>gi|26553578|ref|NP_757512.1| IS1630-like transposase [Mycoplasma penetrans HF-2] >gi|26554426|ref|NP_758360.1| IS1630-like transposase [Mycoplasma penetrans HF-2] >gi|26453584|dbj|BAC43916.1| transposase for IS1630-like insertion sequence element [Mycoplasma penetrans HF-2] >gi|26454436|dbj|BAC44764.1| transposase for IS1630-like insertion sequence element [Mycoplasma penetrans HF-2] (338 aa)
Score = 1590, Expect = 5.3e-175, Identities = 338/338 (100%), Positives = 338/338 (100%)
  Q:     1 MFYTTITLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLNW 338
           MFYTTITLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLNW
  S:     1 MFYTTITLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLNW 338
>gi|26553940|ref|NP_757874.1| IS1630-like transposase [Mycoplasma penetrans HF-2] >gi|26453948|dbj|BAC44278.1| transposase for IS1630-like insertion sequence element [Mycoplasma penetrans HF-2] (338 aa)
Score = 1586, Expect = 1.6e-174, Identities = 337/338 (99%), Positives = 337/338 (99%)
  Q:     1 MFYTTITLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLNW 338
           MFYTTITLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSD LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLNW
  S:     1 MFYTTITLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDNLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLNW 338
>gi|26553986|ref|NP_757920.1| IS1630-like transposase [Mycoplasma penetrans HF-2] >gi|26553991|ref|NP_757925.1| IS1630-like transposase [Mycoplasma penetrans HF-2] >gi|26554018|ref|NP_757952.1| IS1630-like transposase [Mycoplasma penetrans HF-2] >gi|26453994|dbj|BAC44324.1| transposase for IS1630-like insertion sequence element [Mycoplasma penetrans HF-2] >gi|26453999|dbj|BAC44329.1| transposase for IS1630-like insertion sequence element [Mycoplasma penetrans HF-2] >gi|26454026|dbj|BAC44356.1| transposase for IS1630-like insertion sequence element [Mycoplasma penetrans HF-2] (338 aa)
Score = 1577, Expect = 1.7e-173, Identities = 336/338 (99%), Positives = 336/338 (99%)
  Q:     1 MFYTTITLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLNW 338
           MFYTTITLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYV P WMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLNW
  S:     1 MFYTTITLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVFPIWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLNW 338
>gi|15293429|gb|AAK94953.1|AF396969_2 IS30-like protein [Mycoplasma bovis] >gi|15293443|gb|AAK94966.1|AF396970_1 IS30-like protein [Mycoplasma bovis] (338 aa)
Score = 671, Expect = 2.0e-68, Identities = 140/323 (43%), Positives = 213/323 (65%)
  Q:     8 LNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNHKNFFLWQ---KYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKF--DEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           +N T  Y HL+Y ER  I  +      +I  IA +L R  ST+ RE++RN    G Y  + A++K + R +HK  F +    +Y  F + F EK++ +++G+  T  YIK+ +P +  PS + I+NWI+T KW  K  D+LR  Y KG KR   + S+   D  YV+P W RPK+I  R+E+GHWE DL+IGKR +GY N+L +VER+TR  F  K+++K+ F + S +K ++  +NL VK+ITIDNGIEF ++G+   W+  K++  EPYAS+QRG+NEN NG+IRR++ KG DF+ +S  +++++ N+IN MPRK+ N+    + +K
  S:     1 MNYTKNYNHLTYDERAFI-EIQIKSGYSIRSIARQLNRSPSTVSRELKRNTAFSGSYQCKIAEQKALNRHSHKYLFKFTSNFEYAEFEKFFLEKFDKRFYGIVATARYIKQTFPNIASPSIRTIFNWIKTRKWKLKPRDRLRIFYKKGGKRTASVVSRLIGDSHYVYPIWARPKYIDLREEYGHWESDLIIGKRSNGYDNVLTLVERQTRMGFAVKIKSKSAFLVISKLKKIIQDHNLIVKSITIDNGIEFERMGLLGKWLNIKIFRAEPYASFQRGTNENWNGMIRRMFHKGFDFNSISQVQLDDVVNQINEMPRKILNWQKPIELFK 328
>gi|4587470|gb|AAD25737.1|AF100324_5 IS1630 transposase [Mycoplasma fermentans] (366 aa)
Score = 580, Expect = 6.9e-58, Identities = 140/324 (43%), Positives = 203/324 (62%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLW----QKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSK--FDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLNW 338
           + LS+ ER ++ ++ +    +I +IA  L   R+TI  EI+ N+   GY A  A +K I R   KN F +     KYK FS LF ++Y+ K   V+LT   IK  YP + VPS K +YNWI++  WI      LR  Y KG KR+K   ++     +YV PFW RP +I  RKEFGHWE+DL+IGK +  + +LL   ER +R  F+ K+ NKNP+ +N  + +L+ K+ L+VK+IT DNG+EFS +    Y +K  +Y  +PYAS+QRG NEN NGL+RR +KK T+F  +++ EI  +QN+IN  PR++F Y+S+ + Y+K      W
  S:     3 KKLSWNERTVLEYLLWATNYSITKIAKILGYSRTTINNEIKNNSTFWGYFALDAIEKTITREKWKNHFKFLNNLNKYKEFSSLFKKEYDGKLWTVKLTIEKIKNLYPNIDVPSFKTVYNWIKSGYWILNWKGLLRKVYKKGGKREKQSAARRLVGARYVRPFWSRPANINERKEFGHWEIDLIIGKSKGTHCHLLSFTERVSRYGFLVKIPNKNPWNLNLYLWNLIWKHKLNVKSITQDNGLEFSTLFFIGYKLKIFIYKADPYASFQRGLNENFNGLVRRFFKKKTNFDDITEEEILKVQNEINNRPREIFGYLSALEMYEKLNAENPW 332
>gi|56808509|ref|ZP_00366247.1| COG2826: Transposase and inactivated derivatives, IS30 family [Streptococcus pyogenes M49 591] (326 aa)
Score = 388, Expect = 1.2e-35, Identities = 114/313 (36%), Positives = 169/313 (53%)
  Q:     8 LNDTNK--YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN------------VEGYSAEKAQKKYIERRNHKNFFLWQ--KYKTFSEL-FAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMF 320
           +N T K  Y HLS  ER  I     + KK + +IA  L RH STI REI+R +                Y A+  Q+ Y   R   ++        +  ++L FA   N + H V+      K N+P  +VPSTK IY +I+      K  D  +   I  RKR K +     +        RP++I +R EFGHWE+DLV+GK+  G + +L +VER+TR +   K+E+K   TIN A+  L+++    + +IT DNG EFS +     +    VY+  PY+S++RG+NEN NGL+R    KG   + L+  E++N    IN  PR++ 
  S:     4 INSTRKSSYSHLSATERGEIAAYLKMGKKPV-EIARLLGRHCSTICREIKRGSVDQVKDKNGKQTFFNAYFADSGQRVYETNRQKSSYLKLNGCSARFIAQLEFALTANIRLHSVDSFVQTYKVNHPEEVVPSTKTIYRYIKEGLLAIKPIDLPKMVSI--RKRSKKVMKTNKKTLGKSIEERPEYINDRSEFGHWEIDLVLGKKTKGEAVMLTLVERQTRYALGVKLEDKQSQTINRAVTHLISQ--YPIASITADNGSEFSLLSTLEAF---DVYFAHPYSSHERGTNENFNGLLREYVPKGISLNPLTSEELDNYLTAINERPRRLL 325
>gi|94991493|ref|YP_599593.1| transposase [Streptococcus pyogenes MGAS10270] >gi|94545001|gb|ABF35049.1| Transposase [Streptococcus pyogenes MGAS10270] (342 aa)
Score = 380, Expect = 9.3e-35, Identities = 115/318 (36%), Positives = 168/318 (52%)
  Q:     8 LNDTNK--YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVE------------GYSAEKAQKKYIERRNHKNFFLWQKYKTFSELF------AEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS 325
           +N T K  Y HLS  ER  I     + KK + +IA  L  H STI REI+R +  +             Y A+  Q+ Y   R   ++    K    S  F      A   N + H V+      K N+P  +VPSTK IY +I+      K  D  +   I  RKR K +     +        RP++I +R EFGHWE+DLV+G++  G + +L +VE +TR +   K+E+K   TIN A+  L+++    + +IT DNG EFS +          VY+  PY+S++RG+NEN NGL+R    KG   + L+  E++N    IN  PR++  Y SS
  S:     6 INSTRKSSYSHLSATERGEIAAYLKMGKKPV-EIARLLGCHCSTICREIKRGSVEQVKDKNGKQTFFNAYFADSGQRVYETNRQKSSYL---KLNGCSARFIAQLESALTANIRLHSVDSFVQTYKVNHPEEVVPSTKTIYRYIKEGVLAIKPIDLPKMVSI--RKRSKKVMKTNKKTLGKSIEERPEYINDRSEFGHWEIDLVLGQKTKGEAVMLTLVEHQTRYALGVKLEDKQSQTINRAVTHLISQ--YPIASITADNGSEFSLLSTLE---AVDVYFAHPYSSHERGTNENFNGLLREYVPKGISLNPLTSEELDNYLTAINERPRRLLQYQSS 332
>gi|56808870|ref|ZP_00366581.1| COG2826: Transposase and inactivated derivatives, IS30 family [Streptococcus pyogenes M49 591] (326 aa)
Score = 376, Expect = 3.2e-34, Identities = 116/313 (37%), Positives = 167/313 (53%)
  Q:     8 LNDTNK--YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN------------VEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELF------AEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMF 320
           +N T K  Y HLS  ER  I     + KK + +IA  L RH STI REI+R +                Y A+  Q+ Y E    KN +L  K    S  F      A   N + H V+      K N+P  +VPSTK IY +I+      K  D  +   I  RKR K +     +        RP++I +R EFGHWE+DLV+GK+    + +L +VER+TR +   K+E+K   T+N A+  L+++    + +IT DNG EFS +          VY+  PY+S++RG+NEN NGL+R    KG   + L+  E++N    IN  PR++ 
  S:     4 INSTRKSSYSHLSATERGEIAAYLKMGKKPV-EIARLLGRHCSTICREIKRGSVDQVKDKNGKQTFFNAYFADSGQRVY-ETNRQKNSYL--KLNGCSARFIAQLESALTANIRLHSVDSFVQTYKVNHPEEVVPSTKTIYRYIKEGLLAIKPIDLPKMVSI--RKRSKKVMKTNKKTLGKSIEERPEYINDRSEFGHWEIDLVLGKKTKSEAVMLTLVERQTRYALGVKLEDKQSQTVNRAVTHLISQ--YPIASITADNGSEFSLLSTLE---AVDVYFAHPYSSHERGTNENFNGLLREYVPKGISLNPLTSEELDNYLTAINERPRRLL 325
>gi|76787467|ref|YP_328857.1| ISSag3, transposase [Streptococcus agalactiae A909] >gi|77406970|ref|ZP_00783988.1| IS1239, transposase, probable [Streptococcus agalactiae H36B] >gi|76562524|gb|ABA45108.1| ISSag3, transposase [Streptococcus agalactiae A909] >gi|77174428|gb|EAO77279.1| IS1239, transposase, probable [Streptococcus agalactiae H36B] (340 aa)
Score = 370, Expect = 1.3e-33, Identities = 117/313 (37%), Positives = 170/313 (54%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRR--------NNNVEGYSA----EKAQKKYIERRN----HKNFFLWQKYKTFSEL-FAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGR-----KRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSD 326
           Y HLS  ER  I   Y    K  ++IA  L RHRSTI REI+R         N    YS     +  Q+ Y   R     HK  +  Q +  F EL  A K   + H V+      +E  P  ++PSTK +Y +I+      K  D  +   I+ R     K  K +  K  E+       RP+ I NR EFGHWE+DL++GK+  G + ++ +VER+TR     K+ NK   TIN A+KSL+++    +++I  DNG EFS +         +VY+  PYAS++RG+NEN NGL+R    KG   + L+  E+N   + IN  PR++  Y +++
  S:    12 YSHLSASERGEIS-AYLKMGKKPSEIAHLLGRHRSTISREIKRGSVSQVQDKNGKRIYSTVYFPDSGQRVYETNRRKSAYHKLSYCSQTF--FKELEKALKTKPRCHSVDSFVQTYQEKPPLEVIPSTKTVYRYIKDGLLRVKPIDLPKMVCIRKRAKVTPKATKKILGKSIEE-------RPETITNRSEFGHWEIDLMLGKKTKGEAVVMTLVERQTRFVIAVKLANKQAETINRAVKSLLSQ--YPIRSIASDNGSEFSSLSDLK---GVEVYFAHPYASHERGTNENFNGLLREFLPKGVSLNSLTTEELNLYVSAINDRPRRIQKYKTAN 331
>gi|139473641|ref|YP_001128357.1| putative transposase [Streptococcus pyogenes str. Manfredo] >gi|134271888|emb|CAM30126.1| putative transposase [Streptococcus pyogenes str. Manfredo] (328 aa)
Score = 366, Expect = 4.1e-33, Identities = 111/313 (35%), Positives = 167/313 (53%)
  Q:     8 LNDTNK--YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVE------------GYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAE-----KYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMF 320
           +N T K  Y HLS  ER  I     + KK + +IA     HRSTI REI+R +  +             Y A+  Q+ Y   R   ++   +    F+   A+       N + H V+      K N+P  +VPSTK IY++I+      K  D  +   I  RKR K +     +        RP++I +R EFGHWE+DLV+GK+  G + +L +VER+TR +   K+E+K   TIN A+  L+++    + +IT DNG EFS +          VY+  PY+S++ G+NEN NGL+R    KG   + L+  E++N    IN  PR++ 
  S:     6 INSTRKSSYSHLSATERGEIAAYLKMGKKPV-EIARLQGCHRSTICREIKRGSVEQVKDKNGKQTFFNAYFADSGQRVYETNRQKSSYL--KLNDCFARFIAQLESAFTANIRLHSVDSFVQTYKVNHPEEVVPSTKTIYHYIKEGVLAIKLIDLPKMVSI--RKRSKKVMKTNKKTLGKSIEERPEYINDRSEFGHWEIDLVLGKKTKGEAVMLTLVERQTRYALGVKLEDKQSQTINRAVTHLISQ--YPIASITADNGSEFSLLSDLE---AVDVYFAHPYSSHEIGTNENFNGLLREYVPKGVSLNPLTSEELDNDITAINERPRRLL 327
>gi|94995372|ref|YP_603470.1| Transposase [Streptococcus pyogenes MGAS10750] >gi|94548880|gb|ABF38926.1| Transposase [Streptococcus pyogenes MGAS10750] (328 aa)
Score = 365, Expect = 5.9e-33, Identities = 113/313 (36%), Positives = 165/313 (52%)
  Q:     8 LNDTNK--YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN------------VEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELF------AEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMF 320
           +N T K  Y HLS  ER  I     + KK + +IA  L  HRSTI REI+R +                Y A+  Q+ Y   R   ++    K    S  F      A   N + H V+      K N+P  +VPSTK IY +I+      K  D  +   I  RKR K +     +        RP++I +R EFGHWE+DLV+GK+  G + +L +VER+TR++   K+E+K   TIN A+  L+++    + +IT DNG EFS +          VY+  PY+S++R +NEN NGL+R    KG   + L+  E++N    IN   R++ 
  S:     6 INSTRKSSYSHLSATERGEIAAYLKMGKKPV-EIARLLGSHRSTICREIKRGSVDQVKDKNGKQTFFNAYFADSGQRVYETNRQKSSYL---KLNGCSARFIAQLESALTANIRLHSVDSFVQTYKVNHPEEVVPSTKTIYRYIKEGVLAIKPIDLPKMVSI--RKRSKKVMKTNKKTLGKSIEERPEYINDRSEFGHWEIDLVLGKKTKGEAVMLTLVERQTRHALGVKLEDKQSQTINRAVTHLISQ--YPIASITADNGSEFSLLSTLE---AVDVYFAHPYSSHERRTNENFNGLLREYVPKGVSLNPLTSEELDNDITAINERLRRLL 327
>gi|15828862|ref|NP_326222.1| truncated IS1138 transposase [Mycoplasma pulmonis UAB CTIP] >gi|15828870|ref|NP_326230.1| truncated IS1138 transposase [Mycoplasma pulmonis UAB CTIP] >gi|14089805|emb|CAC13564.1| TRANSPOSASE FOR INSERTION SEQUENCE ELEMENT IS1138 (FRAGMENT) (Mycoplasma pulmonis) >gi|14089813|emb|CAC13572.1| TRANSPOSASE FOR INSERTION SEQUENCE ELEMENT IS1138 (FRAGMENT) (Mycoplasma pulmonis) (146 aa)
Score = 361, Expect = 1.6e-32, Identities = 75/140 (53%), Positives = 101/140 (72%)
  Q:   190 LVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           +VIGK+++G++NLL + ERKTR  FI KV+ K    +NS I  LV K NL +KTIT DNG EF  IG+ A W+  KVY  + YAS+QRGSNE+ NGLIRR YKKG DF+ L+  +I++L +KIN MPRK+ N+ S+ + +
  S:     1 MVIGKKKTGHANLLTLTERKTRMGFIAKVDKKISMQVNSVIFKLVKKYNLKIKTITSDNGFEFDNIGLLAKWLDIKVYKADLYASFQRGSNEHFNGLIRRRYKKGFDFNQLTQEDIDDLMDKINNMPRKILNWQSAAEVF 140
>gi|21911398|ref|NP_665666.1| putative transposase [Streptococcus pyogenes MGAS315] >gi|21905614|gb|AAM80469.1| putative transposase [Streptococcus pyogenes MGAS315] (326 aa)
Score = 359, Expect = 2.8e-32, Identities = 110/313 (35%), Positives = 167/313 (53%)
  Q:     8 LNDTNK--YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVE------------GYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAE-----KYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMF 320
           +N T K  Y HLS  ER  I     + KK + +IA  L  HRSTI REI+R +  +             Y A+  Q+ Y   R   ++   +    F+   A+       N + H V+      K N+P  +VPSTK IY++I+      K  D  +   I  RKR K +     +        RP++I +  EFGHWE+DLV+GK+    + +L +VER+TR +   K+E+K   TIN A+  L+++    + +IT DNG EFS   + +      VY+  PY+S++RG+NEN NGL+R    KG   + L+  E++N    IN   R++ 
  S:     4 INSTRKSSYSHLSATERGEIAAYLKMGKKPV-EIARLLGCHRSTICREIKRGSVEQVKDKNGKQTFFNAYFADSGQRVYETNRQKSSYL--KLNDCFARFIAQLESALTANIRLHSVDSFVQTYKVNHPEEVVPSTKTIYHYIKEGVLAIKLIDLPKMVSI--RKRSKKVMKTNKKTLGKSIEERPEYINDHSEFGHWEIDLVLGKKTKSEAVMLTLVERQTRYALGVKLEDKQSQTINRAVTHLISQ--YPIASITADNGSEFS---LLSDLKAVDVYFAHPYSSHERGTNENFNGLLREYVPKGVSLNPLTSEELDNDITAINERLRRLL 325
>gi|28896770|ref|NP_803120.1| putative transposase [Streptococcus pyogenes SSI-1] >gi|28812024|dbj|BAC64953.1| putative transposase [Streptococcus pyogenes SSI-1] (328 aa)
Score = 358, Expect = 3.3e-32, Identities = 110/313 (35%), Positives = 167/313 (53%)
  Q:     8 LNDTNK--YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVE------------GYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAE-----KYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMF 320
           +N T K  Y HLS  ER  I     + KK + +IA  L  HRSTI REI+R +  +             Y A+  Q+ Y   R   ++   +    F+   A+       N + H V+      K N+P  +VPSTK IY++I+      K  D  +   I  RKR K +     +        RP++I +  EFGHWE+DLV+GK+    + +L +VER+TR +   K+E+K   TIN A+  L+++    + +IT DNG EFS   + +      VY+  PY+S++RG+NEN NGL+R    KG   + L+  E++N    IN   R++ 
  S:     6 INSTRKSSYSHLSATERGEIAAYLKMGKKPV-EIARLLGCHRSTICREIKRGSVEQVKDKNGKQTFFNAYFADSGQRVYETNRQKSSYL--KLNDCFARFIAQLESALTANIRLHSVDSFVQTYKVNHPEEVVPSTKTIYHYIKEGVLAIKLIDLPKMVSI--RKRSKKVMKTNKKTLGKSIEERPEYINDHSEFGHWEIDLVLGKKTKSEAVMLTLVERQTRYALGVKLEDKQSQTINRAVTHLISQ--YPIASITADNGSEFS---LLSDLKAVDVYFAHPYSSHERGTNENFNGLLREYVPKGVSLNPLTSEELDNDITAINERLRRLL 327
>gi|145589422|ref|YP_001156019.1| integrase catalytic subunit [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145047828|gb|ABP34455.1| Integrase, catalytic region [Polynucleobacter sp. QLW-P1DMWA-1] (317 aa)
Score = 350, Expect = 2.8e-31, Identities = 103/323 (31%), Positives = 167/323 (51%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKA----QKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTR-----HYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGK--RQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           Y+HLS  ER  I ++     K   QIA  + RH+STI RE+ RN  ++GY  ++A    +++ +  RN       Q  +T   L A+     W  V++       H     +      +   +Y  ++  K  KKR       Y  GR R+  +  +       P   RP HI  R + GHWE D VIG   RQ+    ++ +VERK+    + KV+NK    ++SAI + +N     VKT+T DNG EF++       ++   Y+ +P+AS+QRGSNEN NGL+R+   K    S ++D E+  +Q+++N  PRK   + + ++ + + +N +
  S:     3 YQHLSQTERYQI-YILMKDGKTQTQIAQLMDRHKSTISRELARNTGLKGYRPKQACLLAEERSLGCRNAAQITADQWNQTVDCLLAQ-----WSPVQIANQVGISHETIYRHVYADKAAGGNLYQQLRCQKKRKKR-------YASGRDRRGQIVGR------RPISERPAHIETRSQVGHWEGDTVIGAAHRQA----VVTLVERKSGYVVLAKVKNKTSDLVSSAIITKLNAVTPLVKTLTFDNGKEFAEHARIDTALQSTTYFADPFASWQRGSNENFNGLLRQYIPKKRPLSTVTDKELRMIQDRLNNRPRKRLGFKTPNEVFMQSLNRV 313
>gi|85711343|ref|ZP_01042402.1| Transposase, IS30 family protein [Idiomarina baltica OS145] >gi|85694844|gb|EAQ32783.1| Transposase, IS30 family protein [Idiomarina baltica OS145] (323 aa)
Score = 343, Expect = 2.0e-30, Identities = 104/318 (32%), Positives = 172/318 (54%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNH-KNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKW--------IKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           YR L+ G+R  I  +   ++ +  +IA +L    ST+ RE+RRNNN+ G Y  +KAQ++ ++RR+  K   + +  +   EL        W   +++    +  YP     S + IYN++  + +        ++ R  + R    K R R  G  S  D         RP  I +R+ +G WE+D VIGKR +G   ++ ++ERK+R   + KV +K+  T+  A   ++      V +IT DNG+EF+     A  ++  VY+ +PYASYQRG+NEN NGL+R+   KGTD S +++  +   Q ++N  PRK   ++  D  +K+
  S:     3 YRQLTEGQRYQISAL-LSEEFSQREIARKLNIAPSTVHRELRRNNNLCGSYDPQKAQERMLKRRSKPKPKRVCENTRNAVELMLVM---DWSPEQISAICTRIGYPV----SHEWIYNYVLADFYGGGGLFTHLRHRLRRYRKRLHKQRGRILGRRSIHD---------RPAIIDDRERYGDWEIDTVIGKRGTG--AIVTLLERKSRFYLVKKVTSKHADTVADATIEMLQPFKALVHSITADNGLEFAGHERIAKELETDVYFADPYASYQRGANENANGLLRQYVPKGTDLSTVTNELMAKYQQRLNLRPRKTLGFIQPDIIFKE 311
>gi|125972652|ref|YP_001036562.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125972665|ref|YP_001036575.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125972683|ref|YP_001036593.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125973017|ref|YP_001036927.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125973757|ref|YP_001037667.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125973981|ref|YP_001037891.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125974216|ref|YP_001038126.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125974658|ref|YP_001038568.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125975198|ref|YP_001039108.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125975660|ref|YP_001039570.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125712877|gb|ABN51369.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125712890|gb|ABN51382.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125712908|gb|ABN51400.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125713242|gb|ABN51734.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125713982|gb|ABN52474.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125714206|gb|ABN52698.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125714441|gb|ABN52933.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125714883|gb|ABN53375.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125715423|gb|ABN53915.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125715885|gb|ABN54377.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] (370 aa)
Score = 341, Expect = 3.8e-30, Identities = 114/316 (36%), Positives = 173/316 (54%)
  Q:    10 DTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRR------NNNV---EGYSAEKAQKKYIERRNHKN--FFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVH--PFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV----KTITIDNGIEF------SKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS 325
           +T K +HL+  ER  I  +Y  +K  + +IA  L RHR TI REI R      N+++   + Y A+ AQ++Y+E   +K     +   ++    + ++  N K+    +      +         TK +YN+I       + ++K       G+KR      K   K +       RPK + +RKE+GHWE+D V+G++ S  + LLV+ ERKTR   I K+ +K   ++  AI  L  K         KTIT+DNG EF       K        + KVYY  PY+S++RG+NEN+N LIRR   KGTD S +S A+I +++  IN  PR+MF Y S+
  S:    29 ETRKNKHLNERERYAI-ELYLKEKYTVTEIAKRLGRHRRTIEREITRGTIYLQNSDLTYRKEYCADVAQRRYVENGKNKGPRLKIGNDHELVRYIESKIINEKYSPDAVIGQIKAKGLKFKTSICTKTLYNYIDRGDVFLRLTNKYLPVKKDGKKRIYQRVKKIALKNLKGSSIEERPKEVNDRKEYGHWEMDCVVGRKNSA-AVLLVLSERKTREEIILKLPDKTQESVIKAIDELERKYRRKFREKFKTITVDNGTEFLDYRGIEKSKTEPGKDRTKVYYAHPYSSWERGTNENINKLIRRFIPKGTDISKVSKAKIKSIERWINEYPRRMFGYRSA 365
>gi|85713175|ref|ZP_01044206.1| Transposase, IS30 family protein [Idiomarina baltica OS145] >gi|85692999|gb|EAQ30966.1| Transposase, IS30 family protein [Idiomarina baltica OS145] (323 aa)
Score = 339, Expect = 5.4e-30, Identities = 101/318 (31%), Positives = 168/318 (52%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNH-KNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTN--------KWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           YR L+ G+R  I  +   ++ +  +IA +L    ST+ RE+RRNNN+ G Y  +KAQ++ ++RR+  K   + +  +   EL  E     W   +++    +  YP     S + IY ++  +          ++ R  + +    K R R  G  S  D         RP  I +R+ +G WE+D VIGKR +G   ++ ++ERK+R   + KV +K+   +  A   ++      V +IT DNG+EF+     A  +   VY+ +PYASYQRG+NEN NGL+R+   KGTD   +++  +   Q ++N  PRK   ++  D  +K+
  S:     3 YRQLTEGQRYQISAL-LSEEFSQREIARKLNIAPSTVHRELRRNNNLCGSYDPQKAQERTLKRRSKPKPKRVCENTRNAVELMLEM---DWSPEQISAVCTRIGYPV----SHEWIYKYVLADFHGGGGLFTHLRHRLRRYKKRLHKQRGRILGRRSIHD---------RPAIIDDRERYGDWEIDTVIGKRGTG--AIVTLLERKSRFYLVKKVTSKHADAVADATIEMLQPFKALVHSITADNGLEFADHERIAEELDTDVYFADPYASYQRGANENANGLLRQYVPKGTDLRTVTNKLMAKYQQRLNLRPRKTLGFIQPDIIFKE 311
>gi|152976020|ref|YP_001375537.1| integrase catalytic region [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152024772|gb|ABS22542.1| Integrase catalytic region [Bacillus cereus subsp. cytotoxis NVH 391-98] (316 aa)
Score = 337, Expect = 1.1e-29, Identities = 105/324 (32%), Positives = 162/324 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQK--KNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNH-KNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK-NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLN 337
           Y H +  ER   G +    K  ++  +I   LKRH S++ RE++RN    G YS EKAQ++Y +RR   K    W      ++   EK    W   ++   Y+K         S K IYNW+   K  KK    LR    KG KR+K   ++           RP  I  R+ FGHWELD ++  R          +ERKTR      + ++   ++  AIK +     +  ++T T+D G EFS        ++  V++ +PY+S+QRGSNEN NGL+R  Y K TD SL+S  ++N     IN+ PRK   + ++ + +++ ++ L+
  S:     3 YSHFTTFER---GQLEAFHKLGRSTREIGKILKRHPSSVARELKRNTQKNGTYSGEKAQEQYGQRRKSCKPIGKWSV--ELAKKIQEKLEITWSPEQIQYGYLKGEI------SFKTIYNWLYQGKRFKKDLSLLRQ---KG-KRQKPRETRGRFNIGTSIQKRPSEIRKRETFGHWELDTIVSSRGKSKGCFATFIERKTRYYQAIVIPDRTAESMEFAIKQITAMYPSAALQTATVDRGKEFSCYQRVEKELEIAVFFADPYSSWQRGSNENANGLLREFYPKKTDLSLVSQEQLNQALLLINQRPRKCLAWKTAHEAFQEELSHLD 316
>gi|4877359|dbj|BAA77753.1| transposase-like protein [Erysipelothrix rhusiopathiae] (312 aa)
Score = 336, Expect = 1.3e-29, Identities = 81/240 (33%), Positives = 140/240 (58%)
  Q:    86 KYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFS----KFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS 325
           KY    E     Y+ K H VE+     K  +P     +++Q+YNWI   K ++ + +++     K +KR  GM +      +EK V P  +RPK+I  R E GH E+D +IGK+    + ++ +V+R +R  ++ K E +  +  ++ I+  + +NN+  K+IT+DNG+EF  +GI A  +  K+Y C+PY S+QRG+NE  N ++RR   KG     ++   ++++  KIN MPRK+F++ ++
  S:    56 KYSHLIEYLHSHYDPKVHSVEVCLSNYKRYHPYKPCVTSQQVYNWINQGK-LEIKPNRMCYKRRKRKKRISGMMNHLKWNLEEKTVLPISLRPKYIEERNEIGHLEIDSIIGKKHET-AAIISIVDRCSRMIWLIKAEYRYDYYTSNLIRKFIEENNITTKSITVDNGLEFKTLGITAKRLGVKLYKCDPYCSFQRGTNERANAIVRRFIPKGKSMYDIAQQYLDDICFKINSMPRKIFDFKTA 297
>gi|85712017|ref|ZP_01043071.1| transposase [Idiomarina baltica OS145] >gi|85694203|gb|EAQ32147.1| transposase [Idiomarina baltica OS145] (323 aa)
Score = 334, Expect = 2.4e-29, Identities = 102/318 (32%), Positives = 168/318 (52%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNH-KNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSK-----FDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           YR L+ G+R  I  +   ++ +  +IA +L    ST+ RE+RRNN++ G Y  + AQK+ ++RR+  K   +    +   EL  E     W   +++    +  YP     S + IYN++  + +   R   L T      +R K    K        + +H    RP  I +R+ +G WE+D VIGKR +G   ++ ++ERK+R   + KV +K+   +  A   ++      V +IT DNG+EF+     A  ++   Y+ +PYASYQRG+NEN NGL+R+   KGTD S +++  I   Q ++N  PRK   ++  D  +K+
  S:     3 YRQLTEGQRYQISAL-LSEEFSQREIARKLNIAPSTVHRELRRNNSLCGSYDPQLAQKRTLKRRSKPKPKRVCANTRNAVELMLEM---DWSPEQISAICTRIGYPV----SHEWIYNYVLADFY---RGGGLFTHLRHRLRRYKKRLHKQRGHILGRRSIHN---RPAIIDDRERYGDWEIDTVIGKRGTG--AIVTLLERKSRFYLVKKVTSKHADAVADATIEMLQPFKALVHSITADNGLEFAGHERIAKELETDFYFADPYASYQRGANENANGLLRQYVPKGTDLSTVTNELIAKYQQRLNLRPRKTLGFIQPDIIFKE 311
>gi|91792931|ref|YP_562582.1| integrase catalytic subunit [Shewanella denitrificans OS217] >gi|91794936|ref|YP_564587.1| integrase catalytic subunit [Shewanella denitrificans OS217] >gi|91714933|gb|ABE54859.1| Integrase, catalytic region [Shewanella denitrificans OS217] >gi|91716938|gb|ABE56864.1| Integrase, catalytic region [Shewanella denitrificans OS217] (313 aa)
Score = 328, Expect = 1.2e-28, Identities = 100/318 (31%), Positives = 161/318 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKR-KKGMFSKFDE-KYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           Y+ L+ G R  I  +   Q  +I  IA  +  HR+T+ RE++R + ++GY  + AQ    + R H   +     +     F  +++  W   +++R     N       S + IY ++  NK   ++  KL     +G KR ++G   K    K       RP  +  R+ FG WE+D V+GK  +G  +++ ++ERKTR   I KV +K+   +  A   L+     +V TIT DNG EF+   + A  +    Y+  PY+S++RG+NEN NGL+R+  KKGTD   +SDA I   QN+IN  P+K   +      +K+
  S:     3 YQQLTEGRRYQIS-VLLDQGISITLIAKAINCHRATVYRELKRCHALQGYCPDSAQASACKMRRHSAKYTIPDTRINVVRFLLQHD--WSPEQISRVLSGMNQAV----SHEWIYRFVARNK---RQGGKLYRHLRQGHKRYRRGKKEKAPAIKNGTSIDSRPAIVDTRERFGDWEIDTVLGKHGTG--SIVTILERKTRFYLIKKVASKSAEDVTKATIELLMPYKQYVHTITADNGREFAHHEVIANALDTSFYFAHPYSSWERGANENANGLLRQYVKKGTDLRTVSDAIILFAQNRINYRPKKCLKFKQPAVVFKQ 310
>gi|15615087|ref|NP_243390.1| transposase (10) [Bacillus halodurans C-125] >gi|15616065|ref|NP_244370.1| transposase (10) [Bacillus halodurans C-125] >gi|15616512|ref|NP_244818.1| transposase (10) [Bacillus halodurans C-125] >gi|10175144|dbj|BAB06243.1| transposase (10) [Bacillus halodurans C-125] >gi|10176127|dbj|BAB07222.1| transposase (10) [Bacillus halodurans C-125] >gi|10176575|dbj|BAB07669.1| transposase (10) [Bacillus halodurans C-125] (314 aa)
Score = 327, Expect = 1.4e-28, Identities = 112/324 (34%), Positives = 164/324 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKK--NINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNH-KNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLN 337
           Y HL+  ER   G +  +QK   +  QIA EL RH STI RE++RN   E Y +E A ++Y+ERR   K    W      + +  EK    W   ++     + N       S K IY W+      K     LR    KG KR+K M ++           RPK +  R  FGHWELD ++  R      L    ERKTR     K++N+   ++ +AI  +VNK  L V KT T+D G EF+        +   VY+ +PYAS+QRG+NEN NGL+R  + K TD +L+++ E+    + IN  PRK   + +S + + + ++ L+
  S:     3 YSHLTTFER---GRLETLQKLGWSTRQIAKELNRHHSTIARELKRNRTKE-YVSEVAHERYVERRKGCKPKGKWSP--ELATIIEEKLQLTWSPEQIIGRLSELNL------SFKTIYRWLYLGLVNKSDLSVLRH---KG-KRQKPMETRGRFNIGTSIDQRPKEVKKRTTFGHWELDTMVSSRGKSKGCLATFAERKTRMYLAVKMDNRTSSSMETAILRMVNKYPLGVFKTSTVDRGKEFACYSNIEEQVDMAVYFADPYASWQRGTNENANGLLREFFPKKTDLALITEEELELALHLINHRPRKCLGWKTSYEAFWEEVSQLD 314
>gi|85711735|ref|ZP_01042791.1| Transposase, IS30 family protein [Idiomarina baltica OS145] >gi|85694350|gb|EAQ32292.1| Transposase, IS30 family protein [Idiomarina baltica OS145] (323 aa)
Score = 326, Expect = 2.0e-28, Identities = 101/318 (31%), Positives = 169/318 (53%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERR-NHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKW--------IKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           YR L+ G+R  I  +   ++ +  +IA +L    ST+ RE+RRNN++ G Y  + AQ++ ++RR   K   + +  +   EL        W   +++    +  YP     S + IYN++  + +        ++ R  + R    K R R  G  S  D         RP  I +R+ +G WE+D VIGKR +G   ++ ++ERK+R   + KV +K+   +  A   ++      V +IT DNG+EF+     A  ++  VY+ +PYASYQRG+NEN NGL+R+   KGTD S +++  +   Q ++N  PRK   ++  D  +K+
  S:     3 YRQLTEGQRYQISAL-LSEEFSQREIARKLNIAPSTVHRELRRNNSLCGSYDPQLAQERTLKRRLKPKPKRVCENTRNAVELMLVM---DWSPEQISAICTRIGYPV----SHEWIYNYVLADFYGGGGLFTHLRHRLRRYRKRLHKQRGRILGRRSIHD---------RPAIIDDRERYGDWEIDTVIGKRGTG--AIVTLLERKSRFYLVKKVTSKHADAVADATIEMLQPFKALVHSITADNGLEFAGHERIAKELETDVYFADPYASYQRGANENANGLLRQYVPKGTDLSTVTNELMAKYQQRLNLRPRKTLGFIQPDIIFKE 311
>gi|47076640|dbj|BAD18232.1| transposase of IS658 [Bacillus halodurans] (313 aa)
Score = 326, Expect = 2.1e-28, Identities = 111/312 (35%), Positives = 157/312 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKK--NINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNH-KNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS 325
           Y HL+  ER   G +  +QK   +  QIA EL RH STI RE++RN   E Y +E A ++Y+ERR   K    W      + +  EK    W   ++     + N       S K IY W+      K     LR    KG KR+K M ++           RPK +  R  FGHWELD ++  R      L    ERKTR     K++N+   ++ +AI  +VNK  L V KT T+D G EF+        +   VY+ +PYAS+QRG+NEN NGL+R  + K TD +L+++ E+    + IN  PRK   + +S
  S:     3 YSHLTTFER---GRLETLQKLGWSTRQIAKELNRHHSTIARELKRNRTKE-YVSEVAHERYVERRKGCKPKGKWSP--ELATIIEEKLQLTWSPEQIIGRLSELNL------SFKTIYRWLYLGLVNKSDLSVLRH---KG-KRQKPMETRGRFNIGTSIDQRPKEVKKRTTFGHWELDTMVSSRGKSKGCLATFAERKTRMYLAVKMDNRTSSSMETAILRMVNKYPLGVFKTSTVDRGKEFACYSNIEEQVDMAVYFADPYASWQRGTNENANGLLREFFPKKTDLALITEEELELALHLINHRPRKCLGWKTS 302
>gi|91791406|ref|YP_561057.1| integrase catalytic subunit [Shewanella denitrificans OS217] >gi|91713408|gb|ABE53334.1| Integrase, catalytic region [Shewanella denitrificans OS217] (313 aa)
Score = 325, Expect = 2.3e-28, Identities = 100/318 (31%), Positives = 161/318 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKR-KKGMFSKFDE-KYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           Y+ L+ G R  I  +   Q  +I  IA  +  HR+T+ RE++R + ++GY  + AQ    + R H   +     +     F  +++  W   +++R     N       S + IY ++  NK   ++  KL     +G KR ++G   K    K       RP  +  R+ FG WE+D V+GK  +G  +++ ++ERKTR   I KV +K+   +  A   L+     +V TIT DNG EF+   + A  +    Y+  PY+S++RG+NEN NGL+R+  KKGTD   +SDA I   QN+IN  P+K   +      +K+
  S:     3 YQQLTEGRRYQIS-VLLDQGISIALIAKAINCHRATVYRELKRCHALQGYCPDSAQASACKMRRHSAKYTIPDTRINFVRFLLQHD--WSPEQISRVLSGMNQAV----SHEWIYRFVARNK---RQGGKLYRHLRQGHKRYRRGKKEKAPAIKNGTSIDSRPAIVDTRERFGDWEIDTVLGKHGTG--SIVTILERKTRFYLIKKVASKSAEDVTKATIELLMPYKQYVHTITADNGREFAHHEVIANALDTTFYFAHPYSSWERGANENANGLLRQYVKKGTDLRTVSDAIILFAQNRINYRPKKCLKFKQPTVVFKQ 310
>gi|91791407|ref|YP_561058.1| integrase catalytic subunit [Shewanella denitrificans OS217] >gi|91791767|ref|YP_561418.1| integrase catalytic subunit [Shewanella denitrificans OS217] >gi|91793234|ref|YP_562885.1| integrase catalytic subunit [Shewanella denitrificans OS217] >gi|91793614|ref|YP_563265.1| integrase catalytic subunit [Shewanella denitrificans OS217] >gi|91713409|gb|ABE53335.1| Integrase, catalytic region [Shewanella denitrificans OS217] >gi|91713769|gb|ABE53695.1| Integrase, catalytic region [Shewanella denitrificans OS217] >gi|91715236|gb|ABE55162.1| Integrase, catalytic region [Shewanella denitrificans OS217] >gi|91715616|gb|ABE55542.1| Integrase, catalytic region [Shewanella denitrificans OS217] (313 aa)
Score = 325, Expect = 2.5e-28, Identities = 100/318 (31%), Positives = 161/318 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKR-KKGMFSKFDE-KYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           Y+ L+ G R  I  +   Q  +I  IA  +  HR+T+ RE++R + ++GY  + AQ    + R H   +     +     F  +++  W   +++R     N       S + IY ++  NK   ++  KL     +G KR ++G   K    K       RP  +  R+ FG WE+D V+GK  +G  +++ ++ERKTR   I KV +K+   +  A   L+     +V TIT DNG EF+   + A  +    Y+  PY+S++RG+NEN NGL+R+  KKGTD   +SDA I   QN+IN  P+K   +      +K+
  S:     3 YQQLTEGRRYQIS-VLLDQGISIALIAKAINCHRATVYRELKRCHALQGYCPDSAQASACKMRRHSAKYTIPDTRINFVRFLLQHD--WSPEQISRVLSGMNQAV----SHEWIYRFVARNK---RQGGKLYRHLRQGHKRYRRGKKEKAPAIKNGTSIDSRPAIVDTRERFGDWEIDTVLGKHGTG--SIVTILERKTRFYLIKKVASKSAEDVTKATIELLMPYKQYVHTITADNGREFAHHEVIANALDTTFYFAHPYSSWERGANENANGLLRQYVKKGTDLRTVSDAIILFAQNRINYRPKKCLKFKQPAVVFKQ 310
>gi|47076637|dbj|BAD18230.1| N-terminal region of transposase of IS658 [Bacillus halodurans] (307 aa)
Score = 325, Expect = 2.8e-28, Identities = 111/312 (35%), Positives = 156/312 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKK--NINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNH-KNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS 325
           Y HL+  ER   G +  +QK   +  QIA EL RH STI RE++RN   E Y +E A ++Y+ERR   K    W      + +  EK    W    +     + N       S K IY W+      K     LR    KG KR+K M ++           RPK +  R  FGHWELD ++  R      L    ERKTR     K++N+   ++ +AI  +VNK  L V KT T+D G EF+        +   VY+ +PYAS+QRG+NEN NGL+R  + K TD +L+++ E+    + IN  PRK   + +S
  S:     3 YSHLTTFER---GRLETLQKLGWSTRQIAKELNRHHSTIARELKRNRTKE-YVSEVAHERYVERRKGCKPKGKWSP--ELAAIIEEKLQLTWSPERIIGRLSELNL------SFKTIYRWLYLGLVNKSDLSVLRH---KG-KRQKPMETRGRFNIGTSIDQRPKEVKKRTTFGHWELDTMVSSRGKSKGCLATFAERKTRMYLAVKMDNRTSSSMETAILRMVNKYPLGVFKTSTVDRGKEFACYSNIEEQVDMAVYFADPYASWQRGTNENANGLLREFFPKKTDLALITEEELELALHLINHRPRKCLGWKTS 302
>gi|119946286|ref|YP_943966.1| integrase catalytic subunit [Psychromonas ingrahamii 37] >gi|119864890|gb|ABM04367.1| Integrase, catalytic region [Psychromonas ingrahamii 37] (335 aa)
Score = 324, Expect = 2.9e-28, Identities = 103/311 (33%), Positives = 166/311 (53%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNI--NQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNK-----WIKK--RSDKLRTAYIKGRKRKKGMFSK---FDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           Y  L+Y +R     +Y ++K  +  N+IA +L   +STI RE+ RN    GY  ++AQ    +RR      + +   +  EL   +   KW   +++    ++    +   S + IY  + ++K       KK  R  K+     K ++  +G        DE        RP+ + ++   G WE+DLVIGK  SG   L+ +VERKT  +  T+V++K+  T+ +A  +L+      V TIT DNG EF+        +KC VY+ +PY S+QRG NEN NGL+R+ ++K TDF  +S +E+ ++  K+N  PRK  NY +
  S:    16 YNQLTYEQR---CQIYALKKTGLSQNKIAKQLSVSQSTISRELSRNTGKRGYRIQQAQISSDKRRLAACKAI-KMTTSLIELIDSRIKEKWSPEQISGRLREQQSINI---SHETIYQHVWSDKKSGGNLFKKLRRKGKIYQTRNKDKQAGRGFIKNRISIDE--------RPQVVDDKSRMGDWEIDLVIGKGHSG--ALVTIVERKTSFTVSTRVDDKSAKTVTAATIALLKPFEDSVITITADNGKEFAYHEEMTESLKCDVYFADPYCSWQRGLNENTNGLLRQYWQKSTDFKKVSQSEVQDVIVKLNDRPRKKINYKT 321
>gi|15793743|ref|NP_283565.1| IS1655 transposase [Neisseria meningitidis Z2491] >gi|121051714|emb|CAM08017.1| putative transposase for IS1655 [Neisseria meningitidis Z2491] (321 aa)
Score = 324, Expect = 3.7e-28, Identities = 110/309 (35%), Positives = 162/309 (52%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV-EGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQI-------YNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSL-VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  L+ GER  I   Y  +   + +IA +L RH+STI REIRR+    + YSAEKAQ++    +  K     Q YK  S+L         H   L R  +     C  +    QI       Y +++ +K      W       LR      RKR    +++           RP  +  +   G WE D ++GK Q   S LL +VER TR + I K+++ K   T  +A+++L  +K+ +H  TIT+DNG EF +       +K + Y+C PY S+++G NEN NGLIR+ + K TDF  +SD EI  +Q+++N  PRK F Y
  S:     3 YTQLTQGERYHI--QYLFRHCTVTEIAKQLNRHKSTISREIRRHRTQGQQYSAEKAQRQSRTIKQRKR----QPYKLDSQLIQ-------HIDTLIRRKLSPEQVCAYLCKHHQITLHHSTIYRYLRQDKSNGSTLW-----QHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVDQKSRIGDWEADTIVGKGQK--SALLTLVERVTRYTIICKLDSLKAEDTARAAVRALKAHKDRVH--TITMDNGKEFYQHTKITKALKAETYFCRPYHSWEKGLNENTNGLIRQYFPKQTDFRNISDREIRRVQDELNHRPRKTFGY 305
>gi|119945511|ref|YP_943191.1| integrase catalytic subunit [Psychromonas ingrahamii 37] >gi|119864115|gb|ABM03592.1| Integrase, catalytic region [Psychromonas ingrahamii 37] (335 aa)
Score = 323, Expect = 4.7e-28, Identities = 103/311 (33%), Positives = 165/311 (53%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNI--NQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNK-----WIKK--RSDKLRTAYIKGRKRKKGMFSK---FDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           Y  L+Y +R     +Y ++K  +  N+IA +L   +STI RE+ RN    GY  ++AQ    +RR      + +   +  EL   +   KW   +++    ++    +   S + IY  + ++K       KK  R  K+     K ++  +G        DE        RP+ + ++   G WE+DLVIGK  SG   L+ +VERKT  +  T+V++K+  T+ +A  +L+      V TIT DNG EF+        +KC VY+ +PY S+QRG NEN NGL+R+ + K TDF  +S +E+ ++  K+N  PRK  NY +
  S:    16 YNQLTYEQR---CQIYALKKTGLSQNKIAKQLSVSQSTISRELSRNTGKRGYRIQQAQISSDKRRLAACKAI-KMTTSLIELIDSRIKEKWSPEQISGRLREQQSINI---SHETIYQHVWSDKKSGGNLFKKLRRKGKIYQTRNKDKQAGRGFIKNRISIDE--------RPQVVDDKSRMGDWEIDLVIGKGHSG--ALVTIVERKTSFTVSTRVDDKSAKTVTAATIALLKPFEDSVITITADNGKEFAYHEEMTESLKCDVYFADPYCSWQRGLNENTNGLLRQYWPKSTDFKKVSQSEVQDVIVKLNDRPRKKINYKT 321
>gi|172056299|ref|YP_001812759.1| integrase catalytic region [Exiguobacterium sibiricum 255-15] >gi|172056370|ref|YP_001812830.1| integrase catalytic region [Exiguobacterium sibiricum 255-15] >gi|172057021|ref|YP_001813481.1| integrase catalytic region [Exiguobacterium sibiricum 255-15] >gi|172057157|ref|YP_001813617.1| integrase catalytic region [Exiguobacterium sibiricum 255-15] >gi|172057165|ref|YP_001813625.1| integrase catalytic region [Exiguobacterium sibiricum 255-15] >gi|172058071|ref|YP_001814531.1| integrase catalytic region [Exiguobacterium sibiricum 255-15] >gi|171988820|gb|ACB59742.1| Integrase catalytic region [Exiguobacterium sibiricum 255-15] >gi|171988891|gb|ACB59813.1| Integrase catalytic region [Exiguobacterium sibiricum 255-15] >gi|171989542|gb|ACB60464.1| Integrase catalytic region [Exiguobacterium sibiricum 255-15] >gi|171989678|gb|ACB60600.1| Integrase catalytic region [Exiguobacterium sibiricum 255-15] >gi|171989686|gb|ACB60608.1| Integrase catalytic region [Exiguobacterium sibiricum 255-15] >gi|171990592|gb|ACB61514.1| Integrase catalytic region [Exiguobacterium sibiricum 255-15] (312 aa)
Score = 322, Expect = 5.3e-28, Identities = 103/318 (32%), Positives = 160/318 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNH---KNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRK-KGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           Y HL+  ER  I   Y     ++ +IA  L R  STI RE++RN +   Y +  A ++Y+ER+     +  F  +K         EK    W   ++     +E        S K IY WI +   ++  S  LR    KG+++K +    +F+     P   RP  +  R+ FGHWELD V+  R +  + +   VERK+R      +EN++  ++ SAI++L     L   +T T D G EFS        +   +Y+ +PY+S+QRGSNEN NGL+R  + KGTDF  +S +EI      IN  PRK  N+ ++ + + +
  S:     3 YIHLTISERVKI-ETYLELGFSVRKIAGRLGRQPSTISRELKRNPH---YDSSHADQRYVERKKKCGARTKFTLEK----GICILEKLRETWSPEQIAGRLFQEEGL-----SFKTIYRWIYSG-LVEADSGLLRQ---KGKRQKPRETRGRFNVGL--PISKRPSDVKGRQTFGHWELDTVVSGRGTSKACVATFVERKSRFYLAVPMENRSAQSMESAIQALHLSFPLGTFQTATTDRGKEFSCHERIRDTLGLPMYFADPYSSWQRGSNENANGLLREFFPKGTDFGKVSRSEIAQALAWINGRPRKCLNWKTAYEVFTE 306
>gi|69246174|ref|ZP_00603843.1| Integrase, catalytic region [Enterococcus faecium DO] >gi|68195382|gb|EAN09830.1| Integrase, catalytic region [Enterococcus faecium DO] (329 aa)
Score = 322, Expect = 5.3e-28, Identities = 106/317 (33%), Positives = 156/317 (49%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRN------NNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVH--PFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLL-VMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFS---KIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           Y+HL+  ER  I   Y  +     +IA  L RHRSTI REI+R       N++     + +  + I +   KN  + +K    +     KY    +  E   H +K    C     T  IYNWI + K I     KLR    + + +  G   + D  +       +RP+ +  R EFGHWE D V+ KR  G S  L   +ERKTR     K+ NK    + +AIK L+      VK+IT D G EF    ++G+      C +YY  PYA ++RGSNEN NGL+R  + K  +F  +S   +++    +N  PRK+  + +  Q +K
  S:     3 YKHLTAEERGKI-EAYLDEGLRPAEIARRLDRHRSTITREIQRGTEARKANSIARLPYQASSAQNIAKLRKKNCGVTKKATIHNIKTILKYLNLKYSPEQIAHSVKSVKVC-----TSTIYNWIYS-KTIDFNIKKLRRHGKRYKVKSSGSKIRIDRAFFENRTIDLRPEAVQLRTEFGHWEADTVVSKR--GISTCLATFIERKTRQYVAIKLPNKTGHAMMAAIKKLIEMYPQGVKSITCDRGTEFVNQFQVGLIEDTFGCNIYYANPYAPHERGSNENHNGLLREYFPKPFNFKTVSQRIVDDAVESLNTRPRKILKWKTPAQKFK 322
>gi|119945219|ref|YP_942899.1| integrase catalytic subunit [Psychromonas ingrahamii 37] >gi|119946237|ref|YP_943917.1| integrase catalytic subunit [Psychromonas ingrahamii 37] >gi|119863823|gb|ABM03300.1| Integrase, catalytic region [Psychromonas ingrahamii 37] >gi|119864841|gb|ABM04318.1| Integrase, catalytic region [Psychromonas ingrahamii 37] (335 aa)
Score = 322, Expect = 6.3e-28, Identities = 103/311 (33%), Positives = 164/311 (52%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNI--NQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNK-----WIKK--RSDKLRTAYIKGRKRKKGMFSK---FDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           Y  L+Y +R     +Y ++K  +  N+IA +L    STI RE+ RN    GY  ++AQ    +RR      + +   +  EL   +   KW   +++    ++    +   S + IY  + ++K       KK  R  K+     K ++  +G        DE        RP+ + ++   G WE+DLVIGK  SG   L+ +VERKT  +  T+V++K+  T+ +A  +L+      V TIT DNG EF+        +KC VY+ +PY S+QRG NEN NGL+R+ + K TDF  +S +E+ ++  K+N  PRK  NY +
  S:    16 YNQLTYEQR---CQIYALKKTGLSQNKIAKQLSVSHSTISRELSRNTGKRGYRIQQAQISSDKRRLAACKAI-KMTTSLIELIDSRIKEKWSPEQISGRLREQQSINI---SHETIYQHVWSDKKSGGNLFKKLRRKGKIYQTRNKDKQAGRGFIKNRISIDE--------RPQVVDDKSRMGDWEIDLVIGKGHSG--ALVTIVERKTSFTVSTRVDDKSAKTVTAATIALLKPFEDSVITITADNGKEFAYHEEMTESLKCDVYFADPYCSWQRGLNENTNGLLRQYWPKSTDFKKVSQSEVQDVIVKLNDRPRKKINYKT 321
>gi|172058234|ref|YP_001814694.1| integrase catalytic region [Exiguobacterium sibiricum 255-15] >gi|171990755|gb|ACB61677.1| Integrase catalytic region [Exiguobacterium sibiricum 255-15] (312 aa)
Score = 321, Expect = 6.7e-28, Identities = 103/318 (32%), Positives = 160/318 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNH---KNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRK-KGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           Y HL+  ER  I   Y     ++ +IA  L R  STI RE++RN +   Y +  A ++Y+ER+     +  F  +K         EK    W   ++     +E        S K IY WI +   ++  S  LR    KG+++K +    +F+     P   RP  +  R+ FGHWELD V+  R +  + +   VERK+R      +EN++  ++ SAI++L     L   +T T D G EFS        +   +Y+ +PY+S+QRGSNEN NGL+R  + KGTDF  +S +EI      IN  PRK  N+ ++ + + +
  S:     3 YIHLTISERVKI-ETYLELGFSVRKIAGRLGRQPSTISRELKRNPH---YDSSHADQRYVERKKKCGARTKFTLEK----GICILEKLRETWSPEQIAGRLFQEEGL-----SFKTIYRWIYSG-LVEADSGLLRQ---KGKRQKPRETRGRFNVGL--PISKRPSDVKGRQTFGHWELDTVVSGRGTSKACVATFVERKSRFYLAVPMENRSAQSMESAIQALHLSFPLGTFQTATTDRGKEFSCHERIRDTLGLPMYFVDPYSSWQRGSNENANGLLREFFPKGTDFGKVSRSEIAQALAWINGRPRKCLNWKTAYEVFTE 306
>gi|172058652|ref|YP_001815112.1| integrase catalytic region [Exiguobacterium sibiricum 255-15] >gi|171991173|gb|ACB62095.1| Integrase catalytic region [Exiguobacterium sibiricum 255-15] (312 aa)
Score = 321, Expect = 7.5e-28, Identities = 103/318 (32%), Positives = 161/318 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFA-EKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRK-KGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           Y HL+  ER  I   Y     ++ +IA  L R  STI RE++RN +   Y +  A ++Y+ER+  K      K+     +F  EK    W   ++     +E        S K IY WI +   ++  S  LR    KG+++K +    +F+     P   RP  +  R+ FGHWELD V+  R +  + +   VERK+R      +EN++  ++ SAI++L     L   +T T D G EFS        +   +Y+ +PY+S+QRGSNEN NGL+R  + KGTDF  +S +EI      I+  PRK  N+ ++ + + +
  S:     3 YIHLTISERVKI-ETYLELGFSVRKIAGRLGRQPSTISRELKRNPH---YDSSHADQRYVERK--KKCGARTKFTLEKGIFILEKLRETWSPEQIAGRLFQEEGL-----SFKTIYRWIYSG-LVEADSGLLRQ---KGKRQKPRETRGRFNVGL--PISKRPSDVKGRQTFGHWELDTVVSGRGTSKACVATFVERKSRFYLAVPMENRSAQSMESAIQALHLSFPLGTFQTATTDRGKEFSCHERIRDTLGLPMYFADPYSSWQRGSNENANGLLREFFPKGTDFGKVSRSEIAQALAWIDGRPRKCLNWKTAYEVFTE 306
>gi|172056549|ref|YP_001813009.1| integrase catalytic region [Exiguobacterium sibiricum 255-15] >gi|171989070|gb|ACB59992.1| Integrase catalytic region [Exiguobacterium sibiricum 255-15] (312 aa)
Score = 321, Expect = 7.6e-28, Identities = 103/318 (32%), Positives = 160/318 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNH---KNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRK-KGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           Y HL+  ER  I   Y     ++ +IA  L R  STI RE++RN +   Y +  A ++Y+ER+     +  F  +K         EK    W   ++     +E        S K IY WI +   ++  S  LR    KG+++K +    +F+     P   RP  +  R+ FGHWELD V+  R +  + +   VERK+R      +EN++  ++ SAI++L     L   +T T D G EFS        +   +Y+ +PY+S+QRGSNEN NGL+R  + KGTDF  +S +EI      IN  PRK  N+ ++ + + +
  S:     3 YIHLTISERVKI-ETYLELGFSVRKIAGRLGRQPSTISRELKRNPH---YDSSHAGQRYVERKKKCGARTKFTLEK----GICILEKLRETWSPEQIAGRLFQEEGL-----SFKTIYRWIYSG-LVEADSGLLRQ---KGKRQKPRETRGRFNVGL--PISKRPSDVKGRQTFGHWELDTVVSGRGTSKACVATFVERKSRFYLAVPMENRSAQSMESAIQALHLSFPLGTFQTATTDRGKEFSCHERIRDTLGLPMYFADPYSSWQRGSNENANGLLREFFPKGTDFGKVSRSEIAQALAWINGRPRKCLNWKTAYEVFTE 306
>gi|15722328|emb|CAC79142.1| putative transposase [Lactobacillus delbrueckii subsp. lactis] (342 aa)
Score = 320, Expect = 8.9e-28, Identities = 91/285 (31%), Positives = 145/285 (50%)
  Q:    38 QIATELKRHRSTILREIRR----------NNNVEGYSAEKAQKKYIERRN--HKNFFLWQKYKTFSEL-FAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYV-HPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL-HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           QIA+ L R  STI RE++R          + + +GY AE+    Y E+R   H    L +    F  L  A K   +   V+   HY K +YP    PST  +Y +I+  K  +  S  L     +  +R     ++ ++K +      RP  +  R+E GHWE DLV  KR      L+ + ER +R   I K+ +    T   A++  ++     + +TIT DNG EF+ +         ++Y+  PY+ ++RG+NENVNG +R  + KG  F  LS  ++  +Q+ +N  PR+  +Y
  S:    35 QIASRLHRSPSTISRELKRGLTTQIDSQKHRSYQGYFAERGAAYYREQRAKCHPKGLLQRAAVFFKSLPKALKAKPRVFSVDTYVHYFKAHYPGFPCPSTATVYRYIEAGKLPELHSYDLPMKLRRRVQRPNHRHARLNKKRLGQSIEDRPAVVRKRQELGHWEGDLVKAKRVESEPALMTLTERVSRMEIIVKLPDYRAETCRQALQDTIDDYGAENFRTITFDNGSEFASLNQVQ---GTEIYFAHPYSPWERGTNENVNGQLREFFPKGHSFKNLSLVDLQLVQDTLNHRPRRCISY 331
>gi|91791607|ref|YP_561258.1| integrase catalytic subunit [Shewanella denitrificans OS217] >gi|91713609|gb|ABE53535.1| Integrase, catalytic region [Shewanella denitrificans OS217] (313 aa)
Score = 320, Expect = 9.2e-28, Identities = 99/318 (31%), Positives = 160/318 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKR-KKGMFSKFDE-KYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           Y+ L+ G R  I  +   Q  +I  IA  +  HR+T+ RE++R + ++GY  + AQ    + R H   +     +     F  +++  W   +++R     N       S + IY ++  NK   ++  KL     +G KR ++G   K    K       RP  +  R+ FG WE+D V+GK  +G  +++ ++ERKTR   I KV +K+   +  A   L+     +V TIT DNG EF+   + A  +    Y+  PY+S++RG+NEN NGL+R+  KKGTD   +SD  I   QN+IN  P+K   +      +K+
  S:     3 YQQLTEGRRYQIS-VLLDQGISITLIAKAINCHRATVYRELKRCHALQGYCPDSAQASACKMRRHSAKYKIPDTRINVVRFLLQHD--WSPEQISRVLSGMNQAV----SHEWIYRFVARNK---RQGGKLYRHLRQGHKRYRRGKKEKAPAIKNGTSIDSRPAIVDTRERFGDWEIDTVLGKHGTG--SIVTILERKTRFYLIKKVASKSAEDVTKATIELLMPYKQYVHTITADNGREFAHHEVIANALDTSFYFAHPYSSWERGANENANGLLRQYVKKGTDLRTVSDDIILFAQNRINYRPKKCLKFKQPAVVFKQ 310
>gi|15676979|ref|NP_274130.1| IS30 family transposase [Neisseria meningitidis MC58] >gi|7226337|gb|AAF41490.1| transposase, IS30 family [Neisseria meningitidis MC58] (321 aa)
Score = 320, Expect = 9.7e-28, Identities = 109/309 (35%), Positives = 161/309 (52%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV-EGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQI-------YNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSL-VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  L+ GER  I   Y  +   + +IA +L RH+STI REIRR+    + YSAEKAQ++    +  K     Q YK  S+L         H   L R  +     C  +    QI       Y +++ +K      W       LR      RKR    +++           RP  +  +   G WE D ++GK Q   S LL +VER TR + I K+++ K   T  +A+++L  +K+ +H  TIT+DNG EF +       +K + Y+C PY S+++G NEN NGLIR+ + K TDF  +SD EI  +Q+++N  PRK   Y
  S:     3 YTQLTQGERYHI--QYLSRHCTVTEIAKQLNRHKSTISREIRRHRTQGQQYSAEKAQRQSRTIKQRKR----QPYKLDSQLIQ-------HIDPLIRRKLSPEQVCAYLCKHHQITLHHSTIYRYLRQDKSNGSTLW-----QHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVDQKSRIGDWEADTIVGKGQK--SALLTLVERVTRYTIICKLDSLKAEDTARAAVRALKAHKDRVH--TITMDNGKEFYQHTKITKALKAETYFCRPYHSWEKGLNENTNGLIRQYFPKQTDFRNISDREIRRVQDELNHRPRKTLGY 305
>gi|15676354|ref|NP_273490.1| IS30 family transposase [Neisseria meningitidis MC58] >gi|7225667|gb|AAF40880.1| transposase, IS30 family [Neisseria meningitidis MC58] (321 aa)
Score = 320, Expect = 1.1e-27, Identities = 109/309 (35%), Positives = 166/309 (53%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV-EGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFA--EKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSL-VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  L+ GER  I   Y  +   + +IA +L RH+STI REIRR+    + YSAEKAQ++    +  K     Q YK  S+L    +    +    E    Y+++++   L  ST  IY +++ +K      W       LR      RKR    +++           RP  +  +   G WE D ++GK Q   S LL +VER TR + I K+++ K   T  +A+++L  +K+ +H  TIT+DNG EF +       +K + Y+C PY S+++G NEN NGLIR+ + K TDF  +SD EI  +Q+++N  PRK   Y
  S:     3 YTQLTQGERYHI--QYLSRHCTVTEIAKQLNRHKSTISREIRRHRTQGQQYSAEKAQRQSQTIKQRKR----QPYKLDSQLIQHIDPLIRRKLSPEQVCAYLRKHHQITLHHST--IYRYLRQDKSNGSTLW-----QHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVDQKSRIGDWEADTIVGKGQK--SALLTLVERVTRYTIICKLDSLKAEDTARAAVRALKAHKDRVH--TITMDNGKEFYQHTKITKALKAETYFCRPYHSWEKGLNENTNGLIRQYFPKQTDFRNISDREIRRVQDELNHRPRKTLGY 305
>gi|15794381|ref|NP_284203.1| IS1655 transposase [Neisseria meningitidis Z2491] >gi|15794386|ref|NP_284208.1| IS1655 transposase [Neisseria meningitidis Z2491] >gi|121052305|emb|CAM08635.1| putative transposase for IS1655 [Neisseria meningitidis Z2491] >gi|121052309|emb|CAM08639.1| putative transposase for IS1655 [Neisseria meningitidis Z2491] (321 aa)
Score = 320, Expect = 1.1e-27, Identities = 109/309 (35%), Positives = 166/309 (53%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV-EGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFA--EKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSL-VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  L+ GER  I   Y  +   + +IA +L RH+STI REIRR+    + YSAEKAQ++    +  K     Q YK  S+L    +    +    E    Y+++++   L  ST  IY +++ +K      W       LR      RKR    +++           RP  +  +   G WE D ++GK Q   S LL +VER TR + I K+++ K   T  +A+++L  +K+ +H  TIT+DNG EF +       +K + Y+C PY S+++G NEN NGLIR+ + K TDF  +SD EI  +Q+++N  PRK   Y
  S:     3 YTQLTQGERYHI--QYLFRHCTVTEIAKQLNRHKSTISREIRRHRTQGQQYSAEKAQRQSRTIKQRKR----QPYKLDSQLIQHIDTLIRRKLSPEQVCAYLRKHHQITLHHST--IYRYLRQDKSNGSTLW-----QHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVDQKSRIGDWEADTIVGKGQK--SALLTLVERVTRYTIICKLDSLKAEDTARAAVRALKAHKDRVH--TITMDNGKEFYQHTKITKALKAETYFCRPYHSWEKGLNENTNGLIRQYFPKQTDFRNISDREIRRVQDELNHRPRKTLGY 305
>gi|15677122|ref|NP_274274.1| IS30 family transposase [Neisseria meningitidis MC58] >gi|15677128|ref|NP_274281.1| IS30 family transposase [Neisseria meningitidis MC58] >gi|7226491|gb|AAF41631.1| transposase, IS30 family [Neisseria meningitidis MC58] >gi|7226498|gb|AAF41637.1| transposase, IS30 family [Neisseria meningitidis MC58] (321 aa)
Score = 319, Expect = 1.1e-27, Identities = 109/309 (35%), Positives = 166/309 (53%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV-EGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFA--EKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSL-VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  L+ GER  I   Y  +   + +IA +L RH+STI REIRR+    + YSAEKAQ++    +  K     Q YK  S+L    + +  +    E    Y+ +++   L  ST  IY +++ +K      W       LR      RKR    +++           RP  +  +   G WE D ++GK Q   S LL +VER TR + I K+++ K   T  +A+++L  +K+ +H  TIT+DNG EF +       +K + Y+C PY S+++G NEN NGLIR+ + K TDF  +SD EI  +Q+++N  PRK   Y
  S:     3 YTQLTQGERYHI--QYLSRHCTVTEIAKQLNRHKSTISREIRRHRTQGQQYSAEKAQRQSRTIKQRKR----QPYKLDSQLIQHIDPFIRRKLSPEQVCAYLCKHHQITLHHST--IYRYLRQDKSNGSTLW-----QHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVDQKSRIGDWEADTIVGKGQK--SALLTLVERVTRYTIICKLDSLKAEDTARAAVRALKAHKDRVH--TITMDNGKEFYQHTKITKALKAETYFCRPYHSWEKGLNENTNGLIRQYFPKQTDFRNISDREIRRVQDELNHRPRKTLGY 305
>gi|15676910|ref|NP_274056.1| IS30 family transposase [Neisseria meningitidis MC58] >gi|7226262|gb|AAF41422.1| transposase, IS30 family [Neisseria meningitidis MC58] (321 aa)
Score = 319, Expect = 1.2e-27, Identities = 109/309 (35%), Positives = 161/309 (52%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV-EGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQI-------YNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSL-VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  L+ GER  I   Y  +   + +IA +L RH+STI REIRR+    + YSAEKAQ++    +  K     Q YK  S+L         H   L R  +     C  +    QI       Y +++ +K      W       LR      RKR    +++           RP  +  +   G WE D ++GK Q   S LL +VER TR + I K+++ K   T  +A+++L  +K+ +H  TIT+DNG EF +       +K + Y+C PY S+++G NEN NGLIR+ + K TDF  +SD EI  +Q+++N  PRK   Y
  S:     3 YTQLTQGERYHI--QYLSRHCTVTEIAKQLNRHKSTISREIRRHRTQGQQYSAEKAQRQSQTIKQRKR----QPYKLDSQLIQ-------HIDPLIRRKLSPEQVCAYLCKHHQITLHHSTIYRYLRQDKSNGSTLW-----QHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVDQKSRIGDWEADTIVGKGQK--SALLTLVERVTRYTIICKLDSLKAEDTARAAVRALKAHKDRVH--TITMDNGKEFYQHTKITKALKAETYFCRPYHSWEKGLNENTNGLIRQYFPKQTDFRNISDREIRRVQDELNHRPRKTLGY 305
>gi|15676535|ref|NP_273678.1| IS30 family transposase [Neisseria meningitidis MC58] >gi|7225864|gb|AAF41058.1| transposase, IS30 family [Neisseria meningitidis MC58] (321 aa)
Score = 319, Expect = 1.3e-27, Identities = 109/309 (35%), Positives = 161/309 (52%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV-EGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQI-------YNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSL-VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  L+ GER  I   Y  +   + +IA +L RH+STI REIRR+    + YSAEKAQ++    +  K     Q YK  S+L         H   L R  +     C  +    QI       Y +++ +K      W       LR      RKR    +++           RP  +  +   G WE D ++GK Q   S LL +VER TR + I K+++ K   T  +A+++L  +K+ +H  TIT+DNG EF +       +K + Y+C PY S+++G NEN NGLIR+ + K TDF  +SD EI  +Q+++N  PRK   Y
  S:     3 YTQLTQGERYHI--QYLSRHCTVTEIAKQLNRHKSTISREIRRHRTQGQQYSAEKAQRQSRTIKQRKR----QPYKLDSQLIQ-------HIDPLIRRKLSPEQVCAYLCKHHQITLHHSTIYRYLRQDKSNGSTLW-----QHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVDQKSRIGDWEADTIVGKGQK--SALLTLVERVTRYTIICKLDSLKAEDTARAAVRALKAHKDRVH--TITMDNGKEFYQHTKITKALKAETYFCRPYHSWEKGLNENTNGLIRQYFPKQTDFRNISDREIRRVQDELNHRPRKTLGY 305
>gi|15676151|ref|NP_273282.1| IS30 family transposase [Neisseria meningitidis MC58] >gi|15676936|ref|NP_274084.1| IS30 family transposase [Neisseria meningitidis MC58] >gi|15677961|ref|NP_275133.1| IS30 family transposase [Neisseria meningitidis MC58] >gi|7225448|gb|AAF40681.1| transposase, IS30 family [Neisseria meningitidis MC58] >gi|7226290|gb|AAF41448.1| transposase, IS30 family [Neisseria meningitidis MC58] >gi|7227406|gb|AAF42456.1| transposase, IS30 family [Neisseria meningitidis MC58] >gi|73912929|gb|AAZ91415.1| transposase [Neisseria meningitidis] (321 aa)
Score = 319, Expect = 1.3e-27, Identities = 109/309 (35%), Positives = 161/309 (52%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV-EGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQI-------YNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSL-VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  L+ GER  I   Y  +   + +IA +L RH+STI REIRR+    + YSAEKAQ++    +  K     Q YK  S+L         H   L R  +     C  +    QI       Y +++ +K      W       LR      RKR    +++           RP  +  +   G WE D ++GK Q   S LL +VER TR + I K+++ K   T  +A+++L  +K+ +H  TIT+DNG EF +       +K + Y+C PY S+++G NEN NGLIR+ + K TDF  +SD EI  +Q+++N  PRK   Y
  S:     3 YTQLTQGERYHI--QYLSRHCTVTEIAKQLNRHKSTISREIRRHRTQGQQYSAEKAQRQSQTIKQRKR----QPYKLDSQLIQ-------HIDTLIRRKLSPEQVCAYLCKHHQITLHHSTIYRYLRQDKSNGSTLW-----QHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVDQKSRIGDWEADTIVGKGQK--SALLTLVERVTRYTIICKLDSLKAEDTARAAVRALKAHKDRVH--TITMDNGKEFYQHTKITKALKAETYFCRPYHSWEKGLNENTNGLIRQYFPKQTDFRNISDREIRRVQDELNHRPRKTLGY 305
>gi|15794704|ref|NP_284526.1| IS1655 transposase [Neisseria meningitidis Z2491] >gi|121052595|emb|CAM08935.1| insertion element IS1655 transposase [Neisseria meningitidis Z2491] (321 aa)
Score = 319, Expect = 1.3e-27, Identities = 109/309 (35%), Positives = 161/309 (52%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV-EGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQI-------YNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSL-VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  L+ GER  I   Y  +   + +IA +L RH+STI REIRR+    + YSAEKAQ++    +  K     Q YK  S+L         H   L R  +     C  +    QI       Y +++ +K      W       LR      RKR    +++           RP  +  +   G WE D ++GK Q   S LL +VER TR + I K+++ K   T  +A+++L  +K+ +H  TIT+DNG EF +       +K + Y+C PY S+++G NEN NGLIR+ + K TDF  +SD EI  +Q+++N  PRK   Y
  S:     3 YTQLTQGERYHI--QYLFRHCTVTEIAKQLNRHKSTISREIRRHRTQGQQYSAEKAQRQSRTIKQRKR----QPYKLDSQLIQ-------HIDTLIRRKLSPEQVCAYLCKHHQITLHHSTIYRYLRQDKSNGSTLW-----QHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVDQKSRIGDWEADTIVGKGQK--SALLTLVERVTRYTIICKLDSLKAEDTARAAVRALKAHKDRVH--TITMDNGKEFYQHTKITKALKAETYFCRPYHSWEKGLNENTNGLIRQYFPKQTDFRNISDREIRRVQDELNHRPRKTLGY 305
>gi|15793066|ref|NP_282888.1| IS1655 transposase [Neisseria meningitidis Z2491] >gi|6900442|emb|CAB72041.1| putative transposase [Neisseria meningitidis] >gi|121051090|emb|CAM07360.1| putative transposase for IS1655 [Neisseria meningitidis Z2491] (321 aa)
Score = 318, Expect = 1.5e-27, Identities = 109/309 (35%), Positives = 159/309 (51%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV-EGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDK---------LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSL-VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  L+ GER  I   Y  +   + +IA +L RH+STI REIRR+    + YSAEKAQ++    +  K     Q YK  S+L         H   L R  +     C  +    QI     +  +   R DK         LR      RKR    +++           RP  +  +   G WE D ++GK Q   S LL +VER TR + I K+++ K   T  +A+++L  +K+ +H  TIT+DNG EF +       +K + Y+C PY S+++G NEN NGLIR+ + K TDF  +SD EI  +Q+++N  PRK   Y
  S:     3 YTQLTQGERYHI--QYLSRHCTVTEIAKQLNRHKSTISREIRRHRTQGQQYSAEKAQRQSRTIKQRKR----QPYKLDSQLIQ-------HIDTLIRRKLSPEQVCAYLCKHHQI-TLHHSTIYRHLRQDKSNGSTLWQHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVDQKSRIGDWEADTIVGKGQK--SALLTLVERVTRYTIICKLDSLKAEDTARAAVRTLKAHKDRVH--TITMDNGKEFYQHTKITKALKAETYFCRPYHSWEKGLNENTNGLIRQYFPKQTDFRNISDREIRRVQDELNHRPRKTLGY 305
>gi|149116615|ref|ZP_01843336.1| Integrase, catalytic region [Shewanella baltica OS223] >gi|152998502|ref|YP_001355423.1| integrase catalytic region [Shewanella baltica OS185] >gi|160873065|ref|YP_001557071.1| integrase catalytic region [Shewanella baltica OS195] >gi|146863437|gb|EDK48968.1| Integrase, catalytic region [Shewanella baltica OS223] >gi|151367516|gb|ABS10515.1| Integrase catalytic region [Shewanella baltica OS185] >gi|160858587|gb|ABX51811.1| Integrase catalytic region [Shewanella baltica OS195] (290 aa)
Score = 318, Expect = 1.6e-27, Identities = 97/277 (35%), Positives = 146/277 (52%)
  Q:    48 STILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIK-------KRSDKLRTAYIKGRKRKKGMFSK---FDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           +TI RE  RN    GY  ++AQ   I RR      + +   T  EL   K N KW   E    +++E+  C+ + S + IY  I ++K          +R  K   +  K ++  +G        DE        RP  + ++   G WE+DLVIGK  SG   L+ +VERKT  +  T+V++K+  T+ +A  +L+      V TIT DNG EF+        +KC VY+ +PY S+QRG NEN NGL+R+ + K TDF  +S +E+ ++   +N  PRK  NY +
  S:     4 ATISREFSRNTGKRGYRFKQAQTSTIRRRLAACKAI-KMTTTTVELIESKINAKW-SPEQVSGWLRED-QCIDI-SYETIYKHIWSDKQNGGHLFQQLRRKGKAYQSRSKDKQAGRGFIKNRISIDE--------RPHVVDDKSRVGDWEIDLVIGKGHSG--ALVTIVERKTSFTVSTRVDDKSAKTVTAATIALLAPFKGAVLTITADNGKEFAYHEKMTESLKCDVYFADPYCSWQRGLNENTNGLLRQYWPKSTDFKKVSQSEVQDVIANLNDRPRKKLNYKT 276
>gi|15676730|ref|NP_273875.1| IS30 family transposase [Neisseria meningitidis MC58] >gi|121634168|ref|YP_974413.1| insertion element IS1655 transposase [Neisseria meningitidis FAM18] >gi|121634794|ref|YP_975039.1| putative transposase for IS1655 [Neisseria meningitidis FAM18] >gi|121634817|ref|YP_975062.1| transposase for IS1655 [Neisseria meningitidis FAM18] >gi|121634859|ref|YP_975104.1| transposase for IS1655 [Neisseria meningitidis FAM18] >gi|121635133|ref|YP_975378.1| putative transposase for IS1655 [Neisseria meningitidis FAM18] >gi|121635571|ref|YP_975816.1| putative transposase for IS1655 [Neisseria meningitidis FAM18] >gi|121635671|ref|YP_975916.1| insertion element IS1655 transposase [Neisseria meningitidis FAM18] >gi|121635791|ref|YP_976036.1| insertion element IS1655 transposase [Neisseria meningitidis FAM18] >gi|7226068|gb|AAF41245.1| transposase, IS30 family [Neisseria meningitidis MC58] >gi|120865874|emb|CAM09609.1| insertion element IS1655 transposase [Neisseria meningitidis FAM18] >gi|120866500|emb|CAM10248.1| putative transposase for IS1655 [Neisseria meningitidis FAM18] >gi|120866523|emb|CAM10273.1| transposase for IS1655 [Neisseria meningitidis FAM18] >gi|120866565|emb|CAM10315.1| transposase for IS1655 [Neisseria meningitidis FAM18] >gi|120866839|emb|CAM10597.1| Putative transposase for IS1655 [Neisseria meningitidis FAM18] >gi|120867277|emb|CAM11048.1| putative transposase for IS1655 [Neisseria meningitidis FAM18] >gi|120867377|emb|CAM11149.1| insertion element IS1655 transposase [Neisseria meningitidis FAM18] >gi|120867497|emb|CAM11274.1| insertion element IS1655 transposase [Neisseria meningitidis FAM18] (321 aa)
Score = 318, Expect = 1.6e-27, Identities = 109/309 (35%), Positives = 161/309 (52%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV-EGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQI-------YNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSL-VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  L+ GER  I   Y  +   + +IA +L RH+STI REIRR+    + YSAEKAQ++    +  K     Q YK  S+L         H   L R  +     C  +    QI       Y +++ +K      W       LR      RKR    +++           RP  +  +   G WE D ++GK Q   S LL +VER TR + I K+++ K   T  +A+++L  +K+ +H  TIT+DNG EF +       +K + Y+C PY S+++G NEN NGLIR+ + K TDF  +SD EI  +Q+++N  PRK   Y
  S:     3 YTQLTQGERYHI--QYLSRHCTVTEIAKQLNRHKSTISREIRRHRTQGQQYSAEKAQRQSRTIKQRKR----QPYKLDSQLIQ-------HIDTLIRRKLSPEQVCAYLCKHHQITLHHSTIYRYLRQDKSNGSTLW-----QHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVDQKSRIGDWEADTIVGKGQK--SALLTLVERVTRYTIICKLDSLKAEDTARAAVRALKAHKDRVH--TITMDNGKEFYQHTKITKALKAETYFCRPYHSWEKGLNENTNGLIRQYFPKQTDFRNISDREIRRVQDELNHRPRKTLGY 305
>gi|119944919|ref|YP_942599.1| integrase catalytic subunit [Psychromonas ingrahamii 37] >gi|119863523|gb|ABM03000.1| Integrase, catalytic region [Psychromonas ingrahamii 37] (335 aa)
Score = 318, Expect = 1.7e-27, Identities = 103/311 (33%), Positives = 164/311 (52%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNI--NQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNK-----WIKK--RSDKLRTAYIKGRKRKKGMFSK---FDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           Y  L+Y +R     +Y ++K  +  N+IA +L    STI RE+ RN    GY  ++AQ    +RR      + +   +  EL   +   KW   +++    ++    +   S + IY  + ++K       KK  R  K+     K ++  +G        DE        RP+ + ++   G WE+DLVIGK  SG   L+ +VERKT  +  T+V++K+  T+ +A  +L+      V TIT DNG EF+        +KC VY+ +PY S+QRG NEN NGL+R+ + K TDF  +S +E+ ++  K+N  PRK  NY +
  S:    16 YNQLTYEQR---CQIYALKKTGLSQNKIAKQLSVSHSTISRELSRNTGKRGYRIQQAQISSDKRRLAACKAI-KMTTSLIELIDSRIKEKWSPEQISGRLREQQSINI---SHETIYQHVWSDKKSGGNLFKKLRRKGKIYQTRNKDKQAGRGFIKNRISIDE--------RPQVVDDKSRMGDWEIDLVIGKGHSG--ALVTIVERKTSFTVSTRVDDKSAKTVTAATIALLKPFEDSVITITADNGKEFAYHEEMTESLKCDVYFADPYCSWQRGLNENTNGLLRQYWPKSTDFKKVSQSEVQDVIVKLNDRPRKKKNYKT 321
>gi|37526904|ref|NP_930248.1| IS30 family transposase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36786337|emb|CAE15390.1| Transposase, IS30 family [Photorhabdus luminescens subsp. laumondii TTO1] (322 aa)
Score = 315, Expect = 3.2e-27, Identities = 100/292 (34%), Positives = 153/292 (52%)
  Q:    39 IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGV--ELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSD---KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           IA  LKR  STI RE++RN  V+ Y  E+A  K + RR+    F  +  K   E+        W  +  E    Y+K++    L   T  IY  I  +K  ++  D    LR A    RKR      +   K       RP+ +  ++  G WE D +IGK +   S LL +V+RKT  + I K+++K    +  A   ++      VKTIT DNG+EF+   I    ++ ++Y+  PY+ ++RG NEN+NGLIR+ + KGTDF+ +SD EIN + N++N  PRK     + ++ +K
  S:    27 IAESLKRSPSTISRELKRNQEVQTYCPEQAHLKVLARRH----FAKKAVKITPEVKRWIKRLIWKDLSPEQVADYLKQHKGISLHHET--IYRLIYQDK--REGGDLWQHLRIARKPYRKRYGRYERRGKIKNRVSIDERPEIVDKKERIGDWEGDTIIGKDKK--SVLLTLVDRKTLYTIIVKLDSKQASEVAKAAVKVLYPLKQRVKTITFDNGLEFADHEIIGEELETQIYFAHPYSPWERGINENINGLIRQYFPKGTDFNEVSDQEINFVVNRLNNRPRKTRGGKTPNELFK 313
>gi|172057329|ref|YP_001813789.1| integrase catalytic region [Exiguobacterium sibiricum 255-15] >gi|171989850|gb|ACB60772.1| Integrase catalytic region [Exiguobacterium sibiricum 255-15] (312 aa)
Score = 315, Expect = 3.5e-27, Identities = 102/318 (32%), Positives = 159/318 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNH---KNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRK-KGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           Y HL+  ER  I   Y     ++ +IA  L R   TI RE++RN +   Y +  A ++Y+ER+     +  F  +K         EK    W   ++     +E        S K IY WI +   ++  S  LR    KG+++K +    +F+     P   RP  +  R+ FGHWELD V+  R +  + +   VERK+R      +EN++  ++ SAI++L     L   +T T D G EFS        +   +Y+ +PY+S+QRGSNEN NGL+R  + KGTDF  +S +EI      IN  PRK  N+ ++ + + +
  S:     3 YIHLTISERVKI-ETYLELGFSVRKIAGRLGRQPYTISRELKRNPH---YDSSHADQRYVERKKKCGARTKFTLEK----GICILEKLRETWSPEQIAGRLFQEEGL-----SFKTIYRWIYSG-LVEADSGLLRQ---KGKRQKPRETRGRFNVGL--PISKRPSDVKGRQTFGHWELDTVVSGRGTSKACVATFVERKSRFYLAVPMENRSAQSMESAIQALHLSFPLGTFQTATTDRGKEFSCHERIRDTLGLPMYFADPYSSWQRGSNENANGLLREFFPKGTDFGKVSRSEIAQALAWINGRPRKCLNWKTAYEVFTQ 306
>gi|15676806|ref|NP_273951.1| IS30 family transposase [Neisseria meningitidis MC58] >gi|7226148|gb|AAF41319.1| transposase, IS30 family [Neisseria meningitidis MC58] (321 aa)
Score = 315, Expect = 3.6e-27, Identities = 108/309 (34%), Positives = 166/309 (53%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV-EGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFA--EKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSL-VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           +  L+ GER  I   Y  +   + +IA +L RH+STI REIRR+    + YSAEKAQ++    +  K     Q YK  S+L    +    +    E    Y+++++   L  ST  IY +++ +K      W       LR      RKR    +++           RP  +  +   G WE D ++GK Q   S LL +VER TR + I K+++ K   T  +A+++L  +K+ +H  TIT+DNG EF +       +K + Y+C PY S+++G NEN NGLIR+ + K TDF  +SD EI  +Q+++N  PRK   Y
  S:     3 HTQLTQGERYHI--QYLSRHCTVTEIAKQLNRHKSTISREIRRHRTQGQQYSAEKAQRQSQTIKQRKR----QPYKLDSQLIQHIDPLIRRKLSPEQVCAYLRKHHQITLHHST--IYRYLRQDKSNGSTLW-----QHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVDQKSRIGDWEADTIVGKGQK--SALLTLVERVTRYTIICKLDSLKAEDTARAAVRTLKAHKDRVH--TITMDNGKEFYQHTKITKALKAETYFCRPYHSWEKGLNENTNGLIRQYFPKQTDFRNISDREIRRVQDELNHRPRKTLGY 305
>gi|172058069|ref|YP_001814529.1| integrase catalytic region [Exiguobacterium sibiricum 255-15] >gi|171990590|gb|ACB61512.1| Integrase catalytic region [Exiguobacterium sibiricum 255-15] (312 aa)
Score = 315, Expect = 3.6e-27, Identities = 102/318 (32%), Positives = 159/318 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNH---KNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRK-KGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           Y HL+  ER  I   Y     ++ +IA  L R  STI RE++RN +   Y +  A ++Y+ER+     +  F  +K         EK    W   ++     +E        S K IY WI +   ++  S  LR    KG+++K +    +F+     P    P  +  R+ FGHWELD V+  R +  + +   VERK+R      +EN++  ++ SAI++L     L   +T T D G EFS        +   +Y+ +PY+S+QRGSNEN NGL+R  + KGTDF  +S +EI      IN  PRK  N+ ++ + + +
  S:     3 YIHLTISERVKI-ETYLELGFSVRKIAGRLGRQPSTISRELKRNPH---YDSSHADQRYVERKKKCGARTKFTLEK----GICILEKLRETWSPEQIAGRLFQEEGL-----SFKTIYRWIYSG-LVEADSGLLRQ---KGKRQKPRETRGRFNVGL--PISKCPSDVKGRQTFGHWELDTVVSGRGTSKACVATFVERKSRFYLAVPMENRSAQSMESAIQALHLSFPLRTFQTATTDRGKEFSCHERIRDTLGLPMYFADPYSSWQRGSNENANGLLREFFPKGTDFGKVSRSEIAQALAWINGRPRKCLNWKTAYEVFTE 306
>gi|15676703|ref|NP_273847.1| IS30 family transposase [Neisseria meningitidis MC58] >gi|7226039|gb|AAF41218.1| transposase, IS30 family [Neisseria meningitidis MC58] (321 aa)
Score = 314, Expect = 4.4e-27, Identities = 108/309 (34%), Positives = 161/309 (52%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV-EGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQI-------YNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSL-VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           +  L+ GER  I   Y  +   + +IA +L RH+STI REIRR+    + YSAEKAQ++    +  K     Q YK  S+L         H   L R  +     C  +    QI       Y +++ +K      W       LR      RKR    +++           RP  +  +   G WE D ++GK Q   S LL +VER TR + I K+++ K   T  +A+++L  +K+ +H  TIT+DNG EF +       +K + Y+C PY S+++G NEN NGLIR+ + K TDF  +SD EI  +Q+++N  PRK   Y
  S:     3 HTQLTQGERYHI--QYLSRHCTVTEIAKQLNRHKSTISREIRRHRTQGQQYSAEKAQRQSRTIKQRKR----QPYKLDSQLIQ-------HIDPLIRRKLSPEQVCAYLCKHHQITLHHSTIYRYLRQDKSNGSTLW-----QHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVDQKSRIGDWEADTIVGKGQK--SALLTLVERVTRYTIICKLDSLKAEDTARAAVRALKAHKDRVH--TITMDNGKEFYQHTKITKALKAETYFCRPYHSWEKGLNENTNGLIRQYFPKQTDFRNISDREIRRVQDELNHRPRKTLGY 305
>gi|15677560|ref|NP_274716.1| IS30 family transposase [Neisseria meningitidis MC58] >gi|15677611|ref|NP_274770.1| IS30 family transposase [Neisseria meningitidis MC58] >gi|121634730|ref|YP_974975.1| putative transposase for IS1655 [Neisseria meningitidis FAM18] >gi|7226968|gb|AAF42060.1| transposase, IS30 family [Neisseria meningitidis MC58] >gi|7227024|gb|AAF42110.1| transposase, IS30 family [Neisseria meningitidis MC58] >gi|11877312|emb|CAC19026.1| hypothetical protein [Neisseria meningitidis] >gi|17974318|dbj|BAB79528.1| putative transposase [Neisseria meningitidis] >gi|120866436|emb|CAM10182.1| putative transposase for IS1655 [Neisseria meningitidis FAM18] (321 aa)
Score = 314, Expect = 5.3e-27, Identities = 109/309 (35%), Positives = 165/309 (53%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV-EGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFA--EKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSL-VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  L+ GER  I   Y  +   + +IA +L RH+STI REIRR+    + YSAEKAQ++    +  K     Q YK  S+L    +    +    E    Y+ +++   L  ST  IY +++ +K      W       LR      RKR    +++           RP  +  +   G WE D ++GK Q   S LL +VER TR + I K+++ K   T  +A+++L  +K+ +H  TIT+DNG EF +       +K + Y+C PY S+++G NEN NGLIR+ + K TDF  +SD EI  +Q+++N  PRK   Y
  S:     3 YTQLTQGERYHI--QYLSRHCTVTEIAKQLNRHKSTISREIRRHRTQGQQYSAEKAQRQSRTIKQRKR----QPYKLDSQLIQHIDTLIRRKLSPEQVCAYLCKHHRITLHHST--IYRYLRQDKSNGSTLW-----QHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVDQKSRIGDWEADTIVGKGQK--SALLTLVERVTRYTIICKLDSLKAEDTARAAVRALKAHKDRVH--TITMDNGKEFYQHTKITKALKAETYFCRPYHSWEKGLNENTNGLIRQYFPKQTDFRNISDREIRRVQDELNHRPRKTLGY 305
>gi|126175055|ref|YP_001051204.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126175637|ref|YP_001051786.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|149115894|ref|ZP_01842630.1| Integrase, catalytic region [Shewanella baltica OS223] >gi|125998260|gb|ABN62335.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125998842|gb|ABN62917.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|146864178|gb|EDK49615.1| Integrase, catalytic region [Shewanella baltica OS223] (315 aa)
Score = 313, Expect = 5.7e-27, Identities = 100/309 (32%), Positives = 156/309 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNIN--QIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRN-HKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y+ L+ G+R  I  +Y   K+N +  +I   +   +STI RE+RRN    GY A+ A  +  +RR       + Q    F E FA ++      +      I       L  S + IY ++  NK      +   R  K R  Y KG  +K+G     D   +    +RP  +  R   G WE DLV+GK+ +G   ++ + ERK+R     KV +K+   ++ AI S+++       TIT DNG EFS+  + A  ++ ++Y+  PY+S +RG NEN NGL+R+   KGTD   +SD ++   Q  +N  PRK   +
  S:     3 YQQLTEGQRYQIALLY---KENCSCREIGQRVGVSKSTISRELRRNGTTAGYVAQHAHSQCEQRRGVAAKRSVSQSTIEFVE-FALEWKWSPEQISAVAKLIG------LSVSHEWIYQYVFANKSRGGVLYEHLRQGKRR--YRKGYGQKRGGIP--DAVSIE---LRPAIVDERARLGDWEADLVLGKQGTG--AIVTLAERKSRIYLTKKVFSKDAMEVSKAIISMLSDYKDACHTITFDNGREFSEHKVIAEALEAEMYFAHPYSSQERGLNENTNGLLRQFIPKGTDLRTVSDEDLQRYQGALNSRPRKCLGF 301
>gi|116495471|ref|YP_807205.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116495798|ref|YP_807532.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116495800|ref|YP_807534.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116105621|gb|ABJ70763.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116105948|gb|ABJ71090.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116105950|gb|ABJ71092.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] (338 aa)
Score = 313, Expect = 6.8e-27, Identities = 98/328 (29%), Positives = 165/328 (50%)
  Q:     6 ITLNDTNKYRH---LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN---------NVEGYSAEKAQKKYIERRNHKNFFLWQK-----YKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQT------NKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL-HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCM 333
           +T + TN ++H   LS+ +R  I  +          IA +L R ++TI REI R +         + + Y AE AQ  +  +R+    + + K     +K  S     K   + H V+   H+ ++       PST  +Y +I        N  + K+  +    Y    KRK        + Y     +RP  + +R   GHWE DLV G R +    L+ + ER +R   I K+ + +  T   A++  ++       ++IT DNG EF+K+   +  +  K+Y+  PY+ ++RG+NEN NGL+R  + KG     ++  EI  +Q+ +N  PR++ NY+    YY +CM
  S:     1 MTHSQTNTHKHYQQLSFSDRATIQALQ-AAGDTATVIAQKLHRSKATISREITRGSVTQLDSKRHSHQVYLAETAQAMHDRKRDRTGHYAFLKTGRAFFKALSRELTRK--PRVHSVDSFVHFYRDQGKAC--PSTTTVYRYIDAGLLELDNMTLPKKLRRRIKGYKNAHKRKN------KKIYGDSIELRPAAVNDRTGVGHWEGDLVKGIRLADEPALMTLTERYSRTEIIVKIPDYHAGTCLKALQDTIDDYGAKEFESITFDNGSEFAKL---SEIVGTKIYFAHPYSPWERGTNENANGLLREFFPKGKSLRAVTLVEIQAVQSALNHRPRRILNYLRPCDYY-RCM 337
>gi|20807224|ref|NP_622395.1| IS30 family transposase [Thermoanaerobacter tengcongensis MB4] >gi|20807360|ref|NP_622531.1| IS30 family transposase [Thermoanaerobacter tengcongensis MB4] >gi|167036579|ref|YP_001664157.1| integrase catalytic subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167036604|ref|YP_001664182.1| integrase catalytic subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167036649|ref|YP_001664227.1| integrase catalytic subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167036923|ref|YP_001664501.1| integrase catalytic subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167037079|ref|YP_001664657.1| integrase catalytic subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167037262|ref|YP_001664840.1| integrase catalytic subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167037345|ref|YP_001664923.1| integrase catalytic subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167038427|ref|YP_001666005.1| integrase catalytic subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|20515728|gb|AAM23999.1| transposase, IS30 family [Thermoanaerobacter tengcongensis MB4] >gi|20515878|gb|AAM24135.1| transposase, IS30 family [Thermoanaerobacter tengcongensis MB4] >gi|166855413|gb|ABY93821.1| Integrase, catalytic region [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855438|gb|ABY93846.1| Integrase, catalytic region [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855483|gb|ABY93891.1| Integrase, catalytic region [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855757|gb|ABY94165.1| Integrase, catalytic region [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855913|gb|ABY94321.1| Integrase, catalytic region [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856096|gb|ABY94504.1| Integrase, catalytic region [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856179|gb|ABY94587.1| Integrase, catalytic region [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166857261|gb|ABY95669.1| Integrase, catalytic region [Thermoanaerobacter pseudethanolicus ATCC 33223] (347 aa)
Score = 312, Expect = 8.1e-27, Identities = 115/321 (35%), Positives = 171/321 (53%)
  Q:     9 NDTNK---YRHLSYGEREIIGHMYFVQK--KNINQIATELKRHRSTILREIRRNNNVE---------GYSAEKAQKKYIERR-NHKNFFLWQKYKTFSELFAEK-YNCKWHGVELTRHYIKE-NYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK--NNLH--VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           NDT K   ++HLS  ER   G +Y + K  ++I  IA +L R  STI REI+R    +          Y  E  Q  Y + R N    F   K + F +    K  N KW    +  +  K+ ++    +  TK +YN+I       K  D      +K RK++     +   K +     RPK + +R+ FGHWE+D +IGK+ S    LL ++ERKTR+  I  ++ K+  ++  A+  L +   +NL    KTIT DNG EFS +  A      +VYY  PY+S++R +NE  NGLIRR   KG     LS   I  ++N +N +PRK+ NY +  +Y+
  S:     5 NDTTKKRSFKHLSSYER---GEIYALLKEGRSIRYIAKKLNRSPSTISREIKRGTTTQLRSDLSSYTSYFPETGQAIYEKNRSNCGAKFKVAKAEDFLKYAENKILNEKWSPDAVVGYCKKDPSWNNKTIVCTKTLYNYIDRGLLKVKNIDLPLKLRLKPRKKQNRKNKRIMGKSID---FRPKEVESREVFGHWEIDTLIGKK-SNDKVLLTLIERKTRHEIIFLLDAKDNKSVKDALSKLKDMFGDNLSKVFKTITSDNGTEFSDLESALLEYGVEVYYTHPYSSWERATNERHNGLIRRFIPKGKSIKDLSIDTIKRVENWLNNLPRKLLNYKTPKEYF 339
>gi|116494824|ref|YP_806558.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116104974|gb|ABJ70116.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] (338 aa)
Score = 311, Expect = 1.1e-26, Identities = 97/328 (29%), Positives = 166/328 (50%)
  Q:     6 ITLNDTNKYRH---LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN---------NVEGYSAEKAQKKYIERRNHKNFFLWQKY-KTFSELFAEKYNCK--WHGVELTRHYIKENYPCVLVPSTKQIYNWIQT------NKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL-HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCM 333
           +T + TN ++H   LS+ +R  I  +          IA +L R ++TI REI R +         + + Y AE AQ  +  +R+    + + K  + F +  A +   K   H V+   H+ ++       PST  +Y +I        N  + K+  +    Y    KRK        + Y     +RP  + +R   GHWE DLV G R +    L+ + ER +R   I K+ + +  T   A++  ++       ++IT DNG EF+K+   +  +  ++Y+  PY+ ++RG+NEN NGL+R  + KG     ++  EI  +Q+ +N  PR++ NY+    YY +CM
  S:     1 MTHSQTNTHKHYQQLSFSDRATIQALQ-AAGDTATVIAQKLHRSKATISREITRGSVTQLDSKRHSHQVYLAETAQAMHDRKRDRTGHYAFLKTGRAFFKALARELTRKPRVHSVDSFVHFYRDQGKAC--PSTTTVYRYIDAGLLELDNMTLPKKLRRRIKGYKNAHKRKN------KKIYGDSIELRPAAVNDRTGVGHWEGDLVKGIRLADEPALMTLTERYSRTEIIVKIPDYHAGTCLKALQDTIDDYGAKEFESITFDNGSEFAKL---SEIVGTQIYFAHPYSPWERGTNENANGLLREFFPKGKSLRAITLVEIQAVQSALNHRPRRILNYLRPCDYY-RCM 337
>gi|61889363|emb|CAI72511.1| ISSA1 transposase [Staphylococcus aureus] (328 aa)
Score = 311, Expect = 1.1e-26, Identities = 106/318 (33%), Positives = 157/318 (49%)
  Q:     5 TITLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAE--KY--NCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRK-KGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK-NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           T T +    Y HL+  ER  I  +   +  ++  IA +LKR  STI REI RNN  + Y AE AQK Y  +R      L  +   F+       KY   C W   ++    + +N  C      K IY WI +N    +    LR    KG+++K K    KF+     P   RPK I  R  FGHWE D ++  R      +    ERK+R  +   + +++  ++ +AI +L+       VKTIT+D G EFS            VY+ +PY+++QRG+NEN NGL+R  + K TD + ++  ++N   + IN  PRK  N+
  S:     7 THTRSANMSYNHLTLTERARI-EVLRQENYSLRSIARKLKRSVSTISREISRNNLNQSYQAETAQKNYETKRK-----LCGRPTRFTPELGNIIKYYLKCHWSPEQIVGRLL-QNQICF-----KTIYRWINSNMINFELISCLRQ---KGKRQKPKETRGKFN--IGRPISQRPKEIKKRNTFGHWEADTIVSSRGKSKGCIATFAERKSRYYYCVLMPDRSSNSMETAINNLIKHLPKGAVKTITVDRGKEFSCYQNIENQFNINVYFADPYSAWQRGTNENTNGLLREFFPKKTDLAKVNQEQLNYALDSINYRPRKCLNW 313
>gi|49482327|ref|YP_039551.1| putative transposase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49483152|ref|YP_040376.1| putative transposase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49483357|ref|YP_040581.1| putative transposase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49483611|ref|YP_040835.1| putative transposase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49484823|ref|YP_042047.1| putative transposase [Staphylococcus aureus subsp. aureus MRSA252] >gi|29539354|dbj|BAC67550.1| putative transposase [Staphylococcus aureus] >gi|49240456|emb|CAG39112.1| putative transposase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49241281|emb|CAG39961.1| putative transposase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49241486|emb|CAG40172.1| putative transposase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49241740|emb|CAG40430.1| putative transposase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49242952|emb|CAG41683.1| putative transposase [Staphylococcus aureus subsp. aureus MRSA252] (315 aa)
Score = 311, Expect = 1.1e-26, Identities = 104/309 (33%), Positives = 154/309 (49%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAE--KY--NCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRK-KGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK-NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y HL+  ER  I  +   +  ++  IA +LKR  STI REI RNN  + Y AE AQK Y  +R      L  +   F+       KY   C W   ++    + +N  C      K IY WI +N    +    LR    KG+++K K    KF+     P   RPK I  R  FGHWE D ++  R      +    ERK+R  +   + +++  ++ +AI +L+       VKTIT+D G EFS            VY+ +PY+++QRG+NEN NGL+R  + K TD + ++  ++N   + IN  PRK  N+
  S:     3 YNHLTLTERARI-EVLRQENYSLRSIARKLKRSVSTISREISRNNLNQSYQAETAQKNYETKRK-----LCGRPTRFTPELGNIIKYYLKCHWSPEQIVGRLL-QNQICF-----KTIYRWINSNMINFELISCLRQ---KGKRQKPKETRGKFN--IGRPISQRPKEIKKRNTFGHWEADTIVSSRGKSKGCIATFAERKSRYYYCVLMPDRSSNSMETAINNLIKHLPKGAVKTITVDRGKEFSCYQNIENQFNINVYFADPYSAWQRGTNENTNGLLREFFPKKTDLAKVNQEQLNYALDSINYRPRKCLNW 300
>gi|56684539|gb|AAW22502.1| Tnp [Lactobacillus rhamnosus] (338 aa)
Score = 310, Expect = 1.3e-26, Identities = 97/328 (29%), Positives = 166/328 (50%)
  Q:     6 ITLNDTNKYRH---LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN---------NVEGYSAEKAQKKYIERRNHKNFFLWQKY-KTFSELFAEKYNCK--WHGVELTRHYIKENYPCVLVPSTKQIYNWIQT------NKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL-HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCM 333
           +T + TN ++H   LS+ +R  I  +          IA +L R ++TI REI R +         + + Y AE AQ  +  +R+    + + K  + F +  A +   K   H V+   H+ ++       PST  +Y +I        N  + K+  +    Y    KRK        + Y     +RP  + +R   GHWE DLV G R +    L+ + ER +R   I K+ + +  T   A++  ++       ++IT DNG EF+K+   +  +  ++Y+  PY+ ++RG+NEN NGL+R  + KG     ++  EI  +Q+ +N  PR++ NY+    YY +CM
  S:     1 MTHSQTNTHKHYQQLSFSDRATIQALQ-AAGDTATVIAQKLHRSKATISREITRGSVTQLDSKRHSHQVYLAETAQAMHDRKRDRTGHYAFLKTGRAFFKALARELTRKPRVHSVDSFVHFYRDQGKAC--PSTTTVYRYIDAGLLELDNMTLPKKLRRRIKGYKNAHKRKN------KKIYGDSIELRPAAVNDRTGVGHWEGDLVKGIRLADEPALMTLTERYSRTEIIVKIPDYHAGTCLKALQDTIDDYGAKEFESITFDNGSEFAKL---SEIVGTQIYFAHPYSPWERGTNENANGLLREFFPKGKSLRAVTLVEIQAVQSALNHRPRRILNYLRPCDYY-RCM 337
>gi|9635740|ref|NP_061653.1| transposase [Staphylococcus prophage phiPV83] >gi|3298103|dbj|BAA31353.1| transposase [Staphylococcus aureus] >gi|8918810|dbj|BAA97870.1| tansposase [Staphylococcus prophage phiPV83] (328 aa)
Score = 310, Expect = 1.3e-26, Identities = 106/318 (33%), Positives = 157/318 (49%)
  Q:     5 TITLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAE--KY--NCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRK-KGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK-NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           T T +    Y HL+  ER  I  +   +  ++  IA +LKR  STI REI RNN  + Y AE AQK Y  +R      L  +   F+       KY   C W   ++    + +N  C      K IY WI +N    +    LR    KG+++K K    KF+     P   RPK I  R  FGHWE D ++  R      +    ERK+R  +   + +++  ++ +AI +L+       VKTIT+D G EFS            VY+ +PY+++QRG+NEN NGL+R  + K TD + ++  ++N   + IN  PRK  N+
  S:     7 THTRSANMSYNHLTLTERARI-EVLRQENYSLRSIARKLKRSVSTISREISRNNLNQSYQAETAQKNYETKRK-----LCGRPTRFTPELGNIIKYYLKCHWSPEQIVGRLL-QNQICF-----KTIYRWINSNMINFELISCLRQ---KGKRQKPKETRGKFN--IGRPISQRPKEIKKRNTFGHWEADTIVSSRGKSKGCIATFAERKSRYYYCVLMPDRSSNSMETAINNLIKHLPKGAVKTITVDRGKEFSCYQNIENQFNINVYFADPYSAWQRGTNENTNGLLREFFPKKTDLAKVNQEQLNYALDSINYRPRKCLNW 313
>gi|116495382|ref|YP_807116.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116495835|ref|YP_807569.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|89953835|gb|ABD83366.1| putative transposase [Lactobacillus casei ATCC 334] >gi|116105532|gb|ABJ70674.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116105985|gb|ABJ71127.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] (338 aa)
Score = 310, Expect = 1.3e-26, Identities = 97/328 (29%), Positives = 165/328 (50%)
  Q:     6 ITLNDTNKYRH---LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN---------NVEGYSAEKAQKKYIERRNHKNFFLWQK-----YKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQT------NKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL-HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCM 333
           +T + TN ++H   LS+ +R  I  +          IA +L R ++TI REI R +         + + Y AE AQ  +  +R+    + + K     +K  S     K   + H V+   H+ ++       PST  +Y +I        N  + K+  +    Y    KRK        + Y     +RP  + +R   GHWE DLV G R +    L+ + ER +R   I K+ + +  T   A++  ++       ++IT DNG EF+K+   +  +  ++Y+  PY+ ++RG+NEN NGL+R  + KG     ++  EI  +Q+ +N  PR++ NY+    YY +CM
  S:     1 MTHSQTNTHKHYQQLSFSDRATIQALQ-AAGDTATVIAQKLHRSKATISREITRGSVTQLDSKRHSHQVYLAETAQAMHDRKRDRTGHYAFLKTGRAFFKALSRELTRK--PRVHSVDSFVHFYRDQGKAC--PSTTTVYRYIDAGLLELDNMTLPKKLRRRIKGYKNAHKRKN------KKIYGDSIELRPAAVNDRTGVGHWEGDLVKGIRLADEPALMTLTERYSRTEIIVKIPDYHAGTCLKALQDTIDDYGAKEFESITFDNGSEFAKL---SEIVGTQIYFAHPYSPWERGTNENANGLLREFFPKGKSLRAITLVEIQAVQSALNHRPRRILNYLRPCDYY-RCM 337
>gi|167039233|ref|YP_001662218.1| integrase catalytic subunit [Thermoanaerobacter sp. X514] >gi|167040586|ref|YP_001663571.1| integrase catalytic subunit [Thermoanaerobacter sp. X514] >gi|167040917|ref|YP_001663902.1| integrase catalytic subunit [Thermoanaerobacter sp. X514] >gi|166853473|gb|ABY91882.1| Integrase, catalytic region [Thermoanaerobacter sp. X514] >gi|166854826|gb|ABY93235.1| Integrase, catalytic region [Thermoanaerobacter sp. X514] >gi|166855157|gb|ABY93566.1| Integrase, catalytic region [Thermoanaerobacter sp. X514] (347 aa)
Score = 310, Expect = 1.5e-26, Identities = 113/316 (35%), Positives = 168/316 (53%)
  Q:    14 YRHLSYGEREIIGHMYFVQK--KNINQIATELKRHRSTILREIRRNNNVE---------GYSAEKAQKKYIERR-NHKNFFLWQKYKTFSELFAEK-YNCKWHGVELTRHYIKE-NYPCVLVPSTKQIYNWIQTNKWIKKRSD-----KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK--NNLH--VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           ++HLS  ER   G +Y + K  ++I  IA +L R  STI REI+R    +          Y  E  Q  Y + R N    F   K + F +    K  N KW    +  +  K+ ++    +  TK +YN+I       K  D     +L+    + RK K+ M    D         RPK + +R+ FGHWE+D +IGK+ S    LL ++ERKTR+  I  ++ K+  ++  A+  L +   +NL    KTIT DNG EFS +  A      +VYY  PY+S++RG+NE  NGLIRR   KG     LS   I  ++N +N +PRK+ NY +  + +
  S:    13 FKHLSSYER---GEIYALLKEGRSIRYIAKKLNRSPSTISREIKRGTTTQLRSDLSSYTSYFPETGQAVYEKNRSNCGAKFKAAKAEDFLKYAENKILNEKWSPDAVVGYCKKDPSWNNKTIVCTKTLYNYIDRGLLKVKNIDLPLKLRLKPRKKQNRKNKRIMGKSID--------FRPKEVESREVFGHWEIDTLIGKK-SNDKVLLTLIERKTRHEIILLLDTKDSKSVKDALSKLKDMFGDNLSKVFKTITSDNGTEFSDLESALLEYGVEVYYTHPYSSWERGTNERHNGLIRRFIPKGKSIRDLSIDTIKKVENWLNNLPRKLLNYKTPKECF 339
>gi|116496115|ref|YP_807849.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116106265|gb|ABJ71407.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] (338 aa)
Score = 310, Expect = 1.5e-26, Identities = 97/328 (29%), Positives = 165/328 (50%)
  Q:     6 ITLNDTNKYRH---LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN---------NVEGYSAEKAQKKYIERRNHKNFFLWQK-----YKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQT------NKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL-HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCM 333
           +T + TN ++H   LS+ +R  I  +          IA +L R ++TI REI R +         + + Y AE AQ  +  +R+    + + K     +K  S     K   + H V+   H+ ++       PST  +Y +I        N  + K+  +    Y    KRK        + Y     +RP  + +R   GHWE DLV G R +    L+ + ER +R   I K+ + +  T   A++  ++       ++IT DNG EF+K+   +  +  ++Y+  PY+ ++RG+NEN NGL+R  + KG     ++  EI  +Q+ +N  PR++ NY+    YY +CM
  S:     1 MTHSQTNTHKHYQQLSFSDRATIQALQ-AAGDTATVIAQKLHRSKATISREITRGSVTQLDSKRHSHQVYLAETAQAMHDRKRDRTGHYAFLKTGRAFFKALSRELTRK--PRVHSVDSFVHFYRDQGKAC--PSTTTVYRYIDAGLLELDNMTLPKKLRRRIKGYKNAHKRKN------KKIYGDSIELRPAAVNDRTGVGHWEGDLVKGIRLADEPALMTLTERYSRTEIIVKIPDYHAGTCLKALQDTIDDYGAKEFESITFDNGSEFAKL---SEIVGTQIYFAHPYSPWERGTNENANGLLREFFPKGKSLRAVTLVEIQAVQSALNHRPRRILNYLRPCDYY-RCM 337
>gi|37524850|ref|NP_928194.1| IS30 family transposase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|37525554|ref|NP_928898.1| IS30 family transposase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|37525758|ref|NP_929102.1| IS30 family transposase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|37526195|ref|NP_929539.1| IS30 family transposase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|37528699|ref|NP_932044.1| IS30 family transposase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36784275|emb|CAE13149.1| Transposase, IS30 family [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36784982|emb|CAE13902.1| Transposase, IS30 family [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36785187|emb|CAE14117.1| Transposase, IS30 family [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36785625|emb|CAE14575.1| Transposase, IS30 family [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36788138|emb|CAE17265.1| Transposase, IS30 family [Photorhabdus luminescens subsp. laumondii TTO1] (322 aa)
Score = 309, Expect = 1.7e-26, Identities = 99/292 (33%), Positives = 153/292 (52%)
  Q:    39 IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGV--ELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSD---KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           IA  LKR  STI RE++RN  V+ Y  E+A  K + RR+    F  +  K   E+        W  +  E    Y+K++    L   T  IY  I  +K  ++  D    LR A    RKR      +   K       RP+ +  ++  G WE D +IGK +   S LL +V+RKT  + I K+++K    +  A   ++      VKTIT DNG+EF+   I    ++ ++Y+  PY+ ++RG NEN+NGLIR+ + KGT+F+ +SD EIN + N++N  PRK     + ++ +K
  S:    27 IAKSLKRSPSTISRELKRNQEVQTYCPEQAHLKVLARRH----FAKKAVKITPEVKRWIKRLIWKDLSPEQVADYLKQHKGISLHHET--IYRLIYQDK--REGGDLWQHLRIARKPYRKRYGRYERRGKIKNRVSIDERPEIVDKKERIGDWEGDTIIGKDKK--SVLLTLVDRKTLYTIIVKLDSKQASEVAKAAVKVLYPLKQKVKTITFDNGLEFADHEIIGEELETQIYFAHPYSPWERGINENINGLIRQYFPKGTNFNEISDQEINFVVNRLNNRPRKTRGGKTPNELFK 313
>gi|116495636|ref|YP_807370.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116105786|gb|ABJ70928.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] (338 aa)
Score = 309, Expect = 1.7e-26, Identities = 97/328 (29%), Positives = 167/328 (50%)
  Q:     6 ITLNDTNKYRH---LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN---------NVEGYSAEKAQKKYIERRNHKNFFLWQKY-KTFSELFAEKYNCK--WHGVELTRHYIKENYPCVLVPSTKQIYNWIQT------NKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL-HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCM 333
           +T + TN ++H   LS+ +R  I  +          IA +L R ++TI REI R +         + + Y AE AQ  +  +R+    +++ K  + F +  A +   K   H V+   H+ ++       PST  +Y +I        N  + K+  +    Y    KRK        + Y     +RP  + +R   GHWE DLV G R +    L+ + ER +R   I K+ + +  T   A++  ++       ++IT DNG EF+K+   +  +  ++Y+  PY+ ++RG+NEN NGL+R  + KG     ++  EI  +Q+ +N  PR++ NY+    YY +CM
  S:     1 MTHSQTNTHKHYQQLSFSDRATIQALR-AAGDTATVIAQKLHRSKATISREITRGSVTQLDSKRHSHQVYLAETAQAMHDRKRDRTGHYVFLKTGRAFFKALARELTRKPRVHSVDSFVHFYRDQGKAC--PSTTTVYRYIDAGLLELDNMTLPKKLRRRIKGYKSVHKRKN------KKIYGDSIELRPAAVNDRTGVGHWEGDLVKGIRLADEPALMTLTERYSRTEIIVKIPDYHAGTCLKALQDTIDDYGAKEFESITFDNGSEFAKL---SEIVGTQIYFAHPYSPWERGTNENANGLLREFFPKGKSLRAVTLVEIQAVQSALNHRPRRILNYLRPCDYY-RCM 337
>gi|116495161|ref|YP_806895.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116105311|gb|ABJ70453.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] (338 aa)
Score = 309, Expect = 1.8e-26, Identities = 97/328 (29%), Positives = 166/328 (50%)
  Q:     6 ITLNDTNKYRH---LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN---------NVEGYSAEKAQKKYIERRNHKNFFLWQKY-KTFSELFAEKYNCK--WHGVELTRHYIKENYPCVLVPSTKQIYNWIQT------NKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL-HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCM 333
           +T + TN ++H   LS+ +R  I  +          IA +L R ++TI REI R +         + + Y AE AQ  +  +R+    + + K  + F +  A +   K   H V+   H+ ++       PST  +Y +I        N  + K+  +    Y    KRK        + Y     +RP  + +R   GHWE DLV G R +    L+ + ER +R   I K+ + +  T   A++  ++       ++IT DNG EF+K+   +  +  ++Y+  PY+ ++RG+NEN NGL+R  + KG     ++  EI  +Q+ +N  PR++ NY+    YY +CM
  S:     1 MTHSQTNTHKHYQQLSFSDRATIQALR-AAGDTATVIAQKLHRSKATISREITRGSVTQLDSKRHSHQVYLAETAQAMHDRKRDRTGHYAFLKTGRAFFKALARELTRKPRVHSVDSFVHFYRDQGKAC--PSTTTVYRYIDAGLLELDNMTLPKKLRRRIKGYKNAHKRKN------KKIYGDSIELRPAAVNDRTGVGHWEGDLVKGIRLADEPALMTLTERYSRTEIIVKIPDYHAGTCLKALQDTIDDYGAKEFESITFDNGSEFAKL---SEIVGTQIYFAHPYSPWERGTNENANGLLREFFPKGKSLRAVTLVEIQAVQSALNHRPRRILNYLRPCDYY-RCM 337
>gi|126090251|ref|YP_001041706.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|125999882|gb|ABN63951.1| Integrase, catalytic region [Shewanella baltica OS155] (315 aa)
Score = 308, Expect = 2.3e-26, Identities = 92/309 (29%), Positives = 153/309 (49%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNIN--QIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKR--SDKLRTA------------YIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y+ L+ G+R  I  +Y   K+N +  +I   +   +STI RE+RRN    GY A+ AQ++   RR                + A K       +E     ++  +    + +  ++     +++WI +   +DK R              Y KG  +K+G  +           +RP  +  R   G WE DLV+GK+ +G   ++ + ERK+R     KV +K+   ++ AI S+++       TIT DNG EFS+    A  ++  +Y+  PY+S +RG NEN NGL+R+   KGTD   +S+ ++   Q  +N  PRK   +
  S:     3 YQQLTEGQRYQIALLY---KENCSCREIGQRIGVSKSTISRELRRNGTTAGYVAQSAQRQCEHRR----------------VVAAKRAVSQSTIEFVEFALEWKWSPEQISAVAKLIGLSVSHEWIYQYVFADKSRGGVLYEHLRQGKRRYRKGYGQKRGGITD-----AVSIALRPAIVDERGRLGDWEADLVLGKQGTG--AIVTLAERKSRIYLTKKVFSKDAVEVSKAIISMLSDYKDACHTITFDNGREFSEHKAIAKALEADMYFAHPYSSQERGLNENTNGLLRQFIPKGTDLRTVSEEDLQRYQGALNSRPRKCLGF 301
>gi|407066|emb|CAA78948.1| transposase [Streptococcus salivarius] (341 aa)
Score = 308, Expect = 2.4e-26, Identities = 104/317 (32%), Positives = 154/317 (48%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-----NVEG-------YSAEKAQKKYIERRNHKNFFLWQK-----YKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           Y+HLS  ER  I   Y        +IA  L R+RSTI REI R +      V G       Y A+ A  +Y   R    +           + F+E   EK   + H V+   H  +  +   +VPSTK +YN+I       K  D  R   I+ +  K+    K   K +     RP+ I NR  FG WE+D V+G +  G  ++L +VER+TR +   K+  K    +N A+   +      +K+IT DNG EFS +          VY+   Y+SY+RG+NEN NGL+R    KG     L+   + +    IN  PR++  Y S+ + ++
  S:    14 YKHLSEAERGEI-EAYLSVGLKPAEIARRLGRNRSTITREINRGSITQVKKVNGQKVYYQHYYADAAHNRYRHAREASYYLKLDSVSDDFLRAFTEAMREK--PRVHSVDTFVHTYRLQHVDAVVPSTKTLYNYIHQGLLEIKVIDLPRAVRIRKKFTKRPSTKKHLGKSIEE---RPEEINNRSRFGDWEIDSVLGGKTIGEPSILTLVERQTRYAVTKKLVEKKAEYVNQAVLECMKL--YPIKSITADNGNEFSSLSKIE---GLDVYFAHAYSSYERGTNENFNGLLREFIPKGCSLKELNQNLLEDYTKAINERPRRIHGYQSAKKLFE 336
>gi|116493664|ref|YP_805398.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116493706|ref|YP_805440.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116494310|ref|YP_806044.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116494632|ref|YP_806366.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116494689|ref|YP_806423.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116495281|ref|YP_807015.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116495461|ref|YP_807195.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116495493|ref|YP_807227.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116495551|ref|YP_807285.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116496274|ref|YP_808008.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116103814|gb|ABJ68956.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116103856|gb|ABJ68998.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116104460|gb|ABJ69602.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116104782|gb|ABJ69924.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116104839|gb|ABJ69981.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116105431|gb|ABJ70573.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116105611|gb|ABJ70753.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116105643|gb|ABJ70785.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116105701|gb|ABJ70843.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116106424|gb|ABJ71566.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] (338 aa)
Score = 307, Expect = 3.2e-26, Identities = 97/328 (29%), Positives = 166/328 (50%)
  Q:     6 ITLNDTNKYRH---LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN---------NVEGYSAEKAQKKYIERRNHKNFFLWQKY-KTFSELFAEKYNCK--WHGVELTRHYIKENYPCVLVPSTKQIYNWIQT------NKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL-HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCM 333
           +T + TN ++H   LS+ +R  I  +          IA +L R ++TI REI R +         + + Y AE AQ  +  +R+    + + K  + F +  A +   K   H V+   H+ ++       PST  +Y +I        N  + K+  +    Y    KRK        + Y     +RP  + +R   GHWE DLV G R +    L+ + ER +R   I K+ + +  T   A++  ++       ++IT DNG EF+K+   +  +  ++Y+  PY+ ++RG+NEN NGL+R  + KG     ++  EI  +Q+ +N  PR++ NY+    YY +CM
  S:     1 MTHSQTNTHKHYQQLSFSDRATIQALR-AAGDTATVIAQKLHRSKATISREITRGSVTQLDSKRHSHQVYLAETAQAMHDRKRDRTGHYAFLKTGRAFFKALARELTRKPRVHSVDSFVHFYRDQGKAC--PSTTTVYRYIDAGLLELDNMTLPKKLRRRIKGYKSVHKRKN------KKIYGDSIELRPAAVNDRTGVGHWEGDLVKGIRLADEPALMTLTERYSRTEIIVKIPDYHAGTCLKALQDTIDDYGAKEFESITFDNGSEFAKL---SEIVGTQIYFAHPYSPWERGTNENANGLLREFFPKGKSLRAVTLVEIQAVQSALNHRPRRILNYLRPCDYY-RCM 337
>gi|49483490|ref|YP_040714.1| putative transposase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49241619|emb|CAG40306.1| putative transposase [Staphylococcus aureus subsp. aureus MRSA252] (315 aa)
Score = 306, Expect = 3.7e-26, Identities = 104/309 (33%), Positives = 153/309 (49%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAE--KY--NCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRK-KGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK-NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y HL+  ER  I  +   +  ++  IA +LKR  STI REI RNN  + Y AE AQK Y  +R      L  +   F+       KY   C W   ++    + +N  C      K IY WI +N    +    LR    KG+++K K    KF+     P   RPK I  R  FGHWE D ++  R      +    ERK+R  +   + +++  ++ +AI +L+       VKTIT+D G EFS            VY+ +PY+++QRG+NEN NGL+R    K TD + ++  ++N   + IN  PRK  N+
  S:     3 YNHLTLTERARI-EVLRQENYSLRSIARKLKRSVSTISREISRNNLNQSYQAETAQKNYETKRK-----LCGRPTRFTPELGNIIKYYLKCHWSPEQIVGRLL-QNQICF-----KTIYRWINSNMINFELISCLRQ---KGKRQKPKETRGKFN--IGRPISQRPKEIKKRNTFGHWEADTIVSSRGKSKGCIATFAERKSRYYYCVLMPDRSSNSMETAINNLIKHLPKGAVKTITVDRGKEFSCYQNIENQFNINVYFADPYSAWQRGTNENTNGLLREFSPKKTDLAKVNQEQLNYALDSINYRPRKCLNW 300
>gi|116494415|ref|YP_806149.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116104565|gb|ABJ69707.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] (332 aa)
Score = 305, Expect = 5.3e-26, Identities = 104/316 (32%), Positives = 156/316 (49%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIE-RRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQ-TNKWIKKRSDKLR-----------TAYIKGR-KRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH-VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           Y HL+  +RE I  +     K ++ IA E+ R +ST+ REI RN     YSA  AQ +Y   R   +   +  +  T   +        W   ++      E  P  +  ST  IY  I   N  +  +S   R           T  IKG    ++G F+  D   +H    RP+   NR  FGHWE D V GK  +G+S L+ +V+RK+R     +  N    T+   +  L+     + V+T+T D G EF++    A  +  KV++ +P+A  QRG+NEN NGLIR  + K TD  L SD EI     ++N  PRK+  + +S + +
  S:     4 YTHLTLKDRESI-LLGISTGKTLDTIAKEIGRSKSTVSREIARNGGWRSYSAATAQDRYRRVRLASRRPRILDRPGTRDAVIRYITVLHWSPEQIAGRLSLEGSPIRISYST--IYRGIYLDNLGVPLKSHGARGLPRLLRHRGKTRKIKGTINERRGRFN--DVPSIHD---RPRSAENRSWFGHWEGDTVRGK--TGHSALVTLVDRKSRYLLSKRTANAKADTVRDVMIELLGALPANRVRTVTPDRGTEFARYRELAERLNTKVFFPDPHAPQQRGTNENTNGLIREYFPKNTDLDLQSDQEIETYIEQLNNRPRKVLGWKTSSEVF 324
>gi|126172920|ref|YP_001049069.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126173157|ref|YP_001049306.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126173319|ref|YP_001049468.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126173506|ref|YP_001049655.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126173749|ref|YP_001049898.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126173805|ref|YP_001049954.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126173868|ref|YP_001050017.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126174265|ref|YP_001050414.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126174328|ref|YP_001050477.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126174355|ref|YP_001050504.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126174370|ref|YP_001050519.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126175751|ref|YP_001051900.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126175822|ref|YP_001051971.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126175879|ref|YP_001052028.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126175881|ref|YP_001052030.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126175933|ref|YP_001052082.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126175940|ref|YP_001052089.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126176061|ref|YP_001052210.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126176137|ref|YP_001052286.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|126176226|ref|YP_001052375.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|125996125|gb|ABN60200.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125996362|gb|ABN60437.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125996524|gb|ABN60599.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125996711|gb|ABN60786.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125996954|gb|ABN61029.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125997010|gb|ABN61085.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125997073|gb|ABN61148.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125997470|gb|ABN61545.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125997533|gb|ABN61608.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125997560|gb|ABN61635.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125997575|gb|ABN61650.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125998956|gb|ABN63031.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125999027|gb|ABN63102.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125999084|gb|ABN63159.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125999086|gb|ABN63161.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125999138|gb|ABN63213.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125999145|gb|ABN63220.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125999266|gb|ABN63341.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125999342|gb|ABN63417.1| Integrase, catalytic region [Shewanella baltica OS155] >gi|125999431|gb|ABN63506.1| Integrase, catalytic region [Shewanella baltica OS155] (313 aa)
Score = 305, Expect = 5.5e-26, Identities = 95/309 (30%), Positives = 150/309 (48%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKR-KKGMFSKFDE-KYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y+ L+   R  I  +   Q  +I  IA  +  HRS++ RE++R      Y  + A K+ +  R   + +     +  S +   + +     +      +KE        S + IY +I  +K   +R  KL     +G KR ++G   +    K       RP  + +R+ FG WE+D V+G   +G  +++ ++ERKTR   I KV +K+   +  A   L+     HV TIT DNG EF+     A  +  +VY+  PY S +RG+NEN NGL+R+  KKG D  L+SD  I   QN+IN  P+K   +
  S:     3 YQQLTEARRYQIS-VLLEQGFSIAHIAKCIDCHRSSVYREVKRCQGQSRYQPDIAHKQAVTMRRQSSKYAIPSQRIESIILLLQLDWSPEQISQVLRLVKEPV------SHEWIYRYIARDK---RRGGKLYRHLRQGHKRYRRGKVEQAPTIKNAVSIDDRPAIVDSRERFGDWEIDTVLGLHGTG--SIVTLLERKTRFYLIKKVNSKSAADVTKATIELLMPYKAHVLTITADNGREFAHHQEIAEALDTQVYFAHPYRSCERGANENANGLLRQYVKKGVDLRLVSDELIEFAQNRINYRPKKCLKF 301
>gi|126173560|ref|YP_001049709.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|125996765|gb|ABN60840.1| Integrase, catalytic region [Shewanella baltica OS155] (313 aa)
Score = 304, Expect = 6.0e-26, Identities = 95/309 (30%), Positives = 150/309 (48%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKR-KKGMFSKFDE-KYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y+ L+   R  I  +   Q  +I  IA  +  HRS++ RE++R      Y  + A K+ +  R   + +     +  S +   + +     +      +KE        S + IY +I  +K   +R  KL     +G KR ++G   +    K       RP  + +R+ FG WE+D V+G   +G  +++ ++ERKTR   I KV +K+   +  A   L+     HV TIT DNG EF+     A  +  +VY+  PY S +RG+NEN NGL+R+  KKG D  L+SD  I   QN+IN  P+K   +
  S:     3 YQQLTEARRYQIS-VLLEQGFSIAHIAKCIDCHRSSVYREVKRCQGQSRYQPDIAHKQAVTMRRQSSKYAIPSQRIESIILLLQLDWSPEQISQVLRLVKEPV------SYEWIYRYIARDK---RRGGKLYRHLRQGHKRYRRGKVEQAPTIKNAVSIDDRPAIVDSRERFGDWEIDTVLGLHGTG--SIVTLLERKTRFYLIKKVNSKSAADVTKATIELLMPYKAHVLTITADNGREFAHHQEIAEALDTQVYFAHPYRSCERGANENANGLLRQYVKKGVDLRLVSDELIEFAQNRINYRPKKCLKF 301
>gi|160872967|ref|YP_001556974.1| integrase catalytic region [Shewanella baltica OS195] >gi|160858489|gb|ABX51714.1| Integrase catalytic region [Shewanella baltica OS195] (313 aa)
Score = 304, Expect = 7.2e-26, Identities = 95/309 (30%), Positives = 150/309 (48%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKR-KKGMFSKFDE-KYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y+ L+   R  I  +   Q  +I  IA  +  HRS++ RE++R      Y  + A K+ +  R   + +     +  S +   + +     +      +KE        S + IY +I  +K   +R  KL     +G KR ++G   +    K       RP  + +R+ FG WE+D V+G   +G  +++ ++ERKTR   I KV +K+   +  A   L+     HV TIT DNG EF+     A  +  +VY+  PY S +RG+NEN NGL+R+  KKG D  L+SD  I   QN+IN  P+K   +
  S:     3 YQQLTEARRYQIS-VLLEQGFSIAHIAKCIDCHRSSVYREVKRCQGQSRYQPDIAHKQAVTMRRQSSKYAIPSQRIESIVLLLQLDWSPEQISQVLRLVKEPV------SHEWIYRYIARDK---RRGGKLYRHLRQGHKRYRRGKVEQAPTIKNAVSIDDRPAIVDSRERFGDWEIDTVLGLHGTG--SIVTLLERKTRFYLIKKVNSKSAADVTKATIELLMPYRAHVLTITADNGREFAHHQEIAEALDTQVYFAHPYRSCERGANENANGLLRQYVKKGVDLRLVSDELIEFAQNRINYRPKKCLKF 301
>gi|2673748|emb|CAA05973.1| transposase [Lactobacillus casei subsp. casei ATCC 393] (328 aa)
Score = 304, Expect = 7.2e-26, Identities = 103/309 (33%), Positives = 164/309 (53%)
  Q:    14 YRHLSYGEREIIGHMYFVQKK--NINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRN--HKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSD------------KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK-NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y+HL+  EREI   + F++ K  +I  +A  + R+ STI RE++R      YS  KA   Y ++R   HK   L    + + ++     +  W   ++T  + KE+  CV   S   IY  I  +   +K S             K RT + K  +R + +  + D   +H    RP  I  R+  G WE+D VIG+  +G+S LL +V+R +R + I KV  K+   IN  +  L+       V +IT D+G EF  +   +  +   VY+ +PY+  QRG+NEN NGLIR +  K TD    ++ ++ + Q ++N+ PRK+ NY
  S:     3 YKHLTIKEREI---LMFLRAKGLSIRAVALRMGRNPSTISRELKRCAG--NYSPSKADNDYHQKRQNCHKKRLLDSHPQLWRQIVHYILDPHWSPEQITARFNKEHQWCV---SYNTIYRHIYQHNLGEKYSSRGDTGIQRHLRHKHRTRHSKNTRRHREV--QTDYISIHE---RPGFINQRQRIGDWEIDTVIGR--TGHSILLTVVDRLSRLTLIKKVVQKDSQEINKGLVELLGAIPKEFVHSITPDHGTEFLHLDEISERLGVTVYWPDPYSPEQRGTNENTNGLIREIIPKRTDIDNYTEQDVEHCQKQLNQRPRKVLNY 313
>gi|126173504|ref|YP_001049653.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|125996709|gb|ABN60784.1| Integrase, catalytic region [Shewanella baltica OS155] (315 aa)
Score = 301, Expect = 1.4e-25, Identities = 99/309 (32%), Positives = 155/309 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNIN--QIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRN-HKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y+ L+ G+R  I  +Y   K+N +  +I   +   +STI RE+RRN    GY A+ A  +  +RR       + Q    F E FA ++      +      I       L  S + IY ++  NK      +   R  K R  Y KG  +K+G     D   +    +RP  +  R   G WE  LV+GK+ +G   ++ + ERK+R     KV +K+   ++ AI S+++       TIT DNG EFS+  + A  ++ ++Y+  PY+S +RG NEN NGL+R+   KGTD   +SD ++   Q  +N  PRK   +
  S:     3 YQQLTEGQRYQIALLY---KENCSCREIGQRVGVSKSTISRELRRNGTTAGYVAQHAHSQCEQRRGVAAKRSVSQSTIEFVE-FALEWKWSPEQISAVAKLIG------LSVSHEWIYQYVFANKSRGGVLYEHLRQGKRR--YRKGYGQKRGGIP--DAVSIE---LRPAIVDERARLGDWEAYLVLGKQGTG--AIVTLAERKSRIYLTKKVFSKDAMEVSKAIISMLSDYKDACHTITFDNGREFSEHKVIAEALEAEMYFAHPYSSQERGLNENTNGLLRQFIPKGTDLRTVSDEDLQRYQGALNSRPRKCLGF 301
>gi|77459281|ref|YP_348788.1| integrase catalytic subunit [Pseudomonas fluorescens PfO-1] >gi|77383284|gb|ABA74797.1| Integrase, catalytic region [Pseudomonas fluorescens PfO-1] (342 aa)
Score = 301, Expect = 1.6e-25, Identities = 99/319 (31%), Positives = 157/319 (49%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYN--WIQTNKWIKKR------SDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH---VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           L+  ERE I     V   +I  +A  L R  STI REIRRN     Y A +A +   +R +        + +T +++ A+K   +W   E    ++K  YP       S + IY   +IQ    +KK         +      +  ++K+      D   +     RP    +R   GHWE DL+ G R S    +  +VER+TR   + K++ K+  T+ SA+  + N  NL     K++T D G E +           KVY+C+P+  +QRGSNEN NGL+R+ + KGTD +  S A +N +  ++N  PRK  +Y +  + + + + S
  S:    19 LTLAEREEISRA-VVAGNSIRSMAALLGRAASTISREIRRNGGQGCYRANQADQAAWDRAHRPKVCKLVENRTVAQIVADKLQLQW-SPEQIAGWLKRTYPDDTSYQVSHETIYRTLFIQARGALKKELLEHLRRTRAMRRSRQHTQKKENHGRITDAVSIRE---RPAAAKDRAVPGHWEGDLLCGSRNS---QIATLVERQTRFVMLVKLDGKDSETVISAL--IENARNLPQELYKSLTWDRGKEMADHKRFTVATDIKVYFCDPHRPWQRGSNENTNGLLRQYFPKGTDLAEHSQATLNEVARQLNSRPRKTLDYETPAERFSQSVAS 340
>gi|19551432|ref|NP_599434.1| transposase [Corynebacterium glutamicum ATCC 13032] >gi|19553413|ref|NP_601415.1| transposase [Corynebacterium glutamicum ATCC 13032] (536 aa)
Score = 301, Expect = 1.7e-25, Identities = 90/294 (30%), Positives = 153/294 (52%)
  Q:    38 QIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENY-PCVLVPSTKQIYN--WIQTNKWIK---KRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM--RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVE-NKNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           +I   L R R TI RE+RR  + +G Y A  + +  I +            +    +  E  N K    +++     E+     +  S + IY   ++Q    ++   K    LRT   KGRK +  + S+  + +V    +  RP  + +R   GHWE DLVIG      + L+ +VER +R + I ++  N    T+  A+  ++      ++ ++T D G+E ++    +   KC V++C+P++ +QRGSNEN NGL+R  + KGT+F+ +SD E+   Q+ +N  PRKM  + S+ Q Y+K
  S:   227 EIGRRLGRCRQTISRELRRGQDDDGRYRARDSYEGAIRKLARPKTPKLDANRRLRAVVVEALNNKLSPEQISGLLATEHANDSSMQISHETIYQALYVQGKGALRDELKVEKFLRTGR-KGRKPQSKLPSR-GKPWVEGALISQRPAEVADRAVPGHWEGDLVIGGENQA-TALVTLVERTSRLTLIKRLGVNHEASTVTDALVEMMGDLPQALRRSLTWDQGVEMAEHARFSVVTKCPVFFCDPHSPWQRGSNENTNGLVRDFFPKGTNFAKVSDEEVQRAQDLLNYRPRKMHGFKSATQVYEK 528
>gi|62389077|ref|YP_224479.1| transposase [Corynebacterium glutamicum ATCC 13032] >gi|62390982|ref|YP_226384.1| transposase [Corynebacterium glutamicum ATCC 13032] >gi|62391051|ref|YP_226453.1| transposase [Corynebacterium glutamicum ATCC 13032] >gi|62391421|ref|YP_226823.1| transposase [Corynebacterium glutamicum ATCC 13032] >gi|62391685|ref|YP_227087.1| transposase [Corynebacterium glutamicum ATCC 13032] >gi|41324410|emb|CAF18750.1| TRANSPOSASE [Corynebacterium glutamicum ATCC 13032] >gi|41326321|emb|CAF20483.1| Transposase [Corynebacterium glutamicum ATCC 13032] >gi|41326390|emb|CAF20552.1| Transposase [Corynebacterium glutamicum ATCC 13032] >gi|41326762|emb|CAF21244.1| Transposase [Corynebacterium glutamicum ATCC 13032] >gi|41327027|emb|CAF20871.1| Transposase [Corynebacterium glutamicum ATCC 13032] (504 aa)
Score = 301, Expect = 1.7e-25, Identities = 90/294 (30%), Positives = 153/294 (52%)
  Q:    38 QIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENY-PCVLVPSTKQIYN--WIQTNKWIK---KRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM--RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVE-NKNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           +I   L R R TI RE+RR  + +G Y A  + +  I +            +    +  E  N K    +++     E+     +  S + IY   ++Q    ++   K    LRT   KGRK +  + S+  + +V    +  RP  + +R   GHWE DLVIG      + L+ +VER +R + I ++  N    T+  A+  ++      ++ ++T D G+E ++    +   KC V++C+P++ +QRGSNEN NGL+R  + KGT+F+ +SD E+   Q+ +N  PRKM  + S+ Q Y+K
  S:   195 EIGRRLGRCRQTISRELRRGQDDDGRYRARDSYEGAIRKLARPKTPKLDANRRLRAVVVEALNNKLSPEQISGLLATEHANDSSMQISHETIYQALYVQGKGALRDELKVEKFLRTGR-KGRKPQSKLPSR-GKPWVEGALISQRPAEVADRAVPGHWEGDLVIGGENQA-TALVTLVERTSRLTLIKRLGVNHEASTVTDALVEMMGDLPQALRRSLTWDQGVEMAEHARFSVVTKCPVFFCDPHSPWQRGSNENTNGLVRDFFPKGTNFAKVSDEEVQRAQDLLNYRPRKMHGFKSATQVYEK 496
>gi|23308982|ref|NP_602038.2| putative transposase [Corynebacterium glutamicum ATCC 13032] >gi|7008125|gb|AAF34901.1|AF189147_1 transposase [Corynebacterium glutamicum] >gi|21322946|dbj|BAB97575.1| Transposase [Corynebacterium glutamicum ATCC 13032] >gi|21324983|dbj|BAB99605.1| Transposase [Corynebacterium glutamicum ATCC 13032] >gi|21325618|dbj|BAC00239.1| Transposase [Corynebacterium glutamicum ATCC 13032] (401 aa)
Score = 301, Expect = 1.7e-25, Identities = 90/294 (30%), Positives = 153/294 (52%)
  Q:    38 QIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENY-PCVLVPSTKQIYN--WIQTNKWIK---KRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM--RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVE-NKNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           +I   L R R TI RE+RR  + +G Y A  + +  I +            +    +  E  N K    +++     E+     +  S + IY   ++Q    ++   K    LRT   KGRK +  + S+  + +V    +  RP  + +R   GHWE DLVIG      + L+ +VER +R + I ++  N    T+  A+  ++      ++ ++T D G+E ++    +   KC V++C+P++ +QRGSNEN NGL+R  + KGT+F+ +SD E+   Q+ +N  PRKM  + S+ Q Y+K
  S:    92 EIGRRLGRCRQTISRELRRGQDDDGRYRARDSYEGAIRKLARPKTPKLDANRRLRAVVVEALNNKLSPEQISGLLATEHANDSSMQISHETIYQALYVQGKGALRDELKVEKFLRTGR-KGRKPQSKLPSR-GKPWVEGALISQRPAEVADRAVPGHWEGDLVIGGENQA-TALVTLVERTSRLTLIKRLGVNHEASTVTDALVEMMGDLPQALRRSLTWDQGVEMAEHARFSVVTKCPVFFCDPHSPWQRGSNENTNGLVRDFFPKGTNFAKVSDEEVQRAQDLLNYRPRKMHGFKSATQVYEK 393
>gi|116495645|ref|YP_807379.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116105795|gb|ABJ70937.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] (332 aa)
Score = 300, Expect = 1.9e-25, Identities = 102/316 (32%), Positives = 155/316 (49%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIE-RRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQ-TNKWIKKRSDKLR-----------TAYIKGR-KRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH-VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           Y HL+  +RE I  +     K ++ IA E+ R +ST+ REI RN     YSA  +Q +Y   R   +   +  +  T   +        W   ++      E  P  +  ST  IY  I   N  +  +S   R           T  IKG    ++G F+  D   +H    RP+   NR  FGHWE D V GK  +G+S L+ +V+RK+R     +  N    T+   +  L+     + V+T+T D G EF++    A  +  KV++ +P+A  QRG+NEN NGLIR  + K TD  L SD EI     ++N  PRK+  + +  + +
  S:     4 YTHLTLKDRESI-LLGISTGKTLDTIAKEIGRSKSTVSREIARNGGWRSYSAATSQDRYRRVRLASRRPRILDRPGTRDAVIRYITVLHWSPEQIAGRLSLEGSPIRISYST--IYRGIYLDNLGVPLKSHGARGLPRLLRHRGKTRKIKGTINERRGRFN--DVPSIHD---RPRSAENRSWFGHWEGDTVRGK--TGHSALVTLVDRKSRYLLSKRTANAKADTVRDVMIELLGALPANRVRTVTPDRGTEFARFRELAERLNTKVFFPDPHAPQQRGTNENTNGLIREYFPKNTDLDLQSDQEIETYIEQLNNRPRKVLGWKTPSEVF 324
>gi|134096364|ref|YP_001101439.1| transposase [Herminiimonas arsenicoxydans] >gi|133740267|emb|CAL63318.1| Transposase IS30 family [Herminiimonas arsenicoxydans] (386 aa)
Score = 300, Expect = 1.9e-25, Identities = 101/325 (31%), Positives = 159/325 (48%)
  Q:    11 TNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPC--VLVPSTKQIYN--WIQTNKWIKKR-SDKLRTAYIKGRK----RKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTI-NSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           T   R L+  ERE I     V   +++ IA  + R  STI RE+ RN  VE Y A  A K   ER +        + +  + + A+K   +W   ++   ++K  +P       S + IY   +IQT   +KK  ++ LR   +  R     +K     K  +        RP  + +R   GHWE DL+ G   S  S +  +VER TR   + K++ K+  T+ N+ IK          K++T D G E +           +VY+C+P + +QRGSNEN NGL+R+ + KG + S  S A++N +  ++N  PRK  NY +  Q + + + S
  S:    57 TRSIRSLTLAEREEISRS-IVAGHSMHTIARSIGRSPSTISRELNRNGGVESYRAADADKATWERAHRPKPCKLLQNRPLASMVADKLRQQWSPQQVA-GWLKHIHPDDEEFQVSHETIYRTLFIQTRGALKKELTEHLRRTRVMPRSLHHTQKTDNHGKISDAV--SISERPAMVEDRAVPGHWEGDLLCG---SANSQIATLVERHTRYVMLVKIDRKDTQTVVNALIKHAGKLPQELYKSLTWDRGKELADHKRFTLATDIQVYFCDPRSPWQRGSNENTNGLLRQYFPKGLNLSGYSQAQLNAVARRLNERPRKTLNYETPAQRFYQSVAS 384
>gi|116494074|ref|YP_805808.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116496117|ref|YP_807851.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116104224|gb|ABJ69366.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116106267|gb|ABJ71409.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] (332 aa)
Score = 299, Expect = 2.5e-25, Identities = 103/316 (32%), Positives = 156/316 (49%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIE-RRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQ-TNKWIKKRSDKLR-----------TAYIKGR-KRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH-VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           Y HL+  +RE I  +     K ++ IA E+ R +ST+ REI RN     YSA  +Q +Y   R   +   +  +  T   +        W   ++      E  P  +  ST  IY  I   N  +  +S   R           T  IKG    ++G F+  D   +H    RP+   NR  FGHWE D V GK  +G+S L+ +V+RK+R     +  N    T+   +  L+     + V+T+T D G EF++    A  +  KV++ +P+A  QRG+NEN NGLIR  + K TD  L SD EI     ++N  PRK+  + +S + +
  S:     4 YTHLTLKDRESI-LLGISTGKTLDTIAKEIGRSKSTVSREIARNGGWRSYSAATSQDRYRRVRLASRRPRILDRPGTRDAVIRYITVLHWSPEQIAGRLSLEGSPIRISYST--IYRGIYLDNLGVPLKSHGARGLPRLLRHRGKTRKIKGTINERRGRFN--DVPSIHD---RPRSAENRSWFGHWEGDTVRGK--TGHSALVTLVDRKSRYLLSKRTANAKADTVRDVMIELLGALPANRVRTVTPDRGREFARYRELAERLNTKVFFPDPHAPQQRGTNENTNGLIREYFPKNTDLDLQSDQEIETYIEQLNNRPRKVLGWKTSSEVF 324
>gi|94310471|ref|YP_583681.1| integrase catalytic subunit [Ralstonia metallidurans CH34] >gi|94310534|ref|YP_583744.1| integrase catalytic subunit [Ralstonia metallidurans CH34] >gi|94311318|ref|YP_584528.1| integrase catalytic subunit [Ralstonia metallidurans CH34] >gi|94313049|ref|YP_586258.1| integrase catalytic subunit [Ralstonia metallidurans CH34] >gi|94313134|ref|YP_586343.1| integrase catalytic subunit [Ralstonia metallidurans CH34] >gi|94313343|ref|YP_586552.1| integrase catalytic subunit [Ralstonia metallidurans CH34] >gi|94313388|ref|YP_586597.1| integrase catalytic subunit [Ralstonia metallidurans CH34] >gi|94314637|ref|YP_587846.1| integrase catalytic subunit [Ralstonia metallidurans CH34] >gi|94314674|ref|YP_587883.1| integrase catalytic subunit [Ralstonia metallidurans CH34] >gi|6562843|emb|CAB62563.1| unnamed protein product [Cupriavidus necator] >gi|93354323|gb|ABF08412.1| Integrase, catalytic region [Ralstonia metallidurans CH34] >gi|93354386|gb|ABF08475.1| Integrase, catalytic region [Ralstonia metallidurans CH34] >gi|93355170|gb|ABF09259.1| Integrase, catalytic region [Ralstonia metallidurans CH34] >gi|93356901|gb|ABF10989.1| Integrase, catalytic region [Ralstonia metallidurans CH34] >gi|93356986|gb|ABF11074.1| Integrase, catalytic region [Ralstonia metallidurans CH34] >gi|93357195|gb|ABF11283.1| Integrase, catalytic region [Ralstonia metallidurans CH34] >gi|93357240|gb|ABF11328.1| Integrase, catalytic region [Ralstonia metallidurans CH34] >gi|93358489|gb|ABF12577.1| Integrase, catalytic region [Ralstonia metallidurans CH34] >gi|93358526|gb|ABF12614.1| Integrase, catalytic region [Ralstonia metallidurans CH34] (342 aa)
Score = 298, Expect = 3.5e-25, Identities = 99/323 (30%), Positives = 167/323 (51%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRN--------HKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWI--QTNKWIKKR-SDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVK----TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           Y+ LS  ER  I  +   QK++++ IA  L R +STI RE  RN   +GY+++ AQ++   R+         H+   L   +    +    K++ +    EL R + ++     L  S + IY  I  Q    +KK     LR A+ K   R +G   + + + +    +R   I +R+  GHWE DL+ GK  +  S +  +VER TR   + K+ + NP T    +++  +K     +    T+T D G E ++    +     KVY+C+PY+ +QRGSNEN NGL+R+ + KGTD S  S  +++ + +++N  PR    +    + Y + +  L
  S:     6 YQQLSETERHAIA-LGLQQKQSLSAIARALGRDKSTISRECNRNAGGKGYASKFAQQRSDNRKRQARPSPKLHRQGPL---FPLVCDYLRHKWSPQQIANELQRLHPQDRR---LQASHESIYTCIYAQPRGELKKELVSCLRMAHAKRWPRSRGKDRRKETQDLLSIHVRAPEIEDRQLPGHWEGDLIKGKANA--SAIGTLVERTTRLVVLVKLPHPNPATAAHVLQAFSDKLKTIAQPMRQTLTYDRGSEMAEHRQLSENTGMKVYFCDPYSPWQRGSNENTNGLLRQYFPKGTDLSGYSQEQLDAVADELNGRPRMTLGWRKPIEVYAEHLARL 334
>gi|82702959|ref|YP_412525.1| integrase catalytic subunit [Nitrosospira multiformis ATCC 25196] >gi|82411024|gb|ABB75133.1| Integrase, catalytic region [Nitrosospira multiformis ATCC 25196] (380 aa)
Score = 298, Expect = 3.8e-25, Identities = 95/318 (29%), Positives = 154/318 (48%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELT----RHYIKENYPCVLVPSTKQIYN--WIQTNKWIKKRSDK-LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV----KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMN 334
           LS  ERE+I        K++ +I+ EL R  STI REI RN   E Y A  A+K +++R       L  + +    +        W   ++T    RH       CV   S + IY   +IQT   +++   K LRT  +    +   +  +           RP  + +R   GHWE DL+IG   SG   +  MVER +R + + KV++K      S ++SL+ +  +      K++T D G E +            VY+C+P + +QRG+NEN NGL+R+ + KGT  +  +  ++N +  K N  PRK  ++ +  Q   + ++
  S:    62 LSLKEREMISRG-LASCKSLRRISQELGRAASTISREIARNGGPEKYRACHAEKAFLKRSRRPKPTLLSQDEELRGVVTALLEADWSPEQITGWLKRHSSDGKAMCV---SHETIYKSLFIQTRGVLRQELKKHLRTKRMFRHAKSHRVAGRGHITDAISIRERPAQVEDRALPGHWEGDLLIGSSNSG---IATMVERYSRFTVLCKVQDKRA---ESVVQSLITQMRMLPEQLRKSLTWDRGQELAAHKRFTMATNMAVYFCDPSSPWQRGTNENTNGLLRQYFPKGTSLAPYTQCQLNEVAEKPNSRPRKTLDFRTPAQVLNEALH 380
>gi|126173028|ref|YP_001049177.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|125996233|gb|ABN60308.1| Integrase, catalytic region [Shewanella baltica OS155] (313 aa)
Score = 297, Expect = 4.2e-25, Identities = 94/309 (30%), Positives = 149/309 (48%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKR-KKGMFSKFDE-KYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y+ L+   R  I  +   Q  +I  IA  +  HRS++ RE++       Y  + A K+ +  R   + +     +  S +   + +     +      +KE        S + IY +I  +K   +R  KL     +G KR ++G   +    K       RP  + +R+ FG WE+D V+G   +G  +++ ++ERKTR   I KV +K+   +  A   L+     HV TIT DNG EF+     A  +  +VY+  PY S +RG+NEN NGL+R+  KKG D  L+SD  I   QN+IN  P+K   +
  S:     3 YQQLTEARRYQIS-VLLEQGFSIAHIAKCIDCHRSSVYREVKLCQGQSRYQPDIAHKQAVTMRRQSSKYAIPSQRIESIILLLQLDWSPEQISQVLRLVKEPV------SHEWIYRYIARDK---RRGGKLYRHLRQGHKRYRRGKVEQAPTIKNAVSIDDRPAIVDSRERFGDWEIDTVLGLHGTG--SIVTLLERKTRFYLIKKVNSKSAADVTKATIELLMPYKAHVLTITADNGREFAHHQEIAEALDTQVYFAHPYRSCERGANENANGLLRQYVKKGVDLRLVSDELIEFAQNRINYRPKKCLKF 301
>gi|586115|sp|P37245|TRA1_STRSL Probable transposase for insertion-like sequence element IS1161 >gi|348005|gb|AAA26892.1| transposase [Streptococcus salivarius] (342 aa)
Score = 297, Expect = 4.3e-25, Identities = 100/317 (31%), Positives = 153/317 (48%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQK------------KYIERRNHKNFFLWQKYKTFSELF------AEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           Y+HLS  ER  I   Y        +IA  L R+RSTI REI R +  +      A+               I      +++L  K  + S+ F      A +   + H V+   H  +  +   +VPSTK +YN+I       K  D  R   I+ +  K+    K   K +     RP+ I NR  FG WE+D V+G +  G  ++L +VER+TR +   K+  K    +N A+   +      +K+IT DNG EFS +          VY+   Y+SY+RG+NEN NGL+R    KG     L+   + +    IN  PR++  Y S+ + ++
  S:    14 YKHLSEAERGEI-EAYLSVGLKPAEIARRLGRNRSTITREINRGSITQVKKVNGAKGLLPTLLCRCCSITVIRHAREASYYL--KLDSVSDDFMRAFTDAMREKPRVHSVDTFVHTYRLQHVDAVVPSTKTLYNYIHQGLLEIKVIDLPRRVRIRKKFTKRPSTKKHLGKSIEE---RPEEINNRSRFGDWEIDSVLGGKTIGEPSILTLVERQTRYAVTKKLVEKKAEYVNQAVLECMKL--YPIKSITADNGNEFSSLSKIE---GLDVYFAHAYSSYERGTNENFNGLLREFIPKGCSLKELNQNLLEDYTKAINERPRRIHGYQSAKKLFE 337
>gi|82702816|ref|YP_412382.1| integrase catalytic subunit [Nitrosospira multiformis ATCC 25196] >gi|82410881|gb|ABB74990.1| Integrase, catalytic region [Nitrosospira multiformis ATCC 25196] (380 aa)
Score = 297, Expect = 5.0e-25, Identities = 94/318 (29%), Positives = 154/318 (48%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELT----RHYIKENYPCVLVPSTKQIYN--WIQTNKWIKKRSDK-LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV----KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMN 334
           LS  ERE+I        K++ +I+ EL R  ST  REI RN   E Y A  A+K +++R       L  + +    +        W   ++T    RH       CV   S + IY   +IQT   +++   K LRT  +    +   +  +           RP  + +R   GHWE DL+IG   SG   +  MVER +R + + KV++K      S ++SL+ +  +      K++T D G E +            VY+C+P + +QRG+NEN NGL+R+ + KGT  +  +  ++N +  K+N  PRK  ++ +  Q   + ++
  S:    62 LSLEEREMISRG-LASCKSLRRISQELGRAASTTSREIARNGGPEKYRACHAEKAFLKRSRRPKPTLLSQDEELRGVVTGLLEADWSPEQITGWLKRHSSDGKAMCV---SHETIYKSLFIQTRGVLRQELKKHLRTKRMFRHAKSHRVAGRGHITDAISIRERPAQVEDRALPGHWEGDLLIGSSNSG---IATMVERYSRFTVLCKVQDKRA---ESVVQSLITQMRMLPEQLRKSLTWDRGQELAAHKRFTMATNMAVYFCDPSSPWQRGTNENTNGLLRQYFPKGTSLATYTQCQLNEVAEKLNSRPRKTLDFRTPAQVLNEALH 380
>gi|50915228|ref|YP_061200.1| transposase [Streptococcus pyogenes MGAS10394] >gi|50904302|gb|AAT88017.1| Transposase [Streptococcus pyogenes MGAS10394] (179 aa)
Score = 296, Expect = 5.7e-25, Identities = 65/169 (38%), Positives = 99/169 (58%)
  Q:   152 RKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMF 320
           RKR K +     +        RP++I +R EFGHWE+DLV+GK+  G + +L +VER+TR +   K+E+K   TIN A+  L+++    + +IT DNG EFS +          VY+  PY+S++RG+NEN NGL+R    KG   + L+  E++N    IN  PR++ 
  S:    15 RKRSKKVMKTNKKTLGKSIEERPEYINDRSEFGHWEIDLVLGKKTKGEAVMLTLVERQTRYALGVKLEDKQSQTINRAVTHLISQ--YPIASITADNGSEFSLLSDLE---AVDVYFAHPYSSHERGTNENFNGLLREYVPKGVSLNPLTSEELDNDITAINERPRRLL 178
>gi|145308073|ref|YP_001144404.1| putative IS1 transposase [Aeromonas salmonicida subsp. salmonicida] (324 aa)
Score = 295, Expect = 7.4e-25, Identities = 96/320 (30%), Positives = 157/320 (49%)
  Q:     3 YTTITLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSEL--FAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKR-KKGMFS-KFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y++IT++    Y+ L+ G+R  +  +   Q  +I   A  +  HRST+ RE+RRN   +GY  + A +    RR         K +  +++  F E     W   E      K+     L+ S + IY  +  +K    R  +L     +G KR +KG  S +   K       RP  + +R+  G WE D V+GK+ +G   L+ +VERK+R   + +V +K    +  AI  ++      V TIT DNG EF++       +  + Y+  PY+S++RG NEN NGL+R+   KGTD   ++D ++   +  +N  PRK   +
  S:     5 YSSITMS----YQQLTEGQRYQLSVLR-AQGMSILATARAIGVHRSTLYRELRRNAGPQGYQPDNAHQHATHRRASA-----AKSRLSADVIQFVELTLAWWWSPEQISAVGKQ---IGLMVSHEWIYRHVAADK---ARGGQLYRHLRQGNKRYRKGASSLRSPIKEARSIDERPAIVDSRERLGDWEADTVLGKQGTG--ALVTLVERKSRLYLVKRVASKQAGVVRDAIIEMLTPYIEQVHTITFDNGGEFAEHKAIEEALGAETYFAHPYSSWERGLNENSNGLLRQFIPKGTDLREVTDEDVRRAEQWLNLRPRKCLGF 310
>gi|50914383|ref|YP_060355.1| transposase [Streptococcus pyogenes MGAS10394] >gi|50903457|gb|AAT87172.1| Transposase [Streptococcus pyogenes MGAS10394] (182 aa)
Score = 295, Expect = 7.6e-25, Identities = 64/169 (37%), Positives = 99/169 (58%)
  Q:   152 RKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMF 320
           RKR K +     +        RP++I +R EFGHWE+DL++GK+  G + +L +VER+TR +   K+E+K   TIN A+  L+++    + +IT DNG EFS +          VY+  PY+S++RG+NEN NGL+R    KG   + L+  E++N    IN  PR++ 
  S:    18 RKRSKKVMKTNKKTLGKSIEERPEYINDRSEFGHWEIDLILGKKTKGEAVMLTLVERQTRYALGVKLEDKQSQTINRAVTHLISQ--YPIASITADNGSEFSLLSTLE---AVDVYFAYPYSSHERGTNENFNGLLREYVPKGISLNPLTSEELDNYLTAINERPRRLL 181
>gi|125975686|ref|YP_001039596.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125715911|gb|ABN54403.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] (356 aa)
Score = 293, Expect = 1.1e-24, Identities = 104/325 (32%), Positives = 170/325 (52%)
  Q:    12 NKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKY-------IERRNHKNFFLWQKYKTFSEL--FAEK--YNCKWHG---VELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSD-----KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV----KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           +K++HLS  ER  I  +   + K+   IA +L R  STI REI+R   ++  +     K Y       +  +N  N    +K     +   FAE      KW     V L R   K     ++   TK +YN+I       +  D     +L++   + R+ K+ +    D+        RP+ + +R+ FGHWE+D V GK+ S  S +L + ERKTR   +  ++ K+  T+N A+  L N     V    +TIT DNG EFS++      +  +VY+  PY+S++RG+NE  NGLIRR   KG      S+  I  +Q  +N +PR++  Y + ++ + + +++L
  S:    12 HKFKHLSVYERGQIAAL-LKEGKSQRYIANKLGRSPSTISREIKRGTTMQMRTDLSTYKVYFPETGQAVYEKNRMNCGAKRKLAQVEDFLKFAEDKILREKWSPDAVVGLCRRDPKWQNSTIVC--TKTLYNYIDLGLIKVRNIDLNLKLRLKSKIKRIRQNKRVVGKSIDQ--------RPEEVQSRQTFGHWEIDTVTGKK-SNDSVILTLTERKTRYELLFLLDAKDSNTVNEALSELKNCYGKDVSNVFRTITADNGSEFSRLSEMLQGLGIEVYFTHPYSSWERGTNERHNGLIRRFIPKGKAIKDFSEETIKRIQQWLNSLPRRILGYKTPEECFNEEIHNL 347
>gi|121635268|ref|YP_975513.1| putative insertion element is1655 transposase (fragment) [Neisseria meningitidis FAM18] >gi|120866974|emb|CAM10736.1| putative insertion element is1655 transposase (fragment) [Neisseria meningitidis FAM18] (295 aa)
Score = 293, Expect = 1.3e-24, Identities = 100/280 (35%), Positives = 147/280 (52%)
  Q:    43 LKRHRSTILREIRRNNNV-EGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQI-------YNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSL-VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           L RH+STI REIRR+    + YSAEKAQ++    +  K     Q YK  S+L         H   L R  +     C  +    QI       Y +++ +K      W       LR      RKR    +++           RP  +  +   G WE D ++GK Q   S LL +VER TR + I K+++ K   T  +A+++L  +K+ +H  TIT+DNG EF +       +K + Y+C PY S+++G NEN NGLIR+ + K TDF  +SD EI  +Q+++N  PRK   Y
  S:     4 LNRHKSTISREIRRHRTQGQQYSAEKAQRQSRTIKQRKR----QPYKLDSQLIQ-------HIDTLIRRKLSPEQVCAYLCKHHQITLHHSTIYRYLRQDKSNGSTLW-----QHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVDQKSRIGDWEADTIVGKGQK--SALLTLVERVTRYTIICKLDSLKAEDTARAAVRALKAHKDRVH--TITMDNGKEFYQHTKITKALKAETYFCRPYHSWEKGLNENTNGLIRQYFPKQTDFRNISDREIRRVQDELNHRPRKTLGY 279
>gi|146328216|emb|CAM58132.1| transposase [uncultured marine microorganism] (306 aa)
Score = 293, Expect = 1.4e-24, Identities = 91/299 (30%), Positives = 146/299 (48%)
  Q:    39 IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMF----------SKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFT-INSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLN 337
           IA  L R   T+ REI+RN     Y A KA++   +R +        K +  + + A+K   +W   E    ++K+ YP        Q+ + I       +    L+   IK  + K+ M            +   K +     RP  + +R   GHWE DL++G   S  S +  +VER TR   + KV+ K+  T IN+ IK          +++T D G E S     +      VY+C+P + +QRGSNEN NGL+R+ + KGTD S+ S   +NN+  ++N  PRK   + S  + + +C+ S++
  S:     4 IAILLGRAPCTVSREIKRNGGGRDYRASKAEQAAWDRAHRPKICKLVKNRALAHIVAKKLTQRW-SPEQIAGWLKKTYP---EDENYQVSHEIIYRSLYVQARGALKKELIKHLRNKRTMRHSRHGNSSGEGQGQIKDMISISERPASVEDRAVPGHWEGDLIVG---SNDSYMATLVERHTRYVMLVKVDGKDTKTVINALIKQSKKLPRELYRSLTWDRGKELSDHKRFSLATDIDVYFCDPQSPWQRGSNENTNGLLRQYFPKGTDLSVHSQRHLNNVACELNDRPRKTLGFCSPAEKFNECVASIS 306
>gi|451858|gb|AAA72050.1| [Aeromonas salmonicida gene, complete cds.], gene product (339 aa)
Score = 293, Expect = 1.4e-24, Identities = 95/312 (30%), Positives = 151/312 (48%)
  Q:    11 TNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSEL--FAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKR-KKGMFS-KFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           T  Y+ L+ G+R  +  +   Q  +I   A  +  HRST+ RE+RRN   +GY  + A +    RR         K +  +++  F E     W   E      K+     L+ S + IY  +  +K    R  +L     +G KR +KG  S +   K       RP  + +R+  G WE D V+GK+ +G   L+ +VERK+R   + +V NK    +  AI  ++      V TIT DNG EF++       +  + Y+  PY+S++RG NEN NGL+R+   KGTD   ++D ++   +  +N  PRK   +
  S:    24 TMSYQQLTEGQRYQLSVLR-AQGMSILATARAIGVHRSTLYRELRRNAGPQGYQPDNAHQHATHRRASA-----AKSRLSADVIQFLELTLAWWWSPEQISAVGKQ---IGLMVSHEWIYRHVAADK---ARGGQLYRHLRQGHKRYRKGASSLRSPIKEARSIDERPAIVDSRERLGDWEADTVLGKQGTG--ALVTLVERKSRLYLVKRVANKQAGVVRDAIIEMLTPYIEQVHTITFDNGGEFAEHKAIEEALGAETYFAHPYSSWERGLNENSNGLLRQFIPKGTDLREVTDEDVRRAEQWLNLRPRKCLGF 325
>gi|75182235|gb|ABA12844.1| transposase-like [Lactobacillus paracasei subsp. paracasei] (332 aa)
Score = 291, Expect = 2.0e-24, Identities = 107/313 (34%), Positives = 160/313 (51%)
  Q:    12 NKYRHLSYGEREIIGHMYFVQKKNINQ-IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERR-NHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQ-TNKWIKKRSD-------KLR----TAYIKGR-KRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK-NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           + Y HL+  +RE I  +  V  K+  Q IA  +   ++T+ REI+RN   + YSA KAQ+ Y  RR   +   L    K    +       +W   +++     EN    +  S   IY  I+  N  IK++S        KLR    T  +KG  K ++G F+  D   VH    RP    NR  FGHWE D + GK  +G S L+ +V+RK+R     +V   N   +   +  L++      V+T+T D G EF+     +  +   VY+ +P+A  QRG+NEN NGLIR  + KGTD   L+D +I+     +N  PRK+  + S
  S:     2 SSYNHLTLKDRECI--LLGVTLKDTYQVIAQRIGCSKATVSREIKRNGGRKAYSAVKAQENYQGRRLKSRRPRLLTNLKLRDFILHCIVQRQWSPEQISGRLAHENSEWRI--SYNTIYRGIERDNLGIKRKSHGARGFARKLRHRGKTRKVKGTIKERRGRFN--DVPSVHE---RPVSCENRSRFGHWEGDTIRGK--TGRSALVTLVDRKSRYLLSQRVLKVNAKNVTQVMIDLLHTVMPKRVRTLTPDRGTEFAGYREVSQELSIPVYFPDPHAPQQRGTNENTNGLIREYFPKGTDLDQLTDQDIDKFVRDLNHRPRKVLGWKS 319
>gi|77458990|ref|YP_348496.1| integrase catalytic subunit [Pseudomonas fluorescens PfO-1] >gi|77382993|gb|ABA74506.1| Integrase, catalytic region [Pseudomonas fluorescens PfO-1] (386 aa)
Score = 291, Expect = 2.1e-24, Identities = 99/319 (31%), Positives = 154/319 (48%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYN--WIQTNKWIKKR-----SDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH---VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           L+  ERE I     V   +I  +A  L R  STI REIRRN     Y A +A +   +R +        + +T +++ A+K   +W   E    ++K  YP       S + IY   +IQ    +KK               +   +KK    +  +        RP    +R   GHWE DL+ G R S    +  +VER TR   + K++ K+  T+ SA+  + N  NL     K++T D G E +           KVY+C+P+  +QRGSNEN NGL+R+ + KGTD +  S A +N +  ++N  PRK  +Y +  + + + + S
  S:    63 LTLAEREEISRA-VVAGNSIRSMAALLGRAASTISREIRRNGGQGCYRANQADQAAWDRAHRPKVCKLVENRTVAQIVADKLQLQW-SPEQIAGWLKRTYPDDASYQVSHETIYRTLFIQARGALKKELLEHLRRTRAMRRSRHHTQKKENHGRITDAV--SIRERPAAAKDRAVPGHWEGDLLCGSRNS---QIATLVERHTRYVMLVKLDGKDSETVISAL--IENARNLPQELYKSLTWDRGKEMADHKRFTVATDIKVYFCDPHRPWQRGSNENTNGLLRQYFLKGTDLAEHSQATLNEVARQLNSRPRKTLDYETPAERFSQSVAS 384
>gi|145298556|ref|YP_001141397.1| transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|145299502|ref|YP_001142343.1| transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|145301106|ref|YP_001143947.1| transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|145301250|ref|YP_001144090.1| transpoase [Aeromonas salmonicida subsp. salmonicida A449] >gi|145301265|ref|YP_001144105.1| transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142851328|gb|ABO89649.1| transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142852274|gb|ABO90595.1| transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142853878|gb|ABO92199.1| transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142856027|gb|ABO92342.1| transpoase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142856042|gb|ABO92357.1| transposase [Aeromonas salmonicida subsp. salmonicida A449] (339 aa)
Score = 291, Expect = 2.2e-24, Identities = 94/312 (30%), Positives = 151/312 (48%)
  Q:    11 TNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSEL--FAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKR-KKGMFS-KFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           T  Y+ L+ G+R  +  +   Q  +I   A  +  HRST+ RE+RRN   +GY  + A +    RR         K +  +++  F E     W   E      K+     L+ S + IY  +  +K    R  +L     +G KR +KG  S +   K       RP  + +R+  G WE D V+GK+ +G   L+ +VERK+R   + +V +K    +  AI  ++      V TIT DNG EF++       +  + Y+  PY+S++RG NEN NGL+R+   KGTD   ++D ++   +  +N  PRK   +
  S:    24 TMSYQQLTEGQRYQLSVLR-AQGMSILATARAIGVHRSTLYRELRRNAGPQGYQPDNAHQHATHRRASA-----AKSRLSADVIQFVELTLAWWWSPEQISAVGKQ---IGLMVSHEWIYRHVAADK---ARGGQLYRHLRQGHKRYRKGASSLRSPIKEARSIDERPAIVDSRERLGDWEADTVLGKQGTG--ALVTLVERKSRLYLVKRVASKQAGVVRDAIIEMLTPYIEQVHTITFDNGGEFAEHKAIEEALGAETYFAHPYSSWERGLNENSNGLLRQFIPKGTDLREVTDEDVRRAEQWLNLRPRKCLGF 325
>gi|145308058|ref|YP_001144389.1| putative IS1 transposase [Aeromonas salmonicida subsp. salmonicida] >gi|145308064|ref|YP_001144395.1| putative IS1 transposase [Aeromonas salmonicida subsp. salmonicida] >gi|145308068|ref|YP_001144399.1| putative IS1 transposase [Aeromonas salmonicida subsp. salmonicida] >gi|144226931|emb|CAK02761.1| TnpA [Aeromonas salmonicida subsp. salmonicida] >gi|144226937|emb|CAK02767.1| TnpA [Aeromonas salmonicida subsp. salmonicida] >gi|144226941|emb|CAK02771.1| TnpA [Aeromonas salmonicida subsp. salmonicida] >gi|187606668|emb|CAQ52423.1| TnpA [Aeromonas salmonicida subsp. salmonicida] (339 aa)
Score = 290, Expect = 2.8e-24, Identities = 94/312 (30%), Positives = 151/312 (48%)
  Q:    11 TNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSEL--FAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKR-KKGMFS-KFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           T  Y+ L+ G+R  +  +   Q  +I   A  +  HRST+ RE+RRN   +GY  + A +    RR         K +  +++  F E     W   E      K+     L+ S + IY  +  +K    R  +L     +G KR +KG  S +   K       RP  + +R+  G WE D V+GK+ +G   L+ +VERK+R   + +V +K    +  AI  ++      V TIT DNG EF++       +  + Y+  PY+S++RG NEN NGL+R+   KGTD   ++D ++   +  +N  PRK   +
  S:    24 TMSYQQLTEGQRYQLSVLR-AQGMSILATARAIGVHRSTLYRELRRNAGPQGYQPDNAHQHATHRRASA-----AKSRLSADVIQFVELTLAWWWSPEQISAVGKQ---IGLMVSHEWIYRHVAADK---ARGGQLYRHLRQGNKRYRKGASSLRSPIKEARSIDERPAIVDSRERLGDWEADTVLGKQGTG--ALVTLVERKSRLYLVKRVASKQAGVVRDAIIEMLTPYIEQVHTITFDNGGEFAEHKAIEEALGAETYFAHPYSSWERGLNENSNGLLRQFIPKGTDLREVTDEDVRRAEQWLNLRPRKCLGF 325
>gi|91790169|ref|YP_551121.1| Fis family transcriptional regulator [Polaromonas sp. JS666] >gi|91699394|gb|ABE46223.1| putative transcriptional regulator, Fis family [Polaromonas sp. JS666] (386 aa)
Score = 290, Expect = 3.0e-24, Identities = 100/319 (31%), Positives = 156/319 (48%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCV--LVPSTKQIYN--WIQTNKWIKKRS-DKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM--RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFT-INSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           LS  ERE I     V  ++I  IA++L R  ST+ REI+RN     Y A +A +   +R +        + +  + + A K   +W   ++   ++K  YPC      S + IY   +IQ    +KK     LR      R R     +    K  +   +  RP  + +R   GHWE DL+ G   +    +  +VER+TR   + KV +K+  T IN+ IK+         K++T D G E +            VY+C+P + +QRGSNEN NGL+R+ + KG D S  S A++N +  K+N  PRK  NY +  + + + + S
  S:    63 LSLAEREEISRA-LVAGQSIRSIASQLGRAPSTVSREIKRNGGQGSYRATQADQAAWDRAHRPKRCKLAQNRILARVVAGKLQRQWAPQQIA-GWLKHTYPCDEDYHVSHETIYRSLFIQARGALKKELLQHLRRTRAMRRSRHHTQKTDNHGKITNAVSISERPASVEDRAVPGHWEGDLLFGNLNT---QIATLVERQTRYVMLVKVASKDTQTVINALIKNARKLPQELYKSLTWDRGKEMADHKRFTLATDISVYFCDPQSPWQRGSNENTNGLLRQYFPKGIDISNYSQAQLNAIARKLNERPRKTLNYETPAERFSQLVAS 384
>gi|125972716|ref|YP_001036626.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125972825|ref|YP_001036735.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125972869|ref|YP_001036779.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125973030|ref|YP_001036940.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125973107|ref|YP_001037017.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125973210|ref|YP_001037120.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125973216|ref|YP_001037126.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125973396|ref|YP_001037306.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125973721|ref|YP_001037631.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125973907|ref|YP_001037817.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125974007|ref|YP_001037917.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125974499|ref|YP_001038409.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125974604|ref|YP_001038514.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125974639|ref|YP_001038549.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125974673|ref|YP_001038583.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125975197|ref|YP_001039107.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|125975659|ref|YP_001039569.1| integrase catalytic subunit [Clostridium thermocellum ATCC 27405] >gi|196251217|ref|ZP_03149887.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] >gi|196251801|ref|ZP_03150467.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] >gi|196252015|ref|ZP_03150679.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] >gi|196252825|ref|ZP_03151474.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] >gi|196252857|ref|ZP_03151505.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] >gi|196252942|ref|ZP_03151588.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] >gi|196253002|ref|ZP_03151646.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] >gi|196253192|ref|ZP_03151830.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] >gi|196253479|ref|ZP_03152105.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] >gi|125712941|gb|ABN51433.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125713050|gb|ABN51542.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125713094|gb|ABN51586.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125713255|gb|ABN51747.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125713332|gb|ABN51824.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125713435|gb|ABN51927.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125713441|gb|ABN51933.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125713621|gb|ABN52113.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125713946|gb|ABN52438.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125714132|gb|ABN52624.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125714232|gb|ABN52724.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125714724|gb|ABN53216.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125714829|gb|ABN53321.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125714864|gb|ABN53356.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125714898|gb|ABN53390.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125715422|gb|ABN53914.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|125715884|gb|ABN54376.1| Integrase, catalytic region [Clostridium thermocellum ATCC 27405] >gi|196197104|gb|EDX91975.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] >gi|196197387|gb|EDX92246.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] >gi|196197564|gb|EDX92417.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] >gi|196197659|gb|EDX92510.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] >gi|196197721|gb|EDX92570.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] >gi|196197759|gb|EDX92607.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] >gi|196198604|gb|EDX93437.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] >gi|196198741|gb|EDX93572.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] >gi|196199180|gb|EDX94007.1| Integrase catalytic region [Clostridium thermocellum DSM 4150] (356 aa)
Score = 290, Expect = 3.1e-24, Identities = 103/325 (31%), Positives = 169/325 (52%)
  Q:    12 NKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKY-------IERRNHKNFFLWQKYKTFSEL--FAEK--YNCKWHG---VELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSD-----KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV----KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           +K++HLS  ER  I  +   + K+   IA +L R  STI REI+R   ++  +     K Y       +  +N  N    +K     +   FAE      KW     V L R   K     ++   TK +YN+I       +  D     +L++   + R+ K+ +    D+        RP+ + +R+ FGHWE+D V GK+ S  S +L + ERKTR   +  ++ K+  T+N A+  L N     V    +TIT DNG EFS++      +  + Y+  PY+S++RG+NE  NGLIRR   KG      S+  I  +Q  +N +PR++  Y + ++ + + +++L
  S:    12 HKFKHLSVYERGQIAAL-LKEGKSQRYIANKLGRSPSTISREIKRGTTMQMRTDLSTYKVYFPETGQAVYEKNRMNCGAKRKLAQVEDFLKFAEDKILREKWSPDAVVGLCRRDPKWQNSTIVC--TKTLYNYIDLGLIKVRNIDLNLKLRLKSKIKRIRQNKRVVGKSIDQ--------RPEEVQSRQTFGHWEIDTVTGKK-SNDSVILTLTERKTRYELLFLLDAKDSNTVNEALSELKNCYGKDVSNVFRTITADNGSEFSRLSEMLQGLGIEAYFTHPYSSWERGTNERHNGLIRRFIPKGKAIKDFSEETIKRIQQWLNSLPRRILGYKTPEECFNEEIHNL 347
>gi|118051287|ref|ZP_01519836.1| Integrase, catalytic region [Comamonas testosteroni KF-1] >gi|118001958|gb|EAV16113.1| Integrase, catalytic region [Comamonas testosteroni KF-1] (415 aa)
Score = 289, Expect = 3.6e-24, Identities = 96/320 (30%), Positives = 151/320 (47%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCV--LVPSTKQIYN--WIQTNKWIKKRS-DKLRTAYIKGRKRKKGMFSKFDEKYVH--PFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI-KSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           L+  ERE I        ++I  +A  LKR  STI RE+ RN     Y A  A +   +R +             +++ A K   +W   E    ++K  YP    +  S + IY   ++QT   +KK   + LR      R R     +    + V   P   RP  I +R   GHWE DL+ G     YS +  +VER TR   + K+ +K+ +T+ +A+ K          +++T D G E +           +VY+C+P   +QRG+NEN NGL+R+   KG D S  S  E++ +  K+N  PRK   Y +  + + +C+ S+
  S:    92 LTISEREEISRA-LAAGESIRCVARRLKRAASTISRELLRNGGKTCYRATNADEAAWQRAHRPKMCKLACNPALAQIVAGKLQSQW-SPEQIAGWLKRTYPGAKDMQVSHEAIYRTLFVQTRGALKKELLEHLRRTRGMRRSRHYTQKTPIHGRIVDAVPISERPACIEDRAVPGHWEGDLLFG---DAYSQVATLVERHTRYVMLVKLVDKDSYTVAAALAKHAQTLPQELYRSLTWDRGSEMAGHKRFTVATDIQVYFCDPQNPWQRGTNENTNGLLRQYLPKGIDISGYSQDELDAIARKLNERPRKTLGYRTPAEMFNECVASI 414
>gi|126131332|gb|ABN79863.1| transposase [Leifsonia xyli subsp. cynodontis] (351 aa)
Score = 289, Expect = 3.8e-24, Identities = 98/321 (30%), Positives = 158/321 (49%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG----YSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKK---GMFSKFDEKYVHPFWM---RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTI--NSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           R LS  ERE I  +      ++  IA +L+R  STI REI RN +  G    ++A +   K   R   +      + + F E    K   +W   ++TR  I++ +P    +  +T+ IY  +      + R D L TA   GR R++   G  ++   ++V P  M   RP  + +R   GHWE DL+IG   +  S +  +VER TR   +  +   +      +  I+++        K++T D G E +            VY+C+P + +QRGSNEN NGL+R+ + KGTD S  S A++  + +++N  PRK   + +  Q   K   S
  S:    26 RFLSLEEREQIRDL-LRDGLSLRSIAAQLRRSPSTISREISRNRSSTGIYHPFAAHRYSAKRRPRPKPRRLVTELRLRAFVE---SKLALRWSPEQITRALIRQ-FPDDVGMRVATETIYQTLYLQGRGQLRRD-LATALRTGRARRRPNRGTNAR-RSRFVDPMLMISERPAEVADRAVPGHWEGDLIIGADHA--SAIGTLVERTTRFVMLVHLPTDHAAETVRDGLIRTMSGLPAELKKSLTWDQGAEMAAHKTFTIATDMDVYFCDPASPWQRGSNENTNGLLRQYFPKGTDLSQHSPADLARVAHELNTRPRKTLGWETPAQRLAKLPTS 351
>gi|121593643|ref|YP_985539.1| integrase catalytic subunit [Acidovorax sp. JS42] >gi|120605723|gb|ABM41463.1| Integrase, catalytic region [Acidovorax sp. JS42] (386 aa)
Score = 288, Expect = 5.4e-24, Identities = 84/285 (29%), Positives = 145/285 (50%)
  Q:    38 QIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP---CVLVPSTKQIYN--WIQTNKWIKKR--------SDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK-NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           QIA EL R  STI RE+ RN     Y A  A ++  E+               + L A+K   +W   ++   +++  +P   C+ V S + IY   ++Q    +KK             R     G++  +G  +  D   +H    RP  I +R   GHWE DLV G + S   ++  +VER +R + + +V+ K+  ++  A+   V +     +K++T D G+E +     +   +  V++C+P + +QRG+NEN NGL+R+   KG D S+ S  +++ +  ++N  PRK  +Y
  S:    83 QIAAELGRSPSTISREVHRNGGAARYRAAVADERAWEQARRTKPCALALNPELTSLVAQKLALQWSPQQIA-GWLRREHPDTACMQV-SHETIYRSLFVQARGVLKKELMAHLRTRRSMRRARAGLGKESPRGQIT--DAVSIHS---RPAQIEDRAVPGHWEGDLVTGAKNS---HIATLVERHSRFALLVQVDGKDTASVVQALTREVKRLPGGLMKSLTWDRGMELALHRTFSMATEVDVFFCDPRSPWQRGTNENTNGLVRQYLPKGADLSVYSQEDLDAISMRLNMRPRKTLDY 371
>gi|27365847|ref|NP_761375.1| transposase [Vibrio vulnificus CMCP6] >gi|27361996|gb|AAO10902.1|AE016805_159 Transposase and inactivated derivatives [Vibrio vulnificus CMCP6] (322 aa)
Score = 287, Expect = 5.7e-24, Identities = 94/316 (29%), Positives = 156/316 (49%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN----NVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKY-NCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDK-LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           +Y+HL+  ER +I  +   Q  +  +IA +L RH++TI REI RN+    + + YS +  + + + R         ++Y        E      W   ++  +     YP +   S + IY  I  +K +     K LR +  K RKR     S+           RP    +RKE GHWE+D V+G+       ++ +V+R T  +FI +++++   ++N  +  ++ +++L  KTIT DNG EF           C  Y+  PY S++RG+NEN NGLIR+   K T  S ++    N + +K+N  PRK   Y +  +Y
  S:     2 RYKHLTENERYMISALR-KQGISTAKIAKQLGRHKATIYREIERNSRYNRHFKRYSYQAWRAQQMARNRLSRSRRNKRYSEIDFRLPEALLRLDWSPDQIVGYLRVRGYPTM---SHELIYQHIWNDKTLGGTLWKHLRQSTKKRRKRYNSKDSRGRLAAKRHITERPAKAEHRKEPGHWEIDTVVGRGTK--HCIVTLVDRMTGYTFIGQMDDRTSESLNVRMSKIMTRSDLPFKTITADNGTEFHGYAQLEKHHNCLFYFANPYHSWERGTNENTNGLIRQYLPKRTSMSHVTQKLCNEIAHKLNTRPRKRLGYRTPTEY 317
>gi|45478501|gb|AAS66625.1| transposase [Aeromonas punctata] >gi|51507278|emb|CAF29027.1| putative transposase, IS30 family [Haemophilus influenzae] >gi|122891988|gb|ABM67076.1| transposase [Aeromonas punctata] (315 aa)
Score = 287, Expect = 6.5e-24, Identities = 91/310 (29%), Positives = 155/310 (50%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQ--IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWI-------KKRSDKLRTAYIKGRKR-KKGMFSKFDEKYVHPFWM----RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           KY+ L+ G R  I  +   +   ++Q  IA +L  H STI RE+RRN   + Y  ++A +    RR                L ++K       ++     +  ++    +     + N   +++WI       K     L     +G KR +KG  SK   + V P  +    RP  +  R   G WE+D V+GK+ SG   ++ ++ERK+R   +  V +K    +   I S++     HV TIT DNG EF +    A  ++ +VY+  PY++++RG NEN NGL+R+   KG+D S+++   ++ ++ ++N  PRK   +
  S:     2 KYQQLTEGLRYQIACL---RDHGLSQARIAKQLGVHPSTISRELRRNCAGQAYQPQQAHQLATARR----------------LTSQKRTVPSDTIDFVCMALVADWSPEQISGVGDMINCPVSHEWIYRYVARDKANGGTLYRHLRQGHKRYRKGKNSK---RSVIPNPVSIDERPAIVNERSRVGDWEVDTVLGKQGSG--AIVSLLERKSRLYLVQYVPSKTASAVADTIISMLKPYQAHVHTITADNGSEFVEHERVAAELEAQVYFAHPYSAWERGQNENSNGLLRQYVPKGSDLSVVTAEALSAVEKRLNFRPRKCLGF 301
>gi|118053411|ref|ZP_01521955.1| Integrase, catalytic region [Comamonas testosteroni KF-1] >gi|117999085|gb|EAV13245.1| Integrase, catalytic region [Comamonas testosteroni KF-1] (386 aa)
Score = 286, Expect = 7.4e-24, Identities = 96/320 (30%), Positives = 151/320 (47%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCV--LVPSTKQIYN--WIQTNKWIKKRS-DKLRTAYIKGRKRKKGMFSKFDEKYVH--PFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           LS  ERE I        ++I  +A  LKR  STI RE+ RN     Y A KA +   +R +             +++ A K   +W   E    ++K  YP    +  S + IY   ++QT   +KK   + LR      R R     +    + V   P   RP  I +R   G+WE DL+ G     YS +  +VER TR   + K+ +K+ +T+ +A+          + +++T D G E +            VY+C+P   +QRG+NEN NGL+R+   KG D S  S  E++ +  K+N  PRK   Y +  + + +C+ S+
  S:    63 LSLAEREEISRS-LAAGESIRCVARRLKRAASTISRELMRNGGKTCYRATKADEAAWQRAHRPKTCKLACNPALAQIVAGKLQSQW-SPEQIAGWLKRTYPSAKDMQVSHEAIYRTLFVQTRGALKKELLEHLRRTRGMRRSRHYTQKTPIHGRIVDAVPMSERPACIEDRAVPGYWEGDLLFG---DAYSQVATLVERHTRYVMLVKLVDKDSYTVAAALARHAQTLPQELYRSLTWDRGSEMAGHKRFTVATDILVYFCDPQNPWQRGTNENTNGLLRQYLPKGIDISGYSQDELDAIARKLNERPRKTLGYRTPAEMFNECVASI 385
>gi|28201184|dbj|BAC56721.1| transposase [Pseudomonas sp. K23] (342 aa)
Score = 285, Expect = 9.9e-24, Identities = 92/309 (29%), Positives = 155/309 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNHKNFFLWQKYKTFSELF--AEKYNCKWHGVE--LTRHYIKENYPCVLVPSTKQIYNWIQT--NKWIKKRSDKLRTAYI----KGRKRKKGMFSKFDEKYVHP----FWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  LS  ER  I  +   Q  ++ +IA  + R  ST+ RE+RRN +  G YSA  AQ++   RR        Q  +   +L   +E++    H +   L+   I      + +PS +  Y   +T  N        +LR   I    +G+  ++      D +   P      +RP  + +R   GHWE DL+ GK  +  S++  +VER +    + K+ +    +      + +N   L + K++T D G E ++           +Y+C+P++ +QRGSNEN+NGLIR+   KGTD S+ S  E++ +  ++N  PRK F++
  S:     3 YSELSVEERATI-QVSHAQGLSLRRIACLINRSPSTVSREMRRNRDAAGSYSARVAQQRMKARR--------QACRPMRKLLPGSERFELVIHMLRQRLSPEQIAGKLRSMNIPSLRDAYVCRETIYNAIYALPVGELRKELILCLRQGKTTRRPRLGGVDRRGQIPEMVSIHLRPPEVEDRLMPGHWEGDLIKGKANA--SSVGTLVERTSGYLMLVKMNDATATSAMEGFSAALNNMPLAMRKSMTYDQGREMAQHAEITQRTGVAIYFCDPHSPWQRGSNENINGLIRQYLPKGTDLSVHSQEELDAIAFQLNMRPRKRFDF 316
>gi|37680104|ref|NP_934713.1| transposase and inactivated derivative [Vibrio vulnificus YJ016] >gi|37198850|dbj|BAC94684.1| transposase and inactivated derivative [Vibrio vulnificus YJ016] (338 aa)
Score = 285, Expect = 1.2e-23, Identities = 94/316 (29%), Positives = 155/316 (49%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN----NVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKY-NCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDK-LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           +Y HL+  ER +I  +   Q  +  +IA +L RH++TI REI RN+    + + YS +  + + + R         ++Y        E      W   ++  +     YP +   S + IY  I  +K +     K LR +  K RKR     S+           RP    +RKE GHWE+D V+G+       ++ +V+R T  +FI +++++   ++N  +  ++ +++L  KTIT DNG EF           C  Y+  PY S++RG+NEN NGLIR+   K T  S ++    N + +K+N  PRK   Y +  +Y
  S:    18 RYTHLTENERYMISALR-KQGISTAKIAKQLGRHKATIYREIERNSRYNRHFKRYSYQAWRAQQMARNRLSRSRRNKRYSEIDFRLPEALLRLDWSPDQIVGYLRVRGYPTM---SHELIYQHIWNDKTLGGTLWKHLRQSTKKRRKRYNSKDSRGRLAAKRHITERPAKAEHRKEPGHWEIDTVVGRGTK--HCIVTLVDRMTGYTFIGQMDDRTSESLNVRMSKIMTRSDLPFKTITADNGTEFHGYAQLEKHHNCLFYFANPYHSWERGTNENTNGLIRQYLPKRTSMSHVTQKLCNEIAHKLNTRPRKRLGYRTPTEY 333
>gi|33321495|gb|AAQ06505.1| transposase [Lactobacillus crispatus] (344 aa)
Score = 284, Expect = 1.3e-23, Identities = 92/325 (28%), Positives = 161/325 (49%)
  Q:    11 TNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV---------EGYSAEKAQKKYIERRNHKNFFL---WQKYKTFSELFAEKYNCKWHGVELTRHY--IKENYPCVLVPSTKQIYNWIQTNKW----------IKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           +  Y  L+  +R  I  M      +   IA E+  H+STI REI+R + +         E Y A+ AQ  Y +RR  KN +     + Y  F  + + ++  K+    +       K   P    PST  +Y +I               +K+R +K   ++      KK + +  ++        RPK + +RK   HWE DLV G R+     L+ + ER TR   + K+ +    T    ++  ++++    K+IT DNG EF+ +        C++Y+  PY+ ++RG+NEN NGL+R+ + KG      S A +    + IN   R++  Y ++++ +K+ ++S
  S:     9 SKHYHQLTSVQRGQIQAMLDSGITSRTVIAQEVGCHKSTISREIKRGSVLQRDSSYLLYEHYYADTAQIYYEKRR--KNCYQRNPLKHYAVFLRMLSRRFKAKFDATSIDEFVGEFKRTMPGYPCPSTPTVYRYIDQGLLDISNIDLPMKLKRRRNKRHHSHGGHALHKKHLGNSIEQ--------RPKEVEDRKAPLHWEGDLVKGVRRKNQPALMTLTERTTRFEVVIKIPDYRASTCQRLLQKEIDRHPAWFKSITFDNGSEFADMTKIK---GCQIYFAHPYSPWERGTNENCNGLLRQFFPKGKSMKDKSKAYVQQATDAINHKYRRILQYHTAEELFKQYISS 344
>gi|94988739|ref|YP_596840.1| transposase [Streptococcus pyogenes MGAS9429] >gi|94992563|ref|YP_600662.1| transposase [Streptococcus pyogenes MGAS2096] >gi|94542247|gb|ABF32296.1| transposase [Streptococcus pyogenes MGAS9429] >gi|94546071|gb|ABF36118.1| Transposase [Streptococcus pyogenes MGAS2096] (195 aa)
Score = 284, Expect = 1.3e-23, Identities = 64/169 (37%), Positives = 99/169 (58%)
  Q:   152 RKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMF 320
           RKR K +     +        RP++I +R EFGHWE+DLV+GK+  G + +L +VER+TR +   K+E+K   TIN A+  L+  ++  + +IT DNG EFS   + +      VY+  PY+S++RG+NEN NGL+R    KG   + L+  E++N    IN   R++ 
  S:    31 RKRSKKVMKTNKKTLGKSIEERPEYINDRSEFGHWEIDLVLGKKTKGEAVMLTLVERQTRYALGVKLEDKQSQTINRAVTHLI--SHYPIASITADNGSEFS---LLSDLKAVDVYFAHPYSSHERGTNENFNGLLREYVPKGISLNPLTSEELDNDITAINERLRRLL 194
>gi|118054047|ref|ZP_01522589.1| Integrase, catalytic region [Comamonas testosteroni KF-1] >gi|117998841|gb|EAV13003.1| Integrase, catalytic region [Comamonas testosteroni KF-1] (344 aa)
Score = 284, Expect = 1.6e-23, Identities = 92/308 (29%), Positives = 151/308 (49%)
  Q:    11 TNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRN-HKNFFLWQKYKTFSELFAEKYNCKWH----GVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSD---KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK----NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRK 318
           ++ Y  L   +R  I  +   Q  ++  IA +L R  +TI RE+ RN +  GY +  AQ + ++RR   +           S L       +W      + L R Y   +  CV   S + IYN I      + R +    LR A+ K   R KG   +     +    +RP  I +R+  GHWE DL+ G+  +  S +  +VER +R   + K+    P +  + +++  +K          ++T D G E S     +      VY+C+P++ +QRGSNEN+NGL+R+   KGTD S+ S  +++ + ++IN  PRK
  S:     5 SSHYHQLQPEDRVTIASLR-QQNHSVRAIARQLHRSPATISRELERNASSSGYGSAHAQCQSLQRRRCGRPAIKLHPESILSCLVIHLLRLRWSPEQIALTLARLYPLGHEYCV---SHETIYNCIYAMPVGELRKELIATLRHAHNKRLPRSKGKDRRGQIPDMLSIHVRPPEIEDRQFPGHWEGDLIKGEGNA--SAVGTLVERTSRLVMLVKLPEFKPASAINVLQAFTDKLLGIAQPMRLSMTYDQGREMSMHKKLSEQTGIAVYFCDPHSPWQRGSNENMNGLVRQYLPKGTDLSIYSQEQLDAIADEINNRPRK 318
>gi|116694401|ref|YP_728612.1| transposase IS30 [Ralstonia eutropha H16] >gi|113528900|emb|CAJ95247.1| Transposase IS30 [Ralstonia eutropha H16] (370 aa)
Score = 283, Expect = 2.0e-23, Identities = 91/306 (29%), Positives = 143/306 (46%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELT---RHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVH---PFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNP-FTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           L+  ERE I     V   +I  +A  L R  STI RE+RRN   +GY A +A +   ER          K +T +++ A K   +W   ++    +H    N    +   T     +IQ    +K+   +        R+ ++      +   +        RP    +R   GHWE DL+ G   S  S +  +VER+TR   + K+ +K+    +N+ IK          K++T D G E +           KVY+C+P   +QRG+NEN NGL+R+   KGTD S+ S A++N +  ++N  PRK  N+
  S:    47 LTLAEREEISRA-VVAGHSIRSVAARLGRAPSTISREVRRNGGRQGYLANQADELTWERARRPKACKLVKNRTLAQVVASKLRLQWSPEQIAGWLKHVYAVNRDYQVSHETIYRSLYIQARGALKRELLEHLRRSRAMRRSRQHTLKTDNRTNIRDAVSISERPATAEDRAIPGHWEGDLLFG---SANSQIATLVERQTRFVMLVKIASKDSEAVVNALIKHAGKLPQELYKSLTWDRGTEMAGHKRFTVATDIKVYFCDPQNPWQRGTNENTNGLLRQYLPKGTDLSVYSQAKLNAIARRLNERPRKTLNF 355
>gi|119943930|ref|YP_941610.1| integrase catalytic subunit [Psychromonas ingrahamii 37] >gi|119862534|gb|ABM02011.1| Integrase, catalytic region [Psychromonas ingrahamii 37] (327 aa)
Score = 283, Expect = 2.0e-23, Identities = 109/324 (33%), Positives = 161/324 (49%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN---VEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIK----ENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM------RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPF-TINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           KY HLS  ER++I + +  +K +I +I   L R  +TI RE++RN +   V  Y    AQ+ Y  R   +        +   +    K    W   EL    +K    E Y C      + IY      ++I K + +L     +  KR++  +      YV    +      RP+ I NR   GHWE D +  K +    N  V+VER TR S ITK+ +K    T N+ IK L N  N  V ++T DNG E +        + CK Y+C+ Y S+++G+ E VNGLIRR   KGTDF+L+S   I  ++N +N  PRK   Y +  + Y +   +L
  S:     4 KYSHLSLHERKLIFNWFHYRKMSIRKIGDLLSRSHTTISREVKRNESQYYVPTYYPHSAQRYYAMRMRRRVTKGRLSNEGTKQYVINKLKIGWTP-ELISGRLKLTGEEKYIC-----HESIY------QYIYKEAKELIIYLPRKHKRRRMKYPS--RAYVAKTSLKTSILERPEEIDNRSIPGHWESDSIESKGRKLALN--VVVERVTRMSHITKLSSKKALATKNALIKKLANHPNDFVCSVTYDNGSENAGHLKVNEKLDCKSYFCQAYHSWEKGAVEQVNGLIRRFLPKGTDFALVSHKRIGEIENILNSRPRKCLGYKTPFEIYNEICGAL 325
>gi|42518362|ref|NP_964292.1| transposase [Lactobacillus johnsonii NCC 533] >gi|42518466|ref|NP_964396.1| transposase [Lactobacillus johnsonii NCC 533] >gi|42518696|ref|NP_964626.1| transposase [Lactobacillus johnsonii NCC 533] >gi|42519601|ref|NP_965531.1| transposase [Lactobacillus johnsonii NCC 533] >gi|42519683|ref|NP_965613.1| transposase [Lactobacillus johnsonii NCC 533] >gi|42519703|ref|NP_965633.1| transposase [Lactobacillus johnsonii NCC 533] >gi|41582647|gb|AAS08258.1| transposase [Lactobacillus johnsonii NCC 533] >gi|41582751|gb|AAS08362.1| transposase [Lactobacillus johnsonii NCC 533] >gi|41582982|gb|AAS08592.1| transposase [Lactobacillus johnsonii NCC 533] >gi|41583890|gb|AAS09497.1| transposase [Lactobacillus johnsonii NCC 533] >gi|41583972|gb|AAS09579.1| transposase [Lactobacillus johnsonii NCC 533] >gi|41583992|gb|AAS09599.1| transposase [Lactobacillus johnsonii NCC 533] (349 aa)
Score = 283, Expect = 2.1e-23, Identities = 103/325 (31%), Positives = 154/325 (47%)
  Q:     7 TLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRR------NNNVEGYSAEKAQKKYIERRNH---KNFFLWQKYKTFSELFAEKYNCKWH-GVELTRHYIKENYPCVLVPSTKQIYNWIQTN-----KWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH----VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           T+N   K +HLS+ ER II  +      ++  IA EL    STI  E++R      +  V+ Y A +    Y   R +   K+ FL +K +    +    +   W   V   R      +    V  TK +YN++         +      K  T   + RK KK +    +E        RPK I  R EFGHWE DLV+G +      LL + ER +R   I ++ +K   ++  A K L  + + H     KTIT DNG EF+ +          VYY  PY S  +G+ E  NGLIRR   KG   +  S  +I N++   N +PRK+  Y + D+ +++
  S:     7 TMNQHVKGKHLSFEERVII-QLRLKDGYSLRAIARELNCSPSTISYEVKRGTVKLYHGKVKKYKATQGHDAYKAHRKNCGRKSDFL-RKAQFMRYVHKHFFKDGWSLDVCSNRATAVGEFASSDVVCTKTLYNYVDQGLLGIYNYDLPEKLKRNTKLHRIRKNKKKLGRSIEE--------RPKEINKRNEFGHWECDLVLGHKSKDDEVLLTLSERMSREFLILRIPDKTSVSVMQAFKELQRQYSEHWNDIFKTITTDNGSEFADLSNLEKVSNTLVYYAHPYTSCDKGTVERHNGLIRRFIPKGEAIANYSLQDIINIETWCNSLPRKILAYHTPDEIFER 340
>gi|26250328|ref|NP_756368.1| transposase insI [Escherichia coli CFT073] >gi|26110758|gb|AAN82942.1|AE016769_57 Transposase insI for insertion sequence element IS30B/C/D [Escherichia coli CFT073] (383 aa)
Score = 282, Expect = 2.5e-23, Identities = 95/316 (30%), Positives = 157/316 (49%)
  Q:    16 HLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWI---------QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI--KSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           HL+  ERE I       K +I  IAT L R  STI RE++RN     Y A  A  +           L  +     +L  EK   KW   +++  +++   P    L  S + IY  +           N    +RS  LR      RK ++G  +  +   +H    R ++I NR+  GHWE DLV G + S   ++  +V+RK+R + I ++  K+  ++N A+  K L   + L  K++T D G+E ++          KVY+C+P + +QRG+NEN NGLIR+ + K T  +  +  E++ +  ++N  PRK   + +  +  ++
  S:    58 HLTLSEREEI-RAGLSAKMSIRAIATALNRSPSTISREVQRNRGRRYYKAVDANNRANRMAKRPKPCLLDQNLPLRKLVLEKLEMKWSSEQIS-GWLRRTKPRQKTLRISPETIYKTLYFRSREALHHLNIQHLRRSHSLRYGRRHTRKGERGTINIVNGTPIHE---RSRNIDNRRSLGHWEGDLVSGTKNS---HIATLVDRKSRYTIILRLRGKDSVSVNQALTDKFLSLPSELR-KSLTWDRGMELARHLEFTVSTGVKVYFCDPQSPWQRGTNENTNGLIRQYFPKKTCLAQYTQHELDLVAAQLNNRPRKTLKFKTPKEIIER 377
>gi|16128241|ref|NP_414790.1| KpLE2 phage-like element; IS30 transposase [Escherichia coli str. K-12 substr. MG1655] >gi|89107129|ref|AP_000909.1| IS30 transposase [Escherichia coli W3110] >gi|170079881|ref|YP_001729201.1| CP4-6 prophage; IS30 transposase [Escherichia coli str. K12 substr. DH10B] >gi|170081081|ref|YP_001730401.1| IS30 transposase [Escherichia coli str. K12 substr. DH10B] >gi|1552823|gb|AAB08675.1| IS30 transposase [Escherichia coli] >gi|1786450|gb|AAC73359.1| KpLE2 phage-like element; IS30 transposase [Escherichia coli str. K-12 substr. MG1655] >gi|85674400|dbj|BAE76048.1| IS30 transposase [Escherichia coli W3110] >gi|169887716|gb|ACB01423.1| CP4-6 prophage; IS30 transposase [Escherichia coli str. K12 substr. DH10B] >gi|169888916|gb|ACB02623.1| IS30 transposase [Escherichia coli str. K12 substr. DH10B] (383 aa)
Score = 282, Expect = 2.5e-23, Identities = 95/316 (30%), Positives = 157/316 (49%)
  Q:    16 HLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWI---------QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI--KSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           HL+  ERE I       K +I  IAT L R  STI RE++RN     Y A  A  +           L  +     +L  EK   KW   +++  +++   P    L  S + IY  +           N    +RS  LR      RK ++G  +  +   +H    R ++I NR+  GHWE DLV G + S   ++  +V+RK+R + I ++  K+  ++N A+  K L   + L  K++T D G+E ++          KVY+C+P + +QRG+NEN NGLIR+ + K T  +  +  E++ +  ++N  PRK   + +  +  ++
  S:    58 HLTLSEREEI-RAGLSAKMSIRAIATALNRSPSTISREVQRNRGRRYYKAVDANNRANRMAKRPKPCLLDQNLPLRKLVLEKLEMKWSPEQIS-GWLRRTKPRQKTLRISPETIYKTLYFRSREALHHLNIQHLRRSHSLRHGRRHTRKGERGTINIVNGTPIHE---RSRNIDNRRSLGHWEGDLVSGTKNS---HIATLVDRKSRYTIIVRLRGKDSVSVNQALTDKFLSLPSELR-KSLTWDRGMELARHLEFTVSTGVKVYFCDPQSPWQRGTNENTNGLIRQYFPKKTCLAQYTQHELDLVAAQLNNRPRKTLKFKTPKEIIER 377
>gi|149930794|ref|YP_001294698.1| w0034 [Escherichia coli] >gi|37695782|gb|AAR00444.1|AF401292_46 w0034 [Escherichia coli] (383 aa)
Score = 282, Expect = 2.5e-23, Identities = 95/316 (30%), Positives = 157/316 (49%)
  Q:    16 HLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWI---------QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI--KSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           HL+  ERE I       K +I  IAT L R  STI RE++RN     Y A  A  +           L  +     +L  EK   KW   +++  +++   P    L  S + IY  +           N    +RS  LR      RK ++G  +  +   +H    R ++I NR+  GHWE DLV G + S   ++  +V+RK+R + I ++  K+  ++N A+  K L   + L  K++T D G+E ++          KVY+C+P + +QRG+NEN NGLIR+ + K T  +  +  E++ +  ++N  PRK   + +  +  ++
  S:    58 HLTLSEREEI-RAGLSAKMSIRAIATALNRSPSTISREVQRNRGRRYYKAVDANNRANRMAKRPKPCLLDQNLPLRKLVLEKLEMKWSPEQIS-GWLRRTKPRQKTLRISPETIYKTLYFRCREALHHLNIQHLRRSHSLRHGRRHTRKGERGTINIVNGTPIHE---RSRNIDNRRSLGHWEGDLVSGTKNS---HIATLVDRKSRYTIILRLRGKDSVSVNQALTDKFLSLPSELR-KSLTWDRGMELARHLEFTVSTGVKVYFCDPQSPWQRGTNENTNGLIRQYFPKKTCLAQYTQHELDLVAAQLNNRPRKTLKFKTPKEIIER 377
>gi|10957235|ref|NP_058259.1| IS30 transposase [Salmonella typhi] >gi|16129365|ref|NP_415922.1| KpLE2 phage-like element; IS30 transposase [Escherichia coli str. K-12 substr. MG1655] >gi|16132105|ref|NP_418704.1| KpLE2 phage-like element; IS30 transposase [Escherichia coli str. K-12 substr. MG1655] >gi|89108250|ref|AP_002030.1| IS30 transposase [Escherichia coli W3110] >gi|89110995|ref|AP_004775.1| IS30 transposase [Escherichia coli W3110] >gi|149930805|ref|YP_001294740.1| w0076 [Escherichia coli] >gi|170018783|ref|YP_001723737.1| integrase catalytic region [Escherichia coli ATCC 8739] >gi|170020263|ref|YP_001725217.1| integrase catalytic region [Escherichia coli ATCC 8739] >gi|170020627|ref|YP_001725581.1| integrase catalytic region [Escherichia coli ATCC 8739] >gi|170083718|ref|YP_001733038.1| KpLE2 phage-like element; IS30 transposase [Escherichia coli str. K12 substr. DH10B] >gi|194432487|ref|ZP_03064774.1| transposase InsI for insertion sequence element IS30B/C/D [Shigella dysenteriae 1012] >gi|2851554|sp|P37246|INSI_ECOLI Transposase insI for insertion sequence element IS30B/C/D >gi|7800288|gb|AAF69884.1|AF250878_45 IS30 transposase [Salmonella typhi] >gi|37695793|gb|AAR00455.1|AF401292_58 w0076 [Escherichia coli] >gi|404301|emb|CAA25376.1| unnamed protein product [Escherichia coli] >gi|537125|gb|AAA97180.1| IS30 transposase [Escherichia coli] >gi|1742285|dbj|BAA15014.1| IS30 transposase [Escherichia coli W3110] >gi|1787671|gb|AAC74486.1| KpLE2 phage-like element; IS30 transposase [Escherichia coli str. K-12 substr. MG1655] >gi|1790736|gb|AAC77240.1| KpLE2 phage-like element; IS30 transposase [Escherichia coli str. K-12 substr. MG1655] >gi|14252937|emb|CAC39292.1| unnamed protein product [Escherichia coli] >gi|85677026|dbj|BAE78276.1| IS30 transposase [Escherichia coli W3110] >gi|169753711|gb|ACA76410.1| Integrase catalytic region [Escherichia coli ATCC 8739] >gi|169755191|gb|ACA77890.1| Integrase catalytic region [Escherichia coli ATCC 8739] >gi|169755555|gb|ACA78254.1| Integrase catalytic region [Escherichia coli ATCC 8739] >gi|169891553|gb|ACB05260.1| KpLE2 phage-like element; IS30 transposase [Escherichia coli str. K12 substr. DH10B] >gi|194419374|gb|EDX35456.1| transposase InsI for insertion sequence element IS30B/C/D [Shigella dysenteriae 1012] (383 aa)
Score = 281, Expect = 3.3e-23, Identities = 95/316 (30%), Positives = 157/316 (49%)
  Q:    16 HLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWI---------QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI--KSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           HL+  ERE I       K +I  IAT L R  STI RE++RN     Y A  A  +           L  +     +L  EK   KW   +++  +++   P    L  S + IY  +           N    +RS  LR      RK ++G  +  +   +H    R ++I NR+  GHWE DLV G + S   ++  +V+RK+R + I ++  K+  ++N A+  K L   + L  K++T D G+E ++          KVY+C+P + +QRG+NEN NGLIR+ + K T  +  +  E++ +  ++N  PRK   + +  +  ++
  S:    58 HLTLSEREEI-RAGLSAKMSIRAIATALNRSPSTISREVQRNRGRRYYKAVDANNRANRMAKRPKPCLLDQNLPLRKLVLEKLEMKWSPEQIS-GWLRRTKPRQKTLRISPETIYKTLYFRSREALHHLNIQHLRRSHSLRHGRRHTRKGERGTINIVNGTPIHE---RSRNIDNRRSLGHWEGDLVSGTKNS---HIATLVDRKSRYTIILRLRGKDSVSVNQALTDKFLSLPSELR-KSLTWDRGMELARHLEFTVSTGVKVYFCDPQSPWQRGTNENTNGLIRQYFPKKTCLAQYTQHELDLVAAQLNNRPRKTLKFKTPKEIIER 377
>gi|190014950|ref|YP_001965462.1| IS30D transposase [Escherichia coli] >gi|109389671|gb|ABG29590.1| IS30D transposase [Escherichia coli] (383 aa)
Score = 281, Expect = 3.3e-23, Identities = 95/316 (30%), Positives = 157/316 (49%)
  Q:    16 HLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWI---------QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI--KSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           HL+  ERE I       K +I  IATEL R  STI RE++RN     Y A  A  +           L  +     +L  EK   KW   +++  +++   P    L  S + IY  +           N    +RS  LR      RK ++G  +  +   +H    R ++I NR+  GHWE DLV G + S   ++  +V+RK+R + I ++  K+  ++N A+  K L   + L  K++T D G+E ++          KVY+C+P + +QRG+NEN NGLIR+ + K    +  +  E++ +  ++N  PRK   + +  +  ++
  S:    58 HLTLSEREEI-RAGLSAKMSIRAIATELNRSPSTISREVQRNRGRRYYKAVDANNRANRMAKRPKPCLLDQNLPLRKLVLEKLEMKWSPEQIS-GWLRRTKPRQKTLRISPETIYKTLYFRSREALHHLNIQHLRRSHSLRHGRRHTRKGERGTINIVNGTPIHE---RSRNIDNRRSLGHWEGDLVSGTKNS---HIATLVDRKSRYTIILRLRGKDSVSVNQALTDKFLSLPSELR-KSLTWDRGMELARHLEFTVSTGVKVYFCDPQSPWQRGTNENTNGLIRQYFPKKICLAQYTQHELDLVAAQLNNRPRKTLKFKTPKEIIER 377
>gi|15146033|gb|AAK83662.1| transposase [Lactobacillus delbrueckii subsp. lactis] (349 aa)
Score = 281, Expect = 3.3e-23, Identities = 106/317 (33%), Positives = 156/317 (49%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN------NVEGYSAEKAQKKYIERRNH---KNFFLWQKYKTFSELFAEKYNCKWH-----GVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSD-----KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLV----NKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           K +HL+  +R  I  ++     N   IA EL    ST+  E++R        NV+ Y A + Q  Y   R+    K+ FL ++ K    +    +N  W      G  L +   +++     V STK +YN++       K  D     K  T   + R  K+ +    DE        R   I +RK+FGHWE DLV+G +      LL + ERKTR  F+ K+E+K   ++  A   L     +K N   K+IT DNG EF+ +       K  VYY  PY S  +GS E  NGLIRR   KG      S  +I  ++   N +PRK+ NY + ++Y+
  S:    13 KGKHLTLNDRTTIQELHSKGYSN-RAIARELNCSPSTVGYELKRGTVSLYTGNVKRYKAVEGQSTYELHRSECGRKSLFL-RRQKFIDYVSHCFHNRGWSLDACVGYALAKGIFQKDQ----VVSTKTLYNYVDLGLMDIKNGDLPEKVKRNTKTRRVRVNKRILGRSIDE--------RSPRIESRKDFGHWECDLVLGHKTKDDDVLLTLCERKTRQFFMIKIEDKTSASVMKAFDKLREYYGSKWNQIFKSITTDNGSEFADLSNLEQVSKTLVYYAHPYTSCDKGSVERHNGLIRRYIPKGDRMDKYSVEDIAKIEVWCNSLPRKILNYKTPEEYF 338
>gi|38638326|ref|NP_943558.1| putative transposase [Listonella anguillarum] >gi|29825761|gb|AAO92384.1| transposase [Listonella anguillarum] >gi|38155233|gb|AAR12532.1| putative transposase [Listonella anguillarum] (322 aa)
Score = 281, Expect = 3.4e-23, Identities = 93/316 (29%), Positives = 153/316 (48%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN----VEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKY-NCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDK-LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           KY HL+  ER +I  +   Q  +  +IA +L RH++TI REI RN       + YS +  + + + R         ++Y        E      W   ++  +     YP +   S + IY  +  +K +     K LR +  + RKR     S+           RP +  +RKE GHWE+D V+G+       ++ +V+R T  +FI +++++   ++N  +  ++ +++L  KTIT DNG EF           C  Y+  PY S++RG+NEN NGLIR+   K T  S ++    N + +K+N  PRK   Y    +Y
  S:     2 KYTHLTENERYMISALR-KQGISTAEIAKQLGRHKATIYREIERNCRYNKFFDRYSYQPERAQQMARNRLSRSRRNKRYTKLDFRLPEALLRLDWSPDQIVGYLRMRGYPTM---SHELIYQHVWNDKALGGTLWKHLRQSTKQRRKRYNSKDSRGRLANKRHITERPANAEHRKEPGHWEIDTVVGRGTK--HCIVTLVDRMTGYTFIGQMDDRTSESLNVRMSKIMTRSDLPFKTITADNGTEFHGYAQLEKHHNCLFYFANPYHSWERGTNENTNGLIRQYLPKRTSMSHVTQKLCNEIAHKLNTRPRKRLGYRIPLEY 317
>gi|172062451|ref|YP_001810102.1| integrase catalytic region [Burkholderia ambifaria MC40-6] >gi|171994968|gb|ACB65886.1| Integrase catalytic region [Burkholderia ambifaria MC40-6] (386 aa)
Score = 281, Expect = 3.6e-23, Identities = 97/323 (30%), Positives = 154/323 (47%)
  Q:    13 KYRH-----LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQ----TNKWIKKRSDKL-RTAYIKGR-KRKKGMFSKFDEKYVH--------------------PFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNP-FTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           K RH     L+  ERE I     V   +I  IA +L R  STI RE++RN  + GY A  A +   ER          + +  +++ A K   +W                    S +QI  W++     N+  +   D + R+ YI+ R   KK +                              P   RP  + +R   GHWE DL+ G   S  S +  +VER++R   + KV +K+    IN+ I+          K++T+D G E +           KVY+C+P + +QRGSNEN NGL+R+ + KG D S  S  ++N +  ++N  PRK  ++ +  + + + + S
  S:    54 KQRHRSRLALTLAEREEISRS-VVAGDSIRAIANQLGRAPSTISRELKRNGGMPGYRANNADELAWERARRPQVCKLVRNRELAQVVAGKLRLQW--------------------SPEQIAGWLKHVYAVNRDYQVSHDTIYRSLYIQARGALKKELLEHLRRSRAMRRSRHHTMKTDDHGRICDTVPISERPATVDDRAIPGHWEGDLLFG---SANSQIATLVERQSRFVMLVKVASKDTEAVINALIRHAGKLPQELYKSLTLDRGKEMADHTRFTVATDIKVYFCDPQSPWQRGSNENTNGLLRQYFPKGIDLSAYSQVKLNAVARRLNERPRKTLDFDTPAERFHQFVAS 384
>gi|3688518|emb|CAA06660.1| putative transposase [Pseudomonas sp. OX1] (342 aa)
Score = 280, Expect = 3.9e-23, Identities = 95/320 (29%), Positives = 158/320 (49%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRN-----HKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYI---KENYPCVLVPSTKQIYNWIQTNKWIKKRSDK---LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCM 333
           Y  LS  ER  I  +   Q  ++ +IA  + R  STI RE+RRN +V G YSA  AQ++    R       K     ++++  + +  E+ + +    +L    I   +E Y C      + IYN I      + R +    LR +    R R  G+  +     +    +RP  I +R   GHWE DL+ GK  +  S++  +VER +    + K+ +    +      + +N   L + K++T D G E ++           +++C+P++ +QRGSNEN+NGLIR+   KGTD S+ S  E+N +  ++N  PR  F++    +   K M
  S:     3 YTELSVEERATI-QIGQAQGFSLRRIARLIHRSPSTISREVRRNRDVRGGYSAHVAQQQMRASRRVCRPMRKLLPGSERFELVAHMLRERLSPEQIAGKLRSMNIPSLREAYVC-----RETIYNAIYALPVGELRKELIICLRQSKTTRRPRSGGVDRRGQIPEMVSIHVRPPEIEDRLMPGHWEGDLIKGKANA--SSVGTLVERTSGYLMLVKMNDATATSAMEGFSAALNGMPLAMRKSMTYDQGREMARHAEITQRTGVAIFFCDPHSPWQRGSNENINGLIRQYLPKGTDLSVHSQEELNAIALQLNMRPRNRFDFKCPIEVMGKVM 327
>gi|42525659|ref|NP_970757.1| ISTde2, transposase [Treponema denticola ATCC 35405] >gi|42526532|ref|NP_971630.1| ISTde2, transposase [Treponema denticola ATCC 35405] >gi|42527258|ref|NP_972356.1| ISTde2, transposase [Treponema denticola ATCC 35405] >gi|41815670|gb|AAS10638.1| ISTde2, transposase [Treponema denticola ATCC 35405] >gi|41816725|gb|AAS11511.1| ISTde2, transposase [Treponema denticola ATCC 35405] >gi|41817843|gb|AAS12267.1| ISTde2, transposase [Treponema denticola ATCC 35405] (358 aa)
Score = 280, Expect = 4.1e-23, Identities = 119/319 (37%), Positives = 166/319 (52%)
  Q:    11 TNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTF--SELFAEKYNC-KWHGVELTR-----HY------------------IKE---NYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYV--HPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVK----TITIDNGIEF-SKIGIAAYWIK-----CKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           + K++HLS  ER  I  + F    N  QIA  L R R TI REI+R     G   +  +  Y+ R      +L +   +    +  A+K    K  G+++ +     HY                  IKE    +P ++   TK +YN I    + +  +  L     K  KRK    SK  +  +       R + I  R+E GHWE+DLVIGK   G   L VM ER TR   I K+ +K   +I   I  L  K     K    +IT+DNG EF  + G+    +K        YY  PY+S++RGSNEN N LIRR   KG D S  SD +I  ++N IN  PR+MF Y +++Q Y
  S:    10 SKKWKHLSEKERYAIEAL-FKSDYNARQIAQSLNRDRRTIQREIKR-----GMVIKVTENPYVSRNPKVPDYLEKTVYSARKGQQRADKMKLLKGRGLKIGKDKKLLHYLETCIADNKFSPDAAIGQIKELGLQFPVMIC--TKTVYNMIDRGDFSRLTNKDLPVKRNK-TKRKYKKISKIAKNNIKGRSIEQRSEQINKRQEKGHWEMDLVIGK---GRCCLQVMTERVTRKELIFKIPDKKQESIKKNIDMLEMKYKDEFKEIFKSITMDNGTEFLDQEGLETSCLKEGEKRTTCYYAHPYSSWERGSNENANKLIRRFIPKGADISKYSDIQIKQVENWINNYPRRMFGYKTANQMY 357
>gi|110801482|ref|YP_697955.1| IS1470, transposase [Clostridium perfringens SM101] >gi|110803197|ref|YP_698038.1| IS1470, transposase [Clostridium perfringens SM101] >gi|169342527|ref|ZP_02629271.2| transposase [Clostridium perfringens C str. JGS1495] >gi|169342787|ref|ZP_02863822.1| oligoendopeptidase, M3 family [Clostridium perfringens C str. JGS1495] >gi|169342890|ref|ZP_02863920.1| transposase [Clostridium perfringens C str. JGS1495] >gi|169343910|ref|ZP_02864906.1| transposase [Clostridium perfringens C str. JGS1495] >gi|110681983|gb|ABG85353.1| IS1470, transposase [Clostridium perfringens SM101] >gi|110683698|gb|ABG87068.1| IS1470, transposase [Clostridium perfringens SM101] >gi|169298030|gb|EDS80121.1| transposase [Clostridium perfringens C str. JGS1495] >gi|169299008|gb|EDS81081.1| transposase [Clostridium perfringens C str. JGS1495] >gi|169299044|gb|EDS81116.1| oligoendopeptidase, M3 family [Clostridium perfringens C str. JGS1495] >gi|169299299|gb|EDS81366.1| transposase [Clostridium perfringens C str. JGS1495] (350 aa)
Score = 280, Expect = 4.6e-23, Identities = 99/321 (30%), Positives = 164/321 (51%)
  Q:    10 DTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVE--------GYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKY------NCKWHGVELTRHYIKEN-YPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLV----NKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           ++ K +HL+  ER I+  +      +  +IA EL R  +T+L EIRR    +         Y A+  +  Y + R   N    +KYK        KY      N  W         +  + +    + STK +YN++       K  D     +   R +K        +K       RP  I NR+EFGHWE+D V+G++ +    LL +VERKTR + I+++ + +  ++  A+  +     +K +   K+IT DNG EF+ +       K KVY+  PY+S+++G+NE  NGLIRR   KG   S  S   I+ ++N +N +PRK+ +Y + ++ ++
  S:     9 ESRKNKHLNMKERMIV-EIRLKDGFSAYKIAKELNRPINTVLNEIRRGTTKQIKQGKEFHVYFADTGEAVYKKNRLKSN----RKYKLLECSDFIKYVVDKVKNDHWSLDACVGEALHSSRFSPSQIISTKTLYNYVDLGLLPIKNIDLPAKLH---RNKKSTRVRNNKKKLGTSISDRPNSIENREEFGHWEIDCVLGEKSNKDKVLLTLVERKTRYAIISEMSSHSTISVTKALDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTKTKVYFTHPYSSFEKGTNERHNGLIRRFIPKGKRISDYSLETISFIENWMNTLPRKLLDYKTPEELFE 340
>gi|116334292|ref|YP_795819.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116334297|ref|YP_795824.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116099639|gb|ABJ64788.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] >gi|116099644|gb|ABJ64793.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] (314 aa)
Score = 280, Expect = 4.7e-23, Identities = 96/288 (33%), Positives = 151/288 (52%)
  Q:    35 NINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRN--HKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSD------------KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSL---VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           +I  +A  L R+ STI RE++R      YS  KA   Y ++R   HK   L    +   ++     +  W   ++T  + KE+  CV   S   IY  I  +   +K S             K RT + K  +R + +  + D   +H    RP  I  R+  G WE+D VIG+  +G+S LL +V+R +R + I KV  K+   IN  +  L   + K  +H  +IT D+G EF  +   +  +   VY+ +PY+  QRG+NEN NGLIR  + K TD    ++ ++ + Q ++N+ PRK+ NY
  S:     9 SIRAVALRLGRNPSTISRELKRCAG--NYSPSKADNDYHQKRQNCHKKRLLDSHPQLRRQIVHYILDLHWSPEQITARFNKEHQWCV---SYNTIYRHIYQHNLGEKYSSRGDTGIQRHLRHKHRTRHSKNTRRHREV--QTDYISIHE---RPGFINQRQRIGDWEIDTVIGR--TGHSILLTVVDRLSRLTLIKKVVQKDSQEINKGLVELLGVIPKEVVH--SITPDHGTEFLHLDEISERLGVTVYWPDPYSPEQRGTNENTNGLIREYFPKRTDIDNYTEQDVEHCQKQLNQRPRKVLNY 299
>gi|586116|sp|P37247|TRA4_BACFR Transposase for insertion sequence element IS4351 (Transposon TN4551) >gi|154892|gb|AAA27430.1| ORF-1 [Bacteroides fragilis] >gi|1197006|gb|AAA88672.1| unknown protein [Bacteroides fragilis] (326 aa)
Score = 280, Expect = 4.7e-23, Identities = 97/320 (30%), Positives = 161/320 (50%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG--YSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM----RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINS-AIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMN 334
           +H++  +R  I  M  +       IA  +   +ST+ REI+RN +     YS E AQ+K   R+  K+    +K      +          G    +   +     + + S + IY WI  +K   +R  KL     +  +R     SK   +   P  +    RP+ +  ++ FG  E+D +IGK   G   +L + +R T   +I K+  K    +   A+ +L    NL + TIT DNG EF+K    A  ++ K Y+C+PY S++RG+NEN NGLIR+   KG DFS +++ +I  ++NK+N  PRK   Y++ ++ +K+ +N
  S:     3 KHITEEQRYAISMMLQIPMSK-KAIAEAIGVDKSTVYREIKRNCDARSGSYSMELAQRKADRRKQQKH----RKEVLTPAMRKRIIKLLKKGFSPEQIVGRSRLEGIAMVSHETIYRWIWEDK---RRGGKLHKYLRRQGRRYAKRGSKNAGRGFIPGRVDIDERPEIVELKERFGDLEIDTIIGKNHKG--AILTINDRATSRVWIRKLSGKEAIPVAKIAVWALRKVKNL-IHTITADNGKEFAKHEEIAQKLEIKFYFCKPYHSWERGANENTNGLIRQYIPKGKDFSEVTNKQIKWIENKLNNRPRKRLGYLTPNEKFKQIIN 318
>gi|110801472|ref|YP_697712.1| IS1470, transposase [Clostridium perfringens SM101] >gi|110681973|gb|ABG85343.1| IS1470, transposase [Clostridium perfringens SM101] (350 aa)
Score = 279, Expect = 4.9e-23, Identities = 99/321 (30%), Positives = 164/321 (51%)
  Q:    10 DTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVE--------GYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKY------NCKWHGVELTRHYIKEN-YPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLV----NKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           ++ K +HL+  ER I+  +      +  +IA EL R  +T+L EIRR    +         Y A+  +  Y + R   N    +KYK        KY      N  W         +  + +    + STK +YN++       K  D     +   R +K        +K       RP  I NR+EFGHWE+D V+G++ +    LL +VERKTR + I+++ + +  ++  A+  +     +K +   K+IT DNG EF+ +       K KVY+  PY+S+++G+NE  NGLIRR   KG   S  S   I+ ++N +N +PRK+ +Y + ++ ++
  S:     9 ESRKNKHLNMKERMIV-EIRLKDGFSAYKIAKELNRPINTVLNEIRRGTTKQIKQGKEFHVYFADTGEAVYKKNRLKSN----RKYKLLECSDFIKYVVDKVKNDHWSLDACVGEALHSSRFSPSQIISTKTLYNYVDLGLLPIKNIDLPAKLH---RNKKSTRVRNNKKKLGTSISDRPNSIENREEFGHWEIDCVLGEKSNKDKVLLTLVERKTRYAIISEMSSHSTISVTKALDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTKTKVYFTHPYSSFEKGTNERHNGLIRRFIPKGKRISDYSLETISFIENWMNTLPRKLLDYKTPEELFE 340
>gi|116334374|ref|YP_795901.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116334503|ref|YP_796030.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116099721|gb|ABJ64870.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] >gi|116099850|gb|ABJ64999.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] (314 aa)
Score = 279, Expect = 5.0e-23, Identities = 96/288 (33%), Positives = 151/288 (52%)
  Q:    35 NINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRN--HKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSD------------KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSL---VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           +I  +A  L R+ STI RE++R      YS  KA   Y ++R   HK   L    +   ++     +  W   ++T  + KE+  CV   S   IY  I  +   +K S             K RT + K  +R + +  + D   +H    RP  I  R+  G WE+D VIG+  +G+S LL +V+R +R + I KV  K+   IN  +  L   + K  +H  +IT D+G EF  +   +  +   VY+ +PY+  QRG+NEN NGLIR  + K TD    ++ ++ + Q ++N+ PRK+ NY
  S:     9 SIRAVALRLGRNPSTISRELKRCAG--NYSPSKADNDYHQKRQNCHKKRLLDSHPQLRRQIVHYILDLHWSPEQITARFNKEHQWCV---SYNTIYRHIYQHNLGEKYSSRGDTGIQRHLRHKHRTRHSKNTRRHREV--QTDYISIHE---RPGFINQRQRIGDWEIDTVIGR--TGHSILLTVVDRLSRLTLIKKVVQKDSQEINKGLVELLGVIPKEFVH--SITPDHGTEFLHLDEISERLGVTVYWPDPYSPEQRGTNENTNGLIREYFPKRTDIDNYTEQDVEHCQKQLNQRPRKVLNY 299
>gi|8571122|gb|AAF76755.1|AF218073_3 putative transposase [Escherichia coli] (386 aa)
Score = 279, Expect = 5.1e-23, Identities = 95/307 (30%), Positives = 153/307 (49%)
  Q:    16 HLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWI---------QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI--KSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           HL+  ERE I       K +I  IAT L R  STI RE++RN     Y A  A  +           L  +     +L  EK   KW   +++  +++   P    L  S + IY  +           N    +RS  LR      RK ++G  +  +   +H    R ++I NR+  GHWE DLV G + S   ++  +V+RK+R + I ++  K+  ++N A+  K L   + L  K++T D G+E ++          KVY+C+P + +QRG+NEN NGLIR+ + K T  +  +  E++ +  ++N  PRK   +
  S:    58 HLTLSEREEI-RAGLSAKMSIRAIATALNRSPSTISREVQRNRGRRYYKAVDANNRANRMAKRPKPCLLDQNLPLRKLVLEKLEMKWSPEQIS-GWLRRTKPRQKTLRISPETIYKTLYFRSREALHHLNIQHLRRSHSLRHGRRHTRKGERGTINIVNGTPIHE---RSRNIDNRRSLGHWEGDLVSGTKNS---HIATLVDRKSRYTIILRLRGKDSVSVNQALTDKFLSLPSELR-KSLTWDRGMELARHLEFTVSTGVKVYFCDPQSPWQRGTNENTNGLIRQYFPKKTCLAQYTQHELDLVAAQLNNRPRKTLKF 368
>gi|110802477|ref|YP_697708.1| IS1470, transposase [Clostridium perfringens SM101] >gi|110682978|gb|ABG86348.1| IS1470, transposase [Clostridium perfringens SM101] (350 aa)
Score = 279, Expect = 5.4e-23, Identities = 99/321 (30%), Positives = 164/321 (51%)
  Q:    10 DTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVE--------GYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKY------NCKWHGVELTRHYIKEN-YPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLV----NKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           ++ K +HL+  ER I+  +      +  +IA EL R  +T+L EIRR    +         Y A+  +  Y + R   N    +KYK        KY      N  W         +  + +    + STK +YN++       K  D     +   R +K        +K       RP  I NR+EFGHWE+D V+G++ +    LL +VERKTR + I+++ + +  ++  A+  +     +K +   K+IT DNG EF+ +       K KVY+  PY+S+++G+NE  NGLIRR   KG   S  S   I+ ++N +N +PRK+ +Y + ++ ++
  S:     9 ESRKNKHLNMKERMIV-EIRLKDGFSAYKIAKELNRPINTVLNEIRRGTTKQIKQGKEFHVYFADTGEAVYNKNRLKSN----RKYKLLECSDFIKYVVDKVKNDHWSLDACVGEALHSSRFSPSQIISTKTLYNYVDLGLLPIKNIDLPAKLH---RNKKSTRVRNNKKKLGTSISDRPNSIENREEFGHWEIDCVLGEKSNKDKVLLTLVERKTRYAIISEMSSHSTISVTKALDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTKTKVYFTHPYSSFEKGTNERHNGLIRRFIPKGKRISDYSLETISFIENWMNTLPRKLLDYKTPEELFE 340
>gi|84060923|ref|YP_444135.1| IS30 transposase [Escherichia coli] >gi|60499754|gb|AAX22068.1| IS30 transposase [Escherichia coli] (375 aa)
Score = 279, Expect = 5.6e-23, Identities = 95/312 (30%), Positives = 156/312 (50%)
  Q:    16 HLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWI---------QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI--KSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           HL+  ERE I       K +I  IAT L R  STI RE++RN     Y A  A  +           L  +     +L  EK   KW   +++  +++   P    L  S + IY  +           N    +RS  LR      RK ++G  +  +   +H    R ++I NR+  GHWE DLV G + S   ++  +V+RK+R + I ++  K+  ++N A+  K L   + L  K++T D G+E  +          KVY+C+P + +QRG+NEN NGLIR+ + K T  +  +  E++ +  ++N  PRK   + ++++
  S:    58 HLTLSEREEI-RAGLSAKMSIRAIATALNRSPSTISREVQRNRGRRYYKAVDANNRANRMAKRPKPCLLDQNLPLRKLVLEKLEMKWSPEQIS-GWLRRTKPRQKTLRISPETIYKTLYFRSREALHHLNIQHLRRSHSLRHGRRHTRKGERGTINIVNGTPIHE---RSRNIDNRRSLGHWEGDLVSGTKNS---HIATLVDRKSRYTIILRLRGKDSVSVNQALTDKFLSLPSELR-KSLTWDRGMELVRHLEFTVSAGVKVYFCDPQSPWQRGTNENTNGLIRQYFPKKTCLAQYTQHELDLVAAQLNNRPRKTLKFKTAER 373
>gi|110801885|ref|YP_698410.1| IS1470, transposase [Clostridium perfringens SM101] >gi|110682386|gb|ABG85756.1| IS1470, transposase [Clostridium perfringens SM101] (350 aa)
Score = 279, Expect = 6.1e-23, Identities = 97/321 (30%), Positives = 164/321 (51%)
  Q:    10 DTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVE-----------GYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKY-NCKWHGVELTRHYIKEN-YPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLV----NKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           ++ K +HL+  ER I+  +      +  +IA EL R  +T+L EIRR    +             + E   KK + + N K   L  +   F +   +K  N  W         +  + +    + STK +YN++       K  D     +   R +K        +K       RP  I NR+EFGHWE+D V+G++ +    LL +VERKTR + I+++ + +  ++  A+  +     +K +   K+IT DNG EF+ +       K KVY+  PY+S+++G+NE  NGLIRR   KG   S  S   I+ ++N +N +PRK+ +Y + ++ ++
  S:     9 ESRKNKHLNMKERMIV-EIRLKDGFSAYKIAKELNRPINTVLNEIRRGTTKQIKQGKEFHVYFADTGEAVYKKNLLKSNRKYKLL--ECSDFIKYVVDKVKNDHWSLDACVGEALHSSRFSPSQIISTKTLYNYVDLGLLPIKNIDLPAKLH---RNKKSTRVRNNKKKLGTSISDRPNSIENREEFGHWEIDCVLGEKSNKDKVLLTLVERKTRYAIISEMSSHSTISVTKALDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTKTKVYFTHPYSSFEKGTNERHNGLIRRFIPKGKRISDYSLETISFIENWMNTLPRKLLDYKTPEELFE 340
>gi|27365762|ref|NP_761290.1| transposase [Vibrio vulnificus CMCP6] >gi|27365766|ref|NP_761294.1| transposase [Vibrio vulnificus CMCP6] >gi|27365785|ref|NP_761313.1| transposase [Vibrio vulnificus CMCP6] >gi|27365820|ref|NP_761348.1| transposase [Vibrio vulnificus CMCP6] >gi|27365831|ref|NP_761359.1| transposase [Vibrio vulnificus CMCP6] >gi|27361911|gb|AAO10817.1|AE016805_74 Transposase and inactivated derivatives [Vibrio vulnificus CMCP6] >gi|27361915|gb|AAO10821.1|AE016805_78 Transposase and inactivated derivatives [Vibrio vulnificus CMCP6] >gi|27361934|gb|AAO10840.1|AE016805_97 Transposase and inactivated derivatives [Vibrio vulnificus CMCP6] >gi|27361969|gb|AAO10875.1|AE016805_132 Transposase and inactivated derivatives [Vibrio vulnificus CMCP6] >gi|27361980|gb|AAO10886.1|AE016805_143 Transposase and inactivated derivatives [Vibrio vulnificus CMCP6] (322 aa)
Score = 278, Expect = 6.4e-23, Identities = 95/316 (30%), Positives = 153/316 (48%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVE------GYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKY-NCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDK-LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           +Y HL+  ER +I  +   Q  +  +IA +L RH++TI REI RN+          Y A +AQ+  + R         ++Y        E      W   ++  +     YP +   S + IY  I  +K +     K LR +  K RKR     S+           RP    +R E GHWE+D V+G+       ++ +V+R T  +FI +++++   ++N  +  ++ +++L  KTIT DNG EF           C  Y+  PY S++RG+NEN NGLIR+   K T  S ++    N + +K+N  PRK   Y +  +Y
  S:     2 RYTHLTENERYMISALR-KQGISTAKIAKQLGRHKATIYREIERNSRYNRHFRRFSYQAWRAQQ--MARNRLSRSRRNKRYSEIDFRLPEALLRLDWSPDQIVGYLRVRGYPTM---SHELIYQHIWNDKTLGGTLWKHLRQSTKKRRKRYNSKDSRGRLAAKRHITERPAKAEHRNEPGHWEIDTVVGRGTK--HCIVTLVDRMTGYTFIGQMDDRTSESLNVRMSKIMTRSDLPFKTITADNGTEFHGYAQLEKHHNCLFYFANPYHSWERGTNENTNGLIRQYLPKRTSMSHVTQKLCNEIAHKLNTRPRKRLGYRTPTEY 317
>gi|172064656|ref|YP_001812306.1| integrase catalytic region [Burkholderia ambifaria MC40-6] >gi|171998141|gb|ACB69057.1| Integrase catalytic region [Burkholderia ambifaria MC40-6] (385 aa)
Score = 278, Expect = 6.6e-23, Identities = 96/310 (30%), Positives = 151/310 (48%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPC--VLVPSTKQIYN--WIQTNKWIKKRSD-KLRTAYIKGRKRK---KGMFSKF-DEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           R L+  ERE I         +I  IA +L R  STI REI RN     Y A +A ++ ++        L ++ +       E+  C+    E    ++K  Y     +  S + IY   ++Q    +KK     LRT       R    KG  +K  D   +H    RP+   +R   GHWE DLV G   +   ++  +VER++R + I KV+ K+  ++ + +K  V +   H+ K++T D G+E +           KVY+C+P + +QRG+NEN N L+R+    GT     S AE+N +  ++N  PRK   +MS
  S:    61 RALTLSEREEISRG-VSAGLSIRAIARQLNRAPSTISREIARNGGTGHYRALEADERALQAALRPKRCLLEQNRRL-RYAVERKLCREWSPEQVSGWLKNRYADDEAMRVSHETIYRSLFVQARGVLKKELQYHLRTQRKMRHSRSSSTKGARNKIADAVLIHE---RPREAADRAVPGHWEGDLVSGANNT---HVATLVERRSRFTIIVKVKGKDTVSVVAGLKREVKRLPQHLRKSLTWDRGMELANHKDFTIATDVKVYFCDPRSPWQRGTNENTNRLLRQYLPHGTQLDQYSQAELNKIAARLNERPRKTLGFMS 372
>gi|89902402|ref|YP_524873.1| integrase [Rhodoferax ferrireducens T118] >gi|89347139|gb|ABD71342.1| Integrase [Rhodoferax ferrireducens T118] (343 aa)
Score = 278, Expect = 6.9e-23, Identities = 100/323 (30%), Positives = 156/323 (48%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERR------------NHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIK-ENYPCVLVPSTKQIYNWIQTNKWIKKRSDK---LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV----KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           Y  L Y +R+ I  +   Q  +I  I   L R  STI REI RN+   GYS   AQ++ + RR            NH        +++ +EL  ++    W   ++  H  K          S + IYN I      + R +    LR A  K   R KG   +     +    +RP  I +R+  GHWE DL+ G      S +  +VER TR   + K+ + NP T    +++  +K +       KT+T D G E +     +      VY+C+P++ +QRG+NEN NGLIR+   KGTD S  S  +++ + + +N  PRK  ++ +  + Y   +  L
  S:     7 YSQLDYQDRQTIA-IGLEQGLSIRAIGRVLNRSASTISREIARNSGGNGYSCRYAQQRRVRRRRHARPAPKLVAGNHL-------FESITELLRQR----WSPQQIAAHLAKLHPSDAAQRASHETIYNVIYAQPRGELRKELIACLRMARAKRWPRSKGEDRRGQMANLLSIHVRPPEIEDRQFPGHWEGDLIKGALNQ--SAVGTLVERNTRLLILVKLPHPNPATAAHVLQAFTDKLSAVAQPMRKTLTYDRGTEMAYHQQLSANTGIAVYFCDPHSPWQRGTNENTNGLIRQFLPKGTDLSGYSQEQLDAIADLMNGRPRKTLDWCTPHEVYSAWLAKL 335
>gi|110801863|ref|YP_697643.1| IS1470, transposase [Clostridium perfringens SM101] >gi|110802168|ref|YP_698290.1| IS1470, transposase [Clostridium perfringens SM101] >gi|110682364|gb|ABG85734.1| IS1470, transposase [Clostridium perfringens SM101] >gi|110682669|gb|ABG86039.1| IS1470, transposase [Clostridium perfringens SM101] (350 aa)
Score = 277, Expect = 9.0e-23, Identities = 94/321 (29%), Positives = 164/321 (51%)
  Q:    10 DTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVE--------GYSAEKAQKKYIERR--NHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKEN-YPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLV----NKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           ++ K +HL+  ER I+  +      +  +IA EL R  +T+L EIRR    +         Y A+  +  Y + R  + + + L +       +  +  N  W         +  + +    + STK +YN++       K  D     +   R +K        +K       RP  I NR+EFGHWE+D V+G++ +  + LL +VERKTR + I+++ + +  ++   +  +     +K +   K+IT DNG EF+ +       K KVY+  PY+S+++G+NE  NGLIRR   KG   S  S   I+ ++N +N +PRK+ NY + ++ ++
  S:     9 ESRKNKHLNMKERMIV-EIRLKDGFSAYKIAKELNRPINTVLNEIRRGTTKQIKQGKEFNVYFADTGEAVYKKNRLKSSRKYKLLECSDFIKYVVDKVKNDHWSLDACVGEALHSSRFSPSQIISTKTLYNYVDLGLLPIKNIDLPAKLH---RNKKSTRVRNNKKKLGTSISDRPNSIENREEFGHWEIDCVLGEKSNKDNVLLTLVERKTRYAIISEMPSHSAISVTKTLDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTKTKVYFTHPYSSFEKGTNERHNGLIRRFIPKGKRISDYSLETISFIENWMNTLPRKLLNYKTPEELFE 340
>gi|145284378|gb|ABP51956.1| putative transposase [Actinobacillus pleuropneumoniae] (307 aa)
Score = 277, Expect = 9.1e-23, Identities = 93/307 (30%), Positives = 154/307 (50%)
  Q:    28 MYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCK-WHGVELTRHYIKENYPCVLVPST--KQIYNW---IQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMN 334
           +   Q K   +IA  L R  STI RE++R+  +E YSA  AQ  Y++ R +       +   +  L  EK+  + W   +++     E     +  ST  + IY+    I   K  +K   K +T + K    K+G       +  +    RP    NR  FGHWE D V+GK  +G + LL + ERK+R   + K+  K    +  A+  L++ + L  ++IT D G EF++  +    +  + Y+ EP+  + RG+NEN NGL+R  + K  D +  S+ +I  + NK+N  PRK   + +  + Y+KK ++
  S:     2 ILLAQGKKQAEIAKALGRSSSTISRELKRHA-LESYSATNAQNSYLKHRQNSKAQRKLEQPEYFNLVQEKFLTENWSPEQISARLKLEKSELSISYSTIYRGIYSGLFDIGERKASRKLRHKGKTRHTKNHHEKRGKI-----QISNHLNDRPISAQNRSRFGHWEADTVLGK--AGGACLLTLTERKSRFELVKKIPAKKAEAVQKAMIELLDSHIL--RSITPDRGKEFAQHRLVTEALGVEFYFPEPHQPWTRGTNENTNGLLREYFPKHQDINQWSEVDIQQVINKLNLRPRKCLGWKTPYEVYFKKSLH 305
>gi|47600654|emb|CAE55776.1| hypothetical protein InsI [Escherichia coli Nissle 1917] (366 aa)
Score = 277, Expect = 9.2e-23, Identities = 95/303 (31%), Positives = 152/303 (50%)
  Q:    16 HLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWI---------QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI--KSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRK 318
           HL+  ERE I       K +I  IAT L R  STI RE++RN     Y A  A  +           L  +     +L  EK   KW   +++  +++   P    L  S + IY  +           N    +RS  LR      RK ++G  +  +   +H    R ++I NR+  GHWE DLV G + S   ++  +V+RK+R + I ++  K+  ++N A+  K L   + L  K++T D G+E ++          KVY+C+P + +QRG+NEN NGLIR+ + K T  +  +  E++ +  ++N  PRK
  S:    58 HLTLSEREEI-RAGLSAKMSIRAIATALNRSPSTISREVQRNRGRRYYKAVDANNRANRMAKRPKPCLLDQNLPLRKLVLEKLEMKWSPEQIS-GWLRRTKPRQKTLRISPETIYKTLYFRSREALHHLNIQHLRRSHSLRHGRRHTRKGERGTINIVNGTPIHE---RSRNIDNRRSLGHWEGDLVSGTKNS---HIATLVDRKSRYTIILRLRGKDSVSVNQALTDKFLSLPSELR-KSLTWDRGMELARHLEFTVSTGVKVYFCDPQSPWQRGTNENTNGLIRQYFPKKTCLAQYTQHELDLVAAQLNNRPRK 364
>gi|110803003|ref|YP_698692.1| IS1470, transposase [Clostridium perfringens SM101] >gi|110803585|ref|YP_698400.1| IS1470, transposase [Clostridium perfringens SM101] >gi|110683504|gb|ABG86874.1| IS1470, transposase [Clostridium perfringens SM101] >gi|110684086|gb|ABG87456.1| IS1470, transposase [Clostridium perfringens SM101] (350 aa)
Score = 276, Expect = 1.1e-22, Identities = 94/321 (29%), Positives = 163/321 (50%)
  Q:    10 DTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVE--------GYSAEKAQKKYIERR--NHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKEN-YPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLV----NKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           ++ K +HL+  ER I+  +      +  +IA EL R  +T+L EIRR    +         Y A+  +  Y + R  + + + L +       +  +  N  W         +  + +    + STK +YN++       K  D     +   R +K        +K       RP  I NR+EFGHWE+D V+G++ +    LL +VERKTR + I+++ + +  ++   +  +     +K +   K+IT DNG EF+ +       K KVY+  PY+S+++G+NE  NGLIRR   KG   S  S   I+ ++N +N +PRK+ NY + ++ ++
  S:     9 ESRKNKHLNMKERMIV-EIRLKDGFSAYKIAKELNRPINTVLNEIRRGTTKQIKQGKEFNVYFADTGEAVYKKNRLKSSRKYKLLECSDFIKYVVDKVKNDHWSLDACVGEALHSSRFSPSQIISTKTLYNYVDLGLLPIKNIDLPAKLH---RNKKSTRVRNNKKKLGTSISDRPNSIENREEFGHWEIDCVLGEKSNKDKVLLTLVERKTRYAIISEMPSHSAISVTKTLDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTKTKVYFTHPYSSFEKGTNERHNGLIRRFIPKGKRISDYSLETISFIENWMNTLPRKLLNYKTPEELFE 340
>gi|110802890|ref|YP_697974.1| IS1470, transposase [Clostridium perfringens SM101] >gi|110683391|gb|ABG86761.1| IS1470, transposase [Clostridium perfringens SM101] (350 aa)
Score = 276, Expect = 1.1e-22, Identities = 93/321 (28%), Positives = 163/321 (50%)
  Q:    10 DTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN--------VEGYSAEKAQKKYIERR--NHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKEN-YPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLV----NKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           ++ K +HL+  ER I+  +      +  +IA EL R  +T+L EIRR           +  Y A+  +  Y + R  + + + L +       +  +  N  W         +  + +    + STK +YN++       K  D     +   R +K        +K       RP  I NR+EFGHWE+D V+G++ +    LL +VERKTR + I+++ + +  ++   +  +     +K +   K+IT DNG EF+ +       K KVY+  PY+S+++G+NE  NGLIRR   KG   S  S   I+ ++N +N +PRK+ +Y + ++ ++
  S:     9 ESRKNKHLNMKERMIV-EIRLKDGFSAYKIAKELNRPINTVLNEIRRGTTKQIKQGKELNMYFADTGEAVYKKNRLKSSRKYKLLECSDFIKYVVDKVKNDHWSLDACVGEALHSSRFSPSQIISTKTLYNYVDLGLLPIKNIDLPAKLH---RNKKSTRVRNNKKKLGTSISDRPNSIENREEFGHWEIDCVLGEKSNKDKVLLTLVERKTRYAIISEMPSHSAISVTQTLDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTKTKVYFTHPYSSFEKGTNERHNGLIRRFIPKGKRISDYSLETISFIENWMNTLPRKLLDYKTPEELFE 340
>gi|117676223|ref|YP_863799.1| integrase catalytic subunit [Shewanella sp. ANA-3] >gi|117615047|gb|ABK50500.1| Integrase, catalytic region [Shewanella sp. ANA-3] (273 aa)
Score = 276, Expect = 1.1e-22, Identities = 58/159 (36%), Positives = 96/159 (60%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           RP  + +++ FG WE+D V+GK  +G   ++ ++ERKTR   + KV +K+   +  A   L+     HV TIT DNG EF+     A  ++  VY+  PY+S++RG+NEN NGL+R+  KKGTD + ++D++I    ++IN  P+K  ++      +K+
  S:   112 RPSIVDSKERFGDWEIDTVLGKHGTG--AMVTILERKTRFYLVKKVPSKSADDVTRATIELLMPYKEHVHTITADNGREFAGHETIAKELEADVYFAHPYSSWERGANENANGLLRQYVKKGTDLTTVTDSDIEFALSRINYRPKKCLDFKQPAIVFKE 268
>gi|71904558|ref|YP_281361.1| transposase [Streptococcus pyogenes MGAS6180] >gi|94993391|ref|YP_601490.1| transposase [Streptococcus pyogenes MGAS2096] >gi|71803653|gb|AAX73006.1| transposase [Streptococcus pyogenes MGAS6180] >gi|94546899|gb|ABF36946.1| Transposase [Streptococcus pyogenes MGAS2096] (195 aa)
Score = 276, Expect = 1.2e-22, Identities = 62/169 (36%), Positives = 98/169 (57%)
  Q:   152 RKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMF 320
           RKR K +     +        RP++I +R EFGHWE+DLV+GK+    + +L +VER+TR +   K+E+K   TIN A+  L+++    + +IT DNG EFS   + +      VY+  PY+S++RG++EN NGL+R    KG   + L+  E++N    IN   R++ 
  S:    31 RKRSKKVMKTNKKTLGKSIEERPEYINDRSEFGHWEIDLVLGKKTKSEAVMLTLVERQTRYALGVKLEDKQSQTINRAVTHLISQ--YPIASITADNGSEFS---LLSDLKAVDVYFAHPYSSHERGTSENFNGLLREYVPKGVSLNPLTSEELDNDITAINERLRRLL 194
>gi|22777402|dbj|BAC13675.1| transposase for IS658 (divided with OB1719 and OB1720) [Oceanobacillus iheyensis HTE831] (253 aa)
Score = 275, Expect = 1.5e-22, Identities = 72/209 (34%), Positives = 108/209 (51%)
  Q:   123 STKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK-NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           S K IY WI     +  +   LR    KG KR+K   ++           RPK +  R+ FGHWELD V+  R          VERKTR     K+ N+   ++  AI++L  +  +   +T T+D G EF+           +VY+ EPY+S+QRG+NEN NGL+R  + K TD + +SD E+ N    IN  PRK  N+ ++ + +++
  S:    42 SFKTIYRWIYKGLLVNHQLQVLRH---KG-KRQKPQETRGRFNIGTSITKRPKEVRKRETFGHWELDSVVSSRGKSKGCFATFVERKTRWYVAFKMPNRTSLSMEQAIRTLNERLPSGAFQTATVDRGKEFACYKTIEAETDIEVYFAEPYSSWQRGNNENANGLLREFFPKKTDLAKVSDQELENALTLINNRPRKCLNWKTTHEAFQE 247
>gi|172064607|ref|YP_001812257.1| integrase catalytic region [Burkholderia ambifaria MC40-6] >gi|171998092|gb|ACB69008.1| Integrase catalytic region [Burkholderia ambifaria MC40-6] (385 aa)
Score = 275, Expect = 1.6e-22, Identities = 96/310 (30%), Positives = 150/310 (48%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPC--VLVPSTKQIYN--WIQTNKWIKKRSD-KLRTAYIKGRKRK---KGMFSKF-DEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           R L+  ERE I         +I  IA +L R  STI REI RN     Y A +A ++ ++        L ++ +       E+  C+    E    ++K  Y     +  S + IY   ++Q    +KK     LRT       R    KG  +K  D   +H    RP    +R   GHWE DLV G   +   ++  +VER++R + I KV+ K+  ++ + +K  V +   H+ K++T D G+E +           KVY+C+P + +QRG+NEN N L+R+    GT     S AE+N +  ++N  PRK   +MS
  S:    61 RALTLSEREEISRG-VSAGLSIRAIARQLNRAPSTISREIARNGGTGHYRALEADERALQAALRPKRCLLEQNRRL-RYAVERKLCREWSPEQVSGWLKNRYADDEAMRVSHETIYRSLFVQARGVLKKELQYHLRTQRKMRHSRSSSTKGARNKIADAVSIHE---RPPEAADRAVPGHWEGDLVSGANNT---HVATLVERRSRFTIIVKVKGKDTVSVVAGLKREVKRLPQHLRKSLTWDRGMELANHKDFTIATDVKVYFCDPRSPWQRGTNENTNRLLRQYLPHGTQLDQYSQAELNKIAARLNERPRKTLGFMS 372
>gi|108524625|ref|YP_619847.1| transposase [Plasmid QKH54] >gi|99644196|emb|CAJ43329.1| transposase [Plasmid QKH54] (342 aa)
Score = 274, Expect = 1.9e-22, Identities = 95/309 (30%), Positives = 157/309 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV-EGYSAEKAQKKY-----IERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYI---KENYPCVLVPSTKQIYNWIQTNKWIKKRSDK---LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  LS  ER  I  +  VQ  ++ +IA  + R  STI RE+RRN +V  GYSA  AQ++      + R   K     ++++  + +  E+ + +    +L    I   ++ Y C      + IYN I      + R +    LR +    R R  G+  +     +    +RP  I +R   GHWE DL+ GK  +  S +  +VER +    + K+ +    +      + +N   L + K++T D G E ++           +Y+C+P++ +QRGSNEN+NGLIR+   KGTD S+ S  E+N +  ++N  PRK F++
  S:     3 YTELSVEERATI-QISHVQGFSLRRIACLINRSPSTISRELRRNRDVCGGYSAHAAQQQMQARRQVCRPKRKLLPGGERFELVAHMLRERLSPEQIAGKLRSMNIPSLRDAYVC-----RETIYNAIYALPVGELRKELIICLRQSKTTRRPRSGGVDRRGQIPEMVSIHVRPPEIEDRLMPGHWEGDLIKGKANA--SCVGTLVERTSGYLMLVKMNDATATSAMEGFSAALNGMPLAMRKSMTYDQGREMARHAEITQQTGVAIYFCDPHSPWQRGSNENINGLIRQYLPKGTDLSVHSQEELNAIALQLNMRPRKRFDF 316
>gi|21910524|ref|NP_664792.1| putative transposase carboxy terminal portion [Streptococcus pyogenes MGAS315] >gi|21904724|gb|AAM79595.1| putative transposase carboxy terminal portion [Streptococcus pyogenes MGAS315] (195 aa)
Score = 274, Expect = 2.0e-22, Identities = 62/169 (36%), Positives = 97/169 (57%)
  Q:   152 RKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMF 320
           RKR K +     +        RP++I +  EFGHWE+DLV+GK+    + +L +VER+TR +   K+E+K   TIN A+  L+++    + +IT DNG EFS   + +      VY+  PY+S++RG+NEN NGL+R    KG   + L+  E++N    IN   R++ 
  S:    31 RKRSKKVMKTNKKTLGKSIEERPEYINDHSEFGHWEIDLVLGKKTKSEAVMLTLVERQTRYALGVKLEDKQSQTINRAVTHLISQ--YPIASITADNGSEFS---LLSDLKAVDVYFAHPYSSHERGTNENFNGLLREYVPKGVSLNPLTSEELDNDITAINERLRRLL 194
>gi|1850806|emb|CAA50689.1| putative transposase [Clostridium perfringens] (350 aa)
Score = 274, Expect = 2.1e-22, Identities = 97/321 (30%), Positives = 162/321 (50%)
  Q:    10 DTNKYRHLSYGEREII------GHMYFVQKKNINQ-IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKY------NCKWHGVELTRHYIKEN-YPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKS----LVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           ++ K +HL+  ER I+      G   +   K +N+ I T L   R    ++I++      Y A+  +  Y + R   N    +KYK        KY      N  W         +  + +    + STK +YN++       K  D     +   R +K        +K       RP  I NR+EFGHWE+D V+G++ +    LL +VERKTR + I+++ + +  ++  A+      L +K +   K+IT DNG EF+ +       K KVY+  PY+S+++G+NE  NGLIRR   KG   S  S   I+ ++N +N +PRK+ +Y + ++ ++
  S:     9 ESRKNKHLNMKERMIVEIRLKDGFSAYKNTKELNRPINTVLNEIRRGTTKQIKQGKEFHVYFADTGEAVYKKNRLKSN----RKYKLLECSDFIKYVVDKVKNDHWSLDACVGEALHSSRFSPSQIISTKTLYNYVDLGLLPIKNIDLPAKLH---RNKKSTRVRNNKKKLGTSISDRPNSIENREEFGHWEIDCVLGEKSNKDKVLLTLVERKTRYAIISEMSSHSTISVTKALDKIKEFLGSKFSEVFKSITADNGSEFADLSEFELKTKTKVYFTHPYSSFEKGTNERHNGLIRRFIPKGKRISDYSLETISFIENWMNTLPRKLLDYKTPEELFE 340
>gi|126174858|ref|YP_001051007.1| integrase catalytic subunit [Shewanella baltica OS155] >gi|125998063|gb|ABN62138.1| Integrase, catalytic region [Shewanella baltica OS155] (251 aa)
Score = 274, Expect = 2.1e-22, Identities = 74/200 (37%), Positives = 109/200 (54%)
  Q:   123 STKQIYNWIQTNKWIKKRSDKLRTAYIKGRKR-KKGMFSKFDE-KYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           S + IY +I  +K   +R  KL     +G KR ++G   +    K       RP  + +R+ FG WE+D V+G   +G  +++ ++ERKTR   I KV +K+   +  A   L+     HV TIT DNG EF+     A  +  +VY+  PY S +RG+NEN NGL+R+  KKG D  L+SD  I   QN+IN  P+K   +
  S:    43 SHEWIYRYIARDK---RRGGKLYRHLRQGHKRYRRGKVEQAPTIKNAVSIDDRPAIVDSRERFGDWEIDTVLGLHGTG--SIVTLLERKTRFYLIKKVNSKSAADVTKATIELLMPYKAHVLTITADNGREFAHHQEIAEALDTQVYFAHPYRSCERGANENANGLLRQYVKKGVDLRLVSDELIEFAQNRINYRPKKCLKF 239
>gi|104774534|ref|YP_619514.1| transposase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103423615|emb|CAI98556.1| Transposase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (349 aa)
Score = 274, Expect = 2.1e-22, Identities = 103/325 (31%), Positives = 153/325 (47%)
  Q:     7 TLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRR------NNNVEGYSAEKAQKKYIERRNH---KNFFLWQKYKTFSELFAEKYNCKWH-GVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSD-----KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH----VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           T+N   K +HLS+ ER II  +      ++  IA EL    STI  E++R      +  V+ Y A +    Y   R +   K+ FL +K +    +    +   W   V   R      +    V  TK +Y ++          D     K  T   + RK KK +    +E        RPK I  R EFGHWE DLV+G +      LL + ER +R   I ++ +K   ++  A K L  + + H     KTIT DNG EF+ +          VYY  PY S  +G+ E  NGLIRR   KG   +  S  +I N++   N +PRK+  Y + D+ +++
  S:     7 TMNQHIKGKHLSFEERVII-QLRLKDGYSLRAIARELNCSPSTISYEVKRGTVELYHGKVKRYKATQGHDAYQAHRKNCGRKSDFL-RKTQFMRYVHKHFFKDGWSLDVCSNRATAVGAFSSRDVVCTKTLYKYVDQGLLDIHNYDLPEKLKRNTKLHRIRKNKKKLGRSIEE--------RPKEINKRNEFGHWECDLVLGHKCKDDEVLLALSERMSREFLILRIPDKTSVSVMQAFKELQRQYSEHWNDIFKTITTDNGSEFADLSNLEKASNTLVYYAHPYTSCDKGTVERHNGLIRRFIPKGEAIANYSLQDIINIETWCNSLPRKILAYHTPDEIFER 340
>gi|121594504|ref|YP_986400.1| integrase catalytic subunit [Acidovorax sp. JS42] >gi|120606584|gb|ABM42324.1| Integrase, catalytic region [Acidovorax sp. JS42] (342 aa)
Score = 274, Expect = 2.2e-22, Identities = 91/309 (29%), Positives = 154/309 (49%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN-VEGYSAEKAQKKYIERRN-----HKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYI---KENYPCVLVPSTKQIYNWIQTNKWIKKRSDK---LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  LS  ER  I  +   Q  ++  IA  + R  STI RE+RRN + +  Y+A  AQ++   RR       K     ++++    +  E+ + +    +L    I   ++ Y C      + IYN I      + R +    LR      R R  G+  +     +    +RP  I +R   GHWE DL+ GK  +  S++  +VER +    + K+ +    +      + +N+  L + K++T D G E ++           +Y+C+P++ +QRGSNEN+NGLIR+   KGTD S+ S  E++ +  ++N  PRK F++
  S:     3 YSELSVEERAAI-QLGQAQGFSLRGIARLINRSPSTISRELRRNQDGIGAYAARSAQQQMRIRRQACRPKRKLLPGSERFELVVHMLRERLSPEQIAGKLRSMNISSLRDAYVC-----RETIYNAIYALPVGELRKELIICLRQGKTARRPRSGGVDRRGQIPEMVSIHVRPPEIEDRLMPGHWEGDLIKGKANA--SSVGTLVERTSGYLILVKMNDATATSAMEGFSAALNRMPLAMRKSMTYDQGREMARHAEITQKTGVAIYFCDPHSPWQRGSNENINGLIRQYLPKGTDLSVHSQEELDAIALQLNMRPRKRFDF 316
>gi|28901175|ref|NP_800830.1| IS1655 transposase [Vibrio parahaemolyticus RIMD 2210633] >gi|28809688|dbj|BAC62663.1| putative transposase for IS1655 [Vibrio parahaemolyticus RIMD 2210633] (310 aa)
Score = 274, Expect = 2.2e-22, Identities = 85/291 (29%), Positives = 145/291 (49%)
  Q:    38 QIATELKRHRSTILREIRRNN----NVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKY-NCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDK-LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           +IA +L RH++TI REI RN+    + + YS +  + + + R         ++Y        E      W   ++  +     YP +   S + IY ++  +K +     K LR +  K RKR     S+           RP +  +RKE GHWE+D V+G+       ++ +V+R T  +FI +++++   ++N  +  ++ +++L  KT+T DNG EF           C  Y+  PY S++RG+NEN NGLIR+   K T  S ++    N + +K+N  PRK   Y +  +Y
  S:    14 KIAKQLGRHKATIYREIERNSRYNRHFKRYSYQAWRAQQMARNRLSRSRRNKRYSEIGFRLPEALLRLDWSPDQIVGYLRVRGYPTM---SHELIYQYVWNDKTLGGTLWKHLRQSTKKRRKRYNSKDSRGRLVAKRHITERPANAEHRKEPGHWEIDTVVGRGTK--HCIMTLVDRMTGYTFIGQMDDRTSESLNVRMSKIMTRSDLPFKTMTADNGTEFHGYAQLEKHHNCLFYFVNPYHSWERGTNENTNGLIRQYLPKRTSMSHVTQKLCNEIAHKLNTRPRKRLGYRTPTEY 305
>gi|118049871|ref|ZP_01518422.1| Integrase, catalytic region [Comamonas testosteroni KF-1] >gi|118050946|ref|ZP_01519495.1| Integrase, catalytic region [Comamonas testosteroni KF-1] >gi|118053850|ref|ZP_01522393.1| Integrase, catalytic region [Comamonas testosteroni KF-1] >gi|117999058|gb|EAV13219.1| Integrase, catalytic region [Comamonas testosteroni KF-1] >gi|118001617|gb|EAV15772.1| Integrase, catalytic region [Comamonas testosteroni KF-1] >gi|118003738|gb|EAV17891.1| Integrase, catalytic region [Comamonas testosteroni KF-1] (344 aa)
Score = 272, Expect = 3.6e-22, Identities = 91/308 (29%), Positives = 150/308 (48%)
  Q:    11 TNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRN-HKNFFLWQKYKTFSELFAEKYNCKWH----GVELTRHY-IKENYPCVLVPSTKQIYNWIQTNKWIKKRSD---KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK----NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRK 318
           ++ Y  L   +R  I  +   Q  ++  IA +L R  +TI RE+ RN +  GY +  AQ + ++RR   +           S L       +W      + L R Y +   Y      S + IYN I      + R +    LR A+ K   R KG   +     +    +RP  I +R+  GHWE DL+ G+  +  S +  +VER +R   + K+    P +  + +++  +K          ++T D G E S     +      VY+C+P++ +QRGSNEN+NGL+R+   KGTD S+ S  +++ + ++IN  PRK
  S:     5 SSHYHQLQPEDRVTIASLR-QQNHSVRAIARQLHRSPATISRELERNASSSGYGSAHAQCQSLQRRRCGRPAIKLHPESILSCLVIHLLRLRWSPEQIALTLARLYPLGHEYRV----SHETIYNCIYAMPVGELRKELIATLRHAHNKRLPRSKGKDRRGQIPDMLSIHVRPPEIEDRQFPGHWEGDLIKGEGNA--SAVGTLVERTSRLVMLVKLPEFKPASAINVLQAFTDKLLGIAQPMRLSMTYDQGREMSMHKKLSEQTGIAVYFCDPHSPWQRGSNENMNGLVRQYLPKGTDLSIYSQEQLDAIADEINNRPRK 318
>gi|160897199|ref|YP_001562781.1| integrase catalytic region [Delftia acidovorans SPH-1] >gi|160362783|gb|ABX34396.1| Integrase catalytic region [Delftia acidovorans SPH-1] (386 aa)
Score = 272, Expect = 4.0e-22, Identities = 92/317 (29%), Positives = 157/317 (49%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCV--LVPSTKQIYN--WIQTNKWIKKRS-DKLRTAYIKGRKRKKGMFSKFDEKYVH--PFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI----KSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCM 333
           L+  +RE I     V  ++I+ +A  L R  ST+ RE+ RN     Y A +A +   ER +             +++ A K   +W   E    ++K+ YP    L  S + IY   ++QT   +KK   + LR      R R     +    + V   P   RP  I +R   GHWE DL+ G     +S +  +VER TR   + K+ +K+ +T+ +A+    +SL ++     +++T D G E +           +VY+C+P+  +QRG+NEN NGL+R+   KG D S  S   ++ +  ++N+ PRK   + +  + + +C+
  S:    63 LTLTQREEISRALAV-GESIHCVAARLGRAASTVSRELHRNGGKTCYRAARADEAAWERAHRHKPCKLASNPALAQIVAGKLQHQW-SPEQIAGWLKQTYPGERDLQLSHEAIYRTLFVQTRGALKKELLEHLRRTRGMRRSRHYTQKTSIHGRIVDAVPIAERPACIEDRAVPGHWEGDLLFG---DAHSQIATLVERHTRYVMLIKLVDKDSYTVAAALARHARSLPHE---LYRSLTWDRGSEMAGHKRFTLATDIQVYFCDPHHPWQRGTNENTNGLLRQYLPKGLDLSGYSQEGLDAIARQLNQRPRKTLGFSTPAEMFDECV 382
>gi|104773323|ref|YP_618303.1| transposase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103422404|emb|CAI96941.1| Transposase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (341 aa)
Score = 271, Expect = 4.1e-22, Identities = 103/317 (32%), Positives = 155/317 (48%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-NVEGYSAEKAQKKYIERRNH---KNFFLWQKYKTFSELFAEKYNCKWH-----GVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSD-----KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLV----NKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           K +HL   +R  I  ++     N   IA EL    ST+  E++R   +V  Y A + Q  Y   R+    K+ FL +++K    +    +N  W      G  L +   +++     V STK +YN++       K  D     K  T   + R  K+ +    DE        R   I +RK+FGHWE DLV+G +      LL + ERKTR  F+ K+E+K   ++  A         +K N   K+IT DNG  F+ +       K  VYY  PY S  +GS E  NGLIRR   KG  +S+    +I  ++   N +PRK+ NY + ++Y+
  S:    13 KGKHLKLNDRTTIQELHSEGYSN-RAIARELNCSPSTVGYELKRGTVSVYRYKAVEGQSTYELHRSECGRKSLFL-RRHKFIDYVSHCFHNHGWSLDACVGYALAKGIFQKDQ----VVSTKTLYNYVDLGLMDIKNGDLPEKVKRNTKTRRARVNKRILGRSIDE--------RSPRIESRKDFGHWERDLVLGHKTKDDDVLLTLCERKTRQFFMIKIEDKTSASVMKAFDKFREYYGSKWNQIFKSITTDNGSGFADLSDLEQVSKTLVYYAHPYTSCDKGSVERHNGLIRRYIPKGDQYSV---EDIAKIEVWCNSLPRKILNYKTPEEYF 330
>gi|153803163|ref|ZP_01957749.1| transposase and inactivated derivatives [Vibrio cholerae MZO-3] >gi|124121313|gb|EAY40056.1| transposase and inactivated derivatives [Vibrio cholerae MZO-3] (319 aa)
Score = 271, Expect = 4.1e-22, Identities = 89/316 (28%), Positives = 148/316 (46%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRN-----NNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDK-LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           Y+ L+ GER  I   Y  Q  +   IA    RH+STI REI RN          + A++  +    +         Q+Y        +     W   ++     +   P +   S + IY +I  +K       K LR +  + RKR     S+       P   RPK    RK  GHWE+D V+GK       ++ +VER T  + I +++++   ++N     L+++ +    TIT DNG EF++  +       + Y+  P+ S++RG+NEN NGLIR+   KGT  + L+ A+ N + +K+N  PR    + + ++ +
  S:     3 YKQLTEGERYTIA-AYKKQGLSYTHIAKLTGRHKSTISREIARNRCAYDGAYRAFKADQRTRTRRSKSRRNQRITQQQYNQVVHFIKKD----WSPAQVVGRMKRYKQPTI---SHESIYQFIWRDKANGGTLWKHLRQSTKQRRKRYAAYDSRGRLANKRPISERPKSAETRKTRGHWEIDTVMGK--GSKHCIVTLVERMTGYTLIGQMDDRTTASLNRRTIQLMSRFDGLFTTITADNGTEFNQYELIEAATDTRFYFANPHHSWERGTNENTNGLIRQYLPKGTSMATLTQAKCNAIAHKLNNRPRARLGFKTPEECF 314
>gi|50953969|ref|YP_061257.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50954243|ref|YP_061531.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50954332|ref|YP_061620.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50954373|ref|YP_061661.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50954508|ref|YP_061796.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50954640|ref|YP_061928.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50954691|ref|YP_061979.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50955018|ref|YP_062306.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50955073|ref|YP_062361.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50955118|ref|YP_062406.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50955196|ref|YP_062484.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50955424|ref|YP_062712.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50955584|ref|YP_062872.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50955629|ref|YP_062917.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50955739|ref|YP_063027.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50950451|gb|AAT88152.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50950725|gb|AAT88426.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50950814|gb|AAT88515.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50950855|gb|AAT88556.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50950990|gb|AAT88691.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50951122|gb|AAT88823.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50951173|gb|AAT88874.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50951500|gb|AAT89201.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50951555|gb|AAT89256.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50951600|gb|AAT89301.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50951678|gb|AAT89379.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50951906|gb|AAT89607.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50952066|gb|AAT89767.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50952111|gb|AAT89812.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50952221|gb|AAT89922.1| transposase, ISlxx5 [Leifsonia xyli subsp. xyli str. CTCB07] (403 aa)
Score = 271, Expect = 4.2e-22, Identities = 94/321 (29%), Positives = 160/321 (49%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN--NVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYN--WIQTNKWIKKR-SDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM---RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVE-NKNPFTIN----SAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYK--KGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           R LS  ERE+I  +      ++ ++A +L R  STI REIRRN      GY    A +K   RR         +          K   +W   +++R  I+E +P    +  + + IY   ++Q    +++  +  LRT   K +  + G   +   ++  P  M   RP  I +R   GHWE DL+IG  ++  S +  +VER TR   +  +  ++   ++     SA+K+L  +     ++IT D G E +            VY+C+P + +QRGSNEN NGL+R+ +   KGTD +  +  ++ N+ +++N  PRK   + +  +   K + S
  S:    75 RFLSLQERELIRDLTRA-GLSLCRVAAKLGRSVSTISREIRRNQLPGEGGYHPYVAHRKAASRRPRPKATRLVRNPQLRSYVQRKLTLRWSPEQISRSLIRE-FPGDAEMRVAHETIYQAFYVQGRGQLRRELTMVLRTGRAKRKPHRSGAARR--HRFADPMVMISDRPAEIEDRAVPGHWEGDLIIGGHRN--SAIGTLVERSTRFVMLIHLPIDRTAESVRDGLISAVKTLPRELR---RSITWDQGSEMAAHKSFTIATDIPVYFCDPASPWQRGSNENTNGLLRQYFPKGKGTDLARFTATDLTNVAHELNTRPRKTLGWETPAERLAKLLAS 403
>gi|110801891|ref|YP_697650.1| IS1470, transposase [Clostridium perfringens SM101] >gi|110682392|gb|ABG85762.1| IS1470, transposase [Clostridium perfringens SM101] (350 aa)
Score = 271, Expect = 4.3e-22, Identities = 93/321 (28%), Positives = 162/321 (50%)
  Q:    10 DTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVE--------GYSAEKAQKKYIERR--NHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKEN-YPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLV----NKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           ++ K +HL+  ER I+  +      +  +IA EL R  +T+L EIRR    +         Y A+  +  Y + R  + + + L +       +  +  N  W         +  + +    + STK +YN++       K  D     +   R +K        +K       RP  I NR+EFGHWE+D V+G++ +    LL +VERKTR + I+++ + +  ++   +  +     +K +   K+IT DNG EF+ +       K KVY+  PY+S+++G+NE  NGLIR    KG   S  S   I+ ++N +N +PRK+ NY + ++ ++
  S:     9 ESRKNKHLNMKERMIV-EIRLKDGFSAYKIAKELNRPINTVLNEIRRGTTKQIKQGKEFNVYFADTGEAVYKKNRLKSSRKYKLLECSDFIKYVVDKVKNDHWSLDACVGEALHSSRFSPSQIISTKTLYNYVDLGLLPIKNIDLPAKLH---RNKKSTRVRNNKKKLGTSISDRPNSIENREEFGHWEIDCVLGEKSNKDKVLLTLVERKTRYAIISEMPSHSAISVTKTLDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTKTKVYFTHPYSSFEKGTNERHNGLIRHFIPKGKRISDYSLETISFIENWMNTLPRKLLNYKTPEELFE 340
>gi|56550591|ref|YP_161657.1| IS1086 transposase protein [Ralstonia metallidurans CH34] >gi|94152689|ref|YP_582091.1| integrase catalytic subunit [Ralstonia metallidurans CH34] >gi|94311774|ref|YP_584984.1| integrase catalytic subunit [Ralstonia metallidurans CH34] >gi|94312932|ref|YP_586141.1| integrase catalytic subunit [Ralstonia metallidurans CH34] >gi|110283014|sp|P37248|TRA8_RALME Transposase for insertion sequence element IS1086 >gi|56410297|emb|CAI30179.1| IS1086 transposase protein [Ralstonia metallidurans CH34] >gi|93355626|gb|ABF09715.1| Integrase, catalytic region [Ralstonia metallidurans CH34] >gi|93356784|gb|ABF10872.1| Integrase, catalytic region [Ralstonia metallidurans CH34] >gi|93359055|gb|ABF13141.1| Integrase, catalytic region [Ralstonia metallidurans CH34] (339 aa)
Score = 271, Expect = 4.6e-22, Identities = 97/315 (30%), Positives = 153/315 (48%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIER--------RNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCV--LVPSTKQIYNWIQTNKWIKKRSDK---LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV----KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           KY+ L   ER  I  ++  +  ++  +A  L R  ST++RE+RRN    G Y A  AQ    +R        +   +  LW   + F        + KW   E++   +K  +P    L  S + IYN I      + R      LR A  K   R +G   +     +    +RP  + +R   GHWE DL+ G      S + V+VER +R   + K+ +    T  SA+     K    V    +T+T D G E ++    +     +VY+C+P++ +QRG+ EN NGL+R+   KGTD S+ S  E++ + + +N  PRK  N+ S  Q
  S:     5 KYQQLQPEERMRI-EIWKAEDVSLRAMARRLGRAPSTLMRELRRNATARGGYGAMSAQACRTQRLKASRPVAKLAPDGVLWGVVRHF-------LDQKWSPQEISA-TLKRAFPDQPDLNVSHETIYNAIYAYPRGELRRQLIACLRQARTKRLPRSRGTDRRGQIPDMVSIHVRPPEVNDRLMPGHWEGDLIKGA--GNQSAVGVLVERMSRAVLLVKMPDA---TAASALAGFTGKLQSLVAPLRQTLTYDQGREMARHAELSAATGVRVYFCDPHSPWQRGTCENTNGLLRQYLPKGTDLSVYSQEELDAIADSLNGRPRKTLNWHSPLQ 323
>gi|104774266|ref|YP_619246.1| transposase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103423347|emb|CAI98194.1| Transposase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (344 aa)
Score = 270, Expect = 5.3e-22, Identities = 103/317 (32%), Positives = 154/317 (48%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-NVEGYSAEKAQKKYIERRNH---KNFFLWQKYKTFSELFAEKYNCKWH-----GVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKK-----RSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLV----NKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           K + L   +R  I  ++     N   IA EL    ST+   ++R   +V  Y A + Q  Y   R+    K+ FL +++K    +    +N  W      G  L +   +++     V STK +YN++       K       DK  T   + R  K+ +  + DE        R   I +RK+FGHWE DLV+G +      LL + ERKTR  F+ K+E+K   ++  A   L     +K N   K+IT DNG EF+ +       K  VYY  PY S  +GS E  NGLIRR   KG      S  +I  ++   N +PRK+ NY + ++Y+
  S:    13 KGKRLKLNDRTTIQELHSKGYSN-RAIARELNCSPSTVGYGLKRGTVSVYRYKAVEGQSTYELHRSECGRKSLFL-RRHKFIDYVSHCFHNHGWSLDACVGYALDKGIFQKDQ----VVSTKTLYNYVDLGLMDIKNGDLPEKDKRNTKTRRARVNKRILGRRIDE--------RSPRIESRKDFGHWECDLVLGHKTKDDDVLLTLCERKTRQFFMIKIEDKTSASVMKAFDKLREYYGSKWNQIFKSITTDNGSEFADLSDLEQVSKTLVYYAHPYTSCDKGSVERHNGLIRRYIPKGDRMDKYSVEDIAKIEVWCNSLPRKILNYKTPEEYF 333
>gi|54307203|ref|YP_133733.1| putative transposase [Lactobacillus plantarum WCFS1] >gi|45723569|emb|CAG17850.1| putative transposase [Lactobacillus plantarum WCFS1] (344 aa)
Score = 270, Expect = 5.5e-22, Identities = 65/207 (31%), Positives = 110/207 (53%)
  Q:   123 STKQIYNWIQTNKWIKKRSDKL-----RTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           STK +Y++I       +  D L     R  +    K K+      DE        RPK I  R+EFGH+ELD V+GKR    S +L ++ER++R   +  ++ ++  ++N  +  +  +    +K++T DNG EFS++G     +   +YY  PY S +RG+NE  N +IRR   KG    +L   +I  +++K+N +PR+   Y +  + +
  S:   136 STKTLYHYIDAQLLEVRNLDLLEKTRHRAKHHHSIKHKRLAGRSIDE--------RPKSIDQRQEFGHFELDTVVGKRNGQESVILTLIERQSRCQILRLIDGRDADSVNYELAKICQEYGSIMKSVTADNGAEFSEVGAVLTGV-ADLYYAHPYRSSERGTNEAHNRMIRRDVPKGLSMDILGPHDIQAVESKLNNLPRRQTGYQTPKELF 338
>gi|420944|pir||A47049 probable transposase - Alcaligenes eutrophus >gi|48876|emb|CAA41347.1| ORF 1 [Ralstonia metallidurans CH34] (339 aa)
Score = 270, Expect = 5.6e-22, Identities = 97/315 (30%), Positives = 153/315 (48%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIER--------RNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCV--LVPSTKQIYNWIQTNKWIKKRSDK---LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV----KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           KY+ L   ER  I  ++  +  ++  +A  L R  ST++RE+RRN    G Y A  AQ    +R        +   +  LW   + F        + KW   E++   +K  +P    L  S + IYN I      + R      LR A  K   R +G   +     +    +RP  + +R   GHWE DL+ G      S + V+VER +R   + K+ +    T  SA+     K    V    +T+T D G E ++    +     +VY+C+P++ +QRG+ EN NGL+R+   KGTD S+ S  E++ + + +N  PRK  N+ S  Q
  S:     5 KYQQLQPEERMRI-EIWKAEDVSLRAMARRLGRAPSTLMRELRRNATARGGYGAMSAQACRTQRLKASRPVAKLAPDGVLWGVVRHF-------LDQKWSPQEIS-GTLKRAFPDQPDLNVSHETIYNAIYAYPRGELRRQLIACLRQARTKRLPRSRGTDRRGQIPDMVSIHVRPPEVNDRLMPGHWEGDLIKGA--GNQSAVGVLVERMSRAVLLVKMPDA---TAASALAGFTGKLQSLVAPLRQTLTYDQGREMARHAELSAATGVRVYFCDPHSPWQRGTCENTNGLLRQYLPKGTDLSVYSQEELDAIADSLNGRPRKTLNWHSPLQ 323
>gi|10955405|ref|NP_053117.1| transposase [Escherichia coli] >gi|6009431|dbj|BAA84890.1| Transposase [Escherichia coli] (383 aa)
Score = 270, Expect = 5.8e-22, Identities = 94/316 (29%), Positives = 155/316 (49%)
  Q:    16 HLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWI---------QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI--KSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           HL+  ERE I       K +I  IAT L R  STI RE++RN     Y A  A  +           L  +     +L  EK   KW   +++  +++   P    L  S + IY  +           N    +RS  LR      RK ++G  +  +   +H    R ++I NR+  GHWE DLV G + S   ++  +V+RK+R + I ++  K+  ++N A+  K L   + L  K++T D G+E ++          KVY+C+P +  QRG+NEN NGLIR+ + K    +  +  E++ +  ++N  PRK   + +  +  ++
  S:    58 HLTLSEREEI-RAGLSAKMSIRAIATALNRSPSTISREVQRNRGRRYYKAVDANNRANRMAKRPKPCLLDQNLPLRKLVLEKLEMKWSPEQIS-GWLRRTKPRQKTLRISPETIYKTLYFRSREALHHLNIQHLRRSHSLRHGRRHTRKGERGTTNIVNGTPIHE---RSRNIDNRRSLGHWEGDLVSGTKNS---HIATLVDRKSRYTIILRLRGKDSVSVNQALTDKFLSLPSELR-KSLTWDRGMELARHLEFTVSTGVKVYFCDPQSPCQRGTNENTNGLIRQYFPKKICLAQYTQHELDLVAAQLNNRPRKTLKFKTPKEIIER 377
>gi|116514650|ref|YP_813556.1| IS30 family transposase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116093965|gb|ABJ59118.1| Transposase, IS30 family [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (341 aa)
Score = 269, Expect = 7.3e-22, Identities = 100/324 (30%), Positives = 157/324 (48%)
  Q:     8 LNDTNKYRHLSYGEREII------GHMYFVQKKNIN----QIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRN---HKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSD-----KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH----VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           +N   K +HLS+ ER II      G+      + +N     I+ E+KR    +  +++R    +G+ A +A +K   R++    K  F+   +K F   F + ++     V   R      +    V  TK +YN++          D     K  T   + RK KK +    +E        RPK I  R EFGHWE DLV+G + +    LL + ER +R   I ++ +K   ++  A K L  + + H     KTIT DNG EF+ +          VYY  PY S  +G+ E  NGLIRR   K    +  S  +I N++   N +PRK+  Y + D+ +++
  S:     1 MNQHIKGKHLSFEERVIIQLRLKDGYSLRAIARELNCSPSTISYEVKRGTVELYGKVKRYKATQGHDAYQAHRKNCGRKSDFLRKTQFMRYVHKHF---FKDGWSLD---VCSNRATAVGAFSSRDVVCTKTLYNYVDQGLLDIHNYDLPEKLKRNTKLHRIRKNKKKLGRSIEE--------RPKEINKRNEFGHWECDLVLGHKCTDDEVLLALSERMSREFLILRIPDKTSVSVMQAFKELQRQYSEHWNDIFKTITTDNGSEFADLSNLEKASNTLVYYAHPYTSCDKGTVERHNGLIRRFIPKEEAIANYSLQDIINIETWCNSLPRKILAYHTPDEIFER 332
>gi|110803815|ref|YP_698895.1| IS1470, transposase [Clostridium perfringens SM101] >gi|110684316|gb|ABG87686.1| IS1470, transposase [Clostridium perfringens SM101] (199 aa)
Score = 269, Expect = 7.7e-22, Identities = 60/158 (37%), Positives = 100/158 (63%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLV----NKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           RP  I NR+EFGHWE+D V+G++ +  + LL +VERKTR + I+++ + +  ++   +  +     +K +   K+IT DNG EF+ +       K KVY+  PY+S+++G+NE  NGLIRR   KG   S  S   I+ ++N +N +PRK+ NY + ++ ++
  S:    28 RPNSIENREEFGHWEIDCVLGEKSNKDNVLLTLVERKTRYAIISEMPSHSAISVTKTLDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTKTKVYFTHPYSSFEKGTNERHNGLIRRFIPKGKRISDYSLETISFIENWMNTLPRKLLNYKTPEELFE 189
>gi|15802345|ref|NP_288371.1| IS30 transposase encoded within prophage CP-933T [Escherichia coli O157:H7 EDL933] >gi|168762264|ref|ZP_02787271.1| transposase InsI for insertion sequence element IS30B/C/D [Escherichia coli O157:H7 str. EC4501] >gi|12516008|gb|AAG56925.1|AE005414_2 IS30 transposase encoded within prophage CP-933T [Escherichia coli O157:H7 EDL933] >gi|189367363|gb|EDU85779.1| transposase InsI for insertion sequence element IS30B/C/D [Escherichia coli O157:H7 str. EC4501] (396 aa)
Score = 268, Expect = 9.1e-22, Identities = 95/316 (30%), Positives = 156/316 (49%)
  Q:    16 HLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWI---------QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI--KSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           HL+  ERE I       K +I  IAT L R  STI RE++RN     Y A  A  +           L  +     +L  EK   KW   +++  +++   P    L  S + IY  +           N    +RS  LR      RK ++G  +  +   +H    R ++I NR+  GHWE DLV G + S   ++  +V+RK+R + I ++  K+  ++N A+  K L   + L  K++T D G+E ++          KVY+C+P + +QRG+NEN NGLIR+ + K T  +  +  E + +  ++N  PRK   + +  +  ++
  S:    72 HLTLSEREEI-RAGLSAKMSIRAIATALNRSPSTISREVQRNRGRRYYKAVDANNRANRMAKRPKPCLLDQNLPLRKLVLEKLEMKWSPEQIS-GWLRRTKPRQKTLRISPETIYKTLYFRSREALHHLNIQHLRRSHSLRHGRRHTRKGERGTINIVNGTPIHE---RSRNIDNRRSLGHWEGDLVSGTKNS---HIATLVDRKSRYTIILRLRGKDSVSVNQALTDKFLSLPSELR-KSLTWDRGMELARHLEFTVSTGVKVYFCDPQSPWQRGTNENTNGLIRQYFPKKTCLAQYTQHE-DLVAAQLNNRPRKTLKFKTPKEIIER 390
>gi|16303594|gb|AAL14790.1| transposase-like protein [Pseudomonas fluorescens] (342 aa)
Score = 268, Expect = 9.5e-22, Identities = 90/309 (29%), Positives = 153/309 (49%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN-VEGYSAEKAQKKYIERRN-----HKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYI---KENYPCVLVPSTKQIYNWIQTNKWIKKRSDK---LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  LS  ER  I  +   Q  ++  IA  + R  STI RE+RRN + +  Y+   AQ++   RR       K     ++++    +  E+ + +    +L    I   ++ Y C      + IYN I      + R +    LR      R R  G+  +     +    +RP  I +R   GHWE DL+ GK  +  S++  +VER +    + K+ +    +      + +N+  L + K++T D G E ++           +Y+C+P++ +QRGSNEN+NGLIR+   KGTD S+ S  E++ +  ++N  PRK F++
  S:     3 YSELSVEERAAI-QLGQAQGFSLRGIARLINRSPSTISRELRRNQDGIGAYAGPVAQQQMRIRRQACRPKRKLLPGSERFELVVHMLRERLSPEQIAGKLRSMNIPSLRDAYVC-----RETIYNAIYALPVGELRKELIICLRQGKTARRPRSGGVDRRGQIPEMVSIHVRPPEIEDRLMPGHWEGDLIKGKANA--SSVGTLVERTSGYLILVKMNDATATSAMEGFSAALNRMPLAMRKSMTYDQGREMARHAEITQKTGVAIYFCDPHSPWQRGSNENINGLIRQYLPKGTDLSVHSQEELDAIALQLNMRPRKRFDF 316
>gi|134096370|ref|YP_001101445.1| transposase [Herminiimonas arsenicoxydans] >gi|133740273|emb|CAL63324.1| Transposase IS30 family [Herminiimonas arsenicoxydans] (386 aa)
Score = 268, Expect = 1.2e-21, Identities = 100/319 (31%), Positives = 158/319 (49%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPC--VLVPSTKQIYN--WIQTNKWIKKR-SDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM--RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFT-INSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           L+  ERE I     V   ++  IA  L+R  STI REI+RN  +E Y A +A      R +        + +  +   A K   +W   ++   ++K  +P    L  S + IY   +IQT   +KK  ++ LR   +  R R     +    + +    +  RP  + +R   GHWE DL+ G   SG S++  +VER TR   + K+  K+  T I++ IK          K++T D G E +           +VY+C+P + +QRGSNEN NGL+R+ + KG D S  S A++N +  ++N  PRK  NY +  Q + + + S
  S:    63 LTLAEREEISRS-IVAGDSMRTIAKNLERATSTISREIKRNGGIEAYRAAEADAATWNRAHRPKPCKLLQNRQLASAVATKLRQRWSPQQVA-GWLKYTHPGNEELHVSHETIYKTLFIQTRGALKKELTEHLRRTRVMRRSRHHTQKTDNHGQIIDAVSISERPATVEDRAVPGHWEGDLLFG---SGNSHIATLVERHTRYVMLVKIARKDTQTVIDALIKHAGKLPQELYKSLTWDRGKELADHKRFTLATDIQVYFCDPRSPWQRGSNENTNGLLRQYFPKGMDISGYSQAQLNAVARQLNERPRKTLNYETPAQRFYQSVAS 384
>gi|15610327|ref|NP_217707.1| transposase [Mycobacterium tuberculosis H37Rv] >gi|15842771|ref|NP_337808.1| IS1603 transposase [Mycobacterium tuberculosis CDC1551] >gi|31794365|ref|NP_856858.1| transposase [Mycobacterium bovis AF2122/97] >gi|121639073|ref|YP_979297.1| putative transposase [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148663046|ref|YP_001284569.1| putative transposase [Mycobacterium tuberculosis H37Ra] >gi|2827601|emb|CAA16656.1| PROBABLE TRANSPOSASE [Mycobacterium tuberculosis H37Rv] >gi|13883095|gb|AAK47622.1| IS1603, transposase [Mycobacterium tuberculosis CDC1551] >gi|31619961|emb|CAD95305.1| PROBABLE TRANSPOSASE [Mycobacterium bovis AF2122/97] >gi|121494721|emb|CAL73202.1| Probable transposase [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148507198|gb|ABQ75007.1| putative transposase [Mycobacterium tuberculosis H37Ra] (344 aa)
Score = 266, Expect = 1.8e-21, Identities = 93/321 (28%), Positives = 165/321 (51%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYI----KGRKRKKGMF--SKFDEKYVHPFW---MRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI-KSLVNKNNLHVKTITIDNGIEFSK-IGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           R+LS  ER  I  +      +I +IA +L R  ST+ RE+RRN+  +G Y   +A +  ++RR  ++     K     EL AE    +W   ++ RH ++  YP    +    + IY  +   +    R  ++++ +      GR  ++      +   ++  P      RP    +R E GHWE DL++GK Q   S +  +VER+TR   +  +   + + +  AI +++ +     V++IT D GIE ++ I I A  +   VY+C+  + +QR SNEN NGL+R+ + KGT  S  +   +  ++ +IN  PR++  + S  + +   + S
  S:     7 RYLSEEERINIADLR-RSGLSIRKIADQLGRAPSTVSRELRRNSRRDGQYRPFEAHRWAVQRRVRRHRRRIDKNPDLCELIAELLAQRWSPQQIARH-LRRKYPDDRSMWLCHESIYQAVYQPQSRLIRPPQVKSPHRGPLRTGRTHRRAHLRPGRRRPRFAQPMLSIHQRPFDPADRSEPGHWEGDLIVGKNQG--SAIGTLVERQTRLIRLLHLPTHDAYCLRIAITETMSDLPVTLVRSITWDQGIEMARHIDITAD-LGAPVYFCDSRSPWQRASNENSNGLLRQYFPKGTSLSTYTPDHLRAVEYEINNRPRQVLGHRSPAELFTALLTS 336
>gi|8118238|gb|AAF72952.1|AF236052_3 putative transposase [Pseudomonas aeruginosa] >gi|8118239|gb|AAF72953.1|AF236052_4 putative transposase [Pseudomonas aeruginosa] (338 aa)
Score = 265, Expect = 2.0e-21, Identities = 94/309 (30%), Positives = 148/309 (47%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERR-------------NHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDK---LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  LS  ER  I  +  ++  +   IA  L R  STI REIRRN   +G Y  + AQ+   ERR                +  ++   K FS    E+   K   +E      ++ Y C      + IYN I      + R +    LR      R R  G+  +     +    +RP  I +R   GHWE DL+ GK  +  S +  +VER +    + K+ +    +      + +N+  L   K++T D G E ++           +Y+C+P++ +QRGSNEN+NGLIR+   KGTD S+ S  +++ +  ++N  PRK F +
  S:     3 YHELSLEERSNI-QVGLLRGMSQRAIARMLNRSPSTICREIRRNRGAQGEYITQHAQRATCERRMPCRPQKKLMPGTELLDLVVYLLRKRFS---PEQIAGKLRAMEFPN--FEDAYVC-----RETIYNAIYALPVGELRKELIICLRQGKTSRRPRSGGVDRRGQIPDMVSIHVRPPEIEDRVMPGHWEGDLIKGKANA--SAVGTLVERSSGYLMLVKMLDATATSAVEGFSAALNRMPLAARKSMTYDQGREMARHTEITQKTGVAIYFCDPHSPWQRGSNENINGLIRQYLPKGTDLSVYSQEQLDAIAYELNIRPRKRFGF 316
>gi|1353488|gb|AAB01723.1| putative transposase [Pseudomonas alcaligenes] >gi|42516782|emb|CAF05911.1| transposase [Pseudomonas aeruginosa] (338 aa)
Score = 265, Expect = 2.1e-21, Identities = 95/309 (30%), Positives = 152/309 (49%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNHKNFFLWQKYKTF---SELFAEKYNCKWHGVELTRHYIKENYP---------CVLVPS-------TKQIYNWIQTNKWIKKRSDK---LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  LS  ER  I  +      +  ++A  + R  ST+ REIRRN N +G Y A+ AQ+    RR      + +  K     +ELF           EL  H +++ +           +  PS        + IYN I      + R +    LR      R R  G+  +     +    +RP  I +R   GHWE DL+ GK  +  S +  +VER +    + K+ +    +      + +N+  L V K++T D G E ++           +Y+C+P++ +QRGSNEN+NGLIR+   KGTD S+ S  +++ +  ++N  PRK FN+
  S:     3 YHELSATERVTI-QIGLCNGFSQRRLARLMNRSPSTVSREIRRNRNAQGEYVADDAQRLMHTRR-----VVCRPAKRLVPGNELF-----------ELVAHLLRQRFSPEQIAGKLRTMKSPSFEDAYVCRETIYNAIYALPVGELRKELIICLRQGKTTRRPRSGGVDRRGQIPDMVSIHVRPPEIEDRLMPGHWEGDLIKGKANA--SAVATLVERTSGYLILAKMNDATATSAVEGFSAALNRMPLAVRKSMTYDQGREMARHAEITQKTGVAIYFCDPHSPWQRGSNENINGLIRQYLPKGTDLSVYSQEQLDAIAYELNIRPRKRFNW 316
>gi|13362115|dbj|BAB36070.1| transposase of insertion sequence IS30 [Escherichia coli O157:H7 str. Sakai] (343 aa)
Score = 265, Expect = 2.1e-21, Identities = 95/316 (30%), Positives = 156/316 (49%)
  Q:    16 HLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWI---------QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI--KSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           HL+  ERE I       K +I  IAT L R  STI RE++RN     Y A  A  +           L  +     +L  EK   KW   +++  +++   P    L  S + IY  +           N    +RS  LR      RK ++G  +  +   +H    R ++I NR+  GHWE DLV G + S   ++  +V+RK+R + I ++  K+  ++N A+  K L   + L  K++T D G+E ++          KVY+C+P + +QRG+NEN NGLIR+ + K T  +  +  E + +  ++N  PRK   + +  +  ++
  S:    19 HLTLSEREEI-RAGLSAKMSIRAIATALNRSPSTISREVQRNRGRRYYKAVDANNRANRMAKRPKPCLLDQNLPLRKLVLEKLEMKWSPEQIS-GWLRRTKPRQKTLRISPETIYKTLYFRSREALHHLNIQHLRRSHSLRHGRRHTRKGERGTINIVNGTPIHE---RSRNIDNRRSLGHWEGDLVSGTKNS---HIATLVDRKSRYTIILRLRGKDSVSVNQALTDKFLSLPSELR-KSLTWDRGMELARHLEFTVSTGVKVYFCDPQSPWQRGTNENTNGLIRQYFPKKTCLAQYTQHE-DLVAAQLNNRPRKTLKFKTPKEIIER 337
>gi|90418137|ref|ZP_01226049.1| putative transposase [Aurantimonas sp. SI85-9A1] >gi|90337809|gb|EAS51460.1| putative transposase [Aurantimonas sp. SI85-9A1] (338 aa)
Score = 264, Expect = 3.0e-21, Identities = 87/314 (27%), Positives = 143/314 (45%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKT-ITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           Y HLS  ERE I  +      +   IA  L R RSTI RE+ RN    G YS   A   YIERR        +      +   E+ +  W   ++         P + V +T+ IY ++       +   +      + R+  +   S+   K       RP  + +R++ GHWE DLVI KR      +LV+ ERKTR +  T++  K      +A+ ++  +    +++ +T DN   F++  +         ++C+ YAS+Q+G  EN NG +RR   +  D   LS+A++ +    +N  PRK   +++  Q
  S:    14 YEHLSSAERERIA-ILLAAGHSKAGIAKTLGRSRSTISRELERNALPGGDYSPVVADGAYIERRRRDAVL--ESDGRLRQFVIERLSEGWSPEQVAGWLKNGAEPKLRVLATETIYAFVYRASQKAEELWRYLLRRRRTRRPMRARRSRDTIKNRRSIHDRPAEVEDRRQVGHWEADLVICKRAR---PVLVLHERKTRVTLATRLNGKTAAETIAAMTAVFRRVAPGLRSSVTFDNDTAFARHRLLDDLFGMSTWFCDAYASWQKGGVENANGRLRRWLPRWLDLDTLSEADLQDAIVSLNTTPRKCLGFITPFQ 323
>gi|194541859|ref|YP_002076890.1| hypothetical protein TBCG_03123 [Mycobacterium tuberculosis C] >gi|124599329|gb|EAY58433.1| hypothetical protein TBCG_03123 [Mycobacterium tuberculosis C] (418 aa)
Score = 264, Expect = 3.3e-21, Identities = 93/321 (28%), Positives = 165/321 (51%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYI----KGRKRKKGMF--SKFDEKYVHPFW---MRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI-KSLVNKNNLHVKTITIDNGIEFSK-IGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           R+LS  ER  I  +      +I +IA +L R  ST+ RE+RRN+  +G Y   +A +  ++RR  ++     K     EL AE    +W   ++ RH ++  YP    +    + IY  +   +    R  ++++ +      GR  ++      +   ++  P      RP    +R E GHWE DL++GK Q   S +  +VER+TR   +  +   + + +  AI +++ +     V++IT D GIE ++ I I A  +   VY+C+  + +QR SNEN NGL+R+ + KGT  S  +   +  ++ +IN  PR++  + S  + +   + S
  S:    81 RYLSEEERINIADLR-RSGLSIRKIADQLGRAPSTVSRELRRNSRRDGQYRPFEAHRWAVQRRVRRHRRRIDKNPDLCELIAELLAQRWSPQQIARH-LRRKYPDDRSMWLCHESIYQAVYQPQSRLIRPPQVKSPHRGPLRTGRTHRRAHLRPGRRRPRFAQPMLSIHQRPFDPADRSEPGHWEGDLIVGKNQG--SAIGTLVERQTRLIRLLHLPTHDAYCLRIAITETMSDLPVTLVRSITWDQGIEMARHIDITAD-LGAPVYFCDSRSPWQRASNENSNGLLRQYFPKGTSLSTYTPDHLRAVEYEINNRPRQVLGHRSPAELFTALLTS 410
>gi|1850809|emb|CAA50692.1| putative transposase [Clostridium perfringens] (350 aa)
Score = 263, Expect = 3.8e-21, Identities = 91/321 (28%), Positives = 162/321 (50%)
  Q:    10 DTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIR--------RNNNVEGYSAEKAQKKYIERR--NHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKEN-YPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLV----NKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           ++ K +HL+  +R I+  +      +  +IA EL R  +T+L EIR        +      Y A+  +  Y + R  +++N  L +       +  +  N  W         +  + +    + STK +YN++       K  D     +   R +K        +K       RP  I NR+EFGHWE+D V+G++ +    LL +VERKTR + I+++ + +  ++  A+  +     +K +   K+IT DNG EF+ +       K KVY+  PY+ +++G+NE  NGLI R   KG   S  S   I+ ++N +N +PRK+ +Y + ++ ++
  S:     9 ESRKNKHLNMKDRMIV-EIRLKDGFSAYKIAKELNRPINTVLNEIRPGTTKQIKQGKEFHVYFADTGEAVYNKNRLKSNRNTKLLECSDFIKYVVDKVKNDHWSLDACVGEALHSSRFSPSQIISTKTLYNYVDLGLLPIKNIDLPAKLH---RNKKSTRVRNNKKKLGTSISDRPNSIENREEFGHWEIDCVLGEKSNKDKVLLTLVERKTRYAIISEMSSHSTISVTKALDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTKTKVYFTHPYSPFEKGTNERHNGLIGRFIPKGNRISDYSLETISFIENWMNTLPRKLLDYKTPEELFE 340
>gi|110801483|ref|YP_697687.1| IS1470, transposase [Clostridium perfringens SM101] >gi|110681984|gb|ABG85354.1| IS1470, transposase [Clostridium perfringens SM101] (240 aa)
Score = 263, Expect = 4.3e-21, Identities = 58/158 (36%), Positives = 98/158 (62%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLV----NKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           RP  I NR+EFGHWE+  ++G++ +    LL +VERKTR + I ++ + +  ++  A+  +     +K +   K+IT DNG EF+ +       K K+Y+  PY+S+++G+NE  NGLIRR   KG   S  S   I+ ++N +N +PRK+ NY + ++ ++
  S:    69 RPNSIENREEFGHWEIYCILGEKSNKDKVLLTLVERKTRYAIIFEIPSHSAISVTKALDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTKTKLYFTHPYSSFEKGTNERHNGLIRRFIPKGKRISDYSLETISFIENWMNTLPRKLLNYKTPEELFE 230
>gi|146280652|ref|YP_001170805.1| putative transposase [Pseudomonas stutzeri A1501] >gi|146281957|ref|YP_001172110.1| transposase [Pseudomonas stutzeri A1501] >gi|146283736|ref|YP_001173889.1| transposase [Pseudomonas stutzeri A1501] >gi|145568857|gb|ABP77963.1| putative transposase [Pseudomonas stutzeri A1501] >gi|145570162|gb|ABP79268.1| transposase [Pseudomonas stutzeri A1501] >gi|145571941|gb|ABP81047.1| transposase [Pseudomonas stutzeri A1501] (342 aa)
Score = 262, Expect = 5.1e-21, Identities = 90/309 (29%), Positives = 152/309 (49%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV-EGYSAE-----KAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYI---KENYPCVLVPSTKQIYNWIQTNKWIKKRSDK---LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y  LS  ER  I  +   Q  ++ +IA  + R  STI RE+RRN     GYSA         ++ + R   K     ++++  + +  E+ + +    +L    I   ++ Y C      + IYN I      + R +    LR      R R  G+  +     +    +RP  I +R   GHWE DL+ GK  +  S++  +VER +    + K+ +    +      + +N   L + K++T D G E ++           +Y+C+P++ +QRGSNEN+NGLIR+   KGTD S+ S  E++ +  ++N  PRK F++
  S:     3 YTELSVEERATI-QIGRTQGFSLRRIACLINRSPSTISRELRRNRGACGGYSARLAQQQMQARRQVCRPMRKLLPGSERFELVTHMLRERLSPEQIAGKLRSMNIPNLRDAYVC-----RETIYNAIYALPVGELRKELIICLRQGKTTRRPRSGGVDRRGQIPEMVSIHVRPPEIEDRLMPGHWEGDLIKGKANA--SSVGTLVERTSGYLMLVKMNDATATSALEGFSAALNSMPLEMRKSMTYDQGREMARHAEITQRTGVAIYFCDPHSPWQRGSNENINGLIRQYLPKGTDLSVHSQEELDAIALQLNMRPRKRFDF 316
>gi|88705219|ref|ZP_01102930.1| IS30 family transposase [gamma proteobacterium KT 71] >gi|88700309|gb|EAQ97417.1| IS30 family transposase [Congregibacter litoralis KT71] (386 aa)
Score = 261, Expect = 6.1e-21, Identities = 100/321 (31%), Positives = 146/321 (45%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVE----LTRHYIKENYPCVLVPSTKQIYN--WIQTNKWIKKR-SDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM--RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTI-NSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           + LS GERE I     V    I  IA +L R  STI REI RN   + Y A  A K    R            +   +    K   KW   +    L R Y  + +  V   S + IY   +IQ    +KK   + LR+     R R   +             +  RP  + +R   GHWE DL+ G  ++  + L   VER TR   + K++ K+  T+ N+ IK      +   +++T D G E SK          KVY+C+P + +QRGSNEN N L+R    K TD S+ S +E++ +  ++N  PRK   Y +    +  C+ S
  S:    61 QSLSLGEREEISRG-IVAGLPIRTIAKDLGRAPSTISREINRNGGADAYRATLADKNAWARALRPKVCRLVLNRPLCQQVETKLRIKWSPQQIAGWLKREYPGDEWNQV---SHETIYRSLFIQARGALKKELQEYLRSKRHIRRARTSTLKDDGLGGIAGAISISERPAAVEDRAVPGHWEGDLIEGSNKTCVATL---VERHTRYVMLAKIDKKDSETVVNALIKQSRQLPSELYQSLTWDRGTEMSKHHRFTLETDIKVYFCDPKSPWQRGSNENTNRLLREYLPKYTDLSIYSQSELDWVARQLNERPRKTLEYETPAARFNACVAS 384
>gi|159184777|ref|NP_354494.2| IS30 family transposase [Agrobacterium tumefaciens str. C58] >gi|159140065|gb|AAK87279.2| IS30 family transposase [Agrobacterium tumefaciens str. C58] (333 aa)
Score = 261, Expect = 6.3e-21, Identities = 88/327 (26%), Positives = 152/327 (46%)
  Q:     3 YTTITLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-------NVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTI-NSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           YT ITL D  +  HL               K  +N++A +L RHRSTI REI+RN        + +GY +  A    I R   +     +++         +   +W   ++      + +  + V   + IY +I + +      +      + +   ++ RK + G F        H    RP  I NR +FGHWE DL+I +R  G++N+  +VERK+R + + K  +++   I +  +++         ++ T D G EF+        I    ++C+P A +Q+G+ EN N  IRR     TD +++S  ++  L   IN  PRK   Y +  + +
  S:     5 YTQITLADRRRLHHL------------VAAKVPVNEMARQLGRHRSTIYREIKRNTFHDRELPDYDGYYSTVAHD--ISRDRRRRLIKLRRHPALRAEIINQLEARWSPEQIAGRLQSDGFGRIRV-CKETIYRFIYSKEDYALGLYQYLPEARRKRRPMRSRKPRDGAFPS-----THRISERPDFIGNRSKFGHWEGDLLIFERPLGHANVTTLVERKSRYTVLIKNPSRHSGPIMDKIVRAFSLLPAFARQSFTFDRGTEFAGFRALEEGIGACSWFCDPSAPWQKGTVENTNKRIRRFLPGSTDLAVVSQRDLLRLTRHINDQPRKCLGYRTPAEVF 325
>gi|71907065|ref|YP_284652.1| integrase catalytic subunit [Dechloromonas aromatica RCB] >gi|71909569|ref|YP_287156.1| integrase catalytic subunit [Dechloromonas aromatica RCB] >gi|71846686|gb|AAZ46182.1| Integrase, catalytic region [Dechloromonas aromatica RCB] >gi|71849190|gb|AAZ48686.1| Integrase, catalytic region [Dechloromonas aromatica RCB] (386 aa)
Score = 260, Expect = 8.3e-21, Identities = 94/321 (29%), Positives = 150/321 (46%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYN--WIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVH-------PFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTI-NSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           R L+  ERE I     V   +I  +A +L R  ST+ RE++RN   E Y A +A +    R          +    + + A K    W   E    ++K   P       S + IY   +IQT   +KK       AY++  +  +       +   H           RP    +R   GHWE DL+ G + S    +  +VER++R   + K+  K+  T+ N+ IK+         K++T D G E +           +VY+C+P+  +QRG+NEN NGL+R+ + KG D S  S A+++ +  K+N  PRK  NY +  Q + + + S
  S:    61 RSLTLAEREEISRG-LVAGLSIRVLAAQLGRAPSTVSREVKRNGGRECYRATQADQATWTRALRPKPCKLTENPGLAHIVANKLQSLW-SPEQIAGWLKRTNPDNASNQVSHETIYRTLYIQTRGALKKE----LLAYLRRTRAMRRSRHHTQKTADHGRIVDAVSISERPATADDRAVPGHWEGDLLCGSKNS---QIATLVERQSRYLMLVKLSGKDTGTVTNALIKNARKLPQDLYKSLTWDRGKEMAGHKRFTLATDIQVYFCDPHHPWQRGTNENTNGLLRQYFPKGIDLSPYSQAKLSAIARKLNERPRKTLNYETPAQRFYQTVAS 384
>gi|16262797|ref|NP_435590.1| TRm24 transposase [Sinorhizobium meliloti 1021] >gi|14523430|gb|AAK65002.1| TRm24 transposase [Sinorhizobium meliloti 1021] (333 aa)
Score = 260, Expect = 8.7e-21, Identities = 87/316 (27%), Positives = 152/316 (48%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-------NVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPF----WMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKN--PFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           Y HL+  +R  + H    +K    +IA +L RHRSTI RE++RN           GY +  A    I +   +      ++    EL  E+    W   ++    + +    V V  T+ IY +I + +     + +L     +GR++++   S+       P       RP  I +R +FGHWE DL+I +R  G +N+  +VERK+R + + K  +++  P  I+  I +         ++ T D G EF         +  + ++C+P + +Q+G+ EN N  IRR     TD S +S  ++  L + +N +PRK   Y +  + +
  S:     5 YLHLTLPDRRRV-HQLLERKAPTAEIARQLGRHRSTIYRELKRNTFHDAEFPEYSGYYSGIAND--ISKERRRRLRKLSRHPQLRELVIEQLKALWSPEQIAGRLLADGVSAVRV-CTETIYRFIYSKE---DYALELYQHLPEGRRKRRPRRSRKPRDGSIPLDCRISQRPDFIADRSQFGHWEGDLLIFRRDLGEANVTSLVERKSRYTVMIKNGSRHSRPL-IDKIIDAFSPLPAFARQSFTFDRGTEFRGFKALEDGLGARSWFCDPNSPWQKGAVENTNKRIRRFVPSDTDLSAVSQPQLVALAHHLNSLPRKCLGYRTPAEVF 325
>gi|91215770|ref|ZP_01252740.1| Transposase, IS30 family protein [Psychroflexus torquis ATCC 700755] >gi|91217031|ref|ZP_01253994.1| Transposase, IS30 family protein [Psychroflexus torquis ATCC 700755] >gi|91218069|ref|ZP_01255020.1| Transposase, IS30 family protein [Psychroflexus torquis ATCC 700755] >gi|91218395|ref|ZP_01255338.1| Transposase, IS30 family protein [Psychroflexus torquis ATCC 700755] >gi|91183455|gb|EAS69855.1| Transposase, IS30 family protein [Psychroflexus torquis ATCC 700755] >gi|91183816|gb|EAS70208.1| Transposase, IS30 family protein [Psychroflexus torquis ATCC 700755] >gi|91184902|gb|EAS71282.1| Transposase, IS30 family protein [Psychroflexus torquis ATCC 700755] >gi|91186236|gb|EAS72609.1| Transposase, IS30 family protein [Psychroflexus torquis ATCC 700755] (341 aa)
Score = 260, Expect = 9.4e-21, Identities = 101/307 (32%), Positives = 148/307 (48%)
  Q:    16 HLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG--YSAEKAQKKYIERRNHK--NFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDK-LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           HL+  +R  I  M   +  N   IA  + + +S I RE++RN +     Y  E A KK  ER   K        + KT SE   +        V + +   K   P V   S + +Y  I  +K  K    K LR    + RKR     S+   K       RP  +  R  FG  E+DL+IGK  +    +L + +R +    + KV +K    +  AI  L+     ++KTIT DNG EF+   + A  +    Y+  PY S++RGSNEN+NGLIR+   K TDF+ ++D ++  +Q K+N  PRK FNY
  S:    19 HLTKEQRYTISVMR-KEGYNHRAIAESIDKDKSVISRELKRNKDQRSGEYRYELAVKKCRERHKTKPKQICFTNEIKTASERLLKLDYSPEQVVGILK---KHQEPSV---SVETLYQHIWNDKKHKGTLHKHLRHQGRRYRKRGAAKDSRGIIKDRVSIEKRPSKVELRDRFGDLEVDLIIGKNHN--QAILTINDRSSGMLKMKKVPSKESKGVGLAIIDLLEDWKPYLKTITADNGKEFADHLVVAQELNIDYYFARPYHSWERGSNENLNGLIRQYLPKKTDFTKITDYQVKQIQEKLNLRPRKRFNY 321
>gi|89899986|ref|YP_522457.1| integrase [Rhodoferax ferrireducens T118] >gi|89344723|gb|ABD68926.1| Integrase [Rhodoferax ferrireducens T118] (386 aa)
Score = 259, Expect = 1.2e-20, Identities = 101/321 (31%), Positives = 153/321 (47%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVE----LTRHYIK-ENYPCVLVPSTKQIYN--WIQTNKWIKKRS-DKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM--RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFT-INSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLN 337
           LS  ERE I        ++I  IA  L R  ST+ REI+RN     Y A  A +   +R          + +  + L A K   +W   +    L + Y   ENY      S + IY   +I+    +KK     LR      R R+    +    K  +   +  RP  + +R   GHWE DL+ G   S  + +  +VER+TR   + KV +K+  T IN+ IK+         K++T D G E +            VY+C+P + +QRGSNEN NGL+R+ + KG D S  S A++N +  K+N  PRK  NY +  + + + + S +
  S:    63 LSLAEREEISRA-LAAGRSIRSIACLLGRAPSTVSREIQRNGGQGCYRATLADQAAWDRACRPKTCKLVEKRKLASLVAGKLQLQWSPQQIAGWLKQAYADDENYQV----SHETIYRSLFIRARGALKKELLQHLRRTRAMRRSRQHIQKTDNHGKITNAVSISERPASVQDRAVPGHWEGDLLFG---SLNNQIATLVERQTRYVMLVKVAHKDTQTVINALIKNARKLPQELYKSLTWDRGHEMADHKRFTLATDISVYFCDPQSPWQRGSNENTNGLLRQYFPKGIDISNYSQAQLNAVARKLNERPRKTLNYETPAERFSQLVASTD 386
>gi|18071176|ref|NP_542227.1| putative transposase IS1070 [Lactobacillus casei] >gi|17986220|gb|AAL54830.1| putative transposase IS1070 [Lactobacillus curvatus] (309 aa)
Score = 259, Expect = 1.2e-20, Identities = 65/210 (30%), Positives = 104/210 (49%)
  Q:   123 STKQIYNWIQTNKWIKKRSDKLRTAYIKGRK--RKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKC 332
           ST  IYNW+    W+  +   L    ++  +    +G F+            RP  +  R  FGHWE+D V+  R    S L+  VERKTR  +  K  N+    +N+A    +      VK+IT+D+G EF+         + KVY+C PY+ ++RGSNE  N  +R  + K T+FS ++  EI      IN+ P K+ +  ++ + ++ C
  S:   102 STASIYNWLNRG-WLPFKLTDLPNRNVRQHRVSENRGKFTSGTS-----IEQRPTTVNQRLAFGHWEVDTVLSSRSESRSCLVTFVERKTRLLWAIKAPNRTAKALNTAFGKFMGAFGPQVKSITVDHGKEFANYQALEQDYQIKVYFCHPYSPWERGSNEYFNRRLRWFFPKKTNFSQVTTDEILAALELINQRPLKIHHQQTAIERFRAC 307
>gi|86742886|ref|YP_483286.1| integrase [Frankia sp. CcI3] >gi|86569748|gb|ABD13557.1| Integrase [Frankia sp. CcI3] (326 aa)
Score = 258, Expect = 1.3e-20, Identities = 90/306 (29%), Positives = 149/306 (48%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQ-------KKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKEN---------YPCVLVPSTKQIYNW--IQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSA------IKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           ++  +RE+I      + ++   IA  L RH STI REI RN     Y A  AQ       K+  ER+   +  L   +   +    EK++ K     L + +  +          Y C+ + +  ++     I   K   +R ++ RTA  +GR       S+           RPK   +R   G WE DL++GK     S +  +VER TR   + ++    P+  N+        + +    +   K++T D G E ++           VY+C+P++ +QRGSNEN NGL+R+ + KGTD SL + AE++ L  ++N  PR+   +
  S:     1 MTVEDRELISRE-LSRNRSARFIAKALGRHHSTISREIERNGGESAYRAVDAQARCDAMRKRPKERKLVASAAL---HDAVNAALVEKWSPKQISERLEKDFPDDESMRVSHETIYECLYLQARGELRTQLTIALRKGRARRVNRSRTAVARGRIVDIVNISE-----------RPKEAEDRAVPGFWEGDLILGKGNK--SQIATLVERTTRFVMLVRI----PYDRNAEKVAYLLARKMETLPDFMKKSVTWDQGKEMARHAKFTVATGMPVYFCDPHSPWQRGSNENTNGLLRQYFPKGTDLSLHTQAELDKLAEQLNGRPRQTLGW 309
>gi|75181779|gb|ABA12811.1| transposase-like [Lactobacillus paracasei subsp. paracasei] (340 aa)
Score = 258, Expect = 1.5e-20, Identities = 95/330 (28%), Positives = 159/330 (48%)
  Q:     6 ITLNDTNKYRHLSYGEREIIGHMYFVQKKNINQ--IATELKRHRSTILREIRRNNNVE---------GYSAEKAQKKYIERRNHKN-FFLWQKYKTFSELFAEKYNCKWHGVELTRHY--IKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDF--SLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           +T  D+N  RH      E  G +  +   N +   IA +L  HRSTI RE++R   ++          Y  E AQ K+ +RR   +   L ++   F +L  ++   +++ + +       K  +P    PST  +Y +I   +   K  D  +      +K  +    +  ++       RP+ I  R+    WE DLV G R+     L+ + ER TR   + K+ N    T    ++ ++N +     +IT DNG EFS +    +    K+Y+  PY+ ++RGSNEN NGL+R+ Y KG     SLL    ++     IN  PRK+ +Y ++ Q + + + S
  S:     1 MTQLDSNIPRHYHQLTSEQRGQIEALHDLNWSNAAIARKLHCHRSTIGRELKRGRVLQRNSDYFLYYHYYGETAQAKHEQRRLKCHCHSLLKRGHFFFKLLTKQLGSQFNAMSVDEFIGQFKLKFPDQFCPSTPTVYRYIDQGRLAIKNLDLPQKLSRHLKKHHRSHSRQAVKRLGVSIEKRPQKINQRQRPFDWEGDLVKGVRRKNQPALMTLTERLTRFEIVIKIPNYRAETCRQELQKVINYHPNWFNSITFDNGAEFSTLAKIRH---AKIYFAHPYSPWERGSNENNNGLLRQFYPKGQPIKQSLLY---LHQAVQAINTKPRKLLHYHTAQQCFHQYLAS 340
>gi|81427751|ref|YP_394750.1| IS30 family transposase [Lactobacillus sakei subsp. sakei 23K] >gi|81427826|ref|YP_394825.1| IS30 family transposase [Lactobacillus sakei subsp. sakei 23K] >gi|81428761|ref|YP_395761.1| IS30 family transposase [Lactobacillus sakei subsp. sakei 23K] >gi|116332727|ref|YP_794254.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116332825|ref|YP_794352.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116332894|ref|YP_794421.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116333043|ref|YP_794570.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116334204|ref|YP_795731.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116334224|ref|YP_795751.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116334439|ref|YP_795966.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116334806|ref|YP_796333.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|78609392|emb|CAI54438.1| Transposase of ISLsa1 (IS30 family) [Lactobacillus sakei subsp. sakei 23K] >gi|78609467|emb|CAI54513.1| Transposase of ISLsa1 (IS30 family) [Lactobacillus sakei subsp. sakei 23K] >gi|78610403|emb|CAI55453.1| Transposase of ISLsa1 (IS30 family) [Lactobacillus sakei subsp. sakei 23K] >gi|116098074|gb|ABJ63223.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] >gi|116098172|gb|ABJ63321.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] >gi|116098241|gb|ABJ63390.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] >gi|116098390|gb|ABJ63539.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] >gi|116099551|gb|ABJ64700.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] >gi|116099571|gb|ABJ64720.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] >gi|116099786|gb|ABJ64935.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] >gi|116100153|gb|ABJ65302.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] (306 aa)
Score = 258, Expect = 1.5e-20, Identities = 65/210 (30%), Positives = 104/210 (49%)
  Q:   123 STKQIYNWIQTNKWIKKRSDKLRTAYIKGRK--RKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKC 332
           ST  IYNW+    W+  +   L    ++  +    +G F+            RP  +  R  FGHWE+D V+  R    S L+  VERKTR  +  K  N+    +N+A    +      VK+IT+D+G EF+         + KVY+C PY+ ++RGSNE  N  +R  + K T+FS ++  EI      IN+ P K+ +  ++ + ++ C
  S:    99 STASIYNWLNRG-WLPFKLTDLPNRNVRQHRVSENRGKFTSGTS-----IEQRPTTVNQRLAFGHWEVDTVLSSRSESRSCLVTFVERKTRLLWAIKAPNRTAKALNTAFGKFMGAFGPQVKSITVDHGKEFANYQALEQDYQIKVYFCHPYSPWERGSNEYFNRRLRWFFPKKTNFSQVTTDEILAALELINQRPLKIHHQQTAIERFRAC 304
>gi|91780778|ref|YP_555985.1| putative transposase IS30 [Burkholderia xenovorans LB400] >gi|91693438|gb|ABE36635.1| Putative transposase IS30 [Burkholderia xenovorans LB400] (385 aa)
Score = 258, Expect = 1.6e-20, Identities = 92/310 (29%), Positives = 149/310 (48%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPC--VLVPSTKQIYN--WIQTNKWIKKRSD-KLRTAYIKGRKRKKGMFSKF--------DEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           R L+  ERE I         +I  IA +L R  STI REI RN     Y A +A ++ ++        + ++ +        K   +W   E    ++K  Y     +  S + IY   ++Q    +KK     LRT     RK +   FS          D   +H    RP  + +R   GHWE DLV G   +  +++  +VER++R + I KV+ K+  ++ + +K  V +   H+ K++T D  +E +           KVY+C+P + +QRG+NEN N L+R+    GT     S A++N +  ++N  PRK   + S
  S:    61 RALTLSEREEISRG-VSAGLSIRAIAHQLNRAPSTISREIARNGGTGHYRALEADERALQTALRPKHCILKQNRRLRYAVERKLRREW-SPEQVSGWLKNRYANDEAMRVSHETIYRSLFVQARGVLKKELQYHLRTQ----RKMRHSRFSSTKGARNKIADAVSIHE---RPPEVADRAVPGHWEGDLVSG---ASNTHVATLVERRSRFTIIVKVKGKDTVSVVAGLKREVKRLPQHLRKSLTWDRDMELANHKDFTIATDVKVYFCDPRSPWQRGTNENTNRLLRQYLPHGTQLDHYSQADLNKIAARLNERPRKTLGFRS 372
>gi|116334887|ref|YP_796412.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116100234|gb|ABJ65381.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] (279 aa)
Score = 257, Expect = 1.7e-20, Identities = 65/210 (30%), Positives = 104/210 (49%)
  Q:   123 STKQIYNWIQTNKWIKKRSDKLRTAYIKGRK--RKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKC 332
           ST  IYNW+    W+  +   L    ++  +    +G F+            RP  +  R  FGHWE+D V+  R    S L+  VERKTR  +  K  N+    +N+A    +      VK+IT+D+G EF+         + KVY+C PY+ ++RGSNE  N  +R  + K T+FS ++  EI      IN+ P K+ +  ++ + ++ C
  S:    72 STASIYNWLNRG-WLPFKLTDLPNRNVRQHRVSENRGKFTSGTS-----IEQRPTTVNQRLAFGHWEVDTVLSSRSESRSCLVTFVERKTRLLWAIKAPNRTAKALNTAFGKFMGAFGPQVKSITVDHGKEFANYQALEQDYQIKVYFCHPYSPWERGSNEYFNRRLRWFFPKKTNFSQVTTDEILAALELINQRPLKIHHQQTAIERFRAC 277
>gi|15828863|ref|NP_326223.1| truncated IS1138 transposase [Mycoplasma pulmonis UAB CTIP] >gi|15828871|ref|NP_326231.1| truncated IS1138 transposase [Mycoplasma pulmonis UAB CTIP] >gi|14089806|emb|CAC13565.1| TRANSPOSASE FOR INSERTION SEQUENCE ELEMENT IS1138 (FRAGMENT) (Mycoplasma pulmonis) >gi|14089814|emb|CAC13573.1| TRANSPOSASE FOR INSERTION SEQUENCE ELEMENT IS1138 (FRAGMENT) (Mycoplasma pulmonis) (186 aa)
Score = 257, Expect = 1.7e-20, Identities = 76/177 (42%), Positives = 105/177 (59%)
  Q:     9 NDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIER-RNHKNFFLWQ---KYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKF-DEKYVHPFWMRPKHILNRKEFGH 185
           N   KY HL   +R  I  +   Q  +  QIA  +  H ST+ RE++RN N+ G Y    AQ KY +R + HK+ F +Q   K++ +S LF + Y   + G+E T   IKE +  V +P  K ++NWI+T KWI K ++KLR  Y+KG KRK+   S+     YV PFW R K I NR+EFGH
  S:     6 NVIKKYHHLDEFKRYEIEKL-LAQNYSSRQIAKNIGVHHSTVSRELKRNTNIYGIYERVTAQFKYKKRIKFHKSLFKFQVNFKFEKYSILFKKIYEKDFSGIETTHSKIKERFN-VAIPCLKTVFNWIKTRKWILKPNEKLRRTYVKGGKRKRNAVSRLVPSDYVFPFWARLKDIDNREEFGH 186
>gi|50915124|ref|YP_061096.1| transposase [Streptococcus pyogenes MGAS10394] >gi|50904198|gb|AAT87913.1| Transposase [Streptococcus pyogenes MGAS10394] (354 aa)
Score = 257, Expect = 1.9e-20, Identities = 88/292 (30%), Positives = 141/292 (48%)
  Q:    39 IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           I  E+KR    + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    44 IHNEIKR--GLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|116514720|ref|YP_813626.1| IS30 family transposase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116094035|gb|ABJ59188.1| Transposase, IS30 family [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (285 aa)
Score = 257, Expect = 2.2e-20, Identities = 74/209 (35%), Positives = 105/209 (50%)
  Q:   121 VPSTKQIYNWIQTNKWIKKRSD-----KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLV----NKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           V STK +YN++       K  D     K  T   + R  K+ +    DE        R   + +RK+FGHWE DLV+G +      LL + +RKTR  F+ K+E+K    +      L     +K N   K+IT DNG EF+ +       K  VYY  PY S  +GS E  NGLIRR   KG      S  +I  ++   N +PRK+ NY + ++Y+
  S:    65 VVSTKTLYNYVDLGLMDIKNGDLPEKVKRNTKTRRARVNKRILGRSIDE--------RSPRVESRKDFGHWECDLVLGHKTKDDDVLLTLCKRKTRQFFMIKIEDKTSAIVMKEFDKLREYYGSKWNQIFKSITTDNGSEFADLSDLEQVSKTLVYYAHPYTSCDKGSVERHNGLIRRYIPKGDRMDKYSVEDIAKIEVWCNSLPRKILNYKTPEEYF 274
>gi|3452384|gb|AAC61485.1| putative transposase [Streptococcus pyogenes] (338 aa)
Score = 256, Expect = 2.5e-20, Identities = 84/278 (30%), Positives = 135/278 (48%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S
  S:    50 RGLVRQQVRKGKFEAAYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKS 309
>gi|139473046|ref|YP_001127761.1| insertion sequence IS1239 putative transposase [Streptococcus pyogenes str. Manfredo] >gi|134271292|emb|CAM29508.1| insertion sequence IS1239 putative transposase [Streptococcus pyogenes str. Manfredo] (332 aa)
Score = 256, Expect = 2.5e-20, Identities = 88/292 (30%), Positives = 141/292 (48%)
  Q:    39 IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           I  E+KR    + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KG   +  +  E+  +++ IN  P+++FNY SS +  K
  S:    44 IHNEIKR--GLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSPGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNEALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGNKTT--TPKEVAAIEHWINHYPKRLFNYKSSVEMLK 315
>gi|16262981|ref|NP_435774.1| TRm24 transposase [Sinorhizobium meliloti 1021] >gi|16263572|ref|NP_436365.1| TRm24 transposase [Sinorhizobium meliloti 1021] >gi|14523632|gb|AAK65186.1| TRm24 transposase [Sinorhizobium meliloti 1021] >gi|14524276|gb|AAK65777.1| TRm24 transposase [Sinorhizobium meliloti 1021] (333 aa)
Score = 256, Expect = 2.5e-20, Identities = 87/316 (27%), Positives = 152/316 (48%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-------NVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPF----WMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKN--PFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           Y  L+  +R  + H    +K  I +IA +L RHRSTI RE++RN           GY +  A    I +   +      ++    EL  E+    W   ++    + +    V V  T+ IY +I + +     + +L     +GR++++   S+       P       RP  I +R +FGHWE DL+I +R  G +N+  +VERK+R + + K  +++  P  I+  I +         ++ T D G EF         +  + ++C+P + +Q+G+ EN N  IRR     TD S +S  ++  L + +N +PRK   Y +  + +
  S:     5 YLQLTLPDRRRV-HQLLERKVPIAEIARQLGRHRSTIYRELKRNTFHDAEFPEYSGYYSGIAND--ISKERRRRLRKLSRHPQLRELVIEQLKALWSPEQIAGRLLADGVSAVRV-CTETIYRFIYSKE---DYALELYQHLPEGRRKRRPRRSRKPRDGSIPLDCRISQRPDFIADRSQFGHWEGDLLIFRRDLGEANVTSLVERKSRYTVMIKNGSRHSRPL-IDKIIDAFSPLPAFARQSFTFDRGTEFRGFKALEDGLGARSWFCDPNSPWQKGAVENTNKRIRRFVPSDTDLSAVSQPQLVALAHHLNSLPRKCLGYRTPAEVF 325
>gi|50914873|ref|YP_060845.1| transposase [Streptococcus pyogenes MGAS10394] >gi|50903947|gb|AAT87662.1| Transposase [Streptococcus pyogenes MGAS10394] (350 aa)
Score = 255, Expect = 3.0e-20, Identities = 88/292 (30%), Positives = 141/292 (48%)
  Q:    39 IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           I  E+KR    + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    44 IHNEIKR--GLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|32470688|ref|NP_863681.1| transposase [Rhodopirellula baltica SH 1] >gi|32442833|emb|CAD71352.1| transposase [Rhodopirellula baltica SH 1] (249 aa)
Score = 255, Expect = 3.1e-20, Identities = 66/181 (36%), Positives = 98/181 (54%)
  Q:   144 LRTAYIKGRKRKKGMFSK--FDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK-NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           +R +  + RK+K G   K   D   +H    RPK   NRK  G WELDLV+ K+ +GY  L+  V+RKT  + + + + K    +   I+S+  K    ++KT+T DNG EF        W K  V++ +PY S QR +NEN NGL+R+ Y KG D+  +S  ++      +N  PRK   Y +
  S:    65 MRRSGRRNRKQKPGFIRKQATDRVSIHD---RPKVASNRKRVGDWELDLVVCKKSTGY--LVTAVDRKTGYTLVGRCQKKLSRLVMDTIRSMFKKVPKEYIKTMTFDNGTEFFYHPFLFTWFKVMVFFADPYCSGQRRTNENTNGLLRQYYPKGVDYGSISWQQVRKAAMLLNLRPRKRHGYQT 243
>gi|16126005|ref|NP_420569.1| IS30 family, transposase [Caulobacter crescentus CB15] >gi|13423185|gb|AAK23737.1| IS30 family, transposase [Caulobacter crescentus CB15] (342 aa)
Score = 255, Expect = 3.2e-20, Identities = 83/315 (26%), Positives = 149/315 (47%)
  Q:    12 NKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRN-----NNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWI-----QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHP---FWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSD 326
           ++Y H++  ER  I   +   K ++  I+  L RH STI REIRRN       + GY A  A ++   RR         +    +    E+    W   ++  H +K           + IY ++     +  +  K      R    +  +R +G+       ++ P      RP HI  R+ +GHWE DL+  +++ G  N+  +VER++R   + K  +++   I + +   +      ++ +IT D G EF+        ++   Y+C+P A +Q+G+ EN NG +RR     TD +L+   ++  L  ++NR+PRK   Y + +
  S:     3 SRYDHITLQERHQIAR-WRDAKVSVRVISERLGRHPSTIHREIRRNWFDDGPWLRGYFAVAANERASTRRRRVGKL--HRDPELARFVTERLQETWSPEQIAGH-LKSTRQLQAYACHETIYRYVYGPDGRAAELYKLLPRMRRRRRARYARRPRGL-------HIPPHNTIAQRPAHIGERQSYGHWECDLIAFRKEYGRHNITTLVERRSRYLIMIKNPSRSSTGIMAGLAERLEPFPPPMRQSITFDRGTEFAFFATLKRSLEIDSYFCKPQAPWQKGTVENTNGRLRRFLPSDTDIALVPPEKLLELSTRLNRIPRKCLGYRTPE 320
>gi|50913749|ref|YP_059721.1| transposase [Streptococcus pyogenes MGAS10394] >gi|50902823|gb|AAT86538.1| Transposase [Streptococcus pyogenes MGAS10394] (332 aa)
Score = 255, Expect = 3.2e-20, Identities = 88/292 (30%), Positives = 141/292 (48%)
  Q:    39 IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           I  E+KR    + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    44 IHNEIKR--GLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|134097114|ref|YP_001102775.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] >gi|133909737|emb|CAL99849.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] (469 aa)
Score = 255, Expect = 3.3e-20, Identities = 87/310 (28%), Positives = 151/310 (48%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPC--VLVPSTKQIYN--WIQTNKWIKKRSDKLRTAYIKGRKRKKGMFS--KFDEKYVHPFWM---RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           R L+  ERE I  +   +  ++  I + L R  STILREIR N+   GY    A +    RR               +  A+    +W   ++  H + + +P    +  S + IY   + Q    +K+   +++ A   GR R+K   +  +   +++ P  M   RP    +R   GHWE DL+IG      S +  +VER TR + +  + N  +  T+   + + +     H++ ++T D G E ++           VY+C+P + +QRG+NEN NGL+R+ + KGTD S+    ++ ++  ++N  PRK   + S
  S:   143 RLLTLAERERIRDLR-AEGHSLRDIGSALGRSASTILREIRANSTHGGYQPYAAHRASAARRPRPKQRKLIAQGPLRQFVADGLRERWSPEQIC-HALGKEHPGDQRMRVSVETIYQALYFQARGGLKR---EVQAAIRTGRTRRKPRRNPNQRTARFIDPMVMISDRPAEAADRAVPGHWEGDLIIGA--GNQSAIGTLVERTTRYTMLVHLPNGHDAETVRDGLVATITTLPNHLRGSLTWDQGAEMARHKQFTMATDMPVYFCDPASPWQRGTNENTNGLLRQYFPKGTDLSVYGPEDLEHVAQQLNGRPRKTLGWDS 456
>gi|50913996|ref|YP_059968.1| transposase [Streptococcus pyogenes MGAS10394] >gi|50903070|gb|AAT86785.1| Transposase [Streptococcus pyogenes MGAS10394] (327 aa)
Score = 255, Expect = 3.4e-20, Identities = 88/292 (30%), Positives = 141/292 (48%)
  Q:    39 IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           I  E+KR    + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    44 IHNEIKR--GLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|50913360|ref|YP_059332.1| transposase [Streptococcus pyogenes MGAS10394] >gi|50902434|gb|AAT86149.1| Transposase [Streptococcus pyogenes MGAS10394] (335 aa)
Score = 255, Expect = 3.4e-20, Identities = 88/292 (30%), Positives = 141/292 (48%)
  Q:    39 IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           I  E+KR    + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    44 IHNEIKR--GLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|84687668|ref|ZP_01015542.1| TRm24 transposase [Rhodobacterales bacterium HTCC2654] >gi|84664345|gb|EAQ10835.1| TRm24 transposase [Rhodobacterales bacterium HTCC2654] (336 aa)
Score = 255, Expect = 3.7e-20, Identities = 89/317 (28%), Positives = 152/317 (47%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-------NVEGYSAEKAQKKYIERRN-HKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQT----NKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSA-IKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           Y HL   ER  +   +   K  I++IA  L R  STI R+I+RN         + GY A  AQ  Y +RR  H+   +  + K   E   ++    W   ++      E +P  +  S + IY +  +    ++   +   + R        R+      FD   V     RP  I  R EFGHWE DL++ +++ G  N+  +VER +R + + + E++    I  A IK L        +++T D G EFS        I    ++C+P A YQ+G+ EN N  +R+   + T+ + L++  + ++ +++N  PRK  +Y +  + +K
  S:     5 YSHLKLDERRKLAK-WLEAKMPISEIADRLGRDPSTIYRDIKRNQYTDTELPELNGYYALNAQDMYEKRRAIHRKMVVHPELKATIE---DRLKAGWSPEQIAGRMRLERHPIRV--SHETIYRFAYSKDGRDEQFYRHLPEHRRRRRPRGYRRHNRSHIFD---VQSLSRRPDRISERTEFGHWECDLMMFRKEHGKVNVTSLVERVSRYAVVMRNEDRQSKPIMEALIKGLAPLPADARQSVTFDRGTEFSAWKHLKAGIGADAWFCDPQAPYQKGTVENTNNRLRKYLPRSTEPTALTNRYLRSICHRLNSTPRKCLDYRTPAEVFK 325
>gi|50914158|ref|YP_060130.1| transposase [Streptococcus pyogenes MGAS10394] >gi|50903232|gb|AAT86947.1| Transposase [Streptococcus pyogenes MGAS10394] (328 aa)
Score = 254, Expect = 3.8e-20, Identities = 88/292 (30%), Positives = 141/292 (48%)
  Q:    39 IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           I  E+KR    + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    44 IHNEIKR--GLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|50913493|ref|YP_059465.1| transposase [Streptococcus pyogenes MGAS10394] >gi|50902567|gb|AAT86282.1| Transposase [Streptococcus pyogenes MGAS10394] (333 aa)
Score = 254, Expect = 4.0e-20, Identities = 85/284 (29%), Positives = 137/284 (48%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    50 RGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|50915214|ref|YP_061186.1| transposase [Streptococcus pyogenes MGAS10394] >gi|50904288|gb|AAT88003.1| Transposase [Streptococcus pyogenes MGAS10394] (326 aa)
Score = 254, Expect = 4.2e-20, Identities = 85/284 (29%), Positives = 137/284 (48%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    50 RGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|19745530|ref|NP_606666.1| putative transposase [Streptococcus pyogenes MGAS8232] >gi|19747649|gb|AAL97165.1| putative transposase [Streptococcus pyogenes MGAS8232] (341 aa)
Score = 254, Expect = 4.6e-20, Identities = 87/292 (29%), Positives = 140/292 (47%)
  Q:    39 IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           I  E+KR    + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      L  + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    44 IHNEIKR--GLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LFTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|50914424|ref|YP_060396.1| transposase [Streptococcus pyogenes MGAS10394] >gi|50903498|gb|AAT87213.1| Transposase [Streptococcus pyogenes MGAS10394] (340 aa)
Score = 253, Expect = 5.5e-20, Identities = 85/284 (29%), Positives = 137/284 (48%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    50 RGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|60681629|ref|YP_211773.1| putative IS element [Bacteroides fragilis NCTC 9343] >gi|60493063|emb|CAH07844.1| putative IS element [Bacteroides fragilis NCTC 9343] (315 aa)
Score = 253, Expect = 5.9e-20, Identities = 93/309 (30%), Positives = 163/309 (52%)
  Q:    14 YRHLSYGEREIIGHMYFVQKK-NINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRN----HKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRS-DKLRTAYIKGRKRKKGMFSKF-DEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVE-NKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           Y+ L+  +R  I     +QKK   ++IA  +    STI RE+ RN++  G Y  +KAQ++  +RR+    +++   + +      L  E+++ +     L R+ ++         S + IY  I+ +K+I++ S  K     +K R+R  G  +   D   +H    RP    + K FG +E+D ++G    G   +L +VER T   F+ K++  K+   +  A   L++    ++KT+T DNG EF      A  +   VY+ +PY+S+Q+G+ EN NGLIR+   K +    ++D +I+ + NKIN  PRK  ++
  S:     2 YKQLTSEQRYTIS--VLLQKKCRKSEIAKAIGVSNSTITRELERNSSSRGVYKWDKAQRQADKRRHKAPGNRSVKPYVRTMAIDLLKHEQWSPEQISGYLARNGVR--------ISHETIYAIIRKDKYIERGSLYKYCRHQLKHRRRPVGKHTMIPDRASIH---QRPPEA-DGKRFGDFEMDTIVGGNNQG--AILTIVERSTNMLFMKKLKFGKDAEELAKAAIQLLSPYKGNIKTVTTDNGCEFYAHKAIAKGLDSTVYFADPYSSWQKGAIENANGLIRQYIPKSSPIKKINDTDIDAIMNKINNRPRKKLDF 303
>gi|19746041|ref|NP_607177.1| putative transposase [Streptococcus pyogenes MGAS8232] >gi|19748209|gb|AAL97676.1| putative transposase [Streptococcus pyogenes MGAS8232] (352 aa)
Score = 253, Expect = 6.0e-20, Identities = 87/292 (29%), Positives = 140/292 (47%)
  Q:    39 IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           I  E+KR    + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      L  + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    44 IHNEIKR--GLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LFTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|68535077|ref|YP_249782.1| transposase for IS1513a [Corynebacterium jeikeium K411] >gi|68535693|ref|YP_250398.1| transposase for IS1513c [Corynebacterium jeikeium K411] >gi|68262676|emb|CAI36164.1| transposase for IS1513a [Corynebacterium jeikeium K411] >gi|68263292|emb|CAI36780.1| transposase for IS1513c [Corynebacterium jeikeium K411] (374 aa)
Score = 253, Expect = 6.2e-20, Identities = 54/137 (39%), Positives = 86/137 (62%)
  Q:   184 GHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENK-NPFTINSAIKSLVNK-NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLI-RRVYKKGTDFSLLSDAEINNLQNKINRMPRKMF 320
           GHWE DLVIGK   G S L+ +VER +R + +  + ++ +  T+ + ++ +V   N   +KTIT D G E +          C+V++CEP++ +QR +NEN NG I RR YKKGTDF+ ++   +  +QN++N  PR++ 
  S:   217 GHWEGDLVIGK--GGKSALITLVERTSRYTLLGHLPDEHSSHTVVATLQDMVKDLNTEQLKTITWDQGAEMAVTAQVQIKDGCQVFFCEPHSPWQRPTNENTNGEIRRRFYKKGTDFATVTPEHVAWVQNELNETPRQIL 354
>gi|89902950|ref|YP_525421.1| integrase [Rhodoferax ferrireducens T118] >gi|89347687|gb|ABD71890.1| Integrase [Rhodoferax ferrireducens T118] (386 aa)
Score = 252, Expect = 6.5e-20, Identities = 105/319 (32%), Positives = 154/319 (48%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERR-NHKNFFLWQKYKTFSELFAEKYNCKWHGVE----LTRHYIK-ENYPCVLVPSTKQIYN--WIQTNKWIKKRS-DKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM--RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFT-INSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           LS  ERE I     V  ++I  IA  L R  ST+ REI+RN     + A  A +   +R    K   L +K K  + L A K   +W   +    L + Y   ENY      S + IY   +IQ    +KK     LR      R R     +    K  +   +  RP  + +R   GHWE DL+ G   S  + +  +VER+TR   + KV +K+  T IN+ I+          K++T D G E +            VY+C+P + +QRGSNEN NGL+R+ + KG D S  S A++N +  K+N  PRK  NY +  + + + + S
  S:    63 LSLAEREEISRALAV-GRSIRSIACLLGRAPSTVSREIQRNGGQGCHRATLADQAAWDRACRPKTCKLVEKLK-LASLVAGKLQLQWSPQQIAGWLKQAYADDENYQV----SHETIYRSLFIQARGALKKELLQHLRRTRTMRRSRHHTQKTDNHGKITNAVSISERPASVEDRAIPGHWEGDLLFG---SLNNQIATLVERQTRYVMLVKVAHKDTQTVINALIQKARKLPQELYKSLTWDRGHEMADHKRFTLATDISVYFCDPQSPWQRGSNENTNGLLRQYFPKGIDISNYSQAQLNAVARKLNERPRKTLNYETPAERFSQLVAS 384
>gi|134099122|ref|YP_001104783.1| IS30 transposase [Saccharopolyspora erythraea NRRL 2338] >gi|133911745|emb|CAM01858.1| IS30 transposase [Saccharopolyspora erythraea NRRL 2338] (382 aa)
Score = 252, Expect = 7.2e-20, Identities = 75/284 (26%), Positives = 133/284 (46%)
  Q:    39 IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCV-LVPSTKQIYNWIQTNKWI---KKRSDKLRTAYIKGRKRKKGMFSKFDEKYV--HPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNP-FTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           IA  L+R  STI RE+ +N     Y A  AQ++  E+       L  +     +        +W   ++  H  +          S + IY  I T +W    ++   +LRT     + ++  +  ++  + +   P   RP    +R   GH+E DLVIG   + +S +  +V+RKTR   I K+ +++    +   IK+    +     T+T D G+E ++           V++  P + +QRG+NEN N L+R+   KGT+ +  + AE++ +  K+N  PRK   +
  S:    84 IAAFLQRAVSTISREVTKNGGRHAYRATAAQERAREQARRPKPCLLARQPALRDEIVALLGEEWSPEQIVGHLRRHGGDAAERTISHETIYRSIYTTRWKVIPRELCKRLRTGRPIRKNKRNTVKGQWRSQIIDARPIEQRPDTAQDRSTLGHFEGDLVIG---ANHSQVATLVDRKTRYLVIVKLPSRHSTVVVPELIKTYAGLDPRLRDTLTWDRGMELAEHKRFTAATGVDVFFAAPRSPWQRGTNENTNKLVRQYLPKGTNLATFTQAELDAIATKLNTRPRKCLGF 371
>gi|104774597|ref|YP_619577.1| transposase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103423678|emb|CAI98645.1| Transposase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (340 aa)
Score = 252, Expect = 7.3e-20, Identities = 94/291 (32%), Positives = 142/291 (48%)
  Q:    39 IATELKRHRSTILREIRRNN------NVEGYSAEKAQKKYIERRNH---KNFFLWQKYKTFSELFAEKYNCKWH-----GVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSD-----KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLV----NKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           IA EL    ST+  E++R        NV+ Y A + Q  Y   R+    K+ FL +++K    +    +N  W      G  L +   +++     V STK +YN++       K  D     K  T   + R  K+ +    DE+               ++ GHWE DLV+G +      LL + ERKTR  F+ K+E+K   ++  A   L     +K N   K+IT DNG EF+ +       K  VYY  PY S  +GS E  NGLIRR   +G      S  +I  ++   N +PRK+ NY + ++Y+
  S:    35 IARELNCSPSTVGYELKRGTVSVYTGNVKRYKAVEGQSTYELHRSECGRKSLFL-RRHKFIDYVSHCFHNHGWSLDACVGYALAKGIFQKDQ----VVSTKTLYNYVDLGLMDIKNGDLPEKVKRNTKTRRARVNKRILGRSIDER--------------SRKLGHWECDLVLGHKTKDDDMLLTLWERKTRQFFMIKIEDKTSASVMKAFDKLREYYGSKWNQIFKSITTDNGSEFADLSDLEQVSKTLVYYAHPYTSCDKGSVERHNGLIRRYIPEGDRMDKYSVEDIAKIEVWCNSLPRKILNYKTPEEYF 329
>gi|68535083|ref|YP_249788.1| transposase for IS1513b [Corynebacterium jeikeium K411] >gi|68535699|ref|YP_250404.1| transposase for IS1513d [Corynebacterium jeikeium K411] >gi|68536440|ref|YP_251145.1| transposase for IS1513e [Corynebacterium jeikeium K411] >gi|68262682|emb|CAI36170.1| transposase for IS1513b [Corynebacterium jeikeium K411] >gi|68263298|emb|CAI36786.1| transposase for IS1513d [Corynebacterium jeikeium K411] >gi|68264039|emb|CAI37527.1| transposase for IS1513e [Corynebacterium jeikeium K411] (374 aa)
Score = 252, Expect = 7.4e-20, Identities = 54/137 (39%), Positives = 86/137 (62%)
  Q:   184 GHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENK-NPFTINSAIKSLVNK-NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLI-RRVYKKGTDFSLLSDAEINNLQNKINRMPRKMF 320
           GHWE DLVIGK   G S L+ +VER +R + +  + ++ +  T+ + ++ +V   N   +KTIT D G E +          C+V++CEP++ +QR +NEN NG I RR YKKGTDF+ ++   +  +QN++N  PR++ 
  S:   217 GHWEGDLVIGK--GGKSALITLVERTSRYTLLGHLPDEHSSHTVVATLQDMVKDLNTEQLKTITWDQGAEMAVTAQVQIKDGCQVFFCEPHSPWQRPTNENTNGEIRRRFYKKGTDFATVTPEHVAWVQNELNETPRQIL 354
>gi|32479385|ref|NP_862238.1| Tnp1513 [Corynebacterium striatum] >gi|2555142|gb|AAC63089.1| Tnp1513 [Corynebacterium striatum] (406 aa)
Score = 252, Expect = 7.7e-20, Identities = 54/137 (39%), Positives = 86/137 (62%)
  Q:   184 GHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENK-NPFTINSAIKSLVNK-NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLI-RRVYKKGTDFSLLSDAEINNLQNKINRMPRKMF 320
           GHWE DLVIGK   G S L+ +VER +R + +  + ++ +  T+ + ++ +V   N   +KTIT D G E +          C+V++CEP++ +QR +NEN NG I RR YKKGTDF+ ++   +  +QN++N  PR++ 
  S:   249 GHWEGDLVIGK--GGKSALITLVERTSRYTLLGHLPDEHSSHTVVATLQDMVKDLNTEQLKTITWDQGAEMAVTAQVQIKDGCQVFFCEPHSPWQRPTNENTNGEIRRRFYKKGTDFATVTPEHVAWVQNELNETPRQIL 386
>gi|517210|gb|AAA59388.1| putative transposase [Streptococcus pyogenes] (326 aa)
Score = 252, Expect = 8.3e-20, Identities = 86/284 (30%), Positives = 139/284 (48%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENY-PCVLVPS------TKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY P ++V +         IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    50 RGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMMVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|84502082|ref|ZP_01000240.1| TRm24 putative transposase [Oceanicola batsensis HTCC2597] >gi|84390077|gb|EAQ02711.1| TRm24 putative transposase [Oceanicola batsensis HTCC2597] (330 aa)
Score = 251, Expect = 8.4e-20, Identities = 88/323 (27%), Positives = 162/323 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-------NVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELT-RHYIKENYPCVLVPSTKQIYNWI-----QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK-NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           +  L   ER +I  M    K  +++IA EL RHRS++ REI+RN         + GY    AQK   +RR  +   +  ++    +    +    W   ++  R   +   P V   S + IY ++     QT +  +    + +    +  +R +G+    D + +H    RP H+  R+ FG WE DL+I +R  G +N+  +VERKTR + + +  +++   + + + +++        ++IT D GIEF         I  +V++C+P A +Q+GS EN+N   RR   + T  + LS+  +  + +++N  PRK   + +  + +++ M  L
  S:     3 HTELDLRERRVIEDM-LNAKMPVSKIAVELGRHRSSVYREIKRNRFADDELPYLNGYYGMVAQKAARDRRARRRKLI--RFPELRKAVIAQMKEGWSPEQIAGRLQFEGRRPRV---SHETIYTYVFGPDGQTAELARHLPSRRKKRQPRYARRPRGLVFPPD-RSIH---QRPDHVKTRETFGEWEGDLMIFERAQGNANIASLVERKTRFAVLFRNNDRSTTHLMNRLMTVMEPLPQPARRSITFDRGIEFRNWRKLEPGIGTEVWFCDPQAPWQKGSVENLNKRARRYLPRDTPVAALSNRNMRAICDRLNGTPRKCLGWRTPTEAFREEMMKL 329
>gi|134103719|ref|YP_001109380.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] >gi|133916342|emb|CAM06455.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] (469 aa)
Score = 251, Expect = 8.5e-20, Identities = 87/310 (28%), Positives = 149/310 (48%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPC--VLVPSTKQIYN--WIQTNKWIKKRSDKLRTAYIKGRKRKKGMFS--KFDEKYVHPFWM---RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           R L+  ERE I  +   +  ++  I   L R  STILREIR N+    Y    A +    RR               +  A+    +W   ++  H + + +P    +  S + IY   + Q    +K+   +++ A   GR R+K   +  +   +++ P  M   RP    +R   GHWE DL+IG      S +  +VER TR + +  + N  +  T+   + + +     H++ ++T D G E ++           VY+C+P + +QRGSNEN NGL+R+ + KGTD S+    ++ ++  ++N  PRK   + S
  S:   143 RLLTLVERERIRDLR-AEGHSLRAIGKALGRSASTILREIRANSTHGAYRPYAAHRAAAARRPRPKQRKLIAQGPLRQFVADGLRERWSPEQIC-HALGKEHPGDQRMRVSVETIYQALYFQARGGLKR---EVQAAIRTGRTRRKPRRNPNQRTARFIDPMVMISDRPAEAADRAVPGHWEGDLIIGA--GSQSAIGTLVERTTRYTMLVHLPNGHDAETVRDGLVATITTLPTHLRGSLTWDQGAEMARHKQFTMATDMPVYFCDPASPWQRGSNENTNGLLRQYFPKGTDLSVYGPEDLEHVAQQLNGRPRKTLGWDS 456
>gi|150377006|ref|YP_001313602.1| integrase catalytic region [Sinorhizobium medicae WSM419] >gi|150378338|ref|YP_001314932.1| integrase catalytic region [Sinorhizobium medicae WSM419] >gi|150396505|ref|YP_001326972.1| integrase catalytic region [Sinorhizobium medicae WSM419] >gi|150028020|gb|ABR60137.1| Integrase catalytic region [Sinorhizobium medicae WSM419] >gi|150031553|gb|ABR63669.1| Integrase catalytic region [Sinorhizobium medicae WSM419] >gi|150032885|gb|ABR64999.1| Integrase catalytic region [Sinorhizobium medicae WSM419] (333 aa)
Score = 251, Expect = 9.3e-20, Identities = 86/316 (27%), Positives = 152/316 (48%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-------NVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPF----WMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKN--PFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           Y  L+  +R  + H    +K  I +IA +L RHRSTI RE++RN           GY +  A    I +   +      ++    EL  E+    W   ++    + +    V V  T+ IY +I + +     + +L     +GR++++   S+       P       RP  I +R +FGHWE DL+I +R  G +N+  +VERK+R + + K  +++  P  I+  I +         ++ T D G EF         +  + ++C+P + +Q+G+ EN N  IRR     TD S ++  ++  L + +N +PRK   Y +  + +
  S:     5 YLQLTLPDRRRV-HQLLERKVPIAEIARQLGRHRSTIYRELKRNTFHDAEFPEYSGYYSGIAND--ISKERRRRLRKLSRHAQLRELVIEQLKALWSPEQIAGRLLADGVSAVRV-CTETIYRFIYSKE---DYALELYQHLPEGRRKRRPRRSRKPRDGSIPLDCRISQRPDFIADRSQFGHWEGDLLIFRRDLGEANVTSLVERKSRYTVMIKNGSRHSRPL-IDKIIDAFSPLPAFARQSFTFDRGTEFRGFKALEDGLGARSWFCDPNSPWQKGAVENTNKRIRRFVPSDTDLSAVNQPQLVALAHHLNSLPRKCLGYRTPAEVF 325
>gi|134100117|ref|YP_001105778.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] >gi|133912740|emb|CAM02853.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] (469 aa)
Score = 251, Expect = 9.9e-20, Identities = 87/310 (28%), Positives = 153/310 (49%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYS---AEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPC--VLVPSTKQIYN--WIQTNKWIKKRSDKLRTAYIKGRKRKKGMFS--KFDEKYVHPFWM---RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           R L+  ERE I  +   +  ++  I + L R  STILREIR N+   GY    A +A      R   +   +    + F    A+    +W   ++  H + + +P    +  S + IY   + Q    +K+   +++ A   GR R+K   +  +   +++ P  M   RP  + +R   GHWE DL+IG      S +  +VER TR + +  + N  +  T+   + + +     H++ ++T D G E ++           VY+C+P + +QRG+NEN NGL+R+ + KGTD       ++ ++  ++N  PRK   + S
  S:   143 RLLTLAERERIRDLR-AEGHSLRDIGSALGRSASTILREIRANSTHGGYQPYAAHRAAAARRPRPKQRKLIVQGPLRQF---VADGLRERWSPEQIC-HALGKEHPGDQRMRVSVETIYQALYFQARGGLKR---EVQAAIRTGRTRRKPRRNPNQRTARFIDPMVMISDRPAEVADRAVPGHWEGDLIIGA--GSQSAIGTLVERTTRYTMLVHLPNGHDAETVRDGLVATITTLPNHLRGSLTWDQGAEMARHKQFTMTTDMPVYFCDPASPWQRGTNENTNGLLRQYFPKGTDLGTYGPEDLEHVAQQLNGRPRKTLGWDS 456
>gi|50915227|ref|YP_061199.1| transposase [Streptococcus pyogenes MGAS10394] >gi|50904301|gb|AAT88016.1| Transposase [Streptococcus pyogenes MGAS10394] (367 aa)
Score = 251, Expect = 9.9e-20, Identities = 85/284 (29%), Positives = 137/284 (48%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    50 RGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|19745636|ref|NP_606772.1| transposase-IS1239 [Streptococcus pyogenes MGAS8232] >gi|19747766|gb|AAL97271.1| putative transposase-IS1239 [Streptococcus pyogenes MGAS8232] (333 aa)
Score = 251, Expect = 9.9e-20, Identities = 84/284 (29%), Positives = 136/284 (47%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      L  + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    50 RGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LFTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|19745899|ref|NP_607035.1| putative transposase [Streptococcus pyogenes MGAS8232] >gi|19748053|gb|AAL97534.1| putative transposase [Streptococcus pyogenes MGAS8232] (325 aa)
Score = 251, Expect = 9.9e-20, Identities = 84/284 (29%), Positives = 136/284 (47%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      L  + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    50 RGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LFTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|19746999|ref|NP_608135.1| putative transposase [Streptococcus pyogenes MGAS8232] >gi|19749255|gb|AAL98634.1| putative transposase [Streptococcus pyogenes MGAS8232] (330 aa)
Score = 251, Expect = 1.0e-19, Identities = 84/284 (29%), Positives = 136/284 (47%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      L  + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    50 RGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LFTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|19745292|ref|NP_606428.1| putative transposase [Streptococcus pyogenes MGAS8232] >gi|19747390|gb|AAL96927.1| putative transposase [Streptococcus pyogenes MGAS8232] (333 aa)
Score = 251, Expect = 1.0e-19, Identities = 84/284 (29%), Positives = 136/284 (47%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      L  + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    50 RGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LFTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|167621711|ref|YP_001672219.1| integrase catalytic region [Caulobacter sp. K31] >gi|167351834|gb|ABZ74560.1| Integrase catalytic region [Caulobacter sp. K31] (343 aa)
Score = 250, Expect = 1.1e-19, Identities = 81/315 (25%), Positives = 152/315 (48%)
  Q:    12 NKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRN-----NNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVH-----PFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSD 326
           ++Y H++  ER +I   +   K  +  I+  L RH ST+ REIRRN       + GY A  A ++   RR         +    +    ++    W   ++  H +K           + IY ++        R+ +L     + R+R++  +++     +H         RP HI  R+ +GHWE DL+  +++ G  N+  +VER++R   + K  +++   I + +   +      ++ +IT D G EF+        ++ + Y+C+P A +Q+G+ EN NG +RR     TD +L+   ++  L  ++NR+PRK   Y + +
  S:     3 SRYDHITLEERHLICR-WRDAKVPVRVISERLGRHPSTVHREIRRNWFDDGPWLRGYFAIAADQRASSRRRRVGKL--HRDPELAHFVTQRLRETWSPEQIAGH-LKATRQLQAYACHETIYRYVYGPD---GRAAELYKLLPRMRRRRRARYARRPRGGLHIPLQNTIAQRPAHIGERQGYGHWECDLIAFRQEYGRHNITTLVERRSRYLIMIKNPSRSSTGIMAGLAERLEPLPPPMRQSITFDRGTEFAFFATLKRSLEIESYFCKPQAPWQKGTVENTNGRLRRFLPSDTDIALIPPEKLLELTTRLNRIPRKCLGYRTPE 321
>gi|19746747|ref|NP_607883.1| putative transposase [Streptococcus pyogenes MGAS8232] >gi|19748977|gb|AAL98382.1| putative transposase [Streptococcus pyogenes MGAS8232] (326 aa)
Score = 250, Expect = 1.1e-19, Identities = 84/284 (29%), Positives = 136/284 (47%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      L  + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    50 RGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LFTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|15672663|ref|NP_266837.1| transposase of IS983A [Lactococcus lactis subsp. lactis Il1403] >gi|15672685|ref|NP_266859.1| transposase of IS983B [Lactococcus lactis subsp. lactis Il1403] >gi|15672914|ref|NP_267088.1| transposase of IS983C [Lactococcus lactis subsp. lactis Il1403] >gi|15673285|ref|NP_267459.1| transposase of IS983D [Lactococcus lactis subsp. lactis Il1403] >gi|15673341|ref|NP_267515.1| transposase of IS983E [Lactococcus lactis subsp. lactis Il1403] >gi|15673497|ref|NP_267671.1| transposase of IS983F [Lactococcus lactis subsp. lactis Il1403] >gi|15673680|ref|NP_267854.1| transposase of IS983G [Lactococcus lactis subsp. lactis Il1403] >gi|15673867|ref|NP_268042.1| transposase of IS983H [Lactococcus lactis subsp. lactis Il1403] >gi|15673890|ref|NP_268065.1| transposase of IS983I [Lactococcus lactis subsp. lactis Il1403] >gi|15673913|ref|NP_268088.1| transposase of IS983J [Lactococcus lactis subsp. lactis Il1403] >gi|15673919|ref|NP_268094.1| transposase of IS983K [Lactococcus lactis subsp. lactis Il1403] >gi|15674117|ref|NP_268292.1| transposase of IS983N [Lactococcus lactis subsp. lactis Il1403] >gi|12723589|gb|AAK04779.1|AE006301_8 transposase of IS983A [Lactococcus lactis subsp. lactis Il1403] >gi|12723614|gb|AAK04801.1|AE006304_1 transposase of IS983B [Lactococcus lactis subsp. lactis Il1403] >gi|12723867|gb|AAK05030.1|AE006327_10 transposase of IS983C [Lactococcus lactis subsp. lactis Il1403] >gi|12724281|gb|AAK05401.1|AE006362_7 transposase of IS983D [Lactococcus lactis subsp. lactis Il1403] >gi|12724343|gb|AAK05457.1|AE006368_1 transposase of IS983E [Lactococcus lactis subsp. lactis Il1403] >gi|12724513|gb|AAK05613.1|AE006382_6 transposase of IS983F [Lactococcus lactis subsp. lactis Il1403] >gi|12724714|gb|AAK05796.1|AE006400_6 transposase of IS983G [Lactococcus lactis subsp. lactis Il1403] >gi|12724919|gb|AAK05983.1|AE006418_3 transposase of IS983H [Lactococcus lactis subsp. lactis Il1403] >gi|12724944|gb|AAK06006.1|AE006420_6 transposase of IS983I [Lactococcus lactis subsp. lactis Il1403] >gi|12724970|gb|AAK06029.1|AE006423_8 transposase of IS983J [Lactococcus lactis subsp. lactis Il1403] >gi|12724977|gb|AAK06035.1|AE006424_6 transposase of IS983K [Lactococcus lactis subsp. lactis Il1403] >gi|12725192|gb|AAK06233.1|AE006441_11 transposase of IS983N [Lactococcus lactis subsp. lactis Il1403] (315 aa)
Score = 250, Expect = 1.2e-19, Identities = 100/319 (31%), Positives = 154/319 (48%)
  Q:     7 TLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRN----NNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSEL---FAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM----RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS 325
           ++   +K +HL+  +R  I   +  +  +  +IA  L +   TI RE++R          YSA+KAQ+ Y   R H      +  K  +E+    + +       +E+    +K         S   +YNW+    W++ +   L     K  K+ K    K      HPF      RP+ I NR E GH+E+D VI  R      LL + ERK R   I  ++ K    +N  +  L  + +   K+IT DNG EF+++      + C VYY   YAS++RG+NEN N +IRR   KGT  +  +  E+  ++  +N  PRKMFNY SS
  S:     5 SITSQSKGKHLTNQDRLNIERWHNKEGLSNREIARLLNKAHGTIDREMKRGEIQLKRKVKYSAKKAQENYEGLRAHS----VRPSKLTTEIDCYVSTRLKEDKDSLEVIHQALKG-------VSLSSLYNWVNWG-WLEAKRHHLFYPQYKAAKKIKPRAPK------HPFGKSIEERPEFINNRLEVGHYEIDTVILTRAKN-KVLLTLTERKYRTEIIRLIDGKTAQAVNDELVEL--QKSYDFKSITPDNGHEFARLSEV---VSCPVYYAHAYASFERGTNENHNRMIRRHLPKGT--TKTTPEEVAAIEYWMNHYPRKMFNYKSS 308
>gi|139472955|ref|YP_001127670.1| insertion sequence IS1239 putative transposase [Streptococcus pyogenes str. Manfredo] >gi|134271201|emb|CAM29414.1| insertion sequence IS1239 putative transposase [Streptococcus pyogenes str. Manfredo] (329 aa)
Score = 250, Expect = 1.2e-19, Identities = 74/225 (32%), Positives = 117/225 (52%)
  Q:   106 ELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KG   +  +  E+  +++ IN  P+++FNY SS +  K
  S:    94 EAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSPGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNEALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGNKTT--TPKEVAAIEHWINHYPKRLFNYKSSVEMLK 315
>gi|19745631|ref|NP_606767.1| transposase-IS1239 [Streptococcus pyogenes MGAS8232] >gi|19747760|gb|AAL97266.1| putative transposase-IS1239 [Streptococcus pyogenes MGAS8232] (336 aa)
Score = 250, Expect = 1.3e-19, Identities = 84/284 (29%), Positives = 136/284 (47%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      L  + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    50 RGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LFTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|19746783|ref|NP_607919.1| putative transposase [Streptococcus pyogenes MGAS8232] >gi|19749016|gb|AAL98418.1| putative transposase [Streptococcus pyogenes MGAS8232] (329 aa)
Score = 250, Expect = 1.3e-19, Identities = 84/284 (29%), Positives = 136/284 (47%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      L  + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    50 RGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LFTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|19745528|ref|NP_606664.1| putative transposase [Streptococcus pyogenes MGAS8232] >gi|19747647|gb|AAL97163.1| putative transposase [Streptococcus pyogenes MGAS8232] (344 aa)
Score = 250, Expect = 1.3e-19, Identities = 84/284 (29%), Positives = 136/284 (47%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      L  + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    50 RGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LFTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|19550666|gb|AAL91479.1|AF479752_2 putative transposase [Lactobacillus gasseri] (260 aa)
Score = 250, Expect = 1.3e-19, Identities = 73/205 (35%), Positives = 102/205 (49%)
  Q:   127 IYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH----VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           IYN+    K   KR+ KL     + RK KK +    +E        RPK I  R EFGHWE DLV+G +      LL + ER +R   I ++ +K   ++  A K L  + + H     KTIT DNG EF+ +          VYY  PY S  +G+ E  NGLIRR   KG   +  S   I +++   N +PRK+  Y + D+  K+
  S:    65 IYNYDLPEKL--KRNTKLH----RVRKNKKKLGRSIEE--------RPKEISERNEFGHWECDLVLGHKTKDDEVLLTLSERMSREFLIIRIPDKTSISVMQAFKELQRQYSEHWNDIFKTITTDNGSEFADLSNLEEASNTLVYYAHPYTSCDKGTVERHNGLIRRFIPKGEAIANYSLQNIIDIETWCNSLPRKILAYHTPDESLKE 259
>gi|10954696|ref|NP_066631.1| hypothetical protein pRi1724_p051 [Agrobacterium rhizogenes] >gi|8918696|dbj|BAA97761.1| riorf50 [Agrobacterium rhizogenes] >gi|10567360|dbj|BAB16169.1| riorf50 [Agrobacterium rhizogenes] (336 aa)
Score = 249, Expect = 1.5e-19, Identities = 82/318 (25%), Positives = 153/318 (48%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVE-------GYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTN-----KWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNS-FITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           Y H+   ER  I   +      ++ IA +L RHRSTI REI+RN  V+       GY    A     ERR      +  ++    +   E+    W   ++      E +P  +  S + IY +  ++     K  +   +       +  +RK G     D   +     RP  +  RK+FGHWE DL+  +++ G +N+  +VER +R + F+   + ++   ++  ++ L    +L  ++IT D G EF+        I  + ++C+P + +Q+G+ EN N  +R+   +  D   ++DA++  + +++N  PRK   Y +  + ++K
  S:     5 YSHIDLDERRKIAR-WRTAGLTVSVIAEQLGRHRSTIFREIKRNTFVDKVVPDLTGYYCVTAHAMSCERRAKLRKLV--RFSHVRQSVIERIMHGWSPQQIAGRMRLERHPISV--SHETIYKFAYSSDGHGIKLWRHLPEHRARRRPRHARRKHGQRFSPDLNILR----RPDAVAQRKQFGHWECDLIQFRKKFGKANVTSLVERVSRFAIFLRNNDRQSRPVMDGLVRVLQALPHLARRSITFDRGTEFTDWPYLQASIGTQTWFCDPQSPWQKGTVENTNRRVRKWLSREVDPLTVTDADLIEICSRLNATPRKCLGYRTPAEVFRK 326
>gi|56123007|gb|AAV74420.1| transposase [Acinetobacter baumannii] (322 aa)
Score = 249, Expect = 1.5e-19, Identities = 83/287 (28%), Positives = 140/287 (48%)
  Q:    38 QIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYI--ERRNHKNF----FLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCV---LVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDE-----KYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           + A  +KRH STI RE++RN+  + Y A+ A        RR H+       LW+          E   C W   ++ +    + +P +   +  S   IY+ I+     + + D L     + +KRK     K D      K +H    RP  +  RK  GHWE DL+ GK     S++  ++ER TR   +  + +    ++  A+   +      + KT+T D G E S+  I    +   VY+C+P++ +Q+G+ EN+NGLIR+   KG D +      +N +   +N  PRK  ++++
  S:    13 KFAELIKRHPSTIYRELKRNSINDVYQAQYASDNTFARRRRGHRKLKIDSILWK-------FIVEAIRCLWSPQQIAKRL--KTFPDLDQTMNVSHTTIYSTIRALPKGELKKDLLSCLRHENKKRKANGEPKKDSILQDIKTIHE---RPAEVQERKIPGHWEADLIKGKDNK--SSIATLIERNTRLCILATLPDAKAESVRKALTEALKYLPAELRKTLTHDRGREMSEHKILEEDLGIDVYFCDPHSPWQKGTCENMNGLIRQYLPKGIDLNQADQHYLNQVAMSLNTRPRKALDWLT 300
>gi|19746046|ref|NP_607182.1| putative transposase [Streptococcus pyogenes MGAS8232] >gi|19748214|gb|AAL97681.1| putative transposase [Streptococcus pyogenes MGAS8232] (334 aa)
Score = 249, Expect = 1.5e-19, Identities = 84/284 (29%), Positives = 136/284 (47%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      L  + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    50 RGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LFTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|139473815|ref|YP_001128531.1| insertion sequence IS1239 putative transposase [Streptococcus pyogenes str. Manfredo] >gi|134272062|emb|CAM30301.1| insertion sequence IS1239 putative transposase [Streptococcus pyogenes str. Manfredo] (328 aa)
Score = 249, Expect = 1.6e-19, Identities = 84/284 (29%), Positives = 136/284 (47%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KG   +  +  E+  +++ IN  P+++FNY S  +  K
  S:    50 RGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGNKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|139473472|ref|YP_001128188.1| insertion sequence IS1239 putative transposase [Streptococcus pyogenes str. Manfredo] >gi|134271719|emb|CAM29952.1| insertion sequence IS1239 putative transposase [Streptococcus pyogenes str. Manfredo] (332 aa)
Score = 249, Expect = 1.6e-19, Identities = 84/284 (29%), Positives = 136/284 (47%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS++  +  +    +YY  PYAS++RG+NEN N LIRR   KG   +  +  E+  +++ IN  P+++FNY S  +  K
  S:    50 RGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNKALTGILK--DYTVNSITADNGTEFSRL--SDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGNKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|76556252|emb|CAF29486.2| putative transposase IS1066 [Alcaligenes faecalis] >gi|76786447|gb|ABA54974.1| TnpA [Pseudomonas putida] >gi|117643756|gb|ABK51581.1| putative transposase [Aeromonas punctata] (320 aa)
Score = 249, Expect = 1.7e-19, Identities = 86/314 (27%), Positives = 149/314 (47%)
  Q:    11 TNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFF------------LWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           T  YR L+ G+R  I        ++   IA  +  H STI RE+RRN+    Y A  A  +   RR     F            +W K+    E  A++   +     ++  +I   +      +  ++Y +++  +   ++         +G+ R +   S+           RP  + +R+  G WE D V G       NL+ +V+RK+       V+ +    +  AI  ++  +  H  T+T+DNG EF+     A   +C+V++ +PY+S+QRG+NEN NGL+R+ + KG+DFS L+   +N    +IN  PRK   + +
  S:     2 TTHYRQLTQGQRYQI-EAGLSAAESQASIAKRVGVHPSTISREVRRNSTQNIYKAVSAAHESDARRAGARKFCKPATWLSHHLPVWLKHGMSPEQIAQRLKQEQPSRAVSHEWIYR-FIAAEQRAGGELYTYLRHRRKRYRKRYGSHDR--RGQLRNRVSISE-----------RPAEVESRERLGDWEGDTVHGLG----GNLVTLVDRKSGYLSAYPVKRRTRRQVTRAINLMLQGHAAH--TLTLDNGREFAGHERIALRSQCQVFFADPYSSWQRGTNENTNGLLRQYFPKGSDFSKLTVEAVNRTVARINLRPRKRLGWKT 306
>gi|15674165|ref|NP_268340.1| transposase of IS983O [Lactococcus lactis subsp. lactis Il1403] >gi|12725246|gb|AAK06281.1|AE006447_2 transposase of IS983O [Lactococcus lactis subsp. lactis Il1403] (315 aa)
Score = 248, Expect = 2.1e-19, Identities = 100/319 (31%), Positives = 153/319 (47%)
  Q:     7 TLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRN----NNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSEL---FAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM----RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS 325
           ++   +K +HL+  +R  I   +  +  +  +IA  L +   TI RE++R          YSA+KAQ+ Y   R H      +  K  +E+    + +       +E+    +K         S   +YNW+    W++ +   L     K  K+ K    K      HPF      RP+ I NR E GH+E+D VI  R      LL + ERK R   I  ++ K    +N  +  L  + +   K+IT DNG EF++       + C VYY   YAS++RG+NEN N +IRR   KGT  +  +  E+  ++  +N  PRKMFNY SS
  S:     5 SITSQSKGKHLTNQDRLNIERWHNKEGLSNREIARLLNKAHGTIDREMKRGEIQLKRKVKYSAKKAQENYEGLRAHS----VRPSKLTTEIDCYVSTRLKEDKDSLEVIHQALKG-------VSLSSLYNWVNWG-WLEAKRHHLFYPQYKAAKKIKPRAPK------HPFGKSIEERPEFINNRLEVGHYEIDTVILTRAKN-KVLLTLTERKYRTEIIRLIDGKTAQAVNDELVEL--QKSYDFKSITPDNGHEFARFSEV---VSCPVYYAHAYASFERGTNENHNRMIRRHLPKGT--TKTTPEEVAAIEYWMNHYPRKMFNYKSS 308
>gi|134097028|ref|YP_001102689.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] >gi|133909651|emb|CAL99763.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] (385 aa)
Score = 248, Expect = 2.1e-19, Identities = 85/310 (27%), Positives = 149/310 (48%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPC--VLVPSTKQIYN--WIQTNKWIKKRSDKLRTAYIKGRKRKKGMFS--KFDEKYVHPFWM---RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           R L+  ERE I  +   +  ++  I + L R  STI REIR N+    Y    A +    RR               +  A+    +W   ++  H + + +P    +  S + IY   + Q    +K+   +++ A   GR R+K   +  +   +++ P  M   RP    +R   GHWE DL+IG      S +  +VER TR + +  + N  +  T+   + + +     H++ ++T D G E ++           VY+C+P + +QRG+NEN NGL+R+ + KGTD S+    ++ ++  ++N  PRK   + S
  S:    59 RLLTLAERERIRDLR-AEGHSLRDIGSALGRSASTISREIRANSTHGAYRPYAAHRAAAARRPRPKQRKLIAQGPLRQFVADGLRERWSPEQIC-HALGKEHPGDQRMRVSVETIYQALYFQARGGLKR---EVQAAIRTGRTRRKPRRNPNQRTARFIDPMVMISDRPAEAADRAVPGHWEGDLIIGA--GNQSAIGTLVERTTRYTMLVHLPNGHDAETVRDGLVATITTLPTHLRGSLTWDQGAEMARHKQFTMATDMPVYFCDPASPWQRGTNENTNGLLRQYFPKGTDLSVYGPEDLEHVAQQLNGRPRKTLGWDS 372
>gi|116255155|ref|YP_770989.1| IS30 family transposase [Rhizobium leguminosarum bv. viciae 3841] >gi|115259803|emb|CAK02897.1| putative transposase for insertion sequence (IS30 family) element [Rhizobium leguminosarum bv. viciae 3841] (333 aa)
Score = 247, Expect = 2.9e-19, Identities = 81/316 (25%), Positives = 151/316 (47%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-------NVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTI-NSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           Y  L+  +R  + H     K  +N++A +L RHRSTI REI+RN        +  GY +  A    I +   +     +++ T       +   +W   ++    + +    + V   + IY +I + +      +      + +   ++ RK + G F        H    RP  + +R  FGHWE DL+I +R  G++N+  +VERK+R + + K  +++   I +  I++         ++ T++ G EF+        I    ++C+P A +Q+G+ EN N  IRR     TD +++S  ++ +L   +N  PRK   Y +  + +
  S:     5 YMQLALADRRRL-HQLVAAKVPVNEMARQLGRHRSTIYREIKRNTFHDRELPDYNGYYSTVAND--IAQDRRRRLRKLRRHPTLRTEIINQLEARWSPEQIAGRLLSDGLSRIRV-CKETIYRFIYSKEDYGLGLYQYLPEARRKRRAMRSRKPRDGAFPA-----THRISQRPDFVGDRSRFGHWEGDLLIFERPLGHANITTLVERKSRYTVLIKNPSRHSRPIMDKIIRAFSPLPAFARQSFTLNRGTEFAGFRALEEGIGACSWFCDPSAPWQKGTVENTNKRIRRFLPGTTDLAVVSQRDLLHLTRHVNDQPRKCLGYRTPTEVF 325
>gi|153207355|ref|ZP_01946092.1| transposase insI for insertion sequence element IS30B/C/D [Coxiella burnetii 'MSU Goat Q177'] >gi|153207371|ref|ZP_01946108.1| transposase insI for insertion sequence element IS30B/C/D [Coxiella burnetii 'MSU Goat Q177'] >gi|153208436|ref|ZP_01946739.1| transposase insI for insertion sequence element IS30B/C/D [Coxiella burnetii 'MSU Goat Q177'] >gi|153208467|ref|ZP_01946770.1| transposase insI for insertion sequence element IS30B/C/D [Coxiella burnetii 'MSU Goat Q177'] >gi|165919153|ref|ZP_02219239.1| transposase insI for insertion sequence element IS30B/C/D [Coxiella burnetii RSA 334] >gi|120575982|gb|EAX32606.1| transposase insI for insertion sequence element IS30B/C/D [Coxiella burnetii 'MSU Goat Q177'] >gi|120576013|gb|EAX32637.1| transposase insI for insertion sequence element IS30B/C/D [Coxiella burnetii 'MSU Goat Q177'] >gi|120576664|gb|EAX33288.1| transposase insI for insertion sequence element IS30B/C/D [Coxiella burnetii 'MSU Goat Q177'] >gi|120576680|gb|EAX33304.1| transposase insI for insertion sequence element IS30B/C/D [Coxiella burnetii 'MSU Goat Q177'] >gi|165917165|gb|EDR35769.1| transposase insI for insertion sequence element IS30B/C/D [Coxiella burnetii RSA 334] (330 aa)
Score = 247, Expect = 3.2e-19, Identities = 101/324 (31%), Positives = 154/324 (47%)
  Q:     8 LNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN----VEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVP---STKQIYNWIQTNKWIK-----KRSDKLRTA-YIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSA-IKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           + +   + HLS  ERE +  +Y  Q K + +I   L R  S I RE++RN+N    + GY    A ++  +R+ +       K+    +   EK    W     T   I      V      S + IY ++   +W +      RS K R A     RK +  + ++ D        +RP+   NRKE GHWE D +   R     N  V+ ER +R   IT +ENK   +   A IK L +      K+IT DNG E          +K K Y+C+PY S+++G+ EN NGLIRR   K TD +  S  +++ ++  +N  PRK   + +  Q + K
  S:     1 MKEKRSFSHLSLYEREQL-FVYKQQGKCLREIGRLLDRDHSVISRELKRNSNPHEHMRGYIGTLAHQQAKDRKKNSGKRPRLKHADLQKYVQEKMKIGW-----TPEIIASQVSVVFQGFSISHEAIYQYVYA-QWPEGIIYLPRSHKKRYAKRYSNRKNRAPIPNRTDID------LRPEKATNRKEVGHWESDTLESDRSRVVYN--VIEERVSRLVKITGLENKKAASTKEAVIKRLASLPKKARKSITYDNGSENYYHQEINSVLKTKSYFCKPYHSWEKGAIENTNGLIRRFIPKKTDLANFSQEQLDQIEYLLNHRPRKCLGFKTPYQVFLK 323
>gi|15673986|ref|NP_268161.1| transposase of IS983L [Lactococcus lactis subsp. lactis Il1403] >gi|15674044|ref|NP_268219.1| transposase of IS983M [Lactococcus lactis subsp. lactis Il1403] >gi|12725050|gb|AAK06102.1|AE006430_7 transposase of IS983L [Lactococcus lactis subsp. lactis Il1403] >gi|12725114|gb|AAK06160.1|AE006436_9 transposase of IS983M [Lactococcus lactis subsp. lactis Il1403] (315 aa)
Score = 246, Expect = 3.9e-19, Identities = 93/319 (29%), Positives = 152/319 (47%)
  Q:     7 TLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHG-VELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM----RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS 325
           ++   +K +HL+  +R  I   +  +  +  +IA  L +   TI RE++R     G    K + KY  ++  +N+     +         + +C     ++  +  ++  +  +   S   +YNW+    W++ +   L     K  K+ K    K      HPF      RP+ I NR E GH+E+D VI  R      LL + ERK R   I  ++ K    +N  +  L  + +   K+IT DNG EF+++      + C VYY   YAS++RG+NEN N +IRR   KGT  +  +  E+  ++  +N  PRKMFNY SS
  S:     5 SITSQSKGKHLTNQDRLNIERWHNKEGLSNREIARLLNKAHGTIDREMKR-----GEIQLKRKVKYSAKKAQENYEGLMAHSVRPSKLTTEIDCYVSTRLKEDKDSLEVIHQALKGVSLSSLYNWVNWG-WLEAKRHHLFYPQYKAAKKIKPRAPK------HPFGKSIEERPEFINNRLEVGHYEIDTVILTRAKN-KVLLTLTERKYRTEIIRLIDGKTAQAVNDELVEL--QKSYDFKSITPDNGHEFARLSEV---VSCPVYYAHAYASFERGTNENHNRMIRRHLPKGT--TKTTPEEVAAIEYWMNHYPRKMFNYKSS 308
>gi|85703122|ref|ZP_01034226.1| TRm24 putative transposase [Roseovarius sp. 217] >gi|85703696|ref|ZP_01034800.1| TRm24 putative transposase [Roseovarius sp. 217] >gi|85704296|ref|ZP_01035399.1| TRm24 putative transposase [Roseovarius sp. 217] >gi|85705436|ref|ZP_01036534.1| TRm24 putative transposase [Roseovarius sp. 217] >gi|85705645|ref|ZP_01036743.1| TRm24 putative transposase [Roseovarius sp. 217] >gi|85706823|ref|ZP_01037914.1| TRm24 putative transposase [Roseovarius sp. 217] >gi|85668616|gb|EAQ23486.1| TRm24 putative transposase [Roseovarius sp. 217] >gi|85669861|gb|EAQ24724.1| TRm24 putative transposase [Roseovarius sp. 217] >gi|85670070|gb|EAQ24933.1| TRm24 putative transposase [Roseovarius sp. 217] >gi|85671616|gb|EAQ26474.1| TRm24 putative transposase [Roseovarius sp. 217] >gi|85672050|gb|EAQ26907.1| TRm24 putative transposase [Roseovarius sp. 217] >gi|85672624|gb|EAQ27481.1| TRm24 putative transposase [Roseovarius sp. 217] (333 aa)
Score = 246, Expect = 4.1e-19, Identities = 86/317 (27%), Positives = 155/317 (48%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-------NVEGYSAEKAQKKYIERRN-HKNFFLWQKYKTFSELFAE---KYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWI-----QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITK-VENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           Y HL+  ER  +   +   K +I +IA  L R  STI REI+RN+        + GY A  AQ +  +RR  H+   L      + E+ A     ++  W   ++      E +P  +  S + IY +      +  K+ +           +G +R  G     +    H    RP+ I  R +FGHWE DLV+ +++ G +N+  +VER +R + + K  + ++   + S I +L        ++IT D G EFS        +  + ++C+P + +Q+G+ EN N  +RR   +  D +  +D  + ++ +++N  PRK   Y +  + ++
  S:     5 YPHLNLDERRNLAK-WLEAKISIKEIADRLCRDASTIYREIKRNSCRFDDQPELNGYHALAAQDRSEDRRAVHRKLIL------YPEIMAAVRCGFDAGWSPEQIAGRMRLERHP--MRVSHETIYRYAYSKAGRAEKFYRHLPMHRHRRRPRGTRRHHGRHILDELAIAH----RPEAIAERDQFGHWECDLVMFRKEFGKANVTSLVERVSRFALVLKNPDRQSKPVMESLIANLSPLPAEARRSITFDRGTEFSAWQHLKDGLGVEPWFCDPQSPWQKGTVENTNNRLRRYLSRKADPTAFTDRYLRSICDRLNATPRKCLGYQTPAEVFR 325
>gi|116332723|ref|YP_794250.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116333212|ref|YP_794739.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116333363|ref|YP_794890.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116333927|ref|YP_795454.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116334728|ref|YP_796255.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116098070|gb|ABJ63219.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] >gi|116098559|gb|ABJ63708.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] >gi|116098710|gb|ABJ63859.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] >gi|116099274|gb|ABJ64423.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] >gi|116100075|gb|ABJ65224.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] (307 aa)
Score = 245, Expect = 4.2e-19, Identities = 85/306 (27%), Positives = 143/306 (46%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGR--KRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           LS+  R +I  ++  + +++  IA  L   ++TI  E+ R N    Y AE AQ  + ER+  +        K    L  EK   +    E   H +   Y        K +YNWI    W+  +   L    I+    K K+G FS     +      RP  +  R+EFGH+E D V+  ++ G + +   VERK+R + + ++  ++   +  A+  L ++    +KT+T+D+G EF+           +VY+   Y+ ++RGSNEN N ++RR   KG     LSD ++  +   +N  P K  N+
  S:     6 LSFQNRVVIDTLH-NEGRSLRYIANYLDFSKTTIFNELHRLNG--EYQAELAQTDF-ERKVSQRGRKSSLTKNLKHLIEEKIQVQKWSPEQVAHVVGIAY--------KTVYNWIDQG-WLDVQLPDLPDHGIRRHRAKEKRGTFS-----HGRSIEKRPHKVETRQEFGHFEADTVLSGKRKGQA-VATFVERKSRLTIVKRLHGRDSQFMTQAVLELASQLQDKLKTLTVDHGKEFANYQTIEQLTGTQVYFAHAYSPHERGSNENRNRVLRRFIPKGQAIEELSDYQLVQINWYLNSRPLKCLNW 294
>gi|134098627|ref|YP_001104288.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] >gi|133911250|emb|CAM01363.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] (469 aa)
Score = 245, Expect = 5.1e-19, Identities = 86/310 (27%), Positives = 149/310 (48%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPC--VLVPSTKQIYN--WIQTNKWIKKRSDKLRTAYIKGRKRKKGMFS--KFDEKYVHPFWM---RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           R L+  ERE I  +   +  ++  I + L R  STILREIR N+   GY    A +    RR               +  A+    +W   ++  H + + +P    +  S + IY   + Q    +K+   +++ A   GR R+K   +  +   +++ P  M   RP    +R   GHWE DL+IG      S +  +VER TR + +  + N  +  T+   + + +     H++ ++T D G E ++           VY+C+P + +QRG+NEN NGL+R+ + KGTD       ++ ++  ++N  PRK   + S
  S:   143 RLLTLVERERIRDLR-AEGHSLRDIGSALGRSASTILREIRANSTHGGYQPYAAHRAAAARRPRPKQRKLIAQGPLRQFVADGLRERWSPEQIC-HALGKEHPGDQRMRVSVETIYQALYFQARGGLKR---EVQAAIRTGRTRRKPRRNPNQRTARFIDPMVMISDRPAEAADRAVPGHWEGDLIIGA--GSQSAIGTLVERTTRYTMLVHLPNGHDAETVRDGLVATITTLPNHLRGSLTWDQGAEMARHKQFTMATDMPVYFCDPASPWQRGTNENTNGLLRQYFPKGTDLGTYGPEDLEHVAQQLNGRPRKTLGWDS 456
>gi|27545530|gb|AAO19123.1| putative transposase [Pseudomonas sp. S-47] (339 aa)
Score = 244, Expect = 5.5e-19, Identities = 93/306 (30%), Positives = 150/306 (49%)
  Q:    14 YRHLSYGEREII--GHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNHKNFF---LWQKYKTFSELFAEKYNCKWHGVELTRHYI---KENYPCVLVPSTKQIYNWIQTNKWIKKRSDK---LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKM 319
           Y  LS  ER  I  GH   VQ  +  +IA  + R  STI RE+RRN    G YSA  AQ++   RR         L    +  + +  E+ + +    +L    I   ++ Y C      + IY+ I      + R +    LR      R R  G+  +     +    +RP  I +R   GHWE DL+ GK  +  S +  +VER +    + K+ +    +      + +N+  L + K++T D G E ++           +++C+P++ +QRGSNEN+NGLIR+   KGTD S+ S  E++ +  ++N  PRK+
  S:     3 YSELSVAERATIQIGH---VQGFSQRRIACLVNRSPSTISRELRRNRQACGTYSAHGAQQQMQRRRQACRPRRKXLPGSEELVTHMLRERLSPEQIAGKLRSMNIPNLRDAYVC-----RETIYSAIYALPVGELRKELIICLRQGKTTRRPRSGGVDRRGQIPEMVSIHVRPPEIEDRLMPGHWEGDLIKGKANA--SAVGTLVERTSGYLMLVKMNDATATSAMEGFSAALNRMPLAMRKSMTYDQGREMARHAEITQRTGVAIFFCDPHSPWQRGSNENINGLIRQYLPKGTDLSVHSQEELDAIALQLNMRPRKL 311
>gi|116618232|ref|YP_818603.1| IS30 family transposase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097079|gb|ABJ62230.1| Transposase, IS30 family [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (341 aa)
Score = 244, Expect = 5.6e-19, Identities = 94/323 (29%), Positives = 160/323 (49%)
  Q:     9 NDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV--------------EGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKY------VHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIK----CKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           N  +KY  L + ER  I +M    K N  +IA +L R R+TI  E++RN  V              E   A +  + +  + +H    +  K +   + + +K   K    E   H +     C     T+ IYNWI      +  S  L    +KG++R+       + ++            RP+ I NR  FGHWE+D V+   Q   S ++  VERKTR     K ++K+   + +A+ + +++     ++IT D G EF+   +  Y I+     K+YY +P +  QRG+NE +N  +RRV+  G DF+ ++  ++ N    IN  PR +  + + ++ + K
  S:     5 NPKSKYARLDFSERVTIQNMIDDGKTNA-EIARKLNRPRATITHELKRNARVIIWRGKTKILRHTYEPVQAARRAEYHQSKSHHSQPKITPKKREKIDYYLKK---KHWSPEQIAHGVPRIGVC-----TRTIYNWILN----RNLSATLNDLPLKGKRRRHLRAKPVNPEHKRMMIETRSIHNRPEVINNRSTFGHWEIDGVMSP-QDSQSFVITFVERKTRFMVGVKAKSKSSDDVKTALDTFMSRFENVCESITCDRGTEFTS-SLFIYSIEDTYGKKLYYADPQSPGQRGTNERMNRELRRVFPAGYDFTKITQRKLQNAIQDINERPRNVLRFKTPEKVFTK 336
>gi|29654052|ref|NP_819744.1| IS30 family transposase [Coxiella burnetii RSA 493] >gi|29654060|ref|NP_819752.1| IS30 family transposase [Coxiella burnetii RSA 493] >gi|29654393|ref|NP_820085.1| IS30 family transposase [Coxiella burnetii RSA 493] >gi|29654411|ref|NP_820103.1| IS30 family transposase [Coxiella burnetii RSA 493] >gi|29654835|ref|NP_820527.1| IS30 family transposase [Coxiella burnetii RSA 493] >gi|29541318|gb|AAO90258.1| transposase, IS30 family [Coxiella burnetii RSA 493] >gi|29541326|gb|AAO90266.1| transposase, IS30 family [Coxiella burnetii RSA 493] >gi|29541660|gb|AAO90599.1| transposase, IS30 family [Coxiella burnetii RSA 493] >gi|29541678|gb|AAO90617.1| transposase, IS30 family [Coxiella burnetii RSA 493] >gi|29542103|gb|AAO91041.1| transposase, IS30 family [Coxiella burnetii RSA 493] (330 aa)
Score = 243, Expect = 7.6e-19, Identities = 97/324 (29%), Positives = 149/324 (45%)
  Q:     8 LNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN----VEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVP---STKQIYN-----WIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSA-IKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           + +   + HLS  ERE +  +Y  Q K + +I   L R  S I RE++RN+N    + GY    A ++  +R+ +       K+    +   EK    W     T   I      V      S + IY      W +   ++     K        RK +  + ++ D        +RP+   NRKE GHWE D +   R     N  V+ ER +R   IT +ENK   +   A IK L +      K+IT DNG E          +K K Y+C+PY S+++G+ EN NGLIRR   K TD +  S  +++ ++  +N  PRK   + +  Q + K
  S:     1 MKEKRSFSHLSLYEREQL-FVYKQQGKCLREIGRLLDRDHSVISRELKRNSNPHEHMRGYIGTLAHQQAKDRKKNSGKRPRLKHADLQKYVQEKMKIGW-----TPEIIASQVSVVFQGFSISHEAIYQYVYAQWPEGIIYLPHSRKKRYAKRYSNRKNRAPIPNRTDID------LRPEKATNRKEVGHWESDTLESDRSRVVYN--VIEERVSRLVKITGLENKKAASTKEAVIKRLASLPKKARKSITYDNGSENYYHQEINSVLKTKSYFCKPYHSWEKGAIENTNGLIRRFIPKKTDLANFSQEQLDQIEYLLNHRPRKCLGFKTPYQVFLK 323
>gi|116332729|ref|YP_794256.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116334318|ref|YP_795845.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116098076|gb|ABJ63225.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] >gi|116099665|gb|ABJ64814.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] (309 aa)
Score = 243, Expect = 7.7e-19, Identities = 91/311 (29%), Positives = 141/311 (45%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYN---CKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           ++Y ER  I     +   NI Q+   L R  STI  E+ R    + Y AE AQ     +R+       +K K   EL  +  N     W   E+  H  K         +TK IYNW+   + I    + L    ++ R R     SK+++        RP  I  R   G +ELD V+G R    + LL +++RK+R  +  +++++   T+N A+   +   N  V + T+D G EFS +         K YYC  Y   +RGSNE  N  +R  Y KGT F  +S  ++     +IN+ P K+ ++ +  Q
  S:     4 ITYSERIKIETFCELGLSNI-QMGVRLNRSPSTISYELSR---CQPYQAELAQTDAEYKRSRCG----RKTKLSDELKQKILNHLRLSW-SPEMIAHEFKL--------ATKSIYNWLNQGR-IGFSLNDLPEHGVRQR-RNVDQRSKYNQSLGRSIEQRPMMINQRNRIGDFELDTVVGPRGHSKAVLLTLIDRKSRFLWAYRLKDRTTATVNEALTKFLTTFNGPVHSFTVDRGTEFSGLVSLESQYGIKTYYCHAYTPAERGSNERFNRNLRYFYPKGTRFEHISAQDLTTTLLQINQRPLKILDWQTPYQ 298
>gi|145221085|ref|YP_001131763.1| integrase catalytic subunit [Mycobacterium gilvum PYR-GCK] >gi|145213571|gb|ABP42975.1| Integrase, catalytic region [Mycobacterium gilvum PYR-GCK] (401 aa)
Score = 243, Expect = 8.3e-19, Identities = 83/280 (29%), Positives = 140/280 (50%)
  Q:    38 QIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIER-RNHKNFFL----------------WQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVE-NKNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPR 317
           +I  EL R RS I RE++RN   +G Y A  A     ++ R  K F L                W   K  S++ AE Y     G +L +   +  Y C+ V +  Q+   +      K  S K R    +G + + G++   D   +     RP    +R   GHWE DL++G R    S +  +VER TR   +  +  +    ++ +A+   + +   H++ +IT D G E +        +   V++C+P++ +QRG+NEN N L+R  ++KG+D S+ +  ++N +  K+N  PR
  S:    97 EIGRELGRDRSVIAREVKRNCLPDGRYHALMAHAAASQKARRPKKFKLDNPALCALIAGWMDEGWSP-KLISQVLAETYA----GDKLMQVSHETIYQCLYVQTRGQLRADLH-----KCLSTKRRARSPRGHRGRTGVY---DPDTIFTISDRPAEANDRAVPGHWEGDLILGARHG--SAIGTLVERSTRFVILLHLPVDHTAQSVAAAMIEAMGELPAHLRRSITWDRGSEMASWKHVQMQLNSPVFFCDPHSPWQRGTNENTNRLLRFWFEKGSDLSVHTRDDLNTVAAKLNSRPR 381
>gi|116249622|ref|YP_765460.1| putative transposase for insertion sequence element [Rhizobium leguminosarum bv. viciae 3841] >gi|115254270|emb|CAK03888.1| putative transposase for insertion sequence element [Rhizobium leguminosarum bv. viciae 3841] (336 aa)
Score = 242, Expect = 9.6e-19, Identities = 82/321 (25%), Positives = 149/321 (46%)
  Q:    11 TNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-------NVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSEL---FAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTI-NSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           T  Y  +   ER  I   +     ++  IA +L RHRSTI RE+RRN        ++ GY    A     ERR        +K   FS+L     E+    W   ++      E +P  +   T   + +      IK           +  +  +    +    +V+  + RP  +  RK+FGHWE DL+  +++ G +N+  +VER +R + + +  ++    + +  I+ L +  +L  ++IT D G EF+        I  + ++C+P + +Q+G+ EN N   R+   +  D   LSD ++  + N++N  PRK   Y +  + +++
  S:     2 TRTYSQIDMEERRKIAR-WHTAGISVEMIAEKLHRHRSTIFRELRRNTFEDREMPDLNGYYCVMANDMARERRAK-----LRKLARFSQLRQSVIERIMHGWSPQQIAGRLQLERHPISVSHETIYKFAYSSDGHAIKLWRHLPEHRARRRPRHARRRHGRRFTPHVNILY-RPDAVAERKQFGHWECDLIQFRKKFGKANVTSLVERVSRFAVLLRNNDQQSRPVMDGLIQVLQSLPHLARRSITFDRGTEFTDWPYLHASIGAQTWFCDPQSPWQKGTVENTNRRARKWLSREVDPLSLSDRDLTEICNRLNATPRKCLGYKTPAEVFRQ 326
>gi|94994117|ref|YP_602215.1| Transposase [Streptococcus pyogenes MGAS10750] >gi|94547625|gb|ABF37671.1| Transposase [Streptococcus pyogenes MGAS10750] (317 aa)
Score = 242, Expect = 9.9e-19, Identities = 98/330 (29%), Positives = 151/330 (45%)
  Q:     1 MFYTTITLNDTNKYRHLSYGER-EIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENY-PCVLVPS------TKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           M  + I     + Y HLS  ER EI   +    + N N+I   L R      +++R+      YSA+  Q  Y E R      + Q+ +                 E   HY+ +NY P ++V +         IY WI   K    +   L     K  +++   + K   K +     RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DNG EFS +          +YY  PYAS++RG+NEN N LI R   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:     1 MNMSNINSTRKSSYSHLSATERGEIARLLGKAPQTNHNEIKRGLLR------QQVRKGKFEAVYSAQHTQLIYQENRKRSVRPIRQRKQD---------------REAIEHYMHQNYSPEMMVKAKGVQVPVSTIYYWIHHGKLSLGKEAMLYPRKAKQARKQASPYFKPAGKSIE---QRPDSINQRLEAGHYEIDTVILTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNEALTGILK--DYTVNSITADNGTEFSCLSDVV--PASAIYYAHPYASWERGTNENHNRLILRWLSKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 307
>gi|116492298|ref|YP_804033.1| IS30 family transposase [Pediococcus pentosaceus ATCC 25745] >gi|116102448|gb|ABJ67591.1| Transposase, IS30 family [Pediococcus pentosaceus ATCC 25745] (309 aa)
Score = 242, Expect = 1.1e-18, Identities = 91/311 (29%), Positives = 142/311 (45%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           ++Y ER  I     +   NI Q+A  LK+  STI  E+ R    + Y AE AQ     +R H      +K K  ++L     N       L   +  E     L  +TK IYNW+   K I+    +L    ++ R R     SK+++        RP  I  R   G +E+D V+G R    + LL +++RK+R  +  +++++   T+N A+   +      V T T+D G EFS +         + YYC  Y   +RGSNE  N  +R  Y KGT F  +S  ++     +IN+ P K+ N+ +  Q
  S:     4 ITYSERIKIETFCELGLTNI-QMAERLKQSPSTISYELSR---CQPYQAELAQANAEYKRAHCG----RKTKLNAKLKQTILN------HLRLSWSPEVIAHELKLATKSIYNWLYQGK-IEFSLSELPEHGLRQR-RNLDQRSKYNQSLGRSIEQRPIVINQRNRIGDFEIDTVVGPRGHSKAALLTLIDRKSRFLWAYRLKDRTAATVNEALTMFLTTFKRPVHTFTVDRGTEFSNLVSFEPQYGIQTYYCHAYTPAERGSNERFNRNLRYFYPKGTCFEHISAQDLTTTLLEINQRPLKVLNWQTPYQ 298
>gi|110004028|emb|CAK98368.1| transposase of is30 family protein [Spiroplasma citri] (322 aa)
Score = 242, Expect = 1.2e-18, Identities = 97/316 (30%), Positives = 162/316 (51%)
  Q:    14 YRHLSYGER----EIIGHMYFVQK---KNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFF--LWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQT------NKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL--HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           Y HLS+ ++    +++    F++K   +NI+ IA  L RHRSTILREI+R   ++ Y A K  + Y E+R   N    L ++   F ++   KY C      + R+++K  +        K +Y WI+        + ++ R  K +T   KG+   +G  + F        W     + N    G +E+D V+GK     S+ LV+VE+ ++  F  K+EN     +    K +V  NNL   +K I  D G EFS+      + + +VY+C+     Q+   EN+NG  R+ +   TDF+ +S  +I+ + N IN   R   N++SS + +
  S:     2 YSHLSFMDKVKLEQLLLSKIFLKKNGEQNISAIAKFLNRHRSTILREIKRFKTIDEYGAYKPDEMYYEKRKKNNKRCKLTEEQINFMKIRLNKY-CDSPREFIYRYFLK--FGVKFPVCVKTLYKWIRLGFCGFLKQNLRHRGKKYKT---KGKSDNRGKLTDFKS-----IWDIENKVSN---VGWFEMDTVVGKNHQ--SSCLVLVEQSSKKYFAIKLENHTAREVEKKFKDIVINNNLIGKIKGIITDGGKEFSEWREMEIFAETQVYFCDVSKPRQKPLIENMNGEFRKWFPLETDFNKVSQKQIDWVVNVINDKLRPCLNWISSKEMF 318
>gi|40787278|gb|AAR90195.1| putative transposase [Rhodococcus sp. DK17] (384 aa)
Score = 241, Expect = 1.4e-18, Identities = 89/310 (28%), Positives = 138/310 (44%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWI---QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN--KNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           K R L++ ERE I  +       +  IA  L R  STI REI RN    G Y A  A      R +           +  E   EK   + H  E     ++ ++P    +  ST+ IY  +            +  LRT     R  +K    K     +     RPK + NR   GHWE DL++GKR    S +  +VER T    +  + +  K   T  +  + L        +T+T D G E       +      +Y+C+P+A +QRG+N+N NG++R+ + KG+D S+ S A++  +  ++N  PRK   +
  S:    59 KGRCLTFAEREEIA-IGIAAGHTLRDIAKTLNRSPSTISREIARNREPSGRYRARSAHAAAYHRASRPKPSKLATNPSLRET-VEKSLTERHSPEQIAGRLRLDFPDDPQMRVSTETIYQSLYQPARGGLEHTLTRSLRTGRGLRRPSRKAGQRKNRIPDMANIADRPKDVKNRAVPGHWEGDLIVGKRN--LSAIGTLVERSTGTVMLVHLPDGYKPEQTAPALTEQLETLPTSLRRTLTWDQGSEMRDWKSVSAATGIDIYFCDPHAPWQRGTNQNTNGILRQYFPKGSDLSVHSKADLEWVSRQLNERPRKRLEF 372
>gi|84501128|ref|ZP_00999363.1| TRm24 putative transposase [Oceanicola batsensis HTCC2597] >gi|84391195|gb|EAQ03613.1| TRm24 putative transposase [Oceanicola batsensis HTCC2597] (330 aa)
Score = 241, Expect = 1.4e-18, Identities = 89/323 (27%), Positives = 155/323 (47%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-------NVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELT-RHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHP----FWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKV-ENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           +  L   ER +I  M       +++IA EL RHRS++ REI+RN         + GY    AQK   +RR  +   +  ++    +    +    W   ++  R   +   P V   S + IY ++        +S +L       RK+++  +++     V P       RP H+  R+ FG WE DL+I +R  G +N+  +VERKTR + + +  E      +N  +  +        ++IT D GIEF         I  +V++C+P A +Q+GS EN+N   RR   + T  + LS+  +  + +++N  PRK   + +  + +++ M  L
  S:     3 HTELDLRERRVIEDMLNATMP-VSKIAVELGRHRSSVYREIKRNRFADDELPYLNGYYGMVAQKAARDRRARRRKLI--RFPELRKAVIAQMMEGWSPEQIAGRLQFEGRRPRV---SDETIYTYVFGPD---GQSAELARHLPSRRKKRQPRYARRPSGLVFPPDRSIHQRPDHVKIRETFGEWEGDLMIFERAQGNANIASLVERKTRFAVLFRNNERSTTHLMNRLMTVMEPLPQPARRSITFDRGIEFRNWRKLEPGIGTEVWFCDPQAPWQKGSVENLNKRARRYLPRDTPVAALSNRNMRAICDRLNGTPRKCLGWRTPTEAFREEMMKL 329
>gi|134100607|ref|YP_001106268.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] >gi|133913230|emb|CAM03343.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] (469 aa)
Score = 240, Expect = 1.6e-18, Identities = 87/318 (27%), Positives = 150/318 (47%)
  Q:     7 TLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPC--VLVPSTKQIYN--WIQTNKWIKKRSDKLRTAYIKGRKRKKGMFS--KFDEKYVHPFWM---RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           TL+     R L+  ERE I  +   +  ++  I + L R  STI REIR N+    Y    A +    RR               +  A+    +W   ++  H + + +P    +  S + IY   + Q    +K+   +++ A   GR R+K   +  +   +++ P  M   RP    +R   GHWE DL+IG      S +  +VER TR + +  + N  +  T+   + + +     H++ ++T D G E ++           VY+C+P + +QRGSNEN NGL+R+ + KGTD       ++ ++  ++N  PRK   + S
  S:   135 TLDKQLHPRLLTLAERERIRDLR-AEGHSLRAIGSALGRSASTISREIRANSTHGAYQPYAAHRASAARRPRPKQRKLIAQGPLHQFVADGLRERWSPEQIC-HALGKEHPGDQRMRVSVETIYQALYFQARGGLKR---EVQAAIRTGRTRRKPRRNPNQRTARFIDPMVMISDRPAEAADRAVPGHWEGDLIIGA--GSQSAIGTLVERTTRYTMLVHLPNGHDAETVRDGLVATITTLPNHLRGSLTWDQGAEMARHKQFTMATDMPVYFCDPASPWQRGSNENTNGLLRQYFPKGTDLGTYGPEDLEHVAQQLNGRPRKTLGWDS 456
>gi|111021271|ref|YP_704243.1| transposase [Rhodococcus sp. RHA1] >gi|110820801|gb|ABG96085.1| probable transposase [Rhodococcus sp. RHA1] (385 aa)
Score = 239, Expect = 2.2e-18, Identities = 89/310 (28%), Positives = 139/310 (44%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWI---QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN--KNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           K R L++ ERE I  +       + +IA  L R  STI REI RN    G Y A  A      R +           +  E   EK   + H  E     ++ ++P    +  ST+ IY  +            +  LRT     R  +K    K     +     RPK + +R   GHWE DL++GKR    S +  +VER T    +  + +  K   T  +  + L        +T+T D G E       +      +Y+C+P+A +QRG+NEN NG++R+ + KG+D S+ S A++  +  ++N  PRK   +
  S:    59 KGRCLTFAEREEIA-IGIAAGHTLREIAKALNRSPSTISREIARNCEPSGRYRARSAHAAAYHRASRPKPSKLAINPSLRET-VEKSLTERHSPEQIAGRLRLDFPDDPQMRVSTETIYQSLYQPSRGGLEHTLTRSLRTGRGLRRPSRKAGQRKNRIPDMANIADRPKDVKDRAVPGHWEGDLIVGKRN--LSAIGTLVERSTGTVMLVHLPDGYKPEQTAPALTEQLETLPTSLRRTLTWDQGSEMRDWKSVSAATGIDIYFCDPHAPWQRGTNENTNGILRQYFPKGSDLSVHSKADLEWVSRQLNERPRKRLEF 372
>gi|111026256|ref|YP_708539.1| transposase [Rhodococcus sp. RHA1] >gi|110825099|gb|ABH00381.1| transposase [Rhodococcus sp. RHA1] (384 aa)
Score = 239, Expect = 2.3e-18, Identities = 89/310 (28%), Positives = 138/310 (44%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWI---QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN--KNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           K R L++ ERE I  +       +  IA  L R  STI REI RN    G Y A  A      R +           +  E   EK   + H  E     ++ ++P    +  ST+ IY  +            +  LRT     R  +K    K     +     RPK + +R   GHWE DL++GKR    S +  +VER T    +  + +  K   T  +  + L        +T+T D G E       +      +Y+C+P+A +QRG+NEN NG++R+ + KG+D S+ S A++  +  ++N  PRK   +
  S:    59 KGRCLTFAEREEIA-IGIAAGHTLRDIAKTLNRSPSTISREIARNREPSGRYRARSAHAAAYHRASRPKPSKLAINPSLRET-VEKSLTERHSPEQIAGRLRLDFPDDPQMRVSTETIYQSLYQPSRGGLEHTLTRSLRTGRGLRRPSRKAGQRKNRIPDMANIADRPKDVKDRAVPGHWEGDLIVGKRN--LSAIGTLVERSTGTVMLVHLPDGYKPEQTAPALTEQLETLPTSLRRTLTWDQGSEMRDWKSVSAATGIDIYFCDPHAPWQRGTNENTNGILRQYFPKGSDLSVHSKADLEWVSRQLNERPRKRLEF 372
>gi|2981017|gb|AAC06202.1| putative transposase [Acinetobacter sp. BM2716] (320 aa)
Score = 239, Expect = 2.4e-18, Identities = 101/315 (32%), Positives = 152/315 (48%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSEL--FAEKY-----NCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRK-RKKGMFSK------FDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKV--ENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFS---KIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           KY  LS  ER  I +     K +I  +  EL R RSTI RE++RN    GY A++A K   +RR          Y+  S +  FA  Y        W   +++    +  +  + VPS + IY +I  +K    +  KL       +K RK+G  +        D+  +H    R + I  R+  G +E D VIGK   G   LL +V+RK+    I  +     +  TI  A+  L      H  ++T DNG EFS   +I  A      + Y+ +PY S QR  NEN NGLIR+   K + F  +S+ +I  ++  +N  PRK   + +  +
  S:     3 KYTQLSQDERYEI-YATLKSKGSIASLVRELGRSRSTIYRELKRNTGQRGYRAQQAAKFASQRR----------YRPSSSMTAFAFAYIDYLIGLDWSPEQISGALTQRGW--LDVPSHEWIYQYIYQDK---SKGGKLHLHLRHQKKYRKRGYKNTDRRGQIIDKTSIH---CRDQVIDQRQRLGDFEGDTVIGKHHKG--ALLTLVDRKSLYVHIVHLGSTRASSQTITCALDRLRMS---HAYSVTFDNGKEFSEHKRITDAG----IETYFADPYKSIQRARNENTNGLIRQYLPKSSSFDGVSNEQIEQIEFALNHRPRKTLGWYTPSE 308
>gi|134097499|ref|YP_001103160.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] >gi|133910122|emb|CAM00235.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] (469 aa)
Score = 238, Expect = 2.9e-18, Identities = 84/310 (27%), Positives = 146/310 (47%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPC--VLVPSTKQIYN--WIQTNKWIKKRSDKLRTAYIKGRKRKKGMFS--KFDEKYVHPFWM---RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           R L+  ERE I  +   +  ++  I   L R  STILREIR N+    Y    A +    RR               +   +    +W   ++  H + + +P    +  S + IY   + Q    +K+   +++ A   GR R+K   +  +   +++ P  M   RP  + +R   GHWE DL+IG      S +  +VER TR + +  + N  +   +   + + +     H++ ++T D G E ++           VY+C+P + +QRGSNEN NGL+R+ + KGTD       ++ ++  ++N  PRK   + S
  S:   143 RLLTLVERERIRDLR-AEGHSLRAIGKALGRSASTILREIRANSTHGAYRPYAAHRAAAARRPRPKQRKLIAQGPLRQFVVDGLRKRWSPEQIC-HALGKEHPGDQRMRVSVETIYQALYFQARGGLKR---EVQAAIRTGRTRRKPRRNPNQRTARFIDPMVMISDRPAEVEDRAVPGHWEGDLIIGA--GSQSAIGTLVERTTRYTMLVHLPNGHDAEAVRDGLVATITTLPTHLRGSLTWDQGAEMARHKQFTMATDMPVYFCDPASPWQRGSNENTNGLLRQYFPKGTDLGTYGPEDLEHVAQQLNGRPRKTLGWDS 456
>gi|111019768|ref|YP_702740.1| transposase [Rhodococcus sp. RHA1] >gi|110819298|gb|ABG94582.1| probable transposase [Rhodococcus sp. RHA1] (446 aa)
Score = 238, Expect = 3.2e-18, Identities = 92/310 (29%), Positives = 144/310 (46%)
  Q:    13 KYRHLSYGEREII------GHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWI-QTNKWIKKRS--DKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN--KNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           K R L++ ERE I      GH        + +IA  L R  STI REI RN    G Y A  A      R +           +  E   EK   + H  E     ++ ++P    +  ST+ IY  + Q ++   + +    LRT     R  +K    K     +     RPK + +R   GHWE DL++GKR    S +  +VER T    +  + +  K   T  +  + L        +T+T D G E       +      +Y+C+P+A +QRG+NEN NG++R+ + KG+D S+ S A++  +  ++N  PRK   +
  S:   120 KGRCLTFAEREEIAIGDAAGH-------TLREIAKALNRSPSTISREIARNCEPSGRYRARSAHAAAYHRASRPKPSKLAINPSLRET-VEKSLTERHSPEQIAGRLRLDFPDDPQMRVSTETIYQSLYQPSRGGLEHTLTRSLRTGRGLRRPSRKAGQRKNRIPDMANIADRPKDVKDRAVPGHWEGDLIVGKRN--LSAIGTLVERSTGTVMLVHLPDGYKPEQTAPALTEQLETLPTSLRRTLTWDQGSEMRDWKSVSAATGIDIYFCDPHAPWQRGTNENTNGILRQYFPKGSDLSVHSKADLEWVSRQLNERPRKRLEF 433
>gi|94993472|ref|YP_601570.1| Transposase [Streptococcus pyogenes MGAS10750] >gi|94546980|gb|ABF37026.1| Transposase [Streptococcus pyogenes MGAS10750] (330 aa)
Score = 238, Expect = 3.5e-18, Identities = 83/284 (29%), Positives = 135/284 (47%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           R  + +++R+      YSA+ AQ  Y E R      + Q+ +                 E   HY+++NY   ++   K        IY WI   K    +   L   Y +  K+ +   S + +        RP  I  R E GH+E+D VI  R      LL + +RKTR+  I  + +K+   +N A+  ++   +  V +IT DN  EFS++  +  +    +YY  PYAS++RG+NEN N LI R   KGT  +  +  E+  +++ IN  P+++FNY S  +  K
  S:    50 RGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQD---------------REAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAML---YPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVIMTRAKNQC-LLTLTDRKTRHQLIRLIPDKSAQAVNEALTGILK--DYTVNSITTDNRTEFSRL--SDVFPASAIYYAHPYASWERGTNENHNRLILRWLPKGTKTT--TPKEVAAIEHWINHYPKRLFNYKSPVEMLK 315
>gi|116332796|ref|YP_794323.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116333536|ref|YP_795063.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116495472|ref|YP_807206.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116495632|ref|YP_807366.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116496123|ref|YP_807857.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116496277|ref|YP_808011.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116098143|gb|ABJ63292.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] >gi|116098883|gb|ABJ64032.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] >gi|116105622|gb|ABJ70764.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116105782|gb|ABJ70924.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116106273|gb|ABJ71415.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116106427|gb|ABJ71569.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] (309 aa)
Score = 237, Expect = 3.8e-18, Identities = 90/311 (28%), Positives = 140/311 (45%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYN---CKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           ++Y ER  I     +   NI Q+   L R  STI  E+ R    + Y AE AQ     +R+       +K K   EL  +  N     W    +  H  K         +TK IYNW+   + I    + L    ++ R R     SK+++        RP  I  R   G +ELD V+G R    + LL +++RK+R  +  +++++   T+N A+   +   N  V + T+D G EFS +         K YYC  Y   +RGSNE  N  +R  Y KGT F  +S  ++     +IN+ P K+ ++ +  Q
  S:     4 ITYSERIKIETFCELGLSNI-QMGVRLNRSPSTISYELSR---CQPYQAELAQTDAEYKRSRCG----RKTKLSDELKQKILNHLRLSW-SPGMIAHEFKL--------ATKSIYNWLNQGR-IGFSLNDLPEHGVRQR-RNVDQRSKYNQSLGRSIEQRPMMINQRNRIGDFELDTVVGPRGHSKAVLLTLIDRKSRFLWAYRLKDRTTATVNEALTKFLTTFNGPVHSFTVDRGTEFSGLVSLESQYGIKTYYCHAYTPAERGSNERFNRNLRYFYPKGTRFEHISAQDLTTTLLQINQRPLKILDWQTPYQ 298
>gi|145220986|ref|YP_001131664.1| integrase catalytic subunit [Mycobacterium gilvum PYR-GCK] >gi|145213472|gb|ABP42876.1| Integrase, catalytic region [Mycobacterium gilvum PYR-GCK] (401 aa)
Score = 237, Expect = 3.9e-18, Identities = 88/303 (29%), Positives = 149/303 (49%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIER-RNHKNFFL----------------WQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVE-NKNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPR 317
           R LS+ ER  I        ++  +I  EL R RS I RE++RN   +G Y A  A     ++ R  K F L                W   K  S++ AE Y     G +L +   +  Y C+ V +  Q+   +      K  S K +    +G + + G++   D   +     RP    +R   GHWE DL++G R    S +  +VER TR   +  +  +    ++ +A+   + +   H++ +IT D G E +        +   V++C+P++ +QRG+NEN N L+R  ++KG+D S+ +  ++N +  K+N  PR
  S:    75 RRLSFAERFEIDRG-LQAGRSYAEIGRELGRDRSVIAREVKRNCLPDGRYHALMAHAAASQKARRPKTFKLDNPVLCALIAGWMDEGWSP-KLISQVLAEVYA----GDKLMQVSHETIYQCLYVQTRGQLRADLH-----KCLSTKRQARSPRGHRGRTGVY---DPDTIFTISDRPAEANDRAVPGHWEGDLILGARHG--SAIGTLVERSTRFVILLHLPVDHTAQSVAAAMIEAMGELPAHLRRSITWDRGSEMASWKHIQMQLNSPVFFCDPHSPWQRGTNENTNRLLRFWFEKGSDLSVHTRDDLNIVAAKLNNRPR 381
>gi|149002459|ref|ZP_01827393.1| IS1239, transposase, putative [Streptococcus pneumoniae SP14-BS69] >gi|149019501|ref|ZP_01834820.1| IS1239, transposase, putative [Streptococcus pneumoniae SP23-BS72] >gi|147759396|gb|EDK66388.1| IS1239, transposase, putative [Streptococcus pneumoniae SP14-BS69] >gi|147930876|gb|EDK81856.1| IS1239, transposase, putative [Streptococcus pneumoniae SP23-BS72] (349 aa)
Score = 237, Expect = 4.0e-18, Identities = 101/316 (31%), Positives = 160/316 (50%)
  Q:     9 NDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN---------VEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENY-PCVLVPST------KQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           N T K +HL+   R +I   +  + K+  +IA+ L +   TI  +I+R             E YSA+ AQ+ Y   R H       K  + ++   EK            HY  + + P ++V +         IY WI   K    + D L     KG+  KK   + F +        RP+ I  R E GH+E+D V+  R   Y  LLV+ +RK+R+  I  + NK+   +N A+K ++ ++   + +IT DNG EF+++  +  + +  +YY  PYAS++RG+NEN N LIRR   KGT    ++  E+  ++  IN  P+K  NY S
  S:     4 NYTTKGKHLTIDSRRLI-ERWKKEGKSNREIASLLGKAPQTIHTKIKRRTVRKCLGKGRFKEVYSADYAQQSYENNRKHS-----VKRSSVTKELKEK----------ILHYHNQKFLPEMMVMAKGVNVGISTIYYWIHHGKLGLSKQDLLYPR--KGKALKKQASTNF-KPAGQSIAQRPEAINFRLENGHYEIDTVLLTRAKNYC-LLVLTDRKSRHQIIRLIPNKSAEVVNQALKLILKQHK--ILSITADNGTEFNRL--SNVFSEEHIYYAHPYASWERGTNENHNRLIRRWLPKGT--KKMTPKEVAFIEKWINNYPKKCLNYKS 309
>gi|134097385|ref|YP_001103046.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] >gi|134099525|ref|YP_001105186.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] >gi|133910008|emb|CAM00120.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] >gi|133912148|emb|CAM02261.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] (469 aa)
Score = 237, Expect = 4.0e-18, Identities = 84/310 (27%), Positives = 146/310 (47%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPC--VLVPSTKQIYN--WIQTNKWIKKRSDKLRTAYIKGRKRKKGMFS--KFDEKYVHPFWM---RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           R L+  ERE I  +   +  ++  I   L R  STILREIR N+    Y    A +    RR               +   +    +W   ++  H + + +P    +  S + IY   + Q    +K+   +++ A   GR R+K   +  +   +++ P  M   RP  + +R   GHWE DL+IG      S +  +VER TR + +  + N  +   +   + + +     H++ ++T D G E ++           VY+C+P + +QRGSNEN NGL+R+ + KGTD       ++ ++  ++N  PRK   + S
  S:   143 RLLTLVERERIRDLR-AEGHSLRAIGKALGRSASTILREIRANSAHGAYRPYAAHRAAAARRPRPKQRKLIAQGPLRQFVVDGLRKRWSPEQIC-HALGKEHPGDQRMRVSVETIYQALYFQARGGLKR---EVQAAIRTGRTRRKPRRNPNQRTARFIDPMVMISDRPAEVEDRAVPGHWEGDLIIGA--GSQSAIGTLVERTTRYTMLVHLPNGHDAEAVRDGLVATITTLPTHLRGSLTWDQGAEMARHKQFTMATDMPVYFCDPASPWQRGSNENTNGLLRQYFPKGTDLGTYGPEDLEHVAQQLNGRPRKTLGWDS 456
>gi|116333909|ref|YP_795436.1| IS30 family transposase [Lactobacillus brevis ATCC 367] >gi|116099256|gb|ABJ64405.1| Transposase, IS30 family [Lactobacillus brevis ATCC 367] (309 aa)
Score = 237, Expect = 4.4e-18, Identities = 62/205 (30%), Positives = 101/205 (49%)
  Q:   123 STKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           +TK IYNW+   + I    + L    ++ R R     SK+++        RP  I  R   G +ELD V+G R    + LL +++RK+R  +  +++++   T+N A+   +   N  V + T+D G EFS +         K YYC  Y   +RGSNE  N  +R  Y KGT F  +S  ++     +IN+ P K+ ++ +  Q
  S:    96 ATKSIYNWLNQGR-IGFSLNDLPEHGVRQR-RNVDQRSKYNQSLGRSIEQRPMMINQRNRIGDFELDTVVGPRGHSKAVLLTLIDRKSRFLWAYRLKDRTTATVNEALTKFLTTFNGPVHSFTVDRGTEFSGLVSLESQYGIKTYYCHAYTPAERGSNERFNRNLRYFYPKGTRFEHISAQDLTTTLLQINQRPLKILDWQTPYQ 298
>gi|110005439|emb|CAK99761.1| transposase of is30 family protein [Spiroplasma citri] (322 aa)
Score = 236, Expect = 4.6e-18, Identities = 96/316 (30%), Positives = 159/316 (50%)
  Q:    14 YRHLSYGER----EIIGHMYFVQK---KNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYI---KENYPCVLVPSTKQIYNWIQTN--KWIKKRSDKLRTAYI-KGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL--HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           Y HLS+ ++    +++    F++K   +NI+ IA  L RHRSTILREI+R   ++ YSA K+ K Y E+R   N       +  + +            EL   Y    K  +P  +    K +Y WI+     ++K+        Y  KG+   +G  + F        W     + N    G  E+D V+GK     S +LV+VE+ ++  F  K+EN     +    K ++ KNNL   +K I  D+G EFS+      + + +VY+C+P +  Q+   E +N  +R  + KGTDF+ +S  +I+ + N IN   R   N++S+ + +
  S:     2 YSHLSFMDKVKLEQLLLSKIFLKKNGEQNISAIAKYLNRHRSTILREIKRFKTIDEYSAYKSDKMYYEKRKKNNKRFKFTEEQLNFIHLRFNVYHDSPSELIYRYFLKFKVKFPVCV----KTLYKWIRLGFYGFLKQNLRHHGKKYKRKGKSDNRGKLTDFKS-----IWDIDNKVFN---VGWLEMDTVVGKDHK--SAILVLVEQLSKKYFAIKLENYTAREVEKKFKDIIIKNNLIGKIKGIITDHGKEFSEWREMEIFAETQVYFCDPGSPQQKPLIEYMNSELRHWFPKGTDFNKVSQKQIDWVVNVINDKLRPCLNWISAKEMF 318
>gi|28301749|gb|AAO38817.1|AF459445_4 transposase TraISLpl1 [Lactobacillus plantarum] (309 aa)
Score = 236, Expect = 4.8e-18, Identities = 90/311 (28%), Positives = 140/311 (45%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYN---CKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           ++Y ER  I     +   NI Q+   L R  STI  E+ R    + Y AE AQ     +R+       +K K   EL  +  N     W    +  H  K         +TK IYNW+   + I    + L    ++ R R     SK+++        RP  I  R   G +ELD V+G R    + LL +++RK+R  +  +++++   T+N A+   +   N  V + T+D G EFS +         K YYC  Y   +RGSNE  N  +R  Y KGT F  +S  ++     +IN+ P K+ ++ +  Q
  S:     4 ITYSERIKIETFCELGLSNI-QMGVRLNRSPSTISYELSR---CQPYQAELAQTDAEYKRSRCG----RKTKLSDELKQKILNHLRLSW-SPGMIAHEFKL--------ATKSIYNWLNQER-IGFSLNDLPEHGVRQR-RNVDQRSKYNQSLGRSIEQRPMMINQRNRIGDFELDTVVGPRGHSKAVLLTLIDRKSRFLWAYRLKDRTTATVNEALTKFLTTFNGPVHSFTVDRGTEFSGLVSLESQYGIKTYYCHAYTPAERGSNERFNRNLRYFYPKGTRFEHISAQDLTTTLLQINQRPLKILDWQTPYQ 298
>gi|134100247|ref|YP_001105908.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] >gi|133912870|emb|CAM02983.1| transposase, ISlxx5 [Saccharopolyspora erythraea NRRL 2338] (313 aa)
Score = 236, Expect = 4.9e-18, Identities = 74/289 (25%), Positives = 137/289 (47%)
  Q:    34 KNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPC--VLVPSTKQIYN--WIQTNKWIKKR-SDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM---RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFT-INSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           +++  I   L R  ST+ REI   +    Y   +AQ+ +   R               +  A K   +W   ++    + E +P    +  S + IY   ++Q    +++  +  LRT   + +  +K    +   ++V    M   RP  + +R   GHWE DL++G R    S ++ +VER TR   +  +   +    +   +  L+     H++ ++T D G E +            VY+C+P++ +QRG+NEN NGL+R+ + KGTD S+ S  ++ ++  ++N  PRK   +
  S:     6 RSLRAIGRALGRSASTVKREIDARSTDGVYQPHRAQRAWANSRARPKESKLALDGPLRDYVACKLRERWSPEQICHALVLE-FPDDESMRVSPETIYQAIYVQARGGLRREVAAALRTGRTRRKPHRKP--DQLTPRFVEEMVMISERPPQVEDRAVPGHWEGDLIVGARNE--SAIVTLVERCTRYVMLGHLPGGHTAEEVRDVLVPLIQTLPEHLRGSLTWDQGCEMAAHKQFTVTTAVPVYFCDPHSPWQRGTNENTNGLLRQYFPKGTDLSVHSAEDLEHVAQQLNGRPRKTLGW 299
>gi|32455515|ref|NP_862292.1| hypothetical protein pMD5057_010 [Lactobacillus plantarum] >gi|24020995|gb|AAN40887.1|AF440277_9 iso-IS30 [Lactobacillus plantarum] (285 aa)
Score = 236, Expect = 5.6e-18, Identities = 62/205 (30%), Positives = 101/205 (49%)
  Q:   123 STKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           +TK IYNW+   + I    + L    ++ R R     SK+++        RP  I  R   G +ELD V+G R    + LL +++RK+R  +  +++++   T+N A+   +   N  V + T+D G EFS +         K YYC  Y   +RGSNE  N  +R  Y KGT F  +S  ++     +IN+ P K+ ++ +  Q
  S:    72 ATKSIYNWLNQGR-IGFSLNDLPEHGVRQR-RNVDQRSKYNQSLGRSIEQRPMMINQRNRIGDFELDTVVGPRGHSKAVLLTLIDRKSRFLWAYRLKDRTTATVNEALTKFLTTFNGPVHSFTVDRGTEFSGLVSLESQYGIKTYYCHAYTPAERGSNERFNRNLRYFYPKGTRFEHISAQDLTTTLLQINQRPLKILDWQTPYQ 274
>gi|121633863|ref|YP_976101.1| hypothetical protein pVEF1_038 [Enterococcus faecium] >gi|124112029|ref|YP_001019058.1| hypothetical protein pVEF211 [Enterococcus faecium] >gi|190606532|ref|YP_001974817.1| hypothetical protein -pVEF3_p48 [Enterococcus faecium] >gi|121490922|emb|CAL36558.1| hypothetical protein [Enterococcus faecium] >gi|124012131|emb|CAL90964.1| hypothetical protein [Enterococcus faecium] >gi|190350302|emb|CAP62654.1| hypothetical protein [Enterococcus faecium] (196 aa)
Score = 236, Expect = 5.9e-18, Identities = 58/152 (38%), Positives = 86/152 (56%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENK-NPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIG-IAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           RP     R E GHWE D V GK  +G + ++ +V+R++R S + KVE K +   ++  I  + N      KT+T D G EFS+   I       KVY+ +P+A +QR +NEN NGL+R    KG D S + +++I    NK+N  PRK  N+ +
  S:    32 RPSAANERLEIGHWEADTVAGK--TGRARIVTLVDRRSRFSLLGKVEKKISKNVVDCMINLIRNVGEDKCKTVTPDRGKEFSQHSRITLELNGTKVYFPDPHAPWQRCTNENTNGLLREYSPKGEDISGIFNSQIQEWANKLNTRPRKCLNWKT 183
>gi|187476324|gb|ACD12649.1| ISlsa1-orfA [Lactobacillus sakei] (222 aa)
Score = 235, Expect = 6.4e-18, Identities = 62/205 (30%), Positives = 101/205 (49%)
  Q:   123 STKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           +TK IYNW+   + I    + L    ++ R R     SK+++        RP  I  R   G +ELD V+G R    + LL +++RK+R  +  +++++   T+N A+   +   N  V + T+D G EFS +         K YYC  Y   +RGSNE  N  +R  Y KGT F  +S  ++     +IN+ P K+ ++ +  Q
  S:     9 ATKSIYNWLNQGR-IGFSLNDLPEHGVRQR-RNVDQRSKYNQSLGRSIEQRPMMINQRNRIGDFELDTVVGPRGHSKAVLLTLIDRKSRFLWAYRLKDRTTATVNEALTKFLTTFNGPVHSFTVDRGTEFSGLVSLESQYGIKTYYCHAYTPAERGSNERFNRNLRYFYPKGTRFEHISAQDLTTTLLQINQRPLKILDWQTPYQ 211
>gi|146279498|ref|YP_001169656.1| hypothetical protein Rsph17025_3475 [Rhodobacter sphaeroides ATCC 17025] >gi|145557739|gb|ABP72351.1| hypothetical protein Rsph17025_3475 [Rhodobacter sphaeroides ATCC 17025] (402 aa)
Score = 235, Expect = 6.6e-18, Identities = 95/310 (30%), Positives = 160/310 (51%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-----------YSAEKAQKKYIERRNHKN--------------------------FFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYN--WIQTNKWIKK------RSDK-LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFI-----------TKVENKNPF-------TINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           R LS+ ERE I  +   +K  +  IA +L R  STI REIRRN+   G           + A++A ++    +   N                            +W+K +      + +++  W   ++ +  +K ++P    +  S + IY   +IQ    +K+      RS + LR    + R R K      D   +     RP  + +R+  GHWE DL++G    G S +  +VER TR + +           T+     P         +  AI   +     H++ ++T D G E ++     +     VY+C+P + +QRGSNEN NGL+R+ + KGTD S      +N + + +N  PRK   + +
  S:    16 RSLSFAEREEIA-LECARKTGVRAIARKLGRSPSTISREIRRNSATRGGDFDCRAITAQWHADRAAQRPKTSKLANNPALRDYEQDRLAGVIATPDGVAFDGPVVVWKKRRAVHRQ-SRRWSLAWSPEQIAQR-LKMDFPEDPTMRISHEAIYQALYIQGRGALKRELSACLRSGRALRLPRERARNRGKAFVG--DALMISD---RPAEVGDREVPGHWEGDLILGL---GSSAIGTLVERTTRFTMLLHLPRMEGHGATRSIKNGPALAGHGAEAVRDAIADTIMDLPAHLRRSLTWDQGAEMAQHARLRFDTGLDVYFCDPRSPWQRGSNENTNGLLRQYFPKGTDLSQYGVDALNAVAHALNTRPRKTLGWQT 381
>gi|10954694|ref|NP_066629.1| hypothetical protein pRi1724_p049 [Agrobacterium rhizogenes] >gi|8918694|dbj|BAA97759.1| riorf48 [Agrobacterium rhizogenes] >gi|10567358|dbj|BAB16167.1| riorf48 [Agrobacterium rhizogenes] (333 aa)
Score = 235, Expect = 6.9e-18, Identities = 52/157 (33%), Positives = 85/157 (54%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTI-NSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           RP  I NR EFGHWE DL+I KR+ G +N+  +VERK+R + + K  +++   I +  + +      L  ++ T D G EFS        I  + ++C+P A +Q+G+ EN N  IRR     TD + ++  ++  L + +N  PRK   Y +  + +
  S:   168 RPDSIGNRTEFGHWEGDLLIFKRELGPTNVTSLVERKSRYTVMLKNNSRHSRPIMDKIVHAFSPLPALARRSFTFDRGTEFSGFRALEEGIGARSWFCDPSAPWQKGAVENTNKRIRRFMPGDTDIAKVTQQQLTELAHHLNSQPRKCLGYRTPAEAF 325
>gi|37783321|gb|AAP44572.1| hypothetical protein [Lactobacillus sakei] (307 aa)
Score = 235, Expect = 7.0e-18, Identities = 83/306 (27%), Positives = 144/306 (47%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGR--KRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           LS+  R +I  ++  + +++  IA  L   ++TI  E+ R N+   Y A  AQ  + ER+  +        K    L  EK   +    E   H +   Y        K +YNWI    W+  +   L    I+    K K+G F+     +      RP  +  R+EFGH+E D V+  ++ G + +   VERK+R + + ++  ++  ++  A+  L ++    +KT+T+D+G EF+           +VY+   Y+ ++RGSNEN N ++RR   KG     LSD ++  +   +N  P K  N+
  S:     6 LSFQNRVVIETLH-NEGRSLRYIANYLGFSKTTIFNELHRLNS--EYQAGLAQTDF-ERKVSQRGRKSSLTKNLKHLIEEKIQVQKWSPEQVAHVVGIAY--------KTVYNWIDQG-WLDIQLPDLPDHGIRRHRAKEKRGTFN-----HGRSIEERPHKVETRQEFGHFEADTVLSGKRKGQA-VATFVERKSRLTIVKRLHGRDSQSMTQAVLELASQLQDKLKTLTVDHGKEFANYQTIERRTGTQVYFAHAYSPHERGSNENRNRVLRRFIPKGQAIEELSDHQLVQINWYLNSRPLKCLNW 294
>gi|84502345|ref|ZP_01000493.1| TRm24 putative transposase [Oceanicola batsensis HTCC2597] >gi|84389705|gb|EAQ02424.1| TRm24 putative transposase [Oceanicola batsensis HTCC2597] (322 aa)
Score = 235, Expect = 7.1e-18, Identities = 87/316 (27%), Positives = 151/316 (47%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-------NVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELT-RHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHP----FWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITK-VENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           +  L   ER +I  M       +++IA EL RHRS++ REI+RN         + GY    AQK   +RR  +   +  ++    +    +    W   ++  R   +   P V   S + IY ++        +S +L       RK+++  +++     V P       RP H+  R+ FG WE DL+I +R  G +N+  +VERKTR + + +  E      +N  +  +        ++IT D GIEF         I  +V++C+P A +Q+GS EN+N   RR   + T  + LS+  +  + +++N  PRK   + +  + +
  S:     3 HTELDLRERRVIEDMLNATMP-VSKIAVELGRHRSSVYREIKRNRFADDELPYLNGYYGMVAQKAARDRRARRRKLI--RFPELRKAVIAQMMEGWSPEQIAGRLQFEGRRPRV---SDETIYTYVFGPD---GQSAELARHLPSRRKKRQPRYARRPSGLVFPPDRSIHQRPDHVKIRETFGEWEGDLMIFERAQGNANIASLVERKTRFAVLFRNNERSTTHLMNRLMTVMEPLPQPARRSITFDRGIEFRNWRKLEPGIGTEVWFCDPQAPWQKGSVENLNKRARRYLPRDTPVAALSNRNMRAICDRLNGTPRKCLGWRTPTEAF 322
>gi|194467554|ref|ZP_03073541.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194454590|gb|EDX43487.1| Integrase catalytic region [Lactobacillus reuteri 100-23] (307 aa)
Score = 234, Expect = 8.3e-18, Identities = 83/306 (27%), Positives = 142/306 (46%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGR--KRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           LS+  R +I  ++  + +++  IA  L   ++T+  E+ R N    Y AE AQ  + ER+  +        K    L  EK   +    E   H +   Y        K +YNWI    W+  +   L    I+    K K+G FS     +      R   +  R+EFGH+E D V+  ++ G + +   VERK+R + + ++  ++  ++  A+  L ++    +KT+T+D+G EF+            VY+   Y+ ++RGSNEN N ++RR   KG     LSD ++  +   +N  P K  N+
  S:     6 LSFQNRVVIETLH-NEGRSLRYIANYLGFSKTTVFNELHRLNG--EYQAELAQTDF-ERKVSQRGRKSSLTKNLKHLIEEKIQVQKWSPEQVAHVVGIAY--------KTVYNWIDQG-WLDVQLPDLPDHGIRRHRAKEKRGTFS-----HGRSIEERSHKVETRQEFGHFEADTVLSGKRKGQA-VATFVERKSRLTIVKRLHGRDSQSMTQAVLELASQLQDKLKTLTVDHGKEFANYQAIEQRTGTPVYFAHAYSPHERGSNENRNRVLRRFIPKGQAIEELSDYQLVQINWYLNSRPLKCLNW 294
>gi|170721172|ref|YP_001748860.1| integrase catalytic region [Pseudomonas putida W619] >gi|169759175|gb|ACA72491.1| Integrase catalytic region [Pseudomonas putida W619] (339 aa)
Score = 234, Expect = 8.6e-18, Identities = 84/312 (26%), Positives = 151/312 (48%)
  Q:    11 TNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKK-----YIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRT--AYIK---GRKRKKGMFSKFDEKYV--HPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH----VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           T  Y HL+  ER  +  M  +Q  ++  IA  L R  ST+ RE+RR +  E Y A  A  +     ++ R +       + ++    + A+ ++ +     L + Y  +N      P     +  I    +   R +  R    Y++    ++R +       E+Y        RP+ +  R+  GHWE DL++G      S +  MVER +R   + K++     T ++A++ +  + +      +KT+T D   E +K          K+Y+ +P++ +QRGSNEN NGL+R+   KGTD SL+S   ++ + + +N  PR+   +
  S:     2 TTHYTHLTIEERVTLMIMR-MQGASLRAIAQVLGRQPSTLSREVRRQSQPEHYDASTAGARARALRHVPRCSKILAPGSELFQVVHSMLAKGWSPQQIAARL-KDYWPDN------PERHVSHETIYLTIYAYPRGELKRQLIGYLRQGGSKRRTRSTAPARRERYPAEQNIRYRPEEVEGRQVPGHWESDLIMGANNR--SAVATMVERTSRFVILAKLDAP---TADAALEGMTRELSRMAPALLKTMTHDQSSEMAKHQELTARTGMKIYFADPHSPWQRGSNENTNGLLRQYLPKGTDLSLVSQERLDEIADLLNTRPRQTLGW 316
>gi|110005118|emb|CAK99447.1| transposase of is30 family protein [Spiroplasma citri] (327 aa)
Score = 234, Expect = 9.8e-18, Identities = 92/318 (28%), Positives = 156/318 (49%)
  Q:    14 YRHLSYGEREIIGHMYF---VQKKN----INQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWH-----GVELTRHYIKE---NYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL--HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           Y H+ + ER+    ++     +KKN    +++IA ++ R  +T+ REIRR  N+E Y A KA + Y ++R      L     TF+E   E  N +++       E+ + ++ +    +P  L    K  Y WI        + + L        K++     K DE++   + +  K      + G  E+D V+GK     S+ LV+VE+ ++  F  K+EN     +   ++ LV  N L   +K I  D G EFSK           VYYC+P +  Q+   E +N   R+ Y KGTDF+ ++  EIN + + IN   R   N+ ++ + + +
  S:     4 YTHVKFDERKFFKDLFLSDSCKKKNGTLNLSEIARQIGRDINTVKREIRRFKNIEDYDARKAHEDYYKKRKKCIKKL----PTFTEEQQEFLNLRFNILGDSPAEIIQRFLIKFGIKFPACL----KTFYKWIFLGLLGLLKKNLLNGGRKNRTKKRPDNRGKLDERFKSIWDIENKE----SDVGWLEMDTVVGKDH--LSSCLVLVEQSSKKYFAMKLENHTANEVLEKLEELVRINGLVGKIKGIITDRGKEFSKFEEMEKITGSNVYYCDPGSPKQKPLIERMNREFRKRYGKGTDFNPVTQQEINLVVDIINEKLRPCLNWRTAKEIFSE 324
>gi|116252204|ref|YP_768042.1| putative transposase-related protein [Rhizobium leguminosarum bv. viciae 3841] >gi|115256852|emb|CAK07944.1| putative transposase-related protein [Rhizobium leguminosarum bv. viciae 3841] (324 aa)
Score = 233, Expect = 1.3e-17, Identities = 89/318 (27%), Positives = 161/318 (50%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRN-------NNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELT-RHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHP----FWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMN 334
           +S+ ER  I  M   QK + ++IA  L R R+TI REI+RN        + EGY A  A     +RR      L+++    +E+   K    W   ++  R  I+      +   T  IY ++ + +    +  +L     + R++++  +++  +  V P       RP+ I +RKEFGHWE DL+I +R  G +N+  +VER +R + + K  ++    I   +  +++    H + ++T D G EF         +    ++C+P A +Q+GS EN+N  IRR   + T    + D  I +L +++N  PRK   + +  + +++ +N
  S:     1 MSFDERRSISRM-LDQKFSQSEIARRLGRDRATISREIKRNYWHDQEFPDAEGYWAMTANDMARDRRRRIGK-LFRREDLRNEVIG-KLESGWSPEQIAGRLKIEPAAKASVCHET--IYRYVYSPE---GQRQQLARLLPERRRKRRPRYARKPQNPVFPDERSIKHRPEAINDRKEFGHWEADLMIFERVQGNANVATVVERTSRFTMLFKNNDRQSKPIMERLIDVLSPLPRHARQSLTFDRGFEFVSWRRLKQGMGTDAWFCDPSAPWQKGSVENMNRRIRRYLPRDTAVLSVPDESIRSLIDRLNSTPRKCLGFRTPTEVFRREVN 323
>gi|55820792|ref|YP_139234.1| truncated IS1239 transposase [Streptococcus thermophilus LMG 18311] >gi|55736777|gb|AAV60419.1| IS1239, transposase, IS30 family, truncated [Streptococcus thermophilus LMG 18311] (282 aa)
Score = 232, Expect = 1.5e-17, Identities = 85/282 (30%), Positives = 140/282 (49%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNH--KNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP-------CVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           R T L+++R+    + YSA+ AQ  Y   R    K   L ++ K                 E   HY K+ +          +      IY W         ++D L     K  K++     K   K +     RP+ I  R E GH+E+D V+  R   +  LLV+ +R++R+  I  + NK   ++N A++ ++ ++  H+ +IT DNG EFS++  A  + + ++YY  PY+S++RG+NEN N LIRR   KGT  + L   E+  ++N IN  P+K  +Y S  ++
  S:    15 RGTTLQQVRKGLYKKVYSADYAQTVYQTNRKPSVKKIILTKEMK-----------------EKILHYAKQKFSPEMMVKKKKMKVGISTIYYWFHNGHLGLTKADMLYPRKGKSVKKQASPNFKPAGKSIED---RPEVINLRLENGHYEIDTVLLTRVKNHC-LLVLTDRRSRHQIIRLLPNKTTESVNQALEGILREH--HILSITADNGTEFSRL--AEVFPEERIYYAHPYSSWERGTNENHNRLIRRWLPKGTKKTTLK--EVAFIENWINNYPKKCLDYKSPSEF 278
>gi|55822925|ref|YP_141366.1| truncated IS1239 transposase [Streptococcus thermophilus CNRZ1066] >gi|55738910|gb|AAV62551.1| IS1239, transposase, IS30 family, truncated [Streptococcus thermophilus CNRZ1066] (226 aa)
Score = 232, Expect = 1.5e-17, Identities = 58/156 (37%), Positives = 97/156 (62%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           RP+ I  R E GH+E+D V+  R   +  LLV+ +R++R+  I  + NK   ++N A++ ++ ++  H+ +IT DNG EFS++  A  + + ++YY  PY+S++RG+NEN N LIRR   KGT  + L   E+  ++N IN  P+K  +Y S  ++
  S:    74 RPEVINLRLENGHYEIDTVLLTRVKNHC-LLVLTDRRSRHQIIRLLPNKTTESVNQALEGILREH--HILSITADNGTEFSRL--AEVFPEERIYYAHPYSSWERGTNENHNRLIRRWLPKGTKKTTLK--EVAFIENWINNYPKKCLDYKSPSEF 222
>gi|116513301|ref|YP_812207.1| IS30 family transposase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116092616|gb|ABJ57769.1| Transposase, IS30 family [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (248 aa)
Score = 232, Expect = 1.6e-17, Identities = 68/174 (39%), Positives = 89/174 (51%)
  Q:   121 VPSTKQIYNWIQTNKWIKKRSD-----KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLV----NKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKG 294
           V STK +YN++       K  D     K  T   + R  K+ +    DE        R   I +RK+FGHWE DLV+G +      LL + ERKTR  F+ K+E+K   ++  A   L     +K N   K+IT DNG EF+ +       K  VYY  PY S  +GS E  NGLIRR   KG
  S:    46 VVSTKTLYNYVDLGLMDIKNGDLPEKVKRNTKTRRARVNKRILVRSIDE--------RSPRIESRKDFGHWECDLVLGHKTKDDDVLLTLCERKTRQFFMIKIEDKTSASVMKAFDKLREYYGSKWNQIFKSITTDNGSEFADLSDLEQVSKTLVYYAHPYTSCDKGSVERHNGLIRRYIPKG 220
>gi|50120534|ref|YP_049701.1| transposase (partial) [Pectobacterium atrosepticum SCRI1043] >gi|49611060|emb|CAG74505.1| transposase (partial) [Erwinia carotovora subsp. atroseptica SCRI1043] (180 aa)
Score = 232, Expect = 1.7e-17, Identities = 52/165 (31%), Positives = 90/165 (54%)
  Q:   169 PFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCM 333
           P   R   + +R   GHWE DL+ G + S    +  +VER +R   + K+ +    T+ SA+     + ++ + KT+T D G E +           +VY+C+P + +QRGSNEN + L+R+ + KGTD S+ S   +N++  ++N  PRK  +Y S  + + +C+
  S:    14 PISKRLPDVADRAIPGHWEGDLIQGSKNS---YIFTLVERHSRFVMLAKIRDNKTITVISALIKQARELSVELYKTLTWDRGAEMTSHNQFTVTTDIQVYFCDPQSPWQRGSNENTSRLLRQSFPKGTDLSVHSQQGLNSVARQLNERPRKTLDYESPAERFNQCV 176
>gi|55823124|ref|YP_141565.1| truncated IS1239 transposase [Streptococcus thermophilus CNRZ1066] >gi|55739109|gb|AAV62750.1| IS1239, transposase, IS30 family, truncated [Streptococcus thermophilus CNRZ1066] (225 aa)
Score = 231, Expect = 1.8e-17, Identities = 71/219 (32%), Positives = 119/219 (54%)
  Q:   110 HYIKENYPCVLVPSTKQ------IYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           HY K+ +   ++   K       IY W         ++D L     K  K++     K   K +     RP+ I  R E GH+E+D V+  R   +  LLV+ +R++R+  I  + NK   ++N A++ ++ ++  H+ +IT DNG EFS++  A  + + ++YY  PY+S++RG+NEN N LIRR   KGT  + L   E+  ++N IN  P+K  +Y S  ++
  S:     7 HYAKQKFSPEMMVKKKMKVGISTIYYWFHNGHLGLTKADMLYPRKGKSVKKQASPNFKPAGKSIED---RPEVINLRLENGHYEIDTVLLTRVKNHC-LLVLTDRRSRHQIIRLLPNKTTESVNQALEGILREH--HILSITADNGTEFSRL--AEVFPEERIYYAHPYSSWERGTNENHNRLIRRWLPKGTKKTTLK--EVAFIENWINNYPKKCLDYKSPSEF 221
>gi|116490449|ref|YP_809993.1| IS30 family transposase [Oenococcus oeni PSU-1] >gi|116091174|gb|ABJ56328.1| Transposase, IS30 family [Oenococcus oeni PSU-1] (309 aa)
Score = 230, Expect = 2.4e-17, Identities = 89/311 (28%), Positives = 139/311 (44%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYN---CKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           ++Y ER  I     +   NI Q+   L R  STI  E+ R    + Y AE AQ     +R+       +K K   EL  +  N     W    +  H  K         +TK IYNW+   + I    + L    ++ R R     SK+++        RP  I  R     +ELD V+G R    + LL +++RK+R  +  +++++   T+N A+   +   N  V + T+D G EFS +         K YYC  Y   +RGSNE  N  +R  Y KGT F  +S  ++     +IN+ P K+ ++ +  Q
  S:     4 ITYSERIKIETFCELGLSNI-QMGVRLNRSPSTISYELSR---CQPYQAELAQTDAEYKRSQCG----RKTKLSDELKQKILNHLRLSW-SPGMIAHEFKL--------ATKSIYNWLNQGR-IGFSLNDLPEHGVRQR-RNVDQRSKYNQSLGRSIEQRPMMINQRNRIDDFELDTVVGPRGHSKAVLLTLIDRKSRFLWAYRLKDRTAVTVNEALNKFLATFNGPVHSFTVDRGTEFSGLVSLESQYGIKTYYCHAYTPAERGSNERFNRNLRYFYPKGTYFEHISAQDLTTTLLQINQRPLKILDWQTPYQ 298
>gi|1143013|gb|AAA85003.1| SpV1 ORF3; putative transposase [Spiroplasma citri] (322 aa)
Score = 230, Expect = 2.8e-17, Identities = 97/316 (30%), Positives = 157/316 (49%)
  Q:    14 YRHLSYGER----EIIGHMYFVQK---KNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYI---KENYPCVLVPSTKQIYNWIQTN--KWIKKRSDKLRTAYI-KGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL--HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           Y HLS+ ++    +++    F++K   +NI+ IA  L RHRSTILREI+R   ++ YSA K+ K Y E+R   N       +  + +            EL   Y    K  +P  +    K +Y WI+     ++K+        Y  KG+   +G  + F        W     + N    G  E+D V+GK     S +LV+VE+ ++  F  K+EN     +    K ++ KNNL   +K I  D G EFSK      + + +VY+C+  +  Q+   E +N  +R  + KGTDF+ +S  +I+ + N IN   R   N++SS + +
  S:     2 YSHLSFIDKVKLEQLLLSKIFLKKNGEQNISAIAKYLNRHRSTILREIKRFKTIDEYSAYKSDKMYYEKRKKNNKRFKFTEEQLNFIHLRFNVYHDSPSELIYRYFLKFKVKFPVCV----KTLYKWIRLGFYGFLKQNLRHHGKKYKRKGKSDNRGKLTDFKS-----IWDIDNKVSN---VGWLEMDTVVGKDHK--SAILVLVEQLSKKYFAIKLENHTAREVEKKFKDIIIKNNLIGKIKGIITDRGKEFSKWREMEIFAETQVYFCDAGSPQQKPLIEYMNSELRHWFPKGTDFNKVSQKQIDWVVNVINDKLRPCLNWISSKEMF 318
>gi|116491769|ref|YP_811313.1| IS30 family transposase [Oenococcus oeni PSU-1] >gi|116092494|gb|ABJ57648.1| Transposase, IS30 family [Oenococcus oeni PSU-1] (309 aa)
Score = 230, Expect = 2.9e-17, Identities = 89/311 (28%), Positives = 139/311 (44%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYN---CKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           ++Y ER  I     +   NI Q+   L R  STI  E+ R    + Y AE AQ     +R+       +K K   EL  +  N     W    +  H  K         +TK IYNW+   + I    + L    ++ R R     SK+++        RP  I  R     +ELD V+G R    + LL +++RK+R  +  +++++   T+N A+   +   N  V + T+D G EFS +         K YYC  Y   +RGSNE  N  +R  Y KGT F  +S  ++     +IN+ P K+ ++ +  Q
  S:     4 ITYSERIKIETFCELGLSNI-QMGVRLNRSPSTISYELSR---CQPYQAELAQTDAEYKRSQCG----RKTKLSDELKQKILNHLRLSW-SPGMIAHEFKL--------ATKSIYNWLNQGR-IGFSLNDLPEHGVRQR-RNVDQRSKYNQSLGRSIEQRPMMINQRNRIDDFELDTVVGPRGHSKAVLLTLIDRKSRFLWAYRLKDRTTATVNEALTKFLTTFNGPVHSFTVDRGTEFSGLVSLESQYGIKTYYCHAYTPAERGSNERFNRNLRYFYPKGTYFEHISAQDLTTTLLQINQRPLKILDWQTPYQ 298
>gi|73661644|ref|YP_300425.1| transposase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|73662732|ref|YP_301513.1| transposase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72494159|dbj|BAE17480.1| transposase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72495247|dbj|BAE18568.1| transposase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (332 aa)
Score = 229, Expect = 3.0e-17, Identities = 92/318 (28%), Positives = 155/318 (48%)
  Q:    12 NKYRHLSYGEREIIGHMYFVQKK--NINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKY-IERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKW------------IKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK--NNLHVKTITIDNGIEFSK-IGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           + Y+HL+  ERE I   +F++ K  ++ +IA ++ R  ST+ RE+ RN +   Y+   A   Y   ++      L +    F ++     N +W   ++      E +   L  S   IY  I    +            I+    + +T + K  +  +G       +  +    RP+ I +R+  G WE D V+GK  +G S L+ +V+RKT      KV  K    +   I  L+    NN  + +IT D G EFSK   I +       Y+ +P++ +QRG+NEN NGLIR    KG D   +++ +I +   K+N  PRK F++ +  + +
  S:     2 DSYKHLTIEERERI---FFLKAKGYSLRKIAKDICRSPSTVSRELARNASSGSYNPTYAHNNYKCNKKKCGRKLLLKSKILFDKVKFLFLNQQWSPEQIANRLKSEGFH--LAISYNTIYRAIYLGLFDPPKLSHGNRGCIRLLRHRGKTRHTKSHQENRGRI-----RISYSIHDRPQIINDRERIGDWEADTVMGK--TGKSCLVTLVDRKTGYLLCGKVPKKKSEFVKQKIVDLLGTLPNNKRL-SITPDRGKEFSKHPEITSELDNIPFYFPDPHSPWQRGTNENTNGLIREYIAKGIDIDNITEEQIEHYVYKLNTRPRKRFDWKTPAELF 324
>gi|110004443|emb|CAK98781.1| transposase of is30 family protein [Spiroplasma citri] >gi|110005332|emb|CAK99655.1| transposase of is30 family protein [Spiroplasma citri] (323 aa)
Score = 229, Expect = 3.1e-17, Identities = 96/316 (30%), Positives = 157/316 (49%)
  Q:    14 YRHLSYGER----EIIGHMYFVQK---KNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHY---IKENYPCVLVPSTKQIYNWIQTN--KWIKKRSDKLRTAYI-KGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL--HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           Y HLS+ ++    +++    F++K   +NI+ IA  L RHRSTILREI+R   ++ YSA K+ K Y E+R   N       +  + +            EL   Y    K  +P  +    K +Y WI+     ++K+        Y  KG+   +G  + F        W     + N    G  E+D V+GK     S +LV+VE+ ++  F  K+EN     +    K ++ KNNL   +K I  D G EFSK      + + +VY+C+  +  Q+   E +N  +R  + KGTDF+ +S  +I+ + N IN   R   N++S+ + +
  S:     2 YSHLSFMDKVKLEQLLLSKIFLKKNGEQNISAIAKYLNRHRSTILREIKRFKTIDEYSAYKSDKMYYEKRKKNNKRFKFTEEQLNFIHLRFNVYHDSPSELIYRYFLKFKVKFPVCV----KTLYKWIRLGFYGFLKQNLRHHGKKYKRKGKSDNRGKLTDFKS-----IWDIDNKVFN---VGWLEMDTVVGKDHK--SAILVLVEQLSKKYFAIKLENYTAREVEKKFKDIIIKNNLIGKIKGIITDRGKEFSKWREMEIFAETQVYFCDAGSPQQKPLIEYMNSELRHWFPKGTDFNKVSQKQIDWVVNVINDKLRPCLNWISAKEVF 318
>gi|116618153|ref|YP_818524.1| IS30 family transposase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097000|gb|ABJ62151.1| Transposase, IS30 family [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (393 aa)
Score = 229, Expect = 3.1e-17, Identities = 96/301 (31%), Positives = 154/301 (51%)
  Q:    16 HLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVE-------------------GYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNC--KWHGVE-LTRHYIKENYPCVLVPSTKQIYNW-------IQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYV-------HPFWMRPKHILNRKEFGHWELDLVI-----GKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYW---IKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMP 316
           H++  +R +I +++ ++K     IA  L    S+ILRE+ R N ++                    YSA++ Q   +++R+        K  T S L  E       W  VE  T   I  N   V V S   I  W       I+ +K+ ++       A  + R+ K+   ++  E+         H  + R + + +RK+FGHWE+DLV+      +R    + ++   ERKTR + +  V +K    +  A K    +    V+TIT DNG EF       Y    +K K+YY  P +  QRGSNEN N  +R  Y KGT F  +   +++ + +K+N MP
  S:    14 HINENQRHMIEYLWNIEKMTQADIARRLGYTPSSILRELHRGNTLDFSHVDRRTLLNMEDIHARIKYSAQRGQYLALKKRS--------KMGTGSRLTPELKEIIETWVNVEHWTPEQIAGNVQDVDV-SASVIRLWARKGLIDIRKHKYHRQNGTPKERAVAQTRRAKEREIARLREQLKNDGELVRHSIFDRSQVVESRKQFGHWEIDLVLPAKMNNQRYQDTTAIMTFTERKTRFTALVLVRSKKSSDMVDAFKLFYERYGKAVRTITADNGSEFISWDFLEYVQKELKIKLYYATPSSPQQRGSNENRNRKLRDWYPKGTSFKDVKQRQLDEVASKMNAMP 349
>gi|55822095|ref|YP_140536.1| IS1239 transposase [Streptococcus thermophilus CNRZ1066] >gi|55822211|ref|YP_140652.1| IS1239 transposase [Streptococcus thermophilus CNRZ1066] >gi|55822224|ref|YP_140665.1| IS1239 transposase [Streptococcus thermophilus CNRZ1066] >gi|55822348|ref|YP_140789.1| IS1239 transposase [Streptococcus thermophilus CNRZ1066] >gi|55822660|ref|YP_141101.1| IS1239 transposase [Streptococcus thermophilus CNRZ1066] >gi|55822990|ref|YP_141431.1| IS1239 transposase [Streptococcus thermophilus CNRZ1066] >gi|55823396|ref|YP_141837.1| IS1239 transposase [Streptococcus thermophilus CNRZ1066] >gi|55823572|ref|YP_142013.1| IS1239 transposase [Streptococcus thermophilus CNRZ1066] >gi|55738080|gb|AAV61721.1| IS1239, transposase, IS30 family [Streptococcus thermophilus CNRZ1066] >gi|55738196|gb|AAV61837.1| IS1239, transposase, IS30 family [Streptococcus thermophilus CNRZ1066] >gi|55738209|gb|AAV61850.1| IS1239, transposase, IS30 family [Streptococcus thermophilus CNRZ1066] >gi|55738333|gb|AAV61974.1| IS1239, transposase, IS30 family [Streptococcus thermophilus CNRZ1066] >gi|55738645|gb|AAV62286.1| IS1239, transposase, IS30 family [Streptococcus thermophilus CNRZ1066] >gi|55738975|gb|AAV62616.1| IS1239, transposase, IS30 family [Streptococcus thermophilus CNRZ1066] >gi|55739381|gb|AAV63022.1| IS1239, transposase, IS30 family [Streptococcus thermophilus CNRZ1066] >gi|55739557|gb|AAV63198.1| IS1239, transposase, IS30 family [Streptococcus thermophilus CNRZ1066] (332 aa)
Score = 229, Expect = 3.7e-17, Identities = 85/282 (30%), Positives = 142/282 (50%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYI--ERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP-------CVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           R T L+++R+    + YSA+ AQ  Y    +R+ K   L ++ K                 E   HY K+ +          +      IY W         ++D L     K  K++     K   K +     RP+ I  R E GH+E+D V+  R   +  LLV+ +R++R+  I  + NK   ++N A++ ++ ++  H+ +IT DNG EFS++  A  + + ++YY  PY+S++RG+NEN N LIRR   KGT  + L   E+  ++N IN  P+K  +Y S  ++
  S:    65 RGTTLQQVRKGLYKKVYSADYAQTVYQTNRKRSVKKIILTKEMK-----------------EKILHYAKQKFSPEMMVKKKKMKVGISTIYYWFHNGHLGLTKADMLYPRKGKSVKKQASPNFKPAGKSIED---RPEVINLRLENGHYEIDTVLLTRVKNHC-LLVLTDRRSRHQIIRLLPNKTTESVNQALEGILREH--HILSITADNGTEFSRL--AEVFPEERIYYAHPYSSWERGTNENHNRLIRRWLPKGTKKTTLK--EVAFIENWINNYPKKCLDYKSPSEF 328
>gi|167037795|ref|YP_001665373.1| integrase catalytic subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856629|gb|ABY95037.1| Integrase, catalytic region [Thermoanaerobacter pseudethanolicus ATCC 33223] (308 aa)
Score = 228, Expect = 4.1e-17, Identities = 96/273 (35%), Positives = 144/273 (52%)
  Q:     9 NDTNK---YRHLSYGEREIIGHMYFVQK--KNINQIATELKRHRSTILREIRRNNNVE---------GYSAEKAQKKYIERR-NHKNFFLWQKYKTFSELFAEK-YNCKWHGVELTRHYIKE-NYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK--NNLH--VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNE 281
           NDT K   ++HLS  ER   G +Y + K  ++I  IA +L R  STI REI+R    +          Y  E  Q  Y + R N    F   K + F +    K  N KW    +  +  K+ ++    +  TK +YN+I       K  D      +K RK++     +   K +     RPK + +R+ FGHWE+D +IGK+ S    LL ++ERKTR+  I  ++ K+  ++  A+  L +   +NL+   KTIT DNG EFS +  A      +VYY  PY+S++R  NE
  S:     5 NDTTKNRSFKHLSSYER---GEIYALLKEGRSIRYIAKKLNRSPSTISREIKRGTTTQLRSDLSSYTSYFPETGQAIYEKNRSNCGAKFKVAKAEDFLKYAENKILNEKWSPDAVVGYCKKDPSWNNKTIVCTKTLYNYIDRGLLKVKNIDLPLKLRLKARKKQNRKNKRIMGKSID---FRPKEVESREVFGHWEIDTLIGKK-SNDKVLLTLIERKTRHEIILLLDTKDSKSVKDALSKLKDMFGDNLNKVFKTITSDNGTEFSDLESALKEYGIEVYYTHPYSSWERAKNE 291
>gi|116490404|ref|YP_809948.1| IS30 family transposase [Oenococcus oeni PSU-1] >gi|116091129|gb|ABJ56283.1| Transposase, IS30 family [Oenococcus oeni PSU-1] (309 aa)
Score = 228, Expect = 4.2e-17, Identities = 89/311 (28%), Positives = 139/311 (44%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYN---CKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           ++Y ER  I     +   NI Q+   L R  STI  E+ R    + Y AE AQ     +R+       +K K   EL  +  N     W    +  H  K         +TK IYNW+   + I    + L    ++ R R     SK+++        RP  I  R     +ELD V+G R    + LL +++RK+R  +  +++++   T+N A+   +   N  V + T+D G EFS +         K YYC  Y   +RGSNE  N  +R  Y KGT F  +S  ++     +IN+ P K+ ++ +  Q
  S:     4 ITYSERIKIETFCELGLSNI-QMGVRLNRSPSTISYELSR---CQPYQAELAQTDAEYKRSRCG----RKTKLSDELKQKILNHLRLSW-SPGMIAHEFKL--------ATKSIYNWLNQGR-IGFSLNDLPEHGVRQR-RNVDQRSKYNQSLGRSIEQRPMMINQRNRIDDFELDTVVGPRGHSKAVLLTLIDRKSRFLWAYRLKDRTTATVNEALTKFLTTFNGPVHSFTVDRGTEFSGLVSLESQYGIKTYYCHAYTPAERGSNERFNRNLRYFYPKGTYFEHISAQDLTTTLLQINQRPLKILDWQTPYQ 298
>gi|55820149|ref|YP_138591.1| IS1239 transposase [Streptococcus thermophilus LMG 18311] >gi|55820321|ref|YP_138763.1| IS1239 transposase [Streptococcus thermophilus LMG 18311] >gi|55820363|ref|YP_138805.1| IS1239 transposase [Streptococcus thermophilus LMG 18311] >gi|55821006|ref|YP_139448.1| IS1239 transposase [Streptococcus thermophilus LMG 18311] >gi|55821764|ref|YP_140206.1| IS1239 transposase [Streptococcus thermophilus LMG 18311] >gi|55821952|ref|YP_140394.1| IS1239 transposase [Streptococcus thermophilus LMG 18311] >gi|55821984|ref|YP_140426.1| IS1239 transposase [Streptococcus thermophilus LMG 18311] >gi|55736134|gb|AAV59776.1| IS1239, transposase, IS30 family [Streptococcus thermophilus LMG 18311] >gi|55736306|gb|AAV59948.1| IS1239, transposase, IS30 family [Streptococcus thermophilus LMG 18311] >gi|55736348|gb|AAV59990.1| IS1239, transposase, IS30 family [Streptococcus thermophilus LMG 18311] >gi|55736991|gb|AAV60633.1| IS1239, transposase, IS30 family [Streptococcus thermophilus LMG 18311] >gi|55737749|gb|AAV61391.1| IS1239, transposase, IS30 family [Streptococcus thermophilus LMG 18311] >gi|55737937|gb|AAV61579.1| IS1239, transposase, IS30 family [Streptococcus thermophilus LMG 18311] >gi|55737969|gb|AAV61611.1| IS1239, transposase, IS30 family [Streptococcus thermophilus LMG 18311] (346 aa)
Score = 228, Expect = 4.2e-17, Identities = 85/282 (30%), Positives = 142/282 (50%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYI--ERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP-------CVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           R T L+++R+    + YSA+ AQ  Y    +R+ K   L ++ K                 E   HY K+ +          +      IY W         ++D L     K  K++     K   K +     RP+ I  R E GH+E+D V+  R   +  LLV+ +R++R+  I  + NK   ++N A++ ++ ++  H+ +IT DNG EFS++  A  + + ++YY  PY+S++RG+NEN N LIRR   KGT  + L   E+  ++N IN  P+K  +Y S  ++
  S:    79 RGTTLQQVRKGLYKKVYSADYAQTVYQTNRKRSVKKIILTKEMK-----------------EKILHYAKQKFSPEMMVKKKKMKVGISTIYYWFHNGHLGLTKADMLYPRKGKSVKKQASPNFKPAGKSIED---RPEVINLRLENGHYEIDTVLLTRVKNHC-LLVLTDRRSRHQIIRLLPNKTTESVNQALEGILREH--HILSITADNGTEFSRL--AEVFPEERIYYAHPYSSWERGTNENHNRLIRRWLPKGTKKTTLK--EVAFIENWINNYPKKCLDYKSPSEF 342
>gi|117676276|ref|YP_863852.1| integrase catalytic subunit [Shewanella sp. ANA-3] >gi|117615100|gb|ABK50553.1| Integrase, catalytic region [Shewanella sp. ANA-3] (342 aa)
Score = 228, Expect = 4.4e-17, Identities = 55/179 (30%), Positives = 92/179 (51%)
  Q:   144 LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           LR      R R  G+  +     +    +RP  + +R   GHWE DL+ GK  +  S +  +VER +    + K+ +    +      + +N   L V K++T D G E ++           +Y+C+P++ +QRGSNEN+NGLIR+   KGTD S+ S   ++ +  ++N  PRK F++
  S:   139 LRQGKTSRRPRSGGVDRRGQIPEMLSIHVRPPEVEDRLMPGHWEGDLIKGKANA--SAVGTLVERTSGYLMLIKMADATATSALEGFSAALNGMPLAVRKSMTYDQGREMARHAEITQRTGVAIYFCDPHSPWQRGSNENINGLIRQYLPKGTDLSVHSQEALDAIALQLNMRPRKRFDF 316
>gi|88705544|ref|ZP_01103254.1| Transposase and inactivated derivatives, IS30 family protein [gamma proteobacterium KT 71] >gi|88700057|gb|EAQ97166.1| Transposase and inactivated derivatives, IS30 family protein [Congregibacter litoralis KT71] (256 aa)
Score = 227, Expect = 6.4e-17, Identities = 56/163 (34%), Positives = 87/163 (53%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTI-NSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           RP  + +R   GHWE DL+ G  ++  + L   VER TR   + K++ K+  T+ N+ IK      +   +++T D G E SK          KVY+C+P + +QRGSNEN N L+R    K TD S+ S +E++ +  ++N  PRK   Y +    +  C+ S
  S:    94 RPAAVEDRAVPGHWEGDLIEGSNKTCVATL---VERHTRYVMLAKIDKKDSETVVNALIKQSRQLPSELYQSLTWDRGTEMSKHHRFTLETDIKVYFCDPKSPWQRGSNENTNRLLREYLPKYTDLSIYSQSELDWVARQLNERPRKTLEYETPAARFNACVAS 254
>gi|2995638|gb|AAC98742.1| transposase [Pseudomonas putida] (340 aa)
Score = 225, Expect = 8.7e-17, Identities = 83/312 (26%), Positives = 147/312 (47%)
  Q:    11 TNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKK-----YIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELT--------RHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYV--HPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH----VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           T  Y HL+  E   +  M  +Q  ++  IA  L R  ST+ RE+RR +    Y A  A  +     ++ RR+       + ++    + A+ ++ +     L         RH   E     +    +    + Q   ++++   K RT    G            E+Y        RP+ +  R+  GHWE DL++G      S +  MVER +R   + K++     T ++A++ +  + +      +KT+T D G E +K    +     K+Y  +P++ +QRGSNEN NGL+R+   KGT  SL+S   ++ + + +N  PR+   +
  S:     2 TTHYTHLTIEEGVTLMIMR-MQGASLRAIAQVLGRQPSTLSREVRRQSQPGHYDASTAGARARALRHVPRRSKLLAPGSELFQVVHSMLAKGWSPQQIAARLKDYWPDNPERHVSHETVYLTIYAYPRGELKYRQLIGYLRQGGSKRRTRSSTGH---------VGERYPAEQNIRYRPEEVEGRQVPGHWESDLIMGANNR--SAVATMVERTSRFCILAKLDAP---TADAALEGMTRELSRMAPALLKTMTHDQGSEMAKHQELSSRTGMKIYVADPHSPWQRGSNENTNGLLRQYLPKGTVLSLVSQERLDEIADLLNTRPRQTLGW 317
>gi|134287633|ref|YP_001109799.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134287706|ref|YP_001109872.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134287960|ref|YP_001110124.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134288050|ref|YP_001110214.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134288193|ref|YP_001110356.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134288308|ref|YP_001110471.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134288319|ref|YP_001110482.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134288336|ref|YP_001110499.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134288362|ref|YP_001110525.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134288504|ref|YP_001110667.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134290915|ref|YP_001114684.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134291172|ref|YP_001114941.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134291547|ref|YP_001115316.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134291918|ref|YP_001115687.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134291926|ref|YP_001115695.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134291995|ref|YP_001115764.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134292197|ref|YP_001115933.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134292710|ref|YP_001116446.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134293133|ref|YP_001116869.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134293140|ref|YP_001116876.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134293186|ref|YP_001116922.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134293206|ref|YP_001116942.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134293326|ref|YP_001117062.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134293472|ref|YP_001117208.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134293697|ref|YP_001117433.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134293945|ref|YP_001117681.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134294035|ref|YP_001117771.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134294144|ref|YP_001117879.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134294194|ref|YP_001117929.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134294371|ref|YP_001118106.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134294375|ref|YP_001118110.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134294876|ref|YP_001118611.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134295016|ref|YP_001118751.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134295035|ref|YP_001118770.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134295298|ref|YP_001119033.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134295379|ref|YP_001119114.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134295699|ref|YP_001119434.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134296118|ref|YP_001119853.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134296342|ref|YP_001120077.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134296551|ref|YP_001120286.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134296569|ref|YP_001120304.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134296718|ref|YP_001120453.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134296970|ref|YP_001120705.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134296971|ref|YP_001120706.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134132283|gb|ABO60018.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134132356|gb|ABO60091.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134132610|gb|ABO60236.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134132700|gb|ABO60326.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134132843|gb|ABO59553.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134132958|gb|ABO59668.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134132969|gb|ABO59679.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134132986|gb|ABO59696.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134133012|gb|ABO59722.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134133154|gb|ABO59864.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134134104|gb|ABO58429.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134134361|gb|ABO58686.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134134736|gb|ABO59061.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134135107|gb|ABO59432.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134135115|gb|ABO59440.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134135184|gb|ABO59509.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134135354|gb|ABO56468.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134135867|gb|ABO56981.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134136290|gb|ABO57404.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134136297|gb|ABO57411.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134136343|gb|ABO57457.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134136363|gb|ABO57477.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134136483|gb|ABO57597.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134136629|gb|ABO57743.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134136854|gb|ABO57968.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134137102|gb|ABO58216.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134137192|gb|ABO58306.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134137301|gb|ABO53044.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134137351|gb|ABO53094.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134137528|gb|ABO53271.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134137532|gb|ABO53275.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134138033|gb|ABO53776.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134138173|gb|ABO53916.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134138192|gb|ABO53935.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134138455|gb|ABO54198.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134138536|gb|ABO54279.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134138856|gb|ABO54599.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134139275|gb|ABO55018.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134139499|gb|ABO55242.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134139708|gb|ABO55451.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134139726|gb|ABO55469.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134139875|gb|ABO55618.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134140127|gb|ABO55870.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] >gi|134140128|gb|ABO55871.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] (351 aa)
Score = 225, Expect = 9.5e-17, Identities = 97/323 (30%), Positives = 153/323 (47%)
  Q:    14 YRHLSYGEREIIGHMYFVQKK-NINQIATELKRHRSTILREIRRNNNVEGYSA-----------------EKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTR--HYIKENYPCVL--VPSTKQIYNWIQTNKWIKKRSDK---LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK----NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           Y+HLS  ER  I  M  +Q+  +   IA  L+R  STI REIRR       +A                  +A    ++RR H       K      LF   ++    G   ++    +K  +P  L    S + IYN I      + R +    LR A  K   R +G   +          +RP     R   GHWE DL+ G   +  S + V+VER +R   + K+++    T  SA++    K         KT+T D G E ++    +     +VY+C+P + +QRGS EN+NGL+R+   KGTD S+ S  E++ + +++N  PR +  +      Y+  +  +
  S:     5 YQHLSAEERATI--MILLQQGCSARGIARTLRRSPSTITREIRRALQWPQRTAFVPAGSGGCTYDARAAGARACAMRLKRRRHP------KLAEDGVLFGVVHHFLLEGWSPSQIAGTLKRMWPDDLDRRVSHETIYNCIYAMPRGELRKELIACLRRAQAKRMPRSRGQDRRGQLPDAVSIHLRPPEANERAFPGHWEGDLLKGA--ANRSAVGVLVERSSRLVLLAKLKDA---TAASALEGFTAKLRSIAEPMRKTLTYDRGKEMARHPELSEATGIRVYFCDPRSPWQRGSCENINGLLRQYLPKGTDLSVYSQEELDAIADRLNSRPRAIHGFYPPIAVYQAMLEKV 343
>gi|75181778|gb|ABA12810.1| iso-IS30-like [Lactobacillus paracasei subsp. paracasei] (285 aa)
Score = 225, Expect = 1.0e-16, Identities = 81/289 (28%), Positives = 132/289 (45%)
  Q:    39 IATELKRHRSTILREIRRNNNVEGYSAEKAQK--KYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           ++  LKR  +TI  E+ R    E Y AE AQ   +Y   R  +   L  K +   ++        W   E+  H  K         +TK IYNW+   K I+   + L    ++ R R     SK+++        RP  +  R   G +ELD ++G R    + LL +++RK+R  +  +++++   T+N A+   +   N  V + T+D G EF+ +         K YYC  Y   +RGSNE  N  +R  Y KGT F  +S   +     +IN+ P K+ ++ +  Q
  S:     1 MSDRLKRSPATISYELAR---CEPYQAEVAQTDAEYKRARCGRKTKLNDKLR---QIILNHLRLSW-SPEMIAHEFKL--------ATKSIYNWLNQGK-IEFSLNDLPEHGVRQR-RNLDQRSKYNQSLGRSIEQRPIVVNRRNRIGDFELDTIVGPRGHSKAVLLTLIDRKSRFLWAYRLKSRTAVTVNEALNKFLATFNGPVHSFTVDRGTEFNGLVSLEAQYGIKTYYCHAYTPAERGSNERFNRNLRYFYPKGTYFEHISAQGLKTTLLEINQRPLKILDWQTPYQ 274
>gi|58579776|ref|YP_198792.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58424370|gb|AAW73407.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] (322 aa)
Score = 224, Expect = 1.1e-16, Identities = 74/302 (24%), Positives = 142/302 (47%)
  Q:    35 NINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEK-----------------YVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           ++  IA  L+R  STI RE+RRN +   Y  + AQ+    RR   +    ++ +  +E   +               ++E++     P        + +++WI +  D         +KR   +F    ++                 +   +  RP  +  R   G WELD +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY ++QRGSNEN NGL R+   + TDFS +++A +  ++ ++   PRK+  + +  + + ++ +NS+
  S:    27 SMRAIADALERAPSTISRELRRNQHAARYRPDHAQRISEHRRTQAS----RRPRIDAERIGQ-----------IEDLLREDFS----PEQIAGRTGLASHEWIYRHIDA-------DQKRGGQLFMHLRKRRRKRRRRGMRDGRGQLTHRRSWTQRPSVVEQRSRIGDWELDTI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHTVHTLTADNGKEFADHRLIAACLQSDFYFADPYCAWQRGSNENANGLTRQYLPRQTDFSTITNAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 318
>gi|50844007|gb|AAT81594.1| transposase [Xanthomonas oryzae pv. oryzae] (318 aa)
Score = 224, Expect = 1.2e-16, Identities = 73/298 (24%), Positives = 134/298 (44%)
  Q:    27 HMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEK-----------------YVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           H  +    ++  IA  + R  STI RE+RRN +   Y  + AQ+    RR   +    ++ +  +E   +               ++E++     P        + +++WI +  D         +KR   +F    ++                 +   +  RP  +  R   G WELD +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TDFS ++DA +  ++ ++   PRK+  + +
  S:    15 HALYETGMSMRAIADAVARAPSTISRELRRNRHAAKYRPDHAQRISEHRRTQAS----RRPRIDAERIGQ-----------IEDLLREDFS----PEQIAGRTGLASHEWIYRHIDA-------DQKRGGQLFMHLRKRRRKRRRRGVRDGRGQLTHRRSWTQRPSVVEQRSRIGDWELDTI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDFSTITDAHLRWIEQRLYNRPRKILGFKT 301
>gi|120402539|ref|YP_952368.1| integrase catalytic subunit [Mycobacterium vanbaalenii PYR-1] >gi|120405606|ref|YP_955435.1| integrase catalytic subunit [Mycobacterium vanbaalenii PYR-1] >gi|119955357|gb|ABM12362.1| Integrase, catalytic region [Mycobacterium vanbaalenii PYR-1] >gi|119958424|gb|ABM15429.1| Integrase, catalytic region [Mycobacterium vanbaalenii PYR-1] (399 aa)
Score = 224, Expect = 1.5e-16, Identities = 80/279 (28%), Positives = 139/279 (49%)
  Q:    39 IATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIER-RNHKNFFL-----------WQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQI----YNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVE-NKNPFTINSA-IKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPR 317
           I  +L R RS I RE++RN   +G Y A  A  +  E  R  K F L           W       +L ++         ++ R   +  Y  + V +  Q+    +  + T++  +K          +G+  ++G F       V     RP    +R   GHWE DL+IG R  G S +  +VER TR + +  +  +    T+ +A +K++ +  +   ++IT D G E +     +  ++  VY+C+P++ +QRG+NEN N L+R  ++KGTD S  +  ++  + +K+N  PR
  S:    98 IGDQLGRDRSVIWREVQRNRLPDGTYHALMAHARATENARRPKAFKLDDPGLCADIEAWMDQGWSPKLISQVLARDAGSAKVKRVSHETIYQSLYVQTRGQLRADLHKCLSTSRTQRKP---------RGQTERRGRFGD-----VMRISARPAEAADRAVPGHWEGDLIIGAR--GGSAIGTLVERSTRFTILLHLPGDHTAETVAAAMLKAMGDLPDHLRRSITWDRGSEMAGWQDISLQLQSPVYFCDPHSPWQRGTNENTNRLLRFWFEKGTDLSGYTPDDLKAVADKLNTRPR 379
>gi|119870410|ref|YP_940362.1| integrase catalytic subunit [Mycobacterium sp. KMS] >gi|119696499|gb|ABL93572.1| Integrase, catalytic region [Mycobacterium sp. KMS] (525 aa)
Score = 223, Expect = 1.6e-16, Identities = 60/200 (30%), Positives = 108/200 (54%)
  Q:   123 STKQIYN--WIQTNKWIKKRSDK-LRTAYIKGRKRKKGMFSKFD--EKYVHPFWM---RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           S + IY   + Q    +KK   + LRT    GR R+K    + +  +++  P  M   RP  + +R   GHWE DL+ G++    + +  +VER TR + +  +    +  ++  A+ + ++    H++ ++T D G E +            VY+C+P + +QRGSNEN NGL+R+ + KGTD S+    ++ ++  ++N  PRK   +
  S:   308 SHETIYQALYFQARGGLKKEVQQALRT----GRTRRKPHRKEGERYQRFTDPMVMISDRPAEVDDRAVPGHWEGDLITGEKNQ--TAIGTLVERSTRYTMLVHLPGGHDAESVRDALIATISTLPAHLRGSLTWDQGCEMAGHKQFTMATDMAVYFCDPASPWQRGSNENTNGLLRQYFPKGTDLSIYGPEDLEHVAQELNGRPRKTLGW 511
>gi|108801259|ref|YP_641456.1| integrase catalytic subunit [Mycobacterium sp. MCS] >gi|108771678|gb|ABG10400.1| Integrase, catalytic region [Mycobacterium sp. MCS] (496 aa)
Score = 223, Expect = 1.6e-16, Identities = 60/200 (30%), Positives = 108/200 (54%)
  Q:   123 STKQIYN--WIQTNKWIKKRSDK-LRTAYIKGRKRKKGMFSKFD--EKYVHPFWM---RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           S + IY   + Q    +KK   + LRT    GR R+K    + +  +++  P  M   RP  + +R   GHWE DL+ G++    + +  +VER TR + +  +    +  ++  A+ + ++    H++ ++T D G E +            VY+C+P + +QRGSNEN NGL+R+ + KGTD S+    ++ ++  ++N  PRK   +
  S:   279 SHETIYQALYFQARGGLKKEVQQALRT----GRTRRKPHRKEGERYQRFTDPMVMISDRPAEVDDRAVPGHWEGDLITGEKNQ--TAIGTLVERSTRYTMLVHLPGGHDAESVRDALIATISTLPAHLRGSLTWDQGCEMAGHKQFTMATDMAVYFCDPASPWQRGSNENTNGLLRQYFPKGTDLSIYGPEDLEHVAQELNGRPRKTLGW 482
>gi|108801001|ref|YP_641198.1| integrase catalytic subunit [Mycobacterium sp. MCS] >gi|119870142|ref|YP_940094.1| integrase catalytic subunit [Mycobacterium sp. KMS] >gi|126437238|ref|YP_001072929.1| integrase catalytic subunit [Mycobacterium sp. JLS] >gi|108771420|gb|ABG10142.1| Integrase, catalytic region [Mycobacterium sp. MCS] >gi|119696231|gb|ABL93304.1| Integrase, catalytic region [Mycobacterium sp. KMS] >gi|126237038|gb|ABO00439.1| Integrase, catalytic region [Mycobacterium sp. JLS] (519 aa)
Score = 223, Expect = 1.6e-16, Identities = 60/200 (30%), Positives = 108/200 (54%)
  Q:   123 STKQIYN--WIQTNKWIKKRSDK-LRTAYIKGRKRKKGMFSKFD--EKYVHPFWM---RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           S + IY   + Q    +KK   + LRT    GR R+K    + +  +++  P  M   RP  + +R   GHWE DL+ G++    + +  +VER TR + +  +    +  ++  A+ + ++    H++ ++T D G E +            VY+C+P + +QRGSNEN NGL+R+ + KGTD S+    ++ ++  ++N  PRK   +
  S:   302 SHETIYQALYFQARGGLKKEVQQALRT----GRTRRKPHRKEGERYQRFTDPMVMISDRPAEVDDRAVPGHWEGDLITGEKNQ--TAIGTLVERSTRYTMLVHLPGGHDAESVRDALIATISTLPAHLRGSLTWDQGCEMAGHKQFTMATDMAVYFCDPASPWQRGSNENTNGLLRQYFPKGTDLSIYGPEDLEHVAQELNGRPRKTLGW 505
>gi|68643671|emb|CAI33878.1| putative IS1239 transposase [Streptococcus pneumoniae] (317 aa)
Score = 223, Expect = 1.6e-16, Identities = 93/316 (29%), Positives = 157/316 (49%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYI--ERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQ-------IYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           ++++ +   REI G +     K    I TE+KR   T L+++R+    + YSA+ AQ  Y    +R+ K   L ++ +                 E   HY K+ +   ++ + KQ       IY W         ++D L     KG K++     K   K +     RP  I  R E GH+E+D V+  +   Y  LLV+ +R++R+  I  + NK   ++N A+  L+ ++   + +IT DNG EF ++  +  + +  +YY   Y+S++RGSNEN N LIRR   KGT  +  +  E+  ++N IN  P+K  +Y S  ++
  S:    22 RWKNENKSNREIAGLL----GKAPQTIHTEVKR--GTTLQQVRKGLYKKVYSADYAQTVYQFNRKRSVKKLILTKEIR-----------------EKILHYHKQKFSPEMMVNKKQVKVGISTIYYWFHNGHLGLTKADMLYPRKRKGVKKQASPNFKPAGKSIEE---RPDVINLRLENGHYEIDTVLLTKIKNYC-LLVLTDRRSRHQIIRLIPNKTAESVNQALTLLLGEH--RILSITADNGSEFKRL--SEVFPEEHIYYAHAYSSWERGSNENHNRLIRRWLPKGTKKT--TPKEVAFIENWINNYPKKCLDYKSPSEF 313
>gi|53721109|ref|YP_110094.1| transposase [Burkholderia pseudomallei K96243] >gi|167818137|ref|ZP_02449817.1| transposase [Burkholderia pseudomallei 91] >gi|52211523|emb|CAH37514.1| putative transposase [Burkholderia pseudomallei K96243] (415 aa)
Score = 223, Expect = 1.8e-16, Identities = 95/321 (29%), Positives = 166/321 (51%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG----YSAEKAQKKY---IERRNHKNFFLWQKYKTF---------SELFAEKY---NCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTN----KWIKKRSDKLRTA-YIKGR-----------------KRKKGMFSKFDEKYVHP---FWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFI------------TKVENKNPFT------INSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           R+L + ERE I  + + Q  ++ +I+  L+R  STI RE+RRN    G    Y A  AQ K     ER N        + +T+         ++   E     N  W G    RH  +    C    S +QI   IQ +    + ++   + +  A YI+GR                 +  +    +  + +V P       P  I +R   GHWE +L+ G  +S    L   VER TR + +             +V+N           + +AI + +     H++ ++T D G E ++          ++Y+C+P + +QRG+NEN NGL+R+ + KGTD S  ++ E++ + N +N   RK   + +  + + + +++
  S:    38 RYLPFSEREEIA-LLWAQDCSVREISRRLQRSPSTISRELRRNAATRGGTLVYRATVAQWKAEGAAERPNASKLAENDQLRTYVQDRLAGTVTDYRGEPIPGPNVPWKGRRQGRHADRRWATCW---SPEQISRRIQIDYPDDQSMRISHEAIYQALYIQGRGALRRELTACLRSGRALRVPRARTQQRGKHFVTPEVTISECPAEIADRAVPGHWEGNLITGLNRSAIGTL---VERTTRFTMLLHLPPMEGHGVGVRVKNGPALAGHGAEAVRNAIATKIALLPEHLRRSLTWDQGAEMAQHVQLRIDTALEIYFCDPQSPWQRGTNENTNGLLRQYFPKGTDMSRYTERELDAVANILNCRSRKTLGWKTPAEAFHELLSA 414
>gi|9626114|ref|NP_040341.1| putative transposase [Spiroplasma phage 1-R8A2B] >gi|1352853|sp|P15894|VG3_SPV1R Gene 3 protein >gi|77022|pir||S08451 hypothetical protein 3 - spiroplasma virus 1 >gi|908900|emb|CAA35729.1| unnamed protein product [Spiroplasma phage 1-R8A2B] (322 aa)
Score = 222, Expect = 2.0e-16, Identities = 96/316 (30%), Positives = 156/316 (49%)
  Q:    14 YRHLSYGER----EIIGHMYFVQK---KNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHY---IKENYPCVLVPSTKQIYNWIQTN--KWIKKRSDKLRTAYI-KGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL--HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           Y HLS+ ++    +++    F++K   +NI+ IA  L RHRSTILREI+R   ++ YSA K+ K Y E+R   N       +  + +            EL   Y    K  +P  +    K +Y WI+     ++K+        Y  KG+   +G  + F        W     + N    G  E+D V+GK     S +LV+VE+ ++  F  K+EN     +    K ++ KNNL   +K I  D   EFSK      + + +VY+C+  +  Q+   E +N  +R  + KGTDF+ +S  +I+ + N IN   R   N++SS + +
  S:     2 YSHLSFMDKVKLEQLLLSKIFLKKNGEQNISAIAKYLNRHRSTILREIKRFKTIDEYSAYKSDKMYYEKRKKNNKRFKFTEEQLNFIHLRFNVYHDSPSELIYRYFLKFKVKFPVCV----KTLYKWIRLGFYGFLKQNLRHHGKKYKRKGKSDNRGKLTDFKS-----IWDIDNKVSN---VGWLEMDTVVGKDHK--SAILVLVEQLSKKYFAIKLENHTAREVEKKFKDIIIKNNLIGKIKGIITDRRKEFSKWREMEIFAETQVYFCDAGSPQQKPLIEYMNSELRHWFPKGTDFNKVSQKQIDWVVNVINDKLRPCLNWISSKEMF 318
>gi|148997451|ref|ZP_01825056.1| F0F1 ATP synthase subunit epsilon [Streptococcus pneumoniae SP11-BS70] >gi|148998068|ref|ZP_01825581.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP11-BS70] >gi|147756078|gb|EDK63121.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP11-BS70] >gi|147756506|gb|EDK63547.1| F0F1 ATP synthase subunit epsilon [Streptococcus pneumoniae SP11-BS70] (317 aa)
Score = 222, Expect = 2.2e-16, Identities = 95/318 (29%), Positives = 156/318 (49%)
  Q:    11 TNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG---------YSAEKAQKKYI--ERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQ-------IYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           T K +HL+   R +I       K N  +IA  L +   TI  E++R   ++          YSA+ AQ  Y    +R+ K   L ++ +                 E   HY K+ +   ++ + KQ       IY W         ++D L     KG K++     K   K +     RP  I  R E GH+E+D V+  +   Y  LLV+ +R++R+  I  + NK   ++N A+  L+ ++   + +IT DNG EF ++  +  + +  +YY   Y+S++RGSNEN N LIRR   KGT  +  +  E+  ++N IN  P+K  +Y S  ++
  S:     6 TPKGKHLTIDNRRLIERWKNENKSN-REIAGLLGKAPQTIHNEVKRGTTLQQVRKGLYKKVYSADYAQTVYQFNRKRSVKKLILTKEIR-----------------EKILHYHKQKFSPEMMVNKKQVKVGISTIYYWFHNGHLGLTKADMLYPRKRKGVKKQASPNFKPAGKSIEE---RPDVINLRLENGHYEIDTVLLTKIKNYC-LLVLTDRRSRHQIIRLIPNKTAESVNQALTLLLGEH--RILSITADNGSEFKRL--SEVFPEEHIYYAHAYSSWERGSNENYNRLIRRWLPKGTKKT--TPKEVAFIENWINNYPKKCLDYKSPSEF 313
>gi|148997425|ref|ZP_01825030.1| IS1239, transposase, putative [Streptococcus pneumoniae SP11-BS70] >gi|147756480|gb|EDK63521.1| IS1239, transposase, putative [Streptococcus pneumoniae SP11-BS70] (248 aa)
Score = 222, Expect = 2.2e-16, Identities = 69/198 (34%), Positives = 107/198 (54%)
  Q:   127 IYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           IY WI   K    + D L     KG+  KK   + F +        RP+ I  R E GH+E+D V+  R   Y  LLV+ +RK+R+  I  + NK+   +N A+K ++ ++   + +IT DNG EF+++     + +  +YY  PYAS++RG+NEN N LIRR   KGT    ++  E+  ++  IN  P+K  +Y S
  S:    35 IYYWIHHGKLGLSKQDLLYPR--KGKALKKQASTNF-KPAGQSIEQRPEAINLRLENGHYEIDTVLLTRAKNYC-LLVLTDRKSRHQIIRLIPNKSAEVVNQALKLILKQHK--ILSITADNGTEFNRL--FDVFAEEHIYYAHPYASWERGTNENHNRLIRRWLPKGT--KKMTPKEVAFIEKWINNYPKKCLDYKS 222
>gi|84625015|ref|YP_452387.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84368955|dbj|BAE70113.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (322 aa)
Score = 222, Expect = 2.3e-16, Identities = 73/310 (23%), Positives = 145/310 (46%)
  Q:    27 HMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEK-----------------YVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           H  +    ++  IA  ++R  STI RE+RRN +   Y  + AQ+    RR   +    ++ +  +E   +               ++E++     P        + +++WI +  D         +KR   +F    ++                 +   +  RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY ++QRGSNEN NGL R+   + TDFS +++A +  ++ ++   PRK+  +++  + + ++ +NS+
  S:    19 HALYETGMSMRAIADAVERAPSTISRELRRNQHAARYRPDHAQRISEHRRTQAS----RRPRIDAERIGQ-----------IEDLLREDFS----PEQIAGRTGLASHEWIYRHIDA-------DQKRGGQLFMHLRKRRRKRRRRGMRDGRGQLTHRRSWTQRPSVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHTVHTLTADNGKEFADHRLIAACLQSDFYFADPYCAWQRGSNENANGLTRQYLPRQTDFSTITNAHLRWIEQRLYNRPRKILGFITPLEVFSEEVLNSV 318
>gi|148988348|ref|ZP_01819795.1| IS1239, transposase, putative [Streptococcus pneumoniae SP6-BS73] >gi|147926029|gb|EDK77103.1| IS1239, transposase, putative [Streptococcus pneumoniae SP6-BS73] (318 aa)
Score = 221, Expect = 2.6e-16, Identities = 97/309 (31%), Positives = 155/309 (50%)
  Q:     9 NDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIR---------RNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENY-PCVLVPST------KQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPR 317
           N T K +HL+   R +I   +  + K+  +IA+ L +   TI  +I+         +    E YSA+ AQ+ Y   R H       K  T +    EK            HY  + + P ++V +         IY WI   K    + D L     KG+  KK   + F +        RP+ I  R E GH+E+D V+  R   Y  LLV+ +RK+R+  I  + NK+   +N A+K ++ ++   + +IT DNG EF+++  +  + +  +YY  PYAS++RG+NEN N LIRR   KGT    ++  E+  ++  IN  P+
  S:     4 NYTTKGKHLTIDSRRLI-ERWKKEGKSNREIASLLGKAPQTIHTKIKCRTARKWLGKGRFKEVYSADYAQQSYENNRKHS-----VKRSTVTNELKEK----------ILHYHNQKFLPEMMVMAKGVNVGISTIYYWIHHGKLGLSKQDLLYPR--KGKALKKQASTNF-KPAGQSIAQRPEAINFRLENGHYEIDTVLLTRAKNYC-LLVLTDRKSRHQIIRLIPNKSAEVVNQALKLILKQHK--ILSITADNGTEFNRL--SNVFSEEHIYYAHPYASWERGTNENHNRLIRRWLPKGT--KKMTPKEVAFIEKWINNYPK 302
>gi|126433225|ref|YP_001068916.1| integrase catalytic subunit [Mycobacterium sp. JLS] >gi|126437241|ref|YP_001072932.1| integrase catalytic subunit [Mycobacterium sp. JLS] >gi|126233025|gb|ABN96425.1| Integrase, catalytic region [Mycobacterium sp. JLS] >gi|126237041|gb|ABO00442.1| Integrase, catalytic region [Mycobacterium sp. JLS] (519 aa)
Score = 221, Expect = 2.7e-16, Identities = 60/200 (30%), Positives = 107/200 (53%)
  Q:   123 STKQIYN--WIQTNKWIKKRSDK-LRTAYIKGRKRKKGMFSKFD--EKYVHPFWM---RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           S + IY   + Q    +KK   + LRT    GR R+K    + +  +++  P  M   RP  + +R   GHWE DL+ G++    + +  +VER TR + +  +    +  ++  A+ + ++    H++ ++T D G E +            VY+C+P + +QRGSNEN NGL+R+ + KGTD S+     + ++  ++N  PRK   +
  S:   302 SHETIYQALYFQARGGLKKEVQQALRT----GRTRRKPHRKEGERYQRFTDPMVMISDRPAEVDDRAVPGHWEGDLITGEKNQ--TAIGTLVERSTRYTMLVHLPGGHDAESVRDALIATISTLPAHLRGSLTWDQGCEMAGHKQFTMATDMAVYFCDPASPWQRGSNENTNGLLRQYFPKGTDLSIYGPENLEHVAQELNGRPRKTLGW 505
>gi|148992214|ref|ZP_01821937.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP9-BS68] >gi|147928840|gb|EDK79852.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP9-BS68] (317 aa)
Score = 221, Expect = 3.1e-16, Identities = 95/318 (29%), Positives = 156/318 (49%)
  Q:    11 TNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG---------YSAEKAQKKYI--ERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQ-------IYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           T K +HL+   R +I       K N  +IA  L +   TI  E++R   ++          YSA+ AQ  Y    +R+ K   L ++ +                 E   HY K+ +   ++ + KQ       IY W         ++D L     KG K++     K   K +     RP  I  R E GH+E+D V+  +   Y  LLV+ +R++R+  I  + NK   ++N A+  L+ ++   + +IT DNG EF ++  +  + +  +YY   Y+S++RGSNEN N LIRR   KGT  +  +  E+  ++N IN  P+K  +Y S  ++
  S:     6 TPKGKHLTIDNRRLIERWKNENKSN-REIAGLLGKAPQTIHNEVKRGTTLQQVRKGLYKKVYSADYAQTVYQFNRKRSVKKLILTKEIR-----------------EKILHYHKQKFSPEMMVNKKQVKVGISTIYYWFHNGHLGLTKADMLYPRKRKGVKKQASSNFKPAGKSIEE---RPDVINLRLENGHYEIDTVLLTKIKNYC-LLVLTDRRSRHQIIRLIPNKTAESVNQALTLLLGEH--RILSITADNGSEFKRL--SEVFPEEHIYYAHAYSSWERGSNENHNRLIRRWLPKGTKKT--TPKEVAFIENWINNYPKKCLDYKSPSEF 313
>gi|15903410|ref|NP_358960.1| transposase [Streptococcus pneumoniae R6] >gi|116516748|ref|YP_816804.1| IS1239, transposase, putative [Streptococcus pneumoniae D39] >gi|15459015|gb|AAL00171.1| Transposase [Streptococcus pneumoniae R6] >gi|116077324|gb|ABJ55044.1| IS1239, transposase, putative [Streptococcus pneumoniae D39] (335 aa)
Score = 221, Expect = 3.2e-16, Identities = 97/316 (30%), Positives = 155/316 (49%)
  Q:     9 NDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN---------VEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           N T K +HL+   R +I   +  + K+  +IA+ L +   TI  EI+R             E YSA+ AQ+ Y   R         K  + ++   EK            HY  + +   ++   K        IY WI   K    + D L     KG+  KK   + F +        R + I  R E GH+E+D V+  R   Y  LLV+ +RK+R+  I  + NK+   +N A+K ++ ++   + +IT DNG EF+++     + +  +YY  PYAS++RG+NEN N  IRR   KGT+   ++  E+  ++  IN  P+K  +Y S
  S:     4 NYTTKAKHLTIDSRRLI-ERWKKEGKSNREIASLLGKAPQTIHTEIKRGTVRQCLGKGRFKEVYSADYAQQSYENNRKRS-----VKKSSVTKELKEK----------ILHYHNQKFSPEMMVMAKGVNVGISTIYYWIHHGKLGLSKQDLLYPR--KGKALKKQASTNF-KPVGQSIEQRSEAINLRLENGHYEIDTVLLTRAKNYC-LLVLTDRKSRHQIIRLIPNKSAEVVNQALKLILKQHK--ILSITADNGTEFNRL--FDVFSEEHIYYAHPYASWERGTNENHNRFIRRWLPKGTN--KMTPKEVAFIEKWINNYPKKYLDYKS 309
>gi|148987750|ref|ZP_01819213.1| ribose-phosphate pyrophosphokinase [Streptococcus pneumoniae SP6-BS73] >gi|148988668|ref|ZP_01820101.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP6-BS73] >gi|148988938|ref|ZP_01820338.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP6-BS73] >gi|148997348|ref|ZP_01824953.1| pyridine nucleotide-disulfide oxidoreductase [Streptococcus pneumoniae SP11-BS70] >gi|149002379|ref|ZP_01827321.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP14-BS69] >gi|149002715|ref|ZP_01827647.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP14-BS69] >gi|149002971|ref|ZP_01827882.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP14-BS69] >gi|149003178|ref|ZP_01828074.1| pyridine nucleotide-disulfide oxidoreductase [Streptococcus pneumoniae SP14-BS69] >gi|149003657|ref|ZP_01828522.1| 50S ribosomal protein L34 [Streptococcus pneumoniae SP14-BS69] >gi|149012321|ref|ZP_01833390.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP19-BS75] >gi|149012982|ref|ZP_01833871.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP19-BS75] >gi|68642816|emb|CAI33158.1| putative IS1239 transposase [Streptococcus pneumoniae] >gi|68643415|emb|CAI33665.1| putative IS1239 transposase [Streptococcus pneumoniae] >gi|68643950|emb|CAI34116.1| putative IS1239 transposase [Streptococcus pneumoniae] >gi|68643980|emb|CAI34142.1| putative IS1239 transposase [Streptococcus pneumoniae] >gi|68644295|emb|CAI34398.1| putative IS1239 transposase [Streptococcus pneumoniae] >gi|147756403|gb|EDK63444.1| pyridine nucleotide-disulfide oxidoreductase [Streptococcus pneumoniae SP11-BS70] >gi|147758389|gb|EDK65389.1| 50S ribosomal protein L34 [Streptococcus pneumoniae SP14-BS69] >gi|147758638|gb|EDK65635.1| pyridine nucleotide-disulfide oxidoreductase [Streptococcus pneumoniae SP14-BS69] >gi|147758974|gb|EDK65969.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP14-BS69] >gi|147759326|gb|EDK66319.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP14-BS69] >gi|147759694|gb|EDK66685.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP14-BS69] >gi|147763135|gb|EDK70076.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP19-BS75] >gi|147763647|gb|EDK70582.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP19-BS75] >gi|147925435|gb|EDK76512.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP6-BS73] >gi|147925869|gb|EDK76944.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP6-BS73] >gi|147926214|gb|EDK77287.1| ribose-phosphate pyrophosphokinase [Streptococcus pneumoniae SP6-BS73] >gi|161784419|emb|CAP10107.1| putative IS1239 transposase [Streptococcus pneumoniae] (317 aa)
Score = 221, Expect = 3.2e-16, Identities = 95/318 (29%), Positives = 156/318 (49%)
  Q:    11 TNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG---------YSAEKAQKKYI--ERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQ-------IYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           T K +HL+   R +I       K N  +IA  L +   TI  E++R   ++          YSA+ AQ  Y    +R+ K   L ++ +                 E   HY K+ +   ++ + KQ       IY W         ++D L     KG K++     K   K +     RP  I  R E GH+E+D V+  +   Y  LLV+ +R++R+  I  + NK   ++N A+  L+ ++   + +IT DNG EF ++  +  + +  +YY   Y+S++RGSNEN N LIRR   KGT  +  +  E+  ++N IN  P+K  +Y S  ++
  S:     6 TPKGKHLTIDNRRLIERWKNENKSN-REIAGLLGKAPQTIHNEVKRGTTLQQVRKGLYKKVYSADYAQTVYQFNRKRSVKKLILTKEIR-----------------EKILHYHKQKFSPEMMVNKKQVKVGISTIYYWFHNGHLGLTKADMLYPRKRKGVKKQASPNFKPAGKSIEE---RPDVINLRLENGHYEIDTVLLTKIKNYC-LLVLTDRRSRHQIIRLIPNKTAESVNQALTLLLGEH--RILSITADNGSEFKRL--SEVFPEEHIYYAHAYSSWERGSNENHNRLIRRWLPKGTKKT--TPKEVAFIENWINNYPKKCLDYKSPSEF 313
>gi|111024967|ref|YP_707387.1| transposase [Rhodococcus sp. RHA1] >gi|110823946|gb|ABG99229.1| probable transposase [Rhodococcus sp. RHA1] (363 aa)
Score = 221, Expect = 3.3e-16, Identities = 86/293 (29%), Positives = 129/293 (44%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWI---QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN--KNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEI 305
           K R L++ ERE I  +       +  IA  L R  STI REI RN    G Y A  A      R +              E   EK   + H  E     ++ ++P    +  ST+ IY  +            +  LRT     R  +K    K     +     RPK + NR   GHWE DL+IGKR    S +  +VER T    +  + +  K   T  +  + L        +T+T D G E       +      +Y+C+P+A +QRG+N+N NG++R+ + KG+D S+ S A++
  S:    59 KGRCLTFAEREEIA-IGIAAGHTLRDIAKTLNRSPSTISREIARNREPSGRYRARSAHAAAYHRASRPKPSKLATNPPLRET-VEKSLTERHSPEQIAGRLRLDFPDDPQMRVSTETIYQSLYQPARGGLEHTLTRSLRTGRGLRRPSRKAGQRKNRIPDMANIADRPKDVKNRAVPGHWEGDLIIGKRN--LSAIGTLVERSTGTVMLVHLPDGYKPEQTAPALTEQLETLPTSLRRTLTWDQGSEMRDWKSVSAATGIDIYFCDPHAPWQRGTNQNTNGILRQYFPKGSDLSVHSKADL 355
>gi|145294196|ref|YP_001137017.1| hypothetical protein cgR_0153 [Corynebacterium glutamicum R] >gi|57158010|dbj|BAD83984.1| putative transposase [Corynebacterium glutamicum] >gi|140844116|dbj|BAF53115.1| hypothetical protein [Corynebacterium glutamicum R] (383 aa)
Score = 220, Expect = 3.4e-16, Identities = 83/314 (26%), Positives = 140/314 (44%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCV--LVPSTKQIYN--WIQTNKWIKKRSDKLRTAYIKGRKRKKGMFS---KFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSA-IKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           L+  ERE I     V   +   IA    R  STI RE+ RN     Y A  A  +   +          K        A +    W   ++    +K  Y C   +  S + IY   +IQ+   + K   K   +    RK +    S   +   K       RPK    R + GHWE DLVIG +QS    +  ++ER TR + +  VE+++  ++ +  I+ L    +   +++T D G+E +            V + +P++ +QRG+NEN N L+R+ + K T     S  +++ + +K+N  PRK+  + +  + Y+
  S:    63 LTLAEREEISRGLSV-GLSYRAIARLTGRSASTISREVTRNRGRTAYRAIDADDRSWRQARRPQRCKLAKNPVLRGYVAARLREDWSPEQIAGR-LKITYACTSRMQISHESIYKSLFIQSRGVLPKDLQKHLRSRRPIRKARSNTTSGQWRSQIKDAVSISKRPKEAEARVQVGHWEGDLVIGAQQS---QIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLTWDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTDLDQVADKLNNRPRKVLGFRTPAEQYE 379
>gi|148988559|ref|ZP_01819992.1| IS1239, transposase, putative [Streptococcus pneumoniae SP6-BS73] >gi|147925760|gb|EDK76835.1| IS1239, transposase, putative [Streptococcus pneumoniae SP6-BS73] (335 aa)
Score = 220, Expect = 3.7e-16, Identities = 97/316 (30%), Positives = 155/316 (49%)
  Q:     9 NDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN---------VEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           N T K +HL+   R +I   +  + K+  +IA+ L +   TI  EI+R             E YSA+ AQ+ Y   R         K  + ++   EK            HY  + +   ++   K        IY WI   K    + D L     KG+  KK   + F +        R + I  R E GH+E+D V+  R   Y  LLV+ +RK+R+  I  + NK+   +N A+K ++ ++   + +IT DNG EF+++     + +  +YY  PYAS++RG+NEN N  IRR   KGT+   ++  E+  ++  IN  P+K  +Y S
  S:     4 NYTTKAKHLTIDSRRLI-ERWKKEGKSNREIASLLGKAPQTIHTEIKRGTVRQCLGKGRFKEVYSADYAQQSYENNRKRS-----VKKSSVTKELKEK----------ILHYHNQKFSPEMMVMAKGVNVGISTIYYWIHHGKLGLSKQDLLYPR--KGKALKKQASTNF-KPAGQSIEQRSEAINLRLENGHYEIDTVLLTRAKNYC-LLVLTDRKSRHQIIRLIPNKSAEVVNQALKLILKQHK--ILSITADNGTEFNRL--FDVFSEEHIYYAHPYASWERGTNENHNRFIRRWLPKGTN--KMTPKEVAFIEKWINNYPKKYLDYKS 309
>gi|58579775|ref|YP_198791.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58424369|gb|AAW73406.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] (322 aa)
Score = 220, Expect = 3.7e-16, Identities = 73/302 (24%), Positives = 142/302 (47%)
  Q:    35 NINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEK-----------------YVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           ++  IA  L+R  STI RE+RRN +   Y  + AQ+    RR   +    ++ +  +E   +               ++E++     P        + +++WI +  D         +KR   +F    ++                 +   +  RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY ++QRGSNEN NGL R+   + TDFS +++A +  ++ ++   PRK+  + +  + + ++ +NS+
  S:    27 SMRAIADALERAPSTISRELRRNQHAARYRPDHAQRISEHRRTQAS----RRPRIDAERIGQ-----------IEDLLREDFS----PEQIAGRTGLASHEWIYRHIDA-------DQKRGGQLFMHLRKRRRKRRRRGMRDGRGQLTHRRSWTQRPSVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHTVHTLTADNGKEFADHRLIAACLQSDFYFADPYCAWQRGSNENANGLTRQYLPRQTDFSTITNAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 318
>gi|111025081|ref|YP_707501.1| IS30 family transposase [Rhodococcus sp. RHA1] >gi|110824060|gb|ABG99343.1| transposase, IS30 family protein [Rhodococcus sp. RHA1] (394 aa)
Score = 220, Expect = 4.1e-16, Identities = 83/317 (26%), Positives = 150/317 (47%)
  Q:    15 RHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKEN------YPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKY---VHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTI--NSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           R+LS  +R  I      +++++  IA  + +   ++ +EI RN   +G Y    A  +  +RR      ++    T   L A K   +W   +++R   +        + CV     + IY  +     +      LRT     R+R +G       K    + P   RP H+ +R+  GH E DL+IG  Q   S +  +VERKTR + +  +   +   +  ++ I+          +++T D G E       A     K+Y+ +P++ +QRGSNEN NGL+R+ + KGTD S  +  +++ +  ++N  PR   N ++ +Q  ++
  S:    61 RYLSQDDRIEIADG-LAREESVKTIAERIGKSFQSVYKEIARNRKSDGRYQPWYAHNQAHQRRRRPKVRVFTHDDTLRRLVAAKLGKRWSPAQISRWLRRRYPRRTAWHVCV-----ETIYEAVYRGLVLAATGGSLRTGRTYRRRRGRGRSRDGSLKQSTNMTPIAQRPAHVESRRRVGHIEGDLIIGAGQR--SAIAPLVERKTRLTILVAIRGGHSAQVVGDALIERFTQMPVSLRRSLTWDQGNEMFHHERIADATGLKIYFADPHSPWQRGSNENTNGLLRQYFPKGTDLSGWTQDQLDEVATELNDRPRLCLNDLTPNQAVRR 381
>gi|148984653|ref|ZP_01817921.1| IS1239, transposase, putative [Streptococcus pneumoniae SP3-BS71] >gi|147923044|gb|EDK74159.1| IS1239, transposase, putative [Streptococcus pneumoniae SP3-BS71] (327 aa)
Score = 219, Expect = 4.3e-16, Identities = 90/286 (31%), Positives = 140/286 (48%)
  Q:    39 IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           I TE+KR   T+ + + +    E YSA+ AQ+ Y   R         K  + ++   EK            HY  + +   ++   K        IY WI   K    + D L     KG+  KK   + F +        RP+ I  R E GH+E+D V+  R   Y  LLV+ +RK+R+  I  V NK+   +N A+K ++ ++   + +IT DNG EF+++     + +  +YY  PYAS++RG+NEN N LI R   KGT    ++  E+  ++  IN  P+K  NY S
  S:    22 IHTEIKR--GTVRQCLGKGRFKEVYSADYAQQSYENNRKRS-----VKKSSLTKELKEK----------ILHYHNQKFSPEMMVMAKGVNVGISTIYYWIHRGKLGLSKQDLLYPR--KGKALKKQASTNF-KPAGQSIEQRPEAINLRLENGHYEIDTVLLTRAKNYC-LLVLTDRKSRHQIIRLVPNKSAEVVNQALKLILKQHK--ILSITADNGTEFNRL--FDVFSEEHIYYAHPYASWERGTNENHNRLIHRWLPKGT--KKMTPKEVAFIEKWINNYPKKCLNYKS 287
>gi|81096086|ref|ZP_00874436.1| Integrase, catalytic region [Streptococcus suis 89/1591] >gi|80977865|gb|EAP41398.1| Integrase, catalytic region [Streptococcus suis 89/1591] (317 aa)
Score = 219, Expect = 4.4e-16, Identities = 81/278 (29%), Positives = 139/278 (50%)
  Q:    47 RSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTR-------HYIKENY-PCVLVPSTK------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           R  IL+++R++   + YSA++AQ  Y E R                       C    V+L +       HY+ + Y P ++  S K       IY WI        +   L     K  K++     K   K +     RP+ I  R+  G +E+D VI  R      LL + +RK+R   I  + +K+  ++N  +++++ +  +H  +IT DNG EFS++  +  +   ++YY  PYAS++RG+NEN N LIRR   KG+  +  +  ++  ++N IN  P+K+ +Y +
  S:    50 RGLILQQVRQSRFKKVYSADRAQMAYEENRK----------------------CSVKTVQLDKRTKEKICHYLTQKYSPEMMAKSGKVTVSVSSIYYWIHHGHLGVGKEALLYPRKAKANKKQASPNFKPAGKSIEE---RPESINKRENIGDFEIDTVIQTRAKN-ECLLTLTDRKSRYQIIRLIPDKSASSVNHVLRTILQEYQIH--SITADNGTEFSRL--SEVFDPDQIYYANPYASWERGTNENHNRLIRRWLPKGSKNA--TKKQVTFIENWINNYPKKVLDYKT 309
>gi|41407922|ref|NP_960758.1| hypothetical protein MAP1824c [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41409952|ref|NP_962788.1| hypothetical protein MAP3854 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41396276|gb|AAS04141.1| hypothetical protein MAP_1824c [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41398785|gb|AAS06404.1| hypothetical protein MAP_3854 [Mycobacterium avium subsp. paratuberculosis K-10] (424 aa)
Score = 219, Expect = 4.8e-16, Identities = 51/152 (33%), Positives = 87/152 (57%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK-----NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           RP  + +R   GHWE DL++G   SG S +  +VER TR  F+  +   +     +  +++V K       L  +T+T D G E +     A   +  +Y+C+P++ +QRG+NEN NGL+R+ + KGTD S      ++ + +K+NR PR+  ++ +
  S:   253 RPPEVADRAVPGHWEGDLILGSTASG-SAIGTVVERTTR--FVMLLHLPDGHGAEAVQEAIVAKMAGLPATLR-QTLTWDQGKEMANHAAIAAATELDIYFCDPHSPWQRGTNENTNGLLRQYFAKGTDLSAFPADYLDYVASKLNRRPRQTLDWKT 405
>gi|84625102|ref|YP_452474.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84369042|dbj|BAE70200.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (322 aa)
Score = 219, Expect = 5.5e-16, Identities = 47/152 (30%), Positives = 79/152 (51%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           RP  +  R   G WELD +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TDFS ++DA +  ++ ++   PRK+  + +
  S:   156 RPSVVEQRSRIGDWELDTI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDFSTITDAHLRWIEQRLYNRPRKILGFKT 305
>gi|118052607|ref|ZP_01521153.1| Integrase, catalytic region [Comamonas testosteroni KF-1] >gi|117999737|gb|EAV13895.1| Integrase, catalytic region [Comamonas testosteroni KF-1] (223 aa)
Score = 219, Expect = 5.6e-16, Identities = 51/150 (34%), Positives = 79/150 (52%)
  Q:   184 GHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTI-NSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCM 333
           GHWE DLV G   SG S +  +VER+TR   + K++ K+  T+ N+ IK          +++T D G E             +VY+C P + +QRGSNEN N L+R+   KG + S LS  ++N +  ++N  PRK   + +  +    C+
  S:    72 GHWEGDLVFG---SGNSQIATLVERQTRYVMLVKLDGKDSQTVVNALIKHARKLPQELQQSLTWDRGTEMHAHKQFTLATDIQVYFCAPQSPWQRGSNENTNRLLRQYMPKGMNLSGLSHHQLNAIARQLNERPRKTLGFRTPAEMSSACV 219
>gi|91780016|ref|YP_555224.1| putative transposase [Burkholderia xenovorans LB400] >gi|91692676|gb|ABE35874.1| putative transposase [Burkholderia xenovorans LB400] (340 aa)
Score = 219, Expect = 5.6e-16, Identities = 88/328 (26%), Positives = 152/328 (46%)
  Q:     8 LNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHK--------NFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRK-------RKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV----KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           +++  + + L   ER II  ++ +Q  +I  +A  L R  +T+ RE+ RN++  GY +  A+     RR+              W+   T  E        KW   +++   +K  YP    P+ +  +  I T  + + R +  R      R        R +G   +     +    +RP  I +R   GH E D + G      S++ V+VER +R   + K+E+    T  SA+     K N       ++ T D G E S+          KVY+C+P++ +QRG+ EN NGL+R+   KGTD S+    E++ + + +N  PR    + S  + +   + S
  S:     1 MHEKTQCQQLQPEERLIIASLH-LQGSSIRAMARILGRSPATVSRELTRNSSPAGYGSVPAEALSAARRSAGRRPTELCLQSVCWRIVLTLLEW-------KWLPQQIS-GTLKLMYPTD--PTRQVSHETIYTAIYAQPRGELRRQLIACPRHGHSTRMPRTRGTDRRGQIPDMVSIHVRPPEIEDRLLPGHSEGDFIKGA--GNQSSVGVLVERTSRLVLLAKMEDA---TAASALAGFSAKLNSIAEPLRQSFTYDQGKEMSRHQEFTAATGVKVYFCDPHSPWQRGTCENTNGLLRQYLPKGTDLSVYRQDELDAIADSLNSRPRATHAFHSPFEVFTATLAS 331
>gi|108760666|ref|YP_634030.1| IS30 family transposase [Myxococcus xanthus DK 1622] >gi|108464546|gb|ABF89731.1| transposase, IS30 family [Myxococcus xanthus DK 1622] (379 aa)
Score = 218, Expect = 5.6e-16, Identities = 49/159 (30%), Positives = 87/159 (54%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKN--PFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           RP    +R   GHWE DL++GK+  G S +  +VER++R   +  +      P    +    L    +   +T+T D G E ++          +VY+C+P++ +QRGSNEN NGL+R+ + KG D S LS A+++ +  ++N  PR+  ++ +  + + +
  S:   215 RPPEAESRAVPGHWEGDLLVGKQ--GKSAIGTLVERRSRYVMLLHLPEGRTAPHVREALTHQLGQLPDALRRTLTWDQGKEMAEHVRFTIDTDVQVYFCDPHSPWQRGSNENTNGLLRQYFPKGMDLSGLSRAQLDTVALQLNTRPRQTLDWRTPAEVFAQ 373
>gi|108756774|ref|YP_629579.1| IS30 family transposase [Myxococcus xanthus DK 1622] >gi|108460654|gb|ABF85839.1| transposase, IS30 family [Myxococcus xanthus DK 1622] (400 aa)
Score = 217, Expect = 7.8e-16, Identities = 49/159 (30%), Positives = 87/159 (54%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKN--PFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           RP    +R   GHWE DL++GK+  G S +  +VER++R   +  +      P    +    L    +   +T+T D G E ++          +VY+C+P++ +QRGSNEN NGL+R+ + KG D S LS A+++ +  ++N  PR+  ++ +  + + +
  S:   236 RPPEAESRAVPGHWEGDLLVGKQ--GKSAIGTLVERRSRYVMLLHLPEGRTAPHVREALTHQLGQLPDALRRTLTWDQGKEMAEHVRFTIDTDVQVYFCDPHSPWQRGSNENTNGLLRQYFPKGMDLSGLSRAQLDTVALQLNTRPRQTLDWRTPAEVFAQ 394
>gi|149011749|ref|ZP_01832945.1| IS1239, transposase, putative [Streptococcus pneumoniae SP19-BS75] >gi|147764180|gb|EDK71112.1| IS1239, transposase, putative [Streptococcus pneumoniae SP19-BS75] (335 aa)
Score = 217, Expect = 8.0e-16, Identities = 97/314 (30%), Positives = 153/314 (48%)
  Q:    11 TNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN---------VEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           T K  HL+   R +I   +  + K+  +IA+ L +   TI  EI+R             E YSA+ AQ+ Y   R         K  + ++   EK            HY  + +   ++   K        IY WI   K    + D L     KG+  KK   + F +        R + I  R E GH+E+D V+  R   Y  LLV+ +RK+R+  I  + NK+   +N A+K ++ ++   + +IT DNG EF+++     + +  +YY  PYAS++RG+NEN N LIRR   KGT    ++  E+  ++  IN  P+K  +Y S
  S:     6 TTKGEHLTIDSRRLI-ERWKKEGKSNREIASLLGKVPQTIHTEIKRGTVRQCLGKGRFKEVYSADYAQQSYENNRKRS-----VKKSSLTKELKEK----------ILHYHNQKFSPEMMVMAKGVNVGISTIYYWIHHGKLGLSKQDLLYPR--KGKALKKQASTNF-KPAGQSIEQRSEAINLRLENGHYEIDTVLLTRAKNYC-LLVLTDRKSRHQIIRLIPNKSAEVVNQALKLILKQHK--ILSITADNGTEFNRL--FDVFSEEHIYYAHPYASWERGTNENHNRLIRRWLPKGT--KKMTPKEVAFIEKWINNYPKKCLDYKS 309
>gi|15900795|ref|NP_345399.1| IS1239 transposase [Streptococcus pneumoniae TIGR4] >gi|14972389|gb|AAK75039.1| putative IS1239, transposase [Streptococcus pneumoniae TIGR4] (331 aa)
Score = 217, Expect = 8.1e-16, Identities = 97/314 (30%), Positives = 154/314 (49%)
  Q:    11 TNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN---------VEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           T K  HL+   R +I   +  + K+  +IA+ L +   TI  EI+R             E YSA+ AQ+ Y   R         K  + ++   EK            HY  + +   ++   K        IY WI   K    + D L     KG+  KK   + F +        R + I  R E GH+E+D V+  R   Y  LLV+ +RK+R+  I  + NK+   +N A+K ++ ++   + +IT DNG EF+++  +  + +  +YY  PYAS++RG+NEN N LIRR   KGT    ++  E+  ++  IN  P+K  +Y S
  S:     6 TTKGEHLTIDSRRLI-ERWKKEGKSNREIASLLGKVPQTIHTEIKRGTVRQCLGKGRFKEVYSADYAQQSYENNRKRS-----VKKSSLTKELKEK----------ILHYHNQKFSPEMMVMAKGVNVGISTIYYWIHHGKLGLSKQDLLYPR--KGKALKKQASTNF-KPAGQSIEQRLEAINFRLENGHYEIDTVLLTRAKNYC-LLVLTDRKSRHQIIRLIPNKSADVVNQALKLILKQHK--ILSITADNGTEFNRL--SNVFSEEHIYYAHPYASWERGTNENHNRLIRRWLPKGT--KKMTPKEVAFIEKWINNYPKKCLDYKS 309
>gi|58583176|ref|YP_202192.1| hypothetical protein XOO3553 [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58427770|gb|AAW76807.1| hypothetical protein XOO3553 [Xanthomonas oryzae pv. oryzae KACC10331] (322 aa)
Score = 217, Expect = 8.8e-16, Identities = 73/310 (23%), Positives = 144/310 (46%)
  Q:    27 HMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEK-----------------YVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           H  +    ++  IA  ++R  STI RE+RRN +   Y  + AQ+    RR   +    ++ +  +E   +               ++E++     P        + +++WI +  D         +KR   +F    ++                 +   +  RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY ++QRGSNEN NGL R+   + TDFS +++A +  ++ ++   PRK+  + +  + + ++ +NS+
  S:    19 HALYETGMSMRAIADAVERAPSTISRELRRNQHAARYRPDHAQRISEHRRTQAS----RRPRIDAERIGQ-----------IEDLLREDFS----PEQIAGRTGLASHEWIYRHIDA-------DQKRGGQLFMHLRKRRRKRRRRGMRDGRGQLTHRRSWTQRPSVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGVLRHTVHTLTADNGKEFADHRLIAACLQSDFYFADPYCAWQRGSNENANGLTRQYLPRQTDFSTITNAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 318
>gi|119657225|gb|ABL86712.1| transposase [Xanthomonas oryzae pv. oryzae] (318 aa)
Score = 217, Expect = 8.9e-16, Identities = 49/164 (29%), Positives = 87/164 (53%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WELD +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TDFS ++DA +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   152 RPSVVEQRSRIGDWELDTI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDFSTITDAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 314
>gi|91218400|ref|ZP_01255343.1| transposase for IS1655 [Psychroflexus torquis ATCC 700755] >gi|91183460|gb|EAS69860.1| transposase for IS1655 [Psychroflexus torquis ATCC 700755] (164 aa)
Score = 216, Expect = 1.1e-15, Identities = 52/143 (36%), Positives = 81/143 (56%)
  Q:   180 RKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           R  F   E+DL+I K  +    +L + ER      + KV +K    + +AI  L+     ++KTIT+DNG EF+   +    +    Y+  PY S+++GSNEN+NGLIR+   K TDF+ ++D ++  +Q K+N   RK FNY
  S:     4 RDRFRDLEVDLIISKNHN--QAILTINERSCGMLKMKKVSSKESKGVGAAIIDLLEDWKPYLKTITVDNGKEFADHLVVVQQLNIDYYFARPYHSWKQGSNENLNGLIRQYLPKKTDFTKITDYQVKQIQEKLNLRSRKRFNY 144
>gi|58581204|ref|YP_200220.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58425798|gb|AAW74835.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] (322 aa)
Score = 216, Expect = 1.2e-15, Identities = 48/164 (29%), Positives = 88/164 (53%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WELD +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY ++QRGSNEN NGL R+   + TDFS +++A +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   156 RPSVVEQRSRIGDWELDTI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHTVHTLTADNGKEFADHRLIAACLQSDFYFADPYCAWQRGSNENANGLTRQYLPRQTDFSTITNAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 318
>gi|58581790|ref|YP_200806.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58426384|gb|AAW75421.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] (322 aa)
Score = 216, Expect = 1.2e-15, Identities = 48/164 (29%), Positives = 88/164 (53%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WELD +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY ++QRGSNEN NGL R+   + TDFS +++A +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   156 RPSVVEQRSRIGDWELDTI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHTVHTLTADNGKEFADHRLIAACLQSDFYFADPYCAWQRGSNENANGLTRQYLPRQTDFSTITNAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 318
>gi|58579662|ref|YP_198678.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58581124|ref|YP_200140.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58581906|ref|YP_200922.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58582280|ref|YP_201296.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58582423|ref|YP_201439.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58582505|ref|YP_201521.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|188575331|ref|YP_001912260.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188575584|ref|YP_001912513.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188577361|ref|YP_001914290.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188577465|ref|YP_001914394.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188578827|ref|YP_001915756.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188579096|ref|YP_001916025.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|58424256|gb|AAW73293.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58425718|gb|AAW74755.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58426500|gb|AAW75537.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58426874|gb|AAW75911.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58427017|gb|AAW76054.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58427099|gb|AAW76136.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|188519783|gb|ACD57728.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188520036|gb|ACD57981.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188521813|gb|ACD59758.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188521917|gb|ACD59862.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188523279|gb|ACD61224.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188523548|gb|ACD61493.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae PXO99A] (322 aa)
Score = 215, Expect = 1.4e-15, Identities = 48/164 (29%), Positives = 88/164 (53%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WELD +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY ++QRGSNEN NGL R+   + TDFS +++A +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   156 RPSVVEQRSRIGDWELDTI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHTVHTLTADNGKEFADHRLIAACLQSDFYFADPYCAWQRGSNENANGLTRQYLPRQTDFSTITNAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 318
>gi|84624492|ref|YP_451864.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84368432|dbj|BAE69590.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (318 aa)
Score = 214, Expect = 1.7e-15, Identities = 48/164 (29%), Positives = 88/164 (53%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WELD +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY ++QRGSNEN NGL R+   + TDFS +++A +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   152 RPSVVEQRSRIGDWELDTI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHTVHTLTADNGKEFADHRLIAACLQSDFYFADPYCAWQRGSNENANGLTRQYLPRQTDFSTITNAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 314
>gi|58583548|ref|YP_202564.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58428142|gb|AAW77179.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] (322 aa)
Score = 214, Expect = 1.7e-15, Identities = 48/164 (29%), Positives = 88/164 (53%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WELD +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY ++QRGSNEN NGL R+   + TDFS +++A +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   156 RPSVVEQRSRIGDWELDTI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHTVHTLTADNGKEFADHRLIAACLQSDFYFADPYCAWQRGSNENANGLTRQYLPRQTDFSTITNAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 318
>gi|148992954|ref|ZP_01822573.1| IS1239, transposase, putative [Streptococcus pneumoniae SP9-BS68] >gi|168490270|ref|ZP_02714469.1| transposase [Streptococcus pneumoniae SP195] >gi|147928406|gb|EDK79422.1| IS1239, transposase, putative [Streptococcus pneumoniae SP9-BS68] >gi|183571378|gb|EDT91906.1| transposase [Streptococcus pneumoniae SP195] (331 aa)
Score = 214, Expect = 1.8e-15, Identities = 98/316 (31%), Positives = 153/316 (48%)
  Q:     9 NDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN---------VEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           N T K +HL+   R +I   +  + K+  +IA+ L +   TI  EI+R             E YSA+ AQ+ Y   R        +K     EL            E   HY  + +   ++   K        IY WI   K    + D L     KG+  KK   + F +        R + I  R E GH+E+D V+  R   Y  LLV+ +RK+R+  I  + NK+   +N A+K ++ ++   + +IT DNG EF+++     + +  +YY  PYAS++RG+NEN N LIRR   KG     ++  E+  ++  IN  P+K  +Y S
  S:     4 NYTTKAKHLTIDSRRLI-ERWKKEGKSNREIASLLGKVPQTIHTEIKRGTVRQCLGKGRFKEVYSADYAQQSYENNRKRS----VRKSSVTKEL-----------KEKILHYHNQKFSPEMMVMVKGVNVGISTIYYWIHHGKLGLSKQDLLYPR--KGKALKKQASTNF-KPAGQSIEQRSEAINLRLENGHYEIDTVLLTRAKNYC-LLVLTDRKSRHQIIRLIPNKSADVVNQALKLILKQHK--ILSITADNGTEFNRL--FDVFSEEHIYYAHPYASWERGTNENHNRLIRRWLPKG--IKKMTPKEVAFIEKWINNYPKKCLDYKS 309
>gi|84625362|ref|YP_452734.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84369302|dbj|BAE70460.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (318 aa)
Score = 214, Expect = 1.8e-15, Identities = 48/164 (29%), Positives = 88/164 (53%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WELD +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY ++QRGSNEN NGL R+   + TDFS +++A +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   152 RPSVVEQRSRIGDWELDTI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHTVHTLTADNGKEFADHRLIAACLQSDFYFADPYCAWQRGSNENANGLTRQYLPRQTDFSTITNAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 314
>gi|84621790|ref|YP_449162.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84623047|ref|YP_450419.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84623819|ref|YP_451191.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84624390|ref|YP_451762.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84365730|dbj|BAE66888.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84366987|dbj|BAE68145.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84367759|dbj|BAE68917.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84368330|dbj|BAE69488.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (318 aa)
Score = 214, Expect = 1.9e-15, Identities = 48/164 (29%), Positives = 88/164 (53%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WELD +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY ++QRGSNEN NGL R+   + TDFS +++A +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   152 RPSVVEQRSRIGDWELDTI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHTVHTLTADNGKEFADHRLIAACLQSDFYFADPYCAWQRGSNENANGLTRQYLPRQTDFSTITNAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 314
>gi|119714335|ref|YP_921300.1| integrase catalytic subunit [Nocardioides sp. JS614] >gi|119714836|ref|YP_921801.1| integrase catalytic subunit [Nocardioides sp. JS614] >gi|119716262|ref|YP_923227.1| integrase catalytic subunit [Nocardioides sp. JS614] >gi|119534996|gb|ABL79613.1| Integrase, catalytic region [Nocardioides sp. JS614] >gi|119535497|gb|ABL80114.1| Integrase, catalytic region [Nocardioides sp. JS614] >gi|119536923|gb|ABL81540.1| Integrase, catalytic region [Nocardioides sp. JS614] (479 aa)
Score = 214, Expect = 1.9e-15, Identities = 54/164 (32%), Positives = 95/164 (57%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-----KNPFT-------------INSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           RP    +R   GHWE DL+IG   +G S +  +VER +R++ +  +       + P+              +N+A+ + + K    + KT+T D G E S   + A     KV++ +P++ +QR SNEN NGL+R+ + KGTD S  S  ++  +   +N  PRK+  + +  + +++ + SL
  S:   291 RPAEADDRAVPGHWEGDLIIG---TGRSAIGTLVERSSRSTLLVHLPRLEGWGEKPYVKNGPSLGGYGAVAMNTALTASMTKLPEQLRKTLTWDRGKELSGHALFAVATGTKVFFADPHSPWQRPSNENTNGLLRQYFPKGTDLSRWSAEDLEAVAYALNNRPRKVLGWKTPAEVFEEQLRSL 470
>gi|148998700|ref|ZP_01826139.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP11-BS70] >gi|147755537|gb|EDK62585.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP11-BS70] (310 aa)
Score = 214, Expect = 1.9e-15, Identities = 92/312 (29%), Positives = 154/312 (49%)
  Q:    13 KYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYI--ERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQ-------IYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           ++++ +   REI G +     K    I  E+KR   T L+++R+    + YSA+ AQ  Y    +R+ K   L ++ +                 E   HY K+ +   ++ + KQ       IY W         ++D L     KG K++     K   K +     RP  I  R E GH+E+D V+  +   Y  LLV+ +R++R+  I  + NK   ++N A+  L+ ++   + +IT DNG EF ++  +  + +  +YY   Y+S++RGSNEN N LIRR   KGT  +  +  E+  ++N IN  P+K  +Y S
  S:    22 RWKNENKSNREIAGLL----GKAPQTIHNEVKR--GTTLQQVRKGLYKKVYSADYAQTVYQFNRKRSVKKLILTKEIR-----------------EKILHYHKQKFSPEMMVNKKQVKVGISTIYYWFHNGHLGLTKADMLYPRKRKGVKKQASPNFKPAGKSIEE---RPDVINLRLENGHYEIDTVLLTKIKNYC-LLVLTDRRSRHQIIRLIPNKTAESVNQALTLLLGEH--RILSITADNGSEFKRL--SEVFPEEHIYYAHAYSSWERGSNENHNRLIRRWLPKGTKKT--TPKEVAFIENWINNYPKKCLDYKS 309
>gi|84624162|ref|YP_451534.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84368102|dbj|BAE69260.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (322 aa)
Score = 214, Expect = 2.1e-15, Identities = 48/164 (29%), Positives = 86/164 (52%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WELD +  +   G   ++ M ER++R   +    +     + +A    +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TDFS ++DA +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   156 RPSVVEQRSRIGDWELDTI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNATVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDFSTITDAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 318
>gi|86138543|ref|ZP_01057116.1| Integrase, catalytic region [Roseobacter sp. MED193] >gi|85824603|gb|EAQ44805.1| Integrase, catalytic region [Roseobacter sp. MED193] (166 aa)
Score = 213, Expect = 2.3e-15, Identities = 56/172 (32%), Positives = 93/172 (54%)
  Q:   162 FDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK--NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCM 333
           FD  ++ P       +L R+E    E DL+ G   S  S +  +VER +R   + K+ENK+  ++ +A+     K   +L+ K +T D G E +         K +VY+C+P + +QRGSNEN N L R+ + KGTD S  S A+++ +  ++N  PRK   Y +  + ++ C+
  S:     3 FDTAFIDP-------VLQRRE---REGDLIAG---SSNSYIATLVERHSRFVMLAKIENKDTQSVIAALIKQARKLPKDLY-KLLTWDRGSEMASHAKFTMATKIEVYFCDPQSPWQRGSNENTNRLRRQYFPKGTDISGFSQAKLSAVARQLNERPRKTLQYQTPAEKFEACV 162
>gi|149010444|ref|ZP_01831815.1| IS1239, transposase, putative [Streptococcus pneumoniae SP19-BS75] >gi|147764925|gb|EDK71854.1| IS1239, transposase, putative [Streptococcus pneumoniae SP19-BS75] (221 aa)
Score = 213, Expect = 2.4e-15, Identities = 68/198 (34%), Positives = 107/198 (54%)
  Q:   127 IYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           IY WI   K    + D L     KG+  KK   + F +        R + I  R E GH+E+D V+  R   Y  LLV+ +RK+R+  I  + NK+   +N A+K ++ ++   + +IT DNG EF+++  +  + +  +YY  PYAS++RG+NEN N LIRR   KGT    ++  E+  ++  IN  P+K  +Y S
  S:    12 IYYWIHHGKLGLSKQDLLYPR--KGKALKKQASTNF-KPAGQSIEQRLEAINFRLENGHYEIDTVLLTRAKNYC-LLVLTDRKSRHQIIRLIPNKSADVVNQALKLILKQHK--ILSITADNGTEFNRL--SNVFSEEHIYYAHPYASWERGTNENHNRLIRRWLPKGT--KKMTPKEVAFIEKWINNYPKKCLDYKS 199
>gi|148990030|ref|ZP_01821284.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP6-BS73] >gi|147924556|gb|EDK75643.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP6-BS73] (225 aa)
Score = 213, Expect = 2.5e-15, Identities = 70/219 (31%), Positives = 116/219 (52%)
  Q:   110 HYIKENYPCVLVPSTKQ-------IYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           HY K+ +   ++ + KQ       IY W         ++D L     KG K++     K   K +     RP  I  R E GH+E+D V+  +   Y  LLV+ +R++R+  I  + NK   ++N A+  L+ ++   + +IT DNG EF ++  +  + +  +YY   Y+S++RGSNEN N LIRR   KGT  +  +  E+  ++N IN  P+K  +Y S  ++
  S:     6 HYHKQKFSPEMMVNKKQVKVGISTIYYWFHNGHLGLTKADMLYPRKRKGVKKQASPNFKPAGKSIEE---RPDVINLRLENGHYEIDTVLLTKIKNYC-LLVLTDRRSRHQIIRLIPNKTAESVNQALTLLLGEH--RILSITADNGSEFKRL--SEVFPEEHIYYAHAYSSWERGSNENHNRLIRRWLPKGTKKT--TPKEVAFIENWINNYPKKCLDYKSPSEF 221
>gi|146318243|ref|YP_001197955.1| IS30 family transposase [Streptococcus suis 05ZYH33] >gi|146320440|ref|YP_001200151.1| IS30 family transposase [Streptococcus suis 98HAH33] >gi|145689049|gb|ABP89555.1| Transposase and inactivated derivative, IS30 family [Streptococcus suis 05ZYH33] >gi|145691246|gb|ABP91751.1| Transposase and inactivated derivative, IS30 family [Streptococcus suis 98HAH33] (261 aa)
Score = 213, Expect = 2.6e-15, Identities = 65/202 (32%), Positives = 109/202 (53%)
  Q:   127 IYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           IY W         ++D L   Y +  KR K   S   +        RP  I  R E GH+E+D V+  R   +  LLV+ +R++R+  I  + NK   ++N A++ ++ ++   + +IT+DNG EFS++  A  + +  +YY  PY+S++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+K  +Y S  ++
  S:    66 IYYWFHHGHLGLTKADML---YPRKGKRVKKQASPNFKPAGKSIEERPDVINLRLENGHYEIDTVLLTRGKNHC-LLVLTDRRSRHQIIRLIPNKTAESVNQALEGILREH--RILSITVDNGTEFSRL--AEVFPEEYIYYAHPYSSWERGTNENHNRLIRRWLPKGTKKT--TPKEVAFIEHWINNYPKKCLDYKSPSEF 257
>gi|84502094|ref|ZP_01000242.1| TRm24 putative transposase [Oceanicola batsensis HTCC2597] >gi|84389454|gb|EAQ02173.1| TRm24 putative transposase [Oceanicola batsensis HTCC2597] (296 aa)
Score = 213, Expect = 2.6e-15, Identities = 55/185 (29%), Positives = 97/185 (52%)
  Q:   152 RKRKKGMFSKFDEKYVHP----FWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKV-ENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           RK+++  +++     V P       RP H+  R+ FG WE DL+I +R  G +N+  +VERKTR + + +  E      +N  +  +        ++IT D GIEF         I  +V++C+P A +Q+GS EN+N   RR   + T  + LS+  +  + +++N  PRK   + +  + +++ M  L
  S:   106 RKKRQPRYARRPSGLVFPPDRSIHQRPDHVKIRETFGEWEGDLMIFERAQGNANIASLVERKTRFAVLFRNNERSTTHLMNRLMTVMEPLPQPARRSITFDRGIEFRNWRKLEPGIGTEVWFCDPQAPWQKGSVENLNKRARRYLPRDTPVAALSNRNMRAICDRLNGTPRKCLGWRTPTEAFREEMMKL 295
>gi|50844009|gb|AAT81595.1| transposase [Xanthomonas oryzae pv. oryzae] (318 aa)
Score = 213, Expect = 2.6e-15, Identities = 46/150 (30%), Positives = 79/150 (52%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           RP  +  R   G WELD +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY ++QRGSNEN NGL R+   + TDFS +++A +  ++ ++   PRK+  +
  S:   152 RPSVVEQRSRIGDWELDTI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHTVHTLTADNGKEFADHRLIAACLQSDFYFADPYCAWQRGSNENANGLTRQYLPRQTDFSTITNAHLRWIEQRLYNRPRKILGF 299
>gi|50844011|gb|AAT81596.1| transposase [Xanthomonas oryzae pv. oryzae] >gi|119657227|gb|ABL86713.1| transposase [Xanthomonas oryzae pv. oryzae] (318 aa)
Score = 213, Expect = 2.7e-15, Identities = 46/152 (30%), Positives = 79/152 (51%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TDFS ++DA +  ++ ++   PRK+  + +
  S:   152 RPSVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDFSTITDAHLRWIEQRLYNRPRKILGFKT 301
>gi|58581855|ref|YP_200871.1| hypothetical protein XOO2232 [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58426449|gb|AAW75486.1| hypothetical protein XOO2232 [Xanthomonas oryzae pv. oryzae KACC10331] (322 aa)
Score = 213, Expect = 2.7e-15, Identities = 46/152 (30%), Positives = 79/152 (51%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TDFS ++DA +  ++ ++   PRK+  + +
  S:   156 RPSVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDFSTITDAHLRWIEQRLYNRPRKILGFKT 305
>gi|84622426|ref|YP_449798.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84366366|dbj|BAE67524.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (322 aa)
Score = 212, Expect = 2.9e-15, Identities = 48/164 (29%), Positives = 87/164 (53%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TDFS ++DA +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   156 RPSVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDFSTITDAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 318
>gi|84623755|ref|YP_451127.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84367695|dbj|BAE68853.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (318 aa)
Score = 212, Expect = 3.1e-15, Identities = 46/152 (30%), Positives = 78/152 (51%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           RP  +  R   G WELD +  +   G   ++ M ER++R   +    +     + +A    +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TDFS ++DA +  ++ ++   PRK+  + +
  S:   152 RPSVVEQRSRIGDWELDTI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNATVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDFSTITDAHLRWIEQRLYNRPRKILGFKT 301
>gi|56130712|ref|YP_145615.1| insertion element protein [Ralstonia metallidurans CH34] >gi|94152356|ref|YP_581763.1| integrase catalytic subunit [Ralstonia metallidurans CH34] >gi|56068702|emb|CAI11264.1| insertion element protein [Ralstonia metallidurans CH34] >gi|93358726|gb|ABF12813.1| Integrase, catalytic region [Ralstonia metallidurans CH34] (336 aa)
Score = 212, Expect = 3.2e-15, Identities = 81/323 (25%), Positives = 139/323 (43%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNH------------KNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           Y  L   ER    H    +  ++ Q+A    R  STI RE+ R      Y A  AQ   + RR              K    W +     +  A +   + +  +   H   E   CV+  + +         +  ++    LR A+ + R R  G   +   + +     RP+ +  R   GHWE DL+ G      S +  +VERKTR   + K++         A+     +  L + K++T D G E +        +  +V++ +P++ +QR SNEN+NGL+R    KG D S+ S   +N +   +N  PR + ++ +  +   + +N L
  S:     5 YSQLGIEERNC-SHRLLNEGCSLRQVARVAGRSPSTISREVARAGGHRSYDAASAQGMALRRRRRGPRKLAAGTALLKLVRAWLRVGYSPQQIAGRLR-RMYAHQPEFHVSHETIYCVIYATPR--------GELRRELIGSLRKAHKERRSRGAGNDRRGKLQDMRSIHERPEEVFERLVPGHWEGDLIKGA--GNRSAVATLVERKTRFVVLAKMDGCGAEAALEALTKKFRRVPLALRKSLTYDQGKEMAHHAELTRRVSTEVFFADPHSPWQRPSNENMNGLVREYLPKGDDLSVFSQGYLNGVPKALNYRPRAVLDFATPAEAMAEEINKL 328
>gi|84624932|ref|YP_452304.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84368872|dbj|BAE70030.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (318 aa)
Score = 212, Expect = 3.3e-15, Identities = 48/164 (29%), Positives = 87/164 (53%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TDFS ++DA +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   152 RPSVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDFSTITDAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 314
>gi|86741949|ref|YP_482349.1| integrase [Frankia sp. CcI3] >gi|86568811|gb|ABD12620.1| Integrase [Frankia sp. CcI3] (189 aa)
Score = 212, Expect = 3.6e-15, Identities = 54/163 (33%), Positives = 83/163 (50%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK----NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           RPK   +R   G WE DL+IGK     S +  +VER TR  F+  V   +  T       L  K          ++T D G E ++           VY+C+P++ +QRGSNEN NGL+ + + KGTD SL +  E+N L  ++N  PR+   ++   + + + + S
  S:     7 RPKEAEDRAVPGFWEGDLIIGK--GNRSQIATLVERTTR--FVMLVRIPSDRTAERVAYLLAKKMGTLPEFLRNSVTWDQGKEMARHAEFTVRTGIPVYFCDPHSPWQRGSNENTNGLLHQYFPKGTDPSLHTQDELNKLAAQLNGRPRQTLGWLKPIEVFNELLES 169
>gi|12056956|gb|AAG48147.1|AF322594_4 putative transposase PrcB [Lactobacillus paracasei] (306 aa)
Score = 211, Expect = 4.0e-15, Identities = 86/302 (28%), Positives = 131/302 (43%)
  Q:    30 FVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQK--KYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
            +Q   I  IA  L R R +I  E+ R    + Y A  AQ        R  ++  L  K K    +  EK N  W   E+        Y     P T  IY+WI   +   + S        K  KR++ + S++++       +R +    R E GH E+D V G R S  + +L +V+R TR    TK+EN +   +      L+      V+++T+D+G EFS         +  VY+C  Y   +RG+NE  N  +R  + KGT F  +S+ +I      IN  PRK   + +  Q   K
  S:    14 LMQHHTIQYIAATLGRSRISIRHELHRCPEGD-YCAIIAQDHADTCRHRGGRHSILTPKLK---RMVTEKLNLGW-SPEMV------GYAVHCAPHT--IYHWIYQRQVDFQPSQLFDHG--KRHKRRQDLRSRYNQAVGTSIEIRSESANRRTEKGHLEMDTVRGGRGSK-AAVLTIVDRVTRLMATTKLENLSQNAVLKGFARLMVDFPGPVRSVTVDHGKEFSCDQALTKRYRIPVYFCHAYHPNERGTNERFNRELRYYFPKGTQFDQVSETDIQQATALINNKPRKCLRWQTPVQAVSK 301
>gi|148998337|ref|ZP_01825779.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP11-BS70] >gi|147755734|gb|EDK62779.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP11-BS70] (241 aa)
Score = 210, Expect = 4.9e-15, Identities = 70/219 (31%), Positives = 116/219 (52%)
  Q:   110 HYIKENYPCVLVPSTKQ-------IYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           HY K+ +   ++ + KQ       IY W         ++D L     KG K++     K   K +     RP  I  R E GH+E+D V+  +   Y  LLV+ +R++R+  I  + NK   ++N A+  L+ ++   + +IT DNG EF ++  +  + +  +YY   Y+S++RGSNEN N LIRR   KGT  +  +  E+  ++N IN  P+K  +Y S  ++
  S:    22 HYHKQKFSPEMMVNKKQVKVGISTIYYWFHNGHLGLTKADMLYPRKRKGVKKQASPNFKPAGKSIEE---RPDVINLRLENGHYEIDTVLLTKIKNYC-LLVLTDRRSRHQIIRLIPNKTAESVNQALTLLLGEH--RILSITADNGSEFKRL--SEVFPEEHIYYAHAYSSWERGSNENHNRLIRRWLPKGTKKT--TPKEVAFIENWINNYPKKCLDYKSPSEF 237
>gi|58426505|gb|AAW75542.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] (328 aa)
Score = 210, Expect = 4.9e-15, Identities = 47/164 (28%), Positives = 86/164 (52%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TD S ++DA +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   162 RPSVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDVSTITDAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 324
>gi|149002723|ref|ZP_01827655.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP14-BS69] >gi|149005920|ref|ZP_01829649.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP18-BS74] >gi|149005940|ref|ZP_01829669.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP18-BS74] >gi|149006760|ref|ZP_01830446.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP18-BS74] >gi|147759334|gb|EDK66327.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP14-BS69] >gi|147761675|gb|EDK68639.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP18-BS74] >gi|147762276|gb|EDK69237.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP18-BS74] >gi|147762296|gb|EDK69257.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP18-BS74] (210 aa)
Score = 210, Expect = 5.5e-15, Identities = 65/202 (32%), Positives = 106/202 (52%)
  Q:   127 IYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           IY W         ++D L     KG K++     K   K +     RP  I  R E GH+E+D V+  +   Y  LLV+ +R++R+  I  + NK   ++N A+  L+ ++   + +IT DNG EF ++  +  + +  +YY   Y+S++RGSNEN N LIRR   KGT  +  +  E+  ++N IN  P+K  +Y S  ++
  S:    15 IYYWFHNGHLGLTKADMLYPRKRKGVKKQASPNFKPAGKSIEE---RPDVINLRLENGHYEIDTVLLTKIKNYC-LLVLTDRRSRHQIIRLIPNKTAESVNQALTLLLGEH--RILSITADNGSEFKRL--SEVFPEEHIYYAHAYSSWERGSNENHNRLIRRWLPKGTKKT--TPKEVAFIENWINNYPKKCLDYKSPSEF 206
>gi|81177258|ref|ZP_00876110.1| Integrase, catalytic region [Streptococcus suis 89/1591] >gi|80976065|gb|EAP39722.1| Integrase, catalytic region [Streptococcus suis 89/1591] (260 aa)
Score = 209, Expect = 6.6e-15, Identities = 68/219 (31%), Positives = 116/219 (52%)
  Q:   110 HYIKENYPCVLVPSTKQ------IYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           HY K+ +   ++   K       IY W         ++D L   Y +  KR K   S   +        RP  I  R E GH+++D V+  R   +  LLV+ +R++R+  I  + NK   ++N A++ ++ ++   + +IT+DNG EFS++  A    +  +YY  PY+S++RG+NEN N LIRR   KGT  +  +  E+  +++ IN  P+K  +Y S  ++
  S:    42 HYTKQKFSPEMMVKKKMKVGISTIYYWFHHGHLGLTKADML---YPRKGKRVKKQASPNFKPAGKSIEERPDVINLRLENGHYQIDTVLLTRGKNHC-LLVLTDRRSRHQIIRLIPNKTAESVNQALEGILREH--RILSITVDNGTEFSRL--AEVLPEEYIYYAHPYSSWERGTNENHNRLIRRWLPKGTKKT--TPKEVAFIEHWINNYPKKCLDYKSPSEF 256
>gi|84623824|ref|YP_451196.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84367764|dbj|BAE68922.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (328 aa)
Score = 209, Expect = 7.1e-15, Identities = 47/164 (28%), Positives = 86/164 (52%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TD S ++DA +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   162 RPSVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDVSTITDAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 324
>gi|122879325|ref|YP_202821.6| hypothetical protein XOO4182 [Xanthomonas oryzae pv. oryzae KACC10331] (319 aa)
Score = 209, Expect = 7.4e-15, Identities = 45/150 (30%), Positives = 77/150 (51%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V  +T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TDFS ++DA +  ++ ++   PRK+  +
  S:   153 RPTVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHILTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDFSTITDAHLRWIEQRLYNRPRKILGF 300
>gi|58428399|gb|AAW77436.1| hypothetical protein XOO4182 [Xanthomonas oryzae pv. oryzae KACC10331] (333 aa)
Score = 209, Expect = 7.5e-15, Identities = 45/152 (29%), Positives = 78/152 (51%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V  +T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TDFS ++DA +  ++ ++   PRK+  + +
  S:   167 RPTVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHILTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDFSTITDAHLRWIEQRLYNRPRKILGFKT 316
>gi|84625849|ref|YP_453221.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84369789|dbj|BAE70947.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (322 aa)
Score = 208, Expect = 8.4e-15, Identities = 47/164 (28%), Positives = 86/164 (52%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TD S ++DA +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   156 RPSVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDVSTITDAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 318
>gi|83943452|ref|ZP_00955911.1| IS30 family protein transposase [Sulfitobacter sp. EE-36] >gi|83845684|gb|EAP83562.1| IS30 family protein transposase [Sulfitobacter sp. EE-36] (330 aa)
Score = 208, Expect = 8.7e-15, Identities = 82/318 (25%), Positives = 156/318 (49%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-------NVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWI-----QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNP-FTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           ++ L+  ER  I  M    K  + +IA E+ RH ST+ REI+RN+        + GY    AQK   ERR  +   +  +     +   ++    W   ++      E     +  S + IY ++     Q+ +  +   ++ +       +R +G+    D + +H    RP ++ +R+ FG WE DL+I +R  G  N+  +VERKTR + + +  +++    +N  +  +        K+IT D GIEF         I  + ++C+P A +Q+GS EN+N   RR   +    + LS+ ++ ++ +++N  PRK   + +  + +++
  S:     3 HKELNLRERRAIEDM-LNAKIAVREIAAEIGRHVSTVYREIKRNHYFDKELPELNGYYGVVAQKAATERRARRRKLV--RLVGLRKAVIKQLKEGWSPEQIAGRLQYEGQTTRV--SHETIYAYVYGPDGQSAELARYLPNRRKKRRPHHARRPRGLVFPPD-RSIHE---RPDYVDSRETFGEWEGDLMIFERAQGKMNVASLVERKTRFAVLFRNNDRSTTHLMNRLMGVMEPLPQPARKSITFDRGIEFRNWRKLKPGIGTEAWFCDPQAPWQKGSVENLNKRARRYLPRDAPVAALSNRDMKSICDRLNGTPRKCLGWKTPTEAFRE 324
>gi|58584075|ref|YP_203091.1| hypothetical protein XOO4452 [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58428669|gb|AAW77706.1| hypothetical protein XOO4452 [Xanthomonas oryzae pv. oryzae KACC10331] (322 aa)
Score = 208, Expect = 9.1e-15, Identities = 47/164 (28%), Positives = 86/164 (52%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TD S ++DA +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   156 RPSVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDVSTITDAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 318
>gi|148996995|ref|ZP_01824649.1| IS1239, transposase, putative [Streptococcus pneumoniae SP11-BS70] >gi|147756695|gb|EDK63735.1| IS1239, transposase, putative [Streptococcus pneumoniae SP11-BS70] (365 aa)
Score = 208, Expect = 9.4e-15, Identities = 87/286 (30%), Positives = 139/286 (48%)
  Q:    39 IATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           I TE+KR   T+ + + +    E YSA+ AQ+ Y   R         K  + ++   EK            HY  + +   ++   K        IY WI   K    + D       KG+  KK   + F +        R + I  R E GH+E+D V+  R   Y  LLV+ +RK+R+  I  + NK+   +N A+K ++ ++   + +IT DNG EF+++     + +  +YY  PYAS++RG+NEN N LIRR   KGT    ++  E+  ++  IN  P+K  +Y S
  S:    60 IHTEIKR--GTVRQCLGKGRFKEVYSADYAQQSYENNRKRS-----VKKSSLTKELKEK----------ILHYHNQKFSPEMMVMAKGVNVGISTIYYWIHHGKLGLSKQDLPYPR--KGKALKKQASTNF-KPAGQSIEQRSEAINLRLENGHYEIDTVLLTRAKNYC-LLVLTDRKSRHQIIRLIPNKSAEVVNQALKLILKQHK--ILSITADNGTEFNRL--FDVFSEEHIYYAHPYASWERGTNENHNRLIRRWLPKGT--KKMTPKEVAFIEKWINNYPKKCLDYKS 325
>gi|54302866|ref|YP_132859.1| hypothetical protein PBPRB1187 [Photobacterium profundum SS9] >gi|46916290|emb|CAG23059.1| conserved hypothetical protein [Photobacterium profundum SS9] (345 aa)
Score = 208, Expect = 9.5e-15, Identities = 85/313 (27%), Positives = 150/313 (47%)
  Q:     8 LNDTNK-YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVP--STKQIYNWIQTNKW----IKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMF 320
           +N+ NK Y+ L+   R  I  +  V    +  IA E+  H +T+ R++RRN+   GY    A K + + R   +    ++     E+       +W    +++  + E   C +    S   IY  I+ N+     + +   +    + KG KR K    +     +     RP  +  R+   + + D V G+     ++L+ +V+R  R +   +V +K    ++ A+ S++ K N  V T+T+DNG EF+     +      VY+ +PYAS+QRG+NEN NG IRR + K  D + L++  I +    +N  PRK+ 
  S:    21 MNEYNKQYQQLTQEPRYQISALRKVGMA-LRDIAKEIGVHYNTVSRKLRRNSPQTGYDPVAAHK-FSDVRKRTSLKASKRNDHTDEIIRNSVMLEWSPEAISQRIVVE---CKIGEKLSRITIYRRIEENRLQGGNLYRNLPRFGKTHWKGGKRNKKAGVRLIPDRID-IAERPDVVDARERLDNRKGDTVHGQG----AHLVTLVDRANRFTLAKRVFSKTKNEVSDAMISMLEKVN-SVLTVTLDNGGEFAGHVRVSEATGADVYFAKPYASWQRGTNENTNGRIRRFWPKKFDMATLTEKAIEDRIFMLNLTPRKVL 329
>gi|83955033|ref|ZP_00963689.1| TRm24 putative transposase [Sulfitobacter sp. NAS-14.1] >gi|83840362|gb|EAP79535.1| TRm24 putative transposase [Sulfitobacter sp. NAS-14.1] (330 aa)
Score = 208, Expect = 9.9e-15, Identities = 79/318 (24%), Positives = 156/318 (49%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-------NVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWI-----QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNP-FTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           +R L+  ER +I  M    K  +  IA ++ R  ST+ R+I+RN         + GY    AQ+  I+RR  +   +  ++    +   ++    W   ++      E     +  S + IY ++     Q+ +  +   ++ +       +R +G+    D + +H    RP ++ +R+ FG WE DL+I +R  G  N+  +VERKTR + + +  +++    +N  +  +        K+IT D GIEF         I  + ++C+P A +Q+GS EN+N   RR   +    + LS+ ++ ++ +++N  PRK   + +  + +++
  S:     3 HRELNLRERRVIEDM-LNAKIPVRGIAAKIGRQVSTVYRDIKRNGYTDTELPELSGYYGVVAQRTAIQRRARRRKLV--RFVGLRKAVIKQLKEGWSPEQIAGRLQFEGQSVRV--SHETIYAYVYGPDGQSKELARYLPNRRKKRRPHHSRRPRGLVFPPD-RSIHE---RPDYVDSRETFGEWEGDLMIFERAQGTMNVASLVERKTRFAVLFRNNDRSTTHLMNRLMGVMEPLPQPARKSITFDRGIEFRNWRKLKPGIGTEAWFCDPQAPWQKGSVENLNKRARRYLPRDAPVAALSNRDMKSICDRLNGTPRKCLGWKTPTEAFRE 324
>gi|84624352|ref|YP_451724.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84368292|dbj|BAE69450.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (297 aa)
Score = 207, Expect = 1.1e-14, Identities = 47/164 (28%), Positives = 86/164 (52%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TD S ++DA +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   131 RPSVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDVSTITDAHLRWIEPRLYNRPRKILGFKTPLEVFSEEVLNSV 293
>gi|116618231|ref|YP_818602.1| IS30 family transposase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097078|gb|ABJ62229.1| Transposase, IS30 family [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (305 aa)
Score = 207, Expect = 1.2e-14, Identities = 82/315 (26%), Positives = 145/315 (46%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWI-------------KKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           LS  ER +I  +  +   ++  IA  +KR  ST+  EI +   V  Y AE A    +++R+     L  ++ T +   A   N   H + + + +  E    VL    K IYNW+   +               K++SD  R  ++ GR  +                 RP+ +  R+ FGH+E+D +   ++ G   L+ + ER +R   + +V  +N   +   +     +   + K+IT+D G EF+K       +   VY+  PY+  +RGSNE +N  +RR   K      +S  E++ + + IN  P K  N+ S  + +++
  S:     4 LSSQERTVIQTLLELNY-SVRAIARFIKRSPSTVSIEIHQ---VTPYKAEIAHALALKKRH-----LRGRHDTLTPAIAVFLN---HHIGILK-WSPETAAHVLGLPFKTIYNWLNAGRLKLSLADLPDKGIRQKRQSDGRRQVFVHGRSIET----------------RPESVKARQTFGHFEVDTMQSGKRRG-DVLVTITERLSRQHIVRQVSGRNSQAVTPVLIRFF-QGIKNAKSITVDRGREFAKYNEIEQKLGIPVYFAHPYSPEERGSNEILNRYVRRFIPKERKIETVSAKELDQINHWINARPMKTLNWQSPRKVFQQ 300
>gi|121998065|ref|YP_001002852.1| integrase catalytic subunit [Halorhodospira halophila SL1] >gi|121589470|gb|ABM62050.1| Integrase, catalytic region [Halorhodospira halophila SL1] (343 aa)
Score = 207, Expect = 1.2e-14, Identities = 50/159 (31%), Positives = 88/159 (55%)
  Q:   169 PFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNN----LHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           P   RP+ I  R   GHWE DL+ G      S++  +VERKTR   ++K+ +    T  +A++    +      +  +++T D G E +     A  +   +++ +P+A +QRGSNEN NGL+R+   KG D S  S  ++N++   +N+ PRK  ++ + ++
  S:   169 PIAYRPEEIEQRLMPGHWEGDLIKGAYNR--SSVGTLVERKTRYVVLSKMHDG---TAEAALEGFHRQMRRLPAILRQSLTYDRGSEMACHERLARRLNLSIWFADPHAPWQRGSNENTNGLLRQYLPKGADLSEPSQTQLNDIARLLNQRPRKALDFRTPEE 326
>gi|23336154|ref|ZP_00121381.1| COG2826: Transposase and inactivated derivatives, IS30 family [Bifidobacterium longum DJO10A] (370 aa)
Score = 207, Expect = 1.2e-14, Identities = 46/144 (31%), Positives = 81/144 (56%)
  Q:   184 GHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKN--PFTINSAIKSLVNKNNLHVKTITIDNGIEFS---KIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           GHWE DL+ G R    S +  +VER TR + +  + + +       + I  + +   L   ++T D G E +   +IG +   +   VY+C+P++ +QRG+NEN NGL+R+ + KGTD S+  +  ++ +  ++N  PRK   +M   +
  S:   218 GHWEGDLITGSRNK--SAIGTLVERTTRFTILLHLPDGHDAEHVQQAIIDKMQHLPKLLRNSLTWDQGAELALHKRIGAS---LDMAVYFCDPHSPWQRGTNENTNGLLRQYFPKGTDLSVYPEDYLDAVAEELNDRPRKTLGFMKPSE 361
>gi|58582460|ref|YP_201476.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58427054|gb|AAW76091.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] (297 aa)
Score = 207, Expect = 1.3e-14, Identities = 47/164 (28%), Positives = 86/164 (52%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TD S ++DA +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   131 RPSVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDVSTITDAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 293
>gi|68536670|ref|YP_251376.1| transposase for IS1513f [Corynebacterium jeikeium K411] >gi|68264269|emb|CAI37757.1| transposase for IS1513f [Corynebacterium jeikeium K411] (194 aa)
Score = 206, Expect = 1.5e-14, Identities = 44/125 (35%), Positives = 77/125 (61%)
  Q:   196 QSGYSNLLVMVERKTRNSFITKVENKNP-FTINSAIKSLVNK-NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLI-RRVYKKGTDFSLLSDAEINNLQNKINRMPRKMF 320
           + G S L+ +VER +R + +  + +++   T+ + ++ +V   N   +KTIT D G E +          C+V++CEP++ +QR +NEN NG I RR YKKGTDF+ ++   +  +QN++N  PR++ 
  S:    47 KGGKSALITLVERTSRYTLLGHLPDEHSSHTVVATLQDMVKDLNTEQLKTITWDQGAEMAVTAQVQIKDGCQVFFCEPHSPWQRPTNENTNGEIRRRFYKKGTDFATVTPEHVAWVQNELNETPRQIL 174
>gi|603694|gb|AAA75312.1| putative transposase [Leuconostoc lactis] >gi|5824008|emb|CAA58055.1| putative transposase [Leuconostoc lactis] (305 aa)
Score = 206, Expect = 1.6e-14, Identities = 81/315 (25%), Positives = 146/315 (46%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWI-------------KKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           LS  ER +I  +  +   ++  IA  +KR  ST+  EI +   V  Y AE A    +++R+     L  ++ T +   A   N   H + + + +  E    VL    K IYNW+   +               K++SD  R  ++ GR  +                 RP+ +  R+ FGH+E+D +   ++ G   L+ + ER +R   + +V  +N   +   +     +   + K+IT+D G EF++       +   VY+  PY+  +RGSNE +N  +RR   K      +S  E++ + + IN  P K  N+ S  +++++
  S:     4 LSSQERTVIQTLLELNY-SVRAIARFIKRSPSTVSIEIHQ---VTPYKAEIAHALALKKRH-----LRGRHDTLTPAIAVFLN---HHIGILK-WSPETAAHVLGLPFKTIYNWLNAGRLKLSLADLPDKGIRQKRQSDGRRQVFVHGRSIET----------------RPESVKARRTFGHFEVDTMQSGKRRG-DVLVTITERLSRQHSVRQVTGRNSQAVTPVLIRFF-QGIKNAKSITVDRGREFARYNEIEQKLGIPVYFAHPYSPEERGSNEILNRYVRRFIPKERKIETVSAKELDQINHWINARPMKTLNWQSPRKFFQQ 300
>gi|29826964|ref|NP_821598.1| IS30 family transposase [Streptomyces avermitilis MA-4680] >gi|29604061|dbj|BAC68133.1| putative IS30 family ISCmi3-like transposase [Streptomyces avermitilis MA-4680] (212 aa)
Score = 205, Expect = 2.0e-14, Identities = 52/153 (33%), Positives = 87/153 (56%)
  Q:   184 GHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-----KNP-------------FTINSAIK-SLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           GHWE DL+IG   +G S +  +VER +R++ +  +       +NP               +N+A+  S+        KT+T D G E S     A     KV++ +P++ +QR +NEN NGL+R+ + KGTD S  S  ++  +   IN  PRK   + +  + +++ + SL
  S:    35 GHWEGDLIIG---TGRSAIGTLVERSSRSTLLVHLPRLEGWGENPPVKNGTSLGGYGAIAMNTALTASMTQLPEQLRKTLTWDRGKELSGHAQFALDTGTKVFFADPHSPWQRPTNENTNGLLRQYFPKGTDLSRWSSTDLEAVAMAINNRPRKTLGWRTPAEVFEEQLRSL 203
>gi|108805040|ref|YP_644977.1| integrase catalytic subunit [Rubrobacter xylanophilus DSM 9941] >gi|108766283|gb|ABG05165.1| Integrase, catalytic region [Rubrobacter xylanophilus DSM 9941] (370 aa)
Score = 205, Expect = 2.0e-14, Identities = 78/285 (27%), Positives = 135/285 (47%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPC--VLVPSTKQIYN--WIQTNKWIKK------RSDKL----RTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK-NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLS 301
           L+  ERE I        +++  IA  L R  ST+ RE+ RN   + Y A  A +K   R       L    +   ++ A K    W   +++  ++++ YP    +  S + IY   ++Q    +K+      RS ++    R A  KG+ R +        K       RP    +R   GHWE DL+ G R +   ++  +VER +R   + +V  K+  ++ +A+   + +     + T+T D G E +            VY+C+P + +QRG++EN N LIR+   + TD S+ +
  S:    64 LTLVEREEISRG-LATGESLRAIADRLGRPASTVCREVNRNGGRKNYRATSADEKAWFRARRPKRCLLAMNERLRDVVARKLKEDWSPEQIS-GWLRKEYPEDEAMRVSHETIYRTLFVQARGALKRELLAHLRSGRMMRKGRHASTKGQPRGQ-------IKEAVSIRERPPEAEDRAVPGHWEGDLLSGSRNT---HIATLVERSSRFVMLVRVTGKDTESVVAALSEQIRRLPKTMMATLTWDRGPEMAAHQQFTVATDVAVYFCDPKSPWQRGTSENTNRLIRQYLPRRTDLSVCT 351
>gi|58582903|ref|YP_201919.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58427497|gb|AAW76534.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] (252 aa)
Score = 205, Expect = 2.0e-14, Identities = 46/164 (28%), Positives = 85/164 (51%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   +  D S ++DA +  ++ ++   PRK+  + +  + + ++ +NS+
  S:    86 RPSVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQADVSTITDAHLRWIEPRLYNSPRKILGFKTPLEVFTEEVLNSV 248
>gi|149002390|ref|ZP_01827332.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP14-BS69] >gi|147759705|gb|EDK66696.1| IS1239, transposase, IS30 family protein [Streptococcus pneumoniae SP14-BS69] (180 aa)
Score = 205, Expect = 2.2e-14, Identities = 55/156 (35%), Positives = 91/156 (58%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQY 328
           RP  I  R E GH+E+D V+  +   Y  LLV+ +R++R+  I  + NK   ++N A+  L+ ++   + +IT DNG EF ++  +  + +  +YY   Y+S++RGSNEN N LIRR   KGT  +  +  E+  ++N IN  P+K  +Y S  ++
  S:    28 RPDVINLRLENGHYEIDTVLLTKIKNYC-LLVLTDRRSRHQIIRLIPNKTAESVNQALTLLLGEH--RILSITADNGSEFKRL--SEVFPEEHIYYAHAYSSWERGSNENHNRLIRRWLPKGTKKT--TPKEVAFIENWINNYPKKCLDYKSPSEF 176
>gi|84624762|ref|YP_452134.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188577741|ref|YP_001914670.1| transposase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|84368702|dbj|BAE69860.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188522193|gb|ACD60138.1| transposase [Xanthomonas oryzae pv. oryzae PXO99A] (249 aa)
Score = 204, Expect = 2.4e-14, Identities = 46/164 (28%), Positives = 85/164 (51%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   +  D S ++DA +  ++ ++   PRK+  + +  + + ++ +NS+
  S:    83 RPSVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQADVSTITDAHLRWIEPRLYNSPRKILGFKTPLEVFTEEVLNSV 245
>gi|148555988|ref|YP_001263570.1| integrase catalytic subunit [Sphingomonas wittichii RW1] >gi|148501178|gb|ABQ69432.1| Integrase, catalytic region [Sphingomonas wittichii RW1] (253 aa)
Score = 204, Expect = 2.4e-14, Identities = 49/150 (32%), Positives = 83/150 (55%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           RP    +R   GHWE DL+ G   +  + L   VER TR + + K+  K+   + +A+   + K    ++ ++T D G E ++          +VY+C+P + +QRGSNEN NGL+R+   +GTD S  S +++N +   +N+ PRK  ++
  S:    94 RPAEAEDRAVPGHWEGDLLTGANDTYIATL---VERHTRFAMLVKLRRKDSAAVAAALAHQICKLPEELRRSLTWDQGKEMARHHSFTMATDVQVYFCDPRSPWQRGSNENTNGLLRQYLPRGTDVSRFSQSQLNAIAMWLNQRPRKTLDF 241
>gi|58579938|ref|YP_198954.1| hypothetical protein XOO0315 [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58424532|gb|AAW73569.1| hypothetical protein XOO0315 [Xanthomonas oryzae pv. oryzae KACC10331] (322 aa)
Score = 204, Expect = 2.5e-14, Identities = 47/164 (28%), Positives = 86/164 (52%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WEL+ +  +   G + ++ M ER +    +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TDFS ++DA +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   156 RPSVVEQRSRIGDWELETI--RASHGRAVVVSMTERCSGLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDFSTITDAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 318
>gi|73662740|ref|YP_301521.1| putative transposase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72495255|dbj|BAE18576.1| truncated transposase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (232 aa)
Score = 204, Expect = 2.7e-14, Identities = 57/157 (36%), Positives = 87/157 (55%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK--NNLHVKTITIDNGIEFSK-IGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           RP+ I +R+  G WE D V+GK  +G S L+ +V+RKT      KV  K    +   I  L+    NN  + +IT D G EFSK   I +       Y+ +P++ +QRG+NEN NGLIR    KG D   +++ +I +   K+N  PRK F++ +  + +
  S:    68 RPQIINDRERIGDWEADTVMGK--TGKSCLVTLVDRKTGYLLCGKVPKKKSEFVKQKIVDLLGTLPNNKRL-SITPDRGKEFSKHPEITSELDNIPFYFPDPHSPWQRGTNENTNGLIREYIAKGIDIDNITEEQIEHYVYKLNTRPRKRFDWKTPAELF 224
>gi|148555274|ref|YP_001262856.1| integrase catalytic subunit [Sphingomonas wittichii RW1] >gi|148500464|gb|ABQ68718.1| Integrase, catalytic region [Sphingomonas wittichii RW1] (332 aa)
Score = 204, Expect = 2.8e-14, Identities = 79/318 (24%), Positives = 141/318 (44%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN-----VEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKL--RTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           YR L   ER  I  ++    K+  +I   + RH +T+ RE++RN+      + GY+  +A +    RR     F  ++     ++            ++       N P V   S + IY +I      K    +L  R    +G   K+G  S    K   P   RP     R + GHWE D ++  +     NLLV+ ER+TR + + K+ ++        I   +     H+ KTI+ DNG EF++       +    ++C+  + +Q+G  EN  G +RR   + T+   L+  ++    +++N  PRK   +++  + + K
  S:     5 YRQLGLDERIEIYRLH-ADGKSSREIGDAIGRHHTTVGRELKRNSRQTKIWLGGYNPRRAHELAARRREWDCRFKLERQPDLRKIVENGLAMGSSPEQIAGRLTLLNGPTV---SHESIYRFIYHRSAQKDYWHRLLPRRKSRRGHFGKRGGSSASFIKQRRPIQERPTEADTRTQPGHWEADYMLFAKYG--HNLLVLHERQTRFTIVEKLPHRRARLTACRIAGNLRHIPQHLRKTISFDNGTEFAEHYRLHQSLGVSTFFCDVRSPWQKGGVENTIGRLRRPLPRKTNLETLTAKQLRAHVDQLNNTPRKCLGFLTPAEAFLK 324
>gi|84625609|ref|YP_452981.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84369549|dbj|BAE70707.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (333 aa)
Score = 204, Expect = 2.9e-14, Identities = 45/152 (29%), Positives = 77/152 (50%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           RP  +  R   G WEL+ +     +G  +     ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TDFS ++DA +  ++ ++   PRK+  + +
  S:   167 RPSVVEQRSRIGDWELETIRASHGNGVVS--SRTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDFSTITDAHLRWIEQRLYNRPRKILGFKT 316
>gi|116618234|ref|YP_818605.1| IS30 family transposase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097081|gb|ABJ62232.1| Transposase, IS30 family [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (305 aa)
Score = 204, Expect = 3.1e-14, Identities = 82/315 (26%), Positives = 144/315 (45%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWI-------------KKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           LS  ER +I  +  +   ++  IA  +KR  ST+  EI +   V  Y AE A    ++ R+     L  ++ T +   A   N   H + + + +  E    VL    K IYNW+   +               K++SD  R  ++ GR  +                 RP+ +  R+ FGH+E+D +   ++ G   L+ + ER +R   + +V  +N   +   +     +   + K+IT+D G EF+K       +   VY+  PY+  +RGSNE +N  +RR   K      +S  E++ + + IN  P K  N+ S  + +++
  S:     4 LSSQERTVIQTLLELNY-SVRAIARFIKRSPSTVSIEIHQ---VTPYKAEIAHALALKIRH-----LRGRHDTLTPAIAVFLN---HHIGILK-WSPETAAHVLGLPFKTIYNWLNAGRLKLSLADLPDKGIRQKRQSDGRRQVFVHGRSIET----------------RPESVKARQTFGHFEVDTMQSGKRRG-DVLVTITERLSRQHIVRQVSGRNSQAVTPVLIRFF-QGIKNAKSITVDRGREFAKYNEIEQKLGIPVYFAHPYSPEERGSNEILNRYVRRFIPKERKIETVSAKELDQINHWINARPMKTLNWQSPRKVFQQ 300
>gi|84621943|ref|YP_449315.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84365883|dbj|BAE67041.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (318 aa)
Score = 203, Expect = 3.2e-14, Identities = 47/164 (28%), Positives = 86/164 (52%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WEL+ +  +   G + ++ M ER +    +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TDFS ++DA +  ++ ++   PRK+  + +  + + ++ +NS+
  S:   152 RPSVVEQRSRIGDWELETI--RASHGRAVVVSMTERCSGLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDFSTITDAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 314
>gi|115252806|emb|CAK98242.1| transposase of is30 family protein [Spiroplasma citri] (323 aa)
Score = 203, Expect = 3.5e-14, Identities = 85/280 (30%), Positives = 141/280 (50%)
  Q:    33 KKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIE--RRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKW------IKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL--HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKI 312
           ++NI+ IA  L RHRSTILREI+R   ++ YSA K+ + Y E  ++N+K     ++   F ++   KY+       + R+++K  +        K +Y WI+   +      ++ R  K +T   KG+    G  + F        W     + N    G   +D VIGK     S+ LV+VE+ ++  F  K+EN     +    K +V  NNL   +K I  D G EFS+      + + +VY+C+     Q+   EN+NG  R+ +  GTDF+ +S  +I+ + N +
  S:    33 EQNISVIAKFLNRHRSTILREIKRFKTIKEYSAYKSDEMYYEKRKKNNKRCKFTEEQINFMKIRLNKYHDAPREF-IYRYFLK--FGVKFRVCVKTLYKWIRLGFYGFLKQNLRHRGKKYKT---KGKSDNSGKLTDFKS-----IWDIENKVSNVGWLG---MDTVIGKNHQ--SSCLVLVEQSSKKYFAIKLENHTAREVEKKFKDIVINNNLIGKIKGIITDGGKEFSEWREMEIFAETQVYFCDVSKPRQKPLIENMNGEFRKWFPLGTDFNNVSQKQIDWVVNNV 306
>gi|60683316|ref|YP_213460.1| putative transposase [Bacteroides fragilis NCTC 9343] >gi|60494750|emb|CAH09556.1| putative transposase [Bacteroides fragilis NCTC 9343] (280 aa)
Score = 203, Expect = 3.7e-14, Identities = 84/282 (29%), Positives = 147/282 (52%)
  Q:    14 YRHLSYGEREIIGHMYFVQKK-NINQIATELKRHRSTILREIRRNNNVEG-YSAEKAQKKYIERRN----HKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRS-DKLRTAYIKGRKRKKGMFSKF-DEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVE-NKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGT 295
           Y+ L+  +R  I     +QKK   ++IA  +    STI RE+ RN++  G Y  +KAQ++  +RR+    +++   + +      L  E+++ +     L R+ ++         S + IY  I+ +K+I++ S  K     +K R+R  G  +   D   +H    RP    + K FG +E+D ++G    G   +L +VER T   F+ K++  K+   +  A   L++    ++KT+T DNG EF      A  +   VY+ +PY+S+Q+G+ EN NGLIR+   K +
  S:     2 YKQLTSEQRYTIS--VLLQKKCRKSEIAKAIGVSNSTITRELERNSSSRGVYKWDKAQRQADKRRHKAPGNRSVKPYVRTMAIDLLKHEQWSPEQISGYLARNGVR--------ISHETIYAIIRKDKYIERGSLYKYCRHQLKHRRRPVGKRTMIPDRASIH---QRPPEA-DGKRFGDFEMDTIVGGNNQG--AILTIVERSTNMLFMKKLKFGKDAEELAKAAIQLLSPYKGNIKTVTTDNGCEFYAHKAIAKGLDSTVYFADPYSSWQKGAIENANGLIRQYIPKSS 276
>gi|51574169|gb|AAU08012.1| putative transposase [Lactobacillus sakei] (193 aa)
Score = 203, Expect = 3.8e-14, Identities = 48/174 (27%), Positives = 91/174 (52%)
  Q:   151 GRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           G +RK+   ++    +      RP  I +R   GH+E D V+  ++ G + +   VERK+R + + ++  ++  ++  AI  L N+   ++KT+T+D+G EF+   +        +Y+   Y+ ++RGSNEN N ++RR   KG     ++D E+  +   +N  P K  N+ +
  S:    10 GIRRKRAKETRGSFSHGRSIEDRPAEISDRNTSGHFEADTVLSGKRKGQA-VATFVERKSRLTIVKRLNGRDSTSMTKAILELANQLGDNLKTLTVDHGKEFANYNLIEEQAGVPLYFAHAYSPHERGSNENRNRVLRRFIPKGQPIDEITDDELIQINWYLNSRPLKCLNWRT 182
>gi|148543482|ref|YP_001270852.1| integrase catalytic subunit [Lactobacillus reuteri F275] >gi|184152891|ref|YP_001841232.1| hypothetical protein LAR_0236 [Lactobacillus reuteri F275] >gi|148530516|gb|ABQ82515.1| Integrase, catalytic region [Lactobacillus reuteri F275] >gi|183224235|dbj|BAG24752.1| conserved hypothetical protein [Lactobacillus reuteri F275] (278 aa)
Score = 202, Expect = 4.1e-14, Identities = 74/278 (26%), Positives = 134/278 (48%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHK--NFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRK--KGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKG 294
           LS+ +R +I  + + + +++  IA  L   ++TI  E+ R    + Y   KAQ  +  + +H+     L    K    L  EK   +   +E   H ++  Y        K IY WI         +D L    I+ R+ K  +G FS     +      RP  +++R   GH+E D V+  ++ G + +   VERK+R   + +++ ++  ++  AI  L N+   ++K +T+D+G EF+   +     +  +Y+   Y+ ++RGSNEN N ++RR   KG
  S:     6 LSFEDRVVIETLRY-ESRSLKYIADYLGFSKTTIFNEVHRLT--DEYHTVKAQADHEAKLSHRGRKTILTSNLK---RLIEEKIKIQKWSIEQVAHVVRIAY--------KTIYTWIDQGVLDIGVAD-LPDHGIRRRRAKETRGTFS-----HGRSIEDRPAEVIDRHTSGHFEADTVLSGKRKGQA-IATFVERKSRLVIVKRLQGRDSTSMTKAILELANQLEDNLKILTVDHGKEFANYKLIEEQARIPLYFAHAYSPHERGSNENRNRVLRRFIPKG 266
>gi|149003270|ref|ZP_01828166.1| IS1239, transposase, putative [Streptococcus pneumoniae SP14-BS69] >gi|149021783|ref|ZP_01835790.1| IS1239, transposase, putative [Streptococcus pneumoniae SP23-BS72] >gi|147758730|gb|EDK65727.1| IS1239, transposase, putative [Streptococcus pneumoniae SP14-BS69] >gi|147930019|gb|EDK81006.1| IS1239, transposase, putative [Streptococcus pneumoniae SP23-BS72] (276 aa)
Score = 202, Expect = 4.2e-14, Identities = 87/281 (30%), Positives = 139/281 (49%)
  Q:     9 NDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNN---------VEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTK-------QIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRR 289
           N T K +HL+   R +I   +  + K+  +IA+ L +   TI  EI+R             E YSA+ AQ+ Y   R         K  + ++   EK            HY  + +   ++   K        IY WI   K    + D L     K  K++  +  K   + +     RP+ I  R E GH+E+D V+  R   Y  LLV+ +RK+R+  I  + NK+   +N A+K ++ ++   + +IT DNG EF+++     + +  +YY  PYAS++RG+NEN N LIRR
  S:     4 NYTTKAKHLTIDSRRLI-ERWKKEGKSNREIASLLGKVPQTIHTEIKRGTVRQCLGKGRFKEVYSADYAQQSYENNRKRS-----VKKSSLTKELKEK----------ILHYHNQKFSPEMMVIAKGVNVGISTIYYWIHHGKLGLSKQDLLYPRKGKALKKQASINFKPAGQSIA---QRPEAINLRLENGHYEIDTVLLTRAKNYC-LLVLTDRKSRHQIIRLIPNKSAEVVNQALKLILKQHK--ILSITADNGTEFNRL--FDIFSEEHIYYAHPYASWERGTNENHNRLIRR 276
>gi|84624201|ref|YP_451573.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84368141|dbj|BAE69299.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (180 aa)
Score = 202, Expect = 4.5e-14, Identities = 47/164 (28%), Positives = 84/164 (51%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           RP  +  R   G WELD +  +   G   ++ M ER +    +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TD S ++DA +  ++ ++   PRK+  + +  + + ++ +NS+
  S:    14 RPSVVEQRSRIGDWELDTI--RASHGNGVVVSMTERCSGLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDVSTITDAHLRWIEQRLYNRPRKILGFKTPLEVFTEEVLNSV 176
>gi|110679876|ref|YP_682883.1| transposase, putative [Roseobacter denitrificans OCh 114] >gi|109455992|gb|ABG32197.1| transposase, putative [Roseobacter denitrificans OCh 114] (330 aa)
Score = 202, Expect = 4.5e-14, Identities = 48/164 (29%), Positives = 85/164 (51%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNP-FTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           RP ++  R+ FG WE DL+I +R  G  N+  +VERKTR + + +  +++    IN  +  +        ++IT D G EF         I    ++C+P A +Q+GS EN+N   RR   + T  + LS+  +  + +++N  PRK   + +  + +++ M  L
  S:   165 RPDYVKTRETFGEWEGDLMIFERSQGTMNVASLVERKTRFAVLFRNNDRSSTHFINKLMDVMEPLPQPAWRSITFDRGFEFRAWRKLKSGIGTDSWFCDPQAPWQKGSVENLNKRARRYLPRDTQLAALSNRNMKAICDRLNGTPRKCLGWRTPTEAFREEMMKL 329
>gi|108802390|ref|YP_642586.1| integrase catalytic subunit [Mycobacterium sp. MCS] >gi|108772809|gb|ABG11530.1| Integrase, catalytic region [Mycobacterium sp. MCS] (414 aa)
Score = 202, Expect = 4.7e-14, Identities = 53/164 (32%), Positives = 92/164 (56%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITK------------VENKNPFT------INSA-IKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           RP    +R   GHWE DL+IG   +G S +  +VERK+R+  +              V+N    +      +N+A I SL        +T+T D G E +      +    KV++ +P++ +QR +NEN NG++R+ + KGTD S  S  ++  +   +N  PRK+  + +  + + + ++SL
  S:   226 RPAEAADRAVPGHWEGDLIIG---AGRSAIATVVERKSRSVMLVHLPRLEGWGLAPPVKNGPALSGYGAEAMNAALIASLAQLPKQLRQTLTWDRGKELAAHAQFTFDTGTKVFFADPHSPWQRPTNENTNGVLRQYFPKGTDLSRWSAQDLEAVALTLNNRPRKVLGWKTPAEVFAQQLHSL 405
Score = 96, Expect = 9.4e-02, Identities = 28/68 (41%), Positives = 41/68 (60%)
  Q:     4 TTITLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRN----NNVEGYSAEKAQKK 71
           T I+L++    R+LS+ ERE I  +   Q   + +IA E+KR  ST+ RE+RRN    +  + Y A  AQ K
  S:    17 TPISLDEPTG-RYLSFAEREEIA-LLRAQGAGVREIAREIKRDPSTVSRELRRNAATRSGTQVYRAGVAQWK 86
>gi|108802563|ref|YP_642759.1| integrase catalytic subunit [Mycobacterium sp. MCS] >gi|119855213|ref|YP_935816.1| integrase catalytic subunit [Mycobacterium sp. KMS] >gi|119855370|ref|YP_935973.1| integrase catalytic subunit [Mycobacterium sp. KMS] >gi|119855388|ref|YP_935991.1| integrase catalytic subunit [Mycobacterium sp. KMS] >gi|108772982|gb|ABG11703.1| Integrase, catalytic region [Mycobacterium sp. MCS] >gi|119697930|gb|ABL95001.1| Integrase, catalytic region [Mycobacterium sp. KMS] >gi|119698087|gb|ABL95158.1| Integrase, catalytic region [Mycobacterium sp. KMS] >gi|119698105|gb|ABL95176.1| Integrase, catalytic region [Mycobacterium sp. KMS] (437 aa)
Score = 202, Expect = 4.7e-14, Identities = 53/164 (32%), Positives = 92/164 (56%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITK------------VENKNPFT------INSA-IKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           RP    +R   GHWE DL+IG   +G S +  +VERK+R+  +              V+N    +      +N+A I SL        +T+T D G E +      +    KV++ +P++ +QR +NEN NG++R+ + KGTD S  S  ++  +   +N  PRK+  + +  + + + ++SL
  S:   249 RPAEAADRAVPGHWEGDLIIG---AGRSAIATVVERKSRSVMLVHLPRLEGWGLAPPVKNGPALSGYGAEAMNAALIASLAQLPKQLRQTLTWDRGKELAAHAQFTFDTGTKVFFADPHSPWQRPTNENTNGVLRQYFPKGTDLSRWSAQDLEAVALTLNNRPRKVLGWKTPAEVFAQQLHSL 428
Score = 96, Expect = 9.4e-02, Identities = 28/68 (41%), Positives = 41/68 (60%)
  Q:     4 TTITLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRN----NNVEGYSAEKAQKK 71
           T I+L++    R+LS+ ERE I  +   Q   + +IA E+KR  ST+ RE+RRN    +  + Y A  AQ K
  S:    40 TPISLDEPTG-RYLSFAEREEIA-LLRAQGAGVREIAREIKRDPSTVSRELRRNAATRSGTQVYRAGVAQWK 109
>gi|108801629|ref|YP_641826.1| integrase catalytic subunit [Mycobacterium sp. MCS] >gi|108802465|ref|YP_642661.1| integrase catalytic subunit [Mycobacterium sp. MCS] >gi|119855292|ref|YP_935895.1| integrase catalytic subunit [Mycobacterium sp. KMS] >gi|108772048|gb|ABG10770.1| Integrase, catalytic region [Mycobacterium sp. MCS] >gi|108772884|gb|ABG11605.1| Integrase, catalytic region [Mycobacterium sp. MCS] >gi|119698009|gb|ABL95080.1| Integrase, catalytic region [Mycobacterium sp. KMS] (474 aa)
Score = 202, Expect = 4.7e-14, Identities = 53/164 (32%), Positives = 92/164 (56%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITK------------VENKNPFT------INSA-IKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           RP    +R   GHWE DL+IG   +G S +  +VERK+R+  +              V+N    +      +N+A I SL        +T+T D G E +      +    KV++ +P++ +QR +NEN NG++R+ + KGTD S  S  ++  +   +N  PRK+  + +  + + + ++SL
  S:   286 RPAEAADRAVPGHWEGDLIIG---AGRSAIATVVERKSRSVMLVHLPRLEGWGLAPPVKNGPALSGYGAEAMNAALIASLAQLPKQLRQTLTWDRGKELAAHAQFTFDTGTKVFFADPHSPWQRPTNENTNGVLRQYFPKGTDLSRWSAQDLEAVALTLNNRPRKVLGWKTPAEVFAQQLHSL 465
Score = 96, Expect = 9.4e-02, Identities = 28/68 (41%), Positives = 41/68 (60%)
  Q:     4 TTITLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRN----NNVEGYSAEKAQKK 71
           T I+L++    R+LS+ ERE I  +   Q   + +IA E+KR  ST+ RE+RRN    +  + Y A  AQ K
  S:    77 TPISLDEPTG-RYLSFAEREEIA-LLRAQGAGVREIAREIKRDPSTVSRELRRNAATRSGTQVYRAGVAQWK 146
>gi|145589431|ref|YP_001156028.1| integrase, catalytic region [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145047837|gb|ABP34464.1| integrase, catalytic region [Polynucleobacter sp. QLW-P1DMWA-1] (246 aa)
Score = 202, Expect = 4.8e-14, Identities = 75/235 (31%), Positives = 114/235 (48%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEK----AQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTR-----HYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIG--KRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDN 248
           Y+HLS  ER  I ++     K   QIA  + RH+STI RE+ RN  ++GY  ++    A+++ +  RN       Q  +T   L A+     W  V++       H     +      +   +Y  ++  K  KKR       Y  GR R+  +  +       P   RP HI  R + GHWE D VIG   RQ+    ++ +VERK+    + KV+NK    ++SAI + +N     VKT+T DN
  S:     3 YQHLSQTERYQI-YILMKDGKTQTQIAQLMDRHKSTISRELARNTGLKGYRPKQACLLAEERSLGCRNAAQITADQWNQTVDCLLAQ-----WSPVQIANQVGISHETIYRHVYADKAAGGNLYQQLRCQKKRKKR-------YASGRDRRGQIVGR------RPISERPAHIETRSQVGHWEGDTVIGAAHRQA----VVTLVERKSGYVVLAKVKNKTSDLVSSAIITKLNAVTPLVKTLTFDN 225
>gi|116493932|ref|YP_805666.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116494163|ref|YP_805897.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116104082|gb|ABJ69224.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116104313|gb|ABJ69455.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] (219 aa)
Score = 200, Expect = 7.7e-14, Identities = 58/200 (28%), Positives = 99/200 (49%)
  Q:   136 WIKKRSDKLRTAYI----KGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           WI +R    + + +    K  KR++ + S++++       +R +    R E GH E+D V G R S  + +L +V+R TR    TK+EN +   +      L+      V+++T+D+G EFS         +  VY+C  Y   +RG+NE  N  +R  + KGT F  +S+ +I      IN  PRK   + +  Q   K +++
  S:    16 WIYQRQVDFQPSQLFDHGKRHKRRQDLRSRYNQAVGTSIEIRSESANRRTEKGHLEMDTVRGGRGSK-AAVLTIVDRVTRLMATTKLENLSQNAVLKGFARLMVDFPGPVRSVTVDHGKEFSCDQALTKRYRIPVYFCHAYHPNERGTNERFNRELRYYFPKGTQFDQVSETDIQQATALINNKPRKCLRWQTPVQAVSKPLST 218
>gi|116493592|ref|YP_805326.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116493861|ref|YP_805595.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116493887|ref|YP_805621.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116494127|ref|YP_805861.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116103742|gb|ABJ68884.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116104011|gb|ABJ69153.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116104037|gb|ABJ69179.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116104277|gb|ABJ69419.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] (219 aa)
Score = 199, Expect = 9.1e-14, Identities = 58/200 (28%), Positives = 99/200 (49%)
  Q:   136 WIKKRSDKLRTAYI----KGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           WI +R    + + +    K  KR++ + S++++       +R +    R E GH E+D V G R S  + +L +V+R TR    TK+EN +   +      L+      V+++T+D+G EFS         +  VY+C  Y   +RG+NE  N  +R  + KGT F  +S+ +I      IN  PRK   + +  Q   K +++
  S:    16 WIYQRQVGFQPSQLFDHGKRHKRRQDLRSRYNQAVGTSIEIRSESANRRTEKGHLEMDTVRGGRGSK-AAVLTIVDRVTRLMATTKLENLSQNAVLKGFARLMVDFPGPVRSVTVDHGKEFSCDQALTKRYRIPVYFCHAYHPNERGTNERFNRELRYYFPKGTQFDQVSETDIQQATALINNKPRKCLRWQTPVQAVSKPLST 218
>gi|134101481|ref|YP_001107142.1| IS30 transposase [Saccharopolyspora erythraea NRRL 2338] >gi|133914104|emb|CAM04217.1| IS30 transposase [Saccharopolyspora erythraea NRRL 2338] (194 aa)
Score = 199, Expect = 1.1e-13, Identities = 47/154 (30%), Positives = 80/154 (51%)
  Q:   169 PFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNP-FTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           P   RP    +R   GH+E DLVIG   + +S +  +V+RKTR     K+ +++    +   IK+    +     T+T D G+E ++           V++  P + +QRG+NEN N L+R+   KGT+ +  + AE++ +  K+N  PRK   +
  S:    32 PIEQRPDTAQDRSTLGHFEGDLVIG---ANHSQVATLVDRKTRYLVSVKLPSRHSTVVVPELIKTYAGLDPRLRDTLTWDRGMELAEHKRFTAATGVDVFFAAPRSPWQRGTNENTNKLVRQYLPKGTNLATFTQAELDAIATKLNTRPRKCLGF 183
>gi|116493611|ref|YP_805345.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116493617|ref|YP_805351.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116493623|ref|YP_805357.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116493929|ref|YP_805663.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116493953|ref|YP_805687.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116493989|ref|YP_805723.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116494063|ref|YP_805797.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116494125|ref|YP_805859.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116494140|ref|YP_805874.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116494712|ref|YP_806446.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116495474|ref|YP_807208.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116495510|ref|YP_807244.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116495514|ref|YP_807248.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116495555|ref|YP_807289.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116495851|ref|YP_807585.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116496150|ref|YP_807884.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116496251|ref|YP_807985.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116496294|ref|YP_808028.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116103761|gb|ABJ68903.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116103767|gb|ABJ68909.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116103773|gb|ABJ68915.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116104079|gb|ABJ69221.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116104103|gb|ABJ69245.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116104139|gb|ABJ69281.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116104213|gb|ABJ69355.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116104275|gb|ABJ69417.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116104290|gb|ABJ69432.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116104862|gb|ABJ70004.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116105624|gb|ABJ70766.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116105660|gb|ABJ70802.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116105664|gb|ABJ70806.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116105705|gb|ABJ70847.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116106001|gb|ABJ71143.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116106300|gb|ABJ71442.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116106401|gb|ABJ71543.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] >gi|116106444|gb|ABJ71586.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] (219 aa)
Score = 199, Expect = 1.1e-13, Identities = 58/196 (29%), Positives = 96/196 (48%)
  Q:   136 WIKKRSDKLRTAYI----KGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           WI +R    + + +    K  KR++ + S++++       +R +    R E GH E+D V G R S  + +L +V+R TR    TK+EN +   +      L+      V+++T+D+G EFS         +  VY+C  Y   +RG+NE  N  +R  + KGT F  +S+ +I      IN  PRK   + +  Q   K
  S:    16 WIYQRQVDFQPSQLFDHGKRHKRRQDLRSRYNQAVGTSIEIRSESANRRTEKGHLEMDTVRGGRGSK-AAVLTIVDRVTRLMATTKLENLSQNAVLKGFARLMVDFPGPVRSVTVDHGKEFSCDQALTKRYRIPVYFCHAYHPNERGTNERFNRELRYYFPKGTQFDQVSETDIQQATALINNKPRKCLRWQTPVQAVSK 214
>gi|84503296|ref|ZP_01001374.1| TRm24 putative transposase [Oceanicola batsensis HTCC2597] >gi|84388350|gb|EAQ01300.1| TRm24 putative transposase [Oceanicola batsensis HTCC2597] (330 aa)
Score = 199, Expect = 1.1e-13, Identities = 49/159 (30%), Positives = 86/159 (54%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK----NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           RP+H+  R+ FG WE DL+I +R  G  N+  +VERKTR + + +    N  + N  ++ L++          K+IT D G EF +       I    ++C+P A +Q+GS EN+N   RR   + T  + LS+  +  + +++N  PRK   + +  + +++
  S:   165 RPEHVNTRETFGDWEGDLMIFERAQGNMNVASLVERKTRFAVLFR---NNDRSSNHFMRKLMDVMEPLPQQARKSITFDRGFEFREWRKLKTGIGTDSWFCDPQAPWQKGSVENLNKRARRYLPRDTQLAALSNRNMRAICDRLNGTPRKCLGWRTPTEAFRE 324
>gi|56783604|dbj|BAD81050.1| transposase [Lactobacillus brevis] >gi|145586964|dbj|BAF56900.1| putative transposase [Lactobacillus backi] >gi|145586972|dbj|BAF56907.1| putative transposase [Lactobacillus backi] (305 aa)
Score = 198, Expect = 1.2e-13, Identities = 82/315 (26%), Positives = 140/315 (44%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYN-----CKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWI-------------KKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           LS  ER +I  +  +   +I  IA  + R  +T+  EI +   V  Y A+ A    +++R+     L  ++ T +   A   N      KW           E    VL    K IYNW+   +               K++SD  R  ++ GR  +                 RPK +  R++FGH+E+D +   ++ G   L+ + ER +R   + +V  +N   +   +         + K+IT+D G EF K       +   VY+  PY+  +RGSNE +N  +RR   K      +S  E++ + + IN  P K  N+ S  + +++
  S:     4 LSSQERTVIQTLLELNY-SIRAIARFINRSPATVSVEIHQ---VTPYKADIAHALALKKRH-----LRGRHHTLTPAIAVFLNEHIGILKWS---------PETAAHVLGLPFKTIYNWLNAGRLKLSLADLPDKGIRQKRQSDGRRQVFVHGRSIES----------------RPKSVQARQDFGHFEVDTMQSGKKRG-EVLVTITERLSRQHIVRQVSGRNSQAVTPVLIHFFQGIE-NAKSITVDRGREFVKYDEIEQKLGIPVYFAHPYSPEERGSNEILNRYVRRFIPKERKIETVSAKELDQINHWINARPMKTLNWQSPRKVFQQ 300
>gi|50871993|dbj|BAD34520.1| putative transposase [Pediococcus damnosus] (305 aa)
Score = 198, Expect = 1.2e-13, Identities = 82/315 (26%), Positives = 140/315 (44%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYN-----CKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWI-------------KKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           LS  ER +I  +  +   +I  IA  + R  +T+  EI +   V  Y A+ A    +++R+     L  ++ T +   A   N      KW           E    VL    K IYNW+   +               K++SD  R  ++ GR  +                 RPK +  R++FGH+E+D +   ++ G   L+ + ER +R   + +V  +N   +   +         + K+IT+D G EF K       +   VY+  PY+  +RGSNE +N  +RR   K      +S  E++ + + IN  P K  N+ S  + +++
  S:     4 LSSQERTVIQTLLELNY-SIRAIARFINRSPATVSVEIHQ---VTPYKADIAHALALKKRH-----LRGRHHTLTPAIAVFLNEHIGILKWS---------PETAAHVLGLPFKTIYNWLNAGRLKLSLADLPDKGIRQKRQSDGRRQVFVHGRSIES----------------RPKSVQARQDFGHFEVDTMQSGKKRG-EVLVTITERLSRQHIVRQVSGRNSQAVTPVLIHFFQGIE-NAKSITVDRGREFVKYDEIEQKLGIPVYFAHPYSPEERGSNEILNRYVRRFIPKERKIETVSAKELDQINHWINARPMKTLNWQSPRKVFQQ 300
>gi|49457775|ref|YP_031719.1| putative transposase [Lactobacillus brevis] >gi|49257021|dbj|BAD24808.1| putative transposase [Lactobacillus brevis] (305 aa)
Score = 198, Expect = 1.3e-13, Identities = 56/207 (27%), Positives = 98/207 (47%)
  Q:   125 KQIYNWIQTNKWI-------------KKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           K IYNW+   +               K++SD  R  ++ GR  +                 RPK +  R++FGH+E+D +   ++ G   L+ + ER +R   + +V  +N   +   +         + K+IT+D G EF K       +   VY+  PY+  +RGSNE +N  +RR   K      +S  E++ + + IN  P K  N+ S  + +++
  S:    99 KTIYNWLNAGRLKLSLADLPDKGIRQKRQSDGRRQVFVHGRSIES----------------RPKSVQARQDFGHFEVDTMQSGKKRG-EVLVTITERLSRQHIVRQVSGRNSQAVTPVLIHFFQGIE-NAKSITVDRGREFVKYDEIEQKLGIPVYFAHPYSPEERGSNEILNRYVRRFIPKERKIETVSAKELDQINHWINARPMKTLNWQSPRKVFQQ 300
>gi|58581152|ref|YP_200168.1| hypothetical protein XOO1529 [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58425746|gb|AAW74783.1| hypothetical protein XOO1529 [Xanthomonas oryzae pv. oryzae KACC10331] (322 aa)
Score = 198, Expect = 1.4e-13, Identities = 44/152 (28%), Positives = 77/152 (50%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           RP  +  R   G WEL+ +  +   G + ++ M ER +    +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TD S ++DA +  ++ ++   PRK+  + +
  S:   156 RPSVVEQRSRIGDWELETI--RASHGRAVVVSMTERCSGLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDVSTITDAHLRWIEQRLYNRPRKILGFKT 305
>gi|134101612|ref|YP_001107273.1| transposase [Saccharopolyspora erythraea NRRL 2338] >gi|133914235|emb|CAM04348.1| transposase [Saccharopolyspora erythraea NRRL 2338] (389 aa)
Score = 197, Expect = 1.5e-13, Identities = 54/173 (31%), Positives = 91/173 (52%)
  Q:   152 RKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKV---------ENKNPFTI---------NSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           R R +G   KF  + V     RP  + +R   GHWE DL+IG   S    L   VER TR + +  +           KN   +         ++   ++ N  +   K++T D G E ++          ++Y+ +P++ +QRG+NEN NGL+R+ + KGTD S  S ++++ +   +N  PRK   + +
  S:   190 RARTRGRGKKFVTEEVM-ISQRPAEVEDRAVPGHWEGDLIIGLDSSAIGTL---VERSTRFTMLLHLPPMPGHGGPRAKNGPALAGHGAEAVRDAVATTITNLPDQLRKSLTWDQGAEMAQHAQIRIDTGLQIYFADPHSPWQRGTNENTNGLLRQYFPKGTDLSRHSRSDLDAVAAALNARPRKTLGWKT 376
>gi|90569622|gb|ABD94692.1| putative IS30 family transposase [Pseudomonas aeruginosa] (193 aa)
Score = 197, Expect = 1.6e-13, Identities = 52/164 (31%), Positives = 88/164 (53%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPF------------------TINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           RP  + +R   GHWE DL+IG  +S    L   VER +R + +  +  +  +                  T+ +A+K  V    + + +++T D G E S           KV++ +P++ +QRG+NEN NGL+R+ + KGTD S  S  EI  + + +N  PRK   + +  +     + S+
  S:     5 RPAEVEDRALPGHWEGDLIIGLNRSAIGTL---VERSSRFTMLVHLPREEGYGLTPRTKNGPALAGYGAVTMTNALKRAVTGLPVQLWQSLTWDRGKELSDHVRFTIESGVKVFFADPHSPWQRGTNENTNGLLRQYFPKGTDLSRWSYQEIQAVAHTLNTRPRKTLGWKTPAEVLNDYLTSI 184
>gi|118470400|ref|YP_887010.1| ISMsm8, transposase [Mycobacterium smegmatis str. MC2 155] >gi|118171687|gb|ABK72583.1| ISMsm8, transposase [Mycobacterium smegmatis str. MC2 155] (466 aa)
Score = 197, Expect = 1.6e-13, Identities = 50/165 (30%), Positives = 91/165 (55%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNL---------LVMVERKTRNSFITKVENK------NPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLN 337
           RP  + +R   GHWE DL+IG ++S    L         LV + R+     I + +N          T+ +A++  +      ++ ++T D G E S     +     KV++ +P + +QRG+NEN NGL+R+ + KGTD S  S  ++  + + +N  PRK   + +  + + + ++SL+
  S:   278 RPPEVDDRAVPGHWEGDLLIGLQRSAIGTLVERSSRFTMLVHLPREVGYGIIPRTKNGPALAGYGAITMANALEQTITTLPAQLRRSLTWDRGKELSAHAQFSVASGVKVFFADPKSPWQRGTNENTNGLLRQYFPKGTDLSRWSAEDVAAIAHTLNTRPRKTLGWRTPAEAFAEHLHSLH 458
Score = 94, Expect = 1.5e-01, Identities = 30/72 (41%), Positives = 40/72 (55%)
  Q:     8 LNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVE----GYSAEKAQKKYIERRNHK 79
           L +T   R+LS  ERE I  ++  Q   + +IA  LKR  STI RE+RRN +       Y A  AQ  + ERR  +
  S:    72 LPETVSGRYLSSDERENIA-LWRAQGAGVREIARRLKRAPSTISRELRRNASTRTYRLDYKASTAQ-WHAERRARR 145
>gi|118467851|ref|YP_886093.1| ISMsm8, transposase [Mycobacterium smegmatis str. MC2 155] >gi|118169138|gb|ABK70034.1| ISMsm8, transposase [Mycobacterium smegmatis str. MC2 155] (466 aa)
Score = 197, Expect = 1.7e-13, Identities = 50/165 (30%), Positives = 91/165 (55%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNL---------LVMVERKTRNSFITKVENK------NPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLN 337
           RP  + +R   GHWE DL+IG ++S    L         LV + R+     I + +N          T+ +A++  +      ++ ++T D G E S     +     KV++ +P + +QRG+NEN NGL+R+ + KGTD S  S  ++  + + +N  PRK   + +  + + + ++SL+
  S:   278 RPPEVDDRAVPGHWEGDLLIGLQRSAIGTLVERSSRFTMLVHLPREVGYGIIPRTKNGPALAGYGAITMANALEQTITTLPAQLRRSLTWDRGKELSAHAQFSVASGVKVFFADPKSPWQRGTNENTNGLLRQYFPKGTDLSRWSAEDVAAIAHTLNTRPRKTLGWRTPAEAFAEHLHSLH 458
Score = 94, Expect = 1.6e-01, Identities = 30/72 (41%), Positives = 40/72 (55%)
  Q:     8 LNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVE----GYSAEKAQKKYIERRNHK 79
           L +T   R+LS  ERE I  ++  Q   + +IA  LKR  STI RE+RRN +       Y A  AQ  + ERR  +
  S:    72 LPETVSGRYLSSDERENIA-LWRAQGAGVREIARRLKRAPSTISRELRRNASTRTYRLDYKASTAQ-WHAERRARR 145
>gi|50871995|dbj|BAD34521.1| putative transposase [Lactobacillus paracollinoides] (305 aa)
Score = 197, Expect = 1.7e-13, Identities = 84/315 (26%), Positives = 144/315 (45%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYN-----CKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWI-------------KKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVN--KNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           LS  ER +I  +  +   +I  IA  + R  +T+  EI +   V  Y A+ A    +++R+     L  ++ T +   A   N      KW           E    VL    K IYNW+   +               K++SD  R  ++ GR  +                 RPK +  R++FGH+E+D +   ++ G   L+ + ER +R   + +V  +N   I +    L++  +   + K+IT+D G EF K       +   VY+  PY+  +RGSNE +N  +RR   K      +S  E++ + + IN  P K  N+ S  + +++
  S:     4 LSSQERTVIQTLLELNY-SIRAIARFINRSPATVSVEIHQ---VTPYKADIAHALALKKRH-----LRGRHHTLTPAIAVFLNEHIGILKWS---------PETAAHVLGLPFKTIYNWLNAGRLKLSLADLPDKGIRQKRQSDGRRQVFVHGRSIES----------------RPKSVQARQDFGHFEVDTMQSGKKRG-EVLVTITERLSRQHIVRQVSGRN---IQAVTPVLIHFFQGIENAKSITVDRGREFVKYDEIEQKLGIPVYFAHPYSPEERGSNEILNRYVRRFIPKERKIETVSAKELDQINHWINARPMKTLNWQSPRKVFQQ 300
>gi|58425218|gb|AAW74255.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] (163 aa)
Score = 197, Expect = 1.7e-13, Identities = 44/158 (27%), Positives = 84/158 (53%)
  Q:   179 NRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           +R   G WEL+ +  +   G + ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   +  D S ++DA +  ++ ++   PRK+  + +  + + ++ +NS+
  S:     3 SRSRIGDWELETI--RASHGRAVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQADVSTITDAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 159
>gi|116493879|ref|YP_805613.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116104029|gb|ABJ69171.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] (219 aa)
Score = 197, Expect = 1.7e-13, Identities = 58/196 (29%), Positives = 96/196 (48%)
  Q:   136 WIKKRSDKLRTAYI----KGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           WI +R    + + +    K  KR++ + S++++       +R +    R E GH E+D V G R S  + +L +V+R TR    TK+EN +   +      L+      V+++T+D+G EFS         +  VY+C  Y   +RG+NE  N  +R  + KGT F  +S+ +I      IN  PRK   + +  Q   K
  S:    16 WIYQRQVDFQPSQLFDHGKRHKRRQDLRSRYNQAVGTSIEIRSESANRRTEKGHLEMDTVRGGRGSK-AAVLTIVDRVTRLMATTKLENLSQNAVLKGFARLMVDFPGPVRSMTVDHGKEFSCDQALTKRYRIPVYFCHAYHPNERGTNERFNRELRYYFPKGTQFDQVSETDIQQATALINNKPRKCLRWQTPVQAVSK 214
>gi|46191183|ref|ZP_00120282.2| COG2826: Transposase and inactivated derivatives, IS30 family [Bifidobacterium longum DJO10A] (362 aa)
Score = 197, Expect = 1.9e-13, Identities = 48/151 (31%), Positives = 84/151 (55%)
  Q:   177 ILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKN--PFTINSAIKSLVNKNNLHVKTITIDNGIEFS---KIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           I +R   GHWE DL+ G R    S +  +VER TR + +  + + +       + I  + +   L   ++T D G E +   +IG +   +   VY+C+P++ +QRG+NEN NGL+R+ + KGTD S+  +  ++ +  ++N  PRK   +M   +
  S:   203 IEDRAVPGHWEGDLITGSRNK--SAIGTLVERTTRFTILLHLPDGHDAEHVQQAIIDKMQHLPKLLRNSLTWDQGAELALHKRIGAS---LDMAVYFCDPHSPWQRGTNENTNGLLRQYFPKGTDLSVYPEDYLDAVAEELNDRPRKTLGFMKPSE 353
>gi|170736586|ref|YP_001777846.1| integrase catalytic region [Burkholderia cenocepacia MC0-3] >gi|170736633|ref|YP_001777893.1| integrase catalytic region [Burkholderia cenocepacia MC0-3] >gi|194560261|ref|YP_002095286.1| Integrase [Burkholderia cenocepacia PC184] >gi|194560305|ref|YP_002095330.1| Integrase [Burkholderia cenocepacia PC184] >gi|124875777|gb|EAY65767.1| Integrase [Burkholderia cenocepacia PC184] >gi|124875821|gb|EAY65811.1| Integrase [Burkholderia cenocepacia PC184] >gi|169818774|gb|ACA93356.1| Integrase catalytic region [Burkholderia cenocepacia MC0-3] >gi|169818821|gb|ACA93403.1| Integrase catalytic region [Burkholderia cenocepacia MC0-3] (465 aa)
Score = 196, Expect = 2.3e-13, Identities = 49/152 (32%), Positives = 83/152 (54%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTI-------------------NSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           RP  + +R   GHWE DL+IG  +S    L   VER +R + +  +  +  + +                   N+  K++ +   L  +++T D G E S           +V++ +P++ +QRG+NEN NGL+R+ + KGTD S  S  EI  + + +N  PRK   + +
  S:   277 RPAEVEDRAVPGHWEGDLLIGLNRSAIGTL---VERSSRFTMLVHLPREKGYGLIPRTKNGPALAGYGAVTMANALKKTVTDMPALLWRSLTWDRGKELSDHARFTVESGVQVFFADPHSPWQRGTNENTNGLLRQYFPKGTDLSRWSAQEIQAVAHTLNTRPRKTLGWKT 444
>gi|58579671|ref|YP_198687.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58424265|gb|AAW73302.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] (341 aa)
Score = 195, Expect = 2.9e-13, Identities = 78/303 (25%), Positives = 136/303 (44%)
  Q:    35 NINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLW--QKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM--------RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPF-TINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLN 337
           +IN IA  L R+  T+ REIRR     GY+A  A   Y  RR          +    F ++  +    +W   ++    +K  +P    PS +  +  I T  +   R   L+   ++  ++ K              W+        RP+ +  R   GHWE DL+ G      S +  +VERKTR   + K++   P   +    + +    +  + ++T D G E +        +   +++ +P+A +QRGSNEN NGL+ +   KG D S  S   +NN+ + +N  PR+   + + +Q  ++ +   N
  S:    28 SINSIARRLNRNACTLSREIRRQG-APGYAATSAASNYRLRRRACVRRRRLVEGSAIFQQVRDDLVLYRWSPQQIAAK-LKAMHPDD--PSQRVSHETIYTAIYTHPRGG-LKKELVEALRQHKPTRGLRRTTAAKRTWVPEELRIVHRPEEVAQRLIPGHWEGDLIKGAFNR--SCVGTLVERKTRFVVLCKMDGCTPQDALEGFTRQMKKLPHCLLGSLTYDRGTEMTCYPELMKRLNIDLWFADPHAPWQRGSNENTNGLLCQFMPKGVDLSKASQEYLNNVADLMNARPRQTLGWKTPNQALEEEIAQFN 334
>gi|84621782|ref|YP_449154.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188574317|ref|YP_001911246.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|84365722|dbj|BAE66880.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188518769|gb|ACD56714.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae PXO99A] (315 aa)
Score = 195, Expect = 3.0e-13, Identities = 78/303 (25%), Positives = 136/303 (44%)
  Q:    35 NINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLW--QKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM--------RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPF-TINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLN 337
           +IN IA  L R+  T+ REIRR     GY+A  A   Y  RR          +    F ++  +    +W   ++    +K  +P    PS +  +  I T  +   R   L+   ++  ++ K              W+        RP+ +  R   GHWE DL+ G      S +  +VERKTR   + K++   P   +    + +    +  + ++T D G E +        +   +++ +P+A +QRGSNEN NGL+ +   KG D S  S   +NN+ + +N  PR+   + + +Q  ++ +   N
  S:     2 SINSIARRLNRNACTLSREIRRQG-APGYAATSAASNYRLRRRACVRRRRLVEGSAIFQQVRDDLVLYRWSPQQIAAK-LKAMHPDD--PSQRVSHETIYTAIYTHPRGG-LKKELVEALRQHKPTRGLRRTTAAKRTWVPEELRIVHRPEEVAQRLIPGHWEGDLIKGAFNR--SCVGTLVERKTRFVVLCKMDGCTPQDALEGFTRQMKKLPHCLLGSLTYDRGTEMTCYPELMKRLNIDLWFADPHAPWQRGSNENTNGLLCQFMPKGVDLSKASQEYLNNVADLMNARPRQTLGWKTPNQALEEEIAQFN 308
>gi|126667941|ref|ZP_01738906.1| Integrase [Marinobacter sp. ELB17] >gi|126627601|gb|EAZ98233.1| Integrase [Marinobacter sp. ELB17] (220 aa)
Score = 195, Expect = 3.0e-13, Identities = 51/191 (26%), Positives = 89/191 (46%)
  Q:   144 LRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMN 334
           LR  + K R R  G+  +     +    +RP  +  R   GHWE DL+ G      S +  +VER +   F+ K++            + +N+  L ++ T T D G +  +           +Y+ +P++ +QR  NEN NGL+R+   KGTD S+ S  E++    ++N  PRK   + +  + +   +N
  S:    21 LRQGHTKRRPRAGGVDRRQQIPDLVSIHLRPPEVEERLLPGHWEGDLIKGAFNR--SAVGTLVERVSGLVFLAKMDGGTATAAVQGYSAALNRVPLEMRQTFTYDQGRKLVRHAEITQKTGTAIYFADPHSPWQRAINENTNGLLRQYMPKGTDLSVFSQDELDAFAFQLNTRPRKRLGFKTPLEVFMDLIN 210
>gi|38233368|ref|NP_939135.1| putative transposase [Corynebacterium diphtheriae NCTC 13129] >gi|38199628|emb|CAE49286.1| Putative transposase [Corynebacterium diphtheriae] (437 aa)
Score = 195, Expect = 3.2e-13, Identities = 49/164 (29%), Positives = 93/164 (56%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-----KNPFT-------------INSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           RP    +R   GHWE DL+IG   +G S +  +VER +R+  +  +       + P T             +N+A+++++    L ++ T+T D G E +           KV++ +P++ +QR +NEN NGL+R+ + KGTD S  +  ++  +   +N  PRK+  + +  + + + + S+
  S:   249 RPPEASDRAVPGHWEGDLIIG---TGRSAIGTVVERYSRSILLVHLPRLDGWGEQPRTKNGPALGGYGAEAMNTALQTVMKDLPLQLRQTLTWDRGTELADHAAFTLATGTKVFFADPHSPWQRPTNENSNGLLRQYFPKGTDLSRWTAQDLAAIAYTLNNRPRKVLGFRTPAEVFNEQLQSI 428
>gi|145592934|ref|YP_001157231.1| integrase catalytic subunit [Salinispora tropica CNB-440] >gi|145302271|gb|ABP52853.1| Integrase, catalytic region [Salinispora tropica CNB-440] (192 aa)
Score = 194, Expect = 3.6e-13, Identities = 48/154 (31%), Positives = 81/154 (52%)
  Q:   184 GHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSLVNKNNLHVKT-ITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLN 337
           GHWE DL+IGK  +  S +  +VER TR   +  + N + P  +  A+   V+     +K+ +T D G E +     +      V++C+P   +QRGSNEN NGL+R+   KGTD +  S  +++ +  ++N   RK   + +  +   K + + N
  S:    39 GHWEGDLIIGKAHT--SAIGTLVERTTRFVALVHLPNGRQPAQVRDALVQTVSSLPAQLKSSLTWDQGSEVALHTQFSTATDMPVFFCDPGKPWQRGSNENTNGLLRQYLPKGTDLTRYSRGDLDAVAAELNSRSRKTLGWDTPAERLAKFLATAN 192
>gi|15793509|ref|NP_283331.1| IS1655 transposase [Neisseria meningitidis Z2491] >gi|121051495|emb|CAM07788.1| insertion element IS1655 transposase [Neisseria meningitidis Z2491] (254 aa)
Score = 193, Expect = 4.8e-13, Identities = 84/258 (32%), Positives = 131/258 (50%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNV-EGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFA--EKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNK------WIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVEN-KNPFTINSAIKSL-VNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEP 271
           Y  L+ GER  I   Y  +   + +IA +L RH+STI REIRR+    + YSAEKAQ++    +  K     Q YK  S+L    +    +    E    Y+++++   L  ST  IY +++ +K      W       LR      RKR    +++           RP  +  +   G WE D ++GK Q   S LL +VER TR + I K+++ K   T  +A+++L  +K+ +H  TIT+DNG EF +       +K + Y+C P
  S:     3 YTQLTQGERYHI--QYLFRHCTVTEIAKQLNRHKSTISREIRRHRTQGQQYSAEKAQRQSRTIKQRKR----QPYKLDSQLIQHIDTLIRRKLSPEQVCAYLRKHHQITLHHST--IYRYLRQDKSNGSTLW-----QHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVDQKSRIGDWEADTIVGKGQK--SALLTLVERVTRYTIICKLDSLKAEDTARAAVRALKAHKDRVH--TITMDNGKEFYQHTKITKALKAETYFCRP 254
>gi|58426914|gb|AAW75951.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] (164 aa)
Score = 193, Expect = 5.2e-13, Identities = 45/157 (28%), Positives = 81/157 (51%)
  Q:   180 RKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           R   G WELD +  +   G   ++ M ER +    +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TD S ++DA +  ++ ++   PRK+  + +  + + ++ +NS+
  S:     5 RSRIGDWELDTI--RASHGNGVVVSMTERCSGLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDVSTITDAHLRWIEQRLYNRPRKILGFKTPLEVFTEEVLNSV 160
>gi|116691337|ref|YP_836870.1| integrase catalytic subunit [Burkholderia cenocepacia HI2424] >gi|170735789|ref|YP_001777049.1| integrase catalytic region [Burkholderia cenocepacia MC0-3] >gi|170736800|ref|YP_001778060.1| integrase catalytic region [Burkholderia cenocepacia MC0-3] >gi|170736838|ref|YP_001778098.1| integrase catalytic region [Burkholderia cenocepacia MC0-3] >gi|194560425|ref|YP_002095450.1| Integrase [Burkholderia cenocepacia PC184] >gi|116649337|gb|ABK09977.1| Integrase, catalytic region [Burkholderia cenocepacia HI2424] >gi|124875941|gb|EAY65931.1| Integrase [Burkholderia cenocepacia PC184] >gi|169817977|gb|ACA92559.1| Integrase catalytic region [Burkholderia cenocepacia MC0-3] >gi|169818988|gb|ACA93570.1| Integrase catalytic region [Burkholderia cenocepacia MC0-3] >gi|169819026|gb|ACA93608.1| Integrase catalytic region [Burkholderia cenocepacia MC0-3] (465 aa)
Score = 193, Expect = 5.5e-13, Identities = 50/152 (32%), Positives = 83/152 (54%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPF------------------TINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           RP  + +R   GHWE DL+IG  +S    L   VER +R + +  +  +  +                  T+ +A+K  V      + +++T D G E S           +V++ +P++ +QRG+NEN NGL+R+ + KGTD S  S  EI  + + +N  PRK   + +
  S:   277 RPAEVEDRAVPGHWEGDLLIGLNRSAIGTL---VERSSRFTMLVHLPREKGYGLIPRTKNGPALAGYGAVTMANALKKTVTDMPARLWRSLTWDRGKELSDHARFTVESGVQVFFADPHSPWQRGTNENTNGLLRQYFPKGTDLSRWSAQEIQAVAHTLNTRPRKTLGWKT 444
>gi|153803338|ref|ZP_01957924.1| transposase for insertion sequence element [Vibrio cholerae MZO-3] >gi|124121122|gb|EAY39865.1| transposase for insertion sequence element [Vibrio cholerae MZO-3] (141 aa)
Score = 192, Expect = 6.1e-13, Identities = 40/129 (31%), Positives = 76/129 (58%)
  Q:   202 LLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ----YYK 330
           ++ +VER T  + I +++++   ++N     L+++ +    TIT DNG EF++  +       + Y+  P+ S++RG+NEN NGLIR+   KGT  + L+ A+ N + +K+N  PR    + + ++    YY+
  S:     9 IVTLVERMTGYTLIGQMDDRTTASLNRRTIQLMSRFDGLFTTITADNGTEFNQYELIEATTDTRFYFANPHHSWERGTNENTNGLIRQYLPKGTSMATLTQAKCNAIAHKLNCRPRARLGFQTPEECFVGYYR 141
>gi|126740297|ref|ZP_01755986.1| TRm24 putative transposase [Roseobacter sp. SK209-2-6] >gi|126718752|gb|EBA15465.1| TRm24 putative transposase [Roseobacter sp. SK209-2-6] (285 aa)
Score = 192, Expect = 6.8e-13, Identities = 74/267 (27%), Positives = 130/267 (48%)
  Q:    39 IATELKRHRSTILREIRRN--------NNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKR---SDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI-KSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEI 305
           +A  LKRH+STI REI+RN            GY    AQ +  +RR+ +   +  ++    +   ++    W   ++    I E     +   T  IY +I + + + +             + R+ +K    KFD      F  RP  + +R++FGHWE DL++ K++ G SN+  +VER +R + + K  +K    +   I K++ +  ++  ++IT D G EF         I  + ++C+P + +Q+G+ EN N   RR   +     LL+ A I
  S:     1 MARVLKRHKSTIFREIKRNFWADDAFPKKYAGYFGHAAQLQTDKRRSVQRKLI--RHPELCQTVVQRIKQGWTPEQIGNRMIYEGVKLRVCQET--IYRYIYSKEGMAQELWWYLPEHRKARRPRRARKRQAPKFDRDVSILF--RPDDVAHRRQFGHWEGDLMLFKQKFGQSNITSLVERVSRFTVLLKNPSKRTKPVMGKIMKAVRDLPHIARRSITFDRGTEFVSWPHLQAEIGTQTWFCDPSSPWQKGTVENTNRRARRWGARYLQVRLLNGANI 273
>gi|148544792|ref|YP_001272162.1| integrase catalytic subunit [Lactobacillus reuteri F275] >gi|148531826|gb|ABQ83825.1| Integrase, catalytic region [Lactobacillus reuteri F275] (211 aa)
Score = 191, Expect = 7.7e-13, Identities = 54/154 (35%), Positives = 76/154 (49%)
  Q:   182 EFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRR-VYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNS 335
           EFGH E D V GK+  G   ++ + ER+++   +  V  K    IN  +   + K   H  K+IT DNG EF+     A       Y+ E  A  QRG NEN NGL+RR    K  DF  L D  +  L +K N +PRK   Y +  + +  C+ +
  S:    52 EFGHLEADTVQGKKHRG--AVMTLTERQSKVEIVLNVHEKTADAINQHLSQWLRKFPRHFFKSITFDNGKEFAGWREIANQFDLHTYFAEVGAPNQRGLNENNNGLLRRDGLTKQLDFRNLPDELVTQLMSKRNNLPRKSLGYRTPYEVFMSCVTN 205
>gi|83955034|ref|ZP_00963690.1| TRm24 putative transposase [Sulfitobacter sp. NAS-14.1] >gi|83840363|gb|EAP79536.1| TRm24 putative transposase [Sulfitobacter sp. NAS-14.1] (296 aa)
Score = 191, Expect = 8.0e-13, Identities = 74/258 (28%), Positives = 120/258 (46%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-------NVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVH---PFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI-KSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEP 271
           Y  LS  ER  I      Q  +++++A  LKR RSTI RE++RN+         +GY    A     ERR  +   +  K+    +   E+    W   +++   I E  P  +   T  IY +I + +   +R D           R+     +  E   H       RP  + +R++FGHWE DL++ K++ G +N+  +VER +R + I K  NK    +   I KSL +   +  ++IT D G EF         I  + ++C+P
  S:    10 YNQLSITERRKIERWRHAQV-SVDEMARVLKRCRSTIFRELKRNHFSDESMPGCDGYYGAAAHLMQAERRARERKLI--KHPELCKRVIERIKNGWTPEQISNRMIHEGAPLRVCQET--IYRYIYSKE--GQREDLWWYLPTHRVARRPRRTRRRREPKFHRDVSILFRPDDVAHRRQFGHWEADLMLFKQKLGQNNVTSLVERVSRFTVILKNPNKRTKPVMGKIMKSLKDLPLIARRSITFDRGTEFVSWPHLQAEIGTQTWFCDP 271
>gi|116493901|ref|YP_805635.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116104051|gb|ABJ69193.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] (219 aa)
Score = 191, Expect = 8.4e-13, Identities = 57/196 (29%), Positives = 95/196 (48%)
  Q:   136 WIKKRSDKLRTAYI----KGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           WI +R    + + +    K  KR++ + S++++       +R +    R E GH E+D V G R S  + +L +V+R TR    TK+EN +   +      L+      V+++T+D+G EFS         +   Y+C  Y   +RG+NE  N  +R  + KGT F  +S+ +I      IN  PRK   + +  Q   K
  S:    16 WIYQRQVGFQPSQLFDHGKRHKRRQDLRSRYNQAVGTSIEIRSESANRRTEKGHLEMDTVRGGRGSK-AAVLTIVDRVTRLMATTKLENLSQNAVLKGFARLMVDFPGPVRSVTVDHGKEFSCDQALTKRYRIPGYFCHAYHPNERGTNERFNRELRYYFPKGTQFDQVSETDIQQATALINNKPRKCLRWQTPVQAVSK 214
>gi|116495957|ref|YP_807691.1| IS30 family transposase [Lactobacillus casei ATCC 334] >gi|116106107|gb|ABJ71249.1| Transposase, IS30 family [Lactobacillus casei ATCC 334] (219 aa)
Score = 191, Expect = 9.2e-13, Identities = 57/196 (29%), Positives = 95/196 (48%)
  Q:   136 WIKKRSDKLRTAYI----KGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKK 331
           WI +R    + + +    K  KR++ + S++++       +R +    R E GH E+D V G R S  + +L +V+R TR    TK+EN +   +      L+      V+++T+D+G EFS         +  VY+C  Y   +R +NE  N  +R  + KGT F  +S+ +I      IN  PRK   + +  Q   K
  S:    16 WIYQRQVDFQPSQLFDHGKRHKRRQDLRSRYNQAVGTSIEIRSESANRRTEKGHLEMDTVRGGRGSK-AAVLTIVDRVTRLMATTKLENLSQNAVLKGFARLMVDFPGPVRSVTVDHGKEFSCDHALTKRYRIPVYFCHAYHPNERDTNERFNRELRYYFPKGTQFDQVSETDIQQATALINNKPRKCLRWQTPVQAVSK 214
>gi|42518118|ref|NP_964048.1| transposase [Lactobacillus johnsonii NCC 533] >gi|41582402|gb|AAS08014.1| transposase [Lactobacillus johnsonii NCC 533] (341 aa)
Score = 191, Expect = 9.7e-13, Identities = 86/265 (32%), Positives = 118/265 (44%)
  Q:     7 TLNDTNKYRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRR------NNNVEGYSAEKAQKKYIERRNH---KNFFLWQKYKTFSELFAEKYNCKWH-GVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSD-----KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH----VKTITIDNGIEFSKIGIAAYWIKCKVYYCEP 271
           T+N   K +HLS+ ER II         +I  IA EL    STI  E++R      +   + Y A+  Q  Y   R H   K+ FL +K    S +    +   W   V   R      +      ST+ +YN++       K  D     K        RK KK +    +E        RPK I  R EFGHWE DLV+G +      LL + ER +R   I  + +K   ++  A K L  + + H     KTIT DNG EF+ +       K  VYY  P
  S:     7 TMNQHVKGKHLSFEERVII-QTRLKDGYSIRAIARELGCSPSTISYEVKRGTVSLYHGKQQRYKADHGQSVYQVNRRHCGRKSDFL-KKADFISYVIKHFFEDGWSLDVCANRSLAIGEFSHHQTVSTRTLYNYVDQGLMTIKNYDLPEKLKRNIKLHHVRKNKKKLGRSIEE--------RPKEIDQRNEFGHWECDLVLGHKTKDDQVLLTLSERMSREFLIICIPDKTFASVMRAFKVLQKQYSEHWNDIFKTITTDNGSEFADLANLEEVSKTLVYYAHP 280
>gi|58582250|ref|YP_201266.1| IS30 family transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84624142|ref|YP_451514.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|58426844|gb|AAW75881.1| transposase and inactivated derivatives, IS30 family [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84368082|dbj|BAE69240.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (180 aa)
Score = 191, Expect = 9.7e-13, Identities = 48/164 (29%), Positives = 82/164 (50%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKT-ITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           RP+ +  R   GHWE DL+ G      S +  +VERKTR   + +++              + K    ++T +T D G E +        +   V++ +P+A +QRGSNEN NGL+R+   KG D S +S   +N++   +N  PR+   + +  +  +K + +L
  S:    10 RPEEVQTRLVPGHWEGDLIKGAFNR--SCVGTLVERKTRFVVLCRMDGCTAADALEGFTRQMKKLPASMRTSLTYDRGTELTCYAELMQGLNIDVWFADPHAPWQRGSNENTNGLLRQFLPKGADLSTVSQEYLNHIALLMNTRPRQTLGWKTPSEAMEKEIAAL 172
>gi|52220782|ref|YP_086795.1| putative transposase TraISLp1 [Lactobacillus plantarum] >gi|51965673|emb|CAF32411.1| putative transposase TraISLp1 [Lactobacillus plantarum] (257 aa)
Score = 190, Expect = 1.0e-12, Identities = 50/162 (30%), Positives = 79/162 (48%)
  Q:   123 STKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVN 284
           +TK IYNW+   + I    + L    ++ R R     SK+++        RP  I  R   G +ELD V+G R    + LL +++RK+R  +  +++++   T+N A+   +   N  V + T+D G EFS +         K YYC  Y   +RGSNE  N
  S:    96 ATKSIYNWLNQGR-IGFSLNDLPEHGVRQR-RNVDQRSKYNQSLGRSIEQRPMMINQRNRIGDFELDTVVGPRGHSKAVLLTLIDRKSRFLWAYRLKDRTTATVNEALTKFLTTFNGPVHSFTVDRGTEFSGLVSLESQYGIKTYYCHAYTPAERGSNERFN 255
>gi|57651095|ref|YP_187513.1| integrase/recombinase core subunit [Staphylococcus aureus subsp. aureus COL] >gi|87160377|ref|YP_495270.1| integrase/recombinase [Staphylococcus aureus subsp. aureus USA300] >gi|88196656|ref|YP_501487.1| integrase/recombinase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151222813|ref|YP_001333635.1| integrase [Staphylococcus aureus subsp. aureus str. Newman] >gi|161510912|ref|YP_001576571.1| integrase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|57285281|gb|AAW37375.1| integrase/recombinase, core domain family [Staphylococcus aureus subsp. aureus COL] >gi|87126351|gb|ABD20865.1| integrase/recombinase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87204214|gb|ABD32024.1| integrase/recombinase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150375613|dbj|BAF68873.1| integrase [Staphylococcus aureus subsp. aureus str. Newman] >gi|160369721|gb|ABX30692.1| integrase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (178 aa)
Score = 190, Expect = 1.2e-12, Identities = 48/142 (33%), Positives = 76/142 (53%)
  Q:   181 KEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRV-YKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           KEFGH E D ++G+R    S ++ +VER ++     +   +    I +A+ S+ +    H+ K+IT D G EFS            +++ +P    QRG NE+ NG++RR    K  DF+L++D  I ++  KIN  PRK   Y
  S:    14 KEFGHLEGDTIVGRRHG--SAIITLVERVSKMIITLRPLGRKATDIENALHSMFSSLPSHIFKSITFDCGKEFSNWKTLCNCHDISIFFADPGTPSQRGLNEHSNGILRRSGLDKELDFNLVTDDHIISVAQKINHRPRKSLGY 155
>gi|116516434|ref|YP_816291.1| IS1239, transposase, putative [Streptococcus pneumoniae D39] >gi|116077010|gb|ABJ54730.1| IS1239, transposase, putative [Streptococcus pneumoniae D39] (291 aa)
Score = 190, Expect = 1.2e-12, Identities = 55/152 (36%), Positives = 90/152 (59%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           R + I  R E G++E+D V+  R   Y  LLV+ +RK+R+  I  + NK+   +N A+K ++ ++   + +IT DNG EF+++     + +  +YY  PYAS++RG+NEN N LIRR   KGT    ++  E+  ++  IN  P+K  +Y S
  S:   125 RSEAINLRLENGYYEIDTVLLTRAKNYC-LLVLTDRKSRHQIIRLIPNKSAEVVNQALKLILKQHK--ILSITADNGTEFNRL--FDVFSEEHIYYAHPYASWERGTNENHNRLIRRWLPKGT--KKMTPKEVAFIEKWINNYPKKCLDYKS 269
>gi|15902859|ref|NP_358409.1| degenerate transposase [Streptococcus pneumoniae R6] >gi|15458415|gb|AAK99619.1| Degenerate transposase [Streptococcus pneumoniae R6] (306 aa)
Score = 189, Expect = 1.3e-12, Identities = 55/152 (36%), Positives = 90/152 (59%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           R + I  R E G++E+D V+  R   Y  LLV+ +RK+R+  I  + NK+   +N A+K ++ ++   + +IT DNG EF+++     + +  +YY  PYAS++RG+NEN N LIRR   KGT    ++  E+  ++  IN  P+K  +Y S
  S:   140 RSEAINLRLENGYYEIDTVLLTRAKNYC-LLVLTDRKSRHQIIRLIPNKSAEVVNQALKLILKQHK--ILSITADNGTEFNRL--FDVFSEEHIYYAHPYASWERGTNENHNRLIRRWLPKGT--KKMTPKEVAFIEKWINNYPKKCLDYKS 284
>gi|170021398|ref|YP_001726352.1| putative transposase IS30 [Escherichia coli ATCC 8739] >gi|169756326|gb|ACA79025.1| putative transposase IS30 [Escherichia coli ATCC 8739] (320 aa)
Score = 189, Expect = 1.6e-12, Identities = 77/256 (30%), Positives = 122/256 (47%)
  Q:    16 HLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWI---------QTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAI--KSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEP 271
           HL+  ERE I       K +I  IAT L R  STI RE++RN     Y A  A  +           L  +     +L  EK   KW   +++  +++   P    L  S + IY  +           N    +RS  LR      RK ++G  +  +   +H    R ++I NR+  GHWE DLV G +    S++  +V+RK+R + I ++  K+  ++N A+  K L   + L  K++T D G+E ++          KVY+C+P
  S:    58 HLTLSEREEI-RAGLSAKMSIRAIATALNRSPSTISREVQRNRGRRYYKAVDANNRANRMAKRPKPCLLDQNLPLRKLVLEKLEMKWSPEQIS-GWLRRTKPRQKTLRISPETIYKTLYFRSREALHHLNIQHLRRSHSLRHGRRHTRKGERGTINIVNGTPIHE---RSRNIDNRRSLGHWEGDLVSGTKN---SHIATLVDRKSRYTIILRLRGKDSVSVNQALTDKFLSLPSELR-KSLTWDRGMELARHLEFTVSTGVKVYFCDP 317
>gi|21541532|gb|AAM61874.1| transposase [Lactobacillus plantarum] (233 aa)
Score = 188, Expect = 1.7e-12, Identities = 50/162 (30%), Positives = 79/162 (48%)
  Q:   123 STKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVN 284
           +TK IYNW+   + I    + L    ++ R R     SK+++        RP  I  R   G +ELD V+G R    + LL +++RK+R  +  +++++   T+N A+   +   N  V + T+D G EFS +         K YYC  Y   +RGSNE  N
  S:    72 ATKSIYNWLNQGR-IGFSLNDLPEHGVRQR-RNVDQRSKYNQSLGRSIEQRPMMINQRNRIGDFELDTVVGPRGHSKAVLLTLIDRKSRFLWAYRLKDRTTATVNEALTKFLTTFNGPVHSFTVDRGTEFSGLVSLESQYGIKTYYCHAYTPAERGSNERFN 231
>gi|84494636|ref|ZP_00993755.1| hypothetical protein JNB_07559 [Janibacter sp. HTCC2649] >gi|84497268|ref|ZP_00996090.1| hypothetical protein JNB_13778 [Janibacter sp. HTCC2649] >gi|84498147|ref|ZP_00996944.1| hypothetical protein JNB_18708 [Janibacter sp. HTCC2649] >gi|84498515|ref|ZP_00997285.1| hypothetical protein JNB_16694 [Janibacter sp. HTCC2649] >gi|84381258|gb|EAP97142.1| hypothetical protein JNB_16694 [Janibacter sp. HTCC2649] >gi|84381647|gb|EAP97530.1| hypothetical protein JNB_18708 [Janibacter sp. HTCC2649] >gi|84382156|gb|EAP98038.1| hypothetical protein JNB_13778 [Janibacter sp. HTCC2649] >gi|84384129|gb|EAQ00009.1| hypothetical protein JNB_07559 [Janibacter sp. HTCC2649] (332 aa)
Score = 188, Expect = 2.0e-12, Identities = 75/286 (26%), Positives = 130/286 (45%)
  Q:    39 IATELKRHRSTILREIRRN-NNVEGYSAEKAQKKY---IERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYN--WIQTNKWIKKR-SDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV--KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           I   L R  STI RE+ R  +   GY   +AQ      + R   + F L Q+     +   +  N      E     ++ ++P    +  S + IY   ++Q    +K+  +  LRT  +  + R          K +     RP    +R   GHWE DL++G   +  S +  +VER T    +  + + +     +A           V  +++T D G E +            +Y+C+P++ +QRGSNEN NGL+R+   KG+D S+     ++N+  ++N  PRK F++ +
  S:    23 IGRVLGRPTSTITRELARGCDRRGGYDPVRAQDAVDAAMRRPKARRFELNQRLHVEVQKRLDLRNSP----EQISGRLRVDFPDEPEMWVSPETIYQALYVQGRGALKREVAATLRTGRVHRKPRTAATRKPGAVKDMINISERPAEARDRAVPGHWEGDLIMGANNA--SAVGTLVERSTGFVMLLHLPDDHTAATVAAAMQAAVPKIPEVLRRSLTWDQGSEMALHTQITQATGLPIYFCDPHSPWQRGSNENTNGLLRQYLPKGSDLSIHGPGILDNIAAELNARPRKRFDWAT 313
>gi|58427125|gb|AAW76162.1| hypothetical protein XOO2908 [Xanthomonas oryzae pv. oryzae KACC10331] (324 aa)
Score = 188, Expect = 2.1e-12, Identities = 41/140 (29%), Positives = 71/140 (50%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKI 312
           RP  +  R   G WEL+ +  +   G   ++ M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   +  D S ++DA +  ++ ++
  S:   156 RPSVVEQRSRIGDWELETI--RASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQADVSTITDAHLRWIEQRL 293
>gi|170732245|ref|YP_001764192.1| integrase catalytic region [Burkholderia cenocepacia MC0-3] >gi|169815487|gb|ACA90070.1| Integrase catalytic region [Burkholderia cenocepacia MC0-3] (465 aa)
Score = 188, Expect = 2.2e-12, Identities = 49/152 (32%), Positives = 83/152 (54%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPF------------------TINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           RP  + +R   GHWE DL+IG  +S    L   VER +R + +  +  +  +                  T+ +A+K  V      + +++T D G E S           +V++ +P++ +QRG+NEN NGL+R+ + KGTD S  S  EI  + + ++  PRK   + +
  S:   277 RPAEVEDRAVPGHWEGDLLIGLNRSAIGTL---VERSSRFTMLVHLPREKGYGLIPRTKNGPALAGYGAVTMANALKKTVTDMPARLWRSLTWDRGKELSDHARFTVESGVQVFFADPHSPWQRGTNENTNGLLRQYFPKGTDLSRWSAQEIQAVAHTLSTRPRKTLGWKT 444
>gi|58579783|ref|YP_198799.1| IS30 family transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58582144|ref|YP_201160.1| IS30 family transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58582983|ref|YP_201999.1| IS30 family transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58583002|ref|YP_202018.1| IS30 family transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58583998|ref|YP_203014.1| IS30 family transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84623593|ref|YP_450965.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84624040|ref|YP_451412.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84624823|ref|YP_452195.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84624840|ref|YP_452212.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84625776|ref|YP_453148.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|58424377|gb|AAW73414.1| transposase and inactivated derivatives, IS30 family [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58426738|gb|AAW75775.1| transposase and inactivated derivatives, IS30 family [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58427577|gb|AAW76614.1| transposase and inactivated derivatives, IS30 family [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58427596|gb|AAW76633.1| transposase and inactivated derivatives, IS30 family [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58428592|gb|AAW77629.1| transposase and inactivated derivatives, IS30 family [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84367533|dbj|BAE68691.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84367980|dbj|BAE69138.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84368763|dbj|BAE69921.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84368780|dbj|BAE69938.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84369716|dbj|BAE70874.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (180 aa)
Score = 187, Expect = 2.3e-12, Identities = 46/155 (29%), Positives = 77/155 (49%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKT-ITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           RP+ +  R   GHWE DL+ G      S +  +VERKTR   + +++              + K    ++T +T D G E +        +   V++ +P+A +QRGSNEN NGL+R+   KG D S +S   +N++   +N  PR+   + +  +
  S:    10 RPEEVQTRLVPGHWEGDLIKGAFNR--SCVGTLVERKTRFVVLCRMDGCTAADALEGFTRQMKKLPASMRTSLTYDRGTELTCYAELMQGLNIDVWFADPHAPWQRGSNENTNGLLRQFLPKGADLSTVSQEYLNHIALLMNTRPRQTLGWKTPSE 163
>gi|84621796|ref|YP_449168.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84365736|dbj|BAE66894.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (173 aa)
Score = 187, Expect = 2.6e-12, Identities = 46/155 (29%), Positives = 77/155 (49%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKT-ITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           RP+ +  R   GHWE DL+ G      S +  +VERKTR   + +++              + K    ++T +T D G E +        +   V++ +P+A +QRGSNEN NGL+R+   KG D S +S   +N++   +N  PR+   + +  +
  S:     3 RPEEVQTRLVPGHWEGDLIKGAFNR--SCVGTLVERKTRFVVLCRMDGCTAADALEGFTRQMKKLPASMRTSLTYDRGTELTCYAELMQGLNIDVWFADPHAPWQRGSNENTNGLLRQFLPKGADLSTVSQEYLNHIALLMNTRPRQTLGWKTPSE 156
>gi|58581635|ref|YP_200651.1| IS30 family transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84623554|ref|YP_450926.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|58426229|gb|AAW75266.1| transposase and inactivated derivatives, IS30 family [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84367494|dbj|BAE68652.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (163 aa)
Score = 187, Expect = 2.7e-12, Identities = 46/152 (30%), Positives = 76/152 (50%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKT-ITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           RP+ +  R   GHWE DL+ G      S +  +VERKTR   + +++              + K    ++T +T D G E +        +   V++ +P+A +QRGSNEN NGL+R+   KG D S +S   +N++   +N  PR+   + +
  S:    10 RPEEVQTRLVPGHWEGDLIKGAFNR--SCVGTLVERKTRFVVLCRMDGCTAADALEGFTRQMKKLPASMRTSLTYDRGTELTCYAELMQGLNIDVWFADPHAPWQRGSNENTNGLLRQFLPKGADLSTVSQEYLNHIALLMNTRPRQTLGWKT 160
>gi|158316243|ref|YP_001508751.1| integrase catalytic region [Frankia sp. EAN1pec] >gi|158111648|gb|ABW13845.1| Integrase catalytic region [Frankia sp. EAN1pec] (466 aa)
Score = 185, Expect = 4.0e-12, Identities = 51/164 (31%), Positives = 83/164 (50%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIK---SLVNKNNLHVK----------------TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSL 336
           RP    +R   GHWE DL+IG  +S    L   VER TR + +  +   + +     +K   +L  +    V+                T+T D G E +            VY+ +P++ +QRG+NEN NGL+R+ + KGTD S  +  E+  +   +N  PRK  ++ +  +     + SL
  S:   278 RPVEATDRAVAGHWEGDLIIGLNRSAIGTL---VERTTRLTVLLHLPRMDGYGHEPRVKNGPALAGRGADAVRDAITRAFAELPEQLRRTLTWDRGKEMAGHAALTADTGLGVYFADPHSPWQRGTNENTNGLLRQYFPKGTDLSRWTRHELATIAATLNDRPRKTLDWKTPTEAMNNQLLSL 457
>gi|148544271|ref|YP_001271641.1| integrase catalytic subunit [Lactobacillus reuteri F275] >gi|184153649|ref|YP_001841990.1| transposase [Lactobacillus reuteri F275] >gi|148531305|gb|ABQ83304.1| Integrase, catalytic region [Lactobacillus reuteri F275] >gi|183224993|dbj|BAG25510.1| transposase [Lactobacillus reuteri F275] (322 aa)
Score = 184, Expect = 5.0e-12, Identities = 53/143 (37%), Positives = 75/143 (52%)
  Q:   180 RKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH-VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRR-VYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           + EFGH+E D V GK   G   ++ +VER+++   +  + +K    +N  +   + K   H VK+IT DNG EF+     A       Y+ E  A  QRG NEN NGL+RR    K  DF  L D  +  L ++ N +PRK  NY
  S:   160 QHEFGHFEADTVQGKAHRG--AIMTLVERQSKVMIVLNIHHKTDEAVNCQLDQWLAKLPRHFVKSITFDNGKEFAGWREIANKYDLHTYFAEVGAPNQRGLNENNNGLLRRDGLSKKLDFRDLPDELVTQLMHRRNNIPRKSLNY 302
>gi|194466740|ref|ZP_03072727.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194466964|ref|ZP_03072951.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194467078|ref|ZP_03073065.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194467152|ref|ZP_03073139.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194467372|ref|ZP_03073359.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194468176|ref|ZP_03074162.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194468178|ref|ZP_03074164.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194453029|gb|EDX41927.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194453031|gb|EDX41929.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194453776|gb|EDX42673.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194454000|gb|EDX42897.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194454114|gb|EDX43011.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194454188|gb|EDX43085.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194454408|gb|EDX43305.1| Integrase catalytic region [Lactobacillus reuteri 100-23] (322 aa)
Score = 184, Expect = 5.3e-12, Identities = 53/145 (36%), Positives = 76/145 (52%)
  Q:   180 RKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH-VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRR-VYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           + EFGH+E D V GK   G   ++ +VER+++   +  + +K    +N  +   + K   H VK+IT DNG EF+     A       Y+ E  A  QRG NEN NGL+RR    K  DF  L D  +  L ++ N +PRK  NY +
  S:   160 QHEFGHFEADTVQGKAHRG--AVMTLVERQSKVMIVLNIHHKTDEAVNFQLDQWLAKLPRHFVKSITFDNGKEFAGWREIANKYDLHTYFAEVGAPNQRGLNENNNGLLRRDGLSKKLDFRYLPDELVTQLMHRRNNIPRKSLNYRT 304
>gi|58581679|ref|YP_200695.1| IS30 family transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58426273|gb|AAW75310.1| transposase and inactivated derivatives, IS30 family [Xanthomonas oryzae pv. oryzae KACC10331] (178 aa)
Score = 184, Expect = 5.9e-12, Identities = 46/146 (31%), Positives = 73/146 (50%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKT-ITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRK 318
           RP+ +  R   GHWE DL+ G      S +  +VERKTR   + +++              + K    ++T +T D G E +        +   V++  P+A +QRGSNEN NGL+R+   KG D S +S   +N++   +N  PR+
  S:    10 RPEEVQTRLVPGHWEGDLIKGAFNR--SCVGTLVERKTRFVVLCRMDGCTAADALEGFTRQIKKLPASMRTSLTYDRGTELTCYAELMQGLNIDVWFAHPHAPWQRGSNENTNGLLRQFLPKGADLSTVSQEYLNHIALVMNTRPRQ 154
>gi|122891680|dbj|BAF45147.1| transposase [Streptococcus equi subsp. zooepidemicus] (316 aa)
Score = 184, Expect = 6.0e-12, Identities = 86/316 (27%), Positives = 146/316 (46%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREI----RRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRP---KHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRR-VYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           Y HL+  E  +I   Y  +  ++ +IA  LKR R TI + +    + N+  + Y   KA K    RR      L    KTF + + ++        + +   IK  +P  +  S + +Y  ++   +      K      KG++R  G +S+   K      +R    K+     EFGH E D ++GK     S ++ +VER ++     +   +    I ++I   + +   HV K+IT D G EFS     +      +++ +P    QRG NE+ NGL+RR    K  DF  L+   ++ + +K NR+PRK  +Y +  Q +
  S:     3 YTHLTTNELVMI-EAYVEEGISVLKIAQSLKRSRQTIHKVVTFLKQGNSASDYYQNYKANKSRCGRRQA---ILSDDEKTFIQGYLKQ--------DWSLDVIKGTFPDRISYSMRTLYRLVERGVF------KAEEMPWKGKRRPNG-YSEKRGKQAFRRTLRERADKYPDFETEFGHLEGDTIVGKNHK--SAVITLVERLSKAIITLQTSGRKASDIETSIHRWLARFPKHVFKSITFDCGKEFSNWKSLSNEHDIDIFFADPGCPAQRGLNEHSNGLLRRDGLPKQMDFRGLTQEFLSAIADKRNRIPRKSLDYKTPYQLF 306
>gi|148544017|ref|YP_001271387.1| integrase catalytic subunit [Lactobacillus reuteri F275] >gi|184153411|ref|YP_001841752.1| transposase [Lactobacillus reuteri F275] >gi|17863990|gb|AAL47007.1|AF449484_1 transposase [Lactobacillus reuteri] >gi|148531051|gb|ABQ83050.1| Integrase, catalytic region [Lactobacillus reuteri F275] >gi|183224755|dbj|BAG25272.1| transposase [Lactobacillus reuteri F275] (322 aa)
Score = 184, Expect = 6.1e-12, Identities = 53/143 (37%), Positives = 75/143 (52%)
  Q:   180 RKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH-VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRR-VYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           + EFGH+E D V GK   G   ++ +VER+++   +  + +K    +N  +   + K   H VK+IT DNG EF+     A       Y+ E  A  QRG NEN NGL+RR    K  DF  L D  +  L ++ N +PRK  NY
  S:   160 QHEFGHFEADTVQGKAHRG--AVMTLVERQSKVMIVLNIHHKTDEAVNCQLDQWLAKLPRHFVKSITFDNGKEFAGWREIANKYDLHTYFAEVGAPNQRGLNENNNGLLRRDGLSKKLDFRDLPDELVTQLMHRRNNIPRKSLNY 302
>gi|89057716|ref|YP_512170.1| IS30 family transposase [Jannaschia sp. CCS1] >gi|88866270|gb|ABD57146.1| Transposase and inactivated derivatives IS30 family-like protein [Jannaschia sp. CCS1] (346 aa)
Score = 183, Expect = 7.0e-12, Identities = 73/258 (28%), Positives = 120/258 (46%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNN-------NVEGYSAEKAQKKYIERRN-HKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVH-----PFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSA-IKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEP 271
           Y HLS  +R  I   Y   K  + +IA  L R  STI RE+RRN         + GY A  A   Y +RR  H+   +    K   E   ++    W   +++     E +P  +  S + IY +  +      R ++  + ++   +R++        K  H         RP+++  R+EFGHWE DL++ +R+ G  N+  +VER +R + +++ E++    I  A I  L        ++IT D G EFS        I    ++C P
  S:     5 YPHLSLEDRRKIAKWYDA-KMPVAEIADRLGRASSTIYRELRRNTFADQELPELNGYYALNAHSMYEKRRAVHRKMLIHPDLKAAIE---DRLRAGWSPEQISGRMKLEQHPVRV--SHETIYRFAYSED---GREEQFYS-HLPEHRRRRRKRGMRRYKRTHILDSQSLSQRPEYVAERREFGHWECDLMMFRREHGRINVTSLVERVSRFTVVSRNEDRQSKPIMDALIDGLAPLPADARQSITFDTGTEFSAWQRPKNGIDADAWFCGP 266
>gi|84622561|ref|YP_449933.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|58425208|gb|AAW74245.1| transposase and inactivated derivatives, IS30 family [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84366501|dbj|BAE67659.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (180 aa)
Score = 183, Expect = 7.7e-12, Identities = 46/155 (29%), Positives = 76/155 (49%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKT-ITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           RP+ +  R   GHWE DL+ G      S +  +VERKTR   + +++              + K    ++T +T D G E +            V++ +P+A +QRGSNEN NGL+R+   KG D S +S   +N++   +N  PR+   + +  +
  S:    10 RPEEVQTRLVPGHWEGDLIKGAFNR--SCVGTLVERKTRFVVLCRMDGCTAADALEGFTRQMKKLPASMRTSLTYDRGTELTCYAELMQGSNIDVWFADPHAPWQRGSNENTNGLLRQFLPKGADLSTVSQEYLNHIALLMNTRPRQTLGWKTPSE 163
>gi|58583337|ref|YP_202353.1| IS30 family transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84625163|ref|YP_452535.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|58427931|gb|AAW76968.1| transposase and inactivated derivatives, IS30 family [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84369103|dbj|BAE70261.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (180 aa)
Score = 182, Expect = 1.0e-11, Identities = 46/155 (29%), Positives = 76/155 (49%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKT-ITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           RP+ +  R   GHWE DL+ G      S +  +VERKTR   + +++              + K    ++T +T D G E +            V++ +P+A +QRGSNEN NGL+R+   KG D S +S   +N++   +N  PR+   + +  +
  S:    10 RPEEVQTRLVPGHWEGDLIKGAFNR--SCVGTLVERKTRFVVLCRMDGCTAADALEGFTRQMKKLPASMRTSLTYDRGTELTCYAELMQGSNIDVWFADPHARWQRGSNENTNGLLRQFLPKGADLSTVSQEYLNHIALLMNTRPRQTLGWKTPSE 163
>gi|58580529|ref|YP_199545.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58425123|gb|AAW74160.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] (338 aa)
Score = 182, Expect = 1.1e-11, Identities = 78/302 (25%), Positives = 136/302 (45%)
  Q:    36 INQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKT--FSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM--------RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK----NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLN 337
           +N IA  L R   T+LREIRR     GY+A  A   Y  RR            +  F ++  +    +W   ++    +K  +P    PS +  +  I T  +   R   L+   ++  ++ K              W+        RP+ +      GHWE DL+ G      S +  +VERKTR   + K++     T  +A++    +     +  + ++T D G E +        +   +++ +P+A +QRGSNEN NGL+ +   KG D S  S   +NN+ + +N  PR+   + + +Q  ++ +   N
  S:    26 LNSIARRLNRSACTLLREIRRQG-APGYAATSAASNYRLRRRACVRRRRLVEGSALFQQVRDDLVLYRWSPQQIAAK-LKAMHPDD--PSQRVSHETIYTAIYAHPRGG-LKKELVEALRQHKPTRCLRRTTAAKRTWVPEELRIVHRPEEVAQCLIPGHWEGDLIKGAFNR--SCVGTLVERKTRFVVLCKMDG---CTAENALEGFTRQMKKLPHCLLGSLTYDRGTEMTCYPELMKRLNIDLWFADPHAPWQRGSNENTNGLLCQFMPKGVDLSKASQEYLNNVADLMNARPRQTLGWKTPNQALEEEIAQFN 331
>gi|84622488|ref|YP_449860.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84366428|dbj|BAE67586.1| ISXoo15 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (320 aa)
Score = 181, Expect = 1.1e-11, Identities = 78/302 (25%), Positives = 136/302 (45%)
  Q:    36 INQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKT--FSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWM--------RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK----NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLN 337
           +N IA  L R   T+LREIRR     GY+A  A   Y  RR            +  F ++  +    +W   ++    +K  +P    PS +  +  I T  +   R   L+   ++  ++ K              W+        RP+ +      GHWE DL+ G      S +  +VERKTR   + K++     T  +A++    +     +  + ++T D G E +        +   +++ +P+A +QRGSNEN NGL+ +   KG D S  S   +NN+ + +N  PR+   + + +Q  ++ +   N
  S:     8 LNSIARRLNRSACTLLREIRRQG-APGYAATSAASNYRLRRRACVRRRRLVEGSALFQQVRDDLVLYRWSPQQIAAK-LKAMHPDD--PSQRVSHETIYTAIYAHPRGG-LKKELVEALRQHKPTRCLRRTTAAKRTWVPEELRIVHRPEEVAQCLIPGHWEGDLIKGAFNR--SCVGTLVERKTRFVVLCKMDG---CTAENALEGFTRQMKKLPHCLLGSLTYDRGTEMTCYPELMKRLNIDLWFADPHAPWQRGSNENTNGLLCQFMPKGVDLSKASQEYLNNVADLMNARPRQTLGWKTPNQALEEEIAQFN 313
>gi|84622565|ref|YP_449937.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84366505|dbj|BAE67663.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (215 aa)
Score = 181, Expect = 1.2e-11, Identities = 41/135 (30%), Positives = 68/135 (50%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINN 307
           RP  +  R   G WEL+ +  +   G + ++ M ER +    +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TD S ++DA + +
  S:    31 RPSVVEQRSRIGDWELETI--RASHGRAVVVSMTERCSGLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDVSTITDAHLRD 163
>gi|58579908|ref|YP_198924.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58424502|gb|AAW73539.1| transposase [Xanthomonas oryzae pv. oryzae KACC10331] (243 aa)
Score = 181, Expect = 1.2e-11, Identities = 41/135 (30%), Positives = 68/135 (50%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINN 307
           RP  +  R   G WEL+ +  +   G + ++ M ER +    +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TD S ++DA + +
  S:    33 RPSVVEQRSRIGDWELETI--RASHGRAVVVSMTERCSGLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDVSTITDAHLRD 165
>gi|32470351|ref|NP_863598.1| transposase-like protein [Acidithiobacillus ferrooxidans] >gi|2257708|gb|AAC80182.1| transposase-like protein [Acidithiobacillus ferrooxidans] (336 aa)
Score = 180, Expect = 1.5e-11, Identities = 70/303 (23%), Positives = 135/303 (44%)
  Q:    35 NINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYP--CVLVPSTKQIYNWIQTNKWIKKRSD---KLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH---VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMNSLN 337
           ++  +A ++ R  ST+ RE+RR    E Y A + ++            L       + +       KW   E     ++ +YP       S + IY +I  +   + R      LR    K + R +G   +   + +     RP    +R+  GHWE D + G      S +  +VER +R   + ++E  +    ++A++    +  L    ++T+T D G E ++       +  ++Y+ +P++ +QR +NEN NGL+R+   + TD S  S   +  +  ++N  PRK   + +  +   + +  LN
  S:    25 SMRAVAKQIGRSPSTVSREVRRGLVGETYDAIQGREGRRRGVRKGVRKLVGGAPLTNAVTHAILQRKW-SPEQVAGRLRMDYPEDKQWRVSHETIYQFIYAHPAGELRKALIAALRQGTRKAQARTRGKDRRGQLRNMRSIGERPLEAQDREIPGHWEGDFIKGAFNG--SAIGTLVERSSRFVLLVRMEGTDA---DAALEGFTRRMPLPKSILRTLTYDQGKEMARHEELERKVGIRIYFADPHSPWQRPTNENTNGLLRQYLPQRTDLSGYSQRRLTQVAEELNNRPRKSLGFRTPAEVIAQQIMQLN 329
>gi|84625340|ref|YP_452712.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84369280|dbj|BAE70438.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (137 aa)
Score = 180, Expect = 1.7e-11, Identities = 39/132 (29%), Positives = 74/132 (56%)
  Q:   205 MVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSS-DQYYKKCMNSL 336
           M ER++R   +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY ++QRGSNEN NGL R+   + TDFS +++A +  ++ ++   PRK+  + +  + + ++ +NS+
  S:     1 MTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHTVHTLTADNGKEFADHRLIAACLQSDFYFADPYCAWQRGSNENANGLTRQYLPRQTDFSTITNAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSV 133
>gi|148544229|ref|YP_001271599.1| integrase catalytic subunit [Lactobacillus reuteri F275] >gi|148531263|gb|ABQ83262.1| Integrase, catalytic region [Lactobacillus reuteri F275] (218 aa)
Score = 179, Expect = 2.0e-11, Identities = 51/145 (35%), Positives = 76/145 (52%)
  Q:   180 RKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH-VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRR-VYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           + +FGH+E D V GK   G   ++ +VER ++   +  + +K    +N  +   ++K   H VK+IT DNG EF+     A     + Y+ E  A  QRG NEN NG++RR    K  DF  L D  +  L +  N +PRK  NY +
  S:    56 QHKFGHFEADTVQGKAHHG--AVMTLVERLSKVMIVLNIHHKTDEAVNQHLSQWLDKMPRHFVKSITFDNGKEFAGWREIANRYDLQTYFAEVGAPNQRGLNENNNGILRRDGLSKHLDFRYLPDELVTQLMHHRNNIPRKALNYRT 200
>gi|84624416|ref|YP_451788.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84368356|dbj|BAE69514.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (182 aa)
Score = 176, Expect = 4.6e-11, Identities = 40/140 (28%), Positives = 69/140 (49%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKI 312
           RP  +  R   G WEL+ +  +   G   ++ M ER +    +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   +  D S ++DA +  ++ ++
  S:    14 RPSVVEQRSRIGDWELETI--RASHGNGVVVSMTERCSGLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQADVSTITDAHLRWIEQRL 151
>gi|148543392|ref|YP_001270762.1| integrase catalytic subunit [Lactobacillus reuteri F275] >gi|148544930|ref|YP_001272300.1| integrase catalytic subunit [Lactobacillus reuteri F275] >gi|184152801|ref|YP_001841142.1| transposase [Lactobacillus reuteri F275] >gi|184154267|ref|YP_001842608.1| transposase [Lactobacillus reuteri F275] >gi|60172681|gb|AAX14515.1| transposase [Lactobacillus reuteri] >gi|148530426|gb|ABQ82425.1| Integrase, catalytic region [Lactobacillus reuteri F275] >gi|148531964|gb|ABQ83963.1| Integrase, catalytic region [Lactobacillus reuteri F275] >gi|183224145|dbj|BAG24662.1| transposase [Lactobacillus reuteri F275] >gi|183225611|dbj|BAG26128.1| transposase [Lactobacillus reuteri F275] (322 aa)
Score = 176, Expect = 5.4e-11, Identities = 51/143 (35%), Positives = 75/143 (52%)
  Q:   180 RKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH-VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRR-VYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           + EFGH+E D V GK   G   ++ +VER+++   +  + +K    +N  +   + K   H VK+IT DNG EF+     A       Y+ E  A  QRG NEN NG++RR    K  DF  L +  +  L ++ N +PRK  NY
  S:   160 QHEFGHFEADTVQGKAHRG--AVMTLVERQSKVMIVLNIHHKTDEAVNCQLDQWLAKLPRHFVKSITFDNGKEFAGWREIANKYDLHTYFAEVGAPNQRGLNENNNGILRRDGLSKKLDFRHLPNELVTQLMHRRNNIPRKSLNY 302
>gi|194466348|ref|ZP_03072335.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194466404|ref|ZP_03072391.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194467553|ref|ZP_03073540.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194453384|gb|EDX42281.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194453440|gb|EDX42337.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194454589|gb|EDX43486.1| Integrase catalytic region [Lactobacillus reuteri 100-23] (322 aa)
Score = 175, Expect = 5.6e-11, Identities = 51/143 (35%), Positives = 75/143 (52%)
  Q:   180 RKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH-VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRR-VYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           + EFGH+E D V GK   G   ++ +VER+++   +  + +K    +N  +   + K   H VK+IT DNG EF+     A       Y+ E  A  QRG NEN NG++RR    K  DF  L +  +  L ++ N +PRK  NY
  S:   160 QHEFGHFEADTVQGKAHRG--AVMTLVERQSKVMIVLNIHHKTDEAVNCQLDQWLAKLPRHFVKSITFDNGKEFAGWREIANKYDLHTYFAEVGAPNQRGLNENNNGILRRDGLSKKLDFRHLPNELVTQLMHRRNNIPRKSLNY 302
>gi|148545118|ref|YP_001272488.1| integrase catalytic subunit [Lactobacillus reuteri F275] >gi|184154451|ref|YP_001842792.1| transposase [Lactobacillus reuteri F275] >gi|148532152|gb|ABQ84151.1| Integrase, catalytic region [Lactobacillus reuteri F275] >gi|183225795|dbj|BAG26312.1| transposase [Lactobacillus reuteri F275] (322 aa)
Score = 175, Expect = 5.6e-11, Identities = 51/143 (35%), Positives = 75/143 (52%)
  Q:   180 RKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH-VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRR-VYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           + EFGH+E D V GK   G   ++ +VER+++   +  + +K    +N  +   + K   H VK+IT DNG EF+     A       Y+ E  A  QRG NEN NG++RR    K  DF  L +  +  L ++ N +PRK  NY
  S:   160 QHEFGHFEADTVQGKAHRG--AVMTLVERQSKVMIVLNIHHKTDEAVNCQLDQWLAKLPRHFVKSITFDNGKEFAGWREIANKYDLHTYFAEVGAPNQRGLNENNNGILRRDGLSKKLDFRHLPNELVTQLMHRRNNIPRKSLNY 302
>gi|3328372|gb|AAC95137.1| transposase [Brochothrix campestris] (132 aa)
Score = 175, Expect = 5.9e-11, Identities = 43/116 (37%), Positives = 65/116 (56%)
  Q:   214 FITKVENKNPFTINSAIKSLVNKNNLHV----KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           FI KVE K    +N A+  L  +   +     KTIT DNG EFS I          +Y+  PY+S++RG+NEN NG+IRR   KG   S +SD  +  +Q  +N +PR++  + +  + +
  S:     2 FILKVEGKQASFVNKALLHLKKQCGSYFGALFKTITADNGKEFSGIN-ELLKDTLAIYFTHPYSSWERGTNENHNGIIRRFIPKGRSVSDVSDQLVQRIQTWMNNLPRRILGFQTPKELF 120
>gi|194467147|ref|ZP_03073134.1| Integrase catalytic region [Lactobacillus reuteri 100-23] >gi|194454183|gb|EDX43080.1| Integrase catalytic region [Lactobacillus reuteri 100-23] (322 aa)
Score = 175, Expect = 6.7e-11, Identities = 51/145 (35%), Positives = 76/145 (52%)
  Q:   180 RKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLH-VKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRR-VYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           + EFGH+E D V GK   G   ++ +VER+++   +  + +K    +N  +   + K   H VK+IT DNG EF+     A       Y+ E  A  QRG NEN NG++RR    K  DF  L +  +  L ++ N +PRK  NY +
  S:   160 QHEFGHFEADTVQGKAHRG--AVMTLVERQSKVMIVLNIHHKTDEAVNCQLDQWLAKLPRHFVKSITFDNGKEFAGWREIANKYGLHTYFAEVGAPNQRGLNENNNGILRRDGLSKKLDFRHLPNELVTQLMHRRNNIPRKSLNYRT 304
>gi|86136122|ref|ZP_01054701.1| Integrase, catalytic region [Roseobacter sp. MED193] >gi|85826996|gb|EAQ47192.1| Integrase, catalytic region [Roseobacter sp. MED193] (125 aa)
Score = 174, Expect = 7.9e-11, Identities = 40/119 (33%), Positives = 69/119 (57%)
  Q:   215 ITKVENKNPFTINSAIKSLVNK--NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCM 333
           + K+ENK+  ++ +A+     K   +L+ K +T D G E +         K +VY+C+P + +QRGSNEN N L R+ + KGTD S  S A+++ +  ++N  PRK   Y +  + ++ C+
  S:     2 LAKIENKDTQSVITALIKQARKFPKDLY-KLLTWDRGSEMASHAKFTMATKIEVYFCDPQSPWQRGSNENTNRLRRQYFPKGTDISGFSQAKLSAVARQLNERPRKTLQYQTPAEKFEACV 121
>gi|83943450|ref|ZP_00955909.1| TRm24 putative transposase [Sulfitobacter sp. EE-36] >gi|83845682|gb|EAP83560.1| TRm24 putative transposase [Sulfitobacter sp. EE-36] (258 aa)
Score = 174, Expect = 8.2e-11, Identities = 43/158 (27%), Positives = 82/158 (51%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSA-IKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYK 330
           RP+ I  R +FGHWE DL++ +++ G  N+  +VER +R + + + E++    I  A I+ L        ++IT D+G EF         +    ++C+  A YQ+G+ E  N  +R    + T  + L+   + ++  ++N  PRK  +Y +  + ++
  S:    89 RPESISERVDFGHWECDLMMFRKEHGKVNVTSLVERVSRYAVVMRNEDRQSKPIMEALIQGLAPLPADARQSITFDHGTEFLAWKHLKAGLGAAPWFCDQQAPYQKGTVEITNNRLRNYLPRSTAPTALTYRYLKSICQRLNATPRKCLDYWTPAEVFE 247
>gi|148984858|ref|ZP_01818111.1| IS1239, transposase, putative [Streptococcus pneumoniae SP3-BS71] >gi|149007579|ref|ZP_01831214.1| IS1239, transposase, putative [Streptococcus pneumoniae SP18-BS74] >gi|147760938|gb|EDK67908.1| IS1239, transposase, putative [Streptococcus pneumoniae SP18-BS74] >gi|147922880|gb|EDK73996.1| IS1239, transposase, putative [Streptococcus pneumoniae SP3-BS71] (143 aa)
Score = 172, Expect = 1.5e-10, Identities = 44/123 (35%), Positives = 76/123 (61%)
  Q:   202 LLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           +LV+ +RK+R+  I  + NK+   +N A+K ++ ++   + +IT DNG EF+++  +  + +  +YY  PYAS++RG+NEN N LIRR   KGT    ++  E+  ++  IN  P+K  +Y S
  S:     1 MLVLTDRKSRHQIIRLIPNKSAEVVNQALKLILKQHK--ILSITADNGTEFNRL--SNVFSEEHIYYAHPYASWERGTNENHNRLIRRWLPKGT--KKMTPKEVAFIEKWINNYPKKCLDYKS 117
>gi|624697|gb|AAB42161.1| transposase (319 aa)
Score = 172, Expect = 1.5e-10, Identities = 89/321 (27%), Positives = 145/321 (45%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIE---RRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSK-----FDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRV-YKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMN 334
           Y HL+  E  +I   Y+ Q   I +IA  LKR R+ I   I  N   EG++A +  ++Y E   R   +N  L +K +++     EK    W     T   I       +  S + +Y      +  K++     T  +KG+++  G   +     F    V      P     ++EFGH E D ++G      S ++ +VER ++     K E +    I + +         H+ K+IT D G EFS     +      +Y+ +P    QR  NEN NGL+R+    K  DF+ +  A I+++ NK N +PRK  +Y +  + +   MN
  S:     3 YTHLTTDELVMI-ESYYHQNIKIVKIAEYLKRSRTPIYNVI--NFLKEGHTALEYYQQYKENKKRCGRRNIVLPKKQQSY---IKEKIAQGW-----TPDVIIGRKEKPISCSVRTLY------RQFKEKVFDESTLPMKGKRKPNGHQERRGKQAFKRNIVERETDYPTF---KEEFGHIEGDTIVGIHHK--SAVITLVERLSKIIITLKPEGRKAIDIENTLNHWFGSIPRHLFKSITFDCGKEFSNWKALSNQHDIAIYFADPGTPTQRALNENSNGLLRKDGLPKNMDFNQVDQAFISSVANKRNNIPRKSLDYQTPLEVFMSYMN 311
>gi|194560452|ref|YP_002095477.1| Integrase [Burkholderia cenocepacia PC184] >gi|124875968|gb|EAY65958.1| Integrase [Burkholderia cenocepacia PC184] (464 aa)
Score = 171, Expect = 2.0e-10, Identities = 46/133 (34%), Positives = 74/133 (55%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPF------------------TINSAIKSLVNKNNLHV-KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEI 305
           RP  + +R   GHWE DL+IG  +S    L   VER +R + +  +  +  +                  T+ +A+K  V      + +++T D G E S           +V++ +P++ +QRG+NEN NGL+R+ + KGTD S  S  EI
  S:   277 RPAEVEDRAVPGHWEGDLLIGLNRSAIGTL---VERSSRFTMLVHLPREKGYGLIPRTKNGPALAGYGAVTMANALKKTVTDMPARLWRSLTWDRGKELSDHARFTVESGVQVFFADPHSPWQRGTNENTNGLLRQYFPKGTDLSRWSAQEI 425
>gi|148992601|ref|ZP_01822269.1| IS1239, transposase, putative [Streptococcus pneumoniae SP9-BS68] >gi|147928618|gb|EDK79632.1| IS1239, transposase, putative [Streptococcus pneumoniae SP9-BS68] (143 aa)
Score = 170, Expect = 2.1e-10, Identities = 44/123 (35%), Positives = 75/123 (60%)
  Q:   202 LLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           +LV+ +RK+R+  I  + NK+   +N A+K ++ ++   + +IT DNG EF+++     + +  +YY  PYAS++RG+NEN N LIRR   KGT    ++  E+  ++  IN  P+K  +Y S
  S:     1 MLVLTDRKSRHQIIRLIPNKSAEVVNQALKLILKQHK--ILSITADNGTEFNRL--FDVFSEEHIYYAHPYASWERGTNENHNRLIRRWLPKGT--KKMTPKEVAFIEKWINNYPKKCLDYKS 117
>gi|23336166|ref|ZP_00121392.1| COG2826: Transposase and inactivated derivatives, IS30 family [Bifidobacterium longum DJO10A] >gi|189440504|ref|YP_001955585.1| IS30 family transposase [Bifidobacterium longum DJO10A] >gi|189428939|gb|ACD99087.1| IS30 family transposase [Bifidobacterium longum DJO10A] (251 aa)
Score = 169, Expect = 3.2e-10, Identities = 46/156 (29%), Positives = 75/156 (48%)
  Q:   174 PKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVK-TITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           P    +R  FGHWE D VIG       NL   VERKTR      V +K       A  ++ +      + ++T DNG EF++            Y+ +PY+S +RG NEN NG+IRR   K ++  +    E+  + ++ +  P ++ +Y +  + +
  S:    83 PPEAGDRSGFGHWEADGVIG----AGCNLHTEVERKTRFLMARIVPDKTAGESVGARLAMFSPLPAGARVSVTHDNGTEFARHTRLRDGPSMDTYFADPYSSRRRGGNENRNGMIRRYLPKRSEIRMGMAGELREIVDEADNRPMRVLDYRTPAEAF 235
>gi|111020239|ref|YP_703211.1| transposase [Rhodococcus sp. RHA1] >gi|110819769|gb|ABG95053.1| probable transposase [Rhodococcus sp. RHA1] (283 aa)
Score = 168, Expect = 4.0e-10, Identities = 29/81 (35%), Positives = 51/81 (62%)
  Q:   242 KTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNY 322
           ++IT D G E  +          ++Y+C+P++ +QRGSNEN NGL+R+ + KGTD S+ S+  +  + +++N  PRK  ++
  S:   186 RSITWDQGTEMHQHARFTVDTGVQIYFCDPHSPWQRGSNENTNGLLRQYFPKGTDLSVHSEEHLRFVADELNDRPRKTHDW 266
>gi|475966|emb|CAA83666.1| insertion element [Pediococcus pentosaceus] (301 aa)
Score = 167, Expect = 5.5e-10, Identities = 71/256 (27%), Positives = 110/256 (42%)
  Q:    17 LSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYN---CKWHGVELTRHYIKENYPCVLVPSTKQIYNWIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKFDEKYVHPFWMRPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPY 272
           ++Y ER  I     +   NI Q+   L R  STI  E+ R    + Y AE AQ     +R+       +K K   EL  +  N     W    +  H  K         +TK IYNW+   + I    + L    ++ R R     SK+++        RP     R   G +ELD V+G R    + LL +++RK+R  +  +++++   T+N A+   +   N  V + T+D G EFS +         K YYC  Y
  S:    30 ITYSERIKIETFCELGLSNI-QMGVRLNRSPSTISYELSR---CQPYQAELAQTDAEYKRSQCG----RKTKLSDELKQKILNHLRLSW-SPGMIAHEFKL--------ATKSIYNWLNQGR-IGFSLNDLPEHGVRQR-RNVDQRSKYNQSLGRSIEQRPMMFNQRNRIGDFELDTVVGPRGHSKAVLLTLIDRKSRFLWAYRLKDRTTATVNEALTKFLTTFNGPVHSFTVDRGTEFSGLVSLESQYGIKTYYCHAY 269
>gi|21912929|emb|CAC86398.1| transposase [Mycoplasma agalactiae] (342 aa)
Score = 166, Expect = 7.8e-10, Identities = 48/145 (33%), Positives = 79/145 (54%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPR 317
           RP+ +  R     +E+D VIG R   Y  +L ++ RK+R  + T +  +N   I   ++ L+  NNL + T+TIDNG E  K+    Y I+ ++++C PY+S ++GS EN + L+RR   KG         ++  + + IN  PR
  S:   187 RPESVNLRLNDNDYEMDTVIGLRSDNYC-ILTLINRKSRMFYCT-LSRRNAKAIKENLEKLIKDNNLILDTLTIDNGSENYKLPEIEY-IR-EIFHCHPYSSSEKGSIENAHRLLRRYVPKGKSIDRYVGQDLKPIADFINSHPR 327
>gi|110004869|emb|CAK99201.1| transposase of is30 family protein [Spiroplasma citri] (330 aa)
Score = 165, Expect = 9.2e-10, Identities = 46/152 (30%), Positives = 75/152 (49%)
  Q:   183 FGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKN--NLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYYKKCMN 334
           FG  ++D ++GK     S  L + E K+  +   K+   N   +N A+KS++      +++K I  D G EFSK           VY+C+     Q+   E +N  IR    KGTDF+ ++  EIN +   IN  PR    ++SS + + + +N
  S:   178 FGWLQMDCIVGKEHQ--SACLTITEEKSLYTICFKLNQHNSEEVNKALKSIIRNKLYKINIKGIITDQGKEFSKWKEIEKITNANVYFCDAGTPTQKAKVERINRDIREYLPKGTDFNTVTQKEINKVMKIINEKPRPSLGWLSSKEVFLQNIN 329
>gi|69244258|ref|ZP_00602726.1| Integrase, catalytic region [Enterococcus faecium DO] >gi|68196444|gb|EAN10871.1| Integrase, catalytic region [Enterococcus faecium DO] (319 aa)
Score = 165, Expect = 9.2e-10, Identities = 83/311 (26%), Positives = 137/311 (44%)
  Q:    14 YRHLSYGEREIIGHMYFVQKKNINQIATELKRHRSTILREIRRNNNVEGYSAEKAQKKYIERRNHKNFFLWQKYKTFSELFAEKYNCKWHGVELTRH---YIKENY-----PCVLVPSTKQIYN--WIQTNKWIKKRSDKLRTAYIKGRKRKKGMFSKF-DEKYVHPFWMRPKHILN-RKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNK-NNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRV-YKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMS 324
           Y+HL+  E  +I   Y++Q     +IA  + R   TI       N V  +   K    Y           W +YK        K  C    ++L  H   YIKE       P V++   +++ +   I   +   K    + T  +KG+++  G   K   ++Y      RP +  +   EFGH E D ++G      S ++ +VER ++     K   +    I +A+    ++      K+IT D G EFS     +      +Y+ +P    QR  NEN NG++RR    K  DF  ++   I+++ N+ N +PRK  NY +
  S:     3 YKHLTIDELTMI-ESYYLQHNKPVEIANRMGRAIQTIY------NVVNKFKQGKTALDY-----------WHQYKE------NKKKCGRKVIQLPAHEVDYIKEKVTLGWTPDVIIGRKERLVSCGMITLYRLFSKGIFDIDTLPMKGKRKPNGHQEKRGKQQYQRSIHDRPDNYPDFNSEFGHLEGDTIVGIHHK--SAVITLVERLSKVIITIKPNGRKALDIETALNQWFSRFPKNFFKSITFDCGKEFSNWKAISNQHDIDIYFADPGTPSQRPLNENSNGILRRNGLPKSMDFREVNQTFISSVSNQRNHIPRKSLNYRT 301
>gi|84623075|ref|YP_450447.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84367015|dbj|BAE68173.1| IS1112 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (324 aa)
Score = 164, Expect = 1.0e-09, Identities = 39/126 (30%), Positives = 62/126 (49%)
  Q:   173 RPKHILNRKEFGHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNLHVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFS 298
           RP  +  R   G WEL+ +  +   G + ++ M ER +    +    +     + +AI   +      V T+T DNG EF+   + A  ++   Y+ +PY  +QRGSNEN NGL R+   + TD S
  S:   152 RPSVVEQRSRIGDWELETI--RASHGRAVVVSMTERCSGLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDVS 275
>gi|110005160|emb|CAK99487.1| transposase of is30 family n-terminal truncated protein [Spiroplasma citri] (258 aa)
Score = 164, Expect = 1.1e-09, Identities = 47/146 (32%), Positives = 79/146 (54%)
  Q:   184 GHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL--HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           G  E+D V+GK     S +LV+VE+ ++  F  K+EN     +    K ++ KNNL   +K I  D G EFSK      + + +VY+C+  +  Q+   E +N  +R  + KGTDF+ +S  +I+ + N IN   R    ++S+ + +
  S:   108 GWLEMDTVVGKDHK--SAILVLVEQLSKKYFAIKLENHTAREVEKKFKDIIIKNNLIGKIKGIITDRGKEFSKWREMEIFAETQVYFCDSGSPQQKPLIEYMNSELRHWFPKGTDFNKVSQKQIDWVVNVINDKLRPCLTWISAKEVF 253
>gi|1143018|gb|AAA85007.1| SpV1 ORF3; putative transposase [Spiroplasma citri] (260 aa)
Score = 164, Expect = 1.1e-09, Identities = 47/146 (32%), Positives = 79/146 (54%)
  Q:   184 GHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL--HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           G  E+D V+GK     S +LV+VE+ ++  F  K+EN     +    K ++ KNNL   +K I  D G EFSK      + + +VY+C+  +  Q+   E +N  +R  + KGTDF+ +S  +I+ + N IN   R    ++S+ + +
  S:   110 GWLEMDTVVGKDHK--SAILVLVEQLSKKYFAIKLENHTAREVEKKFKDIIIKNNLIGKIKGIITDRGKEFSKWREMEIFAETQVYFCDSGSPQQKPLIEYMNSELRHWFPKGTDFNKVSQKQIDWVVNVINDKLRPCLTWISAKEVF 255
>gi|110004107|emb|CAK98446.1| transposase of is30 family n-terminal truncated protein [Spiroplasma citri] (147 aa)
Score = 163, Expect = 1.7e-09, Identities = 46/139 (33%), Positives = 76/139 (54%)
  Q:   191 VIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL--HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEIN-NLQNKINRMPRKMFNYMSSDQYY 329
           V+GK     S+ LV+ E+ ++  F+ K+EN     +    K +V  NNL   +K I  D G EFSK      +++ +VY+C+     Q+   EN+NG  R+ + KGTDF+ +S   I+  + N IN   R   N++S+ + +
  S:     4 VVGKEH--LSSCLVLAEQSSKKYFVIKLENHTAREVEKKFKEIVINNNLIGKIKGIITDRGKEFSKWREMEIFVETQVYFCDAGKPRQKPLIENMNGEFRKWFPKGTDFNNVSQKRIDWVVNNVINEKLRPCLNWISAKEMF 143
>gi|23335078|ref|ZP_00120316.1| COG2826: Transposase and inactivated derivatives, IS30 family [Bifidobacterium longum DJO10A] >gi|23335323|ref|ZP_00120560.1| COG2826: Transposase and inactivated derivatives, IS30 family [Bifidobacterium longum DJO10A] (104 aa)
Score = 162, Expect = 1.8e-09, Identities = 30/85 (35%), Positives = 54/85 (63%)
  Q:   243 TITIDNGIEFS---KIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQ 327
           ++T D G E +   +IG +   +   VY+C+P++ +QRG+NEN NGL+R+ + KGTD S+  +  ++ +  ++N  PRK   +M   +
  S:    11 SLTWDQGAELALHKRIGAS---LDMAVYFCDPHSPWQRGTNENTNGLLRQYFPKGTDLSVYPEDYLDAVAEELNDRPRKTLGFMKPSE 95
>gi|110005359|emb|CAK99682.1| transposase of is30 family n-terminal truncated protein [Spiroplasma citri] (183 aa)
Score = 162, Expect = 1.9e-09, Identities = 47/146 (32%), Positives = 79/146 (54%)
  Q:   184 GHWELDLVIGKRQSGYSNLLVMVERKTRNSFITKVENKNPFTINSAIKSLVNKNNL--HVKTITIDNGIEFSKIGIAAYWIKCKVYYCEPYASYQRGSNENVNGLIRRVYKKGTDFSLLSDAEINNLQNKINRMPRKMFNYMSSDQYY 329
           G  E+D V+GK     S +LV+VE+ ++  F  K+EN     +    K ++ KNNL   +K I  D G EFSK      + + +VY+C+  +  Q+   E +N  +R  + KGT+F+ +   +I+ + N IN   R   N++SS + +
  S:    34 GWLEMDTVVGKDHK--SAILVLVEQLSKKYFAIKLENHTAREVEKKFKDIIIKNNLIGKIKGIITDRGKEFSKWREMEIFAETQVYFCDAGSPQQKPLIEYMNSELRHWFPKGTNFNKVIQKQIDWVVNVINDKLRPCLNWISSKEMF 179