>gi|26553579|ref|NP_757513.1| hypothetical protein MYPE1250 [Mycoplasma penetrans HF-2] >gi|26453585|dbj|BAC43917.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (142 aa)
Score = 525, Expect = 3.0e-52, Identities = 142/142 (100%), Positives = 142/142 (100%)
  Q:     1 MEYQNFNNLKNKDKLYKQIYNLFPFQFYSKFKKIILITSIVLFLLIIIYLIVATYLNNPLVWYCCAIPIFFFIFGSLILTTINVEISIKKFKANLYQKQKELTHKDELKIIHLNKKQLFSKRSSFIFNLIDQAWEQLKDQSN 142
           MEYQNFNNLKNKDKLYKQIYNLFPFQFYSKFKKIILITSIVLFLLIIIYLIVATYLNNPLVWYCCAIPIFFFIFGSLILTTINVEISIKKFKANLYQKQKELTHKDELKIIHLNKKQLFSKRSSFIFNLIDQAWEQLKDQSN
  S:     1 MEYQNFNNLKNKDKLYKQIYNLFPFQFYSKFKKIILITSIVLFLLIIIYLIVATYLNNPLVWYCCAIPIFFFIFGSLILTTINVEISIKKFKANLYQKQKELTHKDELKIIHLNKKQLFSKRSSFIFNLIDQAWEQLKDQSN 142