYIERLDWATCIDRYDRPHTLFYLDPPY---FETEGYGV----AFPFEEYEKMAERLRSI--KGRAIVSLNDHPE--------IRRVFAGFHIESVPIQYTI---GGGKGVERRELIIFSWD 314
>gi|160875271|ref|YP_001554587.1| DNA adenine methylase [Shewanella baltica OS195] >gi|160860793|gb|ABX49327.1| DNA adenine methylase [Shewanella baltica OS195] (253 aa)
Score = 182, Expect = 9.2e-12, Identities = 58/201 (28%), Positives = 91/201 (45%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPY 256
           KP + W+GGK +L+ +I   +P H+     Y EPF GG A+ F   SK E +   ++D+N +L+N+Y VIK+ ++E I       + F        KW  LI +  F   K        D+++A+   +L K  F G       G            +I + L++  +  +L    I   D+ +     DK  T  Y DPPY
  S:     3 KPIIPWMGGKRRLVKQILPIFPEHHT----YVEPFCGGAAMFF---SKDEARVEVVNDMNGDLVNLYRVIKHHLEEFI-------RHF--------KW-ALISREEFLWQKNTNPETLTDIQRASRFYYLQKLAFGGKVSGQNFGCSASRPAGLNLLRIEEDLSIAHL--RLARTYIERLDWAECVRRYDKPETLFYLDPPY 179
>gi|56692617|ref|YP_164085.1| Dam modification methylase [Pseudomonas phage B3] >gi|33338642|gb|AAQ13966.1|AF232233_48 Dam modification methylase [Bacteriophage B3] (264 aa)
Score = 182, Expect = 1.0e-11, Identities = 75/298 (25%), Positives = 135/298 (45%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF--DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE----AISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDINKK 353
           +P + W+GGK +L + I   +P H    + Y EPF GG A+ F   V +  EV    ++DIN +L+N+Y V+++ ++E +       + F        KW  L  +  F  L+E       D+++AA   +L ++ F G  RV+ +     +     +P   + L LE    A   +L N  I +  ++      D+ +T  Y DPPY     T  +       F  +  +E+A    +L  KG  I+  N  P+          E +++++I+       +   G       E+LI ++D++ +
  S:     4 QPIIPWIGGKRRLADRIFPLFPRH----SCYVEPFAGGAALFFLRPVPADVEV----LNDINGDLVNLYRVVQHHLEEFV-------RQF--------KW-ALSSRQVFKWLQETRPETLTDIQRAARFYYLQQSAFGG--RVDGQSYGTAT----TSPPGLNLLRLEETLSAAHLRLSNTYIEHLSWQDCLRRYDREHTLFYMDPPY---WETEGYGV----PFGFEQYQEMAVMFRQL--KGKAIISLNDHPE--------IRECFASFHIESTDITYTVG--GGQGSAAREVLIFSWDLSAE 259
>gi|153000636|ref|YP_001366317.1| DNA adenine methylase [Shewanella baltica OS185] >gi|151365254|gb|ABS08254.1| DNA adenine methylase [Shewanella baltica OS185] (253 aa)
Score = 182, Expect = 1.1e-11, Identities = 58/201 (28%), Positives = 91/201 (45%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPY 256
           KP + W+GGK +L+ +I   +P H+     Y EPF GG A+ F   SK E +   ++D+N +L+N+Y VIK+ ++E I       + F        KW  LI +  F   K        D+++A+   +L K  F G       G            +I + L++  +  +L    I   D+ +     DK  T  Y DPPY
  S:     3 KPIIPWMGGKRRLVKQILPIFPEHHT----YVEPFCGGAAMFF---SKDEARVEVVNDMNGDLVNLYRVIKHHLEEFI-------RHF--------KW-ALISREEFLWQKNTNPETLTDIQRASRFYYLQKLAFGGKVSGQNFGCSASRPAGLNLLRIEEDLSIAHL--RLARTYIERLDWAECVRRYDKPETLFYLDPPY 179
>gi|167814860|ref|ZP_02446540.1| DNA adenine methylase [Burkholderia pseudomallei 91] (262 aa)
Score = 181, Expect = 1.3e-11, Identities = 77/296 (26%), Positives = 133/296 (44%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE----AISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRG-EINELLISNFD 349
           +  P + W+GGK +L + I   +P H+     Y E F GG A+ F    +K EV    ++DIN EL+N+Y V+++ ++E +       + F        KW  L  +  F  LK        D+++AA   +L K+CF G       G         ++P   + L +E    A   +L N  I   D+    +  D+ +T  Y DPPY     T  +       F  +  +++A+ +  +  KG  I+  N  P+           +++ ++I+ V  +  I   G  +G E  EL+I ++D
  S:     1 MANPIIPWIGGKRRLADHIIPRFPKHDC----YVEVFAGGAALYFMRPPAKVEV----VNDINGELVNLYRVVQHHLEEFV-------RQF--------KW-ALTSRQVFEWLKHTVPETLTDIQRAARFYYLQKSCFGGKLEGQTFGT------RTEHPPGLNLLRIEEELSAAHIRLANAYIERLDWATCIDRYDRPHTLFYLDPPY---FETEGYGV----AFPFEEYEKMAERLRSI--KGRAIVSLNDHPE--------IRRVFAGFHIESVPIQYTI---GGGKGVERRELIIFSWD 253
>gi|194516926|ref|YP_002052664.1| gp27 [Burkholderia pseudomallei S13] >gi|169652581|gb|EDS85274.1| gp27 [Burkholderia pseudomallei S13] (213 aa)
Score = 181, Expect = 1.5e-11, Identities = 59/203 (29%), Positives = 93/203 (45%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPY 256
           +  P + W+GGK +L + I   +P H+     Y E F GG A+ F    +K EV    I+DIN EL+N+Y V+++ ++E +       + F        KW  L  +  F  LK        D+++AA   +L K+CF G       G    ++      +I + L+   I  +L N  I   D+    +  D+  T  Y DPPY
  S:     1 MANPIIPWIGGKRRLADHIIPRFPKHDC----YVEVFAGGAALYFMRPPAKVEV----INDINGELVNLYRVVQHHLEEFV-------RQF--------KW-ALTSRQVFEWLKHTVPETLTDIQRAARFYYLQKSCFGGKLEGQTFGTATTTVPGLNLLRIEEELSAAHI--RLANAYIERLDWATCIDRYDRPYTLFYLDPPY 179
>gi|134277939|ref|ZP_01764654.1| gp26 [Burkholderia pseudomallei 305] >gi|134251589|gb|EBA51668.1| gp26 [Burkholderia pseudomallei 305] (262 aa)
Score = 180, Expect = 1.5e-11, Identities = 79/296 (26%), Positives = 130/296 (43%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE----AISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTS---SFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRG-EINELLISNFD 349
           +  P + W+GGK +L + I   +P H+     Y E F GG A+ F    ++ EV    I+DIN EL+N+Y V+++ ++E +       + F        KW  L  +  F  LK        D+++AA   +L K+CF G       G         ++P   + L +E    A   +L N  I   D+    +  D+  T  Y DPPY           FT Y K          +A+ +  +  KG  I+  N  P+           +++ ++I+ V  +  I   G  +G E  EL+I ++D
  S:     1 MANPIIPWIGGKRRLADHIIPRFPKHDC----YVEVFAGGAALYFMRPPARVEV----INDINGELVNLYRVVQHHLEEFV-------RQF--------KW-ALTSRQVFEWLKHTVPETLTDIQRAARFYYLQKSCFGGKLEGQTFGT------RTEHPPGLNLLRIEEELSAAHIRLANAYIERLDWATCIDRYDRPYTLFYLDPPYFETEGYGVAFPFTEYEK----------MAERLRSI--KGRAIVSLNDHPE--------IRRVFAGFHIESVPIQYTI---GGGKGVERRELIIFSWD 253
>gi|167893349|ref|ZP_02480751.1| DNA adenine methylase [Burkholderia pseudomallei 7894] (262 aa)
Score = 180, Expect = 1.7e-11, Identities = 59/203 (29%), Positives = 93/203 (45%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPY 256
           +  P + W+GGK +L + I   +P H+     Y E F GG A+ F    +K EV    I+DIN EL+N+Y V+++ ++E +       + F        KW  L  +  F  LK        D+++AA   +L K+CF G       G    +       +I + L+   I  +L N  I   D+    +  D+ +T  Y DPPY
  S:     1 MANPIIPWIGGKRRLADHIIPRFPKHDC----YVEVFAGGAALYFMRPPAKVEV----INDINGELVNLYRVVQHHLEEFV-------RQF--------KW-SLTSRQVFEWLKHTVPETLTDIQRAARFYYLQKSCFGGKLEGQTFGTATTTPPGLNLLRIEEELSAAHI--RLANAYIERLDWATCIDRYDRPHTLFYLDPPY 179
>gi|15896601|ref|NP_349950.1| site-specific DNA methylase dam [Clostridium acetobutylicum ATCC 824] >gi|15026442|gb|AAK81290.1|AE007833_3 Site-specific DNA methylase dam [Clostridium acetobutylicum ATCC 824] (281 aa)
Score = 180, Expect = 1.8e-11, Identities = 78/290 (26%), Positives = 135/290 (46%)
  Q:    59 LKWVGGKTQLLNEIKKY-YPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDF--------LLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYK--NPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +K+ GGK +   EIKK+ +   + +   Y EPF+GGGAV FD+    E +   I+DIN +LI+ Y  +K     +   L+ +E  +         L+  +  +    + +  + EL+E+ +       +  +  F+NKT ++G+ R NKKG +NV  G YK  N K  D  + E     LKN  I+  DY++  +       ++ DPPY  + +             DQ+++ LA+    LN +   I+                +E+Y  Y +     K  +N     R     +++SN+
  S:     2 IKYRGGKAR---EIKKFIHHLKSQKYDSYYEPFIGGGAVYFDL----EPQNAIINDINTKLIDFYVDVKNNFSRIKNELEFLENVYNKNQQQYDALKMINSEERVLSMNEKLYYELREEFNYPTGKYLRGTVYYFINKTSYSGMIRYNKKGEYNVPFGRYKGFNAKGIDIKHYEL----LKNAQILNLDYEEVFKKASSKDIMFLDPPYDCVFNDYGNIQLGGGFDEDQHRR-LAENFKNLNTRSLMII----------GKTKLTEELYRNYIVDEYSKKYCVNIKNRFRNSAIHIVVSNY 280
>gi|167824860|ref|ZP_02456331.1| DNA adenine methylase [Burkholderia pseudomallei 9] (262 aa)
Score = 180, Expect = 1.9e-11, Identities = 60/203 (29%), Positives = 94/203 (46%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE----AISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPY 256
           +  P + W+GGK +L + I   +P H+     Y E F GG A+ F    +K EV    I+DIN EL+N+Y V+++ ++E +       + F        KW  L  +  F  LK        D+++AA   +L K+CF G       G         ++P   + L +E    A   +L N  I   D+    +  D+ +T  Y DPPY
  S:     1 MANPIIPWIGGKRRLADHIIPRFPKHDC----YVEVFAGGAALYFLRPPAKVEV----INDINGELVNLYRVVQHHLEEFV-------RQF--------KW-ALTSRQVFEWLKHTVPETLTDIQRAARFYYLQKSCFGGKLEGQTFGT------RTEHPPGLNLLRIEEELSAAHIRLANAYIERLDWATCIDRYDRPHTLFYLDPPY 179
>gi|167744473|ref|ZP_02417247.1| DNA adenine methylase [Burkholderia pseudomallei 14] (262 aa)
Score = 180, Expect = 1.9e-11, Identities = 60/203 (29%), Positives = 94/203 (46%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE----AISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPY 256
           +  P + W+GGK +L + I   +P H+     Y E F GG A+ F    +K EV    I+DIN EL+N+Y V+++ ++E +       + F        KW  L  +  F  LK        D+++AA   +L K+CF G       G         ++P   + L +E    A   +L N  I   D+    +  D+ +T  Y DPPY
  S:     1 MANPIIPWIGGKRRLADHIIPRFPKHDC----YVEVFAGGAALYFMRPPAKVEV----INDINGELVNLYRVVQHHLEEFV-------RQF--------KW-ALTSRQVFEWLKHTVPETLTDIQRAARFYYLQKSCFGGKLEGQTFGT------RTEHPPGLNLLRIEEELSAAHIRLANAYIERLDWATCIDRYDRPHTLFYLDPPY 179
>gi|167619500|ref|ZP_02388131.1| DNA adenine methylase [Burkholderia thailandensis Bt4] (193 aa)
Score = 180, Expect = 1.9e-11, Identities = 60/203 (29%), Positives = 94/203 (46%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE----AISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPY 256
           +  P + W+GGK +L + I   +P H+     Y E F GG A+ F    +K EV    I+DIN EL+N+Y V+++ ++E +       + F        KW  L  +  F  LK        D+++AA   +L K+CF G       G         ++P   + L +E    A   +L N  I   D+    +  D+ +T  Y DPPY
  S:     1 MANPIIPWIGGKRRLADHIIPRFPKHDC----YVEVFAGGAALYFMRPPAKVEV----INDINGELVNLYRVVQHHLEEFV-------RQF--------KW-ALTSRQVFEWLKHTVPETLTDIQRAARFYYLQKSCFGGKLEGQTFGT------RTEHPPGLNLLRIEEELSAAHIRLANAYIERLDWATCIDRYDRPHTLFYLDPPY 179
>gi|167911595|ref|ZP_02498686.1| DNA adenine methylase [Burkholderia pseudomallei 112] (262 aa)
Score = 179, Expect = 2.4e-11, Identities = 60/203 (29%), Positives = 94/203 (46%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE----AISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPY 256
           +  P + W+GGK +L + I   +P H+     Y E F GG A+ F    +K EV    I+DIN EL+N+Y V+++ ++E +       + F        KW  L  +  F  LK        D+++AA   +L K+CF G       G         ++P   + L +E    A   +L N  I   D+    +  D+ +T  Y DPPY
  S:     1 MANPIIPWIGGKRRLADHIIPRFPKHDC----YVEVFAGGAALYFMRPPAKVEV----INDINGELVNLYRVVQHHLEEFV-------RQF--------KW-ALTSRQVFEWLKHTIPETLTDIQRAARFYYLQKSCFGGKLEGQTFGT------RTEHPPGLNLLRIEEELSAAHIRLANAYIERLDWATCIDRYDRPHTLFYLDPPY 179
>gi|110804053|ref|YP_699979.1| modification methylase dpniia, putative [Clostridium phage phiSM101] >gi|110684554|gb|ABG87921.1| modification methylase dpniia, putative [Clostridium perfringens phage phiSM101] (259 aa)
Score = 179, Expect = 2.4e-11, Identities = 82/300 (27%), Positives = 131/300 (43%)
  Q:    49 NNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           + N +++KP +  +GGK++L   I +  P H      Y EPF G G V F    SK EV    I+D++ ELIN++ +IKY   E+  +L+                Y    ++ F E K        ++++A   ++L    F G     K   +        +P+I     L  I  +L+N  +    ++K  E  D+  +F + DPPY         TA     F ++    L D +   N KG  ++  N  PK          E Y  +NIK VK    +++  S+R E  EL+I+NF
  S:     4 DKNSKMMKPPITRMGGKSKLRKTIIEMIPDH----VCYVEPFFGAGWVFFGKTPSKVEV----INDVDKELINLFKMIKYHAPEIERMLE----------------YEFSGRDIFEEYKNVTLEHLTEIQRAVRFLYLISQSFAG-----KGNHYGYGTNTKPSPQIFYKRVLGDIKNRLRNTYVENLSFEKIIEKYDREYSFFFCDPPYFE-------TAGYGTEFGEKEHLLLRDKLK--NIKGKFLVTINDHPK--------VREWYKDFNIKEVKVMYSVSNQASARKEYGELIITNF 259
>gi|126657777|ref|ZP_01728931.1| D12 class N6 adenine-specific DNA methyltransferase [Cyanothece sp. CCY0110] >gi|126620994|gb|EAZ91709.1| D12 class N6 adenine-specific DNA methyltransferase [Cyanothece sp. CCY0110] (287 aa)
Score = 179, Expect = 2.6e-11, Identities = 60/240 (25%), Positives = 116/240 (48%)
  Q:    52 LQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNK 291
           + ++K  L++ GGK++ + +I++  P   N  ++Y EPFVGGG+V   +   Y   +I+I+D+N EL   + + +  +K L+  L+ ++K+      D R+         F EL + +  +  D ++A     LN+  F+G   +   G  + S          D   +E +   L  + I   DY++  +   +NTF++ DPPY   T  S     N +L    N ++ A+ + + +++
  S:     1 MMMIKSPLRYPGGKSRAIKQIEEQLP---NDFSEYREPFVGGGSVFIYLKQVYPNVKIWINDLNPELYLFWKIAQSDLKMLVTELKAIKKN----RKDGREL--------FTELSQVDVQKMSDFDRAVRFFVLNRITFSG--TIESGGYSDKSFHSRFTESSID--RVERLGDLLPEIRITNLDYREVVKQEGENTFIFLDPPYLTATK-SKLYGKNGNLHTSFNHQDFAETMKQCDHQ 220
>gi|161789174|ref|YP_001595670.1| DNA adenine methylase [Vibrio sp. 0908] >gi|161761460|gb|ABX77105.1| DNA adenine methylase [Vibrio sp. 0908] (280 aa)
Score = 178, Expect = 2.8e-11, Identities = 81/290 (27%), Positives = 129/290 (44%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQIT--KYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKK-GLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           +KP +KW GGKT L    ++      N I+  +  EPF G  A        YE   + ++D N  LIN+Y       K+L    +I   +FLL    +  ++Y  ++   N L   +D   L  ++A L  +L K  FNGL R +K+ G FN+  G YK   I    + +   +  KN     G +  SE  I     V  DPPY       +F AY K    D+N+      +N L      ++ +N+     +    + +E ++ Y   +   +R I+  GS RG+  E++
  S:     1 MKPLIKWAGGKTWLAKRAERIV----NDISPERVVEPFAGSAAFSL----HYEFDNVILNDANPALINLY-------KQLSSGYEINPDEFLL----EADFFYAAREELNNALLSGQD---LGEKEAGLFWYLCKHSFNGLVRQSKRAGKFNMPFGEYKG--IATPPDTKEFMQVAKNWTFNCGCF--SEVDITDAQLVLIDPPYE-----KTFNAYTK----DKNENLQERIVNMLGGYDGAVIATNT--LLPELTHIYREEGFTVY---KTPVRRSISCKGSGRGKTFEMI 253
>gi|161361439|ref|ZP_02107289.1| DNA adenine methylase [Burkholderia pseudomallei 1106b] (262 aa)
Score = 177, Expect = 3.5e-11, Identities = 58/203 (28%), Positives = 93/203 (45%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPY 256
           +  P + W+GGK +L + I   +P H+     Y E F GG A+ F    +K EV    I+DIN EL+N+Y V+++ ++E +       + F        KW  L  +  F  +K        D+++AA   +L K+CF G       G    +       +I + L+   I  +L N  I   D+    +  D+ +T  Y DPPY
  S:     1 MANPIIPWIGGKRRLADHIIPRFPKHDC----YVEVFAGGAALYFMRPPAKVEV----INDINGELVNLYRVVQHHLEEFV-------RQF--------KW-SLTSRQVFEWIKHTVPETLTDIQRAARFYYLQKSCFGGKLEGQTFGTATTTPPGLNLLRIEEELSAAHI--RLANAYIERLDWAACFDRYDRPHTLFYLDPPY 179
>gi|37527323|ref|NP_930667.1| hypothetical protein plu3449 [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36786757|emb|CAE15823.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] (256 aa)
Score = 177, Expect = 3.6e-11, Identities = 58/200 (28%), Positives = 96/200 (48%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPY 256
           P + W+GGK +L   I   +P H    T Y EPF G  A+ F  V SK EV    I+D+N EL+N+Y VIK+ ++E +       + F        KW  L+ +  +  L+   +    D+++AA   +L K  F+G    +  G    S   +   +I + L++  +  +L    I   ++ +  +  D+ +T  Y DPPY
  S:     7 PIVPWIGGKRRLAKHILPLFPEH----TCYVEPFCGAAALYFLKVPSKCEV----INDLNGELVNLYRVIKHHLEEFV-------RQF--------KW-ALVSRQIYKWLQITPEETLTDIQRAARFYYLQKQAFSGKVAEHTFGTSTTSPPRFNLLRIEEELSMAHL--RLARTIIENMNWTQCVQRYDRPHTLFYCDPPY 182
>gi|167749894|ref|ZP_02422021.1| hypothetical protein EUBSIR_00862 [Eubacterium siraeum DSM 15702] >gi|167657206|gb|EDS01336.1| hypothetical protein EUBSIR_00862 [Eubacterium siraeum DSM 15702] (302 aa)
Score = 177, Expect = 3.7e-11, Identities = 75/303 (24%), Positives = 131/303 (43%)
  Q:    51 NLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGH----YKNPKICDTLNLEAISKKLKNV---NIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDINKK 353
           N +V  P +K  G KT+L+  IKK      N +  + EPF+G G V F++    E  +   +D N  +I  Y  IK        V + +E +  L    D ++YY ++  RFN      D            +FLN+ CFNG+ R NK   FNV  GH    +    +   +N  A  + L      + +   ++ + +   K+ F+Y DPPY            + D ++  +++        L   G K +LS  D  N  + + +   ++S       +    + +  ++R  + E L++N+ +  K
  S:     2 NEKVYVPPIKIQGIKTKLVPLIKKSVVMQPNSV--WIEPFMGSGVVGFNI----EPHQAIFADTNPYIIEFYKQIKSGAINPYVVREFLEHEGKLLEQGDDEYYYTVR-TRFNTEHNPLD-----------FLFLNRACFNGMIRFNKNYDFNVPYGHKPQRFAKAYVTKIVNQVAHVENLLKTHSWDFLCQPFETTIDMAGKSDFIYCDPPY---------IGRHVDYYDSWDEQSEFALHKALVESGAKFMLSTWD-HNDYRENEYISTVWSDCQKITREHFYHVGAKETNRNPVIEALLTNYTVTGK 283
>gi|167832371|ref|YP_001686762.1| DNA adenine methyltransferase [Halomonas phage phiHAP-1] >gi|166836345|gb|ABY90394.1| DNA adenine methyltransferase [Halomonas phage phiHAP-1] (251 aa)
Score = 177, Expect = 3.8e-11, Identities = 61/201 (30%), Positives = 97/201 (48%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPY 256
           KPF++W+GGK +L   I   +P H      Y EPF GG A+ F    SK EV    I+D N++L+N+Y V+++ ++E +       + F        KW  L+ +  F   K K  +   D+++AA   +L +  F G  +VN     + + G   N    +  NL     +L  V +   D+K   +  D+ +T  Y DPPY
  S:     3 KPFIQWMGGKRRLAKHILPNFPDHQC----YVEPFAGGAALFFMKQPSKVEV----INDTNSDLVNLYRVVQHHLEEFV-------RQF--------KW-ALVSREMFAWEKLKHTDTLTDIQRAARFYYLQQQGFGG--KVNSNFGISTTSGPGLNLLRIEE-NLSQAHLRLSRVFVENMDWKAVMKRYDRPHTLHYLDPPY 178
>gi|34497566|ref|NP_901781.1| methyltransferase [Chromobacterium violaceum ATCC 12472] >gi|34103421|gb|AAQ59783.1| probable methyltransferase [Chromobacterium violaceum ATCC 12472] (258 aa)
Score = 177, Expect = 4.5e-11, Identities = 78/297 (26%), Positives = 121/297 (40%)
  Q:    52 LQV-VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE----AISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           LQ+   P + W+GGK +L   I   +P H    T Y EPF G  A+ F    K   K   ++D+N EL+N+Y V+++ ++E +       + F        KW  L  +  F  L+   +    D+++AA   +L +  F G       G    S      P   + L +E    A   +L    I   D+    +  D+ +T VY DPPY     T  +      L   Q   ELA  +     KG  I+  N  P+          + +    I RV     +   G S+    EL+I N+
  S:     2 LQIPASPIVPWIGGKRRLAKHILPLFPEH----TCYVEPFCGAAALYF---LKEPAKAEVLNDVNGELVNLYRVVRHHLEEFV-------RQF--------KW-ALSSRQIFKWLQITPEETLTDIQRAARFFYLQRLAFGGKVEGQTLGTSTTS------PPRLNLLRMEEDLSAAHLRLSRTYIENLDWADCIKKYDREHTLVYCDPPY---WGTEGY-GVEFGLHQYQRMAELARSM-----KGNMIISVNDIPE--------MRQAFDGLAIDRVDINYSVGGGGRSKERKGELIIRNW 258
>gi|186681668|ref|YP_001864864.1| D12 class N6 adenine-specific DNA methyltransferase [Nostoc punctiforme PCC 73102] >gi|14594710|gb|AAK68644.1| cytosine-specific DNA methyltransferase [Nostoc punctiforme] >gi|186464120|gb|ACC79921.1| D12 class N6 adenine-specific DNA methyltransferase [Nostoc punctiforme PCC 73102] (288 aa)
Score = 176, Expect = 4.6e-11, Identities = 77/297 (25%), Positives = 136/297 (45%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGH--YKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDI 350
           ++K  L++ GGK++ +N+I +Y P   +  +++ EPFVGGG+V   +  K+   +I+I+D+N EL   +   +  +  L+  ++ +            K  Y   K  F EL   + N   D+E+A     LN+  F+G     + G F+    H  + N  I     LE I    +NV I   DY    +   +N F++ DPPY   T  S     + DL      K  A+ + + +++    L++  D     +N  + +   SA+ ++      M N   S   +  EL I+N++I
  S:     2 IIKSPLRYPGGKSKAINQIAEYLP---DNFSEFREPFVGGGSVFIYLRQKFPHIKIWINDLNRELFLFWKFAQCDLAHLVQEIRHI------------KVKYRDGKLLFTELASVDVNSLSDLERAVRFFVLNRITFSGTV---ESGGFSQEAFHKRFTNSSIDRLEKLEGILS--ENVQITNLDYSHLLKSPGENIFLFLDPPYFSATK-SKLYGKDGDLHTFFEHKRFAELLQQCHHRW---LITYDDSSQIRENFQWAN--ISAWELQY----GMNNYKQSVAAKGKELFITNYEI 270
>gi|115351901|ref|YP_773740.1| D12 class N6 adenine-specific DNA methyltransferase [Burkholderia ambifaria AMMD] >gi|115281889|gb|ABI87406.1| D12 class N6 adenine-specific DNA methyltransferase [Burkholderia ambifaria AMMD] (262 aa)
Score = 176, Expect = 5.0e-11, Identities = 80/296 (27%), Positives = 127/296 (42%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE----AISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTS---SFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRG-EINELLISNFD 349
           +  P + W+GGK +L + I   +P H+     Y E F GG A+ F    +K EV    I+D+N ELIN+Y V+++ ++E +       + F        KW  L  +  F  LK+       D+++AA   +L K+CF         G    +      P   + L +E    A   +L N  I   D+    +  D+ +T  Y DPPY           F  Y K          +A  +  L  KG  I+  N  P           +I  A+N   ++   +  + G  +G E NEL+I ++D
  S:     1 MANPIIPWIGGKRRLADHIIPRFPSHDC----YVEVFAGGAALYFLRPPAKVEV----INDVNGELINLYRVVQHHLEEFV-------RQF--------KW-ALTSRQVFEWLKQTVPETLTDIQRAARFYYLQKSCFGAKLEGQSFGTATTT------PPGLNLLRIEEELSAAHLRLANTFIERLDWAACIDRYDRPHTLFYLDPPYYETEGYGVAFPFGEYEK----------MAHRLRSL--KGRAIVSLNDHP-----------DIRRAFNGFYIETVPIQYTVGGGKGVERNELIIYSWD 253
>gi|126010878|ref|YP_001039848.1| DNA adenine methylase [Vibrio phage VP882] >gi|123203888|gb|ABM73401.1| DNA adenine methylase [Vibrio phage VP882] (253 aa)
Score = 176, Expect = 5.0e-11, Identities = 55/201 (27%), Positives = 94/201 (46%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPY 256
           KPF  W+GGK +L   I   +P H      Y EPF G  A+ F  + +K EV    I+D+N++L+N+Y V+++ ++E +       + F        KW  LI +  F  L +       D+++AA   +L +  F         G    +       ++ +TL+   +  +L  V + + D++   E  D+ +T  Y DPPY
  S:     4 KPFFSWMGGKRRLAKHILPEFPEHEC----YVEPFCGAAALFFMKMPTKVEV----INDVNSDLVNLYRVVQHHLEEFV-------RQF--------KW-ALISREMFKWLDDTPVETLTDIQRAARFYYLQQMGFGAKITGRTFGTATTTPPKLNLLRLEETLSQAHL--RLSRVYVEHLDWQACMEKYDRPHTLFYLDPPY 180
>gi|189426028|ref|YP_001953205.1| D12 class N6 adenine-specific DNA methyltransferase [Geobacter lovleyi SZ] >gi|189422287|gb|ACD96685.1| D12 class N6 adenine-specific DNA methyltransferase [Geobacter lovleyi SZ] (254 aa)
Score = 175, Expect = 6.6e-11, Identities = 76/291 (26%), Positives = 133/291 (45%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNE-LKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEA-ISK---KLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEI-NELLISN 347
           P + W+GGK +L   I    P H    T Y EPF G  A+LF   +SK EV    ++DIN +L+++Y VI++ + E +                 R++ + I   +  E L++       D+++AA   +L K  F G  +V+ +     +     +P   + L LE  +S+   +L  V + +  +++     D+ ++F   DPPY           +++ L        LA+ +  L  +G  +L  N  P   D        ++S + IK V     +   G+S+G+   ELLI+N
  S:     5 PIIPWIGGKRRLARHIIPMIPQH----TCYVEPFAGAAAILFSKPMSKVEV----VNDINHDLVSLYRVIQHHLDEFV-----------------RQFKWAITSRKIYEWLQDTPPETLTDIQRAARFFYLQKLSFGG--KVDGRTFGTAT----TSPPRLNLLRLEEDLSQAHIRLSRVTVEHLPWERCIAKYDRPHSFFLLDPPYWQTEGYGVPFEFDQYL-------ALAEQLKTL--QGKALLTINDHPDIRD--------VFSDFQIKSVDINYTVG--GASKGKARKELLITN 253
>gi|160938529|ref|ZP_02085883.1| hypothetical protein CLOBOL_03426 [Clostridium bolteae ATCC BAA-613] >gi|158438516|gb|EDP16274.1| hypothetical protein CLOBOL_03426 [Clostridium bolteae ATCC BAA-613] (251 aa)
Score = 175, Expect = 7.5e-11, Identities = 83/291 (28%), Positives = 122/291 (41%)
  Q:    58 FLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFL-DVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFID-KNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           F+ W+GGK  L  EI   +P     + +Y E F G G VLF    +    E+Y +D +  L+N+Y  IKY    L   LQ                + L  + +F + + + D + L D++KAA   +L K  F   YR      F  S    +N        L  + K+L+ V I   D++      D K+   Y DPPY       + T YN   F  ++ + LA+ +   N KG  IL  N  P           E+YS Y  K V     +  D +      EL+I+NF
  S:     4 FIGWIGGKRLLRKEILGCFP---EDVGRYIEVFGGAGWVLFAKEKQAGQMEVY-NDRDGNLVNLYRCIKYHCSALQEELQ----------------WLLPSREQFYDYRAQMDMRGLTDIQKAARFFYLLKISFGSDYRT-----FATSSKSIENA----IDYLVKVQKRLQGVVIENKDFENLIGVYDRKDALFYLDPPY-----VGTETYYNVT-FTMEDHQRLAEILK--NIKGKFILSYNDIP--------MIRELYSQYPCKEVVRNSTLAGDSNKPAAYRELIITNF 251
>gi|156147297|gb|ABU53872.1| cje0220 [Campylobacter phage CGC-2007] (326 aa)
Score = 174, Expect = 9.7e-11, Identities = 91/294 (30%), Positives = 130/294 (44%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFD-VLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPK-ICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +K    WVGGK  L  EI    P H +    Y E F G  +V +    SK EV    I+DIN ELIN++  I+ K + L  VL  M                +I +  F+ LK KE     D+E+AA   +L  T F          +   +M   + PK +C   +L   +K+LKN +I    ++   +  D N    Y DPPY     T S+   N   F  +  + L    N L N   K +LS +D +          E+Y  +NIK +K +  +N++   R E  ELLI NF
  S:    77 LKAPFAWVGGKNYLAKEIIALMPEHKS----YIEVFGGALSVFYQKSASKIEV----INDINDELINLHLCIRNKPQSLANVLNSM----------------IISRKIFHMLKNKEIKPRNDLERAAFYFYLISTSFG-------SSMGQFAMSKQRAPKRLCRDFSLH--TKRLKNASIENKSFEYILKEYDYNEALFYLDPPY---VGTESYYK-NVPCFGLKEHELLC---NLLKNIKGKFMLSYNDCE-------LIRELYKDFNIKELKIRYSLNNNVLKRKESKELLIMNF 326
>gi|91777030|ref|YP_546786.1| DNA adenine methylase [Methylobacillus flagellatus KT] >gi|91711017|gb|ABE50945.1| DNA adenine methylase [Methylobacillus flagellatus KT] (263 aa)
Score = 172, Expect = 1.3e-10, Identities = 57/200 (28%), Positives = 92/200 (46%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK----NTFVYFDPPY 256
           P + W+GGK +L   I   +P H    + Y EPF G  A+ F    +K EV    ++DIN EL+N+Y V+++ ++E I       + F        KW  L  +  F  ++   +    D+++AA   +L K  F G       G    S      PK+  +   E +S     ++  Y ++   E+ I K    +T +Y DPPY
  S:    11 PIIPWIGGKRRLAKHILPLFPEH----SCYVEPFCGAAALYFLKAPAKVEV----LNDINGELVNLYRVVRHHLEEFI-------RQF--------KW-ALTSRQIFKWMQITPEETLTDIQRAARFFYLQKLAFGGKVSGQTFGTATTS-----PPKLAFSRLEEDLSAAHLRLDRTYIEHLPWEDCIRKYDRDHTLIYCDPPY 186
>gi|159028506|emb|CAO87313.1| ecoRVM [Microcystis aeruginosa PCC 7806] (310 aa)
Score = 172, Expect = 1.4e-10, Identities = 73/294 (24%), Positives = 134/294 (45%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGH--------YKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSA--YNIKRVKAKRMINSDGSSRGEINELLISNFDI 350
           P +K  G KT+L+ ++K      +    ++ EPF G G + F++      K+  ++D N  +I  Y+ +K +V     V   ++++  +       +YY +++ RFN+     D            +FLN++CFNG+ R N+KG FNV   H        Y    +   + LE I  K  + +    D++++     K   +Y DPPY            + D FN  ++++    +  L +   + +LS     N  +++    + +SA  + I   +    + S    R  I E LI+NF+I
  S:     8 PPIKCQGIKTKLVKDVKNI--VSDLSFGRWIEPFSGSGVMAFNI----NPKKALLADTNTHIIQFYNNLKNQVITSKTVKLFLQENGQVLKEQGESYYYQVRE-RFNQSPNSLD-----------FLFLNRSCFNGVMRFNRKGQFNVPYCHKSERFSQAYITKIVNQVIALENILIK-TDYDFQVADFRETLSDWQKTDLIYLDPPY---------LGRHADYFNSWSEEDEDCLVTILKDISCRFILSTWH-SNQFRSNPLIKKNWSADQFYIYTKQHFYHVGSTEKLRHPITEALITNFNI 282
>gi|134277331|ref|ZP_01764046.1| DNA adenine methylase [Burkholderia pseudomallei 305] >gi|134250981|gb|EBA51060.1| DNA adenine methylase [Burkholderia pseudomallei 305] (262 aa)
Score = 172, Expect = 1.4e-10, Identities = 58/203 (28%), Positives = 93/203 (45%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE----AISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPY 256
           +  P + W+GGK +L + +   +P H+     Y E F GG A+ F    +K EV    I+D+N ELIN+Y V+++ ++E +       + F        KW  L  +  F  LK        D+++AA   +L K+CF G       G    +      P   + L +E    A   +L N  +   D+    +  D+ +T  Y DPPY
  S:     1 MANPIIPWIGGKRRLADHLIPRFPSHDC----YVEVFAGGAALYFLRPPAKVEV----INDVNGELINLYRVVQHHLEEFV-------RQF--------KW-ALTSRQVFEWLKLTVPETLTDIQRAARFYYLQKSCFGGKLEGQTFGTATTT------PPGLNLLRIEEELSAAHLRLANTFVERLDWTTCIDRYDRPHTLFYLDPPY 179
>gi|86149184|ref|ZP_01067416.1| DNA adenine methylase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85840542|gb|EAQ57799.1| DNA adenine methylase [Campylobacter jejuni subsp. jejuni CF93-6] (326 aa)
Score = 171, Expect = 1.9e-10, Identities = 92/307 (29%), Positives = 133/307 (43%)
  Q:    42 LRQKVEINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFD-VLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPK-ICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           L+    I      +K    WVGGK  L  EI    P H +    Y E F G  +V +    SK EV    I+DIN ELIN++  I+ K + L  VL  M                +I +  F+ LK KE     D+E+AA   +L  T F          +   +M   + PK +C   +L   +K+LKN +I    ++   +  D N    Y DPPY     T ++   N   F  +  + L    N L N   K +LS +D +          E+Y  +NIK +K +  +N++   R E  ELLI NF
  S:    64 LKTSTLIKPTRTTLKAPFAWVGGKNYLAKEIIALMPEHKS----YIEVFGGALSVFYQKSASKIEV----INDINDELINLHLCIRNKPQSLANVLNSM----------------IISRKIFHMLKNKEIKPRNDLERAAFYFYLISTSFG-------SSMGQFAMSKQRAPKRLCRDFSLH--TKRLKNASIENKSFEYILKEYDYNEALFYLDPPY---VGTENYYK-NTGGFGLKEHELLC---NLLKNIKGKFMLSYNDCE-------LIRELYKDFNIKELKVRYSLNNNVLKRKESKELLIMNF 326
>gi|145637375|ref|ZP_01793035.1| DNA adenine methylase [Haemophilus influenzae PittHH] >gi|145269467|gb|EDK09410.1| DNA adenine methylase [Haemophilus influenzae PittHH] (141 aa)
Score = 171, Expect = 2.2e-10, Identities = 40/109 (36%), Positives = 60/109 (55%)
  Q:   236 DYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNN-KGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           D++K+ EF DK++ +Y DPPY P+   ++FT Y  + F    Q+ LAD    +   K   IL+SN D K       F  EIY+    KRVK +R I+ +   R ++ EL+
  S:    32 DFQKTFEFADKDSVIYCDPPYAPLQQETNFTGYAGNEFGLMQQRALADLAKSIQKEKQIPILISNHDTK-------FTREIYNGAKFKRVKVQRSISQNPEKRVKVKELI 134
>gi|177664314|ref|ZP_02940117.1| D12 class N6 adenine-specific DNA methyltransferase [Cyanothece sp. PCC 8801] >gi|172076995|gb|EDT62406.1| D12 class N6 adenine-specific DNA methyltransferase [Cyanothece sp. PCC 8801] (306 aa)
Score = 171, Expect = 2.2e-10, Identities = 65/234 (27%), Positives = 109/234 (46%)
  Q:    38 RILSLRQKVEINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKD 271
           +++  R K + N N  ++K  L++ GGK++ + +I +  P        Y EPFVGGG+V   +   Y    I+I+D+N E+   + + + ++KEL+  L+ ++       TD R+         F EL         D+E+A     LN+  F+G   +   G    S          D   LE++   LK++ I   DY +  +   K+ F++ DPPY   T+T S   Y KD
  S:     6 KVMIARSKNKSNKN-NLIKSPLRYPGGKSRAIKQISEQLP---QTFLDYREPFVGGGSVFIYLKQIYPNLTIWINDLNPEVYLFWKIAQSELKELVTALRKIKSTC----TDGRQL--------FEELTSVNVQDLSDLERAVRFFVLNRITFSG--TIESGGFSQQSFLTRFTDSSID--RLESLQTILKDIKITNLDYSEVIQTQGKDVFIFLDPPY--FTATKS-KLYGKD 216
>gi|32265737|ref|NP_859769.1| DNA adenine methylase [Helicobacter hepaticus ATCC 51449] >gi|32261785|gb|AAP76835.1| DNA adenine methylase [Helicobacter hepaticus ATCC 51449] (286 aa)
Score = 170, Expect = 2.3e-10, Identities = 78/297 (26%), Positives = 135/297 (45%)
  Q:    51 NLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKV--KELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSM----GHYKNPKICDTLN-LEAISKKLKNVNIVYG--DYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISN 347
           +L+ + P LK  G K++++  I+  +   N +   Y EPF+G G V F++  K  +     SD N  +I  Y  I+  V  K+        E D L +   +   +YL  + RFN+     D            +FLN++CFNGL R N KG FNV        +    I    N ++A+++ +++ +  +   D+    +   KN F+Y DPPY            + D FN  ++    +    L N   + LLS     N  + + + +E ++ + +K ++    + +   +R  I E LI N
  S:     6 SLKTLIPPLKIQGIKSKIIPHIRDIFQTWNKK-GIYFEPFMGSGVVGFNLAPKRAI----FSDNNPHIIAFYQAIQQGVITKDSARKYLQYEGDILQKVGQE---HYLKVRERFNQTHSPFD-----------FLFLNRSCFNGLMRFNSKGRFNVPYCKKDARFSAAYITKITNQIDAVARLIQHSDYEFRICDFSLVLQEAKKNDFIYCDPPY---------IDRHSDYFNAWSESNERELYKILKNTKAQFLLSTWH-SNVYRQNQYMNEYWNNFKLKLIEHFYHLGASEVNRHTIKEALIQN 282
>gi|148284055|ref|YP_001248145.1| site-specific DNA adenine methylase [Orientia tsutsugamushi str. Boryong] >gi|148284362|ref|YP_001248452.1| site-specific DNA adenine methylase [Orientia tsutsugamushi str. Boryong] >gi|146739494|emb|CAM79192.1| site-specific DNA adenine methylase [Orientia tsutsugamushi Boryong] >gi|146739801|emb|CAM79682.1| site-specific DNA adenine methylase [Orientia tsutsugamushi Boryong] (198 aa)
Score = 169, Expect = 3.0e-10, Identities = 58/172 (33%), Positives = 84/172 (48%)
  Q:   177 EKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFID--KNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           E  A  I+LNK  F G+YRV K G    +       K+     +   S  L  V+I    Y     FI+  K  FVYFDPPY      S    Y +  F++++Q  L D++ +L NKG KI++SN+       N +F  ++Y  +NI  V     IN     R  +NEL+I+N+
  S:    39 EITAKFIYLNKYSFRGIYRVYKNGQSAQTFSGECYIKLHIASRINQCSSLLHGVSI----YATYFSFIEPKKGDFVYFDPPYH----KSGERFYTRLPFDEKDQIRLRDFVQELTNKGVKIMISNN-------NTAFIRDLYKDFNINTVTVVYSIN---EQRNPVNELIITNY 194
>gi|168717082|ref|ZP_02749359.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4206] (146 aa)
Score = 169, Expect = 3.1e-10, Identities = 43/138 (31%), Positives = 68/138 (49%)
  Q:   207 GHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELL 344
           G YK P   +   L   ++K +N       Y  S    D  + VY DPPY P+++T++FTAY+ + F  + Q  LA+    L  +   +L+SN D            E Y    +  VK +R I+S+G +R +++ELL
  S:     4 GRYKKPYFPEA-ELYHFAEKAQNAFFYCESYADSMARADDASVVYCDPPYAPLSATANFTAYHTNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTM-------LTREWYQRAKLHVVKVRRSISSNGGTRKKVDELL 133
>gi|168210863|ref|ZP_02636488.1| DNA adenine-specific methyltransferase [Clostridium perfringens B str. ATCC 3626] >gi|168211970|ref|ZP_02637595.1| DNA adenine-specific methyltransferase [Clostridium perfringens B str. ATCC 3626] >gi|168212178|ref|ZP_02637803.1| DNA adenine-specific methyltransferase [Clostridium perfringens B str. ATCC 3626] >gi|182625454|ref|ZP_02953226.1| DNA adenine-specific methyltransferase [Clostridium perfringens D str. JGS1721] >gi|170709941|gb|EDT22123.1| DNA adenine-specific methyltransferase [Clostridium perfringens B str. ATCC 3626] >gi|170710106|gb|EDT22288.1| DNA adenine-specific methyltransferase [Clostridium perfringens B str. ATCC 3626] >gi|170711082|gb|EDT23264.1| DNA adenine-specific methyltransferase [Clostridium perfringens B str. ATCC 3626] >gi|177909294|gb|EDT71752.1| DNA adenine-specific methyltransferase [Clostridium perfringens D str. JGS1721] (254 aa)
Score = 169, Expect = 3.1e-10, Identities = 82/295 (27%), Positives = 130/295 (44%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++KP +  +GGK++L  EI K  P H      Y EPF G G V F    K + K   I+DI  E+ N++ +IKY   E+  +L                 Y +  ++ F+E K        D+++A   ++L    F G     +   +        + KI D  NL+ + ++LKN  I   D++K  E  D+  T  + DPPY         TA  K  F  + Q +L D +   N KG  IL  N    + ++  S+    Y  +NIK V+    ++     R    EL+I+N+
  S:     5 MLKPPITRLGGKSKLRKEIIKMMPDH----VCYVEPFFGAGWVYF---GKEKSKIEVINDIENEIPNLFKIIKYHAPEMKRLLS----------------YEISGRSIFDEYKNATLEHLTDIQRAIRFMYLITQSFGG-----QGNHYGYGTNTLPSQKIFDC-NLDELQERLKNTYIENLDFQKIIEKYDREYTLFFLDPPYYG-------TAGYKAEFGIKEQLKLRDILK--NIKGKFILTIN----DCEETRSW----YKDFNIKEVEVPYSVSRQTEGRKRNKELIITNY 254
>gi|166367877|ref|YP_001660150.1| adenine-specific DNA metylase [Microcystis aeruginosa NIES-843] >gi|166090250|dbj|BAG04958.1| adenine-specific DNA metylase [Microcystis aeruginosa NIES-843] (310 aa)
Score = 169, Expect = 3.1e-10, Identities = 71/294 (24%), Positives = 136/294 (46%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIV--------YGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSA--YNIKRVKAKRMINSDGSSRGEINELLISNFDI 350
           P +K  G KT+L+ ++K      +    ++ EPF G G V F++      K+  ++D N  +I  Y+ +K +V     V   ++++  +       +YY +++ RFN+     D            +FLN++CFNG+ R N+KG FNV   H K+ +       + +++ +   NI+          D++++     K   +Y DPPY            + D FN  ++++    +  L +   + +LS     N  +++    + +SA  + I   +    + S    R  I E +I+NF+I
  S:     8 PPIKCQGIKTKLVKDVKNI--VSDLSFGRWIEPFSGSGVVAFNI----NPKKALLADTNTHIIQFYNNLKNQVITSKTVKLFLQENGQVLKDQGESYYYQVRE-RFNQSPNSLD-----------FLFLNRSCFNGVMRFNRKGQFNVPYCH-KSERFSQAYITKIVNQVIAIENILIKTDYDFQVADFRETLSDWQKTDLIYLDPPY---------LGRHTDYFNSWSEEDEDCLVTILKDISCRFILSTWH-SNQFRSNPLIKKNWSADKFYIYTKQHFYHVGSTEKLRHPITEAIITNFNI 282
>gi|85058990|ref|YP_454692.1| putative phage DNA adenine methylase [Sodalis glossinidius str. 'morsitans'] >gi|84779510|dbj|BAE74287.1| putative phage DNA adenine methylase [Sodalis glossinidius str. 'morsitans'] (191 aa)
Score = 169, Expect = 3.4e-10, Identities = 51/168 (30%), Positives = 77/168 (45%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE 221
           V  P + WVGGK +L+ +I  ++P H      Y EPF GG A+ F   SK   KE   +DIN EL+N+Y V+K  ++E +       + F        KW  L  +  F   ++   +   D+++AA   +L +  F G  R    G    S      P+  + L LE
  S:     6 VSSPMIPWVGGKRRLIKQILPHFPAHQC----YVEPFCGGAALFF---SKSPSKEEVRNDINGELMNLYRVVKVHLEEFM-------RQF--------KW-ALSSRQLFEWHQQTPPHTLSDIQRAARFYYLQQLAFGGRVRGQSFGTATTS------PRRFNLLRLE 144
>gi|156147139|gb|ABU53723.1| cje0220 [Campylobacter phage CGC-2007] >gi|156147156|gb|ABU53739.1| cje0220 [Campylobacter phage CGC-2007] >gi|156147173|gb|ABU53755.1| cje0220 [Campylobacter phage CGC-2007] (306 aa)
Score = 168, Expect = 4.3e-10, Identities = 90/294 (30%), Positives = 130/294 (44%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFD-VLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPK-ICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +K    WVGGK  L  EI    P H +    Y E F G  +V +    SK EV    I+DIN ELIN++  I+ K + L  VL  M                +I +  F+ LK KE     D+E+AA   +L  T F          +   +M   + PK +C   +L   +K+LKN +I    ++   +  D N    Y DPPY     T ++   N   F  +  + L    N L N   K +LS +D +          E+Y  +N K +K +  +N++ S R E  ELLI NF
  S:    57 LKAPFAWVGGKNYLAKEIIALMPEHKS----YIEVFGGALSVFYQKSASKIEV----INDINDELINLHLCIRNKPQSLANVLNSM----------------IISRKIFHMLKNKEIKPRNDLERAAFYFYLISTSFG-------SSMGQFAMSKQRAPKRLCRDFSLH--TKRLKNASIENKSFEYILKEYDYNEALFYLDPPY---VGTENYYK-NTGGFGLKEHELLC---NLLKNIKGKFMLSYNDCE-------LIRELYKDFNFKELKVRYSLNNNVSKRKESKELLIINF 306
>gi|156147244|gb|ABU53822.1| cje0220 [Campylobacter phage CGC-2007] (326 aa)
Score = 168, Expect = 4.8e-10, Identities = 90/294 (30%), Positives = 130/294 (44%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFD-VLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPK-ICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +K    WVGGK  L  EI    P H +    Y E F G  +V +    SK EV    I+DIN ELIN++  I+ K + L  VL  M                +I +  F+ LK KE     D+E+AA   +L  T F          +   +M   + PK +C   +L   +K+LKN +I    ++   +  D N    Y DPPY     T ++   N   F  +  + L    N L N   K +LS +D +          E+Y  +NIK +K +  +N++   R E  ELLI NF
  S:    77 LKAPFAWVGGKNYLAKEIIALMPEHKS----YIEVFGGALSVFYQKSASKIEV----INDINDELINLHLCIRNKPQSLANVLNSM----------------IISRKIFHMLKNKEIKPKNDLERAAFYFYLISTSFG-------SSMGQFAMSKQRAPKRLCRDFSLH--TKRLKNASIENKSFEYILKEYDYNEALFYLDPPY---VGTENYYK-NTGGFGLKEHELLC---NLLKNIKGKFMLSYNDCE-------LIRELYKDFNIKELKIRYSLNNNVLKRKESKELLIMNF 326
>gi|118575822|ref|YP_875565.1| site-specific DNA methylase [Cenarchaeum symbiosum A] >gi|118194343|gb|ABK77261.1| site-specific DNA methylase [Cenarchaeum symbiosum A] (289 aa)
Score = 167, Expect = 6.0e-10, Identities = 65/262 (24%), Positives = 117/262 (44%)
  Q:    85 KYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSM----GHYKNPKICDTLN-LEAISKKLKNVNIVY--GDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLIS 346
           ++ EPF+G G VLF++    +      SD N  +   Y  I         V + +EK+      +   +YY I+ +RFN   +  D            +FLN+  FNGL R N KG +N       G +    I   +N + A+ + +++    +   D++ + E +  N F Y DPPY            + + ++  ++ ++AD    L ++GT+  LS        +ND+  D  +S + I + +    + S  + R  + E LI+
  S:    46 RWFEPFLGSGVVLFNI----QPGRAAASDHNPHIAGFYQGISRGTITHHAVRRYLEKEGQRLAKEGGAYYYEIR-DRFNSSHDPLD-----------FLFLNRAGFNGLVRFNSKGGYNTPFCKKPGRFSKAYITKIVNQVYAVERLIRDNKWCFETADWRGALEGMRDNDFAYLDPPY---------YGRHANYYDTWSESDMADLAGFLIDRGTRFALSLWYENKYRRNDT-IDRYFSGFAIHKHEHFYHLGSTENLRNSMVEALIT 288
>gi|156147207|gb|ABU53787.1| cje0220 [Campylobacter phage CGC-2007] (306 aa)
Score = 167, Expect = 6.0e-10, Identities = 90/294 (30%), Positives = 130/294 (44%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFD-VLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPK-ICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +K    WVGGK  L  EI    P H +    Y E F G  +V +    SK EV    I+DIN ELIN++  I+ K + L  VL  M                +I +  F+ LK KE     D+E+AA   +L  T F          +   +M   + PK +C   +L   +K+LKN +I    ++   +  D N    Y DPPY     T ++   N   F  +  + L    N L N   K +LS +D +          E+Y  +NIK +K +  +N++   R E  ELLI NF
  S:    57 LKAPFAWVGGKNYLAKEIIALMPEHKS----YIEVFGGALSVFYQKSASKIEV----INDINDELINLHLCIRNKPQSLANVLNSM----------------IISRKIFHMLKNKEIKPRNDLERAAFYFYLISTSFG-------SSMGQFAMSKQRAPKRLCRDFSLH--TKRLKNASIENKSFEYILKEYDYNEALFYLDPPY---VGTENYYK-NTGGFGLKEHELLC---NLLKNIKGKFMLSYNDCE-------LIRELYKDFNIKELKVRYSLNNNVLKRKESKELLIMNF 306
>gi|156147278|gb|ABU53854.1| cje0220 [Campylobacter phage CGC-2007] (306 aa)
Score = 166, Expect = 7.8e-10, Identities = 90/294 (30%), Positives = 130/294 (44%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFD-VLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPK-ICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +K    WVGGK  L  EI    P H +    Y E F G  +V +    SK EV    I+DIN ELIN++  I+ K + L  VL  M                +I +  F+ LK KE     D+E+AA   +L  T F          +   +M   + PK +C   +L   +K+LKN +I    ++   +  D N    Y DPPY     T ++   N   F  +  + L    N L N   K +LS +D +          E+Y  +NIK +K +  +N++   R E  ELLI NF
  S:    57 LKAPFAWVGGKNYLAKEIIALMPEHKS----YIEVFGGALSVFYQKSASKIEV----INDINDELINLHLCIRNKPQSLANVLNSM----------------IISRKIFHMLKNKEIKPRNDLERAAFYFYLISTSFG-------SSMGQFAMSKQRAPKRLCRDFSLH--TKRLKNASIENKSFEYILKEYDYNEALFYLDPPY---VGTENYYK-NTGGFGLKEHELLC---NLLKNIKGKFMLSYNDCE-------LIRELYKDFNIKELKVRYSLNNNVLKRKESKELLIINF 306
>gi|119509651|ref|ZP_01628797.1| D12 class N6 adenine-specific DNA methyltransferase [Nodularia spumigena CCY9414] >gi|119465670|gb|EAW46561.1| D12 class N6 adenine-specific DNA methyltransferase [Nodularia spumigena CCY9414] (278 aa)
Score = 165, Expect = 9.3e-10, Identities = 77/300 (25%), Positives = 128/300 (42%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK-------NVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKN--DSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDINKK 353
           ++K  L++ GGK++ + +I +  P   +  +++ EPFVGGG+V   +  K+   +I+I+D+N EL   +   K  + +L+           +R+  D+   Y   K  F EL   +     D E+AA    LN+  F+G           V  G Y            +I +  K       +V I   DY +  +   KN F++ DPPY   T  S     + DL      +  A+ + + +++    L++  D     +N  DS   E    Y         M N    S  +  EL ISNF  N +
  S:     1 MIKSPLRYPGGKSRAIKQIAENLP---DSFSEFREPFVGGGSVFIYLKQKFPHLKIWINDLNRELFLFWKYAKSDLPQLVEE---------IRHVKDK---YTDGKILFKELTSIDTKTLSDFERAARFFILNRITFSG----------TVESGGYSEQAFQKRFTYSSIERLEKLAEILTDDVKITNLDYSQLLDAEGKNVFIFLDPPYFAATK-SRLYGKDGDLHTTFEHQRFAELLRECHHRW---LITYDDSPQIRENFPDSHLWEWELQYG--------MNNYKQGSAAKGKELFISNFAKNHQ 272
>gi|110004524|emb|CAK98861.1| hypothetical dna methylase c-terminal truncated protein [Spiroplasma citri] (88 aa)
Score = 165, Expect = 9.9e-10, Identities = 39/88 (44%), Positives = 60/88 (68%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKD 142
           +KPFLKWVGGKTQL+NEIKK  P    +  +Y EPF+G G++  ++ +   +K + I+DI++ELIN Y  ++   ++LI +L   EK+
  S:     3 IKPFLKWVGGKTQLINEIKKRMP---KEFNRYFEPFIGWGSLFINIHNNKNIKSV-INDISSELINSYKAVQTNPEKLIKLLNEHEKN 86
>gi|168211930|ref|ZP_02637555.1| DNA adenine-specific methyltransferase [Clostridium perfringens B str. ATCC 3626] >gi|170710131|gb|EDT22313.1| DNA adenine-specific methyltransferase [Clostridium perfringens B str. ATCC 3626] (254 aa)
Score = 165, Expect = 1.1e-09, Identities = 81/295 (27%), Positives = 128/295 (43%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++KP +  +GGK++L  EI    P H      Y EPF G G V F    K + K   I+DI  E+ N++ +IKY   E+  +L                 Y +  ++ F+E K        D+++A   ++L    F G     +   +        + KI D  NL  + ++LKN  I   D++K  E  D+  T  + DPPY         TA  K  F  + Q +L D +   N KG  IL  N    + ++  S+    Y  +NIK V+    ++     R    EL+I+N+
  S:     5 MLKPPITRLGGKSKLRKEIISMMPAH----VCYVEPFFGAGWVYF---GKSKSKIEVINDIENEIPNLFKIIKYHAPEMKRLLS----------------YEISGRSIFDEYKNTTLEHLTDIQRAIRFMYLITQSFGG-----QGNHYGYGTNTLPSQKIFDC-NLGELQERLKNTYIENLDFQKIIEKYDREYTLFFLDPPYYG-------TAGYKAEFGIKEQLKLRDILK--NIKGKFILTIN----DCEETRSW----YKDFNIKEVEVPYSVSRQTEGRKRNKELIITNY 254
>gi|86559608|ref|YP_473428.1| adenine methyltransferase [Clostridium perfringens] >gi|168206698|ref|ZP_02632703.1| adenine methyltransferase [Clostridium perfringens E str. JGS1987] >gi|86475880|dbj|BAE79055.1| adenine methyltransferase [Clostridium perfringens] >gi|170661922|gb|EDT14605.1| adenine methyltransferase [Clostridium perfringens E str. JGS1987] (254 aa)
Score = 165, Expect = 1.1e-09, Identities = 79/295 (26%), Positives = 128/295 (43%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++KP +  +GGK++L  EI    P H      Y EPF G G V F    K + K   I+DI  E+ N++ +IKY   E+  +L                 Y +  ++ F+E K        D+++A   ++L    F G     +   +        + KI D  NL+ + ++LKN  I   D++K  E  D+  T  + DPPY     T+ + A     F  + Q +L D    L N   K +L+ +D K +          Y  +NIK V+    ++     R    EL+I+N+
  S:     5 MLKPPITRLGGKSKLRKEIISMMPDH----VCYVEPFFGAGWVYF---GKEKSKIEVINDIENEIPNLFKIIKYHAPEMKRLLS----------------YEISGRSIFDEYKNATLEHLTDIQRAIRFMYLITQSFGG-----QGNHYGYGTNTLPSQKIFDC-NLDELQERLKNTYIENLDFQKIIEKYDREYTLFFLDPPY---YGTAGYEAK----FGIKEQLKLRDI---LKNIKGKFILTINDCKET-------RSWYKDFNIKEVEVHYSVSRQSEGRKRNKELIITNY 254
>gi|168214549|ref|ZP_02640174.1| DNA adenine-specific methyltransferase [Clostridium perfringens CPE str. F4969] >gi|170713959|gb|EDT26141.1| DNA adenine-specific methyltransferase [Clostridium perfringens CPE str. F4969] (259 aa)
Score = 164, Expect = 1.1e-09, Identities = 80/300 (26%), Positives = 129/300 (43%)
  Q:    49 NNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           + N +++KP +  +GGK++L   I +  P H    T Y E F G G V F    K   K   I+D++ ELIN++ +IKY   E+  +L+                Y    ++ F E K        ++++A   ++L    F G     K   +        +P+I     L  I  +L+N  +    ++K  E  D+  +F + DPPY         TA     F ++    L D +   N KG  ++  N  PK          E Y  +NIK VK    +++  S+R E  EL+I+NF
  S:     4 DKNGKMMKPPITRMGGKSKLRKTIIENIPEH----TCYIELFFGAGWVYF---GKEPSKVEVINDVDKELINLFKMIKYHAPEIERMLE----------------YEFSGRDIFEEYKNVTLEHLTEIQRAVRFLYLISQSFAG-----KGNHYGYGTNTKPSPQIFYKGVLGDIKNRLRNTYVENLSFEKIIEKYDREYSFFFCDPPYFE-------TAGYGTEFGEKEHLLLRDKLK--NIKGKFLVTINDHPK--------VREWYKDFNIKEVKVMYSVSNQASARKEYGELIITNF 259
>gi|167769237|ref|ZP_02441290.1| hypothetical protein ANACOL_00560 [Anaerotruncus colihominis DSM 17241] >gi|167668877|gb|EDS13007.1| hypothetical protein ANACOL_00560 [Anaerotruncus colihominis DSM 17241] (252 aa)
Score = 164, Expect = 1.3e-09, Identities = 71/294 (24%), Positives = 121/294 (41%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCF---NGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFID-KNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +K  + W+GGK  L   I + +P    +  +Y E F G   VLF         E+Y +DIN+ L N++  +KY   EL   L+               W    ++  F+ L +       D+++AA   +  K  F   N  Y    K + N              + +E I ++L+ VNI   D++   +  D ++   Y DPPY           Y +  F  Q+   L   ++++  KG  IL  N  P           E+Y+   I+ +     ++  G+++ +  EL+I NF
  S:     1 MKSLIGWIGGKRALCKAILERFP--TEETGRYIEVFGGAAWVLFAREKIPGQLEVY-NDINSNLTNLFRCVKYHCGELQRELE---------------WMLTSREQFFDCLNQLHIRGLTDIQRAARFFYTIKISFGSDNRTYATGSKSIDNA------------VVYMEKIQERLRGVNIENKDFEDLIKVYDRRDALFYLDPPY------IGAEKYYESPFYMQDHHRLKSVLSQI--KGRFILSYNDHP--------LVHEMYAGSRIEGITRPSTLSGSGNNQTQYAELIIRNF 252
>gi|127451|sp|P14871|MTF1_FLAOK Modification methylase FokI (M.FokI) (Adenine-specific methyltransferase FokI) >gi|148706|gb|AAA24926.1| methylase (MFokI) (647 aa)
Score = 164, Expect = 1.4e-09, Identities = 87/319 (27%), Positives = 157/319 (49%)
  Q:    30 LSKYIFG-TRILSLRQKVEINNNLQV--------VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVI-KYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYK---NPKICDTLNLEAISKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDL--FNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           L +YIF   + ++L   V+ N  ++V        +K  L +VGGK +LLN+I   +P   ++I  + + F GG    F+V       +I  +DIN  ++ V   + K  V+E+I  ++   +++ L  +++  +     +N +N+ K+  D           +  L    FN  +R N    +N   G  +   +P +   L L   +   KNV  V  +++  +   +D+N  VY DPPY  + +T S+   N+    +N   + +L D ++ LN+KG    LSN       +N+    E    YNI  ++     +S  ++RGE  E+LI+N+
  S:   331 LHEYIFYIQKDIALTNSVKSNKKIEVGKHKTNSYIKSPLNYVGGKHKLLNQIVPLFP---DKIDTFVDLFSGG----FNVGINVNANKIIATDINTYVVEVLDTMKKTSVEEVIAHIERRIEEYGLSKSNEEGFKAF--RNYYNKTKKPLD-----------LYTLICYSFNYQFRFNNNQEYNNPFGRERSQFSPALKKKLVLFIEALHEKNVQFVCSEFEHFNFSQLDQNDLVYCDPPY--LITTGSYNDGNRGFKDWNRLQEIKLLDILDHLNSKGVYFALSNVLSHKGLENELLL-EWSKKYNIHHLQHSYSNSSHNTTRGESQEVLITNY 642
>gi|148724|gb|AAA24933.1| methyltransferase (647 aa)
Score = 164, Expect = 1.4e-09, Identities = 87/319 (27%), Positives = 157/319 (49%)
  Q:    30 LSKYIFG-TRILSLRQKVEINNNLQV--------VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVI-KYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYK---NPKICDTLNLEAISKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDL--FNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           L +YIF   + ++L   V+ N  ++V        +K  L +VGGK +LLN+I   +P   ++I  + + F GG    F+V       +I  +DIN  ++ V   + K  V+E+I  ++   +++ L  +++  +     +N +N+ K+  D           +  L    FN  +R N    +N   G  +   +P +   L L   +   KNV  V  +++  +   +D+N  VY DPPY  + +T S+   N+    +N   + +L D ++ LN+KG    LSN       +N+    E    YNI  ++     +S  ++RGE  E+LI+N+
  S:   331 LHEYIFYIQKDIALTNSVKSNKKIEVGKHKTNSYIKSPLNYVGGKHKLLNQIVPLFP---DKIDTFVDLFSGG----FNVGINVNANKIIATDINTYVVEVLDTMKKTSVEEVIAHIERRIEEYGLSKSNEEGFKAF--RNYYNKTKKPLD-----------LYTLICYSFNYQFRFNNNQEYNNPFGRERSQFSPALKKKLVLFIEALHEKNVQFVCSEFEHFNFSQLDQNDLVYCDPPY--LITTGSYNDGNRGFKDWNRLQEIKLLDILDHLNSKGVYFALSNVLSHKGLENELLL-EWSKKYNIHHLQHSYSNSSHNTTRGESQEVLITNY 642
>gi|118050406|ref|ZP_01518956.1| D12 class N6 adenine-specific DNA methyltransferase [Comamonas testosteroni KF-1] >gi|118002492|gb|EAV16646.1| D12 class N6 adenine-specific DNA methyltransferase [Comamonas testosteroni KF-1] (263 aa)
Score = 163, Expect = 1.6e-09, Identities = 50/203 (24%), Positives = 92/203 (45%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKS-------EEFIDKNTFVYFDPPY 256
           +  P + W+GGK +L++ + K +P H+     Y E F GG AV F   +++      ++D+N +L+N+Y V+ + ++E +       + F        KW  L  +  F  L++       D+++AA   +L +  F G           VS   +        +NL  I + L   ++ +  G Y +        + +   +T  Y DPPY
  S:     1 MTNPIIPWIGGKRRLVDMLLKRFPAHDC----YVEVFAGGAAVYF---ARHPADVEVLNDVNGDLVNLYRVVTHHLEEFV-------RQF--------KW-ALTSRQVFKWLQDTRPETLTDIQRAARFFYLQQQSFGG----------KVSGQTFGTATTAPAINLLRIEENLSAAHLRMAAGTYIEQLDWASCMDRYDRAHTLFYMDPPY 179
>gi|169342457|ref|ZP_02863518.1| DNA adenine-specific methyltransferase [Clostridium perfringens C str. JGS1495] >gi|169299456|gb|EDS81521.1| DNA adenine-specific methyltransferase [Clostridium perfringens C str. JGS1495] (254 aa)
Score = 163, Expect = 1.7e-09, Identities = 80/295 (27%), Positives = 130/295 (44%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++KP +  +GGK++L  EI    P H      Y EPF G G V F    K + K   I+DI  E+ N++ +IKY   E+  +L                 Y +  ++ F+E K        D+++A   ++L    F G     +   +        + KI D  NL+ + ++LKN  I   D++K  E  D+  T  + DPPY     T+ + A     F  + Q +L D +   N KG  IL  N    + ++  S+    Y  +NIK V+    ++     R    EL+I+N+
  S:     5 MLKPPITRLGGKSKLRKEIINMMPDH----VCYVEPFFGAGWVYF---GKEKSKIEVINDIENEIPNLFKIIKYHAPEMKRLLS----------------YEISGRSIFDEYKNATLEHLTDIQRAIRFMYLITQSFGG-----QGNHYGYGTNTLPSQKIFDC-NLDELQERLKNTYIENLDFQKIIEKYDREYTLFFLDPPY---YGTAGYEAE----FGIKEQLKLRDILK--NIKGKFILTIN----DCEETRSW----YKDFNIKEVEVHYSVSRQSEGRKRNKELIITNY 254
>gi|156147225|gb|ABU53804.1| cje0220 [Campylobacter phage CGC-2007] >gi|156147262|gb|ABU53839.1| cje0220 [Campylobacter phage CGC-2007] (326 aa)
Score = 163, Expect = 1.7e-09, Identities = 89/294 (30%), Positives = 126/294 (42%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFD-VLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +K    WVGGK  L  EI    P H +    Y E F G  +V +    SK EV    I+DIN ELIN++  I+ K + L  VL  M                +I +  F+ LK KE     D+E+AA   +L  T F          +   +M   + PK     +    +K+LKN +I    ++   +  D N    Y DPPY     T S+   N   F  +  + L D    L N   K +LS +D            E+Y  +NIK +K +  +N++   R E  ELLI NF
  S:    77 LKAPFAWVGGKNYLAKEIIALMPEHKS----YIEVFGGALSVFYQKSASKIEV----INDINDELINLHLCIRNKPQSLANVLNSM----------------IISRKIFHMLKNKEIKPKNDLERAAFYFYLINTSFG-------SSMGQFAMSKQRAPKRL-YRDFSLHTKRLKNASIENKSFEYILKEYDYNEALFYLDPPY---VGTESYYK-NVPCFGLKEHELLCDL---LKNIKGKFMLSYNDC-------DLVRELYKDFNIKELKVRYSLNNNVLKRKESKELLIMNF 326
>gi|153871002|ref|ZP_02000279.1| DNA adenine methylase [Beggiatoa sp. PS] >gi|152072532|gb|EDN69721.1| DNA adenine methylase [Beggiatoa sp. PS] (290 aa)
Score = 163, Expect = 1.8e-09, Identities = 76/300 (25%), Positives = 136/300 (45%)
  Q:    52 LQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYK--VKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSM----GHYKNPKICDTLN-LEAISKKLKNVNIVYG--DYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDIN 351
           ++V  P +K  G KT+L+  I    P   N   ++ EPF+G G V F++ S++ V    + D N  LI+ Y  I     V E +      E   LL   +    YY   ++RFN+  +  D            +FLN+  FNG+ R N+KG FN+        +    I   +N ++ ++K LK  N ++   D+KK+ +       +Y DPPY            + D +N  N ++       L+   ++ +LS     +  +N++     ++ +NI   +    +     +R  + E L++N+ I+
  S:     1 MKVNIPPIKSQGIKTKLVPSISDTVP--KNFKGRWIEPFMGTGVVAFNLASQHAV----LCDTNPHLIHFYQAINDGEIVSERVRQFLNHEGAKLLEKGES---YYYEVRDRFNQKHKPLD-----------FLFLNRAGFNGMIRFNRKGQFNIPFCRKPQRFAQAYITKIVNQVDYVAKLLKRKNFLFKCQDFKKTIQLGTAQDIIYCDPPY---------IDRHVDYYNGWNHEDEKALFQVLSQSPSRFILSTWHHNDYRENEA-IKTYWNQFNILTREHFYHVGGSEKNRNPMIEALVTNYPIS 279
>gi|27764618|ref|NP_776240.1| SsmT [Corynebacterium glutamicum] >gi|27657789|gb|AAO18217.1| SsmT [Corynebacterium glutamicum] (297 aa)
Score = 162, Expect = 1.9e-09, Identities = 72/284 (25%), Positives = 116/284 (40%)
  Q:    56 KPF----LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKK--GLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQ--NQKELADYINKLNNKGTKILLSNSDPKNSDKND---SFFDEIYS---AYNIKRVKAKRMINSDGSSRGE 339
           KPF    LKWVG K ++ +EI  ++P        Y EPF+G  AVL  +     V     SD+ A LI ++ ++    + +I       +   +   +D+K  Y      FNE +  ED            +FL++ C+ G+ R  K   G+      H           +E   +++K       D+++      K   +Y DPPY             K L+  Q  N  +L   I+    +G +I LS    K    ++    F D+++    A N+ R    R      S  GE
  S:     9 KPFRTQLLKWVGNKQRMASEIVSFFP---KNYDTYFEPFLGSAAVLGTLAPHKAVG----SDVLAPLIGIWQLVSEDPERIIAAYAAHRER--IDAGEDKKKVYAEALASFNETRRPED-----------FVFLSRACYGGIIRFRKDDGGMSTPCGAHMPVSSESFAKRVEIWRERIKGTEFRTADFREIFPEAGKGDMIYCDPPY---------VDTQKILYGAQEFNLADLVKEISSAKERGARIALSIDGTKRGGLHEILHDFPDDLFETEVAINVGRSMLLRFQKEGQSLHGE 277
>gi|168207116|ref|ZP_02633121.1| DNA adenine-specific methyltransferase [Clostridium perfringens E str. JGS1987] >gi|170661516|gb|EDT14199.1| DNA adenine-specific methyltransferase [Clostridium perfringens E str. JGS1987] (254 aa)
Score = 162, Expect = 1.9e-09, Identities = 80/295 (27%), Positives = 130/295 (44%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++KP +  +GGK++L  EI    P H      Y EPF G G V F    K + K   I+DI  E+ N++ +IKY   E+  +L                 Y +  ++ F+E K        D+++A   ++L    F G     +   +        + KI D  NL+ + ++LKN  I   D++K  E  D+  T  + DPPY     T+ + A     F  + Q +L D +   N KG  IL  N    + ++  S+    Y  +NIK V+    ++     R    EL+I+N+
  S:     5 MLKPPITRLGGKSKLRKEIISMMPDH----VCYVEPFFGAGWVYF---GKEKSKIEVINDIENEIPNLFKIIKYHAPEMKRLLS----------------YEISGRSIFDEYKNATLEHLTDIQRAIRFMYLITQSFGG-----QGNHYGYGTNTLPSQKIFDC-NLDELQERLKNTYIENLDFQKIIEKYDREYTLFFLDPPY---YGTAGYEAE----FGIKEQLKLRDILK--NIKGKFILTIN----DCEETRSW----YKDFNIKEVEVHYSVSRQTEGRKRNKELIITNY 254
>gi|86559554|ref|YP_473375.1| DNA adenine-specific methyltransferase [Clostridium perfringens CPE str. F4969] >gi|168215378|ref|ZP_02641003.1| DNA adenine-specific methyltransferase [Clostridium perfringens CPE str. F4969] >gi|86475826|dbj|BAE79002.1| DNA adenine-specific methyltransferase [Clostridium perfringens] >gi|170713247|gb|EDT25429.1| DNA adenine-specific methyltransferase [Clostridium perfringens CPE str. F4969] (254 aa)
Score = 162, Expect = 2.1e-09, Identities = 80/295 (27%), Positives = 129/295 (43%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++KP +  +GGK++L  EI    P H      Y EPF G G V F    K + K   I+DI  E+ N++ +IKY   E+  +L                 Y +  ++ F E K        D+++A   ++L    F G     +   +        + KI D  NL+ + ++LKN  I   D++K  E  D+  T  + DPPY     T+ + A     F  + Q +L D +   N KG  IL  N    + ++  S+    Y  +NIK V+    ++     R    EL+I+N+
  S:     5 MLKPPITRLGGKSKLRKEIISMMPDH----VCYVEPFFGAGWVYF---GKEKSKIEVINDIENEIPNLFKIIKYHAPEMKRLLA----------------YEISGRSIFEEYKNATLEHLTDIQRAIRFMYLITQSFGG-----QGNHYGYGTNTLPSQKIFDC-NLDELQERLKNTYIENLDFQKIIEKYDREYTLFFLDPPY---YGTAGYEAE----FGIKEQLKLRDILK--NIKGKFILTIN----DCEETRSW----YKDFNIKEVEVHYSVSRQSEGRKRNKELIITNY 254
>gi|169344606|ref|ZP_02865572.1| DNA adenine-specific methyltransferase [Clostridium perfringens C str. JGS1495] >gi|169297216|gb|EDS79328.1| DNA adenine-specific methyltransferase [Clostridium perfringens C str. JGS1495] (254 aa)
Score = 161, Expect = 2.5e-09, Identities = 79/295 (26%), Positives = 126/295 (42%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++KP +  +GGK++L  EI    P H      Y EPF G G V F    K + K   I+DI  E+ N++ +IKY   E+  +L                 Y +  ++ F+E K        D+++A   ++L    F G     +   +        + KI D  NL  + ++LKN  I   D++K  E  D+  T  + DPPY     T+ + A     F  + Q +L D +   N KG  IL  N   +  +         Y  +NIK V+    ++     R    EL+I+N+
  S:     5 MLKPPITRLGGKSKLRKEIISMMPAH----VCYVEPFFGAGWVYF---GKSKSKIEVINDIENEIPNLFKIIKYHAPEMKRLLS----------------YEISGRSIFDEYKNTTLEHLTDIQRAIRFMYLITQSFGG-----QGNHYGYGTNTLPSQKIFDC-NLGELQERLKNTYIENLDFQKIIEKYDREYTLFFLDPPY---YGTAGYEAE----FGIKEQLKLRDILK--NIKGKFILTINDCEETRN--------WYKDFNIKEVEVHYSVSRQSEGRKRNKELIITNY 254
>gi|168205955|ref|ZP_02631960.1| DNA adenine-specific methyltransferase [Clostridium perfringens E str. JGS1987] >gi|170662531|gb|EDT15214.1| DNA adenine-specific methyltransferase [Clostridium perfringens E str. JGS1987] (254 aa)
Score = 161, Expect = 2.6e-09, Identities = 80/295 (27%), Positives = 130/295 (44%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++KP +  +GGK++L  EI    P H      Y EPF G G V F    K + K   I+DI  E+ N++ +IKY   E+  +L                 Y +  ++ F+E K        D+++A   ++L    F G     +   +        + KI D  NL+ + ++LKN  I   D++K  E  D+  T  + DPPY     T+ + A     F  + Q +L D +   N KG  IL  N    + ++  S+    Y  +NIK V+    ++     R    EL+I+N+
  S:     5 MLKPPITRLGGKSKLRKEIISMMPDH----VCYVEPFFGAGWVYF---GKEKSKIEVINDIENEIPNLFKIIKYHAPEMKRLLS----------------YEISGRSIFDEYKNATLEHLTDIQRAIRFMYLITQSFGG-----QGNHYGYGTNTLPSQKIFDC-NLDELQERLKNTYIENLDFQKIIEKYDREYTLFFLDPPY---YGTAGYEAE----FGIKEQLKLRDILK--NIKGKFILTIN----DCEETRSW----YKDFNIKEVEVHYSVSRKTEGRKRNKELIITNY 254
>gi|156147122|gb|ABU53707.1| cje0220 [Campylobacter phage CGC-2007] (326 aa)
Score = 161, Expect = 3.2e-09, Identities = 88/294 (29%), Positives = 129/294 (43%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFD-VLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPK-ICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +K    WVGGK  L  EI    P H +    Y E F G  +V +    SK EV    I+DIN ELIN++  I+ K + L  VL  M                +I +  F+ LK KE     D+E+AA   +L  T F          +   +M   + PK +C   +L   +K+LKN +I    ++   +  D N    Y DPPY     T ++   N   F  +  + L    N L N   K +LS +D +          ++Y  +N K +K +  +N++   R E  ELLI NF
  S:    77 LKAPFAWVGGKNYLAKEIIALMPEHKS----YIEVFGGALSVFYQKSASKIEV----INDINDELINLHLCIRNKPQSLANVLNSM----------------IISRKIFHMLKNKEIKPKNDLERAAFYFYLISTSFG-------SSMGQFAMSKQRAPKRLCRDFSLH--TKRLKNASIENKSFEYILKEYDYNEALFYLDPPY---VGTENYYK-NTGGFGLKEHELLC---NLLKNIKGKFMLSYNDCE-------LIRKLYKDFNFKELKVRYSLNNNVLKRKESKELLIMNF 326
>gi|172035977|ref|YP_001802478.1| cytosine-specific DNA methyltransferase [Cyanothece sp. ATCC 51142] >gi|171697431|gb|ACB50412.1| probable cytosine-specific DNA methyltransferase [Cyanothece sp. ATCC 51142] (285 aa)
Score = 159, Expect = 4.3e-09, Identities = 69/227 (30%), Positives = 114/227 (50%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNR------FNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDT--LNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKD-----LFNDQNQKE 280
           ++K  L++ GGK++ + +I++  P   N  ++Y EPFVGGG+V   +   Y   +I+I+D+N EL   + V +  +K L+           LRN         IKKNR      F EL + +  +  + ++A     LN+  F+G   +   G    S     N +  ++    +E +   L  + I   DY++      +NTF++ DPPY  +T+T S   Y KD     LFN Q+  E
  S:     1 MIKSPLRYPGGKSRAVKQIQEQLP---NNFSEYREPFVGGGSVFIYLKQIYPNIDIWINDLNPELYLFWKVAQSDLKTLVTE---------LRN---------IKKNRKNGRELFTELSQVDVEKISNFDRAVRFFVLNRITFSG--TIESGGYSERSF----NSRFTESSIARVEKLGHILPEIRITNLDYREVINNKCENTFIFLDPPY--LTATKS-KLYGKDGDLHTLFNHQDFAE 210
>gi|190015762|ref|YP_001967767.1| probable site-specific DNA-methyltransferase [Clostridium perfringens] >gi|86450184|gb|ABC96293.1| probable site-specific DNA-methyltransferase [Clostridium perfringens] (254 aa)
Score = 159, Expect = 4.5e-09, Identities = 80/295 (27%), Positives = 129/295 (43%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           ++KP +  +GGK++   EI    P H      Y EPF G G V F    K + K   I+DI  E+ N++ +IKY   E+  +L                 Y +  ++ F+E K        D+++A   ++L    F G     +   +        + KI D  NL+ + ++LKN  I   D+KK  E  D+  T  + DPPY     T+ + A     F  + Q +L D +   N KG  IL  N    + ++  S+    Y  +NIK V+    ++     R    EL+I+N+
  S:     5 MLKPPITRLGGKSKSRKEIISMMPDH----VCYVEPFFGAGWVYF---GKSKSKIEVINDIENEIPNLFKIIKYHAPEMKRLLS----------------YEISGRSIFDEYKNATLEHLTDIQRAIRFMYLITQSFGG-----QGNHYGYGTNTLPSQKIFDC-NLDELQERLKNTYIENLDFKKIIEKYDREYTLFFLDPPY---YGTAGYEAE----FGIKEQLKLRDILK--NIKGKFILTIN----DCEETRSW----YKDFNIKEVEVHYSVSRQTEGRKRNKELIITNY 254
>gi|148657152|ref|YP_001277357.1| D12 class N6 adenine-specific DNA methyltransferase [Roseiflexus sp. RS-1] >gi|148569262|gb|ABQ91407.1| D12 class N6 adenine-specific DNA methyltransferase [Roseiflexus sp. RS-1] (287 aa)
Score = 159, Expect = 4.6e-09, Identities = 75/297 (25%), Positives = 130/297 (43%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVN--KKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSF-----FDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDI 350
           ++K  L++ GGK++ +  +    P   +   +Y EPFVGGG+    +  KY    ++I+D+N EL   +   +    +L    +IM     L   D R+ +Y        EL     +   D E+A     LN+  F+G+       +G F   +G +    I     +  + K L+ V I   DYK+  +  D+ TF + DPPY  + + S     N  L    +  E A+ + K  +     L++  D     +N  F     ++  Y   N ++ KA++     G+      EL ISN+ +
  S:     1 MIKSPLRYPGGKSRAVQRLLALVP---DVFDEYREPFVGGGSFFVCLRQKYPEVRMWINDLNTELFYFWKCAQEDSVKLAG--EIMR--LKLERVDGRELFY--------ELLGMNTSTMGDFERAVRFFVLNRITFSGVVEAGGYSEGAF---VGRFTKSSI---ERVALLGKILEGVKITNMDYKELLKDGDRRTFTFLDPPYL-VATKSKLYGRNGILHESFDHTEFAEEMKKCRHSW---LITYDDSPEIRQNFQFACIHRWELQYGMNNYRQEKAEK-----GA------ELFISNYQL 268
>gi|16332213|ref|NP_442941.1| modification methylase [Synechocystis sp. PCC 6803] >gi|1653843|dbj|BAA18753.1| modification methylase [Synechocystis sp. PCC 6803] (285 aa)
Score = 159, Expect = 4.8e-09, Identities = 73/294 (24%), Positives = 131/294 (44%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKY--EVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSF-----FDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           VK  L++ GGK++ L +I  + P    QI +Y EPF+GGG+V   +   +   + + +I+D+N +L   +   + +++ L   + ++++      TD R+ +  + K         E  +  + ++A     LN+  F+G   V   G    +          D   L+ +   L N  +  GDY++  E   +N F++ DPPY   T  S       DL      +  A+    + N   K L++  D +   K  SF     +D  Y   N K+         D +S+G+  EL+I N+
  S:    20 VKSPLRYPGGKSKALRQILPHVP---TQIKEYREPFIGGGSVFLAIKQIFGQHINKYWINDLNFDLYCFWKYAQEEIERLTDAVTVIKQ----HQTDGRELFANLTK---------EGLELDEFQRAVRFFVLNRITFSG--TVESGGYSQQAFEKRFTDSSID--RLKTLGTMLANTTVTNGDYQQLIEQPGENVFIFLDPPYLSATK-SKLYGKKGDLHTSFGHQRFAEV---MENCSHKWLITYDDSEEIRKLFSFAQIIEWDLQYGMNNYKQ---------DKASKGK--ELMIKNY 285
>gi|148284774|ref|YP_001248864.1| site-specific DNA adenine methylase [Orientia tsutsugamushi str. Boryong] >gi|146740213|emb|CAM80504.1| site-specific DNA adenine methylase [Orientia tsutsugamushi Boryong] (146 aa)
Score = 158, Expect = 6.9e-09, Identities = 54/160 (33%), Positives = 79/160 (49%)
  Q:   190 FNGLYRVNKKGLF--NVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           F G+YR+N+ G      S   Y    IC  +N    SK L +V+I   D+   E    K  FVY DPPY      S    Y +  F+D+ Q  L D++ +LNNKG KI++SN+       N +F  ++Y    I  +     IN     R  +NEL+I+N++
  S:     3 FRGIYRLNRDGTSAQTFSDKQYLKLHICSRIN--KCSKLLTDVSICAMDFSFIEP--KKGDFVYLDPPYH----QSGERFYTRVPFDDKEQIRLRDFVYELNNKGVKIMISNN-------NTAFIRDLYKELFITHIGVTYSIN---EQRNLVNELIITNYN 146
>gi|92113527|ref|YP_573455.1| DNA adenine methylase [Chromohalobacter salexigens DSM 3043] >gi|91796617|gb|ABE58756.1| DNA adenine methylase [Chromohalobacter salexigens DSM 3043] (253 aa)
Score = 157, Expect = 8.3e-09, Identities = 54/202 (26%), Positives = 87/202 (43%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPY 256
           +KP L W+GGK +L   I   +  H      Y EPF GG A+ F  L      E+ I+D + EL+N+Y ++K+   EL+       + F        +W  L+ +  +   +E       D+++AA   +L K  F G       G    S       +I + L+   +  +L    I + D+ +     D+  T  Y DPPY
  S:     3 MKPILPWMGGKRRLAKAIIPQFQPHRT----YVEPFCGGAAIFF--LKDPSPVEV-INDAHGELVNLYRIVKHHPDELV-------RQF--------RW-SLVSREEYLTQREVNPRHLTDIQRAARFFYLQKLAFGGKVHGQTFGTSATSPPRLNLMRIEEDLSQAHL--RLSRTVIEHLDWSECVTRYDRPETLFYLDPPY 180
>gi|157737883|ref|YP_001490567.1| N6 adenine-specific DNA methyltransferase, D12 class [Arcobacter butzleri RM4018] >gi|157699737|gb|ABV67897.1| N6 adenine-specific DNA methyltransferase, D12 class [Arcobacter butzleri RM4018] (260 aa)
Score = 156, Expect = 1.0e-08, Identities = 89/288 (30%), Positives = 128/288 (44%)
  Q:    61 WVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVL-SKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMI---NSDGSSRGEINELLISNF 348
           WVGGKTQL  +I    P    +   Y E F G G+VL+    SK EV     +DIN+ELIN++  I+   + L   L  +                LI +  FN++K K      ++EKAA   +     F      +K   F ++    + PK     N + IS++LK V I    + K     DK + F Y DPPY    ST S+   N   F  +  +ELA     L+N   K LLS +D            E+Y  +NIK  K  R     N  G  +  ++E+ I+N+
  S:    12 WVGGKTQLARDIIDLIP---QEHKTYIEVFGGAGSVLYQKEPSKLEV----FNDINSELINLHRAIRNNPQSLSIYLNDL----------------LISREIFNDIKSKHLRGRNNIEKAAFYFYQLTQSFG-----SKGDNFAMAAKSGRKPKNI-YRNFKTISERLKYVTIENMSFNKLISLYDKDDAFFYVDPPY---VSTESYYK-NTGGFGLKEHEELAQL---LSNIKGKFLLSYND-------SVIVRELYKGFNIKSTKEIRYTLGANMHGKKK-SVSEVFITNY 260
>gi|12276097|gb|AAG50260.1|AF311653_1 probable DNA adenine methylase [Bacteriophage GMSE-1] (115 aa)
Score = 156, Expect = 1.1e-08, Identities = 33/80 (41%), Positives = 47/80 (58%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELI 133
           V  P + WVGGK +L+ +I  ++P H      Y EPF GG A+ F   SK   KE   +DIN EL+N+Y V+K  ++E +
  S:     6 VSSPMIPWVGGKRRLIKQILPHFPAHQC----YVEPFCGGAALFF---SKSPSKEEVRNDINGELMNLYRVVKVHLEEFM 78
>gi|19705228|ref|NP_602723.1| adenine-specific methyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713179|gb|AAL94022.1| Adenine-specific methyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (496 aa)
Score = 155, Expect = 1.3e-08, Identities = 87/269 (32%), Positives = 141/269 (52%)
  Q:    47 EINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIK-YKVKELIPVLQIMEKDFLLRNTDDRKWYY--------LIKKNRFNELKEKED-NQFLD--VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYK-NPKICDTLNLEAISKKLKNVNIVYGDYKKSE-EFIDKNTFVYFDPPYRPITSTSSFTAYNKD-LFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEI 315
           E+  N  V  PF  + GGK +LL +++K   F   +I  + + F GG  V  +  S     +I  +D+NA++I++   IK   V+EL+  +  +  D+ L NT    + Y        L   N+   LK +ED N+ L+  +E   L+  L    FN   R N KG FN+ +G    N K+ + L L +   K K++     D++  +   I KNTFVY DPPY   T+      YN++ ++ D+ +K+L +++ +L+ KG K  LSN     + +N    D I
  S:   186 EVEENRSVSSPF-NYTGGKYKLLEQLQKL--FKEEEI--FLDIFTGGANVGINSKSS----KIIFNDVNAKIISLMEYIKNIDVEELLKKIDNIIVDYGLSNTMLYGYEYYSCNSSEGLANCNKEAFLKLREDYNKKLNKGIEDYNLLYVLIVFSFNNQVRFNSKGEFNLPVGKRDFNSKMRNKLILFSKKLKEKDIEFYSKDFRDIDINKIPKNTFVYCDPPYLITTA-----GYNENGMWTDKEEKDLLNFLKELDKKGLKFALSNVLESKNKENKILKDWI 455
>gi|167772255|ref|ZP_02444308.1| hypothetical protein ANACOL_03630 [Anaerotruncus colihominis DSM 17241] >gi|167665358|gb|EDS09488.1| hypothetical protein ANACOL_03630 [Anaerotruncus colihominis DSM 17241] (278 aa)
Score = 154, Expect = 1.8e-08, Identities = 76/295 (25%), Positives = 130/295 (44%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKE--KEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRM--INSDGSSRGEINELLISNFDINKK 353
           + W+GGK  L   I   +P +     +Y E F GGG VLF      +  E+Y +D N  L+N+Y  ++ K +ELI  L+                Y L  +  F+ +++    D+   DV+KAA    L +  +         GL   S G   +    +   +E   ++L  V I + D++K     D+  +F Y DPPY    +   +    +D F + +   L D + ++     K LLS +D       D+F   +Y    I  ++  R+  I     +  +  ELLI+N+D+ ++
  S:     1 MSWIGGKKALRELIVTLFPVY---YERYIEVFGGGGWVLFHKPPGNDF-EVY-NDFNGLLVNLYRCVREKPEELIAALR----------------YVLNAREDFDLVRDALARDSPASDVQKAAWFYQLIRYSY-------ASGL--TSFGSQPHDMWSNFPLIEQAHRRLAKVVIEHKDFEKLLRQYDRPVSFFYLDPPYH--ATEGYYQNIGEDGFTEADHIRLRDALIRIEG---KFLLSYND-------DAFVRGLYDQPGICLMETTRINNIKQRYDNGAQFPELLIANYDLRER 258
>gi|15892613|ref|NP_360327.1| putative DNA adenine methyltransferase (MboA) [Rickettsia conorii str. Malish 7] >gi|15619780|gb|AAL03228.1| similarity to DNA adenine methyltransferases (MboA) [Rickettsia conorii str. Malish 7] (182 aa)
Score = 154, Expect = 1.9e-08, Identities = 42/96 (43%), Positives = 53/96 (55%)
  Q:   206 MGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSD 301
           MG Y NP I D  N+ A SK L+N  I+Y D+           FVY DPPY+PI +T SFT Y K  F + +Q +L +    LN KG    +SNSD
  S:     1 MGAYMNPNILDKDNILACSKALQNAEIIYQDFSNISP--KPKDFVYIDPPYQPINNT-SFTKYTKLGFTETDQVKLYEKCRALNKKGV-YFISNSD 92
>gi|118052682|ref|ZP_01521228.1| D12 class N6 adenine-specific DNA methyltransferase [Comamonas testosteroni KF-1] >gi|117999812|gb|EAV13970.1| D12 class N6 adenine-specific DNA methyltransferase [Comamonas testosteroni KF-1] (263 aa)
Score = 154, Expect = 1.9e-08, Identities = 51/203 (25%), Positives = 94/203 (46%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKSEEF---IDK----NTFVYFDPPY 256
           +  P + W+GGK +L++ + K +P H    + Y E F GG AV F   +++      ++D+N +L+N+  V+ + ++E +       + F        KW  L  +  F  L+E       D+++AA   +L +  F G           V+   +        +NL  I + L   ++ +  G Y +  ++   ID+    +T  Y DPPY
  S:     1 MTNPIVPWIGGKRRLVDLLLKRFPAH----SCYVEVFAGGAAVYF---ARHPADVEVLNDVNGDLVNLCRVVTHHLEEFV-------RQF--------KW-ALTSRQVFKWLQETRPETLTDIQRAARFFYLQQQSFGG----------KVAGQTFGTATTAPAINLLRIEENLSAAHLRMAGGTYIEQLDWAQCIDRYDRTHTLFYLDPPY 179
>gi|57237231|ref|YP_178243.1| DNA adenine methylase [Campylobacter jejuni RM1221] >gi|57166035|gb|AAW34814.1| DNA adenine methylase [Campylobacter jejuni RM1221] (271 aa)
Score = 154, Expect = 2.0e-08, Identities = 88/294 (29%), Positives = 129/294 (43%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFD-VLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPK-ICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +K    WVGGK  L  EI    P H +    Y E F G  +V +    SK EV    I+DIN ELIN++  I+ K + L  VL  M                +I +  F+ LK KE     D+E+AA   +L  T F          +   +M   + PK +C   +L   +K+LKN +I    ++   +  D N    Y DPPY     T ++   N   F  +  + L    N L N   K +LS +D +          ++Y  +N K +K +  +N++   R E  ELLI NF
  S:    22 LKAPFAWVGGKNYLAKEIIALMPEHKS----YIEVFGGALSVFYQKSASKIEV----INDINDELINLHLCIRNKPQSLANVLNSM----------------IISRKIFHMLKNKEIKPRNDLERAAFYFYLISTSFG-------SSMGQFAMNKQRAPKRLCRDFSLH--TKRLKNASIENKSFEYILKEYDYNEALFYLDPPY---VGTENYYK-NTGGFGLKEHELLC---NLLKNIKGKFMLSYNDCE-------LIRKLYKDFNFKELKVRYSLNNNVLKRKESKELLIMNF 271
>gi|91780510|ref|YP_555717.1| putative N6 adenine-specific DNA methyltransferase, D12 class [Burkholderia xenovorans LB400] >gi|91693170|gb|ABE36367.1| Putative N6 adenine-specific DNA methyltransferase, D12 class [Burkholderia xenovorans LB400] (263 aa)
Score = 153, Expect = 2.3e-08, Identities = 55/200 (27%), Positives = 92/200 (46%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE----AISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPY 256
           P + W+GGK +L + +   +P H      Y E F G  A+ F +    EV+   ++D+N  LIN+Y V+++ ++E +       + F        KW  L  +  F  L +   +   D+++AA   +L + CF G  RV  +     +     +P   + L LE    A   +L    I   D++      D+ +TF Y DPPY
  S:     4 PIIPWIGGKRRLADILIPRFPPHRC----YVEVFAGAAALFF-MRPAAEVE--VLNDVNDNLINLYRVVQHHLEEFV-------RQF--------KW-ALSSREVFRWLSDTPPHTLTDIQRAARFYYLQQNCFGG--RVEGRTFGTAT----TSPPGLNLLRLEETLSAAHLRLSGAYIEKLDWQTCVARYDRPHTFFYLDPPY 179
>gi|120611562|ref|YP_971240.1| D12 class N6 adenine-specific DNA methyltransferase [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120612745|ref|YP_972423.1| D12 class N6 adenine-specific DNA methyltransferase [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120590026|gb|ABM33466.1| D12 class N6 adenine-specific DNA methyltransferase [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120591209|gb|ABM34649.1| D12 class N6 adenine-specific DNA methyltransferase [Acidovorax avenae subsp. citrulli AAC00-1] (263 aa)
Score = 153, Expect = 2.5e-08, Identities = 51/200 (25%), Positives = 90/200 (45%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLK--NVNIVYGDYKKS---EEFIDK----NTFVYFDPPY 256
           P + W+GGK +L++ +   +P H      Y E F GG AV F   ++       ++D+N +L+N+Y V+ + ++E +       + F        KW  L  +  F  L+E       DV++AA   +L +  F G           V+   +        +NL  I + L   ++ +  G Y +     E +D+    ++  Y DPPY
  S:     4 PIVPWIGGKRRLVDLLLSRFPAHKC----YVEVFAGGAAVFF---ARNPADVEVLNDVNGDLVNLYRVVTHHLEEFV-------RQF--------KW-ALTSRQVFRWLQETRPETLTDVQRAARFFYLQQQSFGG----------KVAGQTFGTATTAPAINLLRIEESLSAAHLRLAGGTYIEQLDWAECVDRYDRPHSLFYLDPPY 179
>gi|77465645|ref|YP_355148.1| putative adenine-specific DNA methyltransferase [Rhodobacter sphaeroides 2.4.1] >gi|77390063|gb|ABA81247.1| putative adenine-specific DNA methyltransferase [Rhodobacter sphaeroides 2.4.1] (268 aa)
Score = 153, Expect = 2.5e-08, Identities = 67/291 (23%), Positives = 124/291 (42%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITK-----YAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTL---NLEAISKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISN 347
           P   W+GGK       K+ +P    +I       Y EPFVG G +      +  ++   ++D N E+IN++ +++    +L+ +++                + +  +  F+ L+  +     D+E+AA  ++L +  F G       G+F VS GH   P+         L+A  ++L  V     D+      +    T  Y DPPY           Y K LF+      +A+ +  L  KG  +L  N  P+           ++  ++++ V+    +++ G +  E  ELL+SN
  S:     9 PVAPWLGGK-------KRLHPLILERIEAIPHRAYVEPFVGMGGIFLRRRFRPRLE--VMNDRNGEIINLFRILQRHYPQLLEIMR----------------FQICSRREFDRLRLTDPATLTDLERAARFLYLQRLSFGG----KLDGVFGVSAGH--GPRFSLARLEPVLDAAHERLDGVVFESLDWADLIPRYDTTETLFYLDPPY-----FGGENDYGKGLFDRAQFARIAEILGGL--KGAFLLSINDTPE--------IRALFGRFHLEPVRLSYSVSASGGT--EAQELLVSN 260
>gi|126464131|ref|YP_001045244.1| D12 class N6 adenine-specific DNA methyltransferase [Rhodobacter sphaeroides ATCC 17029] >gi|126105942|gb|ABN78472.1| D12 class N6 adenine-specific DNA methyltransferase [Rhodobacter sphaeroides ATCC 17029] (268 aa)
Score = 152, Expect = 2.7e-08, Identities = 66/291 (22%), Positives = 125/291 (42%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITK-----YAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTL---NLEAISKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISN 347
           P   W+GGK       K+ +P    +I       Y EPFVG G +      +  ++   ++D N E+IN++ +++    +L+ +++                + +  +  F+ L+  +     D+E+AA  ++L +  F G       G+F VS GH   P+         L+A  ++L  V     D+      +    T  Y DPPY           Y + +F+      +A+ +  L  KG  +L  N  P+           ++  ++++ V+    +++ GS+  E  ELL+SN
  S:     9 PVAPWLGGK-------KRLHPLILERIEAIPHRAYVEPFVGMGGIFLRRRFRPRLE--VMNDRNGEIINLFRILQRHYPQLLEIMR----------------FQICSRREFDRLRLTDPATLTDLERAARFLYLQRLSFGG----KLDGVFGVSAGH--GPRFSLARLEPVLDAAHERLDGVVFESLDWADLIPRYDTAETLFYLDPPY-----FGGENDYGRGIFDRAQFARIAEILGSL--KGAFLLSINDTPE--------IRMLFDRFHLEPVRLNYSVSASGST--EAQELLVSN 260
>gi|46518733|gb|AAS99730.1| cytosine specific DNA methyltransferase [uncultured bacterium] (299 aa)
Score = 152, Expect = 3.2e-08, Identities = 70/297 (23%), Positives = 127/297 (42%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISK------KLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEI-NELLISNFDI 350
           ++K  L++ GGK++ + +I    P       +Y EP VGGG++   +  K+ ++  +I+DIN +L   + V +     L   +  + +      TD R  +Y +          ++  Q  + E+A     LN+  F+G           V  G Y      D     A+ +       L+ V I  GDY    +   ++ F+Y DPPY  + + S       +L  + + + L   + + ++K    LL+       D+ D +  E Y+ Y   R   +  +N+    R     EL I+N+DI
  S:     1 MIKSPLRFPGGKSRAVAQILPLVP----DFEEYREPMVGGGSLFLALKQKFPLRRYWINDINYDLYCFWKVAQECPDALADAVHKVRQS----TTDGRALFYRLL---------EQYGQGSEFERAVRFFVLNRITFSG----------TVDSGGYSEQAFHDRFTHSAVERIRPLGNLLRGVKITCGDYAPVVQQEGESVFIYLDPPYYSV-AESRLYGRRGELHLNFDHERLRRILGQTSHKW---LLT------YDECD-YIRERYADYTQLRWTLQYGMNNYKQPRARPGKELFIANYDI 266
>gi|85058769|ref|YP_454471.1| putative phage DNA adenine methylase [Sodalis glossinidius str. 'morsitans'] >gi|84779289|dbj|BAE74066.1| putative phage DNA adenine methylase [Sodalis glossinidius str. 'morsitans'] (99 aa)
Score = 152, Expect = 3.2e-08, Identities = 32/77 (41%), Positives = 45/77 (58%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELI 133
           P + W+GGK +L   I   +P H      Y EPF GG A+ F   SK   K   ++DIN +LIN+Y V+KY+++E I
  S:     9 PIVPWMGGKRRLAKRILSCFPEHKC----YVEPFCGGAALFF---SKEPSKVAVLNDINGDLINLYRVVKYRLEEFI 78
>gi|171853697|emb|CAM11585.1| Site-specific DNA methylase [Candidatus Phytoplasma australiense] (270 aa)
Score = 152, Expect = 3.3e-08, Identities = 78/290 (26%), Positives = 133/290 (45%)
  Q:    59 LKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMG---HYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPY-RPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           + W+G K ++L ++  Y P  +HN     Y EPF+G GA LF  L+   V    ++D +  LI ++  +  K +     ++  E D +  N D +      +K  F  L EK +   L   K+AL   L K  F G++R    G   +       +KNP I  +  ++ I   +KN+ ++ GD++        N F++ DPPY R  T    F  Y K  F  ++ K L   +   N +  K L +N        N     E++  ++I+ ++     N   +S+G   E++I N+
  S:     3 IAWIGSKKKMLPQLLNYIPTNYHN-----YYEPFLGSGA-LFQSLTPSTVT---LNDNDINLIQLWKDMLAKPELFCDYVRKFE-DKIYVNKDQKT-----QKESFKHLVEKFNKSNLGAYKSALFYVLLKYAFRGIFRYRSDGTIYLGYSFSSRFKNPIIVLS-EIQRIKTNVKNIKLLNGDFESVINQTQSNDFIFVDPPYWREGTKDKDF--YQKP-FTFEDHKRLYKSLEMANYRKVKWLYTNY-------NSPKIIELFKDFHIQPLQT--TTNYALTSKGITQEVIIKNY 270
>gi|75910604|ref|YP_324900.1| D12 class N6 adenine-specific DNA methyltransferase [Anabaena variabilis ATCC 29413] >gi|75704329|gb|ABA24005.1| D12 class N6 adenine-specific DNA methyltransferase [Anabaena variabilis ATCC 29413] (283 aa)
Score = 151, Expect = 3.6e-08, Identities = 74/297 (24%), Positives = 131/297 (44%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKL-KNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDI 350
           ++K  L++ GGK++ + +I +Y P  FH     +Y EPFVGGG+V   +  K+   +I+I+D+N EL   +   +  + EL+           +R   DR   Y   K+ F EL   +     D ++A     LN+  F+G     + G F+      K         LE ++  L +++ I   DY +       + F++ DPPY   T +  +     DL      +  A+ + +  ++   I   NS    ++   +   E    Y +   K        G+++G+  EL ISN++I
  S:     1 MLKSPLRYPGGKSKAIKQIIEYLPTSFH-----EYREPFVGGGSVFIYLKQKFPTLKIWINDLNTELFLFWRFAQSNLPELVQE---------IRRFKDR---YQDGKSLFLELTTVDVTSLSDFDRAVRFFILNRITFSGTV---ESGGFS-QQAFQKRFTYSSIERLEKLADILTEDIKITNLDYSQLLNSEQNDVFIFLDPPYFSATKSRLYGKIG-DLHTSFEHQRFAELLQQCPHRWL-ITYDNSPEIRANFLSAHIYEWELQYGMNNYK------QSGAAKGQ--ELFISNYEI 269
>gi|153092519|gb|EDN73574.1| site-specific DNA-methyltransferase (adenine-specific) [Mannheimia haemolytica PHL213] (722 aa)
Score = 150, Expect = 5.3e-08, Identities = 81/293 (27%), Positives = 146/293 (49%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIK-YKVKELIPVLQIMEKDFLLRNTDDRKWYYL----------IKKNRFNELKEKEDNQFLDVEKAALMIF-LNKTCFNGLYRVNKKGLFNVSMGHYK-NPKICDTLNLEAISKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKD-LFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEIN---ELLISNFDIN 351
             ++GGK +LL +++  +    N+   + + F GGG V  +  S     ++  +D N  LI++   IK      L+  +  + + + L NT    + Y             K RF +L++  + + L  E    M++ L    FN   R N+KGLFN+ +G    N K+   L L +   K K+V  +  DY++ S +   + TF+Y DPPY    +T     YN+  ++ +  +K L +++++ N KG    LSN     + +ND  ++ I S         K   NS+   + +++   E+LI+N+ +N
  S:   421 FNYIGGKFKLLEQLQPLF----NEKEVFLDLFAGGGNVGINSSSS----KVIFNDTNENLIDLIEFIKDTDTDALLKQIDNIIEAYNLSNTSLYGYSYYDCDSSRGLAEYNKGRFLKLRDDFNAKVLAGEIDYPMLYVLMVFSFNNQIRFNRKGLFNLPVGKRDFNSKMRSKLVLFSEELKSKDVQFMKKDYREISLDDFSQETFIYCDPPYLITNAT-----YNEHGMWTEIEEKALLEFLDEANEKGFSFALSNVLESKNKRNDILYNWIESKGYYCNYLNKSYSNSNYHRKDKVSISEEVLITNYPVN 718
>gi|77465361|ref|YP_354864.1| adenine specific DNA methyltransferase, D12 class [Rhodobacter sphaeroides 2.4.1] >gi|77389779|gb|ABA80963.1| Adenine specific DNA methyltransferase, D12 class [Rhodobacter sphaeroides 2.4.1] (262 aa)
Score = 150, Expect = 5.3e-08, Identities = 68/293 (23%), Positives = 119/293 (40%)
  Q:    61 WVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEIN-ELLISNFDINKK 353
           W+GGK  L   I        +    YAEPFVG   +     S+   +   I+D   ++ N++ +++    + +  L+                + L  +  F  L   + +   D+E+AA  ++L +T F G       G+ +   G + N    + + LE +  +L  V +   D+       D+  T  Y DPPY       S T Y + LF  ++   +A+ + KL  +G  +L  N  P+           I+  + I  V     I+      G    ELL+SN+DI ++
  S:     4 WIGGKRNLARRICAI--LDRSPCLTYAEPFVGMAGIFLRRSSRPRAE--VINDRGRDVANLFRILQRHYPQFLDTLR----------------FQLTTRAEFERLGATDPDTLTDLERAARFLYLQRTAFGGKVSGRNFGVSSHRPGRF-NLTTLEPM-LEDLHSRLAGVIVECLDWADFLARYDRPETLFYLDPPY-----WGSETDYGRGLFQREDFGLMAERLAKL--QGRFLLSINDVPQ--------IRAIFGRFRITEVTTTYSISGSAKGNGTARPELLVSNWDIGEE 261
>gi|150390204|ref|YP_001320253.1| DNA adenine methylase [Alkaliphilus metalliredigens QYMF] >gi|149950066|gb|ABR48594.1| DNA adenine methylase [Alkaliphilus metalliredigens QYMF] (253 aa)
Score = 150, Expect = 5.3e-08, Identities = 73/297 (24%), Positives = 124/297 (41%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDI 350
           ++K  L W+GGK +L  +I +  P H    T Y E F G   VLF    K   K    +DIN+EL+N + ++KY  +E       +EKD + R               F E  E       D+++A    +L K  F      +K   F        N  I +T  ++ +  +LK+  +    + +   ++  K TF + DPPY  +T         KD F  ++   L + +   N +G  ++  N  P+          E Y  +N+K  +    ++ +   R    EL+I+N+ +
  S:     1 MLKSPLSWMGGKYRLRKQIIELIPEH----TCYVEIFGGAAWVLF---GKESSKVEVYNDINSELVNFFRILKYHAEEF---KSWIEKDVVSREI-------------FEEYHESPSKYMTDIQRAVRFFYLIKYSF-----ASKGDHFGYGTNKDPNKAIFNTDFIQEVRGRLKHCYVENLSFDQLINKYDRKETFFFCDPPYYELTQY-------KDKFYKEDHLHLVELLK--NIEGKFLVTINDHPE--------VREWYKGFNMKSTEVNYSVSRNIEGRKNYKELIITNYGL 253
>gi|56752312|ref|YP_173013.1| adenine-specific DNA methylase [Synechococcus elongatus PCC 6301] >gi|56687271|dbj|BAD80493.1| adenine-specific DNA methylase [Synechococcus elongatus PCC 6301] (212 aa)
Score = 149, Expect = 6.1e-08, Identities = 52/179 (29%), Positives = 75/179 (41%)
  Q:   107 KEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYI 285
           K   ++DIN  LIN Y  +K  ++  IP          L N  D  + Y   +  FN+       +      A    +LN+T FNGL R N KG FNV  G YK   I    +    S+  ++     GD+   +  + K   +Y DPPY        F  Y K+ F   +Q  LA ++
  S:     4 KRALLNDINPHLINFYQQVKAGLEITIP----------LENDSDLYYQY---RQAFNQ------TELPSALSAQYFYYLNRTGFNGLCRFNSKGEFNVPFGRYKT--IHYRYDFSDYSQLFQDYQFYLGDF--DQLVVGKQDLIYADPPY-----DVEFRQYAKEGFTWDDQVRLAQWL 154
>gi|166364144|ref|YP_001656417.1| DNA methyltransferase [Microcystis aeruginosa NIES-843] >gi|166086517|dbj|BAG01225.1| probable DNA methyltransferase [Microcystis aeruginosa NIES-843] (269 aa)
Score = 149, Expect = 6.2e-08, Identities = 62/237 (26%), Positives = 105/237 (44%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV--LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDT--LNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNK 291
           +K  L++ GGK++ + +I    P +   I +Y EPF  GG+V F V  L   ++K  +I+D+N +L   +   +  +            +FL+    + K  Y   +  F +L  +ED +  D EKA     LN+  F+G   V+  G    +     N +  D+    L  I+  L +V I   DY++      K  F++ DPPY   T  S       +L    + +  AD + +   K
  S:     4 IKSPLRYPGGKSRAIKQIMPQIPVN---IREYREPFFCGGSVFFAVKQLFGQQIKTYWINDLNYDLYCFWQCAQENI------------EFLVAKITEIKQKYDKGRELFQDLT-REDLKLTDFEKAVRFFILNRMTFSG--TVDSGGYSQAAF----NSRFTDSSIARLTQIAPLLSSVKITNQDYEELLFAEGKEVFIFLDPPYYSATK-SRLYGVRGNLHTSFDHQRFADNMRQCQAK 221
>gi|167769295|ref|ZP_02441348.1| hypothetical protein ANACOL_00618 [Anaerotruncus colihominis DSM 17241] >gi|167668263|gb|EDS12393.1| hypothetical protein ANACOL_00618 [Anaerotruncus colihominis DSM 17241] (278 aa)
Score = 149, Expect = 6.7e-08, Identities = 74/295 (25%), Positives = 129/295 (43%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKE--KEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRM--INSDGSSRGEINELLISNFDINKK 353
           + W+GGK  L   I + +P +     +Y E F GGG VLF      +  E+Y +D N  L+N+Y  ++ K +EL+  L+                Y L  +  F+ ++     D+   DV++AA    L +  +         GL   S G   +    +   +E   ++L  V I   D++K     D+  +F Y DPPY    +   +    +D F + +   L D + ++     K LLS +D       D+F   +Y    I  ++  R+  I     +  +  ELLI+N+D+ ++
  S:     1 MSWIGGKKALRELIVRLFPLY---YERYIEVFGGGGWVLFHKPPGNDF-EVY-NDFNGLLVNLYRCVRDKPEELMEALR----------------YVLNAREDFDRIRSALARDSPASDVQRAAWFYQLIRYSY-------ASGL--TSFGSQPHDMRSNFSLIEQAHRRLAKVVIENKDFEKLLHQYDRPVSFFYLDPPYH--ATEGYYQNIGEDGFTEADHIRLRDALMRIEG---KFLLSYND-------DAFVRGLYDRPGIYLMETTRINNIKQRYDNGAQFPELLIANYDLRER 258
>gi|120610321|ref|YP_969999.1| D12 class N6 adenine-specific DNA methyltransferase [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120588785|gb|ABM32225.1| D12 class N6 adenine-specific DNA methyltransferase [Acidovorax avenae subsp. citrulli AAC00-1] (264 aa)
Score = 149, Expect = 7.7e-08, Identities = 57/200 (28%), Positives = 90/200 (45%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF-DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKN-PKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPY 256
           P + W+GGK +L + I   +P H    T Y E F GG A+ F    ++ EV    I+DIN EL+N+Y V++  ++E +       + F        KW  L  +  F  ++  E     D+E+AA   +L    F G       G    +     N  ++ +TL+  A   +L    I   D++      D++ T  Y DPPY
  S:     4 PIIPWLGGKRRLADIIIPRFPAH----TCYVEVFAGGAALYFMRPPAQVEV----INDINGELVNLYRVVQRHLEEFV-------RQF--------KW-ALSSREVFRWMQITEPETLTDIERAARFYYLQNQAFGGRVEGQTWGTATTAPAPTVNLLRLEETLS--AAHLRLHGAYIERLDWQACVRRYDRSHTLFYLDPPY 180
>gi|85059544|ref|YP_455246.1| putative phage DNA modification methyltransferase [Sodalis glossinidius str. 'morsitans'] >gi|84780064|dbj|BAE74841.1| putative phage DNA modification methyltransferase [Sodalis glossinidius str. 'morsitans'] (195 aa)
Score = 148, Expect = 8.3e-08, Identities = 31/80 (38%), Positives = 47/80 (58%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELI 133
           V  P + WVGGK +L+ +I  ++P H      Y EPF GG ++ F   SK   K   ++DIN EL+N+Y V+K  ++E +
  S:     6 VSSPMIPWVGGKRRLIKQILPHFPAHQC----YVEPFCGGASLFF---SKPPSKVEVLNDINGELMNLYRVVKVHLEEFM 78
>gi|34581570|ref|ZP_00143050.1| hypothetical DNA adenine methyltransferases (MboA) [Rickettsia sibirica 246] >gi|28262955|gb|EAA26459.1| hypothetical DNA adenine methyltransferases (MboA) [Rickettsia sibirica 246] (182 aa)
Score = 147, Expect = 1.2e-07, Identities = 41/96 (42%), Positives = 52/96 (54%)
  Q:   206 MGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSD 301
           MG Y NP I D  N+   SK L+N  I+Y D+           FVY DPPY+PI +T SFT Y K  F + +Q +L +    LN KG    +SNSD
  S:     1 MGAYMNPNILDKDNILVCSKALQNAEIIYQDFSNISP--KPKDFVYIDPPYQPINNT-SFTKYTKLGFTEVDQVKLYEKCIALNKKGV-YFISNSD 92
>gi|71733893|ref|YP_274112.1| prophage PSPPH02, putative adenine modification methytransferase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554446|gb|AAZ33657.1| prophage PSPPH02, putative adenine modification methytransferase [Pseudomonas syringae pv. phaseolicola 1448A] (264 aa)
Score = 147, Expect = 1.3e-07, Identities = 68/270 (25%), Positives = 116/270 (42%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEI----YSAYNIKRVKA 326
           P + W+GGK +L + +   +P H      Y E F GG A+ F       V+   ++DIN +L+ +Y V++  ++E +       + F        KW  L  +  F   K        D+++AA   +L    F G  +V+ +     + G   N    +  NL A  ++L    +    + +  E  D+ +TF Y DPPY           Y  D F  +N + +AD++ +   KG  ++  N  P      + F  E+    YS  N ++ KA
  S:     4 PIIPWMGGKRRLADRLIPLFPPHEC----YVEVFAGGAALYFMRPQAAPVE--VLNDINGDLVTLYRVVQNHLEEFV-------RQF--------KW-ALSSRQVFEWQKMTRPETLTDIQRAARFFYLQHHAFAG--KVSGQTFGTATTGPAINLLRIEE-NLSAAWQRLSGTYVENLPWLECAERYDRPHTFHYMDPPYWQT------AGYGMD-FPFENYERMADFMRRC--KGKVMVSINDHPDIRRVFEGFHFEVVDIRYSTANQRKGKA 244
>gi|116328052|ref|YP_797772.1| site-specific DNA-methyltransferase (adenine- specific), dam [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331495|ref|YP_801213.1| site-specific DNA-methyltransferase (adenine- specific), dam [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116120796|gb|ABJ78839.1| Site-specific DNA-methyltransferase (adenine- specific), dam [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116125184|gb|ABJ76455.1| Site-specific DNA-methyltransferase (adenine- specific), dam [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (287 aa)
Score = 146, Expect = 1.6e-07, Identities = 65/248 (26%), Positives = 110/248 (44%)
  Q:    58 FLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTL--NLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNS 305
            LKW+G K +  + I  Y+P    +I  Y EPF+G GAV+  +  +  +     SDI   LI+++  +K    ELI  L   E   L+      K Y +IK + +N     +D           ++FL+++C+ G+ R  K   +  +     NP    +    + + S ++ +   +  +YK + +  + +  +Y DPPY+     S    Y    F   + K+L D I     +G KI LS    K S
  S:    14 LLKWIGNKQKYADTIISYFP---KKIKAYREPFLGSGAVIATLSPQKGIG----SDIFKPLIDIFQKLKSNPDELI--LDYTENYALIEKFGKEKAYEIIKSS-YNLNPNPKD-----------LLFLSRSCYGGVVRFRKVDAYMSTPCGIHNPLSPKSFAERVYSWSNRVADCEFLNLNYKDAFDAAEADDLIYCDPPYK----DSQPILYGAQSF---SLKDLYDSIENAKLRGVKIALSIDGSKKS 235
>gi|171914322|ref|ZP_02929792.1| DNA adenine methylase [Verrucomicrobium spinosum DSM 4136] (278 aa)
Score = 146, Expect = 1.6e-07, Identities = 59/252 (23%), Positives = 107/252 (42%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNN-KGTKILLSNSDPKN 304
           Q  KP ++W GGK++LL  +    P H    T Y EPF GG AVL   L+K       ++D+N +L+ +Y  +++  + LI  LQ               W    ++N  + + +       D++++A  +  NK  F     +   G+   S G     +      +  +S +L  V++    Y++     D   T  + DPPY         T  + D ++  N+ ++  +  ++   KG  I+  +  P N
  S:     4 QRTKPLIRWAGGKSRLLKHLLP-LPEH----TAYVEPFAGGLAVL---LAKSRSTVEVVNDLNGDLVTLYRCVQFHPEALIAELQ---------------WTLNARQNLKDFIAQP---GLTDLQRSARWLIRNKIGFGT--SMTSYGVSRTSGGAATGSRENVQQAIRDLSARLDRVSVENLSYERMLRLYDAPGTLFFMDPPY---------TVSDVDCYDGWNEAQMTKFSAQVAELKGDWIVTVDDSPLN 220
>gi|71902008|ref|ZP_00684054.1| N6 adenine-specific DNA methyltransferase, D12 class [Xylella fastidiosa Ann-1] >gi|71728233|gb|EAO30418.1| N6 adenine-specific DNA methyltransferase, D12 class [Xylella fastidiosa Ann-1] (263 aa)
Score = 145, Expect = 1.9e-07, Identities = 50/200 (25%), Positives = 90/200 (45%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPY 256
           P + W GGK +LL  +  ++P H      Y E F GG AVL  +L         ++DIN +++N+Y  +++ + E +       + F        +W    +     E + + +    D+++AA   +L K  F G  +V  +    V+ G  +   +     L A+  +L +V I  G ++   +  D+ +T  Y DPPY
  S:     4 PIIPWPGGKRRLLKHLYPHFPQHEC----YVEAFAGGAAVL--LLRPNPAPVEVLNDINGDVVNLYRCVRHHLDEFV-------RQF--------RWALNSRAEWLREQRVRAET-LTDIQRAARFYYLQKLAFGG--KVVNQHFGFVTCGASRLNLLRIEEELSAVHVRLADVIIENGPWRVVVDRYDRGHTLHYLDPPY 180
>gi|167729202|emb|CAO80113.1| N6 adenine-specific DNA methyltransferase, D12 class [Candidatus Cloacamonas acidaminovorans] (271 aa)
Score = 145, Expect = 2.0e-07, Identities = 78/290 (26%), Positives = 131/290 (45%)
  Q:    61 WVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKS-EEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDI 350
           W+GGK  L   I    PF    IT Y EPF GG A +     K+   E+Y +D++  L+N++  +KY   ELI      E D+L+ +           +  F ++ ++E     ++++AA  +FL    F      +K   F  S     +        ++ + ++L  V I    Y+K  E++  K+ F Y DPPY        +T  N   F   + +EL   +  +  KG  IL  + +P+          ++Y ++NIK V   + IN     + E NE++I+NFD+
  S:     7 WIGGKRLLRKVIA---PFIPKDITGYIEPF-GGAAWMLLYKEKWGELEVY-NDLDNRLVNLFLQVKYHPDELIK-----ELDWLVAS-----------RKLFGDILKQEG--LTEIQRAARFMFLITRSFG-----SKGDSFGTSQKRGTSSMYNRLERIKELHRRLDMVIIENLSYEKVIEKYDTKSNFFYCDPPY-----MLGYTYENSKQF---SHEELCKKLKGI--KGRFILSYDDNPE--------VLKLYKSFNIKHVTRTKGINRK-EGKSEFNEVIIANFDL 250
>gi|118728284|ref|ZP_01576845.1| DNA adenine methylase [Clostridium cellulolyticum H10] >gi|118662339|gb|EAV69039.1| DNA adenine methylase [Clostridium cellulolyticum H10] (251 aa)
Score = 145, Expect = 2.2e-07, Identities = 78/291 (26%), Positives = 130/291 (44%)
  Q:    58 FLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFL-DVEKAALMIFLNKTCFNGLYR---VNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRV-KAKRMINSDGSSRGEINELLISNF 348
           F+ W+GGK  L  EI K +P     + +Y E F G   VLF   S  ++ E+Y +D N+EL+N++  +KY   EL   LQ                Y L  +  FN+ K + + Q L D+++AA    + KT +    R     KK + N+            T  L+ IS++L  V +   D++   +  D+ + F Y DPPY           Y +  F  ++ + LA  +  +     K LLS +D +       +  E+Y  + I+ V +   ++N          E+L+ N+
  S:     4 FIGWIGGKNYLKKEITKRFP---EGMKRYIEVFGGAAWVLFYKDSHADM-EVY-NDYNSELVNLFRCVKYHCGELQRELQ----------------YLLNSRELFNDFKSQYNMQGLTDIQRAARFFMILKTSYGSNQRDFGCIKKNIANI------------TEYLDRISERLAGVIVENRDFENLIKIYDRLDAFFYLDPPYYGTEK------YYQAEFKPEDHERLAKTLKSIKG---KFLLSYNDCE-------YVRELYRDFTIEEVQRNHNLLNRYKGKEKTYCEVLLRNY 251
>gi|86153445|ref|ZP_01071649.1| DNA adenine methylase [Campylobacter jejuni subsp. jejuni HB93-13] >gi|85843171|gb|EAQ60382.1| DNA adenine methylase [Campylobacter jejuni subsp. jejuni HB93-13] (243 aa)
Score = 144, Expect = 2.9e-07, Identities = 86/287 (29%), Positives = 126/287 (43%)
  Q:    62 VGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFD-VLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPK-ICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +GGK  L  EI    P H +    Y E F G  +V +    SK EV    I+DIN ELIN++  I+ K + L  VL  M                +I +  F+ LK KE     D+E+AA   +L  T F          +   +M   + PK +C   +L   +K+LKN +I    ++   +  D N    Y DPPY     T ++   N   F  +  + L    N L N   K +LS +D +          E+Y  +N K +K +  +N++   R E  ELLI NF
  S:     1 MGGKNYLAKEIIALMPEHKS----YIEVFGGALSVFYQKSASKIEV----INDINDELINLHLCIRNKPQSLANVLNSM----------------IISRKIFHMLKNKEIKPRNDLERAAFYFYLISTSFG-------SSMGQFAMNKQRAPKRLCRDFSLH--TKRLKNASIENKSFEYILKEYDYNEALFYLDPPY---VGTENYYK-NTGGFGLKEHELLC---NLLKNIKGKFMLSYNDCE-------LIRELYKDFNFKELKVRYSLNNNVLKRKESKELLIMNF 243
>gi|77465767|ref|YP_355270.1| adenine-specific DNA methyltransferase [Rhodobacter sphaeroides 2.4.1] >gi|77390185|gb|ABA81369.1| Adenine-specific DNA methyltransferase [Rhodobacter sphaeroides 2.4.1] (268 aa)
Score = 143, Expect = 3.6e-07, Identities = 67/291 (23%), Positives = 122/291 (41%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITK-----YAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE----AISKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISN 347
           P   W+GGK       K+ +P    +I       Y EPFVG G +      +  ++   ++D N E+IN++ +++    +L+ +++                + +  +  F+ L+  +     D+E+AA  ++L +  F G       G F +S G   N  +     LE    A   +L  V     D+      +    T  Y DPPY           Y K LF+      +A+ +  L  KG  +L  N  P+           ++  ++++ V+    +++ GS+  E  ELL+SN
  S:     9 PVAPWLGGK-------KRLHPLILERIEAIPHRAYVEPFVGMGGIFLRRRFRPRLE--VMNDRNGEIINLFRILQRHYPQLLEIMR----------------FQICSRREFDRLRLTDPATLTDLERAARFLYLQRLSFGG----KPNGSFGISPG---NGPLFSLARLEPLLDAARTRLDGVVFECLDWADLIPRYDTAETLFYLDPPY-----FGGENDYGKGLFDRAQFARIAEILGSL--KGAFLLSINDTPE--------IRALFGRFHLEPVRLNYSVSAAGST--EAQELLVSN 260
>gi|26553632|ref|NP_757566.1| adenine-specific DNA methyltransferase [Mycoplasma penetrans HF-2] >gi|26453638|dbj|BAC43970.1| adenine-specific DNA methyltransferase [Mycoplasma penetrans HF-2] (308 aa)
Score = 142, Expect = 4.1e-07, Identities = 82/292 (28%), Positives = 143/292 (48%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRK--------WYYLIKKNRFNELKEKE----DNQF-LDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYK-NPKICDTLNLEAISKKLKNVNIVYGDYK---KSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           PF  +VG K +++ +I K++P     I +  EPF GGG+V  +  +KY ++    +D N  +I ++  +       +   Q +E +    N    K        +  L  K  F    +K      N F  D     L+  L    FN + R N KG FN+ +G+   N  + + L          N++    D++   KS EF DK+ F+Y DPPY    S      YNK+ + ++++++L   ++++N+ G K  LSN   +  DK ++        YN+ ++K+  +   D S+   I+E+LI N+
  S:    16 PFF-YVGDKYKIIKQINKFFP---KNIKRLIEPFCGGGSVFLNTEAKYYIE----NDNNYWMIELHKFLCSFKNNPVLFFQKLEDEITKYNLSASKMGITVPLEYKKLYIKTYFAIFNKKAYANVRNDFNKDKSNYTLLYILLIYGFNHMLRFNSKGDFNLPVGNVDYNKNVYNALENYFNFLTKGNIDFKCLDFRTFLKSLEF-DKDDFIYLDPPYLITKSE-----YNKN-WTEKDERDLLVILDEINDLGIKFALSNV-LRYKDKKNNMLISWSKKYNVLKIKSNYISYHDNSTNKIIDEVLIINY 308
>gi|66391708|ref|YP_239233.1| Dam DNA adenine methylase [Enterobacteria phage RB43] >gi|62288796|gb|AAX78779.1| Dam DNA adenine methylase [Enterobacteria phage RB43] (283 aa)
Score = 142, Expect = 4.5e-07, Identities = 70/290 (24%), Positives = 126/290 (43%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMI--NSDGSSRGEINELLISNF 348
           + + G K  LL+++ + +P H +   ++ + F GG +V  +V      K +  +D +  LI+VY V+K +  +L  V +++ K  L +   D    YL  +  +N+ ++              +  L    F+ + R N+KG FN   G Y+          E     +  +    G Y   E  I    FVY DPPY  IT       YNK  +N   ++EL  +++ LN +G    LSN       +ND    E    Y +  +  K ++  +++   + +  E+ + N+
  S:     7 IPYTGNKQDLLHKLFELFPDHRH-YRRFVDCFCGGLSVSLNV-----PKPVLSNDFDKTLIDVYKVLK-RAPDLSEVRELIAKKGLNKENKDA---YLAFREEYNQHRD-----------PLWLYVLILHSFSNVNRTNEKGEFNAHFG-YRTINASTVKRFEHFKANVAGIEFTSGSYSDIE--IRDTDFVYCDPPYL-ITDA----VYNK-FWNADRERELYAFLDSLNERGIWFGLSNVTHHAGKQNDILI-EWMKKYTVHNLDKKYLLGQHTESYEQNKTQEVYVCNY 267
>gi|163868374|ref|YP_001609583.1| phage-related modification methylase [Bartonella tribocorum CIP 105476] >gi|163868419|ref|YP_001609628.1| phage-related modification methylase [Bartonella tribocorum CIP 105476] >gi|163868528|ref|YP_001609737.1| phage-related modification methylase [Bartonella tribocorum CIP 105476] >gi|163868848|ref|YP_001610074.1| phage-related modification methylase [Bartonella tribocorum CIP 105476] >gi|163868892|ref|YP_001610118.1| phage-related modification methylase [Bartonella tribocorum CIP 105476] >gi|163869293|ref|YP_001610549.1| phage-related modification methylase [Bartonella tribocorum CIP 105476] >gi|161018030|emb|CAK01588.1| phage-related modification methylase [Bartonella tribocorum CIP 105476] >gi|161018075|emb|CAK01633.1| phage-related modification methylase [Bartonella tribocorum CIP 105476] >gi|161018184|emb|CAK01742.1| phage-related modification methylase [Bartonella tribocorum CIP 105476] >gi|161018521|emb|CAK02079.1| phage-related modification methylase [Bartonella tribocorum CIP 105476] >gi|161018565|emb|CAK02123.1| phage-related modification methylase [Bartonella tribocorum CIP 105476] >gi|161018996|emb|CAK02554.1| phage-related modification methylase [Bartonella tribocorum CIP 105476] (273 aa)
Score = 142, Expect = 4.5e-07, Identities = 77/300 (25%), Positives = 136/300 (45%)
  Q:    51 NLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF--DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYK--NPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEI--NELLISNFDI 350
           +++ + P   ++GGK +L   I K      + I  YAEPFVG G + F   ++   E+    I+D + +++N + V++      I +L                 + +  +  F  L+ +      D+E+A   ++L +  F+G  +V ++  F V        NP   + + L+ I ++L  V I + D+       D+ NT  Y DPPY  +        Y KDLF  ++ + ++  + +L  KG  +L  N  P+          + +S ++IK V   R I S   S   I   EL+I+N DI
  S:    11 SVEPISPAAAYIGGKRRLAKTIVKIIEDIPHSI--YAEPFVGMGGIFFRRKLIPSTEI----INDFSGDVVNFFRVLQRHYHPFIELLA----------------FQISSRETFERLQTQNPETLTDLERALRFLYLQRLSFSG--KVAER-TFRVETDRCARFNPFKLEGI-LKLIYRRLARVIIEHLDWSDFIVRYDRPNTLFYLDPPYFGVEDY-----YGKDLFKREDYQTMSMLLAQL--KGKFLLSLNDVPE--------IRKTFSQFHIKEV---RTIYSCNLSNNAIPAKELIITNCDI 273
>gi|17228647|ref|NP_485195.1| cytosine-specific DNA methyltransferase [Nostoc sp. PCC 7120] >gi|8453093|gb|AAF75229.1|AF220507_2 cytosine-specific DNA methyltransferase [Nostoc sp. PCC 7120] >gi|17130498|dbj|BAB73109.1| cytosine-specific DNA methyltransferase [Nostoc sp. PCC 7120] (293 aa)
Score = 142, Expect = 4.8e-07, Identities = 68/297 (22%), Positives = 134/297 (45%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYP--FHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVN--KKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDI 350
           ++K  L++ GGK++ + +I +Y P  FH     +Y EPFVGGG+V   +  K+   +I+I+D+N EL   + + +  + +L+  ++ ++  +      D K  +L       EL   +     D+++A     LN+  F+G        +  F     H    ++    N+  +++ +K  N+ Y     +E+    + F++ DPPY   T  S     + +L      +  A  + +   +   I   NS    ++ + +   E    Y +   K        G+++G+  EL ISN++I
  S:     1 MLKSPLRYPGGKSKAIKQIIEYLPESFH-----EYREPFVGGGSVFIYLKQKFPDLKIWINDLNTELFLFWKIAQSDLSQLVKEIRRIKDKY-----QDGKLLFL-------ELTTVDVISLSDLDRAVRFFVLNRITFSGTVESGGFSQQAFQKRFTHSSIERLEKLENI--LTEDIKITNLDYSQLLNNEQ---NDVFIFLDPPYYSATK-SRLYGKDGELHTSFEHQRFAALLQQCPQRWL-ITYDNSPEIRANFSSAHIYEWELQYGMNNYK------QSGAAKGK--ELFISNYEI 269
>gi|77462599|ref|YP_352103.1| N6 adenine-specific DNA methyltransferase, D12 class [Rhodobacter sphaeroides 2.4.1] >gi|77387017|gb|ABA78202.1| N6 adenine-specific DNA methyltransferase, D12 class [Rhodobacter sphaeroides 2.4.1] (268 aa)
Score = 142, Expect = 5.0e-07, Identities = 67/291 (23%), Positives = 125/291 (42%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITK-----YAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTL---NLEAISKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISN 347
           P   W+GGK       K+ +P    +I       Y EPFVG G +      +  ++   ++D N E+IN++ +++    +L+ +++                + +  +  F+ L+  +     D+E+AA  ++L +  F G       G+F VS GH   P+         L+A  ++L  V     D+      +    T  Y DPPY           Y + +F+      +A+ +  L  KG   LLS +D        S    ++  ++++ V+    +++ G +  E  ELL+SN
  S:     9 PVAPWLGGK-------KRLHPLILERIEAIPHRAYVEPFVGMGGIFLRRRFRPRLE--VMNDRNGEIINLFRILQRHYPQLLEIMR----------------FQICSRREFDRLRVTDPATLTDLERAARFLYLQRLSFGG----KLDGVFGVSAGH--GPRFSLARLEPVLDAAHERLDGVVFESLDWADLIPRYDTAETLFYLDPPY-----FGGENDYGRGIFDRAQFARIAEILGSL--KGA-FLLSIND-------TSEIRALFGRFHLEPVRLNYSVSAAGGT--EAQELLVSN 260
>gi|166364091|ref|YP_001656364.1| DNA methyltransferase [Microcystis aeruginosa NIES-843] >gi|166086464|dbj|BAG01172.1| DNA methyltransferase [Microcystis aeruginosa NIES-843] (269 aa)
Score = 141, Expect = 5.6e-07, Identities = 62/237 (26%), Positives = 107/237 (45%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV--LSKYEVKEIYISDINAELINVYSVIKYKVKELIP-VLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSM-GHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNK 291
           +K  L++ GGK++    IK+  P  +  I +Y EPF GGG+V F V  L   ++K  +I+D+N +L   +   +  ++ L+  + +I +K             Y   +  F +L  +ED +  + EKA     LN+  F+G   V+  G    +    + +  I     L  I+  L +V I   DY++      K  F++ DPPY   T  S       +L    + +  AD + +   K
  S:     4 IKSPLRYPGGKSR---AIKQILPQISVNIREYREPFFGGGSVFFAVKQLFGQQIKTYWINDLNYDLYCFWQCAQENIELLVAKITEIKQK-------------YDSGRELFQDLT-REDLKLTNFEKAVRFFILNRITFSG--TVDSGGYSQAAFTSRFTDSSIA---RLTQIAPLLASVKITNQDYEELLFAEGKEVFIFLDPPYYSATK-SRLYGVRGNLHTSFDHQRFADNMRQCQAK 221
>gi|86151670|ref|ZP_01069884.1| type II DNA modification methyltransferase, putative [Campylobacter jejuni subsp. jejuni 260.94] >gi|85841299|gb|EAQ58547.1| type II DNA modification methyltransferase, putative [Campylobacter jejuni subsp. jejuni 260.94] (284 aa)
Score = 141, Expect = 6.1e-07, Identities = 84/294 (28%), Positives = 123/294 (41%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPK-ICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           +K    WVGGK  L  EI    P H +    Y E F G  +V       Y+     I  IN ELIN++  I+ K + L  VL  M                +I +  F+ LK KE     ++E+AA   +L  T F          +   +M   + PK +C   +L    K+LKN +I    ++   +  D N    Y DPPY     T ++   N   F  +  + L    N L N   K +LS +D +          E+Y  +N K +K +  +N++   R E  ELLI NF
  S:    38 LKAPFAWVGGKNYLAKEIIALMPEHKS----YIEVFGGALSVF------YQKSASKIEVINDELINLHLCIRNKPQSLANVLNSM----------------IISRKIFHMLKNKEIKPRNNLERAAFYFYLINTSFG-------SSMGQFAMNKQRAPKRLCRDFSLHI--KRLKNASIENKSFEYILKEYDYNEALFYLDPPY---VGTENYYK-NLPCFGLKEHELLC---NLLKNIKGKFMLSYNDCE-------LIRELYKDFNFKELKVRYSLNNNVLKRKESKELLIMNF 284
>gi|156742108|ref|YP_001432237.1| D12 class N6 adenine-specific DNA methyltransferase [Roseiflexus castenholzii DSM 13941] >gi|156233436|gb|ABU58219.1| D12 class N6 adenine-specific DNA methyltransferase [Roseiflexus castenholzii DSM 13941] (289 aa)
Score = 141, Expect = 6.5e-07, Identities = 50/209 (23%), Positives = 95/209 (45%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVN--KKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITST 262
           +++  L++ GGK++ +  +    P   +   +Y EPFVGGG+    +  KY   +++I+D+N EL   +   +     L    ++M+    +   + R+ +Y        EL   + ++  + E+A     LN+  F+G+       +G F   +G +    I     L  + + L+ V I   DYK   +  D+  F + DPPY   T +
  S:     1 MIRSPLRYPGGKSRAIQRMLYLIP---DSFDEYREPFVGGGSFFILLRQKYPDVKMWINDLNTELFYFWKCAQEDSARL--AREVMK--IKVERANGRELFY--------ELLGMDTSKMSEFERAVRFFVLNRITFSGVVEAGGYSEGAF---IGRFTRSSI---ERLALLGEILEGVRITNSDYKDLLQDGDQRVFTFLDPPYFAATKS 190
>gi|99081428|ref|YP_613582.1| DNA adenine methylase Dam [Silicibacter sp. TM1040] >gi|99037708|gb|ABF64320.1| DNA adenine methylase Dam [Silicibacter sp. TM1040] (293 aa)
Score = 140, Expect = 6.9e-07, Identities = 65/250 (26%), Positives = 100/250 (40%)
  Q:    56 KPF----LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKK-GLFNVSMGHY---KNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNS 305
           KPF    LKWVG K +  +EI  + P        Y EPF+G G V+ ++     +     SDI   L+ ++  ++     L    Q     F+   T DR   Y   K R+N           D    A  +FL + C+ G+ R  +K G  +   G +   K  K  +   +E    ++K  +    DY+ +         +Y DPPY    + S    Y    F     +EL   I     +G ++ LS    K S
  S:    16 KPFKTQLLKWVGNKQRFAHEIVAHLP---KDYGTYFEPFLGAGGVMANLQPHRALG----SDIYPPLVEIWQALREDPARLNAWYQSRYDRFM---TGDRVATYEAIKARYN-----------DTPNGADFLFLCRACYGGVVRFRRKDGYMSTPCGSHPVMKPHKFAE--RVEMWRARMKGASFACLDYRSAMAQARAGDVIYCDPPY----AHSQTILYGAQAF---RLEELFAAIAACKARGVRVALSIDGTKKS 243
>gi|57506162|ref|ZP_00372083.1| site-specific DNA-methyltransferase (cytosine-specific) [Campylobacter upsaliensis RM3195] >gi|57015557|gb|EAL52350.1| site-specific DNA-methyltransferase (cytosine-specific) [Campylobacter upsaliensis RM3195] (306 aa)
Score = 140, Expect = 7.1e-07, Identities = 72/252 (28%), Positives = 123/252 (48%)
  Q:    48 INNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRK----WYYLIKKNR--FNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYK---NPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFI------DKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSN 299
           I +    +K  L ++GGK ++L++I   +P    +I  + + F GG  V  +V              NAE I     + Y    LI +L+ ++++ L +   + +    +Y L K+N   +  L++  + + L ++  AL+ F     FN   R N    FN   G  +   NP++   +NL A  + L+ +NI       SE F       DK  FVY DPPY     T +        +N+  +K+L +Y++KL++KG +  LSN
  S:     5 IQSKPSYIKSPLNYIGGKYKILSQILPLFP---KRIDTFIDVFCGGCNVAVNV--------------NAERILANDNLSY----LIALLKFLQQNPLEKTLQEIEQIIHFYALSKENAEGYKLLRDDYNARKLPLKLLALIAF----SFNHQIRFNNAHHFNTPFGRNRSSFNPQM--QINLIAFIQSLQQINITLFSLDFSEVFSTLDSMQDKEIFVYCDPPYLITQGTYNDGKRGFSGWNESLEKDLLNYLSKLDSKGIRFGLSN 244
>gi|71736125|ref|YP_277067.1| prophage PSPPH06, putative adenine modification methytransferase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556678|gb|AAZ35889.1| prophage PSPPH06, putative adenine modification methytransferase [Pseudomonas syringae pv. phaseolicola 1448A] (264 aa)
Score = 140, Expect = 7.2e-07, Identities = 68/270 (25%), Positives = 114/270 (42%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEI----YSAYNIKRVKA 326
           P + W+GGK +L + +   +P H      Y E F GG A+ F       V+   ++DIN +L+ +Y V++  ++E +       + F        KW  L  +  F   K        DV++AA   +L    F G  +V+ +     + G   N    +  NL A  ++L    +    + +  E  D+ +TF Y DPPY           Y  D F   N + +AD++ +   +G  ++  N  P      + F  E     YS  N ++ KA
  S:     4 PIIPWMGGKRRLADRLIPLFPPHEC----YVEAFAGGAALYFMRPQAAPVE--VLNDINGDLVTLYRVVQNHLEEFV-------RQF--------KW-ALSSRQVFEWQKMTRPETLTDVQRAARFFYLQHHAFAG--KVSGQTFGTATTGPAINLLRIEE-NLSAAWQRLSGTYVENLPWLECAERYDRPHTFHYMDPPYWQT------AGYGVD-FPFDNYERMADFMRRC--RGKVMVSINDHPDIRRVFEGFHFETVDIRYSTANQRKGKA 244
>gi|83945167|ref|ZP_00957516.1| Adenine specific DNA methyltransferase, D12 class [Oceanicaulis alexandrii HTCC2633] >gi|83851337|gb|EAP89193.1| Adenine specific DNA methyltransferase, D12 class [Oceanicaulis alexandrii HTCC2633] (276 aa)
Score = 140, Expect = 7.2e-07, Identities = 61/248 (24%), Positives = 106/248 (42%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITK-YAEPFVGGGAVLF--DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPK 303
           +P + ++GGK++L    K   P  +    + YAEPF+G G +     V ++ EV    I+D + ++   + +++    + + +L+                + +  +  F  L   + +   D+E+AA  ++L    F G       GL     G +    +     LEA+  +L  V I    + +  E IDK  T  Y DPPY           Y K LF+  +   LAD + ++  KG  IL  N  P+
  S:    17 EPAVGYLGGKSRL---AKTLVPMIDRAGARIYAEPFIGMGGIFLRRKVQARVEV----INDYSRDVATFFRILQRHYPQFVEILK----------------FQITTRAEFERLSRTDPDTLTDLERAARFLYLQSCAFGGNVGRRSFGLDLYKGGGFNLHTVVQ--KLEALHARLAGVIIENLCFDRFIERIDKPETLFYLDPPY-----WGGENDYGKGLFSRSDFSRLADQLRRI--KGRFILSINDVPE 236
>gi|167471900|ref|ZP_02336604.1| hypothetical protein RafrE_04385 [Rickettsia africae ESF-5] (182 aa)
Score = 140, Expect = 8.3e-07, Identities = 40/96 (41%), Positives = 51/96 (53%)
  Q:   206 MGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSD 301
           MG Y NP I D  N+   SK L+N  I+  D+           FVY DPPY+PI +T SFT Y K  F + +Q +L +    LN KG    +SNSD
  S:     1 MGAYMNPNIFDKDNILVCSKALQNAEIICQDFSNISP--KPKDFVYIDPPYQPINNT-SFTKYTKLGFTEADQVKLYEKCIALNKKGV-YFISNSD 92
>gi|71736103|ref|YP_274122.1| prophage PSPPH02, putative adenine modification methytransferase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556656|gb|AAZ35867.1| prophage PSPPH02, putative adenine modification methytransferase [Pseudomonas syringae pv. phaseolicola 1448A] (264 aa)
Score = 140, Expect = 8.4e-07, Identities = 67/293 (22%), Positives = 123/293 (41%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGE-INELLISNFD 349
           P + W+GGK +L + +   +P H      Y E F GG A+ F       V+   ++DIN +L+N+Y V++  ++E +       + F        KW  L  +  F   K        D+++AA   +L    F G  +V+ +     + G   N    +  NL A  ++L    +    + +  E  D+  TF Y DPPY           Y  D +  +N + +AD++     KG  ++  N  P            ++  ++ + V  +   ++    R + + EL+I N++
  S:     4 PIIPWMGGKRRLADRLIPLFPPHEC----YVEVFAGGAALYFMRPQAAPVE--VLNDINGDLVNLYRVVQNHLEEFV-------RQF--------KW-ALSSRQVFEWQKMTRPETLTDIQRAARFFYLQHHAFAG--KVSGQTFGTATTGPAINLLRIEE-NLSAAWQRLSGTYVENLPWLECAERYDRPQTFHYMDPPYWQT------AGYGVD-YPFENYERMADFMRTC--KGKVMVSINDHPD--------IRRVFEEFHFETVDIRYTSSNQRRGRTDVVGELVIMNWE 256
>gi|167729488|emb|CAO80399.1| putative N6 adenine-specific DNA methyltransferase, D12 class [Candidatus Cloacamonas acidaminovorans] (273 aa)
Score = 139, Expect = 1.1e-06, Identities = 75/290 (25%), Positives = 126/290 (43%)
  Q:    61 WVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKS-EEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDI 350
           W+GGK  L   I  Y P     IT + EPF GG A +     K+   E+Y +D++  L+N++  +KY   ELI      E D+L+ +           +  F ++ ++E     ++++AA  ++L    F      +K   F  S     +        ++ + ++L  V I    Y+K  E++  K+ F Y DPPY        +T  N   F+ +      D   KL     + +LS  D     K       +Y  ++IK V   + IN     + E NE++I+NFD+
  S:     8 WIGGKRLLRKVIAPYVP---KDITGFIEPF-GGAAWMLLYKEKWGDLEVY-NDLDNRLVNLFLQVKYHPDELIK-----ELDWLVAS-----------RKLFGDILKQEG--LTEIQRAARFMYLITRSFG-----SKGDSFGTSQKRGTSSMYNRLERIKELHRRLDMVIIENLSYEKVIEKYDTKSNFFYCDPPY-----MLGYTYENSKQFSHE------DLCAKLKKIKGRFILSYDDNPEVLK-------LYKGFDIKHVTRTKGINRK-EGKSEFNEVIIANFDL 251
>gi|157311363|ref|YP_001469406.1| Dam DNA adenine methyltransferase [Enterobacteria phage Phi1] >gi|149380567|gb|ABR24572.1| Dam DNA adenine methyltransferase [Enterobacteria phage Phi1] (270 aa)
Score = 139, Expect = 1.1e-06, Identities = 69/292 (23%), Positives = 130/292 (44%)
  Q:    58 FLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGH--YKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEI-YSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
            + + G K +LL  + KY+P H N   ++ + F GG +V     S Y   ++  +D +  LI  Y  I      +  + +I+ ++ L R+  D    Y+  + ++NE          + +  +L + +  + F+ + R N+KG FN + G   +    +   LN +  +K  + ++   G Y + E  I    FVY DPPY  ITS      YNK  ++D+ + +   ++  +  +G +  +SN        ND   D I  +  N   +     ++  G    +  E+ ++N D
  S:     7 LIPYTGNKEKLLPGVSKYFPKHYN---RFVDAFCGGLSV-----SLYVEGDVLANDYDHRLIEAYKAIDECPDPVSTIKRIIAENDLSRDDKDA---YMAFRKKYNE----------NPDPLSLFVLIQHS-FSNINRHNRKGEFNANFGRRTFNENAVERVLNFKEENKDGR-ISFTSGRYDEIE--ILPGDFVYLDPPYL-ITSAE----YNK-FWSDEEEIKFYQWVESIMARGFQFGISNVTHHKGKANDHLLDFIKRNDLNCVLLNKTYCLDRSGGKSSDTQEVYVTNVD 270
>gi|39726296|gb|AAR30096.1| MspA1I methyltransferase [Moraxella sp. A1] (291 aa)
Score = 138, Expect = 1.2e-06, Identities = 58/204 (28%), Positives = 94/204 (46%)
  Q:    53 QVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPY 256
           Q +    ++ GGK      I ++ P H    T Y EPFVGGG++ F   +K +V+   ++D + +LIN Y +I+ +V EL+  L   E+    R+T    WY    KN F    E        +E+A    +LN+T ++G+  +N K  +      Y         +L   S KL+ V     D++   +      F++ DPPY
  S:     3 QAINSPFRYAGGKFYARKLILEHVPDH----TCYIEPFVGGGSIFF---AKDKVETNILNDADPDLINTYLIIRDRVDELVAALD-GEQALKERHT----WY----KNEFKPTNE--------LERAVRWYYLNRTSYSGI--MNPKNCYWGYGDKYSMRPENWGRSLIKTSAKLQGVEFTNLDFEDVIDNAPDGAFLFVDPPY 180
>gi|33620643|ref|NP_891634.1| DNA adenine methylase [Enterobacteria phage RB49] >gi|33438539|gb|AAL15134.2| DNA adenine methylase [Enterobacteria phage RB49] (270 aa)
Score = 138, Expect = 1.4e-06, Identities = 68/292 (23%), Positives = 131/292 (44%)
  Q:    58 FLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGH--YKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEI-YSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
            + + G K +LL  + KY+P H N   ++ + F GG +V     S Y   ++  +D +  LI+ Y  I      +  + +I+ ++ L R+  D    Y+  + ++NE          + +  +L + +  + F+ + R N+KG FN + G   +    +   LN +  +K  + ++   G Y + E  I    FVY DPPY  +TS      YNK  ++D+ + +   ++  +  +G +  +SN        ND   D I  +  N   +     ++  G    +  E+ ++N D
  S:     7 LIPYTGNKEKLLPGVSKYFPKHYN---RFVDAFCGGLSV-----SLYVEGDVLANDYDHRLIDAYKAIDECPDPVSTIKRIITENGLSRDDKDA---YMAFRKKYNE----------NPDPLSLFVLIQHS-FSNINRHNRKGEFNANFGRRTFNENAVERVLNFKEENKDGR-ISFTSGRYDEIE--ILPGDFVYLDPPYL-VTSAE----YNK-FWSDEEEIKFYQWVESIMARGFQFGISNVTHHKGKVNDHLLDFIKRNDLNCVLLNKTYCLDRSGGKSSDTQEVYVTNVD 270
>gi|15616565|ref|NP_244871.1| hypothetical protein BH4003 [Bacillus halodurans C-125] >gi|10176628|dbj|BAB07722.1| BH4003 [Bacillus halodurans C-125] (264 aa)
Score = 138, Expect = 1.5e-06, Identities = 72/245 (29%), Positives = 127/245 (51%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEK---DFLLRNTDDRKW----------YYLIKKNRFNELKEKEDNQFLDVEKAALMIFL-NKTCFNGLYRVNKKGLFNVSMGHYK-NPKI-CDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSN 299
           +K  L + GGK +LL +I   +P     I  + + F GG  V  +V +K  ++ I   D   E+I ++  IK   K+   +LQI+ K   D+ L +T+   +               K  F +L++  +N+  D     L  +L     FN   R NKKG +N+ +G    N KI  + +N   I K+ K+++ +  D+++ E  + +  F+Y DPPY  + ST+++   N   + ++ + +L   ++ L+ KG K  LSN
  S:    10 LKSCLNYTGGKHKLLGQIIPLFP---ENINNFTDLFCGGANVAINVNAKGVIRGI---DKQKEVIRLFKTIKQSDKD--EILQIINKIICDYSLSDTNKYGYSKYGCESGSGLAAYNKEHFLKLRQDYNNRMEDTIYYDLAFYLLTVYGFNNQIRFNKKGHYNIPVGKRDFNEKIKTNLVNFIRIIKE-KDIDFICSDFREVEIEMSQGDFLYADPPY--LISTATYNEQNG--WTEKEENDLLSLLDSLSEKGVKFALSN 257
>gi|77462169|ref|YP_351673.1| putative N-6 adenine-specific DNA methylase [Rhodobacter sphaeroides 2.4.1] >gi|77386587|gb|ABA77772.1| Putative N-6 adenine-specific DNA methylase [Rhodobacter sphaeroides 2.4.1] (268 aa)
Score = 138, Expect = 1.5e-06, Identities = 65/291 (22%), Positives = 122/291 (41%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITK-----YAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLE----AISKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISN 347
           P   W+GGK       K+ +P    +I       Y EPFVG G +      +  ++   ++D N E+IN++ +++    +L+ +++                + +  +  F+ L+  +     D+E+AA  ++L +  F G       G F +S G   N  +     LE    A   +L  V     D+ +    +    T  Y DPPY           Y + +F+      +A+ +  L  KG  +L  N  P+           ++  ++++ V+    + + GS+  E  ELL+SN
  S:     9 PVAPWLGGK-------KRLHPLILERIEAIPHRAYVEPFVGMGGIFLRRRFRPRLE--VMNDRNGEIINLFRILQRHYPQLLEIMR----------------FQICSRREFDRLRVTDPATLTDLERAARFLYLQRLSFGG----KPNGSFGISPG---NGPLFSLARLEPLLDAARTRLDGVVFECLDWAELIPRYDTAETLFYLDPPY-----FGGENDYGRGIFDRAQFARIAEILGGL--KGAFLLSINDTPE--------IRALFGRFHLEPVRLSYSVAASGST--EAQELLVSN 260
>gi|119509904|ref|ZP_01629047.1| DNA adenine methylase [Nodularia spumigena CCY9414] >gi|119465513|gb|EAW46407.1| DNA adenine methylase [Nodularia spumigena CCY9414] (312 aa)
Score = 137, Expect = 1.8e-06, Identities = 70/300 (23%), Positives = 136/300 (45%)
  Q:    51 NLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSD-------KNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDI 350
           N ++     ++ GGK      I K  P H+    KY EPF GG ++ F   +K  VK   ++D + EL+N Y  I+  V +LI          LL     +K  +   KN F     K  N   D+E+A    +LN+T ++G+ + ++   +     +   P+     +L   S++L+N+ +   D++     +    F++ DPPY        +T Y    F  ++ + L   + K  ++   ++  ++ P+  +       K D  ++   S  + ++   +++ N   S R +  E+ I+N+D+
  S:     5 NKKITNSPFRYPGGKFYARKLILKCIPEHD----KYCEPFAGGSSIFF---AKNNVKFNILNDKDEELVNCYIQIRDNVNKLI---------LLLEGIPAKKELHSYYKNEF-----KPSN---DLERAMRWFYLNRTSYSGIMK-HQNCYWGYGDKYSMRPENW-AFHLRTTSERLQNIEVYNLDFEILINQLPNGYFLFIDPPYFNADQNKFYTCY----FTQEDHERLCQLLKKHQHRFQFLITYDNSPEIREMYNWCVSKQDREWNYTISRTDDQK-NGRKLENGYQSGRYKGKEIFIANYDV 280
>gi|166364241|ref|YP_001656514.1| DNA methyltransferase [Microcystis aeruginosa NIES-843] >gi|166086614|dbj|BAG01322.1| probable DNA methyltransferase [Microcystis aeruginosa NIES-843] (297 aa)
Score = 136, Expect = 2.5e-06, Identities = 74/296 (25%), Positives = 139/296 (46%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKND---SFFDEIYSAYNIKRVKAK----RMINSDGSSRGEINELLISNFDINK 352
           PF ++ GGK      I    P H+    KY EPF GG ++ F   +K  V E  ++D + EL+N Y  IK  +  LI +L+ +     L N      YY   KN F            D+E+A    +LN+T ++G+ ++ +   +     +   P+   + +L+  S+KL+NVN+   D++     +  + F++ DPPY        ++ +    F+ ++ + L   + K  ++   +L  ++  +  +  D   S  D  ++ Y I R   +    ++ +   S R +  E+ I+N+D+ K
  S:    12 PF-RYPGGKFYARKLILACLPSHH----KYCEPFAGGASIFF---AKESVAENILNDKDEELMNCYRHIKDHLDSLIELLKDLNATKELHN------YY---KNEFQPAN--------DLERAMRWYYLNRTSYSGIMKL-ENCYWGYGDKYSMRPENWPS-HLKTTSEKLQNVNLSCLDFEDLINQLPDDYFLFVDPPYFQADQNKFYSCF----FSLEDHERLCKTLKKHQHRFKFLLTYDNCSEIREMYDWCISLQDNEWN-YTINRTDDQKNGLKLEHGYQSERRKGKEVFIANYDLQK 282
>gi|163758733|ref|ZP_02165820.1| Adenine specific DNA methyltransferase, D12 class [Hoeflea phototrophica DFL-43] >gi|162284023|gb|EDQ34307.1| Adenine specific DNA methyltransferase, D12 class [Hoeflea phototrophica DFL-43] (267 aa)
Score = 135, Expect = 2.6e-06, Identities = 58/256 (22%), Positives = 107/256 (41%)
  Q:    48 INNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPK 303
           ++N ++ + P   ++GGK  L   I +    +    T YAEPFVG G V     SK   +   I+D N E+ N++ +++    + +  L+                + +  +  F  L   +     D+E+AA  ++L +  F G       G+     G +   ++     LE I +++  V I   D++   +  D+     Y DPPY       +   Y   +F+  + +E+A  +  L  +G  IL  N  P+
  S:     1 MSNPVKPISPPAAYIGGKRILAKAIIER--INATPHTGYAEPFVGMGGVFLRRASKPRTE--VINDFNGEVANLFRILQRHYPQFMETLK----------------FQITSRREFQRLVGCDPATLTDLERAARFLYLQRLSFGGKVTGQNFGVAKDGGGRFNITRLGPV--LEDIHERMAGVVIEQLDWRDFLKRWDRPGMLFYLDPPY-----YGNEDDYGPGMFSRSDFEEMAATLKGL--RGGVILSLNDRPE 228
>gi|167837451|ref|ZP_02464334.1| prophage PSPPH02, putative adenine modification methytransferase [Burkholderia thailandensis MSMB43] (264 aa)
Score = 135, Expect = 2.9e-06, Identities = 49/203 (24%), Positives = 87/203 (42%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKN---RFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGD--------YKKSEEFIDKNTFVYFDPPY 256
           + +P + W+GGK +L  ++   +P H      Y E F GG A+ F  L         ++DIN EL+N+Y V+++ ++E +                 R++ Y I      ++++L   E     D+++AA   +L    F G           V    +       ++NL  I + L   ++            Y+    +   +TF Y DPPY
  S:     1 MAQPIIPWLGGKRRLAEQLIPLFPQHEC----YVEVFCGGAALYF--LRPMPAPVEVLNDINGELVNLYRVVQHHLEEFV-----------------RQFKYAISSRQVFKWHQLAVPE--TLTDIQRAARFYYLQHHAFGG----------KVEGQTFGTATTAPSVNLLRIEESLSAAHLRLAGAHVENLPWYECMARYDRTHTFFYCDPPY 179
>gi|167032234|ref|YP_001667465.1| D12 class N6 adenine-specific DNA methyltransferase [Pseudomonas putida GB-1] >gi|166858722|gb|ABY97129.1| D12 class N6 adenine-specific DNA methyltransferase [Pseudomonas putida GB-1] (265 aa)
Score = 135, Expect = 3.0e-06, Identities = 63/271 (23%), Positives = 114/271 (42%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSF----FDEIYSAYNIKRVKAK 327
           P + W+GGK +L + +   +P H      Y E F GG A+ F       V+   ++D+N +L+ +Y V++  ++E +       + F        KW  L  +  F   K        D+++AA   +L +  F    ++  +     + G   N    +  NL A  ++L    + +  +    E  D+ +TF Y DPPY           Y  D F  +  + +A+++ +   KG  ++  N  P      + F     D  YS  N ++ KA+
  S:     4 PIIPWMGGKRRLADRLIPLFPPHEC----YVEVFAGGAALFFMRPQPAPVE--VLNDLNGDLVTLYRVVQNHLEEFV-------RQF--------KW-ALSSRQIFEWQKMTRPETLTDIQRAARFFYLQQHAFGA--KLTSQAFGTATTGPAINLLRIEE-NLSAAWQRLAGTYVEHLSWLDCAERYDRAHTFFYMDPPYWQT------AGYGVD-FPFEEYERMAEFMRRC--KGRVMVSINDHPDIRRAFEGFHFESLDIRYSTTNQRQSKAE 245
>gi|159030849|emb|CAO88528.1| unnamed protein product [Microcystis aeruginosa PCC 7806] (297 aa)
Score = 135, Expect = 3.2e-06, Identities = 74/296 (25%), Positives = 139/296 (46%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKND---SFFDEIYSAYNIKRVKAK----RMINSDGSSRGEINELLISNFDINK 352
           PF ++ GGK      I    P H+    KY EPF GG ++ F   +K  V E  ++D + EL+N Y  IK  +  LI +L+ +     L N      YY   KN F            D+E+A    +LN+T ++G+ ++ +   +     +   P+   + +L+  S+KL+NVN+   D++     +  + F++ DPPY        ++ +    F+ ++ + L   + K  ++   +L  ++  +  +  D   S  D  ++ Y I R   +    ++ +   S R +  E+ I+N+D+ K
  S:    12 PF-RYPGGKFYARKLILACLPSHH----KYCEPFAGGASIFF---AKESVAENILNDKDEELMNCYRHIKDHLDSLIELLKDLNATKELHN------YY---KNEFQPAN--------DLERAMRWYYLNRTSYSGIMKL-ENCYWGYGDKYSMRPENWPS-HLKTTSEKLQNVNLSCLDFEDLINQLPDDYFLFVDPPYFQADQNKFYSCF----FSLEDHERLCKTLKKHQHRFKFLLTYDNCSEIREMYDWCISLQDNEWN-YTINRTDDQKNGLKLEHGYQSERRKGKEVFIANYDLEK 282
>gi|163705083|ref|ZP_02123092.1| D12 class N6 adenine-specific DNA methyltransferase [Methylobacterium nodulans ORS 2060] >gi|162429542|gb|EDQ40168.1| D12 class N6 adenine-specific DNA methyltransferase [Methylobacterium nodulans ORS 2060] (314 aa)
Score = 134, Expect = 3.8e-06, Identities = 61/232 (26%), Positives = 106/232 (45%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIK-YKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTC-FNGLYRVNKKGLFNVSMGH-YKNPKICDTLN---------LEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINK 287
           +P L+W GGK +L   I +++P H      Y EPF GGG+VL   L K  V     +D++ +++N++ V++  +  ELI  L +                    ++ +    E  +++     +  +  F+ ++   + L R   +  F    G+  K  + C T +         L AI ++L+ V I   D +      D   T  Y DPPY P T T+    Y  +L  D  Q EL + +++
  S:    27 RPLLRWHGGKWRLAPWIVRHFPAHRT----YIEPFGGGGSVL---LRKPRVFSELYNDLDGDVVNLFRVLRSRRAAELIHRLTLTP----------------FARDEYLAAYEPAEDEVERARRLLVRSFMGRSSNSHSLVRARGRSGFRRMSGYRSKADRNCTTPSRDWANYADALPAIIERLRGVAIEQCDGRDLLRTRDHAGTLFYVDPPYLPSTRTTD-VGYAHELTEDA-QAELLELLDE 246
>gi|28870552|ref|NP_793171.1| DNA adenine methylase, putative [Pseudomonas syringae pv. tomato str. DC3000] >gi|28853800|gb|AAO56866.1| DNA adenine methylase, putative [Pseudomonas syringae pv. tomato str. DC3000] (264 aa)
Score = 133, Expect = 4.9e-06, Identities = 51/200 (25%), Positives = 87/200 (43%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPY 256
           P + W+GGK +L + +   +P H      Y E F GG A+ F       V+   ++DIN +L+ +Y V++  ++E +       + F        KW  L  +  F   K        D+++AA   +L    F G  +V+ +     + G   N    +  NL A  ++L    +    + +  E  D+ +TF Y DPPY
  S:     4 PIIPWMGGKRRLADRLIPLFPPHEC----YVEVFAGGAALYFMRPQAAPVE--VLNDINGDLVTLYRVVQNHLEEFV-------RQF--------KW-ALSSRQVFEWQKMTRPETLTDIQRAARFFYLQHHAFAG--KVSGQTFGTATTGPAINLLRIEE-NLSAAWQRLSGTYVENLPWLECAERYDRPHTFHYMDPPY 179
>gi|153870799|ref|ZP_02000122.1| DNA adenine methylase [Beggiatoa sp. PS] >gi|152072732|gb|EDN69875.1| DNA adenine methylase [Beggiatoa sp. PS] (311 aa)
Score = 132, Expect = 5.8e-06, Identities = 62/249 (24%), Positives = 107/249 (42%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTL--NLEAISKKLKN-VNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDK 307
           +++ G K  L   I  Y+P   N I +  EPF G  A+      +   K+ +++D+N  LI +  +I  + +E   +    EK +  +  D    YY +++ +FN+  + +             ++L   C  G  R N++G FN S    +      T+  N+  +S  LK+  +    DYK     I  +  +Y DPPY+ +        Y    FN     E  + + KLN +    ++S  D K  DK
  S:    15 IQYQGSKRALAPIILSYFP---NDIDRLIEPFAGTAAISVASAHQNLAKKYWLNDLNKPLIKLLELIIEQPEE---IANFYEKIWWKQEQDSIGHYYAVRE-KFNQTDDPK-----------CFLYLLSRCAKGSVRYNREGYFNQSPDKRRKGTKPQTMKKNILGVSYLLKDKTHFSCRDYKDMLANISTHDLIYMDPPYQGVCKDKDARYYASINFN-----EFVETLGKLNAQKLSFIIS-YDGKTGDK 242
>gi|148555114|ref|YP_001262696.1| D12 class N6 adenine-specific DNA methyltransferase [Sphingomonas wittichii RW1] >gi|148500304|gb|ABQ68558.1| D12 class N6 adenine-specific DNA methyltransferase [Sphingomonas wittichii RW1] (288 aa)
Score = 132, Expect = 6.5e-06, Identities = 61/210 (29%), Positives = 99/210 (47%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCF-NGLYRVNKKGLFNVSMGHYKNPKICDTLN-----------LEAISKKLKNVNIVYGDYKKSEEFI----DKNTFVYFDPPYRPITSTS 263
           V +P L+W+GGK +L   I +++P H      Y EPF G  +VL      Y   EIY +D++ EL+N++ V++    E      ++E    +R T   +  YL+      ++          VE+A  MI  +      G  R+++   F       ++  I  T N           L AI  +L+ V+I   D + + E I    D    +Y DPPY P T ++
  S:    11 VPRPLLRWLGGKFRLAPWIIEHFPPHR----IYVEPFGGAASVLLQKPRAY--NEIY-NDLDGELVNLFRVLRSDAAE-----ALIEA---VRLTPYARADYLLAYEPCEDV----------VERARRMIVRSHMGHGTGGARIDRPSGF-------RSDGISGTTNVAGEWADLPGALAAIVDRLRGVSI---DCRPALELIAVYDDPKALIYLDPPYVPETRST 201
>gi|177663850|ref|ZP_02939654.1| DNA adenine methylase [Cyanothece sp. PCC 8801] >gi|196247036|ref|ZP_03145750.1| DNA adenine methylase [Cyanothece sp. PCC 8802] >gi|172077564|gb|EDT62974.1| DNA adenine methylase [Cyanothece sp. PCC 8801] >gi|196205069|gb|EDX99873.1| DNA adenine methylase [Cyanothece sp. PCC 8802] (319 aa)
Score = 132, Expect = 7.0e-06, Identities = 72/295 (24%), Positives = 142/295 (48%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPK-------NSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDIN 351
           PF ++ GGK      I    P HN    KY EPF GG ++ F   +K  VK+  ++D +  L+N Y  I+  V+++I  L+ +        T +   YY   KN+FN           D+E+A    +LN+T ++G+ +  +   +     +   P+     +L   S++L+ V ++  D++K    +    F++ DPPY        F  Y+   F+ ++ + L+  + K  +K   ++  ++ P+        +   D+ ++   S  + +R K +++ +   SSR +  E+ I+N+D++
  S:    12 PF-RYPGGKFYARKLILSCLPTHN----KYCEPFAGGASIFF---AKENVKQTILNDKDELLMNCYQQIRDNVEQIIQSLEGIPA------TKELHSYY---KNKFNPSN--------DLERAVRWYYLNRTSYSGIMK-QENCYWGYGDKYSMRPENWPH-HLRTTSERLQGVELLCLDFEKVINELSNGFFLFIDPPYFN-ADQDKFYTYS---FSLEDHERLSWLLRKNQDKYKFLITYDNTPEIRKMYQWCTSIQDNEWNYTISRTDDQRNK-RKLQDGYQSSRYKGKEVFITNYDLS 281
>gi|126463763|ref|YP_001044876.1| D12 class N6 adenine-specific DNA methyltransferase [Rhodobacter sphaeroides ATCC 17029] >gi|126105574|gb|ABN78104.1| D12 class N6 adenine-specific DNA methyltransferase [Rhodobacter sphaeroides ATCC 17029] (321 aa)
Score = 131, Expect = 7.5e-06, Identities = 63/284 (22%), Positives = 114/284 (40%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRG 338
           ++P   W+GGK  L   I             YAEPFVG   +     S+   +   I+D   ++ N++ +++    + +  L+                + L  +  F  L   + +   D+E+AA  ++L +T F G       G+ +   G + N    + + LE +  +L  V +   D+       D+  T  Y DPPY       S T Y + +F  ++   +A+ + +L  +G  +L  N  P+           I+  + I  V     I+  GS+RG
  S:    39 LQPVATWIGGKRNLARRICAI--LDRTPCLTYAEPFVGMAGIFLRRSSRPRAE--VINDRGRDVANLFRILQRHYPQFLDTLR----------------FQLTTRTEFERLVATDPDTLTDLERAARFLYLQRTAFGGKVSGRNFGVSSHRPGRF-NLTTLEPM-LEDLHSRLAGVIVECLDWADFLARYDRPETLFYLDPPY-----WGSETDYGRGMFRREDFGLMAERLAQL--QGRFLLSINDVPE--------IRAIFGRFRIAEVTTTYSIS--GSARG 284
>gi|186682781|ref|YP_001865977.1| D12 class N6 adenine-specific DNA methyltransferase [Nostoc punctiforme PCC 73102] >gi|186465233|gb|ACC81034.1| D12 class N6 adenine-specific DNA methyltransferase [Nostoc punctiforme PCC 73102] (284 aa)
Score = 131, Expect = 7.9e-06, Identities = 60/206 (29%), Positives = 99/206 (48%)
  Q:    51 NLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPY 256
           N  +  PF ++ GGK    N I  + P H    + Y EPF GGG++ F    K +V   +++DI+  LIN   +I+ + +ELI  L           T +R  YY   KN F        NQ   +E+A    +LN+T ++G+ + ++   +     +   P+     N+   S KL+NV I   D+++  E +   +F++ DPPY
  S:     2 NKPINSPF-RYPGGKFYARNLILNHIPSH----SYYVEPFAGGGSIFF---VKDKVNINWLNDIDELLINTLLIIRDQPEELIKFLAGESA------TKERHTYY---KNEF-----IPQNQ---LEQAGRWFYLNRTSYSGIMK-HQNCYWGYGDKYSMRPENWPR-NIRRTSDKLQNVQITNLDFEEVIESVPNGSFLFIDPPY 180
>gi|58865223|emb|CAI52506.1| DNA-methyltransferase [Geobacillus stearothermophilus] (312 aa)
Score = 130, Expect = 1.1e-05, Identities = 73/280 (26%), Positives = 130/280 (46%)
  Q:    30 LSKYIFGTRILSLRQ-KVEINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDR-KWYYLIKKNRFNELKEKEDNQFLDVEKAALMIF-LNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAIS--KKLKNVNIVY--GDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKND 309
           +S +IF  +IL  ++ KV     ++ +K  L + GGK +LL++I   +P    +I  + + F GG  V  +V              NA  I    +I Y + +L+   Q    D +L + + R + Y L K N+   L  ++   + +  +  L ++ L    FN + R N K  FN   G  ++    DTL  + +    ++ + NIV+   D++ S +    N F Y DPPY       +        ++++ +  L +++++LN KG K  LSN       +ND
  S:     1 MSFFIFLIKILLFKEGKVMQTTKVKYIKSPLNYTGGKFKLLDQILPKFP---KRIDTFVDLFCGGCNVGINV--------------NANKIICNDIIDYLI-QLLKYFQTHSIDHILSHIETRIQEYNLSKSNKEGYLALRD---YYNKHRFILDLYVLTCYSFNHVIRFNSKHEFNAPFGQNRS-HFNDTLKKKLVDFVNEIHSKNIVFTNNDFEISLDEFGPNDFFYCDPPYLISQGVYNDGKRGFKGWDEEQEIRLLNFLDRLNEKGIKFALSNVFENKGLRND 265
>gi|163759281|ref|ZP_02166367.1| Adenine specific DNA methyltransferase, D12 class [Hoeflea phototrophica DFL-43] >gi|162283685|gb|EDQ33970.1| Adenine specific DNA methyltransferase, D12 class [Hoeflea phototrophica DFL-43] (279 aa)
Score = 130, Expect = 1.1e-05, Identities = 50/202 (24%), Positives = 88/202 (43%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITK--YAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK----NTFVYFDPPY 256
           V P   ++GGK QL   +         QI    YAEPFVG G V F    +   +   I+D + ++  ++ +++    + +  L+                + +  ++ F+ L + +     D+E+AA  ++L +  F G       G+ + + G   N  +   L L  I ++L  V I   D+   + FID+     T  Y DPPY
  S:    13 VSPPAAYIGGKKQLAQRVASIV----EQIPHGIYAEPFVGMGGVFFR--RRQAARSEVINDRSGDVTTLFRILQRHYPQFMDALK----------------FQITSRSDFDRLSKADPTTLTDLERAARFLYLQRLAFGGKVSGRSFGV-DYTGGARFNVNLLGPL-LAEIHERLAGVTIENLDW---QAFIDRYDRPETLFYLDPPY 193
>gi|47093526|ref|ZP_00231287.1| DNA methyltransferase [Listeria monocytogenes str. 4b H7858] >gi|47018086|gb|EAL08858.1| ulcer associated adenine specific DNA methyltransferase, putative [Listeria monocytogenes str. 4b H7858] (608 aa)
Score = 130, Expect = 1.2e-05, Identities = 70/293 (23%), Positives = 137/293 (46%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDIN---AELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDIN 351
           L ++G K++++ E+K   P   ++I K+ + F GG  V  ++ S+   K IY +D N    +L+  +S  KY+  + +  +Q M K F L  ++     YL  +N +N L   + +  L +    L  F  +  FN  Y  N     N     + N ++ + +   + + K +N       ++   + ID NTFVY DPPY     + +        +  +++++L D+ ++LN +G K ++S       + ND   D +         +  ++IN +     +  E++I N+D++
  S:   337 LNYIGSKSKMIAEMKPLMP---SEIDKFVDLFGGGFNVGINIKSQ---KTIY-NDTNWIVKDLVKSFS--KYETYDYLMYIQRMIKKFGLEASNRES--YLNVRNHYNSLPIADRDPRL-LYTVILYGFQQQIRFNSDYDFN-----NPVGMRWFNDRVLEKMVSFSRAIKEENFEFTSRSFEDYIDEIDSNTFVYMDPPYMLTNGSYNDGKRGFGGWTTEHEQKLMDFADELNRRGIKFMISYVLEHQGEVNDRMKDWL-------EYRLYKLINLNPIPGRKRKEVVIINYDLS 608
>gi|34557755|ref|NP_907570.1| methyltransferase [Wolinella succinogenes DSM 1740] >gi|34483472|emb|CAE10470.1| METHYLTRANSFERASE [Wolinella succinogenes] (369 aa)
Score = 129, Expect = 1.5e-05, Identities = 52/186 (27%), Positives = 93/186 (50%)
  Q:   100 VLSKYEVKEIYISDINAELIN-----VYSVIKYKVKELIPVLQIMEKDFLLRNTDDR--KWYYLIKKNRFNELKE----KEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYK-NPKICDT----LNLEAISKKLKNVNIVYGDYKKSEEFIDKNT-----FVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYI 285
           +L+  E ++  I +I   L+      ++  I+  + + +  ++ +EK   +   +DR       I+   +  L+E     E   + D    AL  F+    ++G++R N KG FNV  G    N K  D        E +  KL+   I   D+   EEF+ +++     F++ DPPY      S F+ Y  +LF  ++Q+ LA Y+
  S:   115 LLNWLEAQKASIGEIEGALLGCMNGFIFHFIQEAMLDKLSRMKTLEKKRGILKAEDRIKNLSSAIQAGHYTALRELYNHPERYDYSDSFLGALFFFIRSYAYSGMFRYNSKGEFNVPYGGIGYNKKFLDRKIAFFKSEELHAKLQATQIENLDF---EEFLRRHSPTKEDFIFLDPPY-----DSEFSTYAGNLFGKEHQERLASYL 313
Score = 125, Expect = 4.5e-05, Identities = 37/127 (29%), Positives = 70/127 (55%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIM--EKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAAL 181
           ++PF+KW GGK + L  I+ + P    ++ +Y EPF+GGGA+  D     +    YI+D + ELI +Y +I+ +    +  L+ +   K  LL    +R   ++ +++    LK+     +L+ +KA++
  S:     7 LQPFIKWAGGKERELPLIRPHLPL---RMERYFEPFIGGGALYLDT----QASAYYINDKSNELILLYRLIQTQEATFLEHLERLNQSKKALLSLAQERLALWICEESL--HLKDSSLLNWLEAQKASI 126
>gi|148322364|gb|EDK87614.1| site-specific DNA-methyltransferase (adenine-specific) [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (321 aa)
Score = 129, Expect = 1.6e-05, Identities = 82/269 (30%), Positives = 139/269 (51%)
  Q:    47 EINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIK-YKVKELIPVLQIMEKDFLLRNTDDRKWYY--------LIKKNRFNELKEKED-NQFLD--VEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYK-NPKICDTLNLEAISKKLKNVNIVYGDYKKSE-EFIDKNTFVYFDPPYRPITSTSSFTAYNKD-LFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEI 315
           E   N  V  PF  + GGK +LL +++K   F   +I  + + F GG  V  +  S     +I  +D+NA++I++   IK    ++L+  +  +  ++ L NT    + Y        L   N+   LK ++D N+ L+  +E   L+  L    FN   R N KG FN+ +G    N K+ + L L +   K K +     D+++ +   I KNTF+Y DPPY   T+      YN++ ++ D+ +K+L +++ +L+ KG K  LSN     + +N    D I
  S:    11 EDRKNRLVSSPF-NYTGGKYKLLEQLQKL--FKEEEI--FLDIFAGGANVGINSKSP----KIIFNDVNAKIISLIEHIKNIDTEKLLKKIDDIIVEYGLSNTMLYGYKYYSCNSSEGLANYNKEAFLKLRKDYNKKLNEGIEDYILLYVLIVFSFNNQVRFNSKGEFNLPVGKRDFNSKMRNKLILFSKKLKEKEIEFCSKDFREIDINKISKNTFIYCDPPYLITTA-----GYNENGMWTDKEEKDLLNFLKELDKKGLKFALSNVLESKNKENKILKDWI 280
>gi|148245156|ref|YP_001219849.1| DNA methylase [Clostridium kluyveri DSM 555] >gi|146337036|gb|ABQ23647.1| predicted DNA methylase [Clostridium kluyveri DSM 555] (251 aa)
Score = 128, Expect = 1.8e-05, Identities = 73/291 (25%), Positives = 126/291 (43%)
  Q:    58 FLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEI-NELLISNF 348
           F+ W+GGK  L  EI K +P + N   +Y E F G   VLF    K    E+Y +D+N +L+N++  +K+   EL   L  M         + R+ +Y       + + +       D++KAA    L KT +    R         S G  K         L  I ++L  V I   D++   +  DK ++ +Y DPPY           Y +  F++++ + L +    L  +  K +LS +D +       F  ++Y  +N+  V+    +      +  I +EL+I+N+
  S:     4 FIGWIGGKKLLRKEIVKRFPENFN---RYIEVFGGAAWVLFSK-EKLANMEVY-NDVNGDLVNLFRCVKFHCGELQRELSFM--------LNSRELFY-------DFISQYSTRGMTDIQKAARFFMLIKTSYGSDCR---------SYGCVKKDVNVMVKYLTEIQERLSRVVIENKDFQDLLKVYDKDDSLIYLDPPYYGTER------YYQVQFSEKDHERLYEV---LKGEKGKFILSYNDCE-------FIRQLYKDFNMDEVERNHNLLGKYKDKKHIYSELIITNY 251
>gi|89892813|ref|YP_516300.1| hypothetical protein DSY0067 [Desulfitobacterium hafniense Y51] >gi|89332261|dbj|BAE81856.1| hypothetical protein [Desulfitobacterium hafniense Y51] (276 aa)
Score = 126, Expect = 3.0e-05, Identities = 74/295 (25%), Positives = 129/295 (43%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIM---EKDF-LLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKN-TFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRM--INSDGSSRGEINELLISNFDINKK 353
           + W+GGK  L   I   +P +     +Y E F GGG +LF      +  E+Y +D N  L+N+Y  ++ K +EL+  L+ +     DF L+RN   R                  D+   DV++AA    L +  +         GL   S G   +    +   +E   ++L  V +   D+++     D+  +F Y DPPY    + S +    +D F +++   L D + +      K LLS +D         F  ++Y A  I+     R+  I     +  +  E+LI+N+D+ ++
  S:     1 MSWIGGKKALRELIVTLFPLY---YERYIEVFGGGGWILFHKFPGNDF-EVY-NDFNGLLVNLYRCVREKPEELMDALRYVLNSRADFELVRNALAR------------------DSPASDVQRAAWFYQLIRYSY-------ASGL--TSYGSQPHDMRSNFPLIEQAHRRLAKVVVENKDFERLIGQYDRPVSFFYCDPPY--FETESYYKNVGEDGFTEKDHIRLRDALMRAQG---KFLLSYNDC-------GFIRDLYDAPGIQIDSYTRINNIKQRYDNGAQFPEILIANYDMQER 258
>gi|167729201|emb|CAO80112.1| putative N6 adenine-specific DNA methyltransferase, D12 class [Candidatus Cloacamonas acidaminovorans] (261 aa)
Score = 126, Expect = 3.3e-05, Identities = 79/293 (26%), Positives = 128/293 (43%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF---------DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDIN 351
           + WVGGK  L  +I    P H+     Y E F G   +LF          +  K    E+Y +DIN +L+N +  IK   +  +  L                  YL+ +  F+   + E    L+    A+  + N  C  G    N    F V+ G YK   + +   ++  S++L++V I    ++K    F   +TF Y DPPY   T    +   + D FN    KELA+ + ++  KG  +L  N+DP        +  ++Y    I  V+ +  ++  G+ + E  ELLI N+  N
  S:     5 ISWVGGKRILRKKILPLIPKHD----IYCEVFGGAAWILFGKSANKEDWQLSKKSRYTEVY-NDINGDLVNFWRYIKQHPEAFVTELN----------------QYLVSREMFDNFMKHEPRTELE---RAIKFYYNLACSYGSRSKN----FCVNQG-YKYMPLRNLDKVKEASERLRHVIIEKQPWEKIVSRFDHPHTFFYLDPPY--YTKEYLYEREDADAFN--QHKELAEVLKQI--KGKFLLSYNNDP--------YIRQLYDGCVIDEVETQYTVS--GAFQTE-TELLIRNYKSN 261
>gi|85057659|ref|YP_456575.1| adenine-specific methyltransferase [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789764|gb|ABC65496.1| adenine-specific methyltransferase [Aster yellows witches'-broom phytoplasma AYWB] (294 aa)
Score = 125, Expect = 3.9e-05, Identities = 62/247 (25%), Positives = 115/247 (46%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEK---DFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPK-----ICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSD 301
           ++ F+ WVG K +LL  +         +   Y EPF+G GA+   ++ K  +    ++D + +LI ++  I Y  ++        E     +       +K  +    N++N L  K  N+     KA+L   L+K CF G+ R         + G+    K     + D  +L+   +K K+V ++  DY+K      K+ F++ DPPY       + ++++K +F    Q +L + + K + +G K L +N D
  S:    14 MQKFINWVGCKKKLLPHLLPLI---PKKFKTYYEPFLGSGALYLSLMPKKAI----LNDNDTQLIQIWKSILYNPQDFYNKALAFENFIYQYPKSQQKQQKEAFKTLLNQYNHLLTKNKNR---STKASLFFILSKYCFRGILRYKDNTSLYTNFGYKSKYKTSLLNLNDLFSLQKHFQKNKHV-LLCTDYQKIIAATKKDDFLFIDPPYYN-GKNITISSFDKGVFGFTEQVKLFNCLEKADKRGVKWLYTNYD 256
>gi|83319264|ref|YP_424046.1| DNA adenine methylase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283150|gb|ABC01082.1| DNA adenine methylase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (325 aa)
Score = 125, Expect = 4.2e-05, Identities = 80/309 (25%), Positives = 157/309 (50%)
  Q:    45 KVEINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKE----LIPVLQIMEKDFL------------LRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHY---KNPKICDTLNLEAI-SKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDINKK 353
           ++ + NN++   PF  +VG K +++ +I K++P    +I  Y EPF+GGG+ +       +  + +++DIN  +I+++  +    K     L  + ++++K  L            L+    + +Y    K  + EL+   + +  +++   L+I+     FN + R N++G FN+ +G+    KN        LE +  K+++  N  Y ++ K  +F  +  FVY DPPY  + S S +   N  + ++QN   L D I+ L+ K     LSN       KN    ++    Y I  +K+  +   D   + +  E+ I+N++ N++
  S:    18 RLLVKNNIR--SPFF-YVGDKYKIMPQIVKFFP---EKINNYYEPFLGGGSSVMHT----KANKYFLNDINKSVIDLHKCLSSYSKNKNLLLNSLFKLIKKYRLSCSYLSITVPDELKKKYVKTYYSKFNKKSYIELRNDYNKKSDNLKLYLLLIY----GFNHMIRFNQQGKFNLPVGNVDFNKNVYQALITYLEFVDDKRIEFSNNDYIEFIKKIDF-KEGDFVYLDPPY--LISNSEYNK-NWTMIDEQN---LYDLIDNLDRKKVYFGLSNMLTHKGRKN-YLLEKRMKKYYIHEIKSNYISRFDNKIKKDSKEVYITNYEKNRR 324
>gi|166364128|ref|YP_001656401.1| DNA methyltransferase [Microcystis aeruginosa NIES-843] >gi|166086501|dbj|BAG01209.1| probable DNA methyltransferase [Microcystis aeruginosa NIES-843] (251 aa)
Score = 124, Expect = 5.7e-05, Identities = 52/206 (25%), Positives = 90/206 (43%)
  Q:    86 YAEPFVGGGAVLFDV--LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSM-GHYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNK 291
           Y EPF GGG+V F V  L   ++K  +I+D+N +L   +   +  ++ L+  +  ++++            Y   +  F +L  +ED +  D EKA     LN+  F+G   V+  G    +    + +  I     L  I+  L +V I   DY++      K  F++ DPPY   T  S       +L    + +  AD + +   K
  S:    14 YREPFFGGGSVFFAVKQLFDQQIKTYWINDLNYDLYCFWQCAQENIELLVAKITEIKQE------------YDNGRELFQDLT-REDLKLTDFEKAVRFFILNRITFSG--TVDSGGYSQAAFTSRFTDSSIA---RLTQIAPLLASVKITNQDYEELLFAEGKEVFIFLDPPYYSATK-SRLYGVRGNLHTSFDHQRFADNMRQCQAK 203
>gi|121535720|ref|ZP_01667523.1| DNA adenine methylase [Thermosinus carboxydivorans Nor1] >gi|121305685|gb|EAX46624.1| DNA adenine methylase [Thermosinus carboxydivorans Nor1] (377 aa)
Score = 123, Expect = 6.8e-05, Identities = 46/147 (31%), Positives = 73/147 (49%)
  Q:   177 EKAALMIFLNKTCFNGLYRVNKKGLFNVSMG--HYKNP---KICDTLNLEAISKKLKNV---NIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSF-----------FDEIYSAYNIKR 323
           E+AA+  F+ + C+  ++R N+ G FN+  G   Y      K  D L   A  + L      N+ + D+  +    D++ FV+FDPPY      S F  Y    F   +Q+ LA+ +  L      I+      KN+D   +            FD+ Y AYN++R
  S:   210 ERAAIFYFIREYCYGAMFRYNRAGEFNIPYGGMAYNGKDFGKKIDRLLAPATVRCLAAAELYNLDFADFLDAARPTDRD-FVFFDPPY-----DSDFADYEGRTFTRADQRRLAERLYGLAAPFILII------KNTDYIHTLYAGRPNLTILAFDKQY-AYNVRR 362
Score = 115, Expect = 6.0e-04, Identities = 23/72 (31%), Positives = 40/72 (55%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIK 126
           ++P +KW GGK +    I++  P       +Y EPF GGGA+ F    + E +   ++DI+A+L+  Y  ++
  S:     1 MQPLIKWPGGKAREFRYIERLIP----PFDRYIEPFFGGGAIYF----RLEPQRALVNDISADLMQFYRFVR 64
>gi|172034931|ref|YP_001801432.1| putative site-specific DNA-methyltransferase [Cyanothece sp. ATCC 51142] >gi|171696385|gb|ACB49366.1| putative site-specific DNA-methyltransferase [Cyanothece sp. ATCC 51142] (322 aa)
Score = 122, Expect = 8.3e-05, Identities = 74/295 (25%), Positives = 132/295 (44%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGH---YKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKND---SFFDEIYSAYNIKRVKAKRMINSDGS----SRGEINELLISNFDIN 351
           PF ++ GGK      I    P H++    Y EPF GG ++ F   +K  VK   ++D + +L+N Y  I+  V++LI          LL     +K  +   KN F            D+E+A    +LN+T ++G+ +       N   G+   Y         +L   S++L+ V+I   D+++    +    F++ DPPY        +T      F  ++ + L   + K  +K   ++  ++ P+  +  +   S  D  ++ Y I R   ++   + G     SR +  EL I+N+DIN
  S:    21 PF-RYPGGKFYARKLILASLPEHDS----YCEPFAGGASIFF---AKPTVKNNILNDKDEDLVNCYISIRDHVEKLIS---------LLDGIPAKKELHSYYKNEFQPQN--------DLERAMRWYYLNRTSYSGIMKPQ-----NCYWGYGDKYSMRPENWPYHLRTTSERLQGVDIYCLDFEELIGSLSDGYFLFIDPPYFNADQDKFYTCS----FTTEDHQRLCSLLQKNKSKYNFLITYDNSPEIKEMYNWCVSVQDNQWN-YTINRTDDQQNSRNLGDGYKGSRYKGRELFITNYDIN 290
>gi|83588900|ref|YP_428909.1| DNA adenine methylase [Moorella thermoacetica ATCC 39073] >gi|83571814|gb|ABC18366.1| DNA adenine methylase [Moorella thermoacetica ATCC 39073] (375 aa)
Score = 122, Expect = 8.8e-05, Identities = 29/85 (34%), Positives = 47/85 (55%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIM 139
           + P +KW GGK +   E++   P   + +  Y EPFVGGGAV F V    +   +YI+D   ELI +Y++I+   ++    L+ +
  S:     7 LSPIIKWAGGKEK---ELRYILPNLPSGVRNYYEPFVGGGAVFFAV----DRPAMYINDKAPELITLYNMIRENNRDFFQTLEAL 84
>gi|167757966|ref|ZP_02430093.1| hypothetical protein CLOSCI_00302 [Clostridium scindens ATCC 35704] >gi|167664398|gb|EDS08528.1| hypothetical protein CLOSCI_00302 [Clostridium scindens ATCC 35704] (275 aa)
Score = 122, Expect = 8.9e-05, Identities = 61/247 (24%), Positives = 115/247 (46%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNP-----KICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK----NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSD 301
           +K  L++ G K +L   I +Y P H+     Y EPF G  AVLF+   K +     ++D++ E++N + +++ +  EL   +++                    ++ +    E+ +++  +  + A+  ++   C N LYR    G  +    +  NP      + DT+ L   S++L+ V I   +   +EE I +    + F+Y DPPY  +  T     Y  ++ +D+  KEL   +  L     K+L+S  D
  S:    13 MKSVLRYPGAKNRLAPWICEYIPKHD----VYLEPFAGSLAVLFN---KPKSHIETVNDLDGEVVNFFRIVRDRESELRRAIELTP----------------FSRSEYEAAYEQTEDELENARRFAIKCWMGFGCGN-LYR---NGFKSGQQKNSPNPARAWAALPDTIELA--SERLREVQI---EKLPAEELIGRYDTEDVFIYADPPY--LHGTRKNYLYKCEM-SDEEHKEL---LGMLTRHPGKVLISGYD 230
>gi|168717081|ref|ZP_02749358.1| DNA adenine methylase [Escherichia coli O157:H7 str. EC4206] (122 aa)
Score = 122, Expect = 1.1e-04, Identities = 32/109 (29%), Positives = 62/109 (56%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV-LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKE 167
           +KW GGK  LL++IK++ P    +     EPFVG G+V  +   S+Y      ++DIN++LI++Y+++K +  E +       ++  +  T+  + YY  ++  FN+ ++
  S:     1 MKWAGGKYPLLDDIKRHLP----KGECLVEPFVGAGSVFLNTDFSRY-----ILADINSDLISLYNIVKMRTDEYVQA----ARELFVPETNCAEVYYQFRE-EFNKSQD 96
>gi|171911256|ref|ZP_02926726.1| D12 class N6 adenine-specific DNA methyltransferase [Verrucomicrobium spinosum DSM 4136] (284 aa)
Score = 121, Expect = 1.1e-04, Identities = 54/234 (23%), Positives = 115/234 (49%)
  Q:    56 KPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIK---YKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGL----YRVNKKGLFNVSMGHYKN-PKICDTLNLEAISKKLKNVNIVYGDYKKSEEFI----DKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLN 289
           +P +++ GGK +L   I  ++P H      Y EPF GGG+VL      Y   EIY +D+++E++N++ V++    +++E +        +FL          +L   + F + +      ++          ++++  NG     +R N    ++    ++ + P+      LE I ++L+ V I   + +++ + +    ++ T  Y DPPY           Y  ++ ++Q+Q EL +Y+++L+
  S:     5 RPLIRYHGGKWRLAPWIISHFPKHR----VYVEPFGGGGSVLLRKERSY--AEIY-NDLDSEVVNLFRVVRDDGLRLREALRCTPFARAEFL--------GAWLPADSSFEQARRSVVRAYMGFGSGG----VSESRPNGRVMTGFRSNTSRAYSTPASNWHSFPQA-----LELIVERLRGVVI---ENREAVQVMSAHDERTTLHYVDPPYVGSARGDGCGEYRHEMTDEQHQ-ELGEYLSRLS 222
>gi|39938895|ref|NP_950661.1| site-specific DNA methylase [Onion yellows phytoplasma OY-M] >gi|39722004|dbj|BAD04494.1| site-specific DNA methylase [Onion yellows phytoplasma OY-M] (294 aa)
Score = 120, Expect = 1.4e-04, Identities = 60/263 (22%), Positives = 122/263 (46%)
  Q:    86 YAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEK---DFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPK-----ICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           Y EPF+G GA+   ++ K  +    ++D + +LI ++  I Y  ++        E     +       +K  +    N++N L  ++  +   + KA+L   L+K CF+G+ R         + G+    K     + D  +L+   +K K+V ++  DY+K      K+ F++ DPPY       + +++ K +F    Q +L + + K + +G K L +N D             ++  Y  K +K+    N   +++   +E++I+N+
  S:    42 YYEPFLGSGALYLSLMPKKAI----LNDNDTQLIQIWKSILYNPQDFYNKALAFENFIYQYPKSQQKQQKEAFKTLLNQYNHLLTRKKKR---LTKASLFFILSKYCFHGILRYKDNTSLYTNFGYKSKYKTSLLNLNDLFSLQKHFQKNKHV-LLCIDYQKIIAVTKKDDFLFIDPPYYN-GKNITISSFYKGVFGFTEQVKLFNCLEKADKRGVKWLYTNYDTPE-------IRALFKNYYFKSIKSSTTHNL--TNKNNNHEIIITNY 294
>gi|167729489|emb|CAO80400.1| putative N6 adenine-specific DNA methyltransferase, D12 class [Candidatus Cloacamonas acidaminovorans] (258 aa)
Score = 120, Expect = 1.5e-04, Identities = 78/290 (26%), Positives = 128/290 (44%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLF---------DVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           + WVGGK  L  +I    P H+     Y E F G   +LF          +  K    E+Y +DIN +L+N +  IK   +  +  L                  YLI +  F+   + E    L+    A+  + N  C  G    N    F V+ G YK   + +   ++  S++L++V I    ++K    F   +TF Y DPPY   T    +   + D FN    +ELA+ + ++  KG  +L  N+DP        +  ++Y    I  V+ +  ++  G+ + +I ELLI N+
  S:     5 ISWVGGKRILRKKILPLIPKHD----IYCEVFGGAAWILFGKSANKEDWQLSKKSRYTEVY-NDINGDLVNFWKYIKNHPEAFVTELN----------------NYLIAREMFDNFMKHEPRTELE---RAIKFYYNLACSYGSRSKN----FCVNQG-YKYMPLRNMDKVKEASERLRHVIIEKQPWEKIVARFDQPHTFFYLDPPY--YTKEHLYEREDADAFN--QHEELAEALKQI--KGKFLLSYNNDP--------YIRQLYDGCIIDEVETQYTVS--GAFQTKI-ELLIRNY 258
>gi|108563838|ref|YP_628154.1| type II adenine specific DNA methyltransferase [Helicobacter pylori HPAG1] >gi|107837611|gb|ABF85480.1| type II adenine specific DNA methyltransferase [Helicobacter pylori HPAG1] (299 aa)
Score = 120, Expect = 1.8e-04, Identities = 77/292 (26%), Positives = 140/292 (47%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVI-KYKVKELIPVLQIMEKDFLLRNT--------DDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTC--FNGLYRVNKKGLFNVSMGHYK-NPKICDTLNLEAISKKLKNVNIVY-GDYKK--SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           PF  +VG K +L+ ++ K +P   N I ++ EPFVGGG+V  +     + K    +DI+  +IN++  + K+   EL   L  +   + L  +        + +K Y      ++N++  ++     +  +  ++         FN + R N KGLFN+ +G+   N  + + L    I    +N  I Y GDY    +     K+ +VYFDPPY       S + YNK L++  N+  L   ++ L+ KG    ++N      + N     E    Y I  +K+  +  +D + +    E+ ++N+
  S:     8 PFF-YVGDKYKLMPQLNKLFP---NNINQFIEPFVGGGSVFLNT----KAKRYLANDIDTNIINLHKTLSKFNTCELFDELSKIIIHYGLSFSFKGITAPDELKKQYIKTYYAKYNKIAYEKLRADFNSNQNNMLYLYLLLIYGFNHMIRFNSKGLFNLPVGNVDFNENVYNALK-NYIDFIQQNTIIFYNGDYIDFLNHTTYLKDDYVYFDPPY-----LISNSEYNK-LWDSDNEIALYGVLDNLDKKGVLFGITNLVYHKGETN-FILKEWAKKYYIFNIKSNYISYNDNTIKENSQEIFVTNY 298
>gi|149019287|ref|ZP_01834649.1| Adenine-specific methyltransferase [Streptococcus pneumoniae SP23-BS72] >gi|147931157|gb|EDK82136.1| Adenine-specific methyltransferase [Streptococcus pneumoniae SP23-BS72] (716 aa)
Score = 120, Expect = 1.8e-04, Identities = 85/296 (28%), Positives = 154/296 (52%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDV--LSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKD---FLLRNTDDRKWYY--------LIKKNRFNELKEKED---NQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISKKLKNVNIVYG--DYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKD-LFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEIN---ELLISNFD 349
           ++K  L + GGK +LL ++   +P   N    + + F GG  V  ++  ++K + K+  I+DI+ E+I+ Y  ++ + K++   L  +EK    + L NT    + +        L   N+   LK ++D     +   +K  L   L    FN   R N KG +N+ +G  ++        L    + L+N N V    D++K+   ++K  FVY DPPYR  T+     AYN++  +  ++  +L  Y++ +N+KG    LSN    N+ +N     +  S YN+  V      NS+  S+ +++   E+LI+N++
  S:   406 LIKSALNYTGGKYKLLPQLLPLFPESYNN---FIDLFSGGATVAVNLANINKSKTKKYIINDISEEVIDFYKYLESQ-KDVTVFLDKVEKAIEFYKLSNTQKYSYAHYGVNSSTGLGSYNKEAFLKLRQDYNKKNYNKFDKEVLFYLLIVFGFNNQIRFNNKGEYNLPVGK-RDFNANMKSKLITFIQGLQNYNFVIQSCDFRKTMNQVNKGDFVYTDPPYRITTA-----AYNENGAWTLKDDLDLFKYLDSINDKGAYFALSNVVIHNNKENKELM-KWASKYNL-HVLDYHYNNSNYQSKAKMSNTVEVLITNYN 711
>gi|169335892|ref|ZP_02863085.1| hypothetical protein ANASTE_02327 [Anaerofustis stercorihominis DSM 17244] >gi|169258630|gb|EDS72596.1| hypothetical protein ANASTE_02327 [Anaerofustis stercorihominis DSM 17244] (392 aa)
Score = 119, Expect = 2.2e-04, Identities = 42/173 (24%), Positives = 82/173 (47%)
  Q:   179 AALMIFLNKTCFNGLYRVNKKGLFNVSMG--HYKNPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDK-----NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDIN 351
           +A+  F+ +TC++ ++R NK G FNV  G   Y      + +N       + ++N    + K   +F++K     N F++ DPPY      + F+ Y ++ FN  +QK L+DY+         +++ N++  +               +I     K +++    +  E   LLI+N+ +N
  S:   216 SAIYFFIRQTCYSSMFRYNKSGKFNVPYGGISYNRKSFKNKINYFKDKNLINHLNKTIIENKDFYDFMNKYVPNENDFIFLDPPY-----DTEFSTYARNEFNKSDQKRLSDYLINECKANWMLIIKNTEYISDLYKKGIKTANNQQLSIFMFDKKYLVSFQDRNNKEAKHLLITNYKLN 390
Score = 112, Expect = 1.5e-03, Identities = 47/137 (34%), Positives = 71/137 (51%)
  Q:    57 PFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDF-LLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGL 193
           P  K+ GGK + L  I  + P   ++I  Y EPFVGGGAV F +    +  + +I+D + ELI +Y +IK + KE I  L+ +E ++ ++ N  D     LI  N +   K    N+    E+    +  NK  FNGL
  S:    12 PITKYPGGKEKELTHIIPHLP---DKINNYYEPFVGGGAVYFTI----KANKYFINDKSDELILLYKMIKTQNKEFIDKLEAIEYNWQIISNIVDFHKEELI--NLYKNYKNNFLNEQQLSEEITQFVLSNKDEFNGL 140
>gi|39939051|ref|NP_950817.1| site-specific DNA methylase [Onion yellows phytoplasma OY-M] >gi|39722160|dbj|BAD04650.1| site-specific DNA methylase [Onion yellows phytoplasma OY-M] (294 aa)
Score = 118, Expect = 2.8e-04, Identities = 59/263 (22%), Positives = 116/263 (44%)
  Q:    86 YAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPK-----ICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNF 348
           Y EPF+G GA+   ++ K  +    ++D + +LI ++  I Y  ++        E          +K      K   N+       +   + KA+L   L+K CF+G+ R         + G+    K     + D  +L+   +K K+V ++  DY+K      K+ F++ DPPY       + +++ K +F    Q +L + + K + +G K L +N D             ++  Y  K +K+    N   +++   +E++I+N+
  S:    42 YYEPFLGSGALYLSLMPKKAI----LNDNDTQLIQIWKSILYNSQDFYNKALAFENFIYQYPKSQQKQQKEAFKTLLNQYNHLLTKKKKRLTKASLFFILSKYCFHGILRYKDNTSLYTNFGYKSKYKTSLLNLNDLFSLQKHFQKNKHV-LLCIDYQKIIAVTKKDDFLFIDPPYYN-GKNITISSFYKGVFGFTEQVKLFNCLEKADKRGVKWLYTNYDTPE-------IRALFKNYYFKSIKSSTTHNL--TNKNNNHEIIITNY 294
>gi|89897415|ref|YP_520902.1| hypothetical protein DSY4669 [Desulfitobacterium hafniense Y51] >gi|89336863|dbj|BAE86458.1| hypothetical protein [Desulfitobacterium hafniense Y51] (311 aa)
Score = 117, Expect = 3.7e-04, Identities = 79/295 (26%), Positives = 130/295 (44%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDR---KWYYLIKKNRFNELKEKEDNQFLDVEKAAL---------MIFLNKTCFNGLYRVNK-KGLFNVSMGHYKNPKICDTLNLEAI-------SKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDINKK 353
           + WVGGK  L + I +  P    +  +Y E F GGG VLF   S     E+Y +D N++L N++  ++ +     P   + E +F   N  D       YL K+   NE  ++E    LD+ +  L          + L     N + R      L  +S G       C   ++          S++LK+  I   D++   +++  +N F+Y DPPY   T       + KD     +   L D +     K    L+S +D +       F  E+Y  +NI+ V     +     +  E  E+LISN+D  ++
  S:     5 ISWVGGKKALRDMIYQRMP---KEFGRYIEVFGGGGWVLFG-RSPDAAMEVY-NDFNSDLANMFRCVRDR-----PFALLKELNFFPLNGRDEFNVLKKYLEKEEFTNEYLQEE----LDIAQRVLGEPQFEEIKPVLLENAQMNDVKRAAAFYRLIRLSYGSGCTSYGCQPFDIRKTFHLLWQGSRRLKDTVIENKDFEALIKQYDRENAFIYCDPPYYQ-TEGHYAVEFKKD-----DHYRLRDTLASCQGKW---LVSYNDCE-------FIRELYKVFNIEAVSRINNLAQRYDNGSEYAEVLISNYDTGER 290
>gi|73749187|ref|YP_308426.1| methyltransferase [Dehalococcoides sp. CBDB1] >gi|73660903|emb|CAI83510.1| methyltransferase [Dehalococcoides sp. CBDB1] (371 aa)
Score = 116, Expect = 4.2e-04, Identities = 33/94 (35%), Positives = 53/94 (56%)
  Q:    55 VKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNT 148
           +KP LK+ GGK +   E+K   P     + ++ EPFVGGGA  F   S   +K  YI+DI+ ELI  Y  ++ +  + +  L ++ +D+ L +T
  S:    21 LKPILKYPGGKGR---ELKHILPAVPRTVDRFFEPFVGGGATYF---SMDNIKRYYINDISKELIATYRAVQLQDFDFLNTLSLINEDWKLIST 108
>gi|163782832|ref|ZP_02177828.1| D12 class N6 adenine-specific DNA methyltransferase [Hydrogenivirga sp. 128-5-R1-1] >gi|159881953|gb|EDP75461.1| D12 class N6 adenine-specific DNA methyltransferase [Hydrogenivirga sp. 128-5-R1-1] (290 aa)
Score = 116, Expect = 5.1e-04, Identities = 62/297 (20%), Positives = 125/297 (42%)
  Q:    54 VVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAISK------KLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDI 350
           ++K  L++ GGK++ +  + K++P       ++ EP +GG ++ F  +           D+N +L   +  +K   +ELI  ++ ++++      + R+ +  I       L  +E  +  D+++A     LN+  F+G           V  G Y            +I +       +KNV + + DY++      ++  ++ DPPY      S       DL  D + +     + + +++   I   NS+   +   D +  E   +Y +   K  ++    GS      ELLI+NF I
  S:     1 MIKSPLRYPGGKSKAVKFLSKFFP---RDFREFREPMMGGASLTFYWVQNKPSARFIAGDVNYDLYCFWKELKENKEELINEVKHIKQN----AKNGRELFESI-------LARREKQELSDLQRAVDFFILNRITFSG----------TVDCGGYSEQAFKKRFTWSSIERLERAYEVIKNVELYHCDYEELMNMEGQDVVIFLDPPYYS-ARNSRLYGRRGDLHTDFDHERFYKVVERSDHR-ILITYDNSEYIRNLYRDFYMVEWELSYGMTNYKRDKV--RVGS------ELLIANFPI 269
>gi|156432963|gb|ABU63299.1| cje0220 [Campylobacter phage CGC-2007] (190 aa)
Score = 116, Expect = 5.1e-04, Identities = 49/149 (32%), Positives = 65/149 (43%)
  Q:    42 LRQKVEINNNLQVVKPFLKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFD-VLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCF 190
           L+    I      +K    WVGGK  L  EI    P H +    Y E F G  +V +    SK EV    I+DIN ELIN++  I+ K + L  VL  M                +I +  F+ LK KE     D+E+AA   +L  T F
  S:    44 LKTSTLIKPTRTTLKAPFAWVGGKNYLAKEIIALMPEHKS----YIEVFGGALSVFYQKSASKIEV----INDINDELINLHLCIRNKPQSLTNVLNSM----------------IISRKIFHMLKNKEIKPRNDLERAAFYFYLISTSF 169
>gi|118725756|ref|ZP_01574392.1| D12 class N6 adenine-specific DNA methyltransferase [Clostridium cellulolyticum H10] >gi|118664772|gb|EAV71398.1| D12 class N6 adenine-specific DNA methyltransferase [Clostridium cellulolyticum H10] (305 aa)
Score = 115, Expect = 6.1e-04, Identities = 81/291 (27%), Positives = 128/291 (43%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDR----KWY-------------------YLIKKNRFNELKE--KEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAI-------SKKLKNVNIVYGDYKKSEEFIDK-NTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFD 349
           + WVGGK  L   I +  P     I +Y E F GGG VLF      +  E+Y +D N++L+N++  IK +     P   + E +FL  N+ D     K Y                   Y + +  F E+K+   E+    DV++AA    L +  +         G    S G       C   ++          S++LKN  I   D++      D+ N F Y DPPY     T    A     F  ++   L D +   + K    ++S +D +       +  E+Y  Y I+ V     +        E +E+LI+N+D
  S:     5 ISWVGGKRALRELIYRRMP---RDIGRYIEVFGGGGWVLFGRRPD-KCMEVY-NDFNSDLVNLFRCIKER-----PFALLKELNFLPLNSRDDFTALKMYLGKEEFTSQYLQEEMELAQYYLSEPEFEEIKQILIENATMCDVKRAAAFFKLIRYSY---------GSGCTSFG-------CQPFDIRKTFHLIWSGSRRLKNTLIENKDFEALILQYDRDNAFFYIDPPY---FETEGHYAVK---FRKEDHVRLRDVVVGCHGKW---MVSYNDCQ-------YIRELYKGYYIEAVSRLNNLAQRYDKGCEYSEVLITNYD 286
>gi|28379017|ref|NP_785909.1| prophage Lp2 protein 3 [Lactobacillus plantarum WCFS1] >gi|28271855|emb|CAD64760.1| prophage Lp2 protein 3 [Lactobacillus plantarum WCFS1] (304 aa)
Score = 115, Expect = 6.2e-04, Identities = 57/230 (24%), Positives = 107/230 (46%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYA-EPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVS-----MGHYKNPKICDTLNLEAISK---KLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKL 288
            ++ GGKTQL + +  ++    N IT  + EPF GG  +   +L    +  ++I+D +  + +V+  I      LI +++ +  D+   +    ++     K + +     +++Q   +E A   +FLN+T  +G+      G F  +        +    + + +NL    K   KL  +N +    K       KN+F++FDPPY        +++     FN+Q  KELA+ I  L
  S:     8 FRYPGGKTQLYSFV--HHLLKINSITDISLEPFAGGAGIPLKLLIDNRINTVWINDYDKAIYSVWDTILNDPVALISLIESVPFDYHSGHKISPEFSISFWKKQKDIYLNNKNHQH-SIELAFSTLFLNRTNTSGIITAGPLGGFKQNRKTQIYARFNKETLINKINLIHSFKSQIKLTRLNTLDMIPKIRNSVDPKNSFIFFDPPYFEQGKELYYSS-----FNEQGHKELANGILSL 238
>gi|163867621|ref|YP_001608820.1| DNA methyltransferase [Bartonella tribocorum CIP 105476] >gi|161017267|emb|CAK00825.1| DNA methyltransferase [Bartonella tribocorum CIP 105476] (290 aa)
Score = 113, Expect = 9.9e-04, Identities = 53/198 (26%), Positives = 93/198 (46%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYK-NPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFI-------DKNTFVYFDPPY 256
           L++ GGK  L  +IK+ +  +      Y EPF GG  +   +L   +VK+I+I+DI+  + + +  + +K +ELI  +               +WY   K+   +     E    L +  AAL  FLN+T  +G+ + +         G+YK N +      +E I +   + + ++     + EF+       D+N F Y DPPY
  S:     8 LRYPGGKAILYGKIKEIFEKNGLNGCSYREPFAGGCGLALKLLLNNDVKDIHINDIDPFIWSFWHCVLHKTEELIEKINTTAVSL-------EEWY---KQKEISS----EQADVLSLGFAAL--FLNRTNRSGIIKNSGPIGGKGQNGNYKINCRFNKKNIIERILRISTHKDRIHLTRLDAREFLLRYGTDKDENIFFYMDPPY 197
>gi|1773269|gb|AAB40377.1| SphI methyltransferase (316 aa)
Score = 113, Expect = 1.1e-03, Identities = 46/195 (23%), Positives = 83/195 (42%)
  Q:    63 GGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKK-GLFNVSMGHYK---NPKICDTLNLEAISKKLKNVNIVYGDYKKSEEFIDKNTFVYFDPPYR 257
           G K  L ++I   +P  +  + +  EPF G  A+          +   ISD+N  L+ ++ +I    + LI     +  + L    DD + Y+L  +++FN  K+ E           ++++L   C     R ++K G FN    H +   NP       +   S  ++ V +    Y+ +      +  VY DPPY+
  S:    23 GSKRALASQILSLFP--HGGVPRLVEPFAGSAAISVAARHYGIAETALISDVNEPLMGLWKLIIEDPRHLIAEYTRLWNEQL----DDPRAYFLEARDKFNATKQPE-----------ILLYLLCRCVKAAVRYSQKTGDFNQGADHRRLGANPANMAE-RIGRASAIMQGVTVSTSTYEDALVNAAPDELVYMDPPYQ 203
>gi|83311156|ref|YP_421420.1| site-specific DNA methylase [Magnetospirillum magneticum AMB-1] >gi|82945997|dbj|BAE50861.1| Site-specific DNA methylase [Magnetospirillum magneticum AMB-1] (462 aa)
Score = 112, Expect = 1.4e-03, Identities = 25/81 (30%), Positives = 46/81 (56%)
  Q:    63 GGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDF 143
           GGK +L  ++    PF    I++Y EPF G  AV F ++     ++I+I+D++  + N+++V++     LI VL+ +   F
  S:    28 GGKHRLARDLVNLAPF---TISEYREPFAGSAAVAFRMVRAGRTRKIWINDLDPGIANMWTVVRDDPAGLIRVLRSLHGRF 105
>gi|89897318|ref|YP_520805.1| hypothetical protein DSY4572 [Desulfitobacterium hafniense Y51] >gi|89336766|dbj|BAE86361.1| hypothetical protein [Desulfitobacterium hafniense Y51] (311 aa)
Score = 112, Expect = 1.4e-03, Identities = 78/295 (26%), Positives = 127/295 (43%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWY---YLIKKNRFNELKEKE---------DNQFLDVEKAALMIFLNKTCFNGLYRVNK-KGLFNVSMGHYKNPKICDTLNLEAI-------SKKLKNVNIVYGDYKK-SEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSRGEINELLISNFDINKK 353
           + WVGGK  L   I +  P    ++ +Y E F GGG VLF       + E+Y +D N++L N++  ++ +     P+  + E +F   N  D       YL K    N   E+E         + QF +++     I L     N + R      L   S G       C   ++          S++LKN  I   D+ +   ++  +N F+Y DPPY     T    A     F  ++   L D +     K    L+S +D +       F  E+Y  + I+ V     +     +  E  EL+ISN+D  ++
  S:     5 ISWVGGKKALRELIYQRMPI---ELGRYVEVFGGGGWVLFGRPPDTAM-EVY-NDFNSDLANLFRCVRDR-----PMALLKELNFFPLNGRDEFAVLKKYLEKDEFTNHYLEEELEIAGRYLSELQFEEIKP----ILLENAQMNDVKRAAAFYKLIRYSYGSGCTSYSCQPFDIRKTFHLLWQGSRRLKNTVIENKDFAELIRQYDRENAFIYCDPPY---YQTEGHYAVE---FKKEDHARLRDTLAGCQGKW---LVSYNDCE-------FIRELYKDFCIEAVSRINNLAQRYENGSEYAELMISNYDTGER 290
>gi|149191703|ref|ZP_01869944.1| D12 class N6 adenine-specific DNA methyltransferase [Vibrio shilonii AK1] >gi|148834443|gb|EDL51439.1| D12 class N6 adenine-specific DNA methyltransferase [Vibrio shilonii AK1] (290 aa)
Score = 111, Expect = 1.8e-03, Identities = 71/290 (24%), Positives = 126/290 (43%)
  Q:    59 LKWVGGKTQLLNEIKKYYPFHNNQITKYAEPFVGGGAVLFDVLSKYEVKEIYISDINAELINVYSVIKYKVKELIPVLQIMEKDFLLRNTDDRKWYYLIKKNRFNELKEKEDNQFLDVEKAALMIFLNKTCFNGLYRVNKKGLFNVSMGHYKNPKICDTLNLEAIS---KKLKNVNIVYGDYK----KSEEFIDKNTFVYFDPPYRPITSTSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMI---NSDGSSRGEINELLISNF 348
           L++ GGK   ++ ++ +  F   +  +Y EPF GG  V F    K +     ++D++ EL+ +Y V++ K K      Q+++  +L              K R+ E+ +      LDV  A    FLN+T F+G        L + + G+     +      E I+   +KL+NV I +GD+     +  +       +Y DPPY        +    +   + ++   LA+ + K  +   K  L+  D +          EIY   NI  ++    +   N+   SR    EL+I+NF
  S:    14 LRYPGGKFYAMDVLRPF--FEGAKHDEYREPFAGGATVFF---HKEKAPYNVLNDMDIELVTLYRVLQDKTKR-----QLLDARYLEEPE--------ATKERWREVMDFSPTNELDV--AWKYYFLNRTSFSG-------KLVSAAWGYRPKRSLPPFRWHERINPSGEKLENVEITHGDFSDAILREAKKEGGQVLMYVDPPYYLPPKHKHY----RHGLDKEDHIRLAECLKKTKH---KFFLTYDDCEE-------IREIYKWANIYELQFIYRVQDSNTSSGSRKTGFELVITNF 272
>gi|148377522|ref|YP_001256398.1| hypothetical protein MAG2560 [Mycoplasma agalactiae PG2] >gi|148291568|emb|CAL58954.1| Pseudogene of Adenine-specific DNAmethyltransferase (C-terminal part) [Mycoplasma agalactiae PG2] (107 aa)
Score = 111, Expect = 1.8e-03, Identities = 28/77 (36%), Positives = 42/77 (54%)
  Q:   261 STSSFTAYNKDLFNDQNQKELADYINKLNNKGTKILLSNSDPKNSDKNDSFFDEIYSAYNIKRVKAKRMINSDGSSR 337
           + S+FT+Y KD F   + K LA    +L+ KG  ++L+N        N     ++Y  Y I  +KAKR+INS+ S R
  S:    24 NNSTFTSYTKDGFTLDDHKRLAKVFKELDKKGCYLMLTN-------HNTELIRDLYRDYYITVIKAKRLINSNASKR 93