>gi|26553580|ref|NP_757514.1| excinuclease ABC subunit C [Mycoplasma penetrans HF-2] >gi|81748060|sp|Q8EWS6|UVRC_MYCPE UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|26453586|dbj|BAC43918.1| excinuclease ABC subunit C [Mycoplasma penetrans HF-2] (589 aa)
Score = 2649, Expect = 0.0e+00, Identities = 589/589 (100%), Positives = 589/589 (100%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKKL 589
           MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKKL
  S:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKKL 589
>gi|31541404|gb|AAP56705.1| UvrC [Mycoplasma gallisepticum R] (671 aa)
Score = 1187, Expect = 5.4e-128, Identities = 271/588 (46%), Positives = 410/588 (69%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDI-IFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRR-YKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           MN  +K KL   P KPGCYLWK+    +IY+GKA ++  R+ QYF   +DLKT KL NEI  V+++ VNNENE+LLLE NLI K+KP+YN+LL+++N +PYIL+TKE++PR++Y+ +   K KG +YGPFA+S +K Y+LYN + ++FPL+ C     +KC +YD+  C+  C  +V+  DYE   K+I+ FF   +  + + L++KE  A+EK  FE ++KYL+L+K + +  ++Q I ++S K   D++ +  KENVI IV+F YV+  L+SK  +   +Y E  E++ + + +YY K  I+ PK +Y SL       L +SL I+ +NP+ G   ++M  A  N    +  KY  L+  + R   +L++L+KL+ +  L  +E++DNSN+FNT+KV AM+V+EN   NK +YRK+ IKD+ A  DY YM EVIYRR Y+    +F ++P+LII+DGGK QV AA +++  L++D  I +IGLAK++KH+TD+IV +D  EI LDK S LYFFL N+Q+EVH+FAISF+R  K+KSL+++ L +IK LGK R ++L+E ++T+D+IK+AS+  LSQ++PIE+AK++K+
  S:    80 MNFNLKQKLDLAPKKPGCYLWKNHLNEIIYIGKAKNIYKRVHQYFNGPKDLKTSKLVNEIFYVEFIEVNNENEALLLEANLIKKHKPRYNILLKDNNGYPYILMTKEKYPRLIYTRNFDPK-KGKHYGPFASSEMKAYDLYNLLLKLFPLKNCFNKKGRKCEFYDLNLCMKACTHEVSEADYEVMKKKIDYFFHNGADQVLKDLKEKESIASEKFDFEQAKKYLDLQKAINLIFDKQIINLYSAKERIDVLAYQIKENVICIVLFSYVSSQLVSKNTICDFYYGEEQEVITSYLSQYY-KDNIK-PKILYASLDQANATLLKDSLGIEIINPTSGKMNEIMSLALQNVTNELSQKYDSLVKKEQRINLALDQLKKLIKVDKLNHLEVYDNSNLFNTDKVSAMIVFENNQFNKKKYRKYKIKDQQALGDYHYMYEVIYRRLYQALKNNFVDLPDLIILDGGKHQVLAAKKAIVDLQIDKKINLIGLAKNNKHQTDKIVTFDLDEISLDKSSALYFFLANLQEEVHKFAISFFRKTKAKSLYDSILDQIKGLGKKRKQQLIEHFKTIDEIKKASIASLSQVLPIEIAKKLKQ 666
>gi|161511508|ref|NP_853137.2| excinuclease ABC subunit C [Mycoplasma gallisepticum R] >gi|119367674|sp|Q7NBC4|UVRC_MYCGA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) (592 aa)
Score = 1172, Expect = 3.7e-126, Identities = 271/588 (46%), Positives = 410/588 (69%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDI-IFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRR-YKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           MN  +K KL   P KPGCYLWK+    +IY+GKA ++  R+ QYF   +DLKT KL NEI  V+++ VNNENE+LLLE NLI K+KP+YN+LL+++N +PYIL+TKE++PR++Y+ +   K KG +YGPFA+S +K Y+LYN + ++FPL+ C     +KC +YD+  C+  C  +V+  DYE   K+I+ FF   +  + + L++KE  A+EK  FE ++KYL+L+K + +  ++Q I ++S K   D++ +  KENVI IV+F YV+  L+SK  +   +Y E  E++ + + +YY K  I+ PK +Y SL       L +SL I+ +NP+ G   ++M  A  N    +  KY  L+  + R   +L++L+KL+ +  L  +E++DNSN+FNT+KV AM+V+EN   NK +YRK+ IKD+ A  DY YM EVIYRR Y+    +F ++P+LII+DGGK QV AA +++  L++D  I +IGLAK++KH+TD+IV +D  EI LDK S LYFFL N+Q+EVH+FAISF+R  K+KSL+++ L +IK LGK R ++L+E ++T+D+IK+AS+  LSQ++PIE+AK++K+
  S:     1 MNFNLKQKLDLAPKKPGCYLWKNHLNEIIYIGKAKNIYKRVHQYFNGPKDLKTSKLVNEIFYVEFIEVNNENEALLLEANLIKKHKPRYNILLKDNNGYPYILMTKEKYPRLIYTRNFDPK-KGKHYGPFASSEMKAYDLYNLLLKLFPLKNCFNKKGRKCEFYDLNLCMKACTHEVSEADYEVMKKKIDYFFHNGADQVLKDLKEKESIASEKFDFEQAKKYLDLQKAINLIFDKQIINLYSAKERIDVLAYQIKENVICIVLFSYVSSQLVSKNTICDFYYGEEQEVITSYLSQYY-KDNIK-PKILYASLDQANATLLKDSLGIEIINPTSGKMNEIMSLALQNVTNELSQKYDSLVKKEQRINLALDQLKKLIKVDKLNHLEVYDNSNLFNTDKVSAMIVFENNQFNKKKYRKYKIKDQQALGDYHYMYEVIYRRLYQALKNNFVDLPDLIILDGGKHQVLAAKKAIVDLQIDKKINLIGLAKNNKHQTDKIVTFDLDEISLDKSSALYFFLANLQEEVHKFAISFFRKTKAKSLYDSILDQIKGLGKKRKQQLIEHFKTIDEIKKASIASLSQVLPIEIAKKLKQ 587
>gi|185178930|ref|ZP_02964691.1| excinuclease ABC, C subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188039587|ref|ZP_02998304.1| excinuclease ABC, C subunit [Ureaplasma urealyticum serovar 8] >gi|184209193|gb|EDU06236.1| excinuclease ABC, C subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] (584 aa)
Score = 1090, Expect = 9.4e-117, Identities = 256/588 (43%), Positives = 371/588 (63%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKY-DLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           MN+ +K KLK IPHKPGCYLWKD+   +IY+GKA DL NR   YF   +D KT KL + I D++Y+VVNN NE+L+LENNLI  ++PKYN+LL++ + +PYI++T E++PR+ Y     K  KG Y+GP A+S   KY+L+N +N IFP  KCN  P++KCIYYD+ Q    CI +V  Q YE  + E+ + F G    I   LE KE  A  KL FE++QKY E +K L        +        D++GFY K N + I+IF YV G LL+K  D   ++  E++E++ + + +YYS+  I     + +SL D+ L  LS+  K KF+N      K ++  AF+NA+    +    +I+ QN    +L +L+++L + DL  +E FDNSNI  +  +  M+VY+NG  N    RK+N+      SDY +M EVI RRY+   +   ++PNLI+VDGGK QV AAL +L+ L++   IP+IGL KD KHKT+ IV  +  EI LD+KS LY FL N+Q++VH +AISF RNK +KS+F + L  ++ LGK R+ +LL  Y++++ +K AS +EL Q +P  V   +++
  S:     1 MNDLLKTKLKLIPHKPGCYLWKDEFDQIIYIGKAKDLYNRTHSYFNGPKDNKTSKLVSNIKDLEYIVVNNVNEALILENNLIKTHRPKYNILLKDGSNYPYIMITNEQYPRLKYVRTYDKN-KGIYFGPLADST-NKYQLFNLLNSIFPFNKCNHQPHQKCIYYDLHQ----CINQVQPQTYEKAIAEVKEIFKGNLDHILAILENKEQHAVAKLDFENAQKYAEQQKALTYIINSGLVQLDNNESFDVVGFYEKNNYLVIIIFNYVKGKLLNKSADTFAIYDHEINELITSFLMQYYSQNKIS--TKIIVSLDDDNLLALSQRFKTKFINAQTKFHKQILKLAFDNAILYFDSNIKSVINKQNELDEALNQLKQILKLSDLSMIECFDNSNINLSLPIAGMIVYQNGKLNNKLNRKYNLMTTKNASDYHFMIEVITRRYQRLVSQHQKLPNLIVVDGGKLQVNAALYALEQLQIS--IPLIGLKKDQKHKTNAIVLANGDEIILDRKSVLYKFLANMQNDVHNYAISFLRNKHTKSIFNSLLNDVQGLGKKRLNELLNYYDSINDLKSASDQELLQFLPKNVLVNLRE 579
>gi|195867851|ref|ZP_03079850.1| excinuclease ABC, C subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|195660428|gb|EDX53686.1| excinuclease ABC, C subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (584 aa)
Score = 1088, Expect = 1.9e-116, Identities = 256/588 (43%), Positives = 370/588 (62%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKY-DLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           MN+ +K KLK IPHKPGCYLWKD+   +IY+GKA DL NR   YF   +D KT KL + I D++Y+VVNN NE+L+LENNLI  ++PKYN+LL++ + +PYI++T E++PR+ Y     K  KG Y+GP A+S   KY+L+N +N IFP  KCN  P++KCIYYD+ Q    CI +V  Q YE  + E+ + F G    I   LE KE  A  KL FE++QKY E +K L        +        D++GFY K N + I+IF YV G LL+K  D   ++  E++E++ + + +YYS+  I     + +SL D+ L  LS+  K KF+N      K ++  AF+NA+    +     I+ QN    +L +L+++L + DL  +E FDNSNI  +  +  M+VY+NG  N    RK+N+      SDY +M EVI RRY+   +   ++PNLI+VDGGK QV AAL +L+ L++   IP+IGL KD KHKT+ IV  +  EI LD+KS LY FL N+Q++VH +AISF RNK +KS+F + L  ++ LGK R+ +LL  Y++++ +K AS +EL Q +P  V   +++
  S:     1 MNDLLKTKLKLIPHKPGCYLWKDEFDQIIYIGKAKDLYNRTHSYFNGPKDNKTSKLVSNIKDLEYIVVNNVNEALILENNLIKTHRPKYNILLKDGSNYPYIMITNEQYPRLKYVRTYDKN-KGIYFGPLADST-NKYQLFNLLNSIFPFNKCNHQPHQKCIYYDLHQ----CINQVQPQTYEKAIAEVKEIFKGNLDHILAILENKEQHAVAKLDFENAQKYAEQQKALTYIINSGLVQLDNNESFDVVGFYEKNNYLVIIIFNYVKGKLLNKSADTFAIYDHEINELITSFLMQYYSQNKIS--TKIIVSLDDDNLLALSQRFKTKFINAQTKFHKQILKLAFDNAILYFDSNIKSAINKQNELDEALNQLKQILKLSDLSMIECFDNSNINLSLPIAGMIVYQNGKLNNKLNRKYNLMTTKNASDYHFMIEVITRRYQRLVSQHQKLPNLIVVDGGKLQVNAALYALEQLQIS--IPLIGLKKDQKHKTNAIVLANGDEIILDRKSVLYKFLANMQNDVHNYAISFLRNKHTKSIFNSLLNDVQGLGKKRLNELLNYYDSINDLKSASDQELLQFLPKNVLVNLRE 579
>gi|188592845|ref|ZP_03006106.1| excinuclease ABC, C subunit [Ureaplasma urealyticum serovar 10] (584 aa)
Score = 1087, Expect = 2.2e-116, Identities = 255/588 (43%), Positives = 371/588 (63%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKY-DLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           MN+ +K KLK IPHKPGCYLWKD+   +IY+GKA DL NR   YF   +D KT KL + I D++Y+VVNN NE+L+LENNLI  ++PKYN+LL++ + +PYI++T E++PR+ Y     K  KG Y+GP A+S   KY+L+N +N IFP  KCN  P++KCIYYD+ +    CI +V  Q YE  + E+ + F G    I   LE KE  A  KL FE++QKY E +K L        +        D++GFY K N + I+IF YV G LL+K  D   ++  E++E++ + + +YYS+  I     + +SL D+ L  LS+  K KF+N      K ++  AF+NA+    +    +I+ QN    +L +L+++L + DL  +E FDNSNI  +  +  M+VY+NG  N    RK+N+      SDY +M EVI RRY+   +   ++PNLI+VDGGK QV AAL +L+ L++   IP+IGL KD KHKT+ IV  +  EI LD+KS LY FL N+Q++VH +AISF RNK +KS+F + L  ++ LGK R+ +LL  Y++++ +K AS +EL Q +P  V   +++
  S:     1 MNDLLKTKLKLIPHKPGCYLWKDEFDQIIYIGKAKDLYNRTHSYFNGPKDNKTSKLVSNIKDLEYIVVNNVNEALILENNLIKTHRPKYNILLKDGSNYPYIMITNEQYPRLKYVRTYDKN-KGIYFGPLADST-NKYQLFNLLNSIFPFNKCNHQPHQKCIYYDLHR----CINQVQPQTYEKAIAEVKEIFKGNLDHILAILENKEQHAVAKLDFENAQKYAEQQKALTYIINSGLVQLDNNESFDVVGFYEKNNYLVIIIFNYVKGKLLNKSADTFAIYDHEINELITSFLMQYYSQNRIS--TKIIVSLDDDNLLALSQRFKTKFINAQTKFHKQILKLAFDNAILYFDSNIKSVINKQNELDEALNQLKQILKLPDLSMIECFDNSNINLSLPIAGMIVYQNGKLNNKLNRKYNLMTTKNASDYHFMIEVITRRYQRLVSQHQKLPNLIVVDGGKLQVNAALYALEQLQIS--IPLIGLKKDQKHKTNAIVLANGDEIILDRKSVLYKFLANMQNDVHNYAISFLRNKHTKSIFNSLLNDVQGLGKKRLNELLNYYDSINDLKSASDQELLQFLPKNVLVNLRE 579
>gi|171920846|ref|ZP_02696210.2| excinuclease ABC, C subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|188024477|ref|ZP_02997124.1| excinuclease ABC, C subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188518228|ref|ZP_03003763.1| excinuclease ABC, C subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|171903048|gb|EDT49337.1| excinuclease ABC, C subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|188018591|gb|EDU56631.1| excinuclease ABC, C subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998241|gb|EDU67338.1| excinuclease ABC, C subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (584 aa)
Score = 1083, Expect = 7.2e-116, Identities = 254/588 (43%), Positives = 371/588 (63%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKY-DLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           MN+ +K KLK IPHKPGCYLWKD+   +IY+GKA DL NR   YF   +D KT KL + I D++Y+VV+N NE+L+LENNLI  ++PKYN+LL++ + +PYI++T E++PR+ Y     K  KG Y+GP A+S   KY+L+N +N IFP  KCN  P++KCIYYD+ +    CI +V  Q YE  + E+ + F G    I   LE KE  A  KL FE++QKY E +K L        +        D++GFY K N + I+IF YV G LL+K  D   ++  E++E++ + + +YYS+  I     + +SL D+ L  LS+  K KF+N      K ++  AF+NA+    +    +I+ QN    +L +L+++L + DL  +E FDNSNI  +  +  M+VY+NG  N    RK+N+      SDY +M EVI RRY+   +   ++PNLI+VDGGK QV AAL +L+ L++   IP+IGL KD KHKT+ IV  +  EI LD+KS LY FL N+Q++VH +AISF RNK +KS+F + L  ++ LGK R+ +LL  Y++++ +K AS +EL Q +P  V   +++
  S:     1 MNDLLKTKLKLIPHKPGCYLWKDEFDQIIYIGKAKDLYNRTHSYFNGPKDNKTSKLVSNIKDLEYIVVSNVNEALILENNLIKTHRPKYNILLKDGSNYPYIMITNEQYPRLKYVRTYDKN-KGIYFGPLADST-NKYQLFNLLNSIFPFNKCNHQPHQKCIYYDLHR----CINQVQPQTYEKAIAEVKEIFKGNLDHILAILENKEQHAVAKLDFENAQKYAEQQKALTYIINSGLVQLDNNESFDVVGFYEKNNYLVIIIFNYVKGKLLNKSADTFAIYDHEINELITSFLMQYYSQNKIS--TKIIVSLDDDNLLALSQRFKTKFINAQTKFHKQILKLAFDNAILYFDSNIKSVINKQNELDEALNQLKQILKLPDLSMIECFDNSNINLSLPIAGMIVYQNGKLNNKLNRKYNLMTTKNASDYHFMIEVITRRYQRLVSQHQKLPNLIVVDGGKLQVNAALYALEQLQIS--IPLIGLKKDQKHKTNAIVLANGDEIILDRKSVLYKFLANMQNDVHNYAISFLRNKHTKSIFNSLLNDVQGLGKKRLNELLNYYDSINDLKSASDQELLQFLPKNVLVNLRE 579
>gi|188569206|ref|ZP_03005722.1| excinuclease ABC, C subunit [Ureaplasma urealyticum serovar 2] (584 aa)
Score = 1083, Expect = 7.3e-116, Identities = 254/588 (43%), Positives = 370/588 (62%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKY-DLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           MN+ +K KLK IPHKPGCYLWKD+   +IY+GKA DL NR   YF   +D KT KL + I D++Y+VVNN NE+L+LENNLI  ++PKYN+LL++ + +PYI++T E++PR+ Y     K  KG Y+GP A+S   KY+L+N +N IFP  KCN  P++KCIYYD+ +    CI +V  Q YE  + E+ + F G    I   LE KE  A  KL FE++QKY E +K L        +        D++GFY K N + I+IF YV G LL+K  D   ++  E++E++ + + +YYS+  I     + +SL D+ L  LS+  K KF+N      K ++  AF+NA+    +    +I+ QN    +L +L+++L + DL  +E FDNSNI  +  +  M+VY+NG  N    RK+N+      SDY +M EVI RRY+   +   ++PNLI+VDGGK QV A L +L+ L++   IP+IGL KD KHKT+ IV  +  EI LD+KS LY FL N+Q++VH +AISF RNK +KS+F + L  ++ LGK R+ +LL  Y++++ +K AS +EL Q +P  V   +++
  S:     1 MNDLLKTKLKLIPHKPGCYLWKDEFDQIIYIGKAKDLYNRTHSYFNGPKDNKTSKLVSNIKDLEYIVVNNVNEALILENNLIKTHRPKYNILLKDGSNYPYIMITNEQYPRLKYVRTYDKN-KGIYFGPLADST-NKYQLFNLLNSIFPFNKCNHQPHQKCIYYDLHR----CINQVQPQTYEKAIAEVKEIFKGNLDHILAILENKEQHAVAKLDFENAQKYAEQQKALTYIINSGLVQLDNNESFDVVGFYEKNNYLVIIIFNYVKGKLLNKSADTFAIYDHEINELITSFLMQYYSQNKIS--TKIIVSLDDDNLLALSQRFKTKFINAQTKFHKQILKLAFDNAILYFDSNIKSIINKQNELDEALNQLKQILKLPDLSMIECFDNSNINLSLPIAGMIVYQNGKLNNKLNRKYNLMTTKNASDYHFMIEVITRRYQRLVSQHQKLPNLIVVDGGKLQVNATLYALEQLQIS--IPLIGLKKDQKHKTNAIVLANGDEIILDRKSVLYKFLANMQNDVHNYAISFLRNKHTKSIFNSLLNDVQGLGKKRLNELLNYYDSINDLKSASDQELLQFLPKNVLVNLRE 579
>gi|188524411|ref|ZP_03004432.1| excinuclease ABC, C subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530970|ref|ZP_03005232.1| excinuclease ABC, C subunit [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|195659903|gb|EDX53283.1| excinuclease ABC, C subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (584 aa)
Score = 1079, Expect = 2.2e-115, Identities = 254/588 (43%), Positives = 371/588 (63%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKY-DLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           MN+ +K KLK IPHKPGCYLWKD+   +IY+GKA DL NR   YF   +D KT KL + I D++Y+VVNN NE+L+LENNLI  ++PKYN+LL++ + +PYI++T E++PR+ Y     K  KG Y+GP A+S   KY+L+N +N IF   KCN  P++KCIYYD+ +    CI +V  Q YE  + E+ + F G    I   LE KE  A  KL FE++QKY E +K L        +        D++GFY K N + I+IF YV G LL+K  D   ++  E++E++ + + +YYS+  I     + +SL D+ L +LS+  K KF+N      K ++  AF+NA+    +    +I+ QN    +L +L+++L + DL  +E FDNSNI  +  +  M+VY+NG  N    RK+N+      SDY +M EVI RRY+   +   ++PNLI+VDGGK QV AAL +L+ L++   IP+IGL KD KHKT+ IV  +  EI LD+KS LY FL N+Q++VH +AISF RNK +KS+F + L  ++ LGK R+ +LL  Y++++ +K AS +EL Q +P  V   +++
  S:     1 MNDLLKTKLKLIPHKPGCYLWKDEFDQIIYIGKAKDLYNRTHSYFNGPKDNKTSKLVSNIKDLEYIVVNNVNEALILENNLIKTHRPKYNILLKDGSNYPYIMITNEQYPRLKYVRTYDKN-KGIYFGPLADST-NKYQLFNLLNSIFSFNKCNHQPHQKCIYYDLHR----CINQVQPQTYEKAIAEVKEIFKGNLDHILAILENKEQHAVAKLDFENAQKYAEQQKALTYIINSGLVQLDNNESFDVVGFYEKNNYLVIIIFNYVKGKLLNKSADTFAIYDHEINELITSFLMQYYSQNKIS--TKIIVSLDDDNLLSLSQRFKTKFINAQTKFHKQILKLAFDNAILYFDSNIKSVINKQNELDEALNQLKQILKLPDLSMIECFDNSNINLSLPIAGMIVYQNGKLNNKLNRKYNLMTTKNASDYHFMIEVITRRYQRLVSQHQKLPNLIVVDGGKLQVNAALYALEQLQIS--IPLIGLKKDQKHKTNAIVLANGDEIILDRKSVLYKFLANMQNDVHNYAISFLRNKHTKSIFNSLLNDVQGLGKKRLNELLNYYDSINDLKSASDQELLQFLPKNVLVNLRE 579
>gi|183508512|ref|ZP_02689173.2| excinuclease ABC, C subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|182675945|gb|EDT87850.1| excinuclease ABC, C subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] (584 aa)
Score = 1073, Expect = 1.1e-114, Identities = 255/588 (43%), Positives = 370/588 (62%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKY-DLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           MN+ +K+KLK IPHKPGCYLWKD+   +IY+GKA DL NR   YF   +D KT KL N I D++Y+VVNN NE+L+LENNLI  + PKYN+LL++ + +PYI++T E++PR+ Y     K  KG Y+GP A+S   KY+L+N +N IFP  KCN  P KKCIYYD+ Q    CI +V +  Y+  + E+ + F G    I   L+ KE  A  KL FE++QKY E +K L        +        DIIGFY K N + I+IF YV G LL+K  D   ++  E++E++ + + +YYS+  I     + +SL D+ L  LS+    KF+N      K ++  A +NA+   ++    +I+ QN   ++L +L+++L + DL  +E FDNSNI  +  +  M+VY+NG  N    RK+N+      SDY +M EVI RRY+   +   ++PNLI+VDGGK QV AAL +L  L+++  IP+IGL KD KHKTD IV  +  EI LD+KS LY FL N+Q++VH +AISF R+K +KS+F + L  ++ LGK R  +LL+ Y++++ +K AS +EL Q +P  V   +++
  S:     1 MNDLLKNKLKLIPHKPGCYLWKDQFNQIIYIGKAKDLYNRTHSYFNGCKDNKTSKLVNNINDLEYIVVNNVNEALILENNLIKTHLPKYNILLKDGSNYPYIMITNEQYPRLKYVRTYDKN-KGIYFGPLADST-NKYQLFNLLNSIFPFNKCNHQPYKKCIYYDLHQ----CINQVQQSTYQEAISEVKEIFKGNLDHILMILQTKEQHAVTKLDFENAQKYAEQQKALTSIINSGLVQLDNNESFDIIGFYEKNNYLVIIIFNYVKGKLLNKSADTFAIYDYEINELITSFLMQYYSQNKIS--SKIIVSLDDDNLLALSQRFHTKFINAQTKFHKQILKLALDNAILYFESNIKNVINKQNELDDALNQLKQILKLPDLNIIECFDNSNINLSLPIAGMIVYQNGKLNNKLNRKYNLMTTKNASDYHFMIEVITRRYQRLVSQHQKLPNLIVVDGGKLQVNAALYALAQLQIN--IPLIGLKKDQKHKTDAIVLTNGDEIVLDRKSILYKFLANMQNDVHNYAISFLRDKHTKSIFNSLLDNVQGLGKKRFNELLKYYDSINDLKSASDQELLQFLPKNVLVNLRE 579
>gi|13357942|ref|NP_078216.1| excinuclease ABC subunit C [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762218|ref|YP_001752464.1| excinuclease ABC, C subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|189038127|sp|B1AJ20|UVRC_UREP2 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|26006902|sp|Q9PQA9|UVRC_UREPA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|11356846|pir||H82898 excinuclease ABC subunit c UU381 [imported] - Ureaplasma urealyticum >gi|6899365|gb|AAF30791.1|AE002135_7 excinuclease ABC subunit c [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827795|gb|ACA33057.1| excinuclease ABC, C subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] (584 aa)
Score = 1071, Expect = 1.5e-114, Identities = 255/588 (43%), Positives = 370/588 (62%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKY-DLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           MN+ +K+KLK IPHKPGCYLWKD+   +IY+GKA DL NR   YF   +D KT KL N I D++Y+VVNN NE+L+LENNLI  + PKYN+LL++ + +PYI++T E++PR+ Y     K  KG Y+GP A+S   KY+L+N +N IFP  KCN  P KKCIYYD+ Q    CI +V +  Y+  + E+ + F G    I   L+ KE  A  KL FE++QKY E +K L        +        DIIGFY K N + I+IF YV G LL+K  D   ++  E++E++ + + +YYS+  I     + +SL D+ L  LS+    KF+N      K ++  A +NA+   ++    +I+ QN   ++L +L+++L + DL  +E FDNSNI  +  +  M+VY+NG  N    RK+N+      SDY +M EVI RRY+   +   ++PNLI+VDGGK QV AAL +L  L+++  IP+IGL KD KHKTD IV  +  EI LD+KS LY FL N+Q++VH +AISF R+K +KS+F + L  ++ LGK R  +LL+ Y++++ +K AS +EL Q +P  V   +++
  S:     1 MNDLLKNKLKLIPHKPGCYLWKDQFNQIIYIGKAKDLYNRTHSYFNGCKDNKTSKLVNNINDLEYIVVNNVNEALILENNLIKTHLPKYNILLKDGSNYPYIMITNEQYPRLKYVRTYDKN-KGIYFGPLADST-NKYQLFNLLNSIFPFNKCNHQPYKKCIYYDLHQ----CINQVQQSTYQEAISEVKEIFKGNLDHILMILQTKEQHAVTKLDFENAQKYAEQQKALTSIINSGLVQLDNNESFDIIGFYEKNNYLVIIIFNYVKGKLLNKSADTFAIYDYEINELITSFLMQYYSQNKIS--SKIIVSLDDDNLLALSQRFHTKFINAQTKFHKRILKLALDNAILYFESNIKNVINKQNELDDALNQLKQILKLPDLNIIECFDNSNINLSLPIAGMIVYQNGKLNNKLNRKYNLMTTKNASDYHFMIEVITRRYQRLVSQHQKLPNLIVVDGGKLQVNAALYALAQLQIN--IPLIGLKKDQKHKTDAIVLTNGDEIVLDRKSILYKFLANMQNDVHNYAISFLRDKHTKSIFNSLLDNVQGLGKKRFNELLKYYDSINDLKSASDQELLQFLPKNVLVNLRE 579
>gi|171920374|ref|ZP_02690327.2| excinuclease ABC, C subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902806|gb|EDT49095.1| excinuclease ABC, C subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] (584 aa)
Score = 1069, Expect = 3.1e-114, Identities = 254/588 (43%), Positives = 370/588 (62%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKY-DLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           MN+ +K+KLK IPHKPGCYLWKD+   +IY+GKA DL NR   YF   +D KT KL N I D++Y+VVNN NE+L+LENNLI  + PKYN+LL++ + +PYI++T E++PR+ Y     K  KG Y+GP A+S   KY+L+N +N IFP  KCN  P KKCIYYD+ Q    CI +V +  Y+  + E+ + F G    I   L+ KE  A  KL FE++QKY E +K L        +        DIIGFY K N + I+IF YV G LL+K  D   ++  E++E++ + + +YYS+  I     + +SL D+ L  LS+    KF+N      K ++  A +NA+   ++    +I+ QN   ++L +L+++L + DL  +E FDNSNI  +  +  M+VY+NG  N    RK+N+      SDY +M EVI RRY+   +   ++PNLI+VDGGK QV AAL +L  L+++  IP+IGL KD KHKT+ IV  +  EI LD+KS LY FL N+Q++VH +AISF R+K +KS+F + L  ++ LGK R  +LL+ Y++++ +K AS +EL Q +P  V   +++
  S:     1 MNDLLKNKLKLIPHKPGCYLWKDQFNQIIYIGKAKDLYNRTHSYFNGCKDNKTSKLVNNINDLEYIVVNNVNEALILENNLIKTHLPKYNILLKDGSNYPYIMITNEQYPRLKYVRTYDKN-KGIYFGPLADST-NKYQLFNLLNSIFPFNKCNHQPYKKCIYYDLHQ----CINQVQQSTYQEAISEVKEIFKGNLDHILMILQTKEQHAVTKLDFENAQKYAEQQKALTSIINSGLVQLDNNESFDIIGFYEKNNYLVIIIFNYVKGKLLNKSADTFAIYDYEINELITSFLMQYYSQNKIS--SKIIVSLDDDNLLALSQRFHTKFINAQTKFHKQILKLALDNAILYFESNIKNVINKQNELDDALNQLKQILKLPDLNIIECFDNSNINLSLPIAGMIVYQNGKLNNKLNRKYNLMTTKNASDYHFMIEVITRRYQRLVSQHQKLPNLIVVDGGKLQVNAALYALAQLQIN--IPLIGLKKDQKHKTNAIVLTNGDEIVLDRKSILYKFLANMQNDVHNYAISFLRDKHTKSIFNSLLDNVQGLGKKRFNELLKYYDSINDLKSASDQELLQFLPKNVLVNLRE 579
>gi|186701612|ref|ZP_02553940.2| excinuclease ABC, C subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186700842|gb|EDU19124.1| excinuclease ABC, C subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] (584 aa)
Score = 1067, Expect = 4.5e-114, Identities = 254/588 (43%), Positives = 370/588 (62%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKY-DLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           MN+ +K+KLK IPHKPGCYLWKD+   +IY+GKA DL NR   YF   +D KT KL N I D++Y+VVNN NE+L+LENNLI  + PKYN+LL++ + +PYI++T E++PR+ Y     K  KG Y+GP A+S   KY+L+N +N IFP  KCN  P KKCIYYD+ Q    CI +V +  Y+  + E+ + F G    I   L+ KE  A  KL FE++QKY E +K L        +        DIIGFY K N + I+IF YV G LL+K  D   ++  E++E++ + + +YYS+  I     + +SL D+ L  LS+    KF+N      K ++  A +NA+   ++    +I+ QN   ++L +L+++L + DL  +E FDNSNI  +  +  M+VY+NG  N    RK+N+      SDY +M EVI RRY+   +   ++PNLI+VDGGK QV AAL +L  L+++  IP+IGL KD KHKT+ IV  +  EI LD+KS LY FL N+Q++VH +AISF R+K +KS+F + L  ++ LGK R  +LL+ Y++++ +K AS +EL Q +P  V   +++
  S:     1 MNDLLKNKLKLIPHKPGCYLWKDQFNQIIYIGKAKDLYNRTHSYFNGCKDNKTSKLVNNINDLEYIVVNNVNEALILENNLIKTHLPKYNILLKDGSNYPYIMITNEQYPRLKYVRTYDKN-KGIYFGPLADST-NKYQLFNLLNSIFPFNKCNHQPYKKCIYYDLHQ----CINQVQQSTYQEAISEVKEIFKGNLDHILMILQTKEQHAVTKLDFENAQKYAEQQKALTSIINSGLVQLDNNESFDIIGFYEKNNYLVIIIFNYVKGKLLNKSADTFAIYDYEINELITSFLMQYYSQNKIS--SKIIVSLDDDNLLALSQRFHTKFINAQTKFHKRILKLALDNAILYFESNIKNVINKQNELDDALNQLKQILKLPDLNIIECFDNSNINLSLPIAGMIVYQNGKLNNKLNRKYNLMTTKNASDYHFMIEVITRRYQRLVSQHQKLPNLIVVDGGKLQVNAALYALAQLQIN--IPLIGLKKDQKHKTNAIVLTNGDEIVLDRKSILYKFLANMQNDVHNYAISFLRDKHTKSIFNSLLDNVQGLGKKRFNELLKYYDSINDLKSASDQELLQFLPKNVLVNLRE 579
>gi|171324166|ref|ZP_02912682.1| excinuclease ABC, C subunit [Geobacillus sp. WCH70] >gi|171089811|gb|EDT36129.1| excinuclease ABC, C subunit [Geobacillus sp. WCH70] (591 aa)
Score = 1029, Expect = 1.3e-109, Identities = 228/588 (38%), Positives = 365/588 (62%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           M++ +K+KL  +P +PGCYL KDKNG VIYVGKA  L NR++ YF    D KT +L NEI D +Y+V +++ E+L+LE NLI KY PKYN++L++  ++P+I +T E+HPR++ +    KK  G Y+GP+ +      E    ++RI+PLRKC+ +PN+ C+YY +GQCL PC+  V+ Q  +  +++I  F SG  K + ++L +K ++AAE L FE +++Y +    ++   E+Q +I +   D D+ G+   +  + + +F    G L+ +   I   Y + DE LLT + ++Y+K     PK V L  +D   +   + L++  + P +G KK+++D A  NA   +K K+  +  ++ R + ++E L K+L I   +R+E FDNSNI   + V AMVV+ +G   K EYRK+ IK  +   DY+ M+EV+ RRY         +P+LII+DGGK  + AA + L+  EL   IP+ GLAKDDKH+T  ++  D  + + L++ S  ++ L  IQDEVHRFAI+F+R  + K++F + L  I  +G+ R + LL+ + ++  +KEA+VEEL +  +P  VA++I K
  S:     2 MHDHLKEKLAVLPEQPGCYLMKDKNGTVIYVGKAKVLKNRVRSYFTGTHDGKTLRLVNEIADFEYIVTSSDVEALILEMNLIKKYDPKYNVMLKDDKSYPFIKITAEKHPRLVITR-KVKKDGGKYFGPYPHVQAAN-ETKKLLDRIYPLRKCSTMPNRVCLYYHMGQCLAPCVYPVSEQQNKEIVEQIARFLSGGYKEVKKELAEKMMKAAEALEFERAKEYRDQIAYIEATMEKQKMIINDFVDRDVFGYAYDKGWMCVQVFFIRQGKLIERDVSIFPMYQDPDEELLTFLGQFYTKANHFKPKEVILP-ADIDGELAEQLLEVTIVQPKRGKKKELVDLASKNAAIALKEKFYLIERDEERTIKAVENLGKILGIPTPHRIEAFDNSNIHGADPVSAMVVFIDGKPEKKEYRKYKIKTVEGPDDYESMREVVRRRYTRALKEGLPLPDLIIIDGGKGHLAAARDVLEN-ELGLDIPLAGLAKDDKHRTSELIMGDPPQVVPLERNSQEFYLLQRIQDEVHRFAITFHRQARGKTMFRSVLDDIPGVGEKRKKALLKHFGSIKNMKEATVEELQKANIPRSVAEKIYK 587
>gi|56964432|ref|YP_176163.1| excinuclease ABC subunit C [Bacillus clausii KSM-K16] >gi|81365726|sp|Q5WEK8|UVRC_BACSK UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|56910675|dbj|BAD65202.1| excinuclease ABC subunit C UrvC [Bacillus clausii KSM-K16] (594 aa)
Score = 1016, Expect = 3.7e-108, Identities = 231/586 (39%), Positives = 354/586 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFS-EIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           MNE I +KL  +P KPGCYL KD+ G +IYVGKA  L NR++ YF    D KT++L  EICD +Y+V ++  E+L+LE  LI K+ PKYN+LL++   +PYI +T E HPR+L +    KK    Y+GP+ N+     E    ++R++PLRKC K+P+  C+YY IGQCL PC+ +V+ +  +  + EI  F       I EQL ++  +AAE L FE +++  +    ++   E+Q + F+ K D D+ GF   +  + + +F    G L+ +   I  FY E  E LLT I  +Y +     PK ++++ S +K + L E L+ +   P +G KK ++D A  NA   +K K+  +  ++ R + ++E L + + I   YR+E FDNSNI   + V AMVV+ NGV  + EYRK+ IK  +   DY  M+EV+ RRY         +P+LI++DGG  Q+ AA E ++  EL   IPV GLAKDDKH+T +++       + L + S  ++ L  IQDEVHRFAI+F+R  ++KS  +++L  I  +G+ R + LL+ + ++ KIKEAS+E+LS+ VP ++A+ I
  S:     1 MNETITNKLALLPDKPGCYLMKDRQGTIIYVGKAKVLKNRVRSYFTGSHDSKTQRLVGEICDFEYIVTSSNIEALILELTLIKKHDPKYNVLLKDDKTYPYIKITNERHPRLLITR-KVKKDGAKYFGPYPNAGAAT-ETKKLLDRLYPLRKCRKMPDSVCLYYHIGQCLAPCVYEVSEETNQTMVNEITKFLKNGHSDIKEQLRERMEKAAEDLDFERAKELRDTIAQMEKVMEKQKMAFADKTDRDVFGFSYDKGWMCVQVFFIRQGRLIERDVSIFPFYQEASEELLTFIARFYLEKNHIKPKEIFVAESVDK-QLLKELLETRVTQPKRGQKKALLDLAEENAALALKEKFSLIERDEQRTVKAVERLGEAIGINAPYRIEAFDNSNIQGVDPVSAMVVFVNGVPQRKEYRKYKIKTVEGPDDYGSMREVVRRRYVRLLKEKRPLPDLIVIDGGAGQIAAAKEVIED-ELGQAIPVCGLAKDDKHRTSQLLMGSPPVVVPLQRDSHEFYLLQRIQDEVHRFAITFHRQTRAKSFLQSALDDIPGVGEKRRKALLKTFGSVKKIKEASIEDLSKHVPTKLAETI 583
>gi|52081351|ref|YP_080142.1| excinuclease ABC subunit C [Bacillus licheniformis ATCC 14580] >gi|52786728|ref|YP_092557.1| excinuclease ABC subunit C [Bacillus licheniformis ATCC 14580] >gi|81384876|sp|Q65GF0|UVRC_BACLD UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|52004562|gb|AAU24504.1| excinuclease ABC (subunit C) [Bacillus licheniformis ATCC 14580] >gi|52349230|gb|AAU41864.1| UvrC [Bacillus licheniformis DSM 13] (590 aa)
Score = 1011, Expect = 1.4e-107, Identities = 230/588 (39%), Positives = 365/588 (62%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MN++IK+KL  +P +PGCYL KD+   VIYVGKA  L NR++ YF    D KT++L +EI D +Y+V ++  E+L+LE NLI KY PKYN++L++  ++P+I +T E HP+++ +    KK KG Y+GP+ N    + E    ++R++PLRKC KLP++ C+YY +GQCL PC+  V+ +      +EI  F  G    + ++LE K ++A+E L FE ++++ +   +++   E+Q ++ +   D D+  +   +  + + +F    G L+ +   +   Y E DE  LT I ++YSK    LPK + +  S +K   + E L +    P +G KKD++  A  NA   +K K+  +  ++ R + ++E+L K LDI   YR+E FDNSNI  T+ V AMVV+ +G  +K EYRK+ IK  +   DY  M+EVI RRY         +P+LI++DGGK QV AAL+ L+  EL   +PV GL KDDKH+T  ++  D  EI +L++ S  ++ L  IQDEVHRFAISF+R  + KS F++ L  I  +G+ R + LL+ + ++ K+KEAS E++ ++ +P++ A+ I++
  S:     1 MNKKIKEKLALLPDQPGCYLMKDRQDTVIYVGKAKILKNRVRSYFSGSHDAKTQRLVSEIEDFEYIVTSSNIEALILEMNLIKKYDPKYNVMLKDDKSYPFIKITNERHPKLVVTR-KVKKDKGRYFGPYPNVQAAR-ETKKLLDRLYPLRKCAKLPDRVCLYYHLGQCLAPCVYDVSEETNRQLTEEITRFLKGGYNEVKKELEAKMLEASENLQFERAKEFRDQIAHIESTMEKQKMMLNDMVDRDVFAYSYDKGWMCVQVFFIRQGKLIERDVSMFPLYREADEEFLTFIGQFYSKNNHFLPKEILVPDSVDK-DMIEELLDVNVRQPKRGAKKDLLLLAHKNAKLALKEKFSLIERDEERTIGAIEKLGKALDIYTPYRIEAFDNSNIQGTDPVSAMVVFLDGKPHKKEYRKYKIKTVEGPDDYGSMREVIRRRYTRVLKENLPLPDLILIDGGKGQVSAALDVLEN-ELGLDVPVAGLVKDDKHRTSNLLIGDPLEIVQLERNSQEFYLLQRIQDEVHRFAISFHRQLRGKSAFQSVLDGIPGVGEQRKKLLLKHFGSVKKMKEASAEDIRKLGIPLKTAQLIEE 586
>gi|149183293|ref|ZP_01861734.1| excinuclease ABC subunit C [Bacillus sp. SG-1] >gi|148848986|gb|EDL63195.1| excinuclease ABC subunit C [Bacillus sp. SG-1] (590 aa)
Score = 1008, Expect = 3.7e-107, Identities = 232/586 (39%), Positives = 363/586 (61%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLS-DEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           MNE I  KL  +P +PGCYL KD+ G VIYVGKA  L NR++ YF    D KT++L  EI D +Y+V ++  E+L+LE NLI K+ PKYN++L++  ++P+I +T E HPR++ + +  KK KG Y+GP+ N+     E    ++RI+PLRKC+ LP++ C+YY +GQCL PC+K+V  + Y+    EI+ F +G  K I ++L +K  +AAE L FE ++++ +   +++   E+Q +  +   D DI G+   +  + + +F    G L+ +   +   Y E  E  LT I ++YSK     PK + L    DE +  +SE L ++   P KG KK ++  A  NA   +K K+  +  ++ R + ++++L + + I   +R+E FDNSNI  T+ V AM+V+ +G   K EYRK+ IK      DYD M+EV+ RRY         +P+LII+DGGK Q+ AA E L+ LEL+  IPV GLAKDDKH+T  ++  +  E I L+K+S  ++ L  IQDEVHRFAI+F+R  + K+ F + L ++  +G  R ++L + + ++ K+KEAS+EEL++  +P   A+E+
  S:     1 MNEIISHKLALLPDQPGCYLMKDRQGTVIYVGKAKVLKNRVRSYFTGSHDGKTQRLVGEIEDFEYIVTSSNLEALILELNLIKKHDPKYNVMLKDDKSYPFIKLTAERHPRLIITRN-VKKDKGKYFGPYPNAGAAN-ETKKLLDRIYPLRKCDNLPDRVCLYYHLGQCLAPCVKEVEPETYKKLTDEISRFLNGGYKDIKKELNEKMAEAAENLEFERAKEFRDQISHIEATMEKQTMDIADFTDRDIFGYAVDKGWMCVQVFFIRQGKLIERDVSLFPIYDEPAEEFLTFIGQFYSKTNHFKPKEINLPEGIDESI--VSELLDVRTTQPKKGQKKHLVQLAGKNAEIALKEKFALIERDEERTVMAVDKLGEAMGIYTPHRIEAFDNSNIQGTDPVSAMIVFLDGKPEKKEYRKYKIKSVKGPDDYDSMREVVRRRYTRVLKEGLPLPDLIIIDGGKGQIGAAKEVLE-LELNLDIPVAGLAKDDKHQTSELLYGNPLEIIPLEKRSQEFYLLQRIQDEVHRFAITFHRQLRGKTAFSSMLDEVSGIGPKRKKQLQKTFGSMKKMKEASLEELTEAGLPKAAAEEL 584
>gi|169350170|ref|ZP_02867108.1| hypothetical protein CLOSPI_00914 [Clostridium spiroforme DSM 1552] >gi|169292953|gb|EDS75086.1| hypothetical protein CLOSPI_00914 [Clostridium spiroforme DSM 1552] (588 aa)
Score = 1008, Expect = 3.8e-107, Identities = 232/584 (39%), Positives = 364/584 (62%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIA----IELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           + IKDKL  +P  PGCYL KDKNG VIYVGKA  L NR+  YF+   + KT KL +EI D DY+V ++E E+LLLE NLI  Y PKYN+   ++  +PYI +TKE HPR+    ++  K K  ++GPF +    + E +  +NR++PLRKCN +P K C+YY + QCL PCI+ V  + Y+     I  F  G +K I  +L++K   A+E   +E +++  +L  +++  + +Q + F+   D DI+G+Y  +  + + +F   NG LL++   +     +  E +++ +  +Y +      + +PK + +SL       L E +K K + P KG K +++  A  NA E ++ K+L +  N+   + ++++L  LL+I    R+E+FDNSNI  +  V  MV +++G+ +K +YRKF IK  +   DY  MKEVIYRRY        E P+LIIVDGGK Q+K A E +  L L+  I V GLAKDDKH T  ++  + +E+ +DKKS+L+F L+ +QDEVHR+AISF++N +SKSLF++ L  ++ +G  R + LL+++ ++ ++KEAS+E+L +++P EVA  +
  S:     4 KMIKDKLSLLPLLPGCYLMKDKNGDVIYVGKAKKLKNRVSSYFVGAHNYKTTKLVHEIVDFDYIVTDSEKEALLLEINLIKDYSPKYNISFMDNKYYPYIQLTKERHPRLKIVRNAQDK-KHRHFGPFPDGTAAR-ETFKLLNRLYPLRKCNHIPKKPCLYYSLNQCLAPCIQTVNEETYKQITSNITKFIQGDTKQIINELQEKMYNASEVQNYELAKECRDLISHIQHVTSKQHVQFNDLVDRDIVGYYHDKGYLCLQLFFMRNGKLLARDLNLVPMQDDFQEQIISFLVLFYQENTEPKELLVPKELDVSL-------LQEIIKCKIIKPQKGNKANLVAMANENAKEQLEKKFLLIQKNEASTIGAIKQLGSLLNIDLPRRIELFDNSNIQGSYAVAGMVCFKDGLPSKKDYRKFKIKTVEGPDDYASMKEVIYRRYYRVLMENLERPDLIIVDGGKGQIKVAKEVIDSLNLN--IMVCGLAKDDKHSTSMLLDSEGNEVAIDKKSELFFLLVRMQDEVHRYAISFHKNVRSKSLFQSILDNVEGIGPKRKKLLLKEFGSVKQLKEASLEQLEKVLPKEVAANL 580
>gi|153196011|ref|ZP_01940419.1| excinuclease ABC, C subunit [Listeria monocytogenes 10403S] >gi|127634293|gb|EBA23679.1| excinuclease ABC, C subunit [Listeria monocytogenes 10403S] (603 aa)
Score = 1002, Expect = 1.9e-106, Identities = 228/587 (38%), Positives = 357/587 (60%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           +E I++KL  +P +PGCYL KD+ G +IYVGKA  L NR++ YF    D KT++L  EI D +Y+V ++  E+LLLE NLI K+ P++N+ L++   +P+I +T E HPR++ +    KK KG Y+GP+ N      E+   ++R++PLRKC+ LPNK C+YY +GQCL PC+  V    Y+    EI  F +G  K++   L KK  +AAE + FE + ++ +    ++   E+Q +  +   D D+ G+   +  + + +F    G L+ +      FY++ DE  LT I ++Y K     PK +YL   +  E ++ +    KI  + P +G KKD++  A+ NA   +  K++ L  N+ R + ++E L + + I    R+E FDNSNI  T+ V AMV + +G  +KN+YRK+ IK  +   DY  M+EVI RRY         +P+LI++DGGK Q+ +A + L   EL   IPV GLAKDDKH+T +++  D  EI  L++ S  ++ L  +QDEVHRFAI+F+R  +SK+ F++ L  I  +G  R +KLL+ + ++ K+KEAS+EE+ +  VP+ VA+E+ K
  S:     3 SEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYFSGTHDSKTQRLVQEIVDFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKITNERHPRLIITR-QVKKDKGKYFGPYPNVYAAN-EVKRILDRLYPLRKCSTLPNKVCLYYHLGQCLAPCVFDVEASKYKEMQDEIVAFLNGGYKTVKNDLMKKMQEAAENMEFEKAGEFRDQINAIETTMEKQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFYNDADEDFLTFIGQFYQKTNHIPPKEIYLPDDVDSEAVQAIVPDTKI--IVPQRGNKKDLVKLAYKNAKIALNEKFMLLERNEERTVGAVERLGEAMGIPTPSRVEAFDNSNIHGTDPVSAMVTFLDGKPSKNDYRKYKIKTVEGPDDYATMREVIRRRYWRVLKEGLPMPDLILIDGGKGQIDSAKDVLTN-ELGLDIPVAGLAKDDKHRTSQLLFGDPLEIVPLERNSQEFYLLQRMQDEVHRFAITFHRQLRSKTGFQSILDGIPGVGPGRKKKLLKHFGSMKKLKEASIEEIKEAGVPLNVAEEVHK 588
>gi|154686983|ref|YP_001422144.1| excinuclease ABC subunit C [Bacillus amyloliquefaciens FZB42] >gi|189038022|sp|A7Z7D7|UVRC_BACA2 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|154352834|gb|ABS74913.1| UvrC [Bacillus amyloliquefaciens FZB42] (590 aa)
Score = 1001, Expect = 2.0e-106, Identities = 225/584 (38%), Positives = 359/584 (61%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWD-FSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAK 584
           MN+Q+K+KL  +P +PGCYL KD+   VIYVGKA  L NR++ YF    D KT++L +EI D +Y+V ++  E+L+LE NLI KY PKYN++L++   +P+I +T E HPR++ + +  KK KG Y+GP+ N    + E    ++R++PLRKC+KLP++ C+YY +GQCL PC+K ++ +     +++I  F  G    I ++LE K  +AAEKL FE ++++ +   +++   E+Q +  +   D D+  +   +  + + +F    G L+ +   +   Y E DE  LT I ++YSK    LPK + +  S ++   ++E L+     P KG KK+++  A  NA   ++ K+  +  ++ R + + E L + L+I   +R+E FDNSNI  TN V AM+V+ +G  NK EYRK+ IK      DY  M+EV+ RRY         +P+LII+DGGK Q+ AA + L+  EL   +PV GLAKDDKH+T  ++  D    + L++ S  ++ L  IQDEVHRFAISF+R  + KS+F++ L  I  +G+ R + LL+ + ++ K+KEAS++++ +  VP   A+
  S:     1 MNKQLKEKLALLPDQPGCYLMKDRQKTVIYVGKAKVLKNRVRSYFTGSHDAKTQRLVSEIEDFEYIVTSSNLEALILEMNLIKKYDPKYNVMLKDDKTYPFIKITHERHPRLIVTRN-VKKDKGRYFGPYPNVQAAR-ETKKLLDRLYPLRKCSKLPDRVCLYYHLGQCLAPCVKDISEETNREIVEDITRFLKGGHNEIKKELEAKMAEAAEKLEFERAKEFRDQLAHIESTMEKQKMTMNDLLDRDVFAYAYDKGWMCVQVFFIRQGKLIERDVSMFPMYQEADEEFLTFIGQFYSKNNHFLPKEILVPDSVDR-DMITELLETAVHQPKKGPKKELLLLAHKNAKIALREKFSLIERDEERSIGAAERLGEALNIYTPHRIEAFDNSNIQGTNPVSAMIVFIDGKPNKKEYRKYKIKTVTGPDDYGSMREVVRRRYTRVLRENLPLPDLIIIDGGKGQINAARDVLEN-ELGLDVPVAGLAKDDKHRTSNLLIGDPLEPVFLERNSQEFYLLQRIQDEVHRFAISFHRQIRGKSVFQSVLDDIPGIGEKRKKMLLKHFGSVKKMKEASLDDIKKAGVPAAAAQ 582
>gi|153179314|ref|ZP_01932533.1| excinuclease ABC, C subunit [Listeria monocytogenes F6900] >gi|153184605|ref|ZP_01935332.1| excinuclease ABC, C subunit [Listeria monocytogenes J0161] >gi|153190614|ref|ZP_01938003.1| excinuclease ABC, C subunit [Listeria monocytogenes J2818] >gi|126942576|gb|EBA20313.1| excinuclease ABC, C subunit [Listeria monocytogenes J0161] >gi|127765996|gb|EBA26340.1| excinuclease ABC, C subunit [Listeria monocytogenes J2818] >gi|133732799|gb|EBA34497.1| excinuclease ABC, C subunit [Listeria monocytogenes F6900] (603 aa)
Score = 1001, Expect = 2.0e-106, Identities = 228/587 (38%), Positives = 357/587 (60%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           +E I++KL  +P +PGCYL KD+ G +IYVGKA  L NR++ YF    D KT++L  EI D +Y+V ++  E+LLLE NLI K+ P++N+ L++   +P+I +T E HPR++ +    KK KG Y+GP+ N      E+   ++R++PLRKC+ LPNK C+YY +GQCL PC+  V    Y+    EI  F +G  K++   L KK  +AAE + FE + ++ +    ++   E+Q +  +   D D+ G+   +  + + +F    G L+ +      FY++ DE  LT I ++Y K     PK +YL   +  E ++ +    KI  + P +G KKD++  A+ NA   +  K++ L  N+ R + ++E L + + I    R+E FDNSNI  T+ V AMV + +G  +KN+YRK+ IK  +   DY  M+EVI RRY         +P+LI++DGGK Q+ +A + L   EL   IPV GLAKDDKH+T +++  D  EI  L++ S  ++ L  +QDEVHRFAI+F+R  +SK+ F++ L  I  +G  R +KLL+ + ++ K+KEAS+EE+ +  VP+ VA+E+ K
  S:     3 SEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYFSGTHDSKTQRLVQEIVDFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKITNERHPRLIITR-QVKKDKGKYFGPYPNVYAAN-EVKRILDRLYPLRKCSTLPNKVCLYYHLGQCLAPCVFDVEASKYKEMQDEIVAFLNGGYKTVKNDLMKKMQEAAENMEFEKAGEFRDQINAIETTMEKQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFYNDADEDFLTFIGQFYQKANHIPPKEIYLPDDVDSEAVQAVVPDTKI--IVPQRGNKKDLVKLAYKNAKIALNEKFMLLERNEERTVGAVERLGEAMGIPTPSRVEAFDNSNIHGTDPVSAMVTFLDGKPSKNDYRKYKIKTVEGPDDYATMREVIRRRYWRVLKEGLPMPDLILIDGGKGQIDSAKDVLTN-ELGLDIPVAGLAKDDKHRTSQLLFGDPLEIVPLERNSQEFYLLQRMQDEVHRFAITFHRQLRSKTGFQSILDGIPGVGPGRKKKLLKHFGSMKKLKEASIEEIKEAGVPLNVAEEVHK 588
>gi|138896241|ref|YP_001126694.1| excinuclease ABC subunit C [Geobacillus thermodenitrificans NG80-2] >gi|134267754|gb|ABO67949.1| Excinuclease ABC, subunit C [Geobacillus thermodenitrificans NG80-2] (592 aa)
Score = 1001, Expect = 2.1e-106, Identities = 218/586 (37%), Positives = 362/586 (61%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWD-FSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           MN+++K+KL  +P +PGCYL KDK+G VIYVGKA  L  R++ YF    + KT++L  EI D +Y+V ++  E+L+LE NLI K+ PKYN++L+   ++P+I +T E+HPR+L +    KK  G Y+GP+ N    + E    ++R++PLRKC+ LP++ C+YY +GQCL PC+  V+ +  +  ++++  F +G  + +  +L +K  QAAE L FE +++Y +    ++M  E+Q I+F+   D D+ G+   +  + + +F    G L+ +   I   Y + DE +LT + ++Y+K     PK V L  +D   + + E L +  + P KG KK++++ A  NA   +K K+  +  ++ R + ++E L +LL I    R+E FDNSNI+  + V A+VV+ +G   K EYRK+ +K  +  +DY+ M+EV+ RRY         +P+LII+DGGK  + A  + L+  EL   +P+ GLAKD+KH+T  ++  D  + + LD++S  ++ L  IQDEVHRFA++F+R  + K++  + L  I  +G  R + LL  + ++ K+KEA+VEEL +  +P  VA++I
  S:     3 MNDRLKEKLSVLPEQPGCYLMKDKHGTVIYVGKAKSLKARVRSYFTGTHEGKTQRLVEEIADFEYIVTSSNAEALILEMNLIKKHDPKYNVMLKGDESYPFIKITAEKHPRLLITR-KVKKDGGKYFGPYPNVQAAR-ETKKLLDRLYPLRKCSTLPSRVCLYYHMGQCLAPCVYPVSDEQNKAMVEQVVRFLNGGYQEVKRELTEKMHQAAEALEFERAKEYRDQIAAIEMTMEKQKIVFNDFIDRDVFGYAYDKGWMCVQVFFLRQGKLIERDVSIFPLYQDPDEEMLTFLGQFYTKAHHLKPKEVVLP-TDIDGELVRELLGVHVVQPKKGKKKELIELANKNAAIALKEKFYFIERDEERTIKAIERLGELLGIPTPRRIEAFDNSNIYGADPVSALVVFLDGKPAKKEYRKYKVKTVEGPNDYESMREVVRRRYTRVLKERLPLPDLIIIDGGKGHLSAVRDVLEN-ELGLDVPLAGLAKDEKHRTSELIAGDPPAVVPLDRQSQEFYLLQRIQDEVHRFAVTFHRQTRQKTMLHSILDDIPGVGAKRKKALLNYFGSVKKMKEATVEELQRANIPRSVAEKI 586
>gi|168265736|ref|ZP_02687701.1| excinuclease ABC subunit C [Listeria monocytogenes FSL J2-071] (603 aa)
Score = 1001, Expect = 2.2e-106, Identities = 229/587 (39%), Positives = 357/587 (60%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           +E I++KL  +P +PGCYL KD+ G +IYVGKA  L NR++ YF    D KT++L  EI D +Y+V ++  E+LLLE NLI K+ P++N+ L++   +P+I +T E HPR++ +    KK KG Y+GP+ N      E+   ++R++PLRKC+ LPNK C+YY +GQCL PC+  V    Y+    EI  F +G  K++   L KK  +AAE + FE + ++ +    ++   E+Q +  +   D D+ G+   +  + + +F    G L+ +      FY++ DE  LT I ++Y K     PK +YL   +  E ++ +    KI  + P +G KKD++  A+ NA   +  K++ L  N+ R + ++E L + + I    R+E FDNSNI  T+ V AMV + +G  +KN+YRK+ IK  +   DY  M+EVI RRY         +P+LI++DGGK Q+ +A + L   EL   IPV GLAKDDKH+T +++  D  EI  L++ S  ++ L  +QDEVHRFAI+F+R  +SK+ F++ L  I  +G  R +KLL+ + ++ K+KEASVEE+ +  VP+ VA+E+ K
  S:     3 SEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYFSGTHDSKTQRLVQEIVDFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKITNERHPRLIITR-QVKKDKGKYFGPYPNVYAAN-EVKRILDRLYPLRKCSTLPNKVCLYYHLGQCLAPCVFDVEASKYKEMQDEIVAFLNGGYKTVKNDLMKKMQEAAENMEFEKAGEFRDQINAIETTMEKQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFYNDADEDFLTFIGQFYQKANHIPPKEIYLPDDVDSEAVQAVVPDTKI--IVPQRGNKKDLVKLAYKNAKIALNEKFMLLERNEERTVGAVERLGESMGIPTPSRVEAFDNSNIHGTDPVSAMVTFLDGKPSKNDYRKYKIKTVEGPDDYATMREVIRRRYWRVLKEGLPMPDLILIDGGKGQIDSAKDVLTN-ELGLDIPVAGLAKDDKHRTSQLLFGDPLEIVPLERNSQEFYLLQRMQDEVHRFAITFHRQLRSKTGFQSILDGIPGVGPGRKKKLLKHFGSMKKLKEASVEEIKEAGVPLNVAEEVHK 588
>gi|196250198|ref|ZP_03148892.1| excinuclease ABC, C subunit [Geobacillus sp. G11MC16] >gi|196210382|gb|EDY05147.1| excinuclease ABC, C subunit [Geobacillus sp. G11MC16] (590 aa)
Score = 1000, Expect = 2.6e-106, Identities = 218/586 (37%), Positives = 362/586 (61%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWD-FSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           MN+++K+KL  +P +PGCYL KDK+G VIYVGKA  L  R++ YF    + KT++L  EI D +Y+V ++  E+L+LE NLI K+ PKYN++L+   ++P+I +T E+HPR+L +    KK  G Y+GP+ N    + E    ++R++PLRKC+ LP++ C+YY +GQCL PC+  V+ +  +  ++++  F +G  + +  +L +K  QAAE L FE +++Y +    ++M  E+Q I+F+   D D+ G+   +  + + +F    G L+ +   I   Y + DE +LT + ++Y+K     PK V L  +D   + + E L +  + P KG KK++++ A  NA   +K K+  +  ++ R + ++E L +LL I    R+E FDNSNI+  + V A+VV+ +G   K EYRK+ +K  +  +DY+ M+EV+ RRY         +P+LII+DGGK  + A  + L+  EL   +P+ GLAKD+KH+T  ++  D  + + LD++S  ++ L  IQDEVHRFA++F+R  + K++  + L  I  +G  R + LL  + ++ K+KEA+VEEL +  +P  VA++I
  S:     1 MNDRLKEKLSVLPEQPGCYLMKDKHGTVIYVGKAKSLKARVRSYFTGTHEGKTQRLVEEIADFEYIVTSSNAEALILEMNLIKKHDPKYNVMLKGDESYPFIKITAEKHPRLLITR-KVKKDGGKYFGPYPNVQAAR-ETKKLLDRLYPLRKCSTLPSRVCLYYHMGQCLAPCVYPVSDEQNKAMVEQVVRFLNGGYQEVKRELTEKMHQAAEALEFERAKEYRDQIAAIEMTMEKQKIVFNDFIDRDVFGYAYDKGWMCVQVFFLRQGKLIERDVSIFPLYQDPDEEMLTFLGQFYTKAHHLKPKEVVLP-TDIDGELVRELLGVHVVQPKKGKKKELIELANKNAAIALKEKFYFIERDEERTIKAIERLGELLGIPTPRRIEAFDNSNIYGADPVSALVVFLDGKPAKKEYRKYKVKTVEGPNDYESMREVVRRRYTRVLKERLPLPDLIIIDGGKGHLSAVRDVLEN-ELGLDVPLAGLAKDEKHRTSELIAGDPPAVVPLDRQSQEFYLLQRIQDEVHRFAVTFHRQTRQKTMLHSILDDIPGVGAKRKKALLNYFGSVKKMKEATVEELQRANIPRSVAEKI 584
>gi|46907453|ref|YP_013842.1| excinuclease ABC subunit C [Listeria monocytogenes str. 4b F2365] >gi|67461980|sp|Q720J5|UVRC_LISMF UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|46880721|gb|AAT04019.1| excinuclease ABC, C subunit [Listeria monocytogenes str. 4b F2365] (603 aa)
Score = 999, Expect = 3.6e-106, Identities = 229/587 (39%), Positives = 357/587 (60%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           +E I++KL  +P +PGCYL KD+ G +IYVGKA  L NR++ YF    D KT++L  EI D +Y+V ++  E+LLLE NLI K+ P++N+ L++   +P+I +T E HPR++ +    KK KG Y+GP+ N      E+   ++R++PLRKC+ LPNK C+YY +GQCL PC+  V    Y+    EI  F +G  K++   L KK  +AAE + FE + ++ +    ++   E+Q +  +   D D+ G+   +  + + +F    G L+ +      FY++ DE  LT I ++Y K     PK +YL   +  E ++ +    KI  + P +G KKD++  A+ NA   +  K++ L  N+ R + ++E L + + I    R+E FDNSNI  T+ V AMV + +G  +KN+YRK+ IK  +   DY  M+EVI RRY         +P+LI++DGGK Q+ +A + L   EL   IPV GLAKDDKH+T +++  D  EI  L++ S  ++ L  +QDEVHRFAI+F+R  +SK+ F++ L  I  +G  R +KLL+ + ++ K+KEASVEE+ +  VP+ VA+E+ K
  S:     3 SEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYFSGTHDSKTQRLVQEIVDFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKITNERHPRLIITR-QVKKDKGKYFGPYPNVYAAN-EVKRILDRLYPLRKCSTLPNKVCLYYHLGQCLAPCVFDVEASKYKEMQDEIVTFLNGGYKTVKNDLMKKMQEAAENMEFEKAGEFRDQINAIETTMEKQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFYNDADEDFLTFIGQFYQKANHIPPKEIYLPDDVDSEAVQAVVPDTKI--IVPQRGNKKDLVKLAYKNAKIALNEKFMLLERNEERTVGAVERLGEAMGIPTPSRVEAFDNSNIHGTDPVSAMVTFLDGKPSKNDYRKYKIKTVEGPDDYATMREVIRRRYWRVLKEELPMPDLILIDGGKGQIDSAKDVLTN-ELGLDIPVAGLAKDDKHRTSQLLFGDPLEIVPLERNSQEFYLLQRMQDEVHRFAITFHRQLRSKTGFQSILDGIPGVGPGRKKKLLKHFGSMKKLKEASVEEIKEAGVPLNVAEEVHK 588
>gi|47094129|ref|ZP_00231851.1| excinuclease ABC, C subunit [Listeria monocytogenes str. 4b H7858] >gi|47017496|gb|EAL08307.1| excinuclease ABC, C subunit [Listeria monocytogenes str. 4b H7858] (603 aa)
Score = 999, Expect = 3.8e-106, Identities = 229/587 (39%), Positives = 357/587 (60%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           +E I++KL  +P +PGCYL KD+ G +IYVGKA  L NR++ YF    D KT++L  EI D +Y+V ++  E+LLLE NLI K+ P++N+ L++   +P+I +T E HPR++ +    KK KG Y+GP+ N      E+   ++R++PLRKC+ LPNK C+YY +GQCL PC+  V    Y+    EI  F +G  K++   L KK  +AAE + FE + ++ +    ++   E+Q +  +   D D+ G+   +  + + +F    G L+ +      FY++ DE  LT I ++Y K     PK +YL   +  E ++ +    KI  + P +G KKD++  A+ NA   +  K++ L  N+ R + ++E L + + I    R+E FDNSNI  T+ V AMV + +G  +KN+YRK+ IK  +   DY  M+EVI RRY         +P+LI++DGGK Q+ +A + L   EL   IPV GLAKDDKH+T +++  D  EI  L++ S  ++ L  +QDEVHRFAI+F+R  +SK+ F++ L  I  +G  R +KLL+ + ++ K+KEASVEE+ +  VP+ VA+E+ K
  S:     3 SEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYFSGTHDSKTQRLVQEIVDFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKITNERHPRLIITR-QVKKDKGKYFGPYPNVYAAN-EVKRILDRLYPLRKCSTLPNKVCLYYHLGQCLAPCVFDVEASKYKEMQDEIVAFLNGGYKTVKNDLMKKMQEAAENMEFEKAGEFRDQINAIETTMEKQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFYNDADEDFLTFIGQFYQKANHIPPKEIYLPDDVDSEAVQAVVPDTKI--IVPQRGNKKDLVKLAYKNAKIALNEKFMLLERNEERTVGAVERLGEAMGIPTPSRVEAFDNSNIHGTDPVSAMVTFLDGKPSKNDYRKYKIKTVEGPDDYATMREVIRRRYWRVLKEELPMPDLILIDGGKGQIDSAKDVLTN-ELGLDIPVAGLAKDDKHRTSQLLFGDPLEIVPLERNSQEFYLLQRMQDEVHRFAITFHRQLRSKTGFQSILDGIPGVGPGRKKKLLKHFGSMKKLKEASVEEIKEAGVPLNVAEEVHK 588
>gi|16803274|ref|NP_464759.1| excinuclease ABC subunit C [Listeria monocytogenes EGD-e] >gi|153174313|ref|ZP_01929841.1| excinuclease ABC, C subunit [Listeria monocytogenes FSL N3-165] >gi|32130304|sp|Q8Y7P0|UVRC_LISMO UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|16410650|emb|CAC99312.1| uvrC [Listeria monocytogenes] >gi|133730261|gb|EBA31959.1| excinuclease ABC, C subunit [Listeria monocytogenes FSL N3-165] (603 aa)
Score = 999, Expect = 4.0e-106, Identities = 227/587 (38%), Positives = 357/587 (60%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           +E I++KL  +P +PGCYL KD+ G +IYVGKA  L NR++ YF    D KT++L  EI D +Y+V ++  E+LLLE NLI K+ P++N+ L++   +P+I +T E HPR++ +    KK KG Y+GP+ N      E+   ++R++PLRKC+ LPNK C+YY +GQCL PC+  V    Y+    EI  F +G  K++   L KK  +AAE + FE + ++ +    ++   E+Q +  +   D D+ G+   +  + + +F    G L+ +      FY++ DE  LT I ++Y K     P+ +YL   +  E ++ +    KI  + P +G KKD++  A+ NA   +  K++ L  N+ R + ++E L + + I    R+E FDNSNI  T+ V AMV + +G  +KN+YRK+ IK  +   DY  M+EVI RRY         +P+LI++DGGK Q+ +A + L   EL   IPV GLAKDDKH+T +++  D  EI  L++ S  ++ L  +QDEVHRFAI+F+R  +SK+ F++ L  I  +G  R +KLL+ + ++ K+KEAS+EE+ +  VP+ VA+E+ K
  S:     3 SEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYFSGTHDSKTQRLVQEIVDFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKITNERHPRLIITR-QVKKDKGKYFGPYPNVYAAN-EVKRILDRLYPLRKCSTLPNKVCLYYHLGQCLAPCVFDVEASKYKEMQDEIVAFLNGGYKTVKNDLMKKMQEAAENMEFEKAGEFRDQINAIETTMEKQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFYNDADEDFLTFIGQFYQKANHIPPQEIYLPNDVDSEAVQAVVPDTKI--IVPQRGNKKDLVKLAYKNAKIALNEKFMLLERNEERTVGAVERLGEAMGIPTPSRVEAFDNSNIHGTDPVSAMVTFLDGKPSKNDYRKYKIKTVEGPDDYATMREVIRRRYWRVLKEGLPMPDLILIDGGKGQIDSAKDVLTN-ELGLDIPVAGLAKDDKHRTSQLLFGDPLEIVPLERNSQEFYLLQRMQDEVHRFAITFHRQLRSKTGFQSILDGIPGVGPGRKKKLLKHFGSMKKLKEASIEEIKEAGVPLNVAEEVHK 588
>gi|16800266|ref|NP_470534.1| excinuclease ABC subunit C [Listeria innocua Clip11262] >gi|32130305|sp|Q92CH5|UVRC_LISIN UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|16413656|emb|CAC96428.1| uvrC [Listeria innocua] (603 aa)
Score = 999, Expect = 4.0e-106, Identities = 228/587 (38%), Positives = 357/587 (60%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           +E I++KL  +P +PGCYL KD+ G +IYVGKA  L NR++ YF    D KT++L  EI D +Y+V ++  E+LLLE NLI K+ P++N+ L++   +P+I +T E HPR++ +    KK KG Y+GP+ N      E+   ++R++PLRKC+ LPNK C+YY +GQCL PC+  V    Y+    EI  F +G  K++   L KK  +AAE + FE + ++ +    ++   E+Q +  +   D D+ G+   +  + + +F    G L+ +      FY++ DE  LT I ++Y K     PK +YL   +  E ++ +    KI  + P +G KK+++  A+ NA   +  K++ L  N+ R + ++E L + + I    R+E FDNSNI  T+ V AMV + +G  +KN+YRK+ IK  +   DY  M+EVI RRY         +P+LI++DGGK Q+ +A + L   EL   IPV GLAKDDKH+T +++  D  EI  L++ S  ++ L  +QDEVHRFAI+F+R  +SK+ F++ L  I  +G  R +KLL+ + ++ K+KEASVEE+ +  VP+ VA+E+ K
  S:     3 SEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSYFSGTHDSKTQRLVQEIVDFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKITNERHPRLIITR-QVKKDKGKYFGPYPNVYAAN-EVKRILDRLYPLRKCSTLPNKVCLYYHLGQCLAPCVFDVEASKYKEMQDEIVAFLNGGYKTVKNDLMKKMQEAAENMEFEKAGEFRDQINAIETTMEKQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFYNDADEDFLTFIGQFYQKANHIPPKEIYLPDDVDSEAVQAVVPDTKI--IVPQRGNKKELVKLAYKNAKIALNEKFMLLERNEERTVGAVERLGEAMGIPTPSRVEAFDNSNIHGTDPVSAMVTFLDGKPSKNDYRKYKIKTVEGPDDYATMREVIRRRYWRVLKEGLPMPDLILIDGGKGQIDSAKDVLTN-ELGLDIPVAGLAKDDKHRTSQLLFGDPLEIVPLERNSQEFYLLQRMQDEVHRFAITFHRQLRSKTGFQSILDGIPGVGPGRKKKLLKHFGSMKKLKEASVEEIKEAGVPLNVAEEVHK 588
>gi|56421210|ref|YP_148528.1| excinuclease ABC subunit C [Geobacillus kaustophilus HTA426] >gi|81346720|sp|Q5KWH6|UVRC_GEOKA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|56381052|dbj|BAD76960.1| excinuclease ABC subunit C [Geobacillus kaustophilus HTA426] (590 aa)
Score = 993, Expect = 1.7e-105, Identities = 219/586 (37%), Positives = 359/586 (61%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           MNE++K+KL  +P +PGCYL KDK+G VIYVGKA  L  R++ YF    D KT++L  EI D +Y+V ++  E+L+LE NLI K+ PKYN++L++  ++P+I +T E+HPR+L +    KK  G Y+GP+ N      E    ++R++PLRKC+ LP++ C+YY +GQCL PC+  V+ +  +  +++I  F +G  + +  +L +K  +AAE L FE +++Y +    ++M  E+Q ++ +   D D+ G+   +  + + +F    G L+ +   I   Y + DE +LT + ++Y+K     PK V L  SD   +   E L +  + P KG KK++++ A  NA   +K K+  +  ++ R + ++E L + L I    R+E FDNSNI+  + V A+VV+ +G   K EYRK+ +K     +DY+ M+EV+ RRY         +P+LII+DGGK  + A  + L+  EL   +P+ GLAKD+KH+T  ++  D  + + LD++S  ++ L  IQDEVHRFA+ F+R  + K++F + L  I  +G+ R + LL  + ++ K+KEA+VEEL +  +P  VA++I
  S:     1 MNERLKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKARVRSYFTGTHDGKTQRLVEEIADFEYIVTSSNAEALILEMNLIKKHDPKYNVMLKDDKSYPFIKITAEKHPRLLITR-KVKKDGGKYFGPYPNVQAAN-ETKKLLDRLYPLRKCSTLPSRACLYYHMGQCLAPCVHPVSDEQNKAMVEQIVRFLNGGYEDVKRELAEKMHEAAETLEFERAKEYRDQIAAIEMTMEKQKMMLNDFIDRDVFGYAYDKGWMCVQVFFLRQGKLIERDVSIFPLYQDPDEEMLTFLGQFYAKAHHLKPKEVVLP-SDIDGELARELLGVAVVQPKKGKKKELVELASKNAAIALKEKFYFIERDEERTIKAVERLGERLGIPAPRRIEAFDNSNIYGADPVSALVVFLDGKPAKKEYRKYKVKTVAGPNDYETMREVVRRRYTRVLKEGLPLPDLIIIDGGKGHLSAVRDVLEN-ELGLDVPLAGLAKDEKHRTSELLAGDPPDVVPLDRQSQEFYLLQRIQDEVHRFAVMFHRKTRQKTMFHSVLDDIPGVGEKRKKALLNYFGSVKKMKEATVEELQRANIPRAVAEKI 584
>gi|116872605|ref|YP_849386.1| excinuclease ABC subunit C [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123463712|sp|A0AHX5|UVRC_LISW6 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|116741483|emb|CAK20607.1| uvrC [Listeria welshimeri serovar 6b str. SLCC5334] (603 aa)
Score = 993, Expect = 1.8e-105, Identities = 228/587 (38%), Positives = 356/587 (60%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           +E I++KL  +P +PGCYL KD+ G +IYVGKA  L NR++ YF    D KT++L  EI D +Y+V ++  E+LLLE NLI K+ P++N+ L++   +P+I +T E HPR++ +    KK KG Y+GP+ N      E+   ++R++PLRKC+ LPNK C+YY +GQCL PC+  V    Y+    EI  F +G  K++   L KK   AAE + FE + ++ +    ++   E+Q +  +   D D+ G+   +  + + +F    G L+ +      FY++ DE  LT I ++Y K     PK +YL   +  E ++ +    KI  + P +G KK+++  A+ NA   +  K++ L  N+ R + ++E L + + I    R+E FDNSNI  T+ V AMV + +G  +KN+YRK+ IK  +   DY  M+EVI RRY         +P+LI++DGGK Q+ +A + L   EL   IPV GLAKDDKH+T +++  D  EI  L++ S  ++ L  +QDEVHRFAI+F+R  +SK+ F++ L  I  +G  R +KLL+ + ++ K+KEASVEE+ +  VP+ VA+E+ K
  S:     3 SEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSYFSGTHDSKTQRLVQEIVDFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKITNERHPRLIITR-QVKKDKGKYFGPYPNVYAAN-EVKRILDRLYPLRKCSTLPNKVCLYYHLGQCLAPCVFDVEASKYKEMQDEIVAFLNGGYKTVKNDLMKKMQVAAENMEFEKAGEFRDQINAIETTMEKQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFYNDADEDFLTFIGQFYQKANHIPPKEIYLPDDVDSEAVQAVVPDTKI--IVPQRGNKKELVKLAYKNAKIALNEKFMLLERNEERTVGAVERLGEAMGIPTPSRVEAFDNSNIHGTDPVSAMVTFLDGKPSKNDYRKYKIKTVEGPDDYATMREVIRRRYWRVLKERLPMPDLILIDGGKGQIDSAKDVL-INELGLDIPVAGLAKDDKHRTSQLLFGDPLEIVPLERNSQEFYLLQRMQDEVHRFAITFHRQLRSKTGFQSILDGIPGVGPGRKKKLLKHFGSMKKLKEASVEEIKEAGVPMNVAEEVHK 588
>gi|89098899|ref|ZP_01171779.1| excinuclease ABC subunit C [Bacillus sp. NRRL B-14911] >gi|89086303|gb|EAR65424.1| excinuclease ABC subunit C [Bacillus sp. NRRL B-14911] (590 aa)
Score = 992, Expect = 2.3e-105, Identities = 226/587 (38%), Positives = 365/587 (62%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           MNE+IK+KL  +P +PGCYL KD+   VIYVGKA  L NR++ YF    D KT +L NEI D +Y+V +++ E+L+LE NLI KY PKYN++L++  ++P+I +T E HPR++ + +  KK KG Y+GP+ N      E    ++RI+PLRKC+ LP++ C+YY +GQCL PC+K V+ + Y+  + EI  F +G  K I ++L  K   AAE+L FE +++  +   +++   E+Q +  +   D D+ GF   +  + + +F    G L+ +   +   Y E +E +LT + ++Y+K     P+ + +  ++++E  + L   L++K L P +G KKD++  A  NA   ++ K+  +  ++ R + ++E L + L I   +R+E FDNSNI  T+ V AM+V+ +G   K EYRK+ IK      DY+ M+E + RRY         IP+LIIVDGGK  +++  + L+  EL   IP+ GLAKD+KH+T +++  +  E I L++ S  ++ L  IQDEVHRFAI+F+R  + KS F++ L  I  +G+ R + LL+ + ++ K+KEA ++E + I +P  VA+E+K
  S:     1 MNERIKNKLMLLPDQPGCYLMKDRQATVIYVGKAKVLKNRVRSYFTGSHDGKTLRLVNEIEDFEYIVTSSDMEALILEMNLIKKYDPKYNVMLKDDKSYPFIKLTAERHPRLITTRN-VKKDKGKYFGPYPNVQAAN-ETKKLLDRIYPLRKCSTLPDRVCLYYHMGQCLAPCVKPVSEKQYKDIVDEIARFLNGGYKDIKKELTVKMTAAAEELDFERAKELRDQIAHIEATMEKQKMTSTDFTDRDVFGFAVDKGWMCVQVFFIRQGKLIERDVSLFPVYGEPEEEMLTFMGQFYTKANHFKPREILVPDTVNEEMAEKL---LEVKVLKPQRGQKKDLVKLAGKNARIALQEKFSLIERDEERTIKAVENLGRQLGIYTPHRIEAFDNSNIQGTDPVSAMIVFIDGKPEKREYRKYKIKTVKGPDDYESMREAVRRRYTRVLKEGLPIPDLIIVDGGKGHIESVRDVLEN-ELGLDIPISGLAKDEKHRTSQLLYGNPLEIIPLERNSQEFYLLQRIQDEVHRFAITFHRQLRGKSAFQSLLDDIPGIGEKRKKLLLKTFGSVKKMKEAGLDEFTAIGIPANVAQELK 585
>gi|70726816|ref|YP_253730.1| excinuclease ABC subunit C [Staphylococcus haemolyticus JCSC1435] >gi|92058696|sp|Q4L5F1|UVRC_STAHJ UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|68447540|dbj|BAE05124.1| excinuclease ABC subunit C [Staphylococcus haemolyticus JCSC1435] (596 aa)
Score = 991, Expect = 3.0e-105, Identities = 223/586 (38%), Positives = 365/586 (62%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK-YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           E+IK+KL  +P +PGCYL KD+N  VIYVGKA  L NR++ YF    D KT +L  EI + +++V ++E ESLLLE NLI +Y+P+YN+LL++  ++P+I +TKE+HP+++ +  + KK  G Y+GP+ N+     E    ++RI+P RKC+K+P+K C+YY IGQC+GPC+  V +Q Y    +EI+DF +G+ K+I + LE + + A+EKL FE +++Y +L +++   +++Q I+ S     D+ G+   +  + I +F    G+L+ +   +I +     +E   T I ++YS     LPK V++  + +K   +   +  K + P++G KK+++D A +NA   ++NK+  +  +++R + ++EEL + + I+   R+E FDNSNI   + V AMV + +G  +K  YRK+ IK  D   DY  M+EV+ RRY         +P+LIIVDGGK  +   L+ L+  EL   IPV GL K+DKH+T  ++    +E + L K S  ++ L  IQDEVHRFAI+F+R  + K+  ++ L  +  +G  R   LL  + ++ K+KEASV +L +  +P +VA  +++
  S:     7 EKIKNKLSVVPFEPGCYLMKDRNDQVIYVGKAKRLRNRLRSYFTGAHDAKTTRLVGEIRNFEFIVTSSETESLLLELNLIKQYQPRYNILLKDDKSYPFIKITKEKHPKLIVTR-TVKKGTGKYFGPYPNA-YSAQETKKLLDRIYPFRKCDKMPDKLCLYYHIGQCMGPCVYDVDQQVYAQMTREISDFLNGEDKTILKNLEDRMMDASEKLDFERAKEYRDLIQHIHNLTKKQKIMSSDNTIRDVFGYNVSKGWMCIQVFFIRQGNLIQRDATMIPLQQQSEEEEFYTFIGQFYSLNQHILPKEVHVPKNLDK-DMIQSVVDTKIVQPARGAKKEMVDLANHNAEVALENKFELIARDESRTIKAIEELGERMGIQTPIRIEAFDNSNIQGVDPVSAMVTFVDGKADKKGYRKYKIKTVDGPDDYKSMREVVRRRYTRVLNEGLPLPDLIIVDGGKGHMSGVLDVLEN-ELGLDIPVAGLRKNDKHQTSELLYGPNAEVVPLKKNSQAFYLLHRIQDEVHRFAITFHRQTRQKTGLQSVLDTVDGIGSKRKTSLLRTFGSIKKMKEASVVDLKKAGLPEKVALNLQQ 591
>gi|167936697|ref|ZP_02523772.1| excinuclease ABC subunit C [Bacillus cereus AH1134] (594 aa)
Score = 988, Expect = 6.3e-105, Identities = 226/586 (38%), Positives = 354/586 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           M+E +K+KL  +P +PGCYL KDK G VIYVGKA  L NR++ YF    D KT +L  EI D +Y+V ++  E+L+LE NLI KY PKYN+ L++   +P+I +T E+ PR+L + +  KK KG Y+GP+ N+    +E    ++R++PLRKC  +P+K C+YY +GQCL PC+K+VT +  +  + EI  F +G  K +  +LE K  +A+EKL FE +++  +   ++    E+Q +I S   D D+ G+   +  + + +F    G L+ +   +   Y E +E  LT I ++Y   +   PK + +  S +  + +   L+++   P +G KKD+++ A  NA   ++ K+  +  ++ R + +++ L K L I+  YR+E FDNSNI  TN V AM+ + +G   K EYRK+ IK      DY+ M+EV+ RRY         +P+LII+DGGK  + AA + L+  EL   IP+ GL KDDKHKT  ++  D  E + L++ S  ++ L  IQDEVHRFAI+F+R    KS+ +++L  I  +G  R + LL+ + +L K+KEAS+EE  +  +P  VA+ I
  S:     1 MHEHLKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTGSHDGKTLRLVGEIVDFEYIVTSSNLEALILELNLIKKYDPKYNIQLKDDKTYPFIKITAEKQPRLLITRN-VKKDKGKYFGPYPNAQ-SAHETKKLLDRMYPLRKCTNMPDKVCLYYHMGQCLAPCVKEVTEEQNKEIVDEIIKFLNGGHKEVRSELEIKMYEASEKLEFERAKELRDQIAHIDAIMEKQKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLTFIGQFYENSSHFKPKEIVVPGSIDS-ELVERFLEVEATQPKRGKKKDLVELANKNAKIALEEKFYLIERDEERTIKAVDHLGKQLGIETPYRIEAFDNSNIQGTNPVSAMIAFIDGKPAKKEYRKYKIKTVQGPDDYESMREVVRRRYTRALKENSPLPDLIIIDGGKGHLAAASDILEN-ELGLYIPMAGLVKDDKHKTSHLIIGDPPEPVMLERNSQEFYLLQRIQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRKKVLLKHFGSLKKMKEASIEEFVEAGMPKNVAETI 584
>gi|163763607|ref|ZP_02170668.1| excinuclease ABC, C subunit [Bacillus selenitireducens MLS10] >gi|160355927|gb|EDP82579.1| excinuclease ABC, C subunit [Bacillus selenitireducens MLS10] (593 aa)
Score = 987, Expect = 9.0e-105, Identities = 221/583 (37%), Positives = 358/583 (61%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           K KL  +P +PGCYL K+K+  VIYVGKA  L NR++ YF    D KT+ L +EI D +Y+V ++E E+LLLE NLI K++P+YN+LL++  ++P+I +T EEHPR++ + +  KK    Y+GP+ N+     E    ++RI+PLRKC  LP++ C+YY IGQCL PC  +VT    +  +++I  F +G  K + E +EKK  +A+E++ FE +++  +   +++   E+Q I  + + + D+ GF   +  + + +F    G L+ +   +   Y E  +   T I ++Y +   + P  +++  S      +S+ L +K L P +G KK+++D A  NA   +K K+  +  N+ + +++++EL +++ I   YR+E FDNSNI   + V AMV + +G  +K  YRK+ +K      DY+ M+EVI RRYK        +P+LI++DGGK Q+ AA +S+   EL   IPV GL KDDKH+T +++  D  E I L + S+ ++ L  IQDEVHRFAI+F+RN + KS F++ L  +  +G+ R   LL+ + +L +IK+ASVEE+ +  +P  VA  +K+
  S:     5 KHKLDLLPAQPGCYLMKNKHQTVIYVGKAKVLKNRVRSYFTGSHDQKTQMLVSEIADFEYIVTSSEIEALLLEQNLIKKHEPRYNVLLKDDKSYPFIKITNEEHPRLITTRN-VKKDGAKYFGPYPNA-YSANETKKLLDRIYPLRKCRTLPDRVCLYYHIGQCLAPCEFEVTADQNKTMVQDITKFLNGGHKEVKESIEKKMYEASEEMNFERAKELRDQMVHIENVMEKQKITIADQTNRDVFGFEVDKGWMCVQVFFVRQGKLIERDVSLFPVYQEPVDDFYTFIGQFYLEEHHKKPNEIFVQ-SGVDTGLVSDFLDVKVLEPKRGQKKELVDLARKNASISLKEKFDLIEKNEKKTIHAIQELGQVMKIDTPYRIEAFDNSNIQGVDPVSAMVSFLDGKPDKKNYRKYKVKTVQGPDDYESMREVIRRRYKRLLTEEQPLPDLIVIDGGKGQISAA-QSVLEDELGQTIPVCGLVKDDKHRTSQLMAGDPPEVISLKRTSEAFYLLQRIQDEVHRFAITFHRNVRKKSQFQSILDDVDGIGEKRKRTLLKTFGSLKRIKQASVEEIERAGIPQSVASALKR 585
>gi|49481523|ref|YP_038571.1| excinuclease ABC subunit C [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140985|ref|YP_085846.1| excinuclease ABC subunit C [Bacillus cereus E33L] >gi|118479672|ref|YP_896823.1| excinuclease ABC subunit C [Bacillus thuringiensis str. Al Hakam] >gi|166996201|ref|ZP_02262661.1| excinuclease ABC subunit C [Bacillus cereus AH820] >gi|196034329|ref|ZP_03101738.1| excinuclease ABC, C subunit [Bacillus cereus W] >gi|196039346|ref|ZP_03106652.1| excinuclease ABC, C subunit [Bacillus cereus NVH0597-99] >gi|189038023|sp|A0RJC3|UVRC_BACAH UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|81394678|sp|Q6HD05|UVRC_BACHK UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|81686006|sp|Q633S1|UVRC_BACCZ UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|49333079|gb|AAT63725.1| excinuclease ABC, subunit C [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51974454|gb|AAU16004.1| excinuclease ABC, subunit C [Bacillus cereus E33L] >gi|118418897|gb|ABK87316.1| Excinuclease ABC subunit C [Bacillus thuringiensis str. Al Hakam] >gi|195992871|gb|EDX56830.1| excinuclease ABC, C subunit [Bacillus cereus W] >gi|196029973|gb|EDX68574.1| excinuclease ABC, C subunit [Bacillus cereus NVH0597-99] (594 aa)
Score = 987, Expect = 9.5e-105, Identities = 225/586 (38%), Positives = 355/586 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           M+E +K+KL  +P +PGCYL KDK G VIYVGKA  L NR++ YF    D KT +L  EI D +Y+V ++  E+L+LE NLI K+ PKYN+ L++   +P+I +T E+ PR+L + +  KK KG Y+GP+ N+    +E    ++R++PLRKC+ +P+K C+YY +GQCL PC+K+VT +  +  + EI  F +G  K +  +LE K  +A+EKL FE +++  +   ++    E+Q +I S   D D+ G+   +  + + +F    G L+ +   +   Y E +E  LT I ++Y   +   PK + +  S +  + +   L+++   P +G KKD+++ A  NA   ++ K+  +  ++ R + ++E L K L I+  YR+E FDNSNI  TN V AM+ + +G   K EYRK+ IK      DY+ M+EV+ RRY         +P+LII+DGGK  + AA + L+  EL   IP+ GL KDDKHKT  ++  D  E + L++ S  ++ L  +QDEVHRFAI+F+R    KS+ +++L  I  +G  R + LL+ + +L K+KEAS+EE  +  +P  VA+ I
  S:     1 MHEHLKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTGSHDGKTLRLVGEIVDFEYIVTSSNLEALILELNLIKKHDPKYNIQLKDDKTYPFIKITAEKQPRLLITRN-VKKDKGKYFGPYPNAQ-SAHETKKLLDRMYPLRKCSNMPDKVCLYYHMGQCLAPCVKEVTEEQNKEIVDEIIKFLNGGHKEVRSELETKMYEASEKLEFERAKELRDQIAHIDAIMEKQKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLTFIGQFYENSSHFKPKEIVVPGSIDS-ELVERFLEVEATQPKRGKKKDLVELANKNAKIALEEKFYLIERDEERTIKAVENLGKQLGIETPYRIEAFDNSNIQGTNPVSAMIAFIDGKPAKKEYRKYKIKTVQGPDDYESMREVVRRRYTRALKEGLPLPDLIIIDGGKGHLAAASDVLEN-ELGLYIPMAGLVKDDKHKTSHLIIGDPPEPVMLERNSQEFYLLQRVQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRKKVLLKHFGSLKKMKEASIEEFVEAGMPKNVAETI 584
>gi|196044923|ref|ZP_03112157.1| excinuclease ABC, C subunit [Bacillus cereus 03BB108] >gi|196024411|gb|EDX63084.1| excinuclease ABC, C subunit [Bacillus cereus 03BB108] (594 aa)
Score = 987, Expect = 9.8e-105, Identities = 225/586 (38%), Positives = 355/586 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           M+E +K+KL  +P +PGCYL KDK G VIYVGKA  L NR++ YF    D KT +L  EI D +Y+V ++  E+L+LE NLI K+ PKYN+ L++   +P+I +T E+ PR+L + +  KK KG Y+GP+ N+    +E    ++R++PLRKC+ +P+K C+YY +GQCL PC+K+VT +  +  + EI  F +G  K +  +LE K  +A+EKL FE +++  +   ++    E+Q +I S   D D+ G+   +  + + +F    G L+ +   +   Y E +E  LT I ++Y   +   PK + +  S +  + +   L+++   P +G KKD+++ A  NA   ++ K+  +  ++ R + ++E L K L I+  YR+E FDNSNI  TN V AM+ + +G   K EYRK+ IK      DY+ M+EV+ RRY         +P+LII+DGGK  + AA + L+  EL   IP+ GL KDDKHKT  ++  D  E + L++ S  ++ L  +QDEVHRFAI+F+R    KS+ +++L  I  +G  R + LL+ + +L K+KEAS+EE  +  +P  VA+ I
  S:     1 MHEHLKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTGSHDGKTLRLVGEIVDFEYIVTSSNLEALILELNLIKKHDPKYNIQLKDDKTYPFIKITAEKQPRLLITRN-VKKDKGKYFGPYPNAQ-SAHETKKLLDRMYPLRKCSNMPDKVCLYYHMGQCLAPCVKEVTEEQNKEIVDEIIKFLNGGHKEVRSELETKMYEASEKLEFERAKELRDQIAHIDAIMEKQKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLTFIGQFYENSSHFKPKEIVVPGSIDS-ELVEHFLEVEATQPKRGKKKDLVELANKNAKIALEEKFYLIERDEERTIKAVENLGKQLGIETPYRIEAFDNSNIQGTNPVSAMIAFIDGKPAKKEYRKYKIKTVQGPDDYESMREVVRRRYTRALKENLPLPDLIIIDGGKGHLAAASDVLEN-ELGLYIPMAGLVKDDKHKTSHLIIGDPPEPVMLERNSQEFYLLQRVQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRKKVLLKHFGSLKKMKEASIEEFVEAGMPKNVAETI 584
>gi|30264586|ref|NP_846963.1| excinuclease ABC subunit C [Bacillus anthracis str. Ames] >gi|47530056|ref|YP_021405.1| excinuclease ABC subunit C [Bacillus anthracis str. 'Ames Ancestor'] >gi|49187411|ref|YP_030663.1| excinuclease ABC subunit C [Bacillus anthracis str. Sterne] >gi|65321885|ref|ZP_00394844.1| COG0322: Nuclease subunit of the excinuclease complex [Bacillus anthracis str. A2012] >gi|165871485|ref|ZP_02216132.1| excinuclease ABC, C subunit [Bacillus anthracis str. A0488] >gi|167635615|ref|ZP_02393927.1| excinuclease ABC, C subunit [Bacillus anthracis str. A0442] >gi|167641662|ref|ZP_02399907.1| excinuclease ABC, C subunit [Bacillus anthracis str. A0193] >gi|170688237|ref|ZP_02879447.1| excinuclease ABC, C subunit [Bacillus anthracis str. A0465] >gi|170708324|ref|ZP_02898768.1| excinuclease ABC, C subunit [Bacillus anthracis str. A0389] >gi|177653110|ref|ZP_02935397.1| excinuclease ABC, C subunit [Bacillus anthracis str. A0174] >gi|190566893|ref|ZP_03019809.1| excinuclease ABC, C subunit [Bacillus anthracis Tsiankovskii-I] >gi|81581242|sp|Q81L74|UVRC_BACAN UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|30259244|gb|AAP28449.1| excinuclease ABC, C subunit [Bacillus anthracis str. Ames] >gi|47505204|gb|AAT33880.1| excinuclease ABC, C subunit [Bacillus anthracis str. 'Ames Ancestor'] >gi|49181338|gb|AAT56714.1| excinuclease ABC, C subunit [Bacillus anthracis str. Sterne] >gi|164712782|gb|EDR18312.1| excinuclease ABC, C subunit [Bacillus anthracis str. A0488] >gi|167510369|gb|EDR85770.1| excinuclease ABC, C subunit [Bacillus anthracis str. A0193] >gi|167529035|gb|EDR91790.1| excinuclease ABC, C subunit [Bacillus anthracis str. A0442] >gi|170126699|gb|EDS95582.1| excinuclease ABC, C subunit [Bacillus anthracis str. A0389] >gi|170667743|gb|EDT18496.1| excinuclease ABC, C subunit [Bacillus anthracis str. A0465] >gi|172081634|gb|EDT66705.1| excinuclease ABC, C subunit [Bacillus anthracis str. A0174] >gi|190561884|gb|EDV15853.1| excinuclease ABC, C subunit [Bacillus anthracis Tsiankovskii-I] (594 aa)
Score = 986, Expect = 1.1e-104, Identities = 224/586 (38%), Positives = 355/586 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           M+E +K+KL  +P +PGCYL KD+ G VIYVGKA  L NR++ YF    D KT +L  EI D +Y+V ++  E+L+LE NLI K+ PKYN+ L++   +P+I +T E+ PR+L + +  KK KG Y+GP+ N+    +E    ++R++PLRKC+ +P+K C+YY +GQCL PC+K+VT +  +  + EI  F +G  K +  +LE K  +A+EKL FE +++  +   ++    E+Q +I S   D D+ G+   +  + + +F    G L+ +   +   Y E +E  LT I ++Y   +   PK + +  S +  + +   L+++   P +G KKD+++ A  NA   ++ K+  +  ++ R + ++E L K L I+  YR+E FDNSNI  TN V AM+ + +G   K EYRK+ IK      DY+ M+EV+ RRY         +P+LII+DGGK  + AA + L+  EL   IP+ GL KDDKHKT  ++  D  E + L++ S  ++ L  +QDEVHRFAI+F+R    KS+ +++L  I  +G  R + LL+ + +L K+KEAS+EE  +  +P  VA+ I
  S:     1 MHEHLKEKLAILPDQPGCYLMKDRQGTVIYVGKAKVLKNRVRSYFTGSHDGKTLRLVGEIVDFEYIVTSSNLEALILELNLIKKHDPKYNIQLKDDKTYPFIKITAEKQPRLLITRN-VKKDKGKYFGPYPNAQ-SAHETKKLLDRMYPLRKCSNMPDKVCLYYHMGQCLAPCVKEVTEEQNKEIVDEIIKFLNGGHKEVRSELETKMYEASEKLEFERAKELRDQIAHIDAIMEKQKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLTFIGQFYENSSHFKPKEIVVPGSIDS-ELVERFLEVEATQPKRGKKKDLVELANKNAKIALEEKFYLIERDEERTIKAVENLGKQLGIETPYRIEAFDNSNIQGTNPVSAMIAFIDGKPAKKEYRKYKIKTVQGPDDYESMREVVRRRYTRALKEGLPLPDLIIIDGGKGHLAAASDVLEN-ELGLYIPMAGLVKDDKHKTSHLIIGDPPEPVMLERNSQEFYLLQRVQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRKKVLLKHFGSLKKMKEASIEEFVEAGMPKNVAETI 584
>gi|169187954|ref|ZP_02848112.1| excinuclease ABC, C subunit [Paenibacillus sp. JDR-2] >gi|169005370|gb|EDS52223.1| excinuclease ABC, C subunit [Paenibacillus sp. JDR-2] (626 aa)
Score = 985, Expect = 1.7e-104, Identities = 221/584 (37%), Positives = 350/584 (59%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSL--------------SDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           E I++KL  +P +PGCYL K+  G +IYVGKA  L NR++ YF    + KT++L +EI D DY++ ++  E+L+LE NLI +Y P+YN+LL++   FPYI +T E+HPR+  +    K  KG Y+GP+ N+     +    ++R++PLRKC  LP+K C+YY IGQC+ PC   V +  Y+  ++EI  F +G   ++  ++ +K   AAE+L FE +++Y +   ++    E+Q I  +   D DI G+  ++  + + I     G ++ +      +Y E  +  +T + +YYS     LPK + L L              SDE    L   LK+K L P +G K + +  A +NA   + +K+  +  ++ R + + E L + L + ++ R+E FDNSNI  TN V AMVV+ +G  ++ EYRK+ +K      DY+ M+EVI RRY+         P+LI+VDGGK Q+ AAL+ L+  EL   IPV GL KD KHKT +++  D  E + L + S  ++ L  IQDEVHRFAISF+R ++ KS+  + L  I  +G+ R + LL+ + ++ KIKEAS+E+     P+ + +++
  S:    17 ELIRNKLALLPDQPGCYLMKNGEGTIIYVGKAKVLKNRVRSYFNGSHNGKTQRLVSEIRDFDYIITSSNMEALILECNLIKQYHPRYNVLLKDDKTFPYIKITNEKHPRLEVTRRVVKD-KGKYFGPYPNA-FAAQQTKKLLDRLYPLRKCGTLPDKVCLYYHIGQCIAPCEYDVEQGQYDAMIQEITKFLNGGHDAVKAEIHRKMEAAAEELNFERAKEYRDQIISIDAVIEKQKITMNDALDRDIFGYAVEKGWMCVQILYMRQGKMIERRGTTFPYYGEEYDDFMTFVTQYYSDNP-ALPKQILLPLPAEEEEGTAESSTASDEFATMLHNWLKVKVLMPQRGRKSEAVSMAIDNAKIALADKFRLIERDEERSVRASEGLAEWLGLPEVRRIEAFDNSNIQGTNPVSAMVVFTDGKPDRKEYRKYKVKTVVGADDYETMREVIRRRYERMLKEQQTPPDLIVVDGGKGQISAALDILQN-ELGLYIPVCGLVKDAKHKTAQLMTGDPPEVVPLPRDSQEFYLLQRIQDEVHRFAISFHREQRGKSMIASQLDAIPGIGEKRRKLLLKHFGSIKKIKEASIEDFK---PLSIGEKL 608
>gi|161511200|ref|NP_834229.2| excinuclease ABC subunit C [Bacillus cereus ATCC 14579] >gi|119370540|sp|Q817L9|UVRC_BACCR UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) (594 aa)
Score = 985, Expect = 1.7e-104, Identities = 226/586 (38%), Positives = 353/586 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           M+E +K+KL   P +PGCYL KDK G VIYVGKA  L NR++ YF    D KT +L  EI D +Y+V ++  E+L+LE NLI KY PKYN+ L++   +P+I +T E+ PR+L + +  KK KG Y+GP+ N+    +E    ++R++PLRKC  +P+K C+YY +GQCL PC+K+VT +  +  + EI  F +G  K +  +LE K  +A+EKL FE +++  +   ++    E+Q +I S   D D+ G+   +  + + +F    G L+ +   +   Y E +E  LT I ++Y   +   PK + +  S +  + +   L+++   P +G KKD+++ A  NA   ++ K+  +  ++ R + +++ L K L I+  YR+E FDNSNI  TN V AM+ + +G   K EYRK+ IK      DY+ M+EV+ RRY         +P+LII+DGGK  + AA + L+  EL   IP+ GL KDDKHKT  ++  D  E + L++ S  ++ L  IQDEVHRFAI+F+R    KS+ +++L  I  +G  R + LL+ + +L K+KEAS+EE  +  +P  VA+ I
  S:     1 MHEHLKEKLAISPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTGSHDGKTLRLVGEIVDFEYIVTSSNLEALILELNLIKKYDPKYNIQLKDDKTYPFIKITAEKQPRLLITRN-VKKDKGKYFGPYPNAQ-SAHETKKLLDRMYPLRKCTNMPDKVCLYYHMGQCLAPCVKEVTEEQNKEIVDEIIKFLNGGHKEVRSELEIKMYEASEKLEFERAKELRDQIAHIDAIMEKQKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLTFIGQFYENSSHFKPKEIVVPGSIDS-ELVERFLEVEATQPKRGKKKDLVELANKNAKIALEEKFYLIERDEERTIKAVDHLGKQLGIETPYRIEAFDNSNIQGTNPVSAMIAFIDGKPAKKEYRKYKIKTVQGPDDYESMREVVRRRYTRALKENSPLPDLIIIDGGKGHLAAASDILEN-ELGLYIPMAGLVKDDKHKTSHLIIGDPPEPVMLERNSQEFYLLQRIQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRKKVLLKHFGSLKKMKEASIEEFVEAGMPKNVAETI 584
>gi|166982156|ref|ZP_02253598.1| excinuclease ABC subunit C [Bacillus cereus AH187] >gi|168163351|ref|ZP_02598584.1| excinuclease ABC subunit C [Bacillus cereus H3081.97] (594 aa)
Score = 985, Expect = 1.8e-104, Identities = 226/586 (38%), Positives = 354/586 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           M+E +K+KL  +P +PGCYL KDK G VIYVGKA  L NR++ YF    D KT +L  EI D +Y+V ++  E+L+LE NLI K+ PKYN+ L++   +P+I +T E+ PR+L + +  KK KG Y+GP+ N+    +E    ++R++PLRKC+ +P+K C+YY +GQCL PC+K+VT +  +  + EI  F +G  K +  +LE K  +A+EKL FE +++  +   ++    E+Q +I S   D D+ G+   +  + + +F    G L+ +   +   Y E +E  LT I ++Y   +   PK + +  S +  + +   L+++   P +G KKD+++ A  NA   ++ K+  +  ++ R + ++E L K L I+  YR+E FDNSNI  TN V AM+ + +G   K EYRK+ IK      DY+ M+EV+ RRY         +P+LII+DGGK  + AA + L+  EL   IP+ GL KDDKHKT  ++  D  E + L++ S  ++ L  IQDEVHRFAI+F+R    KS+ +++L  I  +G  R + LL+ + +L K+KEASV E  +  +P  VA+ I
  S:     1 MHEHLKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTGSHDGKTLRLVGEIVDFEYIVTSSNLEALILELNLIKKHDPKYNIQLKDDKTYPFIKITAEKQPRLLITRN-VKKDKGKYFGPYPNAQ-SAHETKKLLDRMYPLRKCSNMPDKVCLYYHMGQCLAPCVKEVTEEQNKEIVDEIIKFLNGGHKEVRSELETKMYEASEKLEFERAKELRDQIAHIDAIMEKQKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLTFIGQFYENSSHFKPKEIVVPGSIDS-ELVERFLEVEATQPKRGKKKDLVELANKNAKIALEEKFYLIERDEERTIKAVENLGKQLGIETPYRIEAFDNSNIQGTNPVSAMIAFIDGKPAKKEYRKYKIKTVQGPDDYESMREVVRRRYTRALKEGLPLPDLIIIDGGKGHLAAASDVLEN-ELGLYIPMAGLVKDDKHKTSHLIIGDPPEPVMLERNSQEFYLLQRIQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRKKILLKHFGSLKKMKEASVTEFVEAGMPKNVAETI 584
>gi|160914271|ref|ZP_02076492.1| hypothetical protein EUBDOL_00281 [Eubacterium dolichum DSM 3991] >gi|158433898|gb|EDP12187.1| hypothetical protein EUBDOL_00281 [Eubacterium dolichum DSM 3991] (592 aa)
Score = 983, Expect = 2.5e-104, Identities = 221/583 (37%), Positives = 352/583 (60%)
  Q:     4 QIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           +I+DKL  +P  PGCYL K+K G +IYVGKA  L NR++QYF    D KT +L   I D +Y+V  +E E+LLLE NLI K+ P+YN++  +   +PY+ +TKE+ P +L    +TK  K TY+GPF +S+   Y+    +NRI+PLRKCN+LP K+C+YY +GQCL PC+  +  Q Y    + I  F  G  K I E+L+ +  +A+E L FE +Q+ L L + ++  + RQ I F    D D+ G+Y  +  ISI  F    G L+ +   IT  Y +  E   + + +YY+     LP+ + L   +  ++ L + L  K + P +G K  +++    NA    + K+  +    +R    +++L +LL  K+++R+E+FDNS+I     V  MVVY++G  +K +YR + +  ++  SD D MKEVIYRRY       G+ P+L+IVDGG  Q++AA E +  LE+   I V GL KDD H+T  ++  +   + + K+S L+F L  +QDEVHRFAIS++R  + K + ++ L +++ +G  R +K+   +++L ++K+ASVEE++ +VP++VA+ +
  S:     6 KIEDKLAILPALPGCYLMKNKQGEIIYVGKAKKLKNRVRQYFHGAHDFKTTRLVANIDDFEYIVCGSEKEALLLEINLIKKHTPQYNIMFMDDKTYPYLKLTKEKAP-LLRVVRNTKDKKATYFGPFPDSS-AAYDTQKLLNRIYPLRKCNRLPKKECLYYHMGQCLAPCVNVIDEQVYADMAQGIRKFLRGDVKEIVERLKAEMKEASEALQFEKAQEKLSLIQAIEHVTARQQIDFKDHKDRDVFGYYVDKGYISIQGFFMRGGKLIERTLSITPLYEDAMEAFQSFVLQYYANNP--LPQEILLP-KEYDVEHLVQILDTKIVQPIRGDKLKLVEMVLANAKNSHEQKFELISRKDHRREEGMQQLCQLLG-KEIHRIELFDNSHISGAYNVSGMVVYKDGEPSKQDYRTYRL--QEYRSDLDSMKEVIYRRYVRLLKERGKFPDLLIVDGGWLQIEAAKEIIDALEVS--ITVCGLVKDDNHRTSNLMDSEGRVLAVSKESSLFFLLTQMQDEVHRFAISYHRRLRGKGMTKSILDEVEGIGNVRKKKIWNHFKSLKRLKQASVEEIAAVVPMQVAQSV 578
>gi|73662958|ref|YP_301739.1| excinuclease ABC subunit C [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|92058697|sp|Q49WR3|UVRC_STAS1 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|72495473|dbj|BAE18794.1| excinuclease ABC subunit C [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (595 aa)
Score = 983, Expect = 2.7e-104, Identities = 224/584 (38%), Positives = 360/584 (61%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLS--LSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           E+IK KL  +P +PGCYL KD+N  +IYVGKA  L NR++ YF    D KT +L  EI + +++V ++E ESLLLE NLI +Y+P+YN+LL++  ++P+I +TKE++PR++ +  + KK  G Y+GP+ N+     E    ++RI+P RKC+K+P+K C+YY IGQCLGPC+  V  + Y    KEI DF +G+ K+I   LE+K  +++E L FE +++Y +L +++   +++Q I  S     D+ G+   +  + I +F    G+++ +   +       +E   T I ++Y      LPK V++   L+ E ++++ ++   K + P KG KKD++D A +NA   ++NK+  +  +++R + ++EEL  ++ I+   R+E FDNSNI   N V AMV + +G  NK  YRK+ IK  D   DY  M+EV+ RRY         +P+LIIVDGGK  +   ++ L+  EL   IPV GL K+DKH+T  I+  + +E + + K S  ++ L  IQDEVHRFAI+F+R  + K+  ++ L  +  +G  R  KLL  + ++ ++KEASVE+L    +P  VA+ +
  S:     6 EKIKQKLTVVPIEPGCYLMKDRNDQIIYVGKAKKLRNRLRSYFTGAHDAKTTRLVGEIRNFEFIVTSSETESLLLELNLIKQYQPRYNILLKDDKSYPFIKITKEKYPRLIVTR-TVKKGSGKYFGPYPNA-YSAQETKKLLDRIYPFRKCDKMPDKLCLYYHIGQCLGPCVYPVDLEKYAEMTKEITDFLNGEDKTILHNLEQKMQESSESLDFERAKEYRDLIQHIHNLNKKQKITSSDNTIRDVFGYSISKGWMCIQVFFIRQGNMIKRDATMIPLQQTEEEEFYTFIGQFYDLNQHILPKEVHVPKHLNKELIQSVVDT---KIVQPLKGKKKDMVDLANHNAEVTLENKFELIAKDESRTVKAIEELGDVMGIQTPIRIEAFDNSNIQGVNPVSAMVSFIDGKPNKKGYRKYKIKTVDGPDDYKSMREVVRRRYTRVLNEGSPLPDLIIVDGGKGHMSGVIDVLEN-ELGLDIPVAGLRKNDKHQTSEILYGEQAEVVPMKKNSQPFYLLQRIQDEVHRFAITFHRQTRQKTGLQSVLDTVDGIGAKRKTKLLRTFGSIKRMKEASVEDLKNSGLPQNVAENL 587
>gi|167755831|ref|ZP_02427958.1| hypothetical protein CLORAM_01347 [Clostridium ramosum DSM 1402] >gi|167704770|gb|EDS19349.1| hypothetical protein CLORAM_01347 [Clostridium ramosum DSM 1402] (590 aa)
Score = 982, Expect = 3.8e-104, Identities = 224/583 (38%), Positives = 361/583 (61%)
  Q:     1 MNEQ-IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           MN Q IKDKL  +P +PGCYL KDK+  VIYVGKA  L NR+  YF+   + KT KL  EI D DY+V ++E E+LLLE NLI  Y PKYN+   ++  +PYI +TKE+HPR+    ++  K K  ++GPF +    + E +  +NR++PLRKCN +P K C+YY + QC+ PCI++V+ + Y+     I  F  G +K I   L+ K + A+E   +E +++  +L  +++  + +Q + F+   D DI+G+Y  +  + + +F   NG LL++   +     +  E +++ + ++Y +     PK + L   +  ++ L E +  K + P KG K +++  A  NA E ++ K+L +  N+   + ++++L ++L+I+   R+E+FDNSNI     V  MV +++G  +K +YRKF IK  +   DY  MKEVIYRRY        E P+LIIVDGGK Q+K A E +  L L+  I V GLAKDD+H T  ++      +++++KS+L+F L  +QDEVHR+AISF++N +SKSLF++ L  ++ +G  R + LL+++ ++ ++KEA +E+L +++P EVA
  S:     1 MNRQMIKDKLSLLPLQPGCYLMKDKDNTVIYVGKAKKLKNRVSSYFVGAHNYKTTKLVQEIVDFDYIVTDSEKEALLLEINLIKDYSPKYNISFMDNKYYPYIQLTKEKHPRLKIVRNAQDK-KHKHFGPFPDGTAAR-ETFKLLNRLYPLRKCNHIPKKPCLYYSLNQCVAPCIQEVSDEVYKEMTSSITKFIQGDTKEIINDLQNKMMSASEVQNYELAKECRDLITHIQHVTSKQHVQFNDLVDRDIVGYYSDKGYLCLQLFFMRNGKLLARDLNLVPAQDDYQEQIISFLVQFYQENT--EPKEL-LVPQELDIELLKEIVNCKIIKPQKGNKANLVAMANENAKEQLEKKFLLIQKNEASTIGAIKQLGEILNIQLPRRIELFDNSNIQGAYAVAGMVCFKDGTPSKKDYRKFKIKTVEGPDDYASMKEVIYRRYYRVLMEGLEKPDLIIVDGGKGQIKVAKEVIDALNLN--IMVCGLAKDDRHSTSVLLDSSGEVVEINRKSELFFLLTRMQDEVHRYAISFHKNVRSKSLFQSILDSVEGIGPKRRKMLLKEFGSVKQLKEAQLEQLERVLPHEVA 577
>gi|89894629|ref|YP_518116.1| excinuclease ABC subunit C [Desulfitobacterium hafniense Y51] >gi|119367647|sp|Q24WC0|UVRC_DESHY UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|89334077|dbj|BAE83672.1| hypothetical protein [Desulfitobacterium hafniense Y51] (607 aa)
Score = 982, Expect = 3.9e-104, Identities = 217/574 (37%), Positives = 341/574 (59%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQ 576
           E +++KL  +P KPG YL KD +G +IYVGKA  L NR++ YF    + KT+ + + I D + ++ ++E E+LLLE NLI K+ PKYN+LLR+   +P+I +T E HPRIL +    KK  G YYGP+ N+   K E    +NR+FP RKC ++PNK C+YY +GQCLGPC   V ++ Y+   KE   F  G   +I + LEKK  +A+E L FE +++Y +L ++LK   E+Q+I  +   D D++G+   ++ + I IF    G LLS+ + I  +Y E +E  ++ + ++Y++ +  LP+ + L   D  + T    + +    P KG K+D++  A  NA   +  +    I N      +L E+   L I  L  +E FD SNI  T+ V  M+ + +G  N+++YRKF I+      D   M +VI RRY         +P+LI+VDGGK Q+ AAL +L    L++ IPV G+ K+DKH+T  ++        LD++S  +  L  IQ+EVHRFAI+F+R +++KS+  + L  I  +G  R ++LL+ ++++D I++A++EEL Q
  S:    18 EILREKLSLLPDKPGVYLMKDASGQIIYVGKAKVLKNRVRSYFTGSHNGKTQLMISLIADFETIITDSEVEALLLECNLIKKHNPKYNILLRDDKTYPFITITDEAHPRILVTR-QVKKGAGKYYGPYPNATAAK-EAARLLNRLFPFRKCRQIPNKPCLYYHLGQCLGPCQVDVPKEAYDKIRKEAAAFLKGDQGAILKALEKKMKEASENLEFERAKEYRDLMEDLKKVGEKQNITLNDFVDRDVVGYAYTQDQLCIQIFYLRQGKLLSRDNFIFPYYEEPEEAFVSFLAQFYTE-SSALPQEILLPPLDISVLTKLFPMVV----PQKGQKRDLVQMAMENAQTTLHEQISIEIRNLTECTQALAEIGNALGIPSLRTIESFDISNIAGTHSVAGMIQFLDGKPNRSQYRKFKIQPMPNMDDTASMHQVIERRYARLQQENLPLPDLILVDGGKGQIHAALAALH--SLNAAIPVAGMVKNDKHQTSALIDAMDRIHSLDRRSAGFRLLERIQNEVHRFAITFHRQQRAKSMTLSELDGIAGVGPKRRQQLLKFFKSIDSIRQATLEELQQ 582
>gi|168135549|ref|ZP_02578778.1| excinuclease ABC subunit C [Bacillus cereus B4264] (594 aa)
Score = 981, Expect = 4.9e-104, Identities = 225/586 (38%), Positives = 353/586 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           M+E +K+KL  +P +PGCYL KDK G VIYVGKA  L NR++ YF    D KT +L  EI D +Y+V ++  E+L+LE NLI KY PKYN+ L++   +P+I +T E+ PR+L + +  KK KG Y+GP+ N+    +E    ++R++PLRKC  +P+K C+YY +GQCL PC+K+VT +  +  + EI  F +G  K +  +LE K  +A+EKL FE +++  +   ++    E+Q +I S   D D+ G+   +  + + +F    G L+ +   +   Y E +E  LT I ++Y   +   PK + +  S +  + +   L+++   P +G KKD+++ A  NA   ++ K+  +  ++ R + +++ L K L I+  YR+E FDNSNI  TN V AM+ + +G   K EYRK+ IK      DY+ M+EV+ RRY         +P+LII+DGGK  + AA + L+  EL   IP+ GL KDDKHKT  ++     E + L++ S  ++ L  IQDEVHRFAI+F+R    KS+ +++L  I  +G  R + LL+ + +L K+KEAS+EE  +  +P  VA+ I
  S:     1 MHEHLKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTGSHDGKTLRLVGEIVDFEYIVTSSNLEALILELNLIKKYDPKYNIQLKDDKTYPFIKITAEKQPRLLITRN-VKKDKGKYFGPYPNAQ-SAHETKKLLDRMYPLRKCTNMPDKVCLYYHMGQCLAPCVKEVTEEQNKEIVDEIIKFLNGGHKEVRSELEIKMYEASEKLEFERAKELRDQIAHIDAIMEKQKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLTFIGQFYENSSHFKPKEIVVPGSIDS-ELVERFLEVEATQPKRGKKKDLVELANKNAKIALEEKFYLIERDEERTIKAVDHLGKQLGIETPYRIEAFDNSNIQGTNPVSAMIAFIDGKPAKKEYRKYKIKTVQGPDDYESMREVVRRRYTRALKENSPLPDLIIIDGGKGHLAAASDILEN-ELGLYIPMAGLVKDDKHKTSHLIIGVPPEPVMLERNSQEFYLLQRIQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRKKVLLKHFGSLKKMKEASIEEFVEAGMPKNVAETI 584
>gi|75762575|ref|ZP_00742428.1| Excinuclease ABC subunit C [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74489937|gb|EAO53300.1| Excinuclease ABC subunit C [Bacillus thuringiensis serovar israelensis ATCC 35646] (594 aa)
Score = 981, Expect = 5.1e-104, Identities = 226/586 (38%), Positives = 353/586 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           M+E +K+KL  +P +PGCYL KDK G VIYVGKA  L NR++ YF    D KT +L  EI D +Y+V ++  E+L+LE NLI KY PKYN+ L++   +P+I +T E+ PR+L + +  KK KG Y+GP+ N+    +E    ++R++PLRKC  +P+K C+YY +GQCL PC+K+VT +  +  + EI  F +G  K +  +LE K  +A+EKL FE +++  +   ++    E+Q +I S   D D+ G+   +  + + +F    G L+ +   +   Y E +E  LT I ++Y   +   PK + +  S +  + +   L+++   P +G KKD+++ A  NA   ++ K+  +  ++ R + +++ L K L I+  YR+E FDNSNI  TN V AM+ + +G   K EYRK+ IK      DY+ M+EV+ RRY         +P+LII+DGGK  + AA + L+  EL   IP+ GL KDDKHKT  ++  D  E + L++ S  ++ L  IQDEVHRFAI+F+R    KS+ +++L  I  +G  R + LL+ + +L K+KEASV E  +  +P  VA+ I
  S:     1 MHEHLKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTGSHDGKTLRLVGEIVDFEYIVTSSNLEALILELNLIKKYDPKYNIQLKDDKTYPFIKITAEKQPRLLITRN-VKKDKGKYFGPYPNAQ-SAHETKKLLDRMYPLRKCTNMPDKVCLYYHMGQCLAPCVKEVTEEQNKEIVDEIIKFLNGGHKEVRSELEIKMYEASEKLEFERAKELRDQIAHIDAIMEKQKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLTFIGQFYENSSHFKPKEIVVPGSIDS-ELVERFLEVEATQPKRGKKKDLVELANKNAKIALEEKFYLIERDEERTIKAVDHLGKQLGIETPYRIEAFDNSNIQGTNPVSAMIAFIDGKPAKKEYRKYKIKTVQGPDDYESMREVVRRRYTRALKENLPLPDLIIIDGGKGHLAAASDILED-ELGLYIPMAGLVKDDKHKTSHLIIGDPPEPVVLERNSQEFYLLQRIQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRKKVLLKHFGSLKKMKEASVAEFVEAGMPKNVAETI 584
>gi|42783693|ref|NP_980940.1| excinuclease ABC subunit C [Bacillus cereus ATCC 10987] >gi|81408957|sp|Q72ZM1|UVRC_BACC1 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|42739622|gb|AAS43548.1| excinuclease ABC, C subunit [Bacillus cereus ATCC 10987] (594 aa)
Score = 978, Expect = 9.1e-104, Identities = 225/586 (38%), Positives = 354/586 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           M+E +K+KL  +P +PGCYL KDK G VIYVGKA  L NR++ YF    D KT +L  EI D +Y+V ++  E+L+LE NLI K+ PKYN+ L++   +P+I +T E+ PR+L + +  KK KG Y+GP+ N+    +E    ++R++PLRKC+ +P+K C+YY +GQCL PC+K+VT +  +  + EI  F +G  K +  +LE K  +A+EKL FE +++  +   ++    E+Q +I S   D D+ G+   +  + + +F    G L+ +   +   Y E +E  LT I ++Y   +   PK + +  S +  + +   L+++   P +G KKD+++ A  NA   ++ K+  +  ++ R + ++E L K L I+  +R+E FDNSNI  TN V AM+ + +G   K EYRK+ IK      DY+ M+EV+ RRY         +P+LII+DGGK  + AA + L+  EL   IP+ GL KDDKHKT  ++  D  E + L++ S  ++ L  IQDEVHRFAI+F+R    KS+ +++L  I  +G  R + LL+ + +L K+KEASV E  +  +P  VA+ I
  S:     1 MHEHLKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTGSHDGKTLRLVGEIVDFEYIVTSSNLEALILELNLIKKHDPKYNIQLKDDKTYPFIKITAEKQPRLLITRN-VKKDKGKYFGPYPNAQ-SAHETKKLLDRMYPLRKCSNMPDKVCLYYHMGQCLAPCVKEVTEEQNKEIVDEIIKFLNGGHKEVRSELETKMYEASEKLEFERAKELRDQIAHIDAIMEKQKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLTFIGQFYENSSHFKPKEIVVPGSIDS-ELVERFLEVEATQPKRGKKKDLVELANKNAKIALEEKFYLIERDEERTIKAVENLGKRLGIETPHRIEAFDNSNIQGTNPVSAMIAFIDGKPAKKEYRKYKIKTVQGPDDYESMREVVRRRYTRALKENLPLPDLIIIDGGKGHLAAASDILEN-ELGLYIPMAGLVKDDKHKTSHLIIGDPPEPVMLERNSQEFYLLQRIQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRKKILLKHFGSLKKMKEASVTEFVEAGMPKNVAETI 584
>gi|109645007|ref|ZP_01368927.1| excinuclease ABC, C subunit [Desulfitobacterium hafniense DCB-2] >gi|109642956|gb|EAT52509.1| excinuclease ABC, C subunit [Desulfitobacterium hafniense DCB-2] (591 aa)
Score = 978, Expect = 1.2e-103, Identities = 217/574 (37%), Positives = 341/574 (59%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQ 576
           E +++KL  +P KPG YL KD +G +IYVGKA  L NR++ YF    + KT+ + + I D + ++ ++E E+LLLE NLI K+ PKYN+LLR+   +P+I +T E HPRIL +    KK  G YYGP+ N+   K E    +NR+FP RKC ++PNK C+YY +GQCLGPC   V ++ Y+   KE   F  G   +I + LEKK  +A+E L FE +++Y +L ++LK   E+Q+I  +   D D++G+   ++ + I IF    G LLS+ + I  +Y E +E  ++ + ++Y++ +  LP+ + L   D  + T    + +    P KG K+D++  A  NA   +  +    I N      +L E+   L I  L  +E FD SNI  T+ V  M+ + +G  N+++YRKF I+      D   M +VI RRY         +P+LI+VDGGK Q+ AAL +L    L++ IPV G+ K+DKH+T  ++        LD++S  +  L  IQ+EVHRFAI+F+R +++KS+  + L  I  +G  R ++LL+ ++++D I++A++EEL Q
  S:     2 EILREKLSLLPDKPGVYLMKDASGQIIYVGKAKVLKNRVRSYFTGSHNGKTQLMISLIADFETIITDSEVEALLLECNLIKKHNPKYNILLRDDKTYPFITITDEAHPRILVTR-QVKKGAGKYYGPYPNATAAK-EAARLLNRLFPFRKCRQIPNKPCLYYHLGQCLGPCQVDVPKEAYDKIRKEAAAFLKGDQGAILKALEKKMKEASENLEFERAKEYRDLMEDLKKVGEKQNITLNDFVDRDVVGYAYTQDQLCIQIFYLRQGKLLSRDNFIFPYYEEPEEAFVSFLAQFYTE-SSALPQEILLPPLDISVLTKLFPMVV----PQKGQKRDLVQMAMENAQTTLHEQISIEIRNLTECTQALAEIGNALGIPSLRTIESFDISNIAGTHSVAGMIQFLDGKPNRSQYRKFKIQPMPNMDDTASMHQVIERRYARLQQENLPLPDLILVDGGKGQIHAALAALH--SLNAAIPVAGMVKNDKHQTSALIDAMDRIHSLDRRSAGFRLLERIQNEVHRFAITFHRQQRAKSMTLSELDGIAGVGPKRRQQLLKFFKSIDSIRQATLEELQQ 566
>gi|163942251|ref|YP_001647135.1| excinuclease ABC subunit C [Bacillus weihenstephanensis KBAB4] >gi|163864448|gb|ABY45507.1| excinuclease ABC, C subunit [Bacillus weihenstephanensis KBAB4] (594 aa)
Score = 977, Expect = 1.2e-103, Identities = 225/586 (38%), Positives = 353/586 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           M+E +K+KL  +P +PGCYL KDK G VIYVGKA  L NR++ YF    D KT +L  EI D +Y+V ++  E+L+LE NLI KY PKYN+ L++   +P+I +T E+ PR+L + +  KK KG Y+GP+ N+    +E    ++R++PLRKC+ +P+K C+YY +GQCL PC+K+VT +  +  + EI  F +G  K I  +LE K  +A+EKL FE +++  +   ++    E+Q +I S   D D+ G+   +  + + +F    G L+ +   +   Y E +E  LT I ++Y   +   PK + +  S +  + +   L+++   P +G KKD+++ A  NA   ++ K+  +  ++ R + +++ L K L I+  YR+E FDNSNI  TN V AM+ + +G   K EYRK+ IK      DY+ M+EV+ RRY         +P+LII+DGGK  + A  + L+  EL   IP+ GL KDDKHKT  ++  D  E + L++ S  ++ L  IQDEVHRFAI+F+R    KS+ +++L  I  +G  R + LL+ + +L K+KEAS+ E  +  +P  VA+ I
  S:     1 MHEHLKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTGSHDGKTLRLVGEIVDFEYIVTSSNLEALILELNLIKKYDPKYNIQLKDDKTYPFIKITAEKQPRLLITRN-VKKDKGKYFGPYPNAQ-SAHETKKLLDRMYPLRKCSNMPDKVCLYYHMGQCLAPCVKEVTDEQNKEIVDEIIKFLNGGHKEIRSELETKMYEASEKLEFERAKELRDQIAHIDAIMEKQKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLTFIGQFYENSSHFKPKEIVVPGSIDS-ELVERFLEVEATQPKRGKKKDLVELANKNAKIALEEKFHLIERDEERTVKAIDNLGKQLGIETPYRIEAFDNSNIQGTNPVSAMIAFIDGKPAKKEYRKYKIKTVQGPDDYESMREVVRRRYTRALKENLPLPDLIIIDGGKGHLAATSDVLEN-ELGLYIPMAGLVKDDKHKTSHLIIGDPPEPVMLERNSQEFYLLQRIQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRKKVLLKHFGSLKKMKEASIAEFVEAGMPKNVAEMI 584
>gi|15924136|ref|NP_371670.1| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus Mu50] >gi|15926730|ref|NP_374263.1| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus N315] >gi|148267638|ref|YP_001246581.1| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus JH9] >gi|150393693|ref|YP_001316368.1| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus JH1] >gi|156979468|ref|YP_001441727.1| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus Mu3] >gi|189038098|sp|A7X172|UVRC_STAA1 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|189038119|sp|A6U0W3|UVRC_STAA2 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|189038120|sp|A5IS32|UVRC_STAA9 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|54039845|sp|P67429|UVRC_STAAN UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|54042753|sp|P67428|UVRC_STAAM UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|13700946|dbj|BAB42242.1| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus N315] >gi|14246916|dbj|BAB57308.1| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus Mu50] >gi|147740707|gb|ABQ49005.1| Excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus JH9] >gi|149946145|gb|ABR52081.1| excinuclease ABC, C subunit [Staphylococcus aureus subsp. aureus JH1] >gi|156721603|dbj|BAF78020.1| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus Mu3] (593 aa)
Score = 977, Expect = 1.3e-103, Identities = 222/586 (37%), Positives = 357/586 (60%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           ++IK+KL  +P +PGCYL KD+N  VIYVGKA  L NR++ YF    D KT +L  EI   +++V ++E ESLLLE NLI +Y+P+YN+LL++  ++P+I +TKE++PR+L +  + K+  G Y+GP+ N+     E    ++RI+P RKC+K+P+K C+YY IGQCLGPC+  V    Y    KEI DF +G+ K+I + LE++ + A+E L FE +++Y +L ++++  + +Q I+ S K   D+ G+   +  + I +F    G+++ +   +       +E   T I ++YS     LPK V++  + +K + +   +  K + P++G KKD++D A +NA   + NK+  +  +++R + ++EEL   + I+   R+E FDNSNI   + V AMV + +G  +K  YRK+ IK      DY  M+EV+ RRY         +P+LIIVDGGK  +   ++ L+  EL   IPV GL K+DKH+T  ++    +EI  L K S  ++ L  IQDEVHRFAI+F+R  + K+  ++ L  I  +G  R   LL  + ++ K+KEA++E+   I +P  VAK + +
  S:     6 QRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGAHDAKTTRLVGEIRRFEFIVTSSETESLLLELNLIKQYQPRYNILLKDDKSYPFIKITKEKYPRLLVTR-TVKQGTGKYFGPYPNA-YSAQETKKLLDRIYPYRKCDKMPDKLCLYYHIGQCLGPCVYDVDLSKYAQMTKEITDFLNGEDKTILKSLEERMLTASESLDFERAKEYRDLIQHIQNLTNKQKIMSSDKTIRDVFGYCVDKGWMCIQVFFIRQGNMIKRDTTMIPLQQTEEEEFYTFIGQFYSLNQHILPKEVHVPRNLDK-EMIQSVVDTKIVQPARGPKKDMVDLAAHNAKVSLNNKFELISRDESRTIKAIEELGTQMGIQTPIRIEAFDNSNIQGVDPVSAMVTFVDGKPDKKNYRKYKIKTVKGPDDYKSMREVVRRRYSRVLNEGLPLPDLIIVDGGKGHMNGVIDVLQN-ELGLDIPVAGLQKNDKHQTSELLYGASAEIVPLKKNSQAFYLLHRIQDEVHRFAITFHRQTRQKTGLKSILDDIDGIGNKRKTLLLRSFGSIKKMKEATLEDFKNIGIPENVAKNLHE 589
>gi|27467757|ref|NP_764394.1| excinuclease ABC subunit C [Staphylococcus epidermidis ATCC 12228] >gi|27315301|gb|AAO04436.1|AE016746_226 excinuclease ABC subunit C [Staphylococcus epidermidis ATCC 12228] (600 aa)
Score = 977, Expect = 1.3e-103, Identities = 220/585 (37%), Positives = 358/585 (61%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           ++IK+KL  +P +PGCYL KD+N  VIYVGKA  L NR++ YF    D KT +L  EI + +++V ++E ESLLLE NLI +Y+P+YN+LL++  ++P+I +TKE+HPR+L +  + KK  G Y+GP+ N+     E    ++RI+P RKC+ +P+K C+YY IGQC+GPC+  V  + Y    KEI DF +G+ K+I   LE +  +A+E+L FE +++Y ++ +++   +++Q I+ S     D+ G+   +  + + +F    G+++ +   +       +E   T I ++YS     LPK V++  + +K   +   +  K + P +G KKD+++ A +NA   + NK+  +  +++R + ++EEL + + I+   R+E FDNSNI   + V AMV + +G  +K +YRK+ IK  +   DY  M+EV+ RRY         +P+LIIVDGGK  +   ++ L+  EL   IPV GL K+DKH+T  ++    +EI  L K S  ++ L  IQDEVHRFAI+F+R  + K+  ++ L  I  +G  R   LL  + ++ K+KEAS +EL Q  +P +VAK ++
  S:    12 KKIKEKLNVVPLEPGCYLMKDRNDQVIYVGKAKRLRNRLRSYFTGAHDAKTTRLVGEIRNFEFIVTSSETESLLLELNLIKQYQPRYNILLKDDKSYPFIKITKEKHPRLLVTR-TVKKNSGKYFGPYPNA-YSAQETKKLLDRIYPFRKCDNMPDKLCLYYHIGQCMGPCVYDVDLEKYAQMTKEITDFLNGEDKTILHHLEDRMNKASEQLDFEQAKEYRDMIQHIHNLTKKQKIMSSDNTIRDVFGYSVSKGWMCVQVFFVRQGNMIKRDATMIPLQQTEEEEFYTFIGQFYSLNQHLLPKEVHVPKNLDK-DIIQSVVDTKIVQPVRGAKKDMINLANHNAEVQLDNKFELIARDESRTIKAIEELGERMGIQTPIRIEAFDNSNIQGVDPVSAMVTFVDGKPHKKDYRKYKIKTVEGPDDYKSMREVVRRRYTRVLNEGLPLPDLIIVDGGKGHMNGVMDVLEN-ELGLDIPVAGLQKNDKHQTSELLYGASAEIVPLKKNSQAFYLLHRIQDEVHRFAITFHRQTRQKTGLKSVLDDIDGIGTKRKTSLLRTFGSIKKMKEASFDELRQAGLPEKVAKNLQ 594
>gi|82750753|ref|YP_416494.1| excinuclease ABC subunit C [Staphylococcus aureus RF122] >gi|119367844|sp|Q2YXC9|UVRC_STAAB UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|82656284|emb|CAI80698.1| excinuclease ABC subunit C [Staphylococcus aureus RF122] (593 aa)
Score = 977, Expect = 1.4e-103, Identities = 222/586 (37%), Positives = 357/586 (60%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           ++IK+KL  +P +PGCYL KD+N  VIYVGKA  L NR++ YF    D KT +L  EI   +++V ++E ESLLLE NLI +Y+P+YN+LL++  ++P+I +TKE++PR+L +  + K+  G Y+GP+ N+     E    ++RI+P RKC+K+P+K C+YY IGQCLGPC+  V    Y    KEI DF +G+ K+I + LE++ + A+E L FE +++Y +L ++++  + +Q I+ S K   D+ G+   +  + I +F    G+++ +   +       +E   T I ++YS     LPK V++  + +K + +   +  K + P++G KKD++D A +NA   + NK+  +  +++R + ++EEL   + I+   R+E FDNSNI   + V AMV + +G  +K  YRK+ IK      DY  M+EV+ RRY         +P+LIIVDGGK  +   ++ L+  EL   IPV GL K+DKH+T  ++    +EI  L K S  ++ L  IQDEVHRFAI+F+R  + K+  ++ L  I  +G  R   LL  + ++ K+KEA++E+   I +P  VAK + +
  S:     6 QRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGAHDAKTTRLVGEIRRFEFIVTSSETESLLLELNLIKQYQPRYNILLKDDKSYPFIKITKEKYPRLLVTR-TVKQGTGKYFGPYPNA-YSAQETKKLLDRIYPYRKCDKMPDKLCLYYHIGQCLGPCVYDVDLSKYAQMTKEITDFLNGEDKTILKSLEERMLTASESLDFERAKEYRDLIQHIQNLTNKQKIMSSDKTIRDVFGYSVDKGWMCIQVFFIRQGNMIKRDTTMIPLQQTEEEEFYTFIGQFYSLNQHILPKEVHVPRNLDK-EMIQSVVDTKIVQPARGPKKDMVDLAAHNAKVSLNNKFELISRDESRTIKAIEELGTQMGIQTPIRIEAFDNSNIQGVDPVSAMVTFVDGKPDKKNYRKYKIKTVKGPDDYKSMREVVRRRYSRVLNEGLPLPDLIIVDGGKGHMNGVIDVLQN-ELGLDIPVAGLQKNDKHQTSELLYGASAEIVPLKKNSQAFYLLHRIQDEVHRFAITFHRQTRQKTGLKSILDDIDGIGSKRKTLLLRSFGSIKKMKEATLEDFKNIGIPENVAKNLHE 589
>gi|57650256|ref|YP_186020.1| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus COL] >gi|151221270|ref|YP_001332092.1| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus str. Newman] >gi|161353528|ref|YP_499646.2| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|161509321|ref|YP_001574980.1| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|162138564|ref|YP_493743.2| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus USA300] >gi|168727553|ref|ZP_02759830.1| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|189038121|sp|A6QG48|UVRC_STAAE UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|189038122|sp|A8Z1S8|UVRC_STAAT UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|71153397|sp|Q5HGT7|UVRC_STAAC UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|119367842|sp|Q2FHT5|UVRC_STAA3 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|119367843|sp|Q2FZD0|UVRC_STAA8 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|57284442|gb|AAW36536.1| excinuclease ABC, C subunit [Staphylococcus aureus subsp. aureus COL] >gi|150374070|dbj|BAF67330.1| uvr ABC system protein, C subunit [Staphylococcus aureus subsp. aureus str. Newman] >gi|160368130|gb|ABX29101.1| excinuclease ABC subunit UvrC [Staphylococcus aureus subsp. aureus USA300_TCH1516] (593 aa)
Score = 976, Expect = 1.7e-103, Identities = 222/586 (37%), Positives = 357/586 (60%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           ++IK+KL  +P +PGCYL KD+N  VIYVGKA  L NR++ YF    D KT +L  EI   +++V ++E ESLLLE NLI +Y+P+YN+LL++  ++P+I +TKE++PR+L +  + K+  G Y+GP+ N+     E    ++RI+P RKC+K+P+K C+YY IGQCLGPC+  V    Y    KEI DF +G+ K+I + LE++ + A+E L FE +++Y +L ++++  + +Q I+ S K   D+ G+   +  + I +F    G+++ +   +       +E   T I ++YS     LPK V++  + +K + +   +  K + P++G KKD++D A +NA   + NK+  +  +++R + ++EEL   + I+   R+E FDNSNI   + V AMV + +G  +K  YRK+ IK      DY  M+EV+ RRY         +P+LIIVDGGK  +   ++ L+  EL   IPV GL K+DKH+T  ++    +EI  L K S  ++ L  IQDEVHRFAI+F+R  + K+  ++ L  I  +G  R   LL  + ++ K+KEA++E+   I +P  VAK + +
  S:     6 QRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGAHDAKTTRLVGEIRRFEFIVTSSETESLLLELNLIKQYQPRYNILLKDDKSYPFIKITKEKYPRLLVTR-TVKQGTGKYFGPYPNA-YSAQETKKLLDRIYPYRKCDKMPDKLCLYYHIGQCLGPCVYDVDLSKYAQMTKEITDFLNGEDKTILKSLEERMLTASESLDFERAKEYRDLIQHIQNLTNKQKIMSSDKTIRDVFGYSVDKGWMCIQVFFIRQGNMIKRDTTMIPLQQTEEEEFYTFIGQFYSLNQHILPKEVHVPRNLDK-EMIQSVVDTKIVQPARGPKKDMVDLAAHNAKVSLNNKFELISRDESRTIKAIEELGTQMGIQTPIRIEAFDNSNIQGVDPVSAMVTFVDGKPDKKNYRKYKIKTVKGPDDYKSMREVVRRRYSRVLNEGLPLPDLIIVDGGKGHMNGVIDVLQN-ELGLDIPVAGLQKNDKHQTSELLYGASAEIVPLKKNSQAFYLLHRIQDEVHRFAITFHRQTRQKTGLKSILDDIDGIGNKRKTLLLRSFGSIKKMKEATLEDFKNIGIPENVAKNLHE 589
>gi|71153186|sp|Q8CPL4|UVRC_STAES UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) (594 aa)
Score = 976, Expect = 1.8e-103, Identities = 220/585 (37%), Positives = 358/585 (61%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           ++IK+KL  +P +PGCYL KD+N  VIYVGKA  L NR++ YF    D KT +L  EI + +++V ++E ESLLLE NLI +Y+P+YN+LL++  ++P+I +TKE+HPR+L +  + KK  G Y+GP+ N+     E    ++RI+P RKC+ +P+K C+YY IGQC+GPC+  V  + Y    KEI DF +G+ K+I   LE +  +A+E+L FE +++Y ++ +++   +++Q I+ S     D+ G+   +  + + +F    G+++ +   +       +E   T I ++YS     LPK V++  + +K   +   +  K + P +G KKD+++ A +NA   + NK+  +  +++R + ++EEL + + I+   R+E FDNSNI   + V AMV + +G  +K +YRK+ IK  +   DY  M+EV+ RRY         +P+LIIVDGGK  +   ++ L+  EL   IPV GL K+DKH+T  ++    +EI  L K S  ++ L  IQDEVHRFAI+F+R  + K+  ++ L  I  +G  R   LL  + ++ K+KEAS +EL Q  +P +VAK ++
  S:     6 KKIKEKLNVVPLEPGCYLMKDRNDQVIYVGKAKRLRNRLRSYFTGAHDAKTTRLVGEIRNFEFIVTSSETESLLLELNLIKQYQPRYNILLKDDKSYPFIKITKEKHPRLLVTR-TVKKNSGKYFGPYPNA-YSAQETKKLLDRIYPFRKCDNMPDKLCLYYHIGQCMGPCVYDVDLEKYAQMTKEITDFLNGEDKTILHHLEDRMNKASEQLDFEQAKEYRDMIQHIHNLTKKQKIMSSDNTIRDVFGYSVSKGWMCVQVFFVRQGNMIKRDATMIPLQQTEEEEFYTFIGQFYSLNQHLLPKEVHVPKNLDK-DIIQSVVDTKIVQPVRGAKKDMINLANHNAEVQLDNKFELIARDESRTIKAIEELGERMGIQTPIRIEAFDNSNIQGVDPVSAMVTFVDGKPHKKDYRKYKIKTVEGPDDYKSMREVVRRRYTRVLNEGLPLPDLIIVDGGKGHMNGVMDVLEN-ELGLDIPVAGLQKNDKHQTSELLYGASAEIVPLKKNSQAFYLLHRIQDEVHRFAITFHRQTRQKTGLKSVLDDIDGIGTKRKTSLLRTFGSIKKMKEASFDELRQAGLPEKVAKNLQ 588
>gi|21282758|ref|NP_645846.1| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus MW2] >gi|49485984|ref|YP_043205.1| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus MSSA476] >gi|24212605|sp|Q8NX55|UVRC_STAAW UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|56749719|sp|Q6GA68|UVRC_STAAS UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|21204196|dbj|BAB94894.1| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus MW2] >gi|49244427|emb|CAG42855.1| putative excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus MSSA476] (593 aa)
Score = 975, Expect = 2.1e-103, Identities = 222/586 (37%), Positives = 357/586 (60%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           ++IK+KL  +P +PGCYL KD+N  VIYVGKA  L NR++ YF    D KT +L  EI   +++V ++E ESLLLE NLI +Y+P+YN+LL++  ++P+I +TKE++PR+L +  + K+  G Y+GP+ N+     E    ++RI+P RKC+K+P+K C+YY IGQCLGPC+  V    Y    KEI DF +G+ K+I + LE++ + A+E L FE +++Y +L ++++  + +Q I+ S K   D+ G+   +  + I +F    G+++ +   +       +E   T I ++YS     LPK V++  + +K + +   +  K + P++G KKD++D A +NA   + NK+  +  +++R + ++EEL   + I+   R+E FDNSNI   + V AMV + +G  +K  YRK+ IK      DY  M+EV+ RRY         +P+LIIVDGGK  +   ++ L+  EL   IPV GL K+DKH+T  ++    +EI  L K S  ++ L  IQDEVHRFAI+F+R  + K+  ++ L  I  +G  R   LL  + ++ K+KEA++E+   I +P  VAK + +
  S:     6 QRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGAHDAKTTRLVGEIRRFEFIVTSSETESLLLELNLIKQYQPRYNILLKDDKSYPFIKITKEKYPRLLVTR-TVKQGTGKYFGPYPNA-YSAQETKKLLDRIYPYRKCDKMPDKLCLYYHIGQCLGPCVYDVDLSKYAQMTKEITDFLNGEDKTILKSLEERMLTASESLDFERAKEYRDLIQHIQNLTNKQKIMSSDKTIRDVFGYSVDKGWMCIQVFFIRQGNMIKRDTTMIPLQQTEEEEFYTFIGQFYSLNQHILPKEVHVPRNLDK-EMIQSVVDTKIVQPARGPKKDMVDLAAHNAKVSLNNKFELISRDESRTIKAIEELGTQMGIQTPIRIEAFDNSNIQGVDPVSAMVTFIDGKPDKKNYRKYKIKTVKGPDDYKSMREVVRRRYSRVLNEGLPLPDLIIVDGGKGHMNGVIDVLQN-ELGLDIPVAGLQKNDKHQTSELLYGASAEIVPLKKNSQAFYLLHRIQDEVHRFAITFHRQTRQKTGLKSILDDIDGIGNKRKTLLLRSFGSIKKMKEATLEDFKNIGIPENVAKNLHE 589
>gi|49483309|ref|YP_040533.1| excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus MRSA252] >gi|8134803|sp|Q9ZEH3|UVRC_STAAU UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|56749748|sp|Q6GHT9|UVRC_STAAR UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|3776112|emb|CAA11405.1| excinuclease ABC, subunit C [Staphylococcus aureus] >gi|49241438|emb|CAG40122.1| putative excinuclease ABC subunit C [Staphylococcus aureus subsp. aureus MRSA252] (593 aa)
Score = 975, Expect = 2.3e-103, Identities = 222/586 (37%), Positives = 357/586 (60%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           ++IK+KL  +P +PGCYL KD+N  VIYVGKA  L NR++ YF    D KT +L  EI   +++V ++E ESLLLE NLI +Y+P+YN+LL++  ++P+I +TKE++PR+L +  + K+  G Y+GP+ N+     E    ++RI+P RKC+K+P+K C+YY IGQCLGPC+  V    Y    KEI DF +G+ K+I + LE++ + A+E L FE +++Y +L ++++  + +Q I+ S K   D+ G+   +  + I +F    G+++ +   +       +E   T I ++YS     LPK V++  + +K + +   +  K + P++G KKD++D A +NA   + NK+  +  +++R + ++EEL   + I+   R+E FDNSNI   + V AMV + +G  +K  YRK+ IK      DY  M+EV+ RRY         +P+LIIVDGGK  +   ++ L+  EL   IPV GL K+DKH+T  ++    +EI  L K S  ++ L  IQDEVHRFAI+F+R  + K+  ++ L  I  +G  R   LL  + ++ K+KEA++E+   I +P  VAK + +
  S:     6 KRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGAHDAKTTRLVGEIRRFEFIVTSSETESLLLELNLIKQYQPRYNILLKDDKSYPFIKITKEKYPRLLVTR-TVKQGTGKYFGPYPNA-YSAQETKKLLDRIYPYRKCDKMPDKLCLYYHIGQCLGPCVYDVDLSKYAQMTKEITDFLNGEDKTILKSLEERMLTASESLDFERAKEYRDLIQHIQNLTNKQKIMSSDKTIRDVFGYSVDKGWMCIQVFFIRQGNMIKRDTTMIPLQQTEEEEFYTFIGQFYSLNQHILPKEVHVPRNLDK-EMIQSVVDTKIVQPARGPKKDMVDLAAHNAKVSLNNKFELISRDESRTIKAIEELGTQMGIQTPIRIEAFDNSNIQGVDPVSAMVTFVDGKPDKKNYRKYKIKTVKGPDDYKSMREVVRRRYSRVLNEGLPLPDLIIVDGGKGHMNGVIDVLQN-ELGLDIPVAGLQKNDKHQTSELLYGASAEIVPLKKNSQAFYLLHRIQDEVHRFAITFHRQTRQKTGLKSILDDIDGIGSKRKTLLLRSFGSIKKMKEATLEDFKNIGIPENVAKNLHE 589
>gi|57866656|ref|YP_188312.1| excinuclease ABC subunit C [Staphylococcus epidermidis RP62A] >gi|71153398|sp|Q5HQ28|UVRC_STAEQ UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|57637314|gb|AAW54102.1| excinuclease ABC, C subunit [Staphylococcus epidermidis RP62A] (594 aa)
Score = 974, Expect = 2.8e-103, Identities = 219/585 (37%), Positives = 359/585 (61%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           ++IK+KL  +P +PGCYL KD+N  VIYVGKA  L NR++ YF    D KT +L  EI + +++V ++E ESLLLE NLI +Y+P+YN+LL++  ++P+I +TKE+HPR+L +  + KK  G Y+GP+ N+     E    ++RI+P RKC+ +P+K C+YY IGQC+GPC+  V  + Y    KEI DF +G+ K+I   LE++  +A+E+L FE +++Y ++ +++   +++Q I+ S     D+ G+   +  + + +F    G+++ +   +       +E   T I ++YS     +PK V++  + +K   +   +  K + P +G KKD+++ A +NA   + NK+  +  +++R + ++EEL + + I+   R+E FDNSNI   + V AMV + +G  +K +YRK+ IK  +   DY  M+EV+ RRY         +P+LIIVDGGK  +   ++ L+  EL   IPV GL K+DKH+T  ++    +EI  L K S  ++ L  IQDEVHRFAI+F+R  + K+  ++ L  I  +G  R   LL  + ++ K+KEAS +EL Q  +P +VAK ++
  S:     6 KKIKEKLNVVPLEPGCYLMKDRNDQVIYVGKAKRLRNRLRSYFTGAHDAKTTRLVGEIRNFEFIVTSSETESLLLELNLIKQYQPRYNILLKDDKSYPFIKITKEKHPRLLVTR-TVKKNSGKYFGPYPNA-YSAQETKKLLDRIYPFRKCDNMPDKLCLYYHIGQCMGPCVYDVDLEKYAQMTKEITDFLNGEDKTILNHLEERMNKASEQLDFEQAKEYRDMIQHIHNLTKKQKIMSSDNTIRDVFGYSVSKGWMCVQVFFVRQGNMIKRDATMIPIQQTEEEEFYTFIGQFYSLNQHLIPKEVHVPKNLDK-DIIQSVVDTKIVQPVRGAKKDMINLANHNAEVQLDNKFELIARDESRTIKAIEELGERMGIQTPIRIEAFDNSNIQGVDPVSAMVTFVDGKPHKKDYRKYKIKTVEGPDDYKSMREVVRRRYTRVLNEGLPLPDLIIVDGGKGHMNGVMDVLEN-ELGLDIPVAGLQKNDKHQTSELLYGASAEIVPLKKNSQAFYLLHRIQDEVHRFAITFHRQTRQKTGLKSVLDDIDGIGTKRKTSLLRTFGSIKKMKEASFDELRQAGLPEKVAKNLQ 588
>gi|168140499|ref|ZP_02583728.1| excinuclease ABC subunit C [Bacillus cereus G9842] (594 aa)
Score = 973, Expect = 4.4e-103, Identities = 225/586 (38%), Positives = 352/586 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           M+E +K+KL  +P +PGCYL KDK G VIYVGKA  L NR++ YF    D KT +L  EI D +Y+V ++  E+L+LE NLI KY PKYN+ L++   +P+I +T E+ PR+L + +  KK KG Y+GP+ N+    +E    ++R++PLRKC  +P+K C+YY + QCL PC+K+VT +  +  + EI  F +G  K +  +LE K  +A+EKL FE +++  +   ++    E+Q +I S   D D+ G+   +  + + +F    G L+ +   +   Y E +E  LT I ++Y   +   PK + +  S +  + +   L+++   P +G KKD+++ A  NA   ++ K+  +  ++ R + +++ L K L I+  YR+E FDNSNI  TN V AM+ + +G   K EYRK+ IK      DY+ M+EV+ RRY         +P+LII+DGGK  + AA + L+  EL   IP+ GL KDDKHKT  ++  D  E + L++ S  ++ L  IQDEVHRFAI+F+R    KS+ +++L  I  +G  R + LL+ + +L K+KEASV E  +  +P  VA+ I
  S:     1 MHEHLKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTGSHDGKTLRLVGEIVDFEYIVTSSNLEALILELNLIKKYDPKYNIQLKDDKTYPFIKITAEKQPRLLITRN-VKKDKGKYFGPYPNAQ-SAHETKKLLDRMYPLRKCTNMPDKVCLYYHMDQCLAPCVKEVTEEQNKEIVDEIIKFLNGGHKEVRSELEIKMYEASEKLEFERAKELRDQIAHIDAIMEKQKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLTFIGQFYENSSHFKPKEIVVPGSIDS-ELVERFLEVEATQPKRGKKKDLVELANKNAKIALEEKFYLIERDEERTIKAVDHLGKQLGIETPYRIEAFDNSNIQGTNPVSAMIAFIDGKPAKKEYRKYKIKTVQGPDDYESMREVVRRRYTRALKENLPLPDLIIIDGGKGHLAAASDILED-ELGLYIPMAGLVKDDKHKTSHLIIGDPPEPVVLERNSQEFYLLQRIQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRKKVLLKHFGSLKKMKEASVAEFVEAGMPKNVAETI 584
>gi|15615659|ref|NP_243963.1| excinuclease ABC subunit C [Bacillus halodurans C-125] >gi|20140835|sp|Q9K8A9|UVRC_BACHD UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|10175719|dbj|BAB06816.1| excinuclease ABC (subunit C) [Bacillus halodurans C-125] (591 aa)
Score = 973, Expect = 4.4e-103, Identities = 223/586 (38%), Positives = 355/586 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEE-LSQIVPIEVAKEI 586
           M + IK KL  +P +PGCYL KD+ G +IYVGKA  L NR++ YF    D KT++L  EI D +Y+V ++  E+L+LE NLI K+ PKYN++L++  ++PY+ +T EEHPR++ +    KK  G Y+GP+ N+     E    ++R++PLRKC  LP+K C+YY IGQCL PC+ +VT +  E  ++EI  F     K +  +LEKK  +AAE+L FE +++  +    ++   E+Q ++ + + D D+ G+   +  + + +F    G L+ +   I  FY E +E  LT I ++Y +     P  V L    +    + + L +    P +G KK+++D A  NA   +K K+  +  N+ R + ++E+L + + I   YR+E FDNSNI  T+ V AMV + +G  NK EYRK+ IK      DY+ M+EV+ RRY         +P+LI++DGGK Q+ AA E L   EL   IPV GLAKD+KH+T +++  D  + + L + S  ++ L  IQDEVHRFA++F+R  +SK+ F++ L  +  +G+ R  +LL+ + ++ K+KEAS+++ L+  +P  VA+ +
  S:     1 MKDHIKQKLTVLPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSYFTGSHDAKTQRLVGEIADFEYIVTSSNIEALILEMNLIKKHDPKYNVMLKDDKSYPYLKLTNEEHPRLVTTR-KLKKDGGKYFGPYPNAGAAN-ETKKLLDRLYPLRKCRTLPDKVCLYYHIGQCLAPCVYEVTPEQNEQMVQEITRFLKYGHKEVKVELEKKMHKAAEELNFERAKELRDTLGYMEAVMEKQTMMVNDRVDRDVFGYAYDKGWMCVQVFFVRQGKLIERDVSIFPFYKEAEEDFLTFIGQFYLQKDHIKPGEVLLPAGTDA-ALVEQLLDVSVHIPKRGKKKELVDVAMRNATMALKEKFALIERNEERTIKAVEQLGEAMGIPTPYRIEAFDNSNIQGTDPVSAMVAFIDGKPNKKEYRKYKIKTVTGPDDYESMREVVRRRYVRLLKEQRSLPDLIVIDGGKGQIAAAQEILHD-ELGLSIPVCGLAKDEKHRTSQLLLGDPPQVVPLKRDSHEFYLLQRIQDEVHRFALTFHRQTRSKTFFQSVLDDVPGIGEKRKRQLLKHFGSVKKMKEASIDDFLALSIPKSVAETL 584
>gi|29898156|gb|AAP11430.1| Excinuclease ABC subunit C [Bacillus cereus ATCC 14579] (590 aa)
Score = 972, Expect = 5.7e-103, Identities = 224/582 (38%), Positives = 350/582 (60%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           +K+KL   P +PGCYL KDK G VIYVGKA  L NR++ YF    D KT +L  EI D +Y+V ++  E+L+LE NLI KY PKYN+ L++   +P+I +T E+ PR+L + +  KK KG Y+GP+ N+    +E    ++R++PLRKC  +P+K C+YY +GQCL PC+K+VT +  +  + EI  F +G  K +  +LE K  +A+EKL FE +++  +   ++    E+Q +I S   D D+ G+   +  + + +F    G L+ +   +   Y E +E  LT I ++Y   +   PK + +  S +  + +   L+++   P +G KKD+++ A  NA   ++ K+  +  ++ R + +++ L K L I+  YR+E FDNSNI  TN V AM+ + +G   K EYRK+ IK      DY+ M+EV+ RRY         +P+LII+DGGK  + AA + L+  EL   IP+ GL KDDKHKT  ++  D  E + L++ S  ++ L  IQDEVHRFAI+F+R    KS+ +++L  I  +G  R + LL+ + +L K+KEAS+EE  +  +P  VA+ I
  S:     1 MKEKLAISPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTGSHDGKTLRLVGEIVDFEYIVTSSNLEALILELNLIKKYDPKYNIQLKDDKTYPFIKITAEKQPRLLITRN-VKKDKGKYFGPYPNAQ-SAHETKKLLDRMYPLRKCTNMPDKVCLYYHMGQCLAPCVKEVTEEQNKEIVDEIIKFLNGGHKEVRSELEIKMYEASEKLEFERAKELRDQIAHIDAIMEKQKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLTFIGQFYENSSHFKPKEIVVPGSIDS-ELVERFLEVEATQPKRGKKKDLVELANKNAKIALEEKFYLIERDEERTIKAVDHLGKQLGIETPYRIEAFDNSNIQGTNPVSAMIAFIDGKPAKKEYRKYKIKTVQGPDDYESMREVVRRRYTRALKENSPLPDLIIIDGGKGHLAAASDILEN-ELGLYIPMAGLVKDDKHKTSHLIIGDPPEPVMLERNSQEFYLLQRIQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRKKVLLKHFGSLKKMKEASIEEFVEAGMPKNVAETI 580
>gi|23099571|ref|NP_693037.1| excinuclease ABC subunit C [Oceanobacillus iheyensis HTE831] >gi|32130294|sp|Q8CXB4|UVRC_OCEIH UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|22777801|dbj|BAC14072.1| excinuclease ABC subunit C (deoxyribodipyrimidine photolyase) [Oceanobacillus iheyensis HTE831] (596 aa)
Score = 970, Expect = 8.1e-103, Identities = 224/584 (38%), Positives = 365/584 (62%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLIS-NQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI--KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAK 584
           MNE I+ KL  +P +PGCYL KDKNG VIYVGK+  L NR++ YF    D KT++L  EI D +Y+V ++E E+L+LE NLI KY P+YN++L++  ++PY+ +T E HPR++ +    KK KG Y+GP+ N  I   E    ++R++PLRKCN    + C+YY +GQC        + ++Y+  ++EI+ F  G  K I + L  +  +A+E L FE +++  +  +++    E+Q +  + + D DI G+   +  + + +F    G L+ +   +  F+   +E +++ I  +Y       PK V + +  +  + L++ L+I+   P +G KK+++  A  NA EI  N+  QLI  ++ R + ++E+L + L+I+  +R+E FDNSNI  T+ V AM+V+E+G  NK EYRK+ I+D     DYD M+EV+ RRY         +P+LIIVDGGK Q+ AALE L+  EL   IP+ GLAKDD+HKT  ++ +    I   L+++S  ++ +  IQDEVHRFAI+F+R  + KSLF++ L KI  +G+ R + LL  ++++++IK+AS+E++ ++ +P  +A+
  S:     1 MNENIEKKLSILPQQPGCYLMKDKNGTVIYVGKSKKLRNRVRSYFRGANDRKTQRLVQEIRDFEYMVTSSEIEALILEMNLIKKYDPRYNVMLKDDKSYPYLKITSERHPRLIVTR-RLKKDKGKYFGPYPNV-IAARETKKLLDRMYPLRKCNNPSGRPCLYYHMGQCKACAENPPSVKEYQEIVQEISSFLQGGFKDIRKNLAGEMQKASEALNFERAKEIRDTIQHIDATMEQQKMTLTDQMDRDIFGYSYDKGWMCVQVFFIRQGKLIERDTSVFPFFDSPEETIVSFIGRFYLHENHLKPKQVLVPVGIDN-ELLAKVLEIQVHIPLRGRKKELVQLAVKNA-EISLNEKFQLIEKDEERTIQAIEDLGEQLNIETPHRIEAFDNSNIQGTDPVSAMIVFEDGKPNKKEYRKYKIRDVKGPDDYDTMREVVRRRYSRVLKENLPLPDLIIVDGGKGQMSAALEVLED-ELGLDIPLAGLAKDDRHKTSELL-YGMPPIVVPLERQSQAFYLVQRIQDEVHRFAITFHRQLRGKSLFQSELDKIPGVGEKRRKLLLSHFKSINQIKKASIEDMRKLGIPSNIAE 582
>gi|126652659|ref|ZP_01724820.1| excinuclease ABC subunit C [Bacillus sp. B14905] >gi|126590508|gb|EAZ84626.1| excinuclease ABC subunit C [Bacillus sp. B14905] (596 aa)
Score = 965, Expect = 3.3e-102, Identities = 219/586 (37%), Positives = 353/586 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQ-NRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           MN+ IK KL  +P +PGCYL KD+ G +IYVGKA  L NR++ YF    + KT++L +EI D +Y+V ++  E+L+LE NLI  + PKYN++L +   +PY+ +T E+HPR++ +    KK K  Y+GP+ N+     E    ++R++PLRKC +LP+K C+YY +GQC+ PC+K++    Y+  ++++  F +G  +++ ++LE K + AAE L FE ++++ +   ++    ++Q I+ S   + DI G+  ++  + + +F    G L+ +   I   Y + +E  LT +  +Y K     PK V++  + +    L+E L IK L P +G KK+++D A  NA EI  +   QLI  Q  R + + E L   + I    R+E FDNS++  T+ V AMVV+ +G   K EYRK+  +    + DY  M+EVI RRY         +P+L+++DGGK Q++ A E L+  EL  +IP+ GLAKDDKH T +++  D  E I L + SD ++ L  IQDEVHRFAI+F R +  K   ++ L +I+ +G  R ++LL+ + ++ KI+EAS   L +  +P  +A  I
  S:     1 MNDLIKRKLDILPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSYFTGTHEGKTQRLVSEIEDFEYIVTSSNIEALILELNLIKLHDPKYNVMLTDDKTYPYLKITNEKHPRLITTR-KVKKDKAKYFGPYPNAYAAS-ETKKLLDRLYPLRKCVQLPSKVCLYYHMGQCIAPCVKQIDGHVYQEMIEDMTKFLNGGVEAVKKELEIKMLAAAENLEFERAKEFRDQIAHIDTVMQKQKIVSSDTTNRDIFGYAVEKGWMCVQVFFVRQGKLIERDVSIFPIYQDAEEEFLTFVGRFYEKPEHIKPKEVFIPQAIDG-AILTELLGIKVLTPKRGQKKELVDLATKNA-EIAVSAKFQLIERQEERTIGACEALGDAMGITTPLRIEAFDNSHMHGTDAVSAMVVFIDGKPAKKEYRKYKTRTAAKHDDYGAMQEVIRRRYIRVLKEGLPLPDLVLIDGGKGQMEVAREVLED-ELGLVIPIAGLAKDDKHNTSQLLFGDPPEVIALKRTSDGFYLLQRIQDEVHRFAITFLRQQHEKHAIQSVLDQIEGVGPKRKQQLLKHFGSVKKIREASELALQEAGMPANLANHI 584
>gi|152976918|ref|YP_001376435.1| excinuclease ABC subunit C [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152025670|gb|ABS23440.1| excinuclease ABC, C subunit [Bacillus cereus subsp. cytotoxis NVH 391-98] (596 aa)
Score = 964, Expect = 4.5e-102, Identities = 220/586 (37%), Positives = 351/586 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           ++E +K+KL  +P +PGCYL KDK G VIYVGKA  L NR++ YF    D KT +L  EI D +Y+V ++  E+L+LE NLI KY P+YNM L++   +P+I +T E+ PR+L +    KK KG Y+GP+ NS    +E    ++R++PLRKC K+P+K C+YY +GQCL PC+ +VT +  +  + +I  F +G  K I  +LE K  +A+EKL FE +++  +   ++    E+Q +I +   D D+ G+   +  + + +F    G L+ +   +   Y E +E  LT I ++Y +     PK + +  S +  + +   L++    P +G KK++++ A  NA   ++ K+  +  ++ R + ++E L + L I   YR+E FDNSNI   N V AM+V+ +G   K EYRK+ IK      DY+ M+EV+ RRY         +P+LI++DGGK  + AA + L+  EL   IP+ GL KD+KH+T  ++  D  + + L++ S  ++ L  IQDEVHRFAI+F+R    KS+ +++L  I  +G+ R + LL+ + +L K+KEASV E  +  +P  VA+ I
  S:     3 VHEHLKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTGSHDGKTLRLVGEIADFEYIVTSSNLEALILELNLIKKYDPRYNMKLKDDKTYPFIKITGEKQPRLLITR-KVKKDKGKYFGPYPNSQ-SAHETKKLLDRMYPLRKCTKMPDKVCLYYHMGQCLAPCVNEVTDEQNKEIVDKITKFLNGGHKEIRSELEAKMYEASEKLEFERAKELRDQIAHMDAIMEKQKMIMNDIVDRDVFGYAVDKGWMCVQVFFIRKGKLIERDVSMFPIYDEPEEGFLTFIGQFYEQNNHFKPKEIAVPGSIDP-ELVERFLEVDVTQPKRGKKKELVELANKNAKIALEEKFYLIERDEERTVKAIENLGERLGIDTPYRIEAFDNSNIQGVNPVSAMIVFIDGKPAKKEYRKYKIKTVQGPDDYESMREVVRRRYTRALKEGLPLPDLIVIDGGKGHLAAASDVLEN-ELGLYIPIAGLVKDEKHRTSHLIIGDPPDPVILERNSQEFYLLQRIQDEVHRFAITFHRQLHGKSVIQSALDGIPGVGEKRKKVLLKHFGSLKKMKEASVGEFVEAGIPQHVAETI 586
>gi|29375973|ref|NP_815127.1| excinuclease ABC subunit C [Enterococcus faecalis V583] >gi|81585291|sp|Q835H1|UVRC_ENTFA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|29343435|gb|AAO81197.1| excinuclease ABC, subunit C [Enterococcus faecalis V583] (598 aa)
Score = 962, Expect = 7.0e-102, Identities = 229/588 (38%), Positives = 342/588 (58%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIV-KWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MNE+IK+KL  +P +PGCYL KDKNG +IYVGKA  L NR++ YF    D KT++L +EI D +Y+V  +  E+LLLE NLI K  PKYN++L++   +P+I +T E++PR++ +    K  K  Y+GP+ + N    E    ++R+FPLRKCN      C+YY +GQCL P    V  Q Y+  ++EI  F SG    I ++L++K   AA  + FE + ++ +  K ++    RQ +      D D+ G+   +  + + +F    G L+ +   I  FY +  E  LT I ++Y +    +PK V +   D   +++   L  K L P +G KK ++  A  NA   +  K+  ++  Q R + ++E+L   ++I    R+E FDNSNI  TN V AMVV+ +G   KNEYRK+ IK      DY  M+EVIYRRY          P+LI++DGGK QV  A + L   +L   IPV GLAK+DKHKT  ++   +   + L++ S  +F L  IQDEVHRFAI+F+R  +SK+ F + L  I+ LG  R + LL+++++L  I  ASVEEL +  +P  VAK + +
  S:     1 MNERIKNKLALLPDQPGCYLMKDKNGTIIYVGKAKILKNRVRSYFRGSHDTKTERLVSEIDDFEYIVTESNIEALLLEINLIHKNNPKYNIMLKDDKTYPFIKITNEKYPRLMITRKVLKD-KALYFGPYPDVNAAN-ETKKLLDRLFPLRKCNPSQKTPCLYYHLGQCLCPYAFDVDPQVYKDMVEEIKGFLSGGHTEIQDRLQEKMAYAAAHMEFEKAAEFRDQIKAIETVMTRQKMTNVDLIDRDVFGYAVDKGWMCVQVFFVRQGKLIERDVSIFPFYDDASEAFLTFIGQFYQENEHFVPKEVLIP-DDIDKESVEALLATKVLQPQRGEKKKLVKLASKNAAVALNEKFDLIVRKQERTIGAVEKLGNAMNIPAPIRIEAFDNSNIMGTNPVSAMVVFIDGRPAKNEYRKYKIKTVQGPDDYASMREVIYRRYSRVLKEGLPFPDLILIDGGKGQVDVAKDVLAN-QLGVDIPVAGLAKNDKHKTSELLFGPNLEVVPLERNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFASKLDNIEGLGPKRKKNLLKEFKSLKNITAASVEELRKAGLPETVAKNVYR 586
>gi|169829497|ref|YP_001699655.1| excinuclease ABC subunit C [Lysinibacillus sphaericus C3-41] >gi|168993985|gb|ACA41525.1| UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) [Lysinibacillus sphaericus C3-41] (596 aa)
Score = 961, Expect = 9.0e-102, Identities = 218/586 (37%), Positives = 352/586 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQ-NRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           MN+ IK KL  +P +PGCYL KD+ G +IYVGKA  L NR++ YF    + KT++L +EI D +Y+V ++  E+L+LE NLI  + PKYN++L +   +PY+ +T E+HPR++ +    KK K  Y+GP+ N+     E    ++R++PLRKC +LP+K C+YY +GQC+ PC+K++    Y+  ++++  F +G  +++ ++LE K + AAE L FE ++++ +   ++    ++Q I+ S   + D+ G+  ++  + + +F    G L+ +   I   Y + +E  LT +  +Y K     PK V++  + +    L+E L IK L P +G KK+++D A  NA EI      QLI  Q  R + + E L   + I    R+E FDNS++  T+ V AMVV+ +G   K EYRK+  +    + DY  M+EVI RRY         +P+L+++DGGK Q++ A E L+  EL  +IP+ GLAKDDKH T +++  D  E I L + SD ++ L  IQDEVHRFAI+F R +  K   ++ L +I+ +G  R ++LL+ + ++ KI+EAS   L +  +P  +A  I
  S:     1 MNDLIKRKLDILPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSYFTGTHEGKTQRLVSEIEDFEYIVTSSNIEALILELNLIKLHDPKYNVMLTDDKTYPYLKITNEKHPRLITTR-KVKKDKAKYFGPYPNAYAAS-ETKKLLDRLYPLRKCVQLPSKVCLYYHMGQCIAPCVKEIEGHVYQEMIEDMTKFLNGGVEAVKKELEVKMLAAAENLEFERAKEFRDQIAHIDTVMQKQKIVSSDTTNRDVFGYAVEKGWMCVQVFFVRQGKLIERDVSIFPIYQDPEEEFLTFVGRFYEKPEHIKPKEVFIPQAIDG-AILTELLGIKVLTPKRGQKKELVDLATKNA-EIAVAAKFQLIERQEERTIGACEALGDAMGITTPLRIEAFDNSHMHGTDAVSAMVVFIDGKPAKKEYRKYKTRTAAKHDDYGAMQEVIRRRYIRVLKEGLPLPDLVLIDGGKGQMEVAREVLED-ELGLVIPIAGLAKDDKHNTSQLLFGDPPEVIALKRTSDGFYLLQRIQDEVHRFAITFLRQQHEKHAIQSVLDQIEGVGPKRKQQLLKHFGSVKKIREASELALQEAGMPANLASHI 584
>gi|16079901|ref|NP_390727.1| excinuclease ABC subunit C [Bacillus subtilis subsp. subtilis str. 168] >gi|137192|sp|P14951|UVRC_BACSU UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|142521|gb|AAA87316.1| deoxyribodipyrimidine photolyase >gi|1770045|emb|CAA99578.1| deoxyribodipyrimidine photolyase [Bacillus subtilis] >gi|2635314|emb|CAB14809.1| excinuclease ABC (subunit C) [Bacillus subtilis subsp. subtilis str. 168] (598 aa)
Score = 959, Expect = 1.5e-101, Identities = 216/576 (37%), Positives = 351/576 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIK-LDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQ 576
           MN+Q+K+KL  +P +PGCYL KD+   VIYVGKA  L NR++ YF    D KT++L  EI D +Y+V ++  E+L+LE NLI K+ PKYN++L++   +P+I +T E HPR++ + +  KK KG Y+GP+ N    + E    ++R++PLRKC+KLP++ C+YY +GQCL PC+K ++ +     ++ I  F  G    + ++LE+K  +AAE L FE +++  +   +++   E+Q +  +   D D+  +   +  + + +F    G L+ +   +   Y E DE  LT I ++YSK    LPK + +  S ++   + + L+     P KG KK+++  A  NA   +K K+  +  ++ R + ++++L + L+I   +R+  FDNSNI  TN V AM+V+ +G   K EYRK+ IK      DY  M+EV+ RRY         +P+LII+DGGK Q+ AA + ++  EL   IP+ GLAKD+KH+T  ++  D  E+  L++ S  ++ L  IQDEVHRFAISF+R  + KS F++ L  I  +G+ R + LL+ + ++ K+KEAS+E++ +
  S:     1 MNKQLKEKLALLPDQPGCYLMKDRQQTVIYVGKAKVLKNRVRSYFTGSHDAKTQRLVTEIEDFEYIVTSSNLEALILEMNLIKKHDPKYNVMLKDDKTYPFIKLTHERHPRLIVTRN-VKKDKGRYFGPYPNVQAAR-ETKKLLDRLYPLRKCSKLPDRVCLYYHLGQCLAPCVKDISEETNRELVESITRFLRGGYNEVKKELEEKMHEAAENLEFERAKELRDQIAHIESTMEKQKMTMNDLVDRDVFAYAYDKGWMCVQVFFIRQGKLIERDVSMFPLYQEADEEFLTFIGQFYSKNNHFLPKEILVPDSIDQ-SMIEQLLETNVHQPKKGPKKELLMLAHKNAKIALKEKFSLIERDEERSIGAVQKLGEALNIYTPHRIVAFDNSNIQGTNPVSAMIVFIDGKPYKKEYRKYKIKTVTGPDDYGSMREVVRRRYTRVLRENLPLPDLIIIDGGKGQINAARDVIEN-ELGLDIPIAGLAKDEKHRTSNLLIGDPLEVAYLERNSQEFYLLQRIQDEVHRFAISFHRQIRGKSAFQSVLDDIPGIGEKRKKMLLKHFGSVKKMKEASLEDIKK 573
>gi|153166589|ref|ZP_01927129.1| excinuclease ABC, C subunit [Listeria monocytogenes FSL N1-017] >gi|133727516|gb|EBA29214.1| excinuclease ABC, C subunit [Listeria monocytogenes FSL N1-017] (573 aa)
Score = 957, Expect = 2.9e-101, Identities = 217/568 (38%), Positives = 341/568 (60%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEA 569
           +E I++KL  +P +PGCYL KD+ G +IYVGKA  L NR++ YF    D KT++L  EI D +Y+V ++  E+LLLE NLI K+ P++N+ L++   +P+I +T E HPR++ +    KK KG Y+GP+ N      E+   ++R++PLRKC+ LPNK C+YY +GQCL PC+  V    Y+    EI  F +G  K++   L KK  +AAE + FE + ++ +    ++   E+Q +  +   D D+ G+   +  + + +F    G L+ +      FY++ DE  LT I ++Y K     PK +YL   +  E ++ +    KI  + P +G KKD++  A+ NA   +  K++ L  N+ R + ++E L + + I    R+E FDNSNI  T+ V AMV + +G  +KN+YRK+ IK  +   DY  M+EVI RRY         +P+LI++DGGK Q+ +A + L   EL   IPV GLAKDDKH+T +++  D  EI  L++ S  ++ L  +QDEVHRFAI+F+R  +SK+ F++ L  I  +G  R +KLL+ + ++ K+K +
  S:     3 SEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYFSGTHDSKTQRLVQEIVDFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKITNERHPRLIITR-QVKKDKGKYFGPYPNVYAAN-EVKRILDRLYPLRKCSTLPNKVCLYYHLGQCLAPCVFDVEASKYKEMQDEIVAFLNGGYKTVKNDLMKKMQEAAENMEFEKAGEFRDQINAIETTMEKQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFYNDADEDFLTFIGQFYQKANHIPPKEIYLPDDVDSEAVQAVVPDTKI--IVPQRGNKKDLVKLAYKNAKIALNEKFMLLERNEERTVGAVERLGEAMGIPTPSRVEAFDNSNIHGTDPVSAMVTFLDGKPSKNDYRKYKIKTVEGPDDYATMREVIRRRYWRVLKEELPMPDLILIDGGKGQIDSAKDVLTN-ELGLDIPVAGLAKDDKHRTSQLLFGDPLEIVPLERNSQEFYLLQRMQDEVHRFAITFHRQLRSKTGFQSILDGIPGVGPGRKKKLLKHFGSMKKLKRS 568
>gi|168490496|ref|ZP_02714639.1| excinuclease ABC, C subunit [Streptococcus pneumoniae CDC0288-04] >gi|183574918|gb|EDT95446.1| excinuclease ABC, C subunit [Streptococcus pneumoniae CDC0288-04] (614 aa)
Score = 946, Expect = 5.2e-100, Identities = 217/588 (36%), Positives = 351/588 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MN  IK KL+ +P  PGCY+ KDKNG +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI + KPKYN++L++  ++P+I +T E +PR++ +    KK  G Y+GP+ +      E+   ++RIFP RKC   P+K C YY IGQC+   I K     ++   +E++DF  G+   I ++L+ K + AA+ + FE + +Y +L + +     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  ++++ DE  LT + ++Y + +  +P  V +   + +E +K L ++   K L P +G KK +++ A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRK+ IK      DY  M+EVI RRY          P+LI++DGG+ QV  A + ++  EL   IP+ GL K+DKH+T  ++  D  E + L + S  +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L++ +++L KIKEASV+E+ ++ VP  VA+ +++
  S:     1 MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFRGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKITNERYPRLIITR-QVKKDGGLYFGPYPDVGAAN-EIKRLLDRIFPFRKCTNPPSKVCFYYHIGQCMAHTICKKDEAYFKSMAQEVSDFLKGQDNKIIDELKGKMVAAAQTMEFERAAEYRDLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFNDPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDT---KILKPQRGEKKQLVNLAIKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMVVFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQVNIAKQVIQ-EELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMKHFKSLTKIKEASVDEIVEVGVPRVVAEAVQR 586
>gi|169832456|ref|YP_001694096.1| excinuclease ABC, C subunit [Streptococcus pneumoniae Hungary19A-6] >gi|168994958|gb|ACA35570.1| excinuclease ABC, C subunit [Streptococcus pneumoniae Hungary19A-6] (615 aa)
Score = 945, Expect = 6.6e-100, Identities = 217/588 (36%), Positives = 352/588 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MN  IK KL+ +P  PGCY+ KDKNG +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI + KPKYN++L++  ++P+I +T E +PR++ +    KK  G Y+GP+ +      E+   ++RIFP RKC   P+K C YY IGQC+   I K     ++   +E++DF  G+   I ++L+ K   AA+ + FE + +Y +L + +     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  ++++ DE  LT + ++Y + +  +P  V +   + +E +K L +S   K L P +G KK +++ A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRK+ IK      DY  M+EVI RRY          P+LI++DGG+ QV  A + ++  EL   IP+ GL K+DKH+T  ++  D  E ++L + S  +F L  IQDEVHRFAI+F+R  +SK+ F + L  I+ LG  R + L++ +++L KIKEASV+++ ++ VP  VA+ +++
  S:     1 MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFRGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKITNERYPRLIITR-QVKKDGGLYFGPYPDVGAAN-EIKRLLDRIFPFRKCTNPPSKVCFYYHIGQCMAHTICKKDEAYFKSMAQEVSDFLKGQDNKIIDELKGKMAAAAQTMEFERAAEYRDLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFNDPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDS---KILKPQRGEKKQLVNLAIKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMVVFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQVHIAKQVIQ-EELGLDIPIAGLQKNDKHQTHELLFGDPLEVVELSRNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSQLDGIEGLGPKRKQNLMKHFKSLTKIKEASVDDIVEVGVPRAVAEAVQR 586
>gi|149010764|ref|ZP_01832135.1| excinuclease ABC subunit C [Streptococcus pneumoniae SP19-BS75] >gi|147765245|gb|EDK72174.1| excinuclease ABC subunit C [Streptococcus pneumoniae SP19-BS75] (614 aa)
Score = 943, Expect = 1.2e-99, Identities = 217/588 (36%), Positives = 350/588 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MN  IK KL+ +P  PGCY+ KDKNG +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI + KPKYN++L++  ++P+I +T E +PR++ +    KK  G Y+GP+ +      E+   ++RIFP RKC   P+K C YY IGQC+   I K     ++   +E++DF  G+   I ++L+ K   AA+ + FE + +Y +L + +     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  ++++ DE  LT + ++Y + +  +P  V +   + +E +K L ++   K L P +G KK +++ A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRK+ IK      DY  M+EVI RRY          P+LI++DGG+ QV  A + ++  EL   IP+ GL K+DKH+T  ++  D  E + L + S  +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L++ +++L KIKEASV+E+ ++ VP  VA+ +++
  S:     1 MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFRGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKITNERYPRLIITR-QVKKDGGLYFGPYPDVGAAN-EIKRLLDRIFPFRKCTNPPSKVCFYYHIGQCMAHTICKKDETYFKSMAQEVSDFLKGQDNKIIDELKGKMAAAAQTMEFERAAEYRDLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFNDPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDT---KILKPQRGEKKQLVNLAIKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMVVFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQVNIAKQVIQ-EELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMKHFKSLTKIKEASVDEIVEVGVPRVVAEAVQR 586
>gi|168485730|ref|ZP_02710238.1| excinuclease ABC, C subunit [Streptococcus pneumoniae CDC1087-00] >gi|183571093|gb|EDT91621.1| excinuclease ABC, C subunit [Streptococcus pneumoniae CDC1087-00] (614 aa)
Score = 941, Expect = 1.8e-99, Identities = 218/588 (37%), Positives = 348/588 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MN  IK KL+ +P  PGCY+ KDKNG +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI + KPKYN++L++  ++P+I +T E +PR++ +    KK  G Y+GP+ +      E+   ++RIFP RKC   P+K C YY IGQC+   I K     ++   +E++DF  G+   I + L+ K   AA+ + FE + +Y +L + +     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  ++++ DE  LT + ++Y + +  +P  V +   + +E +K L +S   K L P +G KK +++ A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRK+ IK      DY  M+EVI RRY          P+LI++DGG+ QV  A + ++  EL   IP+ GL K+DKH+T  ++  D  E + L + S  +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L+  +++L KIKEASV+E+ ++ VP  VA+ +++
  S:     1 MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFRGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKITNERYPRLIITR-QVKKDGGLYFGPYPDVGAAN-EIKRLLDRIFPFRKCTNPPSKVCFYYHIGQCMAHTICKKDEAYFKSMAQEVSDFLKGQDDKIIDDLKSKMAVAAQSMEFERAAEYRDLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFNDPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDS---KILKPQRGEKKQLVNLAIKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMVVFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQVNIAKQVIQ-EELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMRHFKSLTKIKEASVDEIVEVGVPRVVAEAVQR 586
>gi|194398570|ref|YP_002037276.1| excinuclease ABC, C subunit [Streptococcus pneumoniae G54] >gi|194358237|gb|ACF56685.1| excinuclease ABC, C subunit [Streptococcus pneumoniae G54] (615 aa)
Score = 940, Expect = 2.3e-99, Identities = 218/587 (37%), Positives = 348/587 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           MN  IK KL+ +P  PGCY+ KDKNG +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI + KPKYN++L++  ++P+I +T E +PR++ +    KK  G Y+GP+ +      E+   ++RIFP RKC   P+K C YY IGQC+   I K     ++   +E++DF  G+   I ++L+ K   AA+ + FE + +Y +L + +     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  ++++ DE  LT + ++Y + +  +P  V +   + +E +K L +S   K L P +G KK +++ A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRK+ IK      DY  M+EVI RRY          P+LI++DGG+ QV  A + ++  EL   IP+ GL K+DKH+T  ++  D  E + L + S  +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L+  +++L KIKEASV+E+ ++ VP  VA+ ++
  S:     1 MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFRGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKITNERYPRLIITR-QVKKDGGLYFGPYPDVGAAN-EIKRLLDRIFPFRKCTNPPSKVCFYYHIGQCMAHTICKKDEAYFKSMAQEVSDFLKGQDNKIIDELKGKMAAAAQTMEFERAAEYRDLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFNDPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDS---KILKPQRGEKKQLVNLAIKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMVVFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQVNIAKQVIQ-EELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMRHFKSLTKIKEASVDEIVEVGVPRAVAEAVQ 585
>gi|149021578|ref|ZP_01835633.1| excinuclease ABC subunit C [Streptococcus pneumoniae SP23-BS72] >gi|147930274|gb|EDK81259.1| excinuclease ABC subunit C [Streptococcus pneumoniae SP23-BS72] (614 aa)
Score = 940, Expect = 2.5e-99, Identities = 218/588 (37%), Positives = 349/588 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MN  IK KL+ +P  PGCY+ KDKNG +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI + KPKYN++L++  ++P+I +T E +PR++ +    KK  G Y+GP+ +      E+   ++RIFP RKC   P+K C YY IGQC+   I K     ++   +E++DF  G+   I + L+ K   AA+ + FE + +Y +L + +     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  ++++ DE  LT + ++Y + +  +P  V +   + +E +K L +S   K L P +G KK +++ A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRK+ IK      DY  M+EVI RRY          P+LI++DGG+ QV  A + ++  EL   IP+ GL K+DKH+T  ++  D  E + L + S  +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L++ +++L KIKEASV+E+ ++ VP  VA+ +++
  S:     1 MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFRGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKITNERYPRLIITR-QVKKDGGLYFGPYPDVGAAN-EIKRLLDRIFPFRKCTNPPSKVCFYYHIGQCMAHTICKKDETYFKSMAQEVSDFLKGQDNKIIDDLKSKMAVAAQSMEFERAAEYRDLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFNDPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDS---KILKPQRGEKKQLVNLAIKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMVVFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQVNIAKQVIQ-EELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMKHFKSLTKIKEASVDEIVEVGVPRVVAEAVQR 586
>gi|15900526|ref|NP_345130.1| excinuclease ABC subunit C [Streptococcus pneumoniae TIGR4] >gi|24212615|sp|Q97S07|UVRC_STRPN UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|14972094|gb|AAK74770.1| excinuclease ABC, subunit C [Streptococcus pneumoniae TIGR4] (614 aa)
Score = 940, Expect = 2.5e-99, Identities = 218/588 (37%), Positives = 349/588 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MN  IK KL+ +P  PGCY+ KDKNG +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI + KPKYN++L++  ++P+I +T E +PR++ +    KK  G Y+GP+ +      E+   ++RIFP RKC   P+K C YY IGQC+   I K     ++   +E++DF  G+   I + L+ K   AA+ + FE + +Y +L + +     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  ++++ DE  LT + ++Y + +  +P  V +   + +E +K L +S   K L P +G KK +++ A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRK+ IK      DY  M+EVI RRY          P+LI++DGG+ QV  A + ++  EL   IP+ GL K+DKH+T  ++  D  E + L + S  +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L++ +++L KIKEASV+E+ ++ VP  VA+ +++
  S:     1 MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFRGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKITNERYPRLIITR-QVKKDGGLYFGPYPDVGAAN-EIKRLLDRIFPFRKCTNPPSKVCFYYHIGQCMAHTICKKDEAYFKSMAQEVSDFLKGQDDKIIDDLKSKMAVAAQSMEFERAAEYRDLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFNDPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDS---KILKPQRGEKKQLVNLAIKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMVVFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQVNIAKQVIQ-EELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMKHFKSLTKIKEASVDEIVEVGVPRVVAEAVQR 586
>gi|148992275|ref|ZP_01821998.1| excinuclease ABC subunit C [Streptococcus pneumoniae SP9-BS68] >gi|168488302|ref|ZP_02712501.1| excinuclease ABC, C subunit [Streptococcus pneumoniae SP195] >gi|147928901|gb|EDK79913.1| excinuclease ABC subunit C [Streptococcus pneumoniae SP9-BS68] >gi|183573193|gb|EDT93721.1| excinuclease ABC, C subunit [Streptococcus pneumoniae SP195] (614 aa)
Score = 940, Expect = 2.6e-99, Identities = 217/588 (36%), Positives = 348/588 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MN  IK KL+ +P  PGCY+ KDKNG +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI + KPKYN++L++  ++P I +T E +PR++ +    KK  G Y+GP+ +      E+   ++RIFP RKC   P+K C YY IGQC+   I K     ++   +E++DF  G+   I ++L+ K   AA+ + FE + +Y +L + +     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  ++++ DE  LT + ++Y + +  +P  V +   + +E +K L ++   K L P +G KK +++ A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRK+ IK      DY  M+EVI RRY          P+LI++DGG+ QV  A + ++  EL   IP+ GL K+DKH+T  ++  D  E + L + S  +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L+  +++L KIKEASV+E+ ++ VP  VA+ +++
  S:     1 MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFRGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPSIKITNERYPRLIITR-QVKKDGGLYFGPYPDVGAAN-EIKRLLDRIFPFRKCTNPPSKVCFYYHIGQCMAHTICKKDETYFKSMAQEVSDFLKGQDNKIIDELKGKMAAAAQTMEFERAAEYRDLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFNDPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDT---KILKPQRGEKKQLVNLAIKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMVVFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQVNIAKQVIQ-EELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMRHFKSLTKIKEASVDEIVEVGVPRAVAEAVQR 586
>gi|148983998|ref|ZP_01817317.1| excinuclease ABC subunit C [Streptococcus pneumoniae SP3-BS71] >gi|147924145|gb|EDK75257.1| excinuclease ABC subunit C [Streptococcus pneumoniae SP3-BS71] (614 aa)
Score = 939, Expect = 3.5e-99, Identities = 217/588 (36%), Positives = 349/588 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MN  IK KL+ +P  PGCY+ KDKNG +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI + KPKYN++L++  ++P+I +T E +PR++ +    KK  G Y+GP+ +      E+   ++RIFP RKC   P+K C YY IGQC+   I K     ++   +E++DF  G+   I + L+ K   AA+ + FE + +Y +L + +     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  ++++ DE  LT + ++Y + +  +P  V +   + +E +K L +S   K L P +G KK +++ A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMV++ NG  +K +YRK+ IK      DY  M+EVI RRY          P+LI++DGG+ QV  A + ++  EL   IP+ GL K+DKH+T  ++  D  E + L + S  +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L++ +++L KIKEASV+E+ ++ VP  VA+ +++
  S:     1 MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFRGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKITNERYPRLIITR-QVKKDGGLYFGPYPDVGAAN-EIKRLLDRIFPFRKCTNPPSKVCFYYHIGQCMAHTICKKDETYFKSMAQEVSDFLKGQDNKIIDDLKSKMAVAAQSMEFERAAEYRDLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFNDPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDS---KILKPQRGEKKQLVNLAIKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMVIFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQVNIAKQVIQ-EELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMKHFKSLTKIKEASVDEIVEVGVPRVVAEAVQR 586
>gi|168492779|ref|ZP_02716922.1| excinuclease ABC, C subunit [Streptococcus pneumoniae CDC3059-06] >gi|182683548|ref|YP_001835295.1| excinuclease ABC subunit C [Streptococcus pneumoniae CGSP14] >gi|182628882|gb|ACB89830.1| excinuclease ABC subunit C [Streptococcus pneumoniae CGSP14] >gi|183576998|gb|EDT97526.1| excinuclease ABC, C subunit [Streptococcus pneumoniae CDC3059-06] (615 aa)
Score = 938, Expect = 4.2e-99, Identities = 218/587 (37%), Positives = 348/587 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           MN  IK KL+ +P  PGCY+ KDKNG +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI + KPKYN++L++  ++P+I +T E +PR++ +    KK  G Y+GP+ +      E+   ++RIFP RKC   P+K C YY IGQC+   I K     ++   +E++DF  G+   I ++L+ K   AA+ + FE + +Y +L + +     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  ++++ DE  LT + ++Y + +  +P  V +   + +E +K L +S   K L P +G KK +++ A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRK+ IK      DY  M+EVI RRY          P+LI++DGG+ QV  A + ++  EL   IP+ GL K+DKH+T  ++  D  E + L + S  +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L+  +++L KIKEASV+E+ ++ VP  VA+ ++
  S:     1 MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFRGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKITNERYPRLIITR-QVKKDGGLYFGPYPDVGAAN-EIKRLLDRIFPFRKCTNPPSKVCFYYHIGQCMAHTICKKDEIYFKSMAQEVSDFLKGQDNKIIDELKGKMAAAAQTMEFERAAEYRDLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFNDPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDS---KILKPQRGEKKQLVNLAIKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMVVFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQVNIAKQVIQ-EELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMRHFKSLTKIKEASVDEIVEVGVPRAVAEAVQ 585
>gi|148998291|ref|ZP_01825760.1| excinuclease ABC subunit C [Streptococcus pneumoniae SP11-BS70] >gi|147755934|gb|EDK62978.1| excinuclease ABC subunit C [Streptococcus pneumoniae SP11-BS70] (615 aa)
Score = 936, Expect = 6.9e-99, Identities = 215/588 (36%), Positives = 347/588 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MN  IK KL+ +P  PGCY++KDKNG +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI + KPKYN++L++  ++P+I +T E +PR++ +    KK  G Y+GP+ +      E+   ++RIFP RKC   P+K C YY IGQC+   I K     ++   +E++DF  G+   I + L+ K    A+ + FE + +Y +L + +     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  ++++ DE  LT + ++Y + +  +P  V +   + +E +K L ++   K L P +G KK +++ A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRK+ IK      DY  M+EVI RRY          P+LI++DGG+ QV  A + ++  EL   IP+ GL K+DKH+T  ++  D  E + L + S  +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L+  +++L KIKEA V+E+ ++ VP  VA+ +++
  S:     1 MNNLIKPKLELLPTSPGCYIYKDKNGTIIYVGKAKNLRNRVRSYFRGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKITNEHYPRLIITR-QVKKDGGLYFGPYPDVGAAN-EIKRLLDRIFPFRKCTNPPSKVCFYYHIGQCMAHTICKNDEAYFKSMAQEVSDFLKGQDDKIIDDLKSKMAVTAQSMEFERAAEYRDLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFNDPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDT---KILKPQRGEKKQLVNLAIKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMVVFVNGRPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQHEALTPPDLIVIDGGQGQVNIAKQVIQ-EELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMRHFKSLTKIKEAGVDEIVEVGVPRAVAEAVQR 586
>gi|168576483|ref|ZP_02722357.1| excinuclease ABC, C subunit [Streptococcus pneumoniae MLV-016] >gi|183577678|gb|EDT98206.1| excinuclease ABC, C subunit [Streptococcus pneumoniae MLV-016] (615 aa)
Score = 935, Expect = 9.2e-99, Identities = 215/588 (36%), Positives = 347/588 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MN  IK KL+ +P  PGCY++KDKNG +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI + KPKYN++L++  ++P+I +T E +PR++ +    KK  G Y+GP+ +      E+   ++RIFP RKC   P+K C YY IGQC+   I K     ++   +E++DF  G+   I + L+ K    A+ + FE + +Y +L + +     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  ++++ DE  LT + ++Y + +  +P  V +   + +E +K L ++   K L P +G KK +++ A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRK+ IK      DY  M+EVI RRY          P+LI++DGG+ QV  A + ++  EL   IP+ GL K+DKH+T  ++  D  E + L + S  +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L+  +++L KIKEA V+E+ ++ VP  VA+ +++
  S:     1 MNNLIKPKLELLPTSPGCYIYKDKNGTIIYVGKAKNLRNRVRSYFRGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKITNEHYPRLIITR-QVKKDGGLYFGPYPDVGAAN-EIKRLLDRIFPFRKCTNPPSKVCFYYHIGQCMAHTICKNDEAYFKSMAQEVSDFLKGQDDKIIDDLKSKMAVTAQSMEFERAAEYRDLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFNDPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDT---KILKPQRGEKKQLVNLAIKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMVVFVNGRPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQVNIAKQVIQ-EELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMRHFKSLTKIKEAGVDEIVEVGVPRAVAEAVQR 586
>gi|149005728|ref|ZP_01829467.1| excinuclease ABC subunit C [Streptococcus pneumoniae SP18-BS74] >gi|147762668|gb|EDK69628.1| excinuclease ABC subunit C [Streptococcus pneumoniae SP18-BS74] (614 aa)
Score = 935, Expect = 1.0e-98, Identities = 217/588 (36%), Positives = 349/588 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MN  IK KL+ +P  PGCY+ KDKNG +IYVGKA +L NR++ YF    + KT+ L +EI D +++V  +  E+LLLE NLI + KPKYN++L++  ++P+I +T E +PR++ +    KK  G Y+GP+ +      E+   ++RIFP RKC   P+K C YY IGQC+   I K     ++   +E++DF  G+   I + L+ K   AA+ + FE + +Y +L + +     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  ++++ DE  LT + ++Y + +  +P  V +   + +E +K L +S   K L P +G KK +++ A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRK+ IK      DY  M+EVI RRY          P+LI++DGG+ QV  A + ++  EL   IP+ GL K+DKH+T  ++  D  E + L + S  +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L++ +++L KIKEASV+E+ ++ VP  VA+ +++
  S:     1 MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFRGSHNTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKITNERYPRLIITR-QVKKDGGLYFGPYPDVGAAN-EIKRLLDRIFPFRKCTNPPSKVCFYYHIGQCMAHTICKKDEAYFKSMAQEVSDFLKGQDDKIIDDLKSKMAVAAQSMEFERAAEYRDLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFNDPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDS---KILKPQRGEKKQLVNLAIKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMVVFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQVNIAKQVIQ-EELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMKHFKSLTKIKEASVDEIVEVGVPRVVAEAVQR 586
>gi|15902587|ref|NP_358137.1| excinuclease ABC subunit C [Streptococcus pneumoniae R6] >gi|116515431|ref|YP_816039.1| excinuclease ABC subunit C [Streptococcus pneumoniae D39] >gi|168482850|ref|ZP_02707802.1| excinuclease ABC, C subunit [Streptococcus pneumoniae CDC1873-00] >gi|122279075|sp|Q04LQ9|UVRC_STRP2 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|32130298|sp|Q8DQQ9|UVRC_STRR6 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|15458119|gb|AAK99347.1| Exonuclease ABC - subunit C [Streptococcus pneumoniae R6] >gi|116076007|gb|ABJ53727.1| excinuclease ABC, C subunit [Streptococcus pneumoniae D39] >gi|172043714|gb|EDT51760.1| excinuclease ABC, C subunit [Streptococcus pneumoniae CDC1873-00] (614 aa)
Score = 933, Expect = 1.8e-98, Identities = 217/588 (36%), Positives = 347/588 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MN  IK KL+ +P  PGCY+ KDKNG +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI + KPKYN++L++  ++P+I +T E +PR++ +    KK    Y+GP+ +      E+   ++RIFP RKC   P+K C YY IGQC+   I K     ++   +E++DF  G+   I + L+ K   AA+ + FE + +Y +L + +     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  ++++ DE  LT + ++Y + +  +P  V +   + +E +K L +S   K L P +G KK +++ A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRK+ IK      DY  M+EVI RRY          P+LI++DGG+ QV  A + ++  EL   IP+ GL K+DKH+T  ++  D  E + L + S  +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L+  +++L KIKEASV+E+ ++ VP  VA+ +++
  S:     1 MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFRGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKITNERYPRLIITR-QVKKDGSLYFGPYPDVGAAN-EIKRLLDRIFPFRKCTNPPSKVCFYYHIGQCMAHTICKKDEAYFKSMAQEVSDFLKGQDDKIIDDLKSKMAVAAQSMEFERAAEYRDLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFNDPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDS---KILKPQRGEKKQLVNLAIKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMVVFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQVNIAKQVIQ-EELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMRHFKSLTKIKEASVDEIVEVGVPRVVAEAVQR 586
>gi|195978295|ref|YP_002123539.1| excinuclease ABC subunit C [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975000|gb|ACG62526.1| excinuclease ABC subunit C [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (594 aa)
Score = 930, Expect = 4.2e-98, Identities = 214/586 (36%), Positives = 348/586 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLS-DEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWD-FSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           MNE IK KL+ +P  PGCYL KDK G +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI +  PKYN+ L++  ++P+I +T E  PR+L +    KK  G Y+GP+ ++     E+   ++RIFP +KC    NK C YY +GQC    I    +  ++  + ++  F +GK   I + L  K ++A+ K  FE + +Y +L   +     +Q ++     D DI G++  +  + + +F    G L+ +   +  +Y+E +E  LT + ++YS     +PK +++  + DE L  ++  +  + + P +G KK ++  A  NA   ++ K+  L  +  +   ++E L +LL I+   R+E FDNSNI  T+ V AMVV+ +G  +K +YRKF IK      DY  M+EVIYRRY        ++P+LIIVDGG+ QVKAA + ++  +L   IPV GL K+DKH+T  ++  +  + ++L + S+ +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + LL++++++  +++AS+EE+ Q+ +P  VA+ +
  S:     1 MNELIKHKLELLPDSPGCYLHKDKAGTIIYVGKAKNLRNRVRSYFRGSHDTKTELLVSEIADFEFIVTGSNTEALLLEINLIQENMPKYNIKLKDDKSYPFIKITNEPFPRLLITR-QIKKNDGLYFGPYPDAYTAT-EVKKLLDRIFPFKKCKNPVNKVCFYYHLGQCQAHTICHTDKAYWDSLVADVKQFLNGKDDKIIDDLRSKMLEASNKQEFERAAEYRDLISGIATMRTKQRVMSKDLQDRDIFGYFVDKGWMCVQVFFVRQGKLIQRDVNMFPYYNEAEEDFLTYVGQFYSDQRHLIPKEIFIPETIDETL--VAAIVPARIVKPQRGEKKQLVALATKNARVSLQQKFDLLEKDLRKTSGAIEHLGQLLGIEKPVRIEAFDNSNIQGTSPVAAMVVFVDGKPSKKDYRKFKIKTVIGPDDYASMREVIYRRYSRVKHEGLQVPDLIIVDGGQGQVKAARDVIEH-QLGLSIPVAGLQKNDKHQTHELLFGNPLAVVELPRNSEEFFLLHRIQDEVHRFAITFHRQVRSKNAFSSKLDHIAGLGPKRKQLLLKRFKSMTALEQASLEEIQQLGIPKTVAEAL 584
>gi|192811504|ref|ZP_03040175.1| excinuclease ABC, C subunit [Geobacillus sp. Y412MC10] >gi|192800067|gb|EDV76576.1| excinuclease ABC, C subunit [Geobacillus sp. Y412MC10] (667 aa)
Score = 927, Expect = 7.7e-98, Identities = 215/584 (36%), Positives = 348/584 (59%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSK-------------------------------------IAIELPKTVYLSLSDEKLKTL-----------------------SESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           E I+ KL  +P +PGCYL K+  G +IYVGKA  L NR++ YF    + KT+ L +EI D +Y+V  +  E+L+LE NLI  ++P++N+LL++   +PY+ +T EEHPR+  +    K  K  Y+GP+ N+   + +    ++R++PLRKC  +P + C+YY +GQCL PC+K+V +  YE    EI  F SG  + I ++L++K  +AAE L FE +++  +   ++    E+Q I  +   D D+ G+   +  + + I     G ++ +   +  FY +     ++ I +YYS                                       A E  K +   +S+E+ + L                        E L +K   P +G+KK ++  A +NA   +  K+  +  ++ R   +   L +++ ++ L R+E FDNSNI  +N V AMVV+ NG  +K EYRK+ I+      DYD M+EVI RRY+        +P+LI+VDGGK Q+ AA++ L+  EL   +PV GL KD KHKT +++  D  E + L + S  ++ L  IQDEVHRFAISF+R ++ KS+  + L  I  +G+ R + LL+ + ++ KIKEASVE+     P+ + +++
  S:    16 ENIRHKLALLPDQPGCYLMKNHEGTIIYVGKAKVLKNRVRSYFTGSHNGKTQMLVSEIRDFEYIVTGSNMEALILECNLIKTHQPRFNVLLKDDKTYPYLKITNEEHPRLEVTRRVLKD-KAKYFGPYPNAYAAQ-QTKKLLDRMYPLRKCGVMPKEVCLYYHMGQCLAPCVKEVPKSAYEQITGEITSFLSGGHEEIKKELQRKMQEAAEDLYFERAKELRDQIIHIDTLMEKQKITTTDTRDRDVFGYAVDKGWMCVQILYMRQGKMVQRNKSVFPFYGDAHSDFMSFIAQYYSDNPALPQEILLPGPLLAEEAGSETATGSAGEQGARNAGEAAETEKKLTTDISEEQHEVLVQAQAEQAEAAGLVDAAGGAAALQEWLGVKVHVPQRGLKKQMVGMASDNAKVSLDEKFRLIERDEERTSVAAANLGEVIGLQSLNRIEAFDNSNIQGSNPVSAMVVFTNGKPDKKEYRKYKIRTVQGPDDYDTMREVIRRRYERVLKENLPLPDLIVVDGGKGQISAAIDVLEN-ELGLFVPVCGLVKDAKHKTAQLMVGDPPEPVSLPRDSQEFYLLQRIQDEVHRFAISFHREQRGKSMVTSKLDSIPGIGEKRRKMLLKHFGSVKKIKEASVEDFK---PLSIGEKL 654
>gi|157149911|ref|YP_001450129.1| excinuclease ABC subunit C [Streptococcus gordonii str. Challis substr. CH1] >gi|189038123|sp|A8AWG9|UVRC_STRGC UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|157074705|gb|ABV09388.1| excinuclease ABC, C subunit [Streptococcus gordonii str. Challis substr. CH1] (611 aa)
Score = 926, Expect = 1.0e-97, Identities = 213/588 (36%), Positives = 349/588 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWD-FSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MN+ I+ KL+ +P  PGCY+ KDKNG +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI + KPKYN++L++  ++P+I +T E +PR++ +    KK  G Y+GP+ +      E+   ++R+FP RKC   P K C YY +GQC    I +V  Q ++   +E+  F  G+   I E L  K   AA+ + FE + +Y +L +++     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  +Y++ DE  LT I ++Y + +   P  + +   + +E ++ + ++   K L P +G KK +++ A  NA   ++ K+  L  +  +   ++E L +LL+I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRK+ IK      DY  M+EVI RRY          P+LI++DGG+ QV  A E ++  +L   IP+ GL K+DKH+T  ++  D    ++L + S  +F L  IQDEVHRFAI+F+R  +SK+ F + L  I+ LG  R + L++ +++L KIKEASV+E+ ++ VP  VA+ +++
  S:     1 MNKLIQSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFRGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKITNETYPRLIITR-QVKKDGGLYFGPYPDVGAAN-EIKRLLDRLFPFRKCTNPPEKVCFYYHLGQCKAHTICQVDSQYFKDLAQEVAAFLKGQDDQIIEDLRGKMAGAAQTMEFEKAAEYRDLIQSIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYYNDPDEDFLTYIGQFYQEKSHLKPNEILIPADIDEEAVRAMVDT---KVLKPQRGEKKQLVNLAIKNARVSLQQKFDLLEKSIEKTQGAIENLGQLLNIPTPVRIESFDNSNIMGTSPVSAMVVFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIKRRYSRVIRDGLTPPDLIVIDGGQGQVNVAKEVIQ-EQLGLDIPIAGLQKNDKHQTHELLFGDPLQVVELSRNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSQLDGIEGLGPKRKQNLMKHFKSLTKIKEASVDEIVEVGVPRAVAEAVQE 586
>gi|77412313|ref|ZP_00788627.1| excinuclease ABC, C subunit [Streptococcus agalactiae CJB111] >gi|77161632|gb|EAO72629.1| excinuclease ABC, C subunit [Streptococcus agalactiae CJB111] (593 aa)
Score = 925, Expect = 1.3e-97, Identities = 214/587 (36%), Positives = 343/587 (58%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           MNE IK KL+ +P  PGCYL KDKNG +IYVGKA +L NR+K YF    + KT+ L +EI D +Y+V  +  E+LLLE NLI +  PKYN+ L++  ++PYI +T E +PR++ +    KK  GTY+GP+ +S     E+   ++R+FP +KC    NK C YY +GQC    + +  +  ++   +++  F +GK   I   L +K   AA  + FE + +Y +L + + +   +Q +I     D D+ G++  +  + + +F   NG L+ +   +  +Y+E +E  LT I ++Y      LPK V++   D   K++   +  K + P +G KK +++ A  NA   ++ K+  L  +  +   ++E L  LL+I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRKF IK      DY  M+EVI+RRY          P+LI++DGG+ QV  A + ++  +L   IP+ GL K+DKH+T  ++  D  E ++L + S+ +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L++ +++L  I++A +E++    +P  VA+ ++
  S:     1 MNELIKHKLELLPDSPGCYLHKDKNGTIIYVGKAKNLKNRVKSYFHGSHNTKTELLVSEIEDFEYIVTTSNTEALLLEINLIQENMPKYNIRLKDDKSYPYIKITNERYPRLMITR-QVKKSDGTYFGPYPDSGAAT-EIKRLLDRLFPFKKCTNPANKVCFYYHLGQCNAHTVCQTNKAYWDSLREDVKQFLNGKDNKIVNGLTEKMKSAAMTMEFERAAEYRDLIEAISLLRTKQRVIHQDMKDRDVFGYFVDKGWMCVQVFFVRNGKLIQRDVNMFPYYNEPEEDFLTYIGQFYQDTKHFLPKEVFIP-QDIDAKSVETIVGCKIVKPQRGEKKQLVNLAIKNARVSLQQKFDLLEKDIRKTHGAIENLGNLLNIPKPVRIEAFDNSNIQGTSPVAAMVVFVNGKPSKKDYRKFKIKTVIGPDDYASMREVIHRRYSRVLKDGLTPPDLIVIDGGQGQVNIARDVIEN-QLGLAIPIAGLQKNDKHQTHELLFGDPLEVVELPRNSEEFFLLHRIQDEVHRFAITFHRQLRSKNSFSSKLDGITGLGPKRKQLLMKHFKSLSSIQKADIEDIIMCGIPRNVAESLR 585
>gi|25011343|ref|NP_735738.1| excinuclease ABC subunit C [Streptococcus agalactiae NEM316] >gi|81446312|sp|Q8CX26|UVRC_STRA3 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|24412881|emb|CAD46953.1| excinuclease ABC (subunit C) [Streptococcus agalactiae NEM316] (593 aa)
Score = 924, Expect = 1.8e-97, Identities = 214/587 (36%), Positives = 343/587 (58%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           MNE IK KL+ +P  PGCYL KDKNG +IYVGKA +L NR+K YF    + KT+ L +EI D +Y+V  +  E+LLLE NLI +  PKYN+ L++  ++PYI +T E +PR++ +    KK  GTY+GP+ +S     E+   ++R+FP +KC    NK C YY +GQC    + +  +  ++   +++  F +GK   I   L +K   AA  + FE + +Y +L + + +   +Q +I     D D+ G++  +  + + +F   NG L+ +   +  +Y+E +E  LT I ++Y      LPK V++   D   K++   +  K + P +G KK +++ A  NA   ++ K+  L  +  +   ++E L  LL+I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRKF IK      DY  M+EVI+RRY          P+LI++DGG+ QV  A + ++  +L   IP+ GL K+DKH+T  ++  D  E ++L + S+ +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L++ +++L  I++A +E++    +P  VA+ ++
  S:     1 MNELIKHKLELLPDSPGCYLHKDKNGTIIYVGKAKNLKNRVKSYFHGSHNTKTELLVSEIEDFEYIVTTSNTEALLLEINLIQENMPKYNIRLKDDKSYPYIKITNERYPRLMITR-QVKKSDGTYFGPYPDSGAAT-EIKRLLDRLFPFKKCTNPANKVCFYYHLGQCNAHTVCQTNKAYWDSLREDVKQFLNGKDNKIVNGLTEKMKSAAMTMEFERAAEYRDLIEAISLLRTKQRVIHQDMKDRDVFGYFVDKGWMCVQVFFVRNGKLIQRDVNMFPYYNEPEEDFLTYIGQFYQDTKHFLPKEVFIP-QDIDAKSVETIVGCKIVKPQRGEKKQLVNLAIKNARVSLQQKFDLLEKDIRKTHGAIENLGNLLNIPKPVRIEAFDNSNIQGTSPVAAMVVFVNGKPSKKDYRKFKIKTVIGPDDYASMREVIHRRYSRVLKDGLTPPDLIVIDGGQGQVNIARDVIEN-QLGLAIPIAGLQKNDKHQTHELLFGDPLEVVELPRNSEEFFLLHRIQDEVHRFAITFHRQLRSKNSFSSKLDGITGLGPKRKQLLMKHFKSLPNIQKAEIEDIIMCGIPRTVAESLR 585
>gi|76786803|ref|YP_329921.1| excinuclease ABC subunit C [Streptococcus agalactiae A909] >gi|77405386|ref|ZP_00782480.1| excinuclease ABC, C subunit [Streptococcus agalactiae H36B] >gi|92058698|sp|Q3K0N2|UVRC_STRA1 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|76561860|gb|ABA44444.1| UvrABC system, C protein [Streptococcus agalactiae A909] >gi|77175968|gb|EAO78743.1| excinuclease ABC, C subunit [Streptococcus agalactiae H36B] (593 aa)
Score = 923, Expect = 2.7e-97, Identities = 213/587 (36%), Positives = 343/587 (58%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           MNE IK KL+ +P  PGCYL KDKNG +IYVGKA +L NR++ YF    + KT+ L +EI D +Y+V  +  E+LLLE NLI +  PKYN+ L++  ++PYI +T E +PR++ +    KK  GTY+GP+ +S     E+   ++R+FP +KC    NK C YY +GQC    + +  +  ++   +++  F +GK   I   L +K   AA  + FE + +Y +L + + +   +Q +I     D D+ G++  +  + + +F   NG L+ +   +  +Y+E +E  LT I ++Y      LPK V++   D   K++   +  K + P +G KK +++ A  NA   ++ K+  L  +  +   ++E L  LL+I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRKF IK      DY  M+EVI+RRY          P+LI++DGG+ QV  A + ++  +L   IP+ GL K+DKH+T  ++  D  E ++L + S+ +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L++ +++L  I++A +E++    +P  VA+ ++
  S:     1 MNELIKHKLELLPDSPGCYLHKDKNGTIIYVGKAKNLKNRVRSYFHGSHNTKTELLVSEIEDFEYIVTTSNTEALLLEINLIQENMPKYNIRLKDDKSYPYIKITNERYPRLMITR-QVKKSDGTYFGPYPDSGAAT-EIKRLLDRLFPFKKCTNPANKVCFYYHLGQCNAHTVCQTNKAYWDSLREDVKQFLNGKDNKIVNGLTEKMKSAAMTMEFERAAEYRDLIEAISLLRTKQRVIHQDMKDRDVFGYFVDKGWMCVQVFFVRNGKLIQRDVNMFPYYNEPEEDFLTYIGQFYQDTKHFLPKEVFIP-QDIDAKSVETIVGCKIVKPQRGEKKQLVNLAIKNARVSLQQKFDLLEKDIRKTHGAIENLGNLLNIPKPVRIEAFDNSNIQGTSPVAAMVVFVNGKPSKKDYRKFKIKTVIGPDDYASMREVIHRRYSRVLKDGLTPPDLIVIDGGQGQVNIARDVIEN-QLGLAIPIAGLQKNDKHQTHELLFGDPLEVVELPRNSEEFFLLHRIQDEVHRFAITFHRQLRSKNSFSSKLDGITGLGPKRKQLLMKHFKSLPNIQKADIEDIIMCGIPRTVAESLR 585
>gi|157693266|ref|YP_001487728.1| excinuclease ABC subunit C [Bacillus pumilus SAFR-032] >gi|189038024|sp|A8FG01|UVRC_BACP2 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|157682024|gb|ABV63168.1| excision endonuclease subunit UvrC [Bacillus pumilus SAFR-032] (590 aa)
Score = 922, Expect = 3.1e-97, Identities = 215/584 (36%), Positives = 356/584 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAK 584
           MN+ IK+KL  +P +PGCYL KD+   VIYVGKA  L NR++ YF    D KT++L +EI D +Y+V ++  E+L+LE NLI KY PKYN++L++   +P+I +T E HP+++ +    KK KG Y+GP+ N    + E    ++R++PLRKC  LP++ C+YY +GQCL PC+  ++ +  +  + EI  F +G  + I ++L +K  +AAE+L FE +++  +    +    E+Q +  S  +D D+  +   +  + + +F    G L+ +   +   Y + +E  LT + ++YSK    LPK + +  S ++ + + + L+     P KG KKD++  A  NA   +K K+  +  ++ R + ++++L   L+I   YR+E FDNSNI   + V AMVV+++G   K EYRK+ IK      DY  M+EVI RRY         +P+LI++DGGK Q+ AA++ L+  EL+  +PV GL KD+KH+T  ++  D  EI  L++ S  ++ L  IQDEVHRFAISF+R  + K+ F++ L  +  +G+ R ++LL+ + ++ K+KEA++E+  +  +P + A+
  S:     1 MNKLIKEKLSVLPDQPGCYLMKDRQNTVIYVGKAKILKNRVRSYFTGSHDAKTQRLVSEIEDFEYIVTSSNIEALILELNLIKKYDPKYNVMLKDDKTYPFIKITNERHPKLIVTR-HVKKDKGKYFGPYPNVQAAR-ETKKLLDRLYPLRKCATLPDRVCLYYHLGQCLAPCVYDISEETNKQLVDEIIRFLNGGHQQIKKELTEKMQEAAEQLEFERAKELRDQIAYIDSTMEKQKMTMSDLSDRDVFAYAYDKGWMCVQVFFIRQGKLIERDVSLFPMYQDPEEEFLTFMGQFYSKNNHFLPKEILVPDSVDQ-EMIEQLLETNVHQPKKGKKKDLLLLAHQNAKIALKEKFSLIERDEERSIGAVKQLGDALNIYMPYRIEAFDNSNIQGADPVSAMVVFQDGKPYKKEYRKYKIKTVTGPDDYASMREVIRRRYTRVLKDELPLPDLILIDGGKGQINAAIDVLEN-ELNLSVPVAGLVKDEKHRTSNLMMGDTLEIVALERNSQAFYLLQRIQDEVHRFAISFHRQLRGKNAFQSILDDVPGIGEKRKKQLLKHFGSVKKMKEATIEDFQEAGIPKQTAE 582
>gi|55821309|ref|YP_139751.1| excinuclease ABC subunit C [Streptococcus thermophilus LMG 18311] >gi|81560416|sp|Q5M3R7|UVRC_STRT2 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|55737294|gb|AAV60936.1| excinuclease ABC subunit C [Streptococcus thermophilus LMG 18311] (595 aa)
Score = 922, Expect = 3.2e-97, Identities = 217/586 (37%), Positives = 349/586 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWD-FSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           MN+ IK KL+ +P+ PGCYL KDK G +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI +  PK+N+ L++  ++P+I +TKE +PR+L +    KK  G Y+GP+ ++     E+   ++RIFP +KC    NK C YY IGQC    I   T   ++  ++++ +F +G    I  QL+ K    ++++ FE + +Y +L + +     +Q +I     D DI G+Y  +  + + +F    G L+ +   +  +Y++ +E  LT I ++Y       PK +++   +  E ++ L  + ++K   P +G KK +++ A  NA   +  K+  L  +  +   ++E L KL+ I    R+E FDNSNI  T+ V AMVV+ENG  NK EYRK+ IK  +   DY  M+EVI RRY          P+LII+DGG+ QV  A + L+  EL+  IPV GL K+DKH+T+ ++  D    I L ++S+ +F L  IQDEVHRFAI+F+R  +SK+ F + L  ++ LG  R +KLL+ ++++  I++ASVE++  + +P +VA+ +
  S:     1 MNDLIKHKLELLPNNPGCYLHKDKFGNIIYVGKAKNLKNRVRSYFRGSHDTKTELLVSEIADFEFIVTESNIEALLLEINLIQENMPKFNIRLKDGKSYPFIKITKELYPRLLITR-QVKKDGGLYFGPYPDAGAAN-EIKKLLDRIFPFKKCKNPANKVCFYYHIGQCKAHTICHTTEAYWQGLVEDVKNFLNGHDDKIVNQLKAKMKDMSDQMEFERAAEYRDLIEAVSTLRTKQRVIRQDMQDRDIFGYYVDKGWMCVQVFFVRQGKLIQRDVNMFPYYNDAEEDFLTYIGQFYLDSRHLKPKEIFIPGDIDQESVEALVGN-EVKVFKPQRGEKKQLVNLAMKNARVSLTQKFDLLEKDIAKTQGAIENLGKLMGIPTPVRIESFDNSNIMGTSPVSAMVVFENGKPNKKEYRKYKIKTVEGPDDYASMREVIRRRYSRVKRDGLTPPDLIIMDGGQGQVNVAKDVLRN-ELNLSIPVAGLQKNDKHQTNELLFGDPLRVIDLPRQSEEFFLLHRIQDEVHRFAITFHRQVRSKNSFSSKLDGVEGLGPKRKQKLLKNFKSMTAIQQASVEDIQALGIPEKVAQAL 586
>gi|22537378|ref|NP_688229.1| excinuclease ABC subunit C [Streptococcus agalactiae 2603V/R] >gi|81454002|sp|Q8DZ90|UVRC_STRA5 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|22534251|gb|AAN00102.1|AE014247_17 excinuclease ABC, C subunit [Streptococcus agalactiae 2603V/R] (593 aa)
Score = 921, Expect = 4.5e-97, Identities = 213/587 (36%), Positives = 342/587 (58%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           MNE IK KL+ +P  PGCYL KDKNG +IYVGKA +L NR+K YF    + KT+ L +EI D +Y+V  +  E+LLLE NLI +  PKYN+ L++  ++PYI +T E +PR++ +    KK  GTY+GP+ +S     E+   ++R+FP +KC    NK C YY +GQC    + +  +  ++   +++  F +GK   I   L +K   AA  + FE + +Y +L + + +   +Q +I     D D+ G++  +  + + +F   NG L+ +   +  +Y+E +E  LT I ++Y      LPK V++   D   K++   +  K + P +G KK +++ A  NA   ++ K+  L  +  +   ++E L  LL+I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRKF IK      DY  M+EVI+RRY          P+LI++DGG+ QV  A + ++  +    IP+ GL K+DKH+T  ++  D  E ++L + S+ +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L++ +++L  I++A +E++    +P  VA+ ++
  S:     1 MNELIKHKLELLPDSPGCYLHKDKNGTIIYVGKAKNLKNRVKSYFHGSHNTKTELLVSEIEDFEYIVTTSNTEALLLEINLIQENMPKYNIRLKDDKSYPYIKITNERYPRLMITR-QVKKSDGTYFGPYPDSGAAT-EIKRLLDRLFPFKKCTNPANKVCFYYHLGQCNAHTVCQTNKAYWDSLREDVKQFLNGKDNKIVNGLTEKMKSAAMTMEFERAAEYRDLIEAISLLRTKQRVIHQDMKDRDVFGYFVDKGWMCVQVFFVRNGKLIQRDVNMFPYYNEPEEDFLTYIGQFYQDTKHFLPKEVFIP-QDIDAKSVETIVGCKIVKPQRGEKKQLVNLAIKNARVSLQQKFDLLEKDIRKTHGAIENLGNLLNIPKPVRIEAFDNSNIQGTSPVAAMVVFVNGKPSKKDYRKFKIKTVIGPDDYASMREVIHRRYSRVLKDGLTPPDLIVIDGGQGQVNIARDVIEN-QFGLAIPIAGLQKNDKHQTHELLFGDPLEVVELPRNSEEFFLLHRIQDEVHRFAITFHRQLRSKNSFSSKLDGITGLGPKRKQLLMKHFKSLPNIQKAEIEDIIMCGIPRTVAESLR 585
>gi|87126817|gb|ABD21331.1| excinuclease ABC, C subunit [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202406|gb|ABD30216.1| excinuclease ABC, C subunit [Staphylococcus aureus subsp. aureus NCTC 8325] (570 aa)
Score = 920, Expect = 5.0e-97, Identities = 212/567 (37%), Positives = 342/567 (60%)
  Q:    22 KDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           KD+N  VIYVGKA  L NR++ YF    D KT +L  EI   +++V ++E ESLLLE NLI +Y+P+YN+LL++  ++P+I +TKE++PR+L +  + K+  G Y+GP+ N+     E    ++RI+P RKC+K+P+K C+YY IGQCLGPC+  V    Y    KEI DF +G+ K+I + LE++ + A+E L FE +++Y +L ++++  + +Q I+ S K   D+ G+   +  + I +F    G+++ +   +       +E   T I ++YS     LPK V++  + +K + +   +  K + P++G KKD++D A +NA   + NK+  +  +++R + ++EEL   + I+   R+E FDNSNI   + V AMV + +G  +K  YRK+ IK      DY  M+EV+ RRY         +P+LIIVDGGK  +   ++ L+  EL   IPV GL K+DKH+T  ++    +EI  L K S  ++ L  IQDEVHRFAI+F+R  + K+  ++ L  I  +G  R   LL  + ++ K+KEA++E+   I +P  VAK + +
  S:     2 KDRNDQVIYVGKAKKLRNRLRSYFTGAHDAKTTRLVGEIRRFEFIVTSSETESLLLELNLIKQYQPRYNILLKDDKSYPFIKITKEKYPRLLVTR-TVKQGTGKYFGPYPNA-YSAQETKKLLDRIYPYRKCDKMPDKLCLYYHIGQCLGPCVYDVDLSKYAQMTKEITDFLNGEDKTILKSLEERMLTASESLDFERAKEYRDLIQHIQNLTNKQKIMSSDKTIRDVFGYSVDKGWMCIQVFFIRQGNMIKRDTTMIPLQQTEEEEFYTFIGQFYSLNQHILPKEVHVPRNLDK-EMIQSVVDTKIVQPARGPKKDMVDLAAHNAKVSLNNKFELISRDESRTIKAIEELGTQMGIQTPIRIEAFDNSNIQGVDPVSAMVTFVDGKPDKKNYRKYKIKTVKGPDDYKSMREVVRRRYSRVLNEGLPLPDLIIVDGGKGHMNGVIDVLQN-ELGLDIPVAGLQKNDKHQTSELLYGASAEIVPLKKNSQAFYLLHRIQDEVHRFAITFHRQTRQKTGLKSILDDIDGIGNKRKTLLLRSFGSIKKMKEATLEDFKNIGIPENVAKNLHE 566
>gi|194017145|ref|ZP_03055757.1| excinuclease ABC, C subunit [Bacillus pumilus ATCC 7061] >gi|194011013|gb|EDW20583.1| excinuclease ABC, C subunit [Bacillus pumilus ATCC 7061] (590 aa)
Score = 919, Expect = 7.0e-97, Identities = 214/584 (36%), Positives = 356/584 (60%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAK 584
           MN+ IK+KL  +P +PGCYL KD+   VIYVGKA  L NR++ YF    D KT++L +EI D +Y+V ++  E+L+LE NLI KY PKYN++L++   +P+I +T E HP+++ +    KK KG Y+GP+ N    + E    ++R++PLRKC  LP++ C+YY +GQCL PC+  ++ +  +  + EI  F +G  + I ++L +K  +AAE+L FE +++  +    +    E+Q +  S  +D D+  +   +  + + +F    G L+ +   +   Y + +E  LT + ++Y+K    LPK + +  S ++ + + + L+     P KG KKD++  A  NA   +K K+  +  ++ R + ++++L   L+I   YR+E FDNSNI   + V AMVV+++G   K EYRK+ IK      DY  M+EVI RRY         +P+LI++DGGK Q+ AA++ L+  EL+  +PV GL KD+KH+T  ++  D  EI  L++ S  ++ L  IQDEVHRFAISF+R  + K+ F++ L  +  +G+ R ++LL+ + ++ K+KEAS+++  +  +P + A+
  S:     1 MNKLIKEKLSVLPDQPGCYLMKDRQNTVIYVGKAKVLKNRVRSYFTGSHDAKTQRLVSEIEDFEYIVTSSNIEALILELNLIKKYDPKYNVMLKDDKTYPFIKITNERHPKLIVTR-HVKKDKGKYFGPYPNVQAAR-ETKKLLDRLYPLRKCATLPDRVCLYYHLGQCLAPCVYDISEETNKQLVDEIIRFLNGGHQQIKKELTEKMNEAAEQLEFERAKELRDQIAYIDSTMEKQKMTMSDLSDRDVFAYAYDKGWMCVQVFFIRQGKLIERDVSLFPMYQDPEEEFLTFMGQFYAKNNHFLPKEILVPDSVDQ-EMIEQLLETNVHQPKKGKKKDLLLLAHQNAKIALKEKFSLIERDEERSIGAVKQLGDALNIYMPYRIEAFDNSNIQGADPVSAMVVFQDGKPYKKEYRKYKIKTVTGPDDYASMREVIRRRYTRVLKDELPLPDLILIDGGKGQINAAIDVLEN-ELNLSVPVAGLVKDEKHRTSNLMMGDTLEIVALERNSQAFYLLQRIQDEVHRFAISFHRQLRGKNAFQSILDDVPGIGEKRKKQLLKHFGSVKKMKEASIQDFQEAGIPKQTAE 582
>gi|55823221|ref|YP_141662.1| excinuclease ABC subunit C [Streptococcus thermophilus CNRZ1066] >gi|81559227|sp|Q5LZ62|UVRC_STRT1 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|55739206|gb|AAV62847.1| excinuclease ABC subunit C [Streptococcus thermophilus CNRZ1066] (595 aa)
Score = 917, Expect = 1.2e-96, Identities = 216/586 (36%), Positives = 347/586 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWD-FSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           MN+ IK KL+ +P  PGCYL KDK G +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI +  PK+N+ L++  ++P+I +TKE +PR+L +    KK  G Y+GP+ ++     E+   ++RIFP +KC    NK C YY IGQC    I   T   ++  ++++ +F +G    I  QL+ K    ++++ FE + +Y +L + +     +Q +I     D DI G+Y  +  + + +F    G L+ +   +  +Y++ +E  LT + ++Y       PK +++   +  E ++ L    ++K   P +G KK +++ A  NA   +  K+  L  +  +   ++E L KL+ I    R+E FDNSNI  T+ V AMVV+ENG  NK EYRK+ IK  +   DY  M+EVI RRY          P+LII+DGG+ QV  A + L+  EL+  IPV GL K+DKH+T+ ++  D    I L ++S+ +F L  IQDEVHRFAI+F+R  +SK+ F + L  ++ LG  R +KLL+ ++++  I++ASVE++  + +P +VA+ +
  S:     1 MNDLIKHKLELLPSNPGCYLHKDKFGNIIYVGKAKNLKNRVRSYFRGSHDTKTELLVSEIADFEFIVTESNIEALLLEINLIQENMPKFNIRLKDGKSYPFIKITKELYPRLLITR-QVKKDGGLYFGPYPDAGAAN-EIKKLLDRIFPFKKCKNPANKVCFYYHIGQCKAHTICHTTEAYWQGLVEDVKNFLNGHDDKIVNQLKAKMKDMSDQMEFERAAEYRDLIEAVSTLRTKQRVIRQDMQDRDIFGYYVDKGWMCVQVFFVRQGKLIQRDVNMFPYYNDAEEDFLTYMGQFYLDSRHLKPKEIFIPGDIDQESVEALVGD-EVKVFKPQRGEKKQLVNLATKNARVSLTQKFDLLEKDIAKTQGAIENLGKLMGIPTPVRIESFDNSNIMGTSPVSAMVVFENGKPNKKEYRKYKIKTVEGPDDYASMREVIRRRYSRVKRDGLTPPDLIIIDGGQGQVNVAKDVLRN-ELNLSIPVAGLQKNDKHQTNELLFGDPLRVIDLPRQSEEFFLLHRIQDEVHRFAITFHRQVRSKNSFSSKLDGVEGLGPKRKQKLLKNFKSMTAIQQASVEDIQALGIPEKVAQAL 586
>gi|116628039|ref|YP_820658.1| excinuclease ABC subunit C [Streptococcus thermophilus LMD-9] >gi|122267365|sp|Q03K10|UVRC_STRTD UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|116101316|gb|ABJ66462.1| Excinuclease ABC subunit C [Streptococcus thermophilus LMD-9] (595 aa)
Score = 916, Expect = 1.6e-96, Identities = 217/586 (37%), Positives = 346/586 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWD-FSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           MN  IK KL+ +P  PGCYL KDK G +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI +  PK+N+ L++  ++P+I +TKE +PR+L +    KK  G Y+GP+ +S     E+   ++RIFP +KC    NK C YY IGQC    I   T   ++  ++++ +F +G    I  QL+ K    ++++ FE + +Y +L + +     +Q +I     D DI G+Y  +  + + +F    G L+ +   +  +Y++ +E  LT + ++Y       PK +++   +  E ++ L    ++K   P +G KK +++ A  NA   +  K+  L  +  +   ++E L KL+ I    R+E FDNSNI  T+ V AMVV+ENG  NK EYRK+ IK  +   DY  M+EVI RRY          P+LII+DGG+ QV  A + L+  EL+  IPV GL K+DKH+T+ ++  D    I L ++S+ +F L  IQDEVHRFAI+F+R  +SK+ F + L  ++ LG  R +KLL+ ++++  I++ASVE++  + +P +VA+ +
  S:     1 MNGLIKHKLELLPSNPGCYLHKDKFGNIIYVGKAKNLKNRVRSYFRGSHDTKTELLVSEIADFEFIVTESNIEALLLEINLIQENMPKFNIRLKDGKSYPFIKITKELYPRLLITR-QVKKDGGLYFGPYPDSGAAN-EIKKLLDRIFPFKKCKNPANKVCFYYHIGQCNAHTICHTTEDYWQGLVEDVKNFLNGHDDKIVNQLKAKMKDMSDQMAFERAAEYRDLIEAVSTLRTKQRVIRQDMQDRDIFGYYVDKGWMCVQVFFVRQGKLIQRDVNMFPYYNDAEEDFLTYMGQFYLDSRHLKPKEIFIPGDIDQESVEALVGD-EVKVFKPKRGEKKQLVNLATKNARVSLTQKFDLLEKDIAKTQGAIENLGKLMGIPTPVRIESFDNSNIMGTSPVSAMVVFENGKPNKKEYRKYKIKTVEGPDDYASMREVIRRRYSRVKRDGLTPPDLIIMDGGQGQVNVAKDVLRN-ELNLSIPVAGLQKNDKHQTNELLFGDPLRVIDLPRQSEEFFLLHRIQDEVHRFAITFHRQVRSKNSFSSKLDGVEGLGPKRKQKLLKNFKSMTAIQQASVEDIQALGIPKKVAQAL 586
>gi|81096617|ref|ZP_00874955.1| Excinuclease ABC, C subunit [Streptococcus suis 89/1591] >gi|80977343|gb|EAP40888.1| Excinuclease ABC, C subunit [Streptococcus suis 89/1591] (622 aa)
Score = 915, Expect = 2.0e-96, Identities = 214/588 (36%), Positives = 348/588 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MN+ IK KL+ +P  PGCYL K+K G +IYVGKA +L NR++ YF    D KT+ L +EI D +++V ++  E+LLLE NLI + KP+YN++L++  ++P+I +TKE HPR+L +    KK  G Y+GP+ +       L   + R++P RKC    NK C+YY +GQCL       +  DY+   KE+  F +G    I ++++ K   AA  L FE + +Y ++ +++     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  +Y++ DE  LT I ++Y      +P  V +   +  E ++ L ++   K + P +G KK +++ A  NA   ++ K+  L  N  +   ++E + +LL I    R+E FDNSNI  T+ V AMVV+ENGV NK EYRK+ IK  +   DY  M+EV+ RRY          P+LII+DGG+ QV  A + ++  EL   IP+ GL K+DKH+T  ++  +  E ++L + S  +F L  IQDEVHRFAI F+R  +SK+ F + L  I+ LG  R + L++ ++++  I+ AS++E+++  VP +VA+ +K+
  S:    29 MNDLIKHKLELLPDSPGCYLHKNKYGKIIYVGKAKNLRNRVRSYFRGAHDTKTEALVSEIADFEFIVTDSNIEALLLEINLIQENKPRYNIMLKDDKSYPFIKITKERHPRLLITR-QIKKDSGQYFGPYPDVGAANQTL-KLLERLYPFRKCKLPENKYCLYYHLGQCLAHGENLPSLSDYDKMAKEVAQFLTGHDDKIVKEVQDKMKAAAGNLEFEKAAEYRDVLQSISTLRTKQRVMAHDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERNVNLFPYYNDADEDFLTYIGQFYRDQQHLIPSEVLIPQDIDQEAVEALVDT---KVIKPQRGEKKQLINLATKNARVSLEQKFNLLEKNLEKTYGAVENIGQLLGIPTPVRIEAFDNSNIMGTSPVSAMVVFENGVPNKKEYRKYKIKTVEGPDDYASMREVLQRRYSRVLRDDLTPPDLIIIDGGQGQVNVAKQVIE-QELGMSIPIAGLQKNDKHQTHELLFGNPLEVVELPRNSQEFFLLHRIQDEVHRFAIEFHRQVRSKNSFSSKLDGIEGLGPKRKQALMKHFKSIGNIQSASLQEIAEAGVPYKVAELVKE 614
>gi|69245124|ref|ZP_00603248.1| Excinuclease ABC, C subunit [Enterococcus faecium DO] >gi|68195967|gb|EAN10400.1| Excinuclease ABC, C subunit [Enterococcus faecium DO] (592 aa)
Score = 915, Expect = 2.1e-96, Identities = 216/586 (36%), Positives = 349/586 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK-CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIV-KWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEI 586
           MNE+IK+KL  +P +PGCYL KDKNG +IYVGKA  L NR++ YF    + KT++L +EI D +Y+V  +  E+LLLE NLI K  PKYN++L++   +P++ +T E++PR++ +    K  K  Y+GP+ +      E    ++R+FPLRKC     K+ C+YY +GQCL P    V  + Y   + E+  F +G  + I+ ++ +K  +AAE + FE + +Y +  + ++    RQ +  +   D D+ G+   +  + + +F    G L+ +   +  FY+E +E  LT + ++Y +    +PK V +  + +K  ++   L  K L P +G KK +++ A  NA   +  ++  +   Q R + ++E L   ++I    R+E FDNSNI  TN V AMVV+ +G   + EYRK+ IK  +   DY  M+EVIYRRY         +P+LI++DGGK QV  A + L+  +L   IP+ G+AK+DKHKT+ ++   D + + L++ S  +F L  IQDEVHRFAI+F+R  +SK+ F + L +I+ LG  R + LL+++++L  I  A+ EEL +I +P  VA+ +
  S:     1 MNERIKNKLALLPDQPGCYLMKDKNGTIIYVGKAKILKNRVRSYFTGSHNTKTERLVSEIEDFEYIVTESNIEALLLEINLIKKNDPKYNIMLKDDKTYPFLKITNEKYPRLVITRKVLKD-KALYFGPYPDVGAAN-ETKKILDRLFPLRKCKPSQTKEPCLYYHLGQCLCPYYFDVDPKVYTKIVDEVKKFLNGGHEKIESEIHQKMEKAAENMEFEKAAEYRDQIRAIETIMTRQKMTNTDLLDRDVFGYAIDKGWMCVQVFFVRQGKLIERDVSMFPFYNEAEEDFLTYLGQFYQENEHFIPKEVLIPDTIDK-PSVEALLATKVLQPKRGEKKKLVELANKNASVALNERFDLIARKQERTIGAVERLGNAMNIPTPIRIESFDNSNIMGTNPVAAMVVFIDGKPARKEYRKYKIKTVNGPDDYASMREVIYRRYSRVIREGLPLPDLILIDGGKGQVDVAKDVLEN-QLGIDIPIAGMAKNDKHKTNELLFGIDLAVVPLERNSPEFFLLQRIQDEVHRFAITFHRQLRSKNSFASRLDEIEGLGPKRKKMLLKEFKSLKNITAATTEELQEIGLPKNVAQNV 585
>gi|125718113|ref|YP_001035246.1| excinuclease ABC subunit C [Streptococcus sanguinis SK36] >gi|189038125|sp|A3CNE1|UVRC_STRSV UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|125498030|gb|ABN44696.1| Nuclease subunit of the excinuclease complex, subunit C, putative [Streptococcus sanguinis SK36] (611 aa)
Score = 913, Expect = 3.7e-96, Identities = 210/588 (35%), Positives = 348/588 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWD-FSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MN+ I+ KL+ +P  PGCY+ KDKN  +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI + +PKYN++L++  ++P+I +T E +PR++ +    K + G Y+GP+ +      E+   ++R+FP RKC   P K C YY +GQC    I KV  Q ++   +E+  F  G+   I E L  K   AA+ + FE + +Y +L +++     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  +Y++ DE  LT I ++Y + +   P  + +   + +E ++ + ++   K L P +G KK +++ A  NA   ++ K+  L  +  +   ++E L +LL+I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRK+ IK      DY  M+EVI RRY          P+LI++DGG+ QV  A E ++  +L   IP+ GL K+DKH+T  ++  D    ++L + S  +F L  IQDEVHRFAI+F+R  +SK+ F + L  I+ LG  R + L++ +++L KIKEASV+++ ++ VP  VA+ +++
  S:     1 MNKLIQSKLELLPTSPGCYIHKDKNDTIIYVGKAKNLRNRVRSYFRGSHDTKTEALVSEIEDFEFIVTESNIEALLLEINLIKENQPKYNIMLKDDKSYPFIKITNETYPRLIITRQVKKDV-GLYFGPYPDVGAAN-EIKRLLDRLFPFRKCTNPPEKVCFYYHLGQCKAHTICKVDSQYFKELAQEVAAFLKGQDDQIIEDLRGKMAGAAQAMEFEKAAEYRDLIQSIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYYNDPDEDFLTYIGQFYQEKSHLKPNEILIPADIDEEAVRAMVDT---KVLKPQRGEKKQLVNLAIKNARVSLQQKFDLLEKSIEKTQGAIENLGQLLNIPTPVRIESFDNSNIMGTSPVSAMVVFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIKRRYSRVIRDGLTPPDLIVIDGGQGQVNIAKEVIQ-EQLGLDIPIAGLQKNDKHQTHELLFGDPLQVVELSRNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSQLDGIEGLGPKRKQNLMKHFKSLTKIKEASVDQIVEVGVPRAVAEAVRE 586
>gi|146320599|ref|YP_001200310.1| excinuclease ABC subunit C [Streptococcus suis 98HAH33] >gi|145691405|gb|ABP91910.1| Nuclease subunit of the excinuclease complex [Streptococcus suis 98HAH33] (620 aa)
Score = 908, Expect = 1.5e-95, Identities = 211/585 (36%), Positives = 342/585 (58%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKE 585
           MN+ IK KL+ +P  PGCYL K+K G +IYVGKA +L NR++ YF    D KT+ L  EI D +++V ++  E+LLLE NLI + KP+YN++L++  ++P+I +TKE HPR+L +    KK  G Y+GP+ +       L   + R++P RKC    NK C+YY +GQCL       +  DY+   KE+  F +G    I ++++ K   AA  L FE + +Y ++ +++     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  +Y++  E  LT I ++Y      +P  V +   +  E ++ L ++   K + P +G KK +++ A  NA   ++ K+  L  N  +   ++E + +LL I    R+E FDNSNI  T+ V AMVV+ENGV NK EYRK+ I   +   DY  M+EV+ RRY          P+LII+DGG+ QV  A + ++  EL   IP+ GL K+DKH+T  ++  +  E ++L + S  +F L  IQDEVHRFAI F+R  +SK+ F + L  I+ LG  R + L++ ++++  I+ AS++E+++  VP +VA +
  S:    29 MNDLIKHKLELLPDSPGCYLHKNKYGKIIYVGKAKNLRNRVRSYFRGAHDTKTEALVAEIADFEFIVTDSNIEALLLEINLIQENKPRYNIMLKDDKSYPFIKITKERHPRLLITR-QIKKDGGQYFGPYPDVGAANQTL-KLLERLYPFRKCKLPENKYCLYYHLGQCLAHGDNMPSLSDYDKMAKEVAQFLTGHDDKIIKEVQDKMKAAAGNLEFEKAAEYRDVLQSISTLRTKQRVMAHDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERNVNLFPYYNDAGEDFLTYIGQFYRDQQHLIPSEVLIPQDIDQEAVEALVDT---KVIKPQRGEKKQLINLATKNARVSLEQKFNLLEKNLEKTYGAVENIGQLLGIPTPVRIEAFDNSNIMGTSPVSAMVVFENGVPNKKEYRKYKINTVEGPDDYASMREVLQRRYSRVLRDGLTPPDLIIIDGGQGQVNVAKQVIE-QELGMSIPIAGLQKNDKHQTHELLFGNPLEVVELPRNSQEFFLLHRIQDEVHRFAIEFHRQVRSKNSFSSKLDGIEGLGPKRKQTLMKHFKSIGNIQSASLQEIAEAGVPYKVADK 611
>gi|146318403|ref|YP_001198115.1| excinuclease ABC subunit C [Streptococcus suis 05ZYH33] >gi|145689209|gb|ABP89715.1| Nuclease subunit of the excinuclease complex [Streptococcus suis 05ZYH33] (622 aa)
Score = 908, Expect = 1.5e-95, Identities = 212/588 (36%), Positives = 345/588 (58%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MN+ IK KL+ +P  PGCYL K+K G +IYVGKA +L NR++ YF    D KT+ L  EI D +++V ++  E+LLLE NLI + KP+YN++L++  ++P+I +TKE HPR+L +    KK  G Y+GP+ +       L   + R++P RKC    NK C+YY +GQCL       +  DY+   KE+  F +G    I ++++ K   AA  L FE + +Y ++ +++     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  +Y++  E  LT I ++Y      +P  V +   +  E ++ L ++   K + P  G KK +++ A  NA   ++ K+  L  N  +   ++E + +LL I    R+E FDNSNI  T+ V AMVV+ENGV NK EYRK+ I   +   DY  M+EV+ RRY          P+LII+DGG+ QV  A + ++  EL   IP+ GL K+DKH+T  ++  +  E ++L + S  +F L  IQDEVHRFAI F+R  +SK+ F + L  I+ LG  R + L++ ++++  I+ AS++E+++  VP +VA+++K+
  S:    29 MNDLIKHKLELLPDSPGCYLHKNKYGKIIYVGKAKNLRNRVRSYFRGAHDTKTEALVAEIADFEFIVTDSNIEALLLEINLIQENKPRYNIMLKDDKSYPFIKITKERHPRLLITR-QIKKDGGQYFGPYPDVGAANQTL-KLLERLYPFRKCKLPENKYCLYYHLGQCLAHGDNMPSLSDYDKMAKEVAQFLTGHDDKIIKEVQDKMKAAAGNLEFEKAAEYRDVLQSISTLRTKQRVMAHDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERNVNLFPYYNDAGEDFLTYIGQFYRDQQHLIPSEVLIPQDIDQEAVEALVDT---KVIKPQLGEKKQLINLATKNARVSLEQKFNLLEKNLEKTYGAVENIGQLLGIPTPVRIEAFDNSNIMGTSPVSAMVVFENGVPNKKEYRKYKINTVEGPDDYASMREVLQRRYSRVLRDGLTPPDLIIIDGGQGQVNVAKQVIE-QELGMSIPIAGLQKNDKHQTHELLFGNPLEVVELPRNSQEFFLLHRIQDEVHRFAIEFHRQVRSKNSFSSKLDGIEGLGPKRKQTLMKHFKSIGSIQSASLQEIAEAGVPYKVAEKVKE 614
>gi|172058170|ref|YP_001814630.1| excinuclease ABC, C subunit [Exiguobacterium sibiricum 255-15] >gi|171990691|gb|ACB61613.1| excinuclease ABC, C subunit [Exiguobacterium sibiricum 255-15] (594 aa)
Score = 900, Expect = 1.3e-94, Identities = 205/586 (34%), Positives = 353/586 (60%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL-SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE----IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           E IK KL  +P +PGCYL K++ G VIYVGKA +L NR++ YF    DLKT++L  +I D +Y++  +E E+LLLE  LI K+ PKYN++L++  ++PY+ +T E +PR++ +    KK  G Y+GP+ N+     E    ++R++PLRKC  +P K C+YY IGQCLGPC       D +  + EI  F SG++K + + L++K   AAE++ FE + +  +  + ++    +Q++I +     D+ G Y  +  + + +F    G ++ +   +   Y    E L + I ++Y K     P  +Y+  L ++ L  L E+L ++   P +G K+ ++D A  NA   +  ++  +  ++ + + +++EL   +DI  L R+EI DN+NI   + V A+VV+E+G   K EYRKF IK      DY+ M+E++ RRY+        +P+L+++DGG  Q+ AALE ++  EL   +PV  L KDDKH+T +++   F E    I+L  +S  ++ L  +QDEVHRFAI+F+R+ +SK +  + L  I  +G  R ++L+  + ++  +K+A++E+L++  +P+++A+ + +
  S:     5 EHIKAKLSLLPDEPGCYLHKNQFGEVIYVGKAKNLKNRVRSYFTGAHDLKTERLVADIRDFEYIITGSELEALLLEMTLIKKHDPKYNIMLKDDKSYPYLKITNETYPRLITTR-KLKKDGGHYFGPYPNAYAAN-ETKRLLDRLYPLRKCQPMPKKLCLYYHIGQCLGPCEIPNLEGDQKEIVSEIRRFLSGETKDLVQSLQQKMSVAAEEMEFERAGELRDQIRAIESIMNKQNMITADLTARDVFGIYVDKGWMCVQVFFLRGGKMIERDVSLFPIYGTPAEELESFIVQFYEKNI--KPSEIYVPPLVNQML--LKEALSLRVHVPVRGSKRKLLDLATKNAENAIGERFELIARDEKKTVQAVQELADAIDIHPLSRIEIIDNANIQGADAVSALVVFEDGKPLKKEYRKFKIKTVTGPDDYESMREIVRRRYRRLLLEGARLPDLVLIDGGLGQLNAALEVIQD-ELGLSLPVGSLKKDDKHRTSQLL---FGEGGRLIELHPRSSAFYLLQRMQDEVHRFAITFHRSLRSKGMTRSLLDDIPGVGPKRRQQLIRHFGSMRSLKKANIEQLTEAGLPVKLAETVAE 586
>gi|77412862|ref|ZP_00789067.1| excinuclease ABC, C subunit [Streptococcus agalactiae 515] >gi|77161158|gb|EAO72264.1| excinuclease ABC, C subunit [Streptococcus agalactiae 515] (583 aa)
Score = 898, Expect = 1.8e-94, Identities = 207/576 (35%), Positives = 335/576 (58%)
  Q:    12 IPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           +P  PGCYL KDKNG +IYVGKA +L NR+K YF    + KT+ L +EI D +Y+V  +  E+LLLE NLI +  PKYN+ L++  ++PYI +T E +PR++ +    KK  GTY+GP+ +S     E+   ++R+FP +KC    NK C YY +GQC    + +  +  ++   +++  F +GK   I   L +K   AA  + FE + +Y +L + + +   +Q +I     D D+ G++  +  + + +F   NG L+ +   +  +Y+E +E  LT I ++Y      LPK V++   D   K++   +  K + P +G KK +++ A  NA   ++ K+  L  +  +   ++E L  LL+I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRKF IK      DY  M+EVI+RRY          P+LI++DGG+ QV  A + ++  +L   IP+ GL K+DKH+T  ++  D  E ++L + S+ +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L++ +++L  I++A +E++    +P  VA+ ++
  S:     2 LPDSPGCYLHKDKNGTIIYVGKAKNLKNRVKSYFHGSHNTKTELLVSEIEDFEYIVTTSNTEALLLEINLIQENMPKYNIRLKDDKSYPYIKITNERYPRLMITR-QVKKSDGTYFGPYPDSGAAT-EIKRLLDRLFPFKKCTNPANKVCFYYHLGQCNAHTVCQTNKAYWDSLREDVKQFLNGKDNKIVNGLTEKMKSAAMTMEFERAAEYRDLIEAISLLRTKQRVIHQDMKDRDVFGYFVDKGWMCVQVFFVRNGKLIQRDVNMFPYYNEPEEDFLTYIGQFYQDTKHFLPKEVFIP-QDIDAKSVETIVGCKIVKPQRGEKKQLVNLAIKNARVSLQQKFDLLEKDIRKTHGAIENLGNLLNIPKPVRIEAFDNSNIQGTSPVAAMVVFVNGKPSKKDYRKFKIKTVIGPDDYASMREVIHRRYSRVLKDGLTPPDLIVIDGGQGQVNIARDVIEN-QLGLAIPIAGLQKNDKHQTHELLFGDPLEVVELPRNSEEFFLLHRIQDEVHRFAITFHRQLRSKNSFSSKLDGITGLGPKRKQLLMKHFKSLPNIQKAEIEDIIMCGIPRTVAESLR 575
>gi|77407834|ref|ZP_00784587.1| excinuclease ABC, C subunit [Streptococcus agalactiae COH1] >gi|77173581|gb|EAO76697.1| excinuclease ABC, C subunit [Streptococcus agalactiae COH1] (583 aa)
Score = 898, Expect = 1.8e-94, Identities = 207/576 (35%), Positives = 335/576 (58%)
  Q:    12 IPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           +P  PGCYL KDKNG +IYVGKA +L NR+K YF    + KT+ L +EI D +Y+V  +  E+LLLE NLI +  PKYN+ L++  ++PYI +T E +PR++ +    KK  GTY+GP+ +S     E+   ++R+FP +KC    NK C YY +GQC    + +  +  ++   +++  F +GK   I   L +K   AA  + FE + +Y +L + + +   +Q +I     D D+ G++  +  + + +F   NG L+ +   +  +Y+E +E  LT I ++Y      LPK V++   D   K++   +  K + P +G KK +++ A  NA   ++ K+  L  +  +   ++E L  LL+I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRKF IK      DY  M+EVI+RRY          P+LI++DGG+ QV  A + ++  +L   IP+ GL K+DKH+T  ++  D  E ++L + S+ +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L++ +++L  I++A +E++    +P  VA+ ++
  S:     2 LPDSPGCYLHKDKNGTIIYVGKAKNLKNRVKSYFHGSHNTKTELLVSEIEDFEYIVTTSNTEALLLEINLIQENMPKYNIRLKDDKSYPYIKITNERYPRLMITR-QVKKSDGTYFGPYPDSGAAT-EIKRLLDRLFPFKKCTNPANKVCFYYHLGQCNAHTVCQTNKAYWDSLREDVKQFLNGKDNKIVNGLTEKMKSAAMTMEFERAAEYRDLIEAISLLRTKQRVIHQDMKDRDVFGYFVDKGWMCVQVFFVRNGKLIQRDVNMFPYYNEPEEDFLTYIGQFYQDTKHFLPKEVFIP-QDIDAKSVETIVGCKIVKPQRGEKKQLVNLAIKNARVSLQQKFDLLEKDIRKTHGAIENLGNLLNIPKPVRIEAFDNSNIQGTSPVAAMVVFVNGNPSKKDYRKFKIKTVIGPDDYASMREVIHRRYSRVLKDGLTPPDLIVIDGGQGQVNIARDVIEN-QLGLAIPIAGLQKNDKHQTHELLFGDPLEVVELPRNSEEFFLLHRIQDEVHRFAITFHRQLRSKNSFSSKLDGITGLGPKRKQLLMKHFKSLPNIQKADIEDIIMCGIPRTVAESLR 575
>gi|24379665|ref|NP_721620.1| excinuclease ABC subunit C [Streptococcus mutans UA159] >gi|81446291|sp|Q8CWX4|UVRC_STRMU UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|24377620|gb|AAN58926.1|AE014960_7 putative excinuclease ABC (subunit C) [Streptococcus mutans UA159] (595 aa)
Score = 893, Expect = 8.2e-94, Identities = 213/588 (36%), Positives = 346/588 (58%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLS-DEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKF-LELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MNE IK KL+ +P  PGCY+ KDKNG +IYVGKA +L NR++ YF    + KT+ L +EI D +Y+V  +  E+LLLE NLI + KPKYN+ L++  ++P+I +T E +PR+L +    KK  G Y+GP+ +S     E+   ++R+FP +KC    NK C YY +GQC    I +  +  ++   +++ +F +G+   I  +L  K  +A+E + FE + +Y +L + + +   +Q ++     D DI G+Y  +  + + +F    G L+ +   +  +Y+E +E  LT + ++Y      +PK +++  + DE L  +   +  K + P +G KK +++ A  NA   ++ K+  L  +  +   ++E +  LL+I    R+E FDNSNI  T+ V AMVV+ +G  +K +YRKF IK      DY  M+EVIYRRY          P+LII+DGG+ QV  A + ++  L LD  IP+ GL K+DKH+T  ++  D  E I L + S+ +F L  IQDEVHRFAI+F+R  + K+ F + L  I  LG  R + L++ ++ L  I++AS++++    +P  VA+ I++
  S:     1 MNELIKHKLELLPDSPGCYIHKDKNGTIIYVGKAKNLKNRVRSYFHGSHNTKTELLVSEIEDFEYIVTGSNTEALLLEINLIQENKPKYNIRLKDDKSYPFIKITNEPYPRLLITR-QVKKDGGLYFGPYPDSGAAT-EIKRLLDRLFPFKKCTNPANKVCFYYHLGQCKAHTICQTDQTYWDSLKEDVKNFLNGRDDKIVNELRDKMTKASELMEFERAAEYRDLIEGIGLLRTKQRVMNQDMQDRDIFGYYVDKGWMCVQVFFIRQGKLIQRDVNMFPYYNESEEDFLTYVGQFYQDNRHFIPKEIFIPRNIDETL--VKAVVNTKIIKPQRGEKKQLVNLATKNARVSLQQKFDLLEKDIRKTHGAIENIGDLLNIPKPVRIEAFDNSNIQGTSPVAAMVVFVDGKPSKKDYRKFKIKTVIGPDDYASMREVIYRRYSRVMRDGLTPPDLIIIDGGQGQVNVARDVIENKLGLD--IPIAGLQKNDKHQTHELLFGDPLEVIPLPRNSEEFFLLQRIQDEVHRFAITFHRQLRGKNTFSSKLNGIAGLGPKRKQLLMKHFKNLPNIQKASLDDIINCGIPKNVAENIQE 586
>gi|50914154|ref|YP_060126.1| excinuclease ABC subunit C [Streptococcus pyogenes MGAS10394] >gi|73920384|sp|Q5XCC0|UVRC_STRP6 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|50903228|gb|AAT86943.1| Excinuclease ABC subunit C [Streptococcus pyogenes MGAS10394] (598 aa)
Score = 892, Expect = 1.1e-93, Identities = 212/588 (36%), Positives = 337/588 (57%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLS-DEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKT-DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MNE IK KL+ +P  PGCYL KDK G +IYVGKA +L  R++ YF    D KT+ L +EI D +Y+V  ++ E+LLLE NLI K  PKYN+ L++  ++P++ +T E  PR++ +    KK  G Y+GP+ +S     E+   ++RIFP +KC    NK C YY +GQC    I    +  ++  + ++  F +GK   I E L  K + A+E++ FE + +Y +L   +     +Q ++     D DI G+Y  +  + + +F    G L+ +   +  +Y++ +E  LT + ++Y      +PK V++  + DE+L  ++  +  K + P +G KK ++  A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ +G  +K +YRKF IK      DY  M+EV++RRY        + PNLIIVDGG  QV  A + ++  +L   IPV GL K+DKH+T D +       + L ++S+ +F L  IQDEVHRFA++F+R  + K+ F ++L  I  LG  R + LL  ++T+  I  A+ EE+  + +P  V + I++
  S:     1 MNELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFRGSHDTKTELLVSEIVDFEYIVTESDTEALLLEINLIQKNMPKYNIKLKDDKSYPFLKITNESFPRLVITR-YIKKNDGLYFGPYPDSYTAN-EVKKLLDRIFPFKKCKNPINKVCFYYHLGQCCAHTICHTDKAYWDRLIDDVKHFLNGKDDKIIEDLRSKMLAASEEMAFERAAEYRDLISGIATMRTKQRVMSKDLQDRDIFGYYVDKGWMCVQVFFVRQGKLIQRDVNLFPYYNDAEEDFLTYMGQFYQDKQHFIPKEVFIPEAIDEEL--VAAIVPTKIIKPKRGEKKQLVALATKNARVSLQQKFDLLEKDIKKTSGAIENLGQLLRIDKPVRIEAFDNSNIQGTSPVAAMVVFVDGKPSKKDYRKFKIKTVVGPDDYASMREVLFRRYSRVKKEGLQAPNLIIVDGGVGQVNVAKDVIE-KQLGLTIPVAGLQKNDKHQTHDLLFGNPLEVVSLPRRSEEFFLLHRIQDEVHRFAVTFHRQVRRKNSFSSTLDHISGLGPKRKQLLLRHFKTITAIASATSEEIQALGIPKTVVEAIQQ 586
>gi|56808206|ref|ZP_00365982.1| COG0322: Nuclease subunit of the excinuclease complex [Streptococcus pyogenes M49 591] >gi|94988536|ref|YP_596637.1| excinuclease ABC subunit C [Streptococcus pyogenes MGAS9429] >gi|94990413|ref|YP_598513.1| excinuclease ABC subunit C [Streptococcus pyogenes MGAS10270] >gi|94992359|ref|YP_600458.1| excinuclease ABC subunit C [Streptococcus pyogenes MGAS2096] >gi|94994335|ref|YP_602433.1| excinuclease ABC subunit C [Streptococcus pyogenes MGAS10750] >gi|119367845|sp|Q1JBZ4|UVRC_STRPB UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|119367846|sp|Q1JLX6|UVRC_STRPC UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|119367847|sp|Q1JH25|UVRC_STRPD UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|119367848|sp|Q1J6U4|UVRC_STRPF UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|94542044|gb|ABF32093.1| excinuclease ABC subunit C [Streptococcus pyogenes MGAS9429] >gi|94543921|gb|ABF33969.1| Excinuclease ABC subunit C [Streptococcus pyogenes MGAS10270] >gi|94545867|gb|ABF35914.1| Excinuclease ABC subunit C [Streptococcus pyogenes MGAS2096] >gi|94547843|gb|ABF37889.1| Excinuclease ABC subunit C [Streptococcus pyogenes MGAS10750] (598 aa)
Score = 892, Expect = 1.1e-93, Identities = 212/588 (36%), Positives = 337/588 (57%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLS-DEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKT-DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MNE IK KL+ +P  PGCYL KDK G +IYVGKA +L  R++ YF    D KT+ L +EI D +Y+V  ++ E+LLLE NLI K  PKYN+ L++  ++P++ +T E  PR++ +    KK  G Y+GP+ +S     E+   ++RIFP +KC    NK C YY +GQC    I    +  ++  + ++  F +GK   I E L  K + A+E++ FE + +Y +L   +     +Q ++     D DI G+Y  +  + + +F    G L+ +   +  +Y++ +E  LT + ++Y      +PK V++  + DE+L  ++  +  K + P +G KK ++  A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ +G  +K +YRKF IK      DY  M+EV++RRY        + PNLIIVDGG  QV  A + ++  +L   IPV GL K+DKH+T D +       + L ++S+ +F L  IQDEVHRFA++F+R  + K+ F ++L  I  LG  R + LL  ++T+  I  A+ EE+  + +P  V + I++
  S:     1 MNELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFRGSHDTKTELLVSEIVDFEYIVTESDTEALLLEINLIQKNMPKYNIKLKDDKSYPFLKITNESFPRLVITR-YIKKNDGLYFGPYPDSYTAN-EVKKLLDRIFPFKKCKNPINKVCFYYHLGQCCAHTICHTDKAYWDRLIDDVKHFLNGKDDKIIEDLRSKMLAASEEMAFERAAEYRDLISGIATMRTKQRVMSKDLQDRDIFGYYVDKGWMCVQVFFVRQGKLIQRDVNLFPYYNDAEEDFLTYMGQFYQDKQHFIPKEVFIPEAIDEEL--VAAIVPTKIIKPKRGEKKQLVALATKNARVSLQQKFDLLEKDIKKTSGAIENLGQLLRIDKPVRIEAFDNSNIQGTSPVAAMVVFVDGKPSKKDYRKFKIKTVVGPDDYASMREVLFRRYSRVKKEGLQAPNLIIVDGGVGQVNVAKDVIE-KQLGLTIPVAGLQKNDKHQTHDLLFGNPLEVVPLPRRSEEFFLLHRIQDEVHRFAVTFHRQVRRKNSFSSTLDHISGLGPKRKQLLLRHFKTITAIASATSEEIQALGIPKTVVEAIQQ 586
>gi|71903430|ref|YP_280233.1| excinuclease ABC subunit C [Streptococcus pyogenes MGAS6180] >gi|92058699|sp|Q48TS8|UVRC_STRPM UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|71802525|gb|AAX71878.1| excinuclease ABC subunit C [Streptococcus pyogenes MGAS6180] (598 aa)
Score = 891, Expect = 1.3e-93, Identities = 212/588 (36%), Positives = 337/588 (57%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLS-DEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKT-DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MNE IK KL+ +P  PGCYL KDK G +IYVGKA +L  R++ YF    D KT+ L +EI D +Y+V  ++ E+LLLE NLI K  PKYN+ L++  ++P++ +T E  PR++ +    KK  G Y+GP+ +S     E+   ++RIFP +KC    NK C YY +GQC    I    +  ++  + ++  F +GK   I E L  K + A+E++ FE + +Y +L   +     +Q ++     D DI G+Y  +  + + +F    G L+ +   +  +Y++ +E  LT + ++Y      +PK V++  + DE+L  ++  +  K + P +G KK ++  A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ +G  +K +YRKF IK      DY  M+EV++RRY        + PNLIIVDGG  QV  A + ++  +L   IPV GL K+DKH+T D +       + L ++S+ +F L  IQDEVHRFA++F+R  + K+ F ++L  I  LG  R + LL  ++T+  I  A+ EE+  + +P  V + I++
  S:     1 MNELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFRGSHDTKTELLVSEIVDFEYIVTESDTEALLLEINLIQKNMPKYNIKLKDDKSYPFLKITNESFPRLVITR-YIKKNDGLYFGPYPDSYTAN-EVKKLLDRIFPFKKCKNPINKVCFYYHLGQCCAHTICHTDKAYWDRLIDDVKHFLNGKDDKIIEDLRSKMLAASEEMAFERAAEYRDLISGIATMRTKQRVMSKDLQDRDIFGYYVDKGWMCVQVFFVRQGKLIQRDVNLFPYYNDAEEDFLTYMGQFYQDKQHFIPKEVFIPEAIDEEL--VAAIVPTKIIKPKRGEKKQLVALATKNARVSLQQKFDLLEKDIKKTSGAIENLGQLLKIDKPVRIEAFDNSNIQGTSPVAAMVVFVDGKPSKKDYRKFKIKTVVGPDDYASMREVLFRRYSRVKKEGLQAPNLIIVDGGVGQVNVAKDVIE-KQLGLTIPVAGLQKNDKHQTHDLLFGNPLEVVPLPRRSEEFFLLHRIQDEVHRFAVTFHRQVRRKNSFSSTLDHISGLGPKRKQLLLRHFKTITAIASATSEEIQALGIPKTVVEAIQQ 586
>gi|21910285|ref|NP_664553.1| excinuclease ABC subunit C [Streptococcus pyogenes MGAS315] >gi|28895862|ref|NP_802212.1| excinuclease ABC subunit C [Streptococcus pyogenes SSI-1] >gi|25453317|sp|Q8K7L7|UVRC_STRP3 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|21904480|gb|AAM79356.1| putative excinuclease ABC (subunit C) [Streptococcus pyogenes MGAS315] >gi|28811112|dbj|BAC64045.1| putative excinuclease ABC subunit C [Streptococcus pyogenes SSI-1] (598 aa)
Score = 890, Expect = 1.9e-93, Identities = 212/588 (36%), Positives = 337/588 (57%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLS-DEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKT-DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MNE IK KL+ +P  PGCYL KDK G +IYVGKA +L  R++ YF    D KT+ L +EI D +Y+V  ++ E+LLLE NLI K  PKYN+ L++  ++P++ +T E  PR++ +    KK  G Y+GP+ +S     E+   ++RIFP +KC    NK C YY +GQC    I    +  ++  + ++  F +GK   I E L  K + A+E++ FE + +Y +L   +     +Q ++     D DI G+Y  +  + + +F    G L+ +   +  +Y++ +E  LT + ++Y      +PK V++  + DE+L  ++  +  K + P +G KK ++  A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ +G  +K +YRKF IK      DY  M+EV++RRY        + PNLIIVDGG  QV  A + ++  +L   IPV GL K+DKH+T D +       + L ++S+ +F L  IQDEVHRFA++F+R  + K+ F ++L  I  LG  R + LL  ++T+  I  A+ EE+  + +P  V + I++
  S:     1 MNELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFRGSHDTKTELLVSEIVDFEYIVTESDTEALLLEINLIQKNMPKYNIKLKDDKSYPFLKITNESFPRLVITR-YIKKNDGLYFGPYPDSYTAN-EVKKLLDRIFPFKKCKNPINKVCFYYHLGQCCAHTICHTDKVYWDRLIDDVKHFLNGKDDKIIEDLRSKMLAASEEMAFERAAEYRDLISGIATMRTKQRVMSKDLQDRDIFGYYVDKGWMCVQVFFVRQGKLIQRDVNLFPYYNDAEEDFLTYMGQFYQDKQHFIPKEVFIPEAIDEEL--VAAIVPTKIIKPKRGEKKQLVALATKNARVSLQQKFDLLEKDIKKTSGAIENLGQLLKIDKPVRIEAFDNSNIQGTSPVAAMVVFVDGKPSKKDYRKFKIKTVVGPDDYASMREVLFRRYSRVKKEGLQAPNLIIVDGGVGQVNVAKDVIE-KQLGLTIPVAGLQKNDKHQTHDLLFGNPLEVVPLPRRSEEFFLLHRIQDEVHRFAVTFHRQVRRKNSFSSTLDHISGLGPKRKQLLLRHFKTITAIASATSEEIQALGIPKTVVEAIQQ 586
>gi|15675060|ref|NP_269234.1| excinuclease ABC subunit C [Streptococcus pyogenes M1 GAS] >gi|71910604|ref|YP_282154.1| excinuclease ABC subunit C [Streptococcus pyogenes MGAS5005] >gi|24212616|sp|Q99ZU3|UVRC_STRP1 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|13622214|gb|AAK33955.1| excinuclease ABC (subunit C) [Streptococcus pyogenes M1 GAS] >gi|71853386|gb|AAZ51409.1| excinuclease ABC subunit C [Streptococcus pyogenes MGAS5005] (598 aa)
Score = 888, Expect = 2.5e-93, Identities = 211/588 (35%), Positives = 337/588 (57%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLS-DEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKT-DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MNE IK KL+ +P  PGCYL KDK G +IYVGKA +L  R++ YF    D KT+ L +EI D +Y+V  ++ E+LLLE NLI K  PKYN+ L++  ++P++ +T E  PR++ +    KK  G Y+GP+ +S     E+   ++RIFP +KC    NK C YY +GQC    I    +  ++  + ++  F +GK   I E L  K + A++++ FE + +Y +L   +     +Q ++     D DI G+Y  +  + + +F    G L+ +   +  +Y++ +E  LT + ++Y      +PK V++  + DE+L  ++  +  K + P +G KK ++  A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ +G  +K +YRKF IK      DY  M+EV++RRY        + PNLIIVDGG  QV  A + ++  +L   IPV GL K+DKH+T D +       + L ++S+ +F L  IQDEVHRFA++F+R  + K+ F ++L  I  LG  R + LL  ++T+  I  A+ EE+  + +P  V + I++
  S:     1 MNELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFRGSHDTKTELLVSEIVDFEYIVTESDTEALLLEINLIQKNMPKYNIKLKDDKSYPFLKITNESFPRLVITR-YIKKNDGLYFGPYPDSYTAN-EVKKLLDRIFPFKKCKNPINKVCFYYHLGQCCAHTICHTDKAYWDRLIDDVKHFLNGKDDKIIEDLRSKMLAASKEMAFERAAEYRDLISGIATMRTKQRVMSKDLQDRDIFGYYVDKGWMCVQVFFVRQGKLIQRDVNLFPYYTDAEEDFLTYMGQFYQDKQHFIPKEVFIPEAIDEEL--VAAIVPTKIIKPKRGEKKQLVALATKNARVSLQQKFDLLEKDIKKTSGAIENLGQLLRIDKPVRIEAFDNSNIQGTSPVAAMVVFVDGKPSKKDYRKFKIKTVVGPDDYASMREVLFRRYSRVKKEGLQAPNLIIVDGGVGQVNVAKDVIE-KQLGLTIPVAGLQKNDKHQTHDLLFGNPLEVVPLPRRSEEFFLLHRIQDEVHRFAVTFHRQVRRKNSFSSTLDHISGLGPKRKQLLLRHFKTITAIASATSEEIQALGIPKTVVEAIQQ 586
>gi|125624511|ref|YP_001032994.1| excinuclease ABC subunit C [Lactococcus lactis subsp. cremoris MG1363] >gi|189038062|sp|A2RLW6|UVRC_LACLM UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|124493319|emb|CAL98290.1| excinuclease ABC, C subunit [Lactococcus lactis subsp. cremoris MG1363] (669 aa)
Score = 888, Expect = 2.6e-93, Identities = 225/587 (38%), Positives = 351/587 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVY----------------------------------------LSLSDEK---------------LKTLSESL-KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           MN+ IK KL+ +P  PGCYL KDKNG VIYVGKA +L NR++ YF    + KT+ L +EI D++++VV +  ESL+LE NLI +YKPKYN++L++   +P++ +T E++PR+L      +K   TY+GP+ +      E+   ++RIFP RKC     K C Y+ I QCL P +  V  Q Y+   +E+ +F +G  K I ++LE K I A++ + FE + +Y ++ K +     +Q ++     D D+ G+Y  +  + + +F    G L+ +   +  +Y++ +E  LT I ++Y      +P+ ++                                        L  SD+K                K LS  L K + + PS+G KK +++ A  NA   ++ K+     +  +   ++E L K+L I    R+E FDNSNI  T+ V AMVV+ +G  +K +YRK+ IK      DY  M+EV+ RRY         +P+LI +DGG  QV  A E L+  EL   IPV G+ K+DKH+T  ++  D  E + L ++S  +F L  IQDEVHRFAI+F+R  + K+ F + L  I  LG  R +KLL  ++ L  I+EA+V+E+++  VP EVA+ +K
  S:     1 MNQTIKAKLELLPDSPGCYLHKDKNGTVIYVGKAKNLKNRVRSYFHGSHNTKTELLVSEIEDLEWIVVGSNIESLVLEINLIQRYKPKYNIMLKDDKYYPFLKITNEKYPRLLVVR-KVQKDGATYFGPYPDVKAAN-EVKRLLDRIFPFRKCGLHEKKVCFYFHIHQCLCPVVNHVDPQVYKDMTQEVKEFLTGSDKKIVKELEGKMISASDNMEFEQAAEYRDVIKAIGTLRTKQRVMNQDLKDRDVFGYYVDKGWMCVQVFFVRQGKLIQRDVNMFPYYNDAEEDFLTYIGQFYQDNNHMMPREIFIPQDIDKDSVEAVVAASQEGNLLTKAQAKAVDAKVFTAKTLKFSDQKDVEQSIVKLDKELSSEKRLSSLLAKTQIIQPSRGEKKQLVNMATKNAQTQLQLKFDVAERDILKTTKAVENLGKILGIPKPVRIESFDNSNIMGTSPVSAMVVFIDGKPSKKDYRKYKIKTVVGADDYASMREVMTRRYSRALKEETALPDLIAMDGGAGQVNIAKEVLR--ELGLAIPVAGMQKNDKHQTSELLFGDPLEVVPLSRQSQEFFLLTRIQDEVHRFAITFHRQLRGKNTFSSKLDGIVGLGPKRKQKLLTTFKNLKAIEEATVQEVAEAGVPYEVAERVK 641
>gi|139473819|ref|YP_001128535.1| excinuclease ABC subunit C [Streptococcus pyogenes str. Manfredo] >gi|189038124|sp|A2REN0|UVRC_STRPG UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|134272066|emb|CAM30305.1| UvrABC system protein C [Streptococcus pyogenes str. Manfredo] (598 aa)
Score = 887, Expect = 3.9e-93, Identities = 211/588 (35%), Positives = 336/588 (57%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLS-DEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKT-DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MNE IK KL+ +P  PGCYL KDK G +IYVGKA +L  R++ YF    D KT+ L +EI D +Y+V  ++ E+LLLE NLI K  PKYN+ L++  ++P++ +T E  PR++ +    KK  G Y+GP+ +S     E+   ++RIFP +KC    NK C YY +GQC    I    +  ++  + ++  F +GK   I E L  K + A+E++ FE + +Y +L   +     +Q ++     D DI G+Y  +  + + +F    G L+ +   +  +Y++ +E  LT + ++Y      +PK V++  + DE+L  ++  +  K + P +G KK ++  A  NA   ++ K+  L  +  +   +++ L  LL I    R+E FDNSNI  T+ V AMVV+ +G  +K +YRKF IK      DY  M+EV++RRY        + PNLIIVDGG  QV  A + ++  +L   IPV GL K+DKH+T D +       + L ++S+ +F L  IQDEVHRFA++F+R  + K+ F ++L  I  LG  R + LL  ++T+  I  A+ EE+  + +P  V + I++
  S:     1 MNELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFRGSHDTKTELLVSEIVDFEYIVTESDTEALLLEINLIQKNMPKYNIKLKDDKSYPFLKITNESFPRLVITR-YIKKNDGLYFGPYPDSYTAN-EVKKLLDRIFPFKKCKNPINKVCFYYHLGQCCAHTICHTDKAYWDRLIDDVKHFLNGKDDKIIEDLRSKMLAASEEMAFERAAEYRDLISGIATMRTKQRVMSKDLQDRDIFGYYVDKGWMCVQVFFVRQGKLIQRDVNLFPYYNDAEEDFLTYMGQFYQDKQHFIPKEVFIPEAIDEEL--VAAIVPTKIIKPKRGEKKQLVALATKNARVSLQQKFDLLEKDIKKTSGAIDNLGHLLGINKPVRIEAFDNSNIQGTSPVAAMVVFVDGKPSKKDYRKFKIKTVVGPDDYASMREVLFRRYSRVKKEGLQAPNLIIVDGGVGQVNVAKDVIE-KQLGLTIPVAGLQKNDKHQTHDLLFGNPLEVVPLPRRSEEFFLLHRIQDEVHRFAVTFHRQVRRKNSFSSTLDHISGLGPKRKQLLLRHFKTITAIASATSEEIQALGIPKTVVEAIQQ 586
>gi|19746037|ref|NP_607173.1| excinuclease ABC subunit C [Streptococcus pyogenes MGAS8232] >gi|24212606|sp|Q8P163|UVRC_STRP8 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|19748204|gb|AAL97672.1| excinuclease ABC (subunit C) [Streptococcus pyogenes MGAS8232] (598 aa)
Score = 886, Expect = 5.0e-93, Identities = 210/588 (35%), Positives = 336/588 (57%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLS-DEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKT-DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MNE IK KL+ +P  PGCYL KDK G +IYVGKA +L  R++ YF    D KT+ L +EI D +Y+V  ++ E+LLLE NLI K  PKYN+ L++  ++P++ +T E  PR++ +    KK  G Y+GP+ +S     E+   ++RIFP +KC    NK C YY +GQC    I    +  ++  + ++  F +GK   I E L  K + A+E++ FE + +Y +L   +     +Q ++     D DI G+Y  +  + + +F    G L+ +   +  +Y++ +E  LT + ++Y      +PK V++  + DE+L  ++  +  K + P +G KK ++  A  NA   ++ K+  L  +  +   +++ L  LL I    R+E FDNSNI  T+ V AMVV+ +G  +K +YRKF +K      DY  M+EV++RRY        + PNLIIVDGG  QV  A + ++  +L   IPV GL K+DKH+T D +       + L ++S+ +F L  IQDEVHRFA++F+R  + K+ F ++L  I  LG  R + LL  ++T+  I  A+ EE+  + +P  V + I++
  S:     1 MNELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFRGSHDTKTELLVSEIVDFEYIVTESDTEALLLEINLIQKNMPKYNIKLKDDKSYPFLKITNESFPRLVITR-YIKKNDGLYFGPYPDSYTAN-EVKKLLDRIFPFKKCKNPINKVCFYYHLGQCCAHTICHTDKAYWDRLIDDVKHFLNGKDDKIIEDLRSKMLAASEEMAFERAAEYRDLISGIATMRTKQRVMSKDLQDRDIFGYYVDKGWMCVQVFFVRQGKLIQRDVNLFPYYNDAEEDFLTYMGQFYQDKQHFIPKEVFIPEAIDEEL--VAAIVPTKIIKPKRGEKKQLVALATKNARVSLQQKFDLLEKDIKKTSGAIDNLGHLLGINKPVRIEAFDNSNIQGTSPVAAMVVFVDGKPSKKDYRKFKVKTVVGPDDYASMREVLFRRYSRVKKEGLQAPNLIIVDGGVGQVNVAKDVIE-KQLGLTIPVAGLQKNDKHQTHDLLFGNPLEVVPLPRRSEEFFLLHRIQDEVHRFAVTFHRQVRRKNSFSSTLDHISGLGPKRKQLLLRHFKTITAIASATSEEIQALGIPKTVVEAIQQ 586
>gi|116617637|ref|YP_818008.1| excinuclease ABC subunit C [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096484|gb|ABJ61635.1| Excinuclease ABC subunit C [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (599 aa)
Score = 886, Expect = 5.4e-93, Identities = 201/575 (34%), Positives = 334/575 (58%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEI-KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           + I+ KL  +P +PG Y  KD+NG +IYVGKA +L NR++ YF +D D KT +L ++I D D++V N++ E+ LLEN LI KYKP YN+ L+    +PYI +TKE +P++   ++  KK  G Y+GP+ N    + E   F+ + +PLR+CN    + C+YY++GQCLG C + V  Q+Y   +  I  F  G +K + +Q+ +K   AA  L FE +    +  K +    E Q ++       D+  +Y  +  +++ +F      L+ ++        E DE + + I ++YS+  I+ P+ V +    +  K LS  L++    P +G K++++D A  NA  +++ K+  +  N+ +   +++E+   L I   +R+E FD+S+      V AMVV+++G+ NK EYRK+ IK  D  +++   +EVI RRY       G+ P+LI++DGG+ Q+ AA E L+     + IP+  + K+DKHKT  ++    ++I  LDK+S+ +F +  +Q+EVHRFAISF+R  +SK+   + L  I+ +G    +KLL ++ +L KI  ASV +L  I
  S:     7 QHIEQKLILLPSEPGSYQMKDQNGKIIYVGKAKNLKNRVRSYFKQDHDGKTAELVSKIVDFDFIVTNSDKEAFLLENELIKKYKPYYNIRLKYGTGYPYIKITKERNPKMALVNE-VKKDGGFYFGPYPNVYAAQ-ETLRFLEKNYPLRRCNGPQGRPCLYYNMGQCLGACFRDVPVQEYNDQISRIKKFLDGDTKIVKKQIAEKMQVAASSLEFERAADLRDQLKYIDETVESQRVLSKDTTPRDLFNYYMDKGWMTVEVFFLRQARLIRQFKRTFSIVGEADEEVSSFIQQFYSQKNIQKPREVLVPKGIDT-KALSAVLEVPVRIPVRGEKRELLDLAAKNARIVLEEKFRLMQLNERKTTGAMKEITDALQIPMGHRIEAFDHSHTQGVEIVSAMVVFDDGIPNKTEYRKYKIKSTDHANEWAETQEVIRRRYSRLLREDGDFPDLILMDGGEIQLHAAQEVLEDELGLTNIPIAAMVKNDKHKTADLIDGVTNQIVTLDKQSEGFFLIQRVQEEVHRFAISFHRQLRSKNSLASRLDTIQGVGPKTRQKLLREFGSLPKITAASVSDLVDI 579
>gi|163789539|ref|ZP_02183977.1| excinuclease ABC subunit C [Carnobacterium sp. AT7] >gi|159875071|gb|EDP69137.1| excinuclease ABC subunit C [Carnobacterium sp. AT7] (592 aa)
Score = 883, Expect = 1.1e-92, Identities = 211/588 (35%), Positives = 350/588 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRE-LNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWD-FSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           +N  I +KL  +P  PGCYL K+K   +IY+GKA +L  R++ YF    + KT+ L  EI D + ++ + + E LLLE  LI K+ PKYN+ L++  ++PY+ +T E+ P+++ + +  K+  G Y+GP+ N      E   FI +++PLRKCN    + C+YY +GQC+GPC  ++ +++Y   + +I  F +G  K I + L+ K +QAA++L FE + +Y    + ++   ERQ+II +     D+  +Y  +  ISI +F     +L+ +   I   Y    E L + + ++Y +    LPK + L  S    KTLSE L+I    P +G KKD++D A  N+ EI  N+  QLI   +R+ + +++EL + L +  + R+E FD+SNI  TN V AMV + +G  +K+ YRK+ IK+   +++    +EVI RRY+        +P+LI++DGGK QV  A+  L+  EL   IPV G+ KDDKH+T  ++  +   ++ L   S  ++ +  IQDEVHRFAI+F+R  + K+   + L +I+ +G     K+L+ ++++ K+ EASVEE++ + +P++ A  IK+
  S:     2 VNTHINNKLMLLPDLPGCYLMKNKEKEIIYIGKAKNLKKRVRSYFRGTHEGKTQLLVEEIVDFETIITSTDKECLLLEITLIKKHLPKYNIKLKQGTSYPYLKITNEKDPQLIITSE-VKRDGGHYFGPYPNVYAAS-ETQQFIQKVYPLRKCNGYQKRACLYYHLGQCIGPCDHEIPKEEYNAQIDKIRRFLNGDVKEIKKILKSKMMQAADELAFERAAEYRNQIQYIETTVERQNIITNDFTTRDVFSYYMNKGWISIQVFFIRQATLIKREATIFPCYDTPQEELASYMVQFYQEENHLLPKEI-LVPSGVDTKTLSEVLEIPVKVPLQGRKKDMLDLATKNS-EISLNEKFQLIEMDDRKTIGAIKELSEALHLPLVSRIEAFDHSNIQGTNPVSAMVSFLDGRPDKSNYRKYKIKNVHGSNELATTEEVIRRRYERLLKEGKPLPDLILMDGGKIQVNGAINILEN-ELGLSIPVAGMVKDDKHRTSSLIFGEKLEKVSLKPTSQAFYLVQRIQDEVHRFAITFHRQLRGKNSLSSKLDRIEGVGPKTRTKILKHFKSVKKVTEASVEEINGLGIPLKTAVRIKE 587
>gi|13507864|ref|NP_109813.1| excinuclease ABC subunit C [Mycoplasma pneumoniae M129] >gi|2499104|sp|P75350|UVRC_MYCPN UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|1673677|gb|AAB95677.1| excinuclease ABC subunit C [Mycoplasma pneumoniae M129] (586 aa)
Score = 883, Expect = 1.2e-92, Identities = 204/562 (36%), Positives = 336/562 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK---CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKN-LKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK----YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIP--NLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYET 562
           +N  +  KLK  PHKPGCYLWKD  G V+YVGKA D+  R+  YF  +R  KT+ L   I DV+YV++ NEN++L LE  LI +YKP++N++L+E+N + Y  +T    P +       +  K  Y+GPFA+S  +  ++Y+ + ++FPLRKC   P+++   C YY +  C+G C+ + T + Y+  +K I  FF+   + +   L+++EI+A+E+  FE ++ +L+L+K  L++ + +Q      K   D IG+  ++NV++I +F YV+  L+ K    ++L      E++  L+T IY YYS   I  PKT+ +SLS+E L  L+ SLKI    P  G +K ++ T  +NA   +  K+   I+N NR     ++L +LL +  +  +EI D S     + VGAM+ YENG + K   R++NI + D   D +YM +V+YRR  ++  +  ++P  +L+IVDGG  Q+    +        +   +IGLAK+ +H+TD IV  D + I +DK + L+ +L  IQ+EV  FA      + S++ F+N L +I+ +G+  ++ LL+ ++T
  S:     4 VNNTLAFKLKNAPHKPGCYLWKDDAGQVLYVGKAKDIFKRVHHYFNPNRSFKTRALVERIADVEYVILKNENDALNLEAKLIKQYKPRFNLVLKENNGYLYFFITASVKPTLELGR-RYEFSKNKYFGPFASSKFRLRDIYDLLLKLFPLRKC--APHERGHPCFYYQLKMCMGQCMGEDTPERYQTTVKGIEQFFNHGPEQVLNHLQQQEIKASEQQNFEAARHFLDLQKAVLELVNMQQTAFIKAKQSHDFIGYVFEKNVLAITVFAYVDNQLIGKNQQVFELPQDDEKEVESALVTFIYHYYSTNKI--PKTLTVSLSEENLSLLANSLKINVTQPKNGEQKSILQTVIDNARYALNTKWTGFINNLNRA-EVHQQLAQLLQVPSIQSLEIIDISFYDKDHVVGAMLRYENGKRMKALSRRYNI-NIDHKGDTNYMADVVYRRIISSIQTHKQLPLSDLLIVDGGIAQINTVTKVFASFPNVTQPIIIGLAKNTRHQTDHIVLTDNTTINIDKNTPLFAYLTTIQEEVDSFAKHNAFKRVSRARFQNPLLQIEGVGRKTVQILLDNFQT 568
>gi|28378731|ref|NP_785623.1| excinuclease ABC subunit C [Lactobacillus plantarum WCFS1] >gi|38258748|sp|Q88VE9|UVRC_LACPL UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|28271568|emb|CAD64473.1| excinuclease ABC, subunit C [Lactobacillus plantarum WCFS1] (604 aa)
Score = 878, Expect = 4.0e-92, Identities = 202/584 (34%), Positives = 329/584 (56%)
  Q:     4 QIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKT-DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
            I+ KL  +P  PGCYL K+ N  +IYVGKA +L NR++ YF      KT +L +EI D +++V + + E+ LLE  LI K++P +N+ L++   +PYI +T E  P+IL   D  +K  G Y+GP+ N    + E  NFI +++PLR+C+    + C+YY +GQCLG C K V   +Y+  +K I  F +G  +++ +QL K+  QAA  L FE + +  +    ++M  E+Q II +     D+  FY  +  +SI +F      L+ +   +    S   E + + I ++Y++    LP+ V +    +K + LS+ L I    P +G KKD++D A  NA  +++ K+  L  ++ +   +++E+   L I   +++E FD+S+I   + V AMVV+ +G  NK  YRK+ ++  D   +    +EVI RRY         +P+LI++DGG+ Q++AA + L+  EL    PV  + K+D HKT D +       + LD KS  ++ L  IQDEVHRFAI+F+R   +K    + L +I  +G     KLL K+ ++ KI  AS+EE+  + +   VA+ +K
  S:     5 HIEHKLSLLPDLPGCYLMKNLNSQIIYVGKAKNLKNRVRSYFKSSHTGKTARLVSEIADFEFIVTSTDKEAFLLEITLIQKHQPYFNIKLKKGTGYPYIKITNERDPQILIVSD-VRKDGGYYFGPYPNVYAAQ-ETVNFIQKVYPLRRCHGFQKRPCLYYHMGQCLGACFKTVPVAEYDAQIKRIKSFLNGHVETVKKQLTKRMDQAAADLEFERAAELRDQLNYIEMTVEKQKIISNDNTPRDLFNFYLDKGWLSIQVFFIRQARLMKREKRLFPVVSTAPEEMTSFILQFYNRKNNVLPREVLVPNGLDK-QVLSDILGIPVRTPQRGQKKDLLDMAQKNARIVLEEKFRLLELDERKTTGAMQEITDALGIPAGHKIEAFDHSHIQGADLVSAMVVFTDGQPNKKLYRKYKLRTVDHADEAASTREVIRRRYTRLLKEHAALPDLILMDGGEIQLEAAKDVLEN-ELGIATPVAAMVKNDHHKTADLLASAGDQHLHLDPKSQGFYLLQRIQDEVHRFAITFHRQVHTKHSLSSRLDEIPGVGPKTRNKLLRKFGSMSKIAGASLEEIQSLGIAKNVAQTVK 586
>gi|15672822|ref|NP_266996.1| excinuclease ABC subunit C [Lactococcus lactis subsp. lactis Il1403] >gi|13878835|sp|Q9CH98|UVRC_LACLA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|12723766|gb|AAK04938.1|AE006318_1 excinuclease ABC subunit C [Lactococcus lactis subsp. lactis Il1403] (668 aa)
Score = 870, Expect = 3.9e-91, Identities = 220/587 (37%), Positives = 348/587 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVY----------------------------------------LSLSDEK---------------LKTLSESL-KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWD-FSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           MN+ IK KL+ +P  PGCYL KDKNG VIYVGKA +L NR++ YF    + KT+ L +EI D++++VV +  ESL+LE NLI +YKPKYN++L++   +P++ +T E++PR+L      +K   TY+GP+ +      E+   ++RIFP RKC     K C Y+ I QCL P +  V  Q ++   +E+ +F +G  K I  +LE K + +++ + FE + +Y ++ K +     +Q ++     D D+ G+Y  +  + + +F    G L+ +   +  +Y++ +E  LT I ++Y      +P+ ++                                        L  SD+K                K LS  L K + + PS+G KK +++ A  NA   ++ K+     +  +   ++E L K+L I    R+E FDNSNI  T+ V AMVV+ +G  +K +YRK+ IK      DY  M+EV+ RRY         +P+LI +DGG  QV    + LK  EL   IPV G+ K+DKH+T  ++  D    + L ++S  +F L  IQDEVHRFAI+F+R  + K+ F + L  I  LG  R +KLL  ++ L  I+EASV+E+++  +P EVA+ +K
  S:     1 MNQTIKAKLELLPDSPGCYLHKDKNGTVIYVGKAKNLKNRVRSYFHGSHNTKTELLVSEIEDLEWIVVGSNIESLVLEINLIQRYKPKYNIMLKDDKYYPFLKITNEKYPRLLVVR-KVQKDGATYFGPYPDVKAAN-EVKRLLDRIFPFRKCGLHEKKVCFYFHIHQCLCPVVNHVDPQVFKDMTQEVKEFLTGSDKKIVNELEAKMMVSSDNMEFEQAAEYRDVIKAIGTLRTKQRVMNQDLKDRDVFGYYVDKGWMCVQVFFVRQGKLIQRDVNMFPYYNDAEEDFLTYIGQFYQDNNHMMPREIFIPQDIDKESVEAVVAASQEGNLLTKAQAKEVDAKVFTAKTLKFSDQKDVEQSIVKLDKELSAEKRLSSLLAKTQIVQPSRGEKKQLVNMATKNAQSQLQLKFDVAERDILKTTKAVENLGKILGIPKPVRIESFDNSNIMGTSPVSAMVVFIDGKPSKKDYRKYKIKTVVGADDYASMREVMTRRYSRALKEETALPDLIAMDGGAGQVNITKQVLK--ELGLSIPVAGMQKNDKHQTSELLFGDPLDVVPLSRQSQEFFLLTRIQDEVHRFAITFHRQLRGKNTFSSKLDGIVGLGPKRKQKLLTTFKNLKAIEEASVQEVAEADIPYEVAERVK 641
>gi|42518995|ref|NP_964925.1| excinuclease ABC subunit C [Lactobacillus johnsonii NCC 533] >gi|81667898|sp|Q74JN8|UVRC_LACJO UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|41583282|gb|AAS08891.1| excinuclease ABC subunit C [Lactobacillus johnsonii NCC 533] (600 aa)
Score = 865, Expect = 1.4e-90, Identities = 209/574 (36%), Positives = 334/574 (58%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDE----DANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE------IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQ 576
           E I++KLK +P KPGCYL KD NG VIYVGK+ +L NR++ YF   +  +  +L  EI D D + V+++ ES LLE  LI KY+P YN+ L++   +PYI +T E  P+   +     K  G Y+GP+ N    +  L  FI +++PLR+C     + C+YY +GQCLG C K+V +  Y+  +++I  F +G    + + L +K  QA+  L FE + +  +  K ++   E+Q II +     DI  FY  ++ ISI IF      LL +   +       D  +  ++ I ++Y +    LPK V +    +  ++LSE LK+    P +G KK +++ A +NA   +  K+  L     +   + +E+   L +   +R+E FD+S+I   + V A+VV+ +G  +K+EYRK+ +K E    +A  +    +EV+ RRY        ++P+LI++DGG+ QV+A L+ L+  EL+  IPV G+ KDD H+T+ ++  D ++      I LD KS+ ++ +  IQDEVHRFAI+F+R   +K+   + L +IK +G     KLL K+ +L KIKEASV+EL +
  S:     4 EHIENKLKLLPDKPGCYLMKDVNGNVIYVGKSKNLKNRVRSYFKSKQVGRRAELVREIRDFDIITVSSDKESFLLEITLIKKYQPYYNVQLKQGTGYPYIEITNERDPQTRLT-SIVHKDHGYYFGPYPNVYAAQATL-KFIQKVWPLRRCTGHQGRPCLYYHMGQCLGACFKEVPKSTYDAQIRKIKRFLNGDIAQVKQDLTEKMTQASMDLEFERAAEIRDQLKYIEQTVEKQKIISNDHTQRDIFNFYVDKSWISIQIFFLRQAKLLRRETRLFPLTDTNDPQDAFVSFIAQFYGQRNRVLPKEVLVPAGMDN-ESLSEVLKVPVRTPQRGQKKALLEMAHDNAKLKLDEKFRLLELGNRKTKGAQKEIFDALGLPYGHRIESFDHSHIQGADPVSALVVFTDGEADKHEYRKYKLKGEVEHQNAADEVGNTREVVRRRYSRLLKEHKKMPDLILMDGGQIQVEACLDVLRN-ELNVNIPVAGMVKDDHHRTNHLIFGDPTKGEELKLIPLDPKSEGFYLMTRIQDEVHRFAITFHRRTHAKNALSSKLDEIKGIGPKSRNKLLRKFGSLKKIKEASVDELRE 585
>gi|171779772|ref|ZP_02920728.1| hypothetical protein STRINF_01609 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281874|gb|EDT47308.1| hypothetical protein STRINF_01609 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (598 aa)
Score = 861, Expect = 4.0e-90, Identities = 210/588 (35%), Positives = 344/588 (58%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKF-LELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           MNE IK KL+ +P  PGCY+ KDKNG +IYVGKA +L NR++ YF    + KT+ L +EI D +Y+V  +  E+LLLE NLI +  PKYN+ L++  ++P+I +T  E++PR++ +    KK    Y+GP+ +S     E+   ++RIFP +KC    NK C YY +GQC    I  V    +    +++ +F  GK   I + L+ K  +A++ + FE + +Y +L + +     +Q ++     D DI G+Y  +  + + +F    G L+ +   +  +Y++ +E  LT + ++Y      +PK +++   + +E +K + ++   K + P +G KK +++ A  NA   ++ K+  L  +  +   ++E + +LL+I    R+E FDNSNI  T+ V  MVV+ NG  +K  YRKF IK      DY  M+EVIYRRY          P+LII+DGG+ QV  A + ++  L LD  IP+ GL K+DKH+T  ++  D  E ++L + S+ +F L  IQDEVHRFAI+F+R  +SK+ F + L  I  LG  R + L++ +++L  +++A VE++    +P  VA  +K+
  S:     1 MNELIKHKLELLPDSPGCYIHKDKNGKIIYVGKAKNLKNRVRSYFHGSHNTKTELLVSEIEDFEYIVTGSNTEALLLEINLIQENMPKYNIKLKDDKSYPFIKITVNEQYPRLMITR-QIKKDGAMYFGPYPDSGAAT-EIKRLLDRIFPFKKCTNPANKVCFYYHLGQCKAHTICHVDHDYFVEMAQDVKNFLDGKDNKIVDGLKDKMQKASDMMEFERAAEYRDLLQAISTLRTKQRVMNQDMMDRDIFGYYVDKGWMCVQVFFVRQGKLIQRDVNMFPYYNDPEEDFLTYVGQFYRDSKHFIPKEIFIPQDIDEELVKAVVDT---KVIKPQRGEKKQLVNLAIKNARVSLQQKFDLLEKDIRKTHGAIENIGELLNIPKPVRIEAFDNSNIQGTSPVAGMVVFVNGKPSKKNYRKFKIKTVVGPDDYASMREVIYRRYSRVMKDGLTPPDLIIIDGGQGQVNVARDVIENKLGLD--IPIAGLQKNDKHQTHELLFGDPLEVVELPRNSEEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSKLDGIAGLGPKRKQLLMKHFKSLPNVQKADVEDIINCGIPRNVAVVVKE 587
>gi|90962073|ref|YP_535989.1| excinuclease ABC subunit C [Lactobacillus salivarius UCC118] >gi|119367662|sp|Q1WT45|UVRC_LACS1 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|90821267|gb|ABD99906.1| Excinuclease ABC subunit C [Lactobacillus salivarius UCC118] (590 aa)
Score = 860, Expect = 5.3e-90, Identities = 208/585 (35%), Positives = 339/585 (57%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLG-KTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           + I++KLK +P  PGCY+ KD N  +IYVGKA +L NR++ YF    + KT KL +EI + + ++ + + E+ LLE  LI K+KP YN+ L+    +PYI +T E+ P+ L      KK  G Y+GP+ N      E    + +++PLR+CN    + C+YY +GQCLG C K+V + +YE  +K+I  F +G    I ++LE+K   A+E L FE + +  +    ++M  E+Q II +     D+  FY  +  +S+ IF      L+ +   +       +  L + I ++Y++    LPK + +    +K +TLSE L I    P +G K+D+++ A  NA  +++ K+  L  ++ +   ++ E+   L + + +R+E FD+S++   + V AMV + +G   K EYRK+ +K+ D   +    +EVIYRRY         +P+LI++DG   Q+ AA++ L   +L   IPV G+ K+D+HKT  ++  +  +I LD KS+ ++ L  IQDEVHRFAI+F+R  +SK+   + L +I+ +G KTRI KLL  Y +L  I  ASVE+L  + +  +VA+ IK
  S:     4 QHIENKLKLLPDLPGCYMMKDINSRIIYVGKAKNLKNRVRSYFKSSHEGKTAKLVSEIRNFETIITSTDKEAFLLEITLIQKHKPYYNIKLKRGTGYPYIKITHEKDPQ-LKIVSQVKKDGGYYFGPYPNV-YAATETLQLLQKVYPLRRCNGYQKRPCLYYHMGQCLGACFKEVPQSEYEKQIKKIKSFLNGNVSKIKKELEQKMETASENLEFERAAEIRDQIHYVEMTVEKQKIISNDNTPRDLFAFYMNKGWLSLQIFSIRQARLMKREKRLFPCIDTPEAELESFILQFYNQKNRILPKEILVPSGMDK-ETLSEILGIPVKTPQRGQKRDLLEMAQKNARLVLEEKFRLLELDERKTTGAMNEITDALGLPNGHRIEAFDHSHLQGEDLVSAMVCFIDGKPEKTEYRKYKLKNVDHADEAASTREVIYRRYSRLLKEKANLPDLILMDGASIQINAAVDVLHN-QLGIDIPVAGMVKNDRHKTADLMTENDEKIGLDPKSEGFYLLQRIQDEVHRFAITFHRQVRSKNSLASRLERIQGVGPKTRI-KLLRNYGSLKNISAASVEDLESLGISKKVAQTIK 585
>gi|116511657|ref|YP_808873.1| excinuclease ABC subunit C [Lactococcus lactis subsp. cremoris SK11] >gi|116107311|gb|ABJ72451.1| Excinuclease ABC subunit C [Lactococcus lactis subsp. cremoris SK11] (658 aa)
Score = 857, Expect = 1.2e-89, Identities = 219/576 (38%), Positives = 343/576 (59%)
  Q:    12 IPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVY----------------------------------------LSLSDE--------KL-KTLSESLKIKFL-------NPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           +P  PGCYL KDKNG VIYVGKA +L NR++ YF    + KT+ L +EI D++++VV +  ESL+LE NLI +YKPKYN++L++   +P++ +T E++PR+L      +K   TY+GP+ +      E+   ++RIFP RKC     K C Y+ I QCL P +  V  Q Y+   +E+ +F +G  K I ++LE K I A++ + FE + +Y ++ K +     +Q ++     D D+ G+Y  +  + + +F    G L+ +   +  +Y++ +E  LT I ++Y      +P+ ++                                        L  SD+        KL K LS   ++  L        PS+G KK +++ A  NA   ++ K+     +  +   ++E L K+L I    R+E FDNSNI  T+ V AMVV+ +G  +K +YRK+ IK      DY  M+EV+ RRY         +P+LI +DGG  QV  A E L+  EL   IPV G+ K+DKH+T  ++  D  E + L ++S  +F L  IQDEVHRFAI+F+R  + K+ F + L  I  LG  R +KLL  ++ L  I+EA+V+E+++  VP EVA+ +K
  S:     1 MPDSPGCYLHKDKNGTVIYVGKAKNLKNRVRSYFHGSHNTKTELLVSEIEDLEWIVVGSNIESLVLEINLIQRYKPKYNIMLKDDKYYPFLKITNEKYPRLLVVR-KVQKDGATYFGPYPDVKAAN-EVKRLLDRIFPFRKCGLHEKKVCFYFHIHQCLCPVVNHVDPQVYKDMTQEVKEFLTGSDKKIVKELEGKMISASDNMEFEQAAEYRDVIKAIGTLRTKQRVMNQDLKDRDVFGYYVDKGWMCVQVFFVRQGKLIQRDVNMFPYYNDAEEDFLTYIGQFYQDNNHMMPREIFIPQDIDKDSVEAVVAASQEGNLLTKAQAKAVDAKVFTAKTLKFSDQEDVEQSIVKLDKELSSEKRLSSLLAKTQIIQPSRGEKKQLVNMATKNAQTQLQLKFDVAERDILKTTKAVENLGKILGIPKPVRIESFDNSNIMGTSPVSAMVVFIDGKPSKKDYRKYKIKTVVGADDYASMREVMTRRYSRALKEETALPDLIAMDGGAGQVNIAKEVLR--ELGLAIPVAGMQKNDKHQTSELLFGDPLEVVPLSRQSQEFFLLTRIQDEVHRFAITFHRQLRGKNTFSSKLDGIVGLGPKRKQKLLTTFKNLKAIEEATVQEVAEAGVPYEVAERVK 630
>gi|162447172|ref|YP_001620304.1| excinuclease ABC, subunit C [Acholeplasma laidlawii PG-8A] >gi|161985279|gb|ABX80928.1| excinuclease ABC, subunit C [Acholeplasma laidlawii PG-8A] (577 aa)
Score = 856, Expect = 1.3e-89, Identities = 218/584 (37%), Positives = 339/584 (58%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIKK 588
           +K+KL  +P +PGCY+  D++G VIYVGKA +L NR+  YF    + KT+KL +EI D +Y+V N+E ESL+LE NLI KY P YN+ L +  ++PY+ +T E+ P ++ S         T +GP+ NS   + E    + R++PLR+CN + +K C+YY +G CLGPC  +  + DY+P ++ I  F  G +K +  +LE++  QA+E L FE + +Y ++   +K  +E+Q +  +   D D I F   E+ ++I I     G +L  +  +  + ++  E  LT I  YY K    LP  +         K L    K K + P  G KK ++D A  NA+E + + Y    + + +    +E L+++ D K  Y +E+FDN+++F T  +  M+V+++    +  YRKF++K    N DY  MKEV+YRRY+       ++P+LI VDGGK QV AA E ++   LD  IP++GL KD  H  +  V  +   I LDKKS LY FL  + +EVHRF I+F++  K++  + + L  I  LG TR +KLL  ++++D IK AS E+L  I +P +V K IK+
  S:     1 MKEKLSILPTEPGCYMMLDQSGEVIYVGKAKNLKNRVSSYFRGAHNAKTEKLISEISDFNYIVTNSEQESLILEYNLIKKYAPLYNIRLIDDKSYPYLEITNEKDPMLVVSRYIEVDKTKTLFGPYPNSKSAR-ETLKLLQRLYPLRRCNPVDSKPCLYYHMGLCLGPCAHE--KVDYKPNIERITRFLKGDTKEVLNELEERMKQASEDLEFERAVEYRDMILAVKDTTEKQIMTLNDYKDRDFISFAYNEDDMAIQILMMRQGRILDTHKNVISYMTDPYETFLTYIKNYYDKFL--LPDELVFD-QQIPFKELQMYFKNKVVVPKIGDKKKLVDLAHKNALEDLTHYYKLYRAKEEKLGEQIEALEQIFDKKISY-IEVFDNAHLFGTAPISGMIVWKDYHFERKMYRKFHLK-TTTNDDYQAMKEVLYRRYQRLLVEKQKLPDLICVDGGKGQVSAAYEVIQLFNLD--IPILGLKKDKYHMLEGYVIQNEVTI-LDKKSPLYQFLGQLSEEVHRFTITFHQKTKNRKDYTSVLDNIPGLGPTRKKKLLASFKSIDDIKNASTEDLRSIGLPDKVIKSIKE 574
>gi|116629526|ref|YP_814698.1| excinuclease ABC subunit C [Lactobacillus gasseri ATCC 33323] >gi|122273536|sp|Q043W2|UVRC_LACGA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|116095108|gb|ABJ60260.1| Excinuclease ABC subunit C [Lactobacillus gasseri ATCC 33323] (600 aa)
Score = 854, Expect = 2.2e-89, Identities = 204/572 (35%), Positives = 333/572 (58%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVF--YSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDE----DANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE------IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           E I++KLK +P KPGCYL KD NG VIYVGK+ +L NR++ YF   +  +  +L  EI D D + V+++ ES LLE  LI KY+P YN+ L++   +PYI +T E  P+   +     K  G Y+GP+ N    +  L  FI +++PLR+C+    + C+YY +GQCLG C K+V +  Y+  +++I  F +G    + + L +K  QA+  L FE + ++ +  K ++   E+Q II +     DI  FY  ++ ISI +F      LL +   +      +E  +  ++ I ++Y +    LPK V +    +  + L+E L +    P +G K+ +++ A +NA   +  K+  L     +   + +E+   L +   +R+E FD+S+I   + V A+VV+ +G  +K+EYRK+ +K E    +A  +    +EV+ RRY        ++P+LI++DGG+ QV A L+ L+  EL+  IPV G+ KDD H+T+ ++  D ++      I L+ KS+ ++ +  IQDEVHRFAI+F+R   +K+   + L +IK +G     KLL K+ +L KIKEAS+EEL
  S:     4 EHIENKLKLLPDKPGCYLMKDINGNVIYVGKSKNLKNRVRSYFKSKQVGRRAELVREIRDFDIITVSSDKESFLLEITLIKKYQPYYNVQLKQGTGYPYIEITNERDPQTRLT-SFVHKDHGYYFGPYPNVYAAQATL-KFIQKVWPLRRCSGHQGRPCLYYHMGQCLGACFKEVPKSAYDKQIRKIKRFLNGDISQVKQDLTEKMTQASMNLEFERAAEFRDQLKYIEQTVEKQKIISNDHTQRDIFNFYVDKSWISIQVFFLRQAKLLRRETRLFPLTDTNEPQDAFVSFIAQFYGQRNRVLPKEVLVPAGIDN-EALAEVLGVAVRTPQRGQKRALLEMAHDNAKLKLDEKFRLLELGNRKTKGAQKEIFDALGLPYGHRIESFDHSHIQGADPVSALVVFTDGEPDKHEYRKYKLKGEVEHQNAADEVGNTREVVRRRYSRLLKEHKKMPDLILMDGGQIQVDACLDVLRN-ELNVNIPVAGMVKDDHHRTNHLIFGDPTQGEELKLIPLNPKSEGFYLMTRIQDEVHRFAITFHRRTHAKNALSSKLDEIKGIGPKSRNKLLRKFGSLKKIKEASIEEL 583
>gi|148543889|ref|YP_001271259.1| excinuclease ABC subunit C [Lactobacillus reuteri F275] >gi|184153289|ref|YP_001841630.1| excinuclease ABC subunit C [Lactobacillus reuteri F275] >gi|189038063|sp|A5VJ98|UVRC_LACRF UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|148530923|gb|ABQ82922.1| Excinuclease ABC subunit C [Lactobacillus reuteri F275] >gi|183224633|dbj|BAG25150.1| excinuclease ABC subunit C [Lactobacillus reuteri F275] (603 aa)
Score = 850, Expect = 7.5e-89, Identities = 205/576 (35%), Positives = 329/576 (57%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIK------DEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKT-DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +E ++ KL  +P KPGCYL K+ N  +IYVGKA +L NR++ YF      K  K+ +E+ D + +V +   ES LLE  LI K++P +N+ L++   +PYI +T E  P+I       KK  G Y+GP+ N    + E  +FI +++PLR+CN    + C+YY +GQCLG C K+V + DYE  +K+I  F SG + ++  QL KK  +AAE + FE + +  +    +++  E+Q II + K   D+  FY  +  +SI IF      L+ +   +        E + + I ++Y++    LP  + L       K +SE L +    P +G K+D++  A  NA   +  K+  L  +Q++   +++E+   L + + +R+E FD+S+I   + V AMVV+ NG   KN YRK+ +K      DE A++     +EVI RRY         +P++I +DGG+ Q+ AA + L+  EL   IPV+G+ K+DKH+T D +   D   I L+ +S  ++ +  IQDEVHRFAI+F+R   +K    + L +IK +G     KLL+KY ++ KI +ASV+E+  +
  S:     3 SEHLEHKLALLPDKPGCYLMKNINDQIIYVGKAKNLKNRVRSYFKSSHTGKVAKMVSEVADFETIVTSTNKESFLLEITLIQKHQPYFNIKLKKGTGYPYIKITNERDPQIKIV-SKIKKDGGYYFGPYPNVYAAE-ETMHFIQKVYPLRRCNGYQGRPCLYYHMGQCLGACFKEVPKSDYEEQIKKIKSFLSGNTATVKRQLTKKMQRAAENMEFERAAEIRDQLHYIEVTVEKQKIISNDKTPRDLFNFYMDKGWLSIQIFFIRQARLMKREKRLFPIVDTAVEEMTSFILQFYNRRNNILPHEILLPKGLPN-KEISEILGVPVRTPVRGEKRDLLAMAHENAQLSLDEKFRLLEMDQSKTTGAMKEITDALGLPEGHRIEAFDHSHIQGADPVSAMVVFINGEPAKNFYRKYKLKTVINHADEAAST-----REVIRRRYSRLLKENKPMPDMIFMDGGEIQMDAAKDVLEN-ELGLEIPVVGMVKNDKHQTADLLFGDDDHHINLNPRSQGFYLVQRIQDEVHRFAITFHRRVHTKHSLSSRLDEIKGVGPRTRTKLLKKYGSITKIAQASVDEIHSL 576
>gi|116492896|ref|YP_804631.1| excinuclease ABC subunit C [Pediococcus pentosaceus ATCC 25745] >gi|122265640|sp|Q03F33|UVRC_PEDPA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|116103046|gb|ABJ68189.1| Excinuclease ABC subunit C [Pediococcus pentosaceus ATCC 25745] (594 aa)
Score = 846, Expect = 2.0e-88, Identities = 200/586 (34%), Positives = 340/586 (58%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKT-DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           +E I+ KL  +P KPGCY  K+ N  +IYVGKA +L NR++ YF    + KT KL +EI D DY+V +++ E+ LLE  LI K++P YN+ L++   +PYI +T E+ PR+     S ++  G Y+GP+ N    + E  +F+ +++PLR+CN    + C+YY +GQCLG C ++V +++Y+  + +I  F  G    I + L+ K  +A+E + FE +    +    +++  E+Q II +     D+  FY  +  +SI IF      L+ +   +    +++++ L + I ++Y+     LP  + L  S    K ++E L +    P +G KK++++ A  NA   ++ K+  +  ++++   +++E+   L I + +R+E FD+S+I  +  V AMVV+ +G  +K  YRKF +   D   +    +EVI RRY         +P+LI++DGG  Q+ AA + L   EL   IPV G+ K+DKHKT D I       ++LD KS  ++ +  IQDEVHRFAI+F+R   +K+   + L  I+ +G     KLL+ + +L+KI++A+++E+ ++ +P +VAK IK
  S:     3 SEHIEHKLALLPDKPGCYQMKNLNSQIIYVGKAKNLKNRVRSYFKSSHEGKTAKLVSEIADFDYIVTSSDKEAFLLEITLIQKFQPYYNIKLKKGTGYPYIKITNEKDPRMEIV-SSVRRDGGFYFGPYPNVYAAE-ETLHFLEKVYPLRRCNGFQGRPCLYYHMGQCLGACFQEVPKEEYDQQIAKIKSFLRGNVAKIKQSLQTKMQKASEAMEFERAADIRDQIHYIEVTVEKQKIISNDSTPRDLFNFYLDKGWLSIQIFFIRQSRLIKREKRLFPIATDVNDELSSFILQFYNNKNKVLPNEI-LVPSGLDNKIMAEILGVPVRTPQRGEKKNLLELAKENAQITLEEKFRLMELDESKTTGAMKEITDALGIPEGHRIEAFDHSHIQGSELVSAMVVFTDGKPDKKMYRKFKLNTVDHADEAASTREVIRRRYVRLLKEKQSLPDLILMDGGDIQLNAAKDVL-VNELSLHIPVAGMVKNDKHKTSDLIFGSQDQRVQLDPKSQGFYLVQRIQDEVHRFAITFHRQLHAKNSLASQLDLIQGVGPKTRNKLLKSFGSLNKIRDANLKEIEELGIPEKVAKTIK 586
>gi|194468445|ref|ZP_03074431.1| excinuclease ABC, C subunit [Lactobacillus reuteri 100-23] >gi|194453298|gb|EDX42196.1| excinuclease ABC, C subunit [Lactobacillus reuteri 100-23] (603 aa)
Score = 845, Expect = 2.5e-88, Identities = 205/576 (35%), Positives = 329/576 (57%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIK------DEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKT-DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +E I+ KL  +P KPGCYL K+ N  +IYVGKA +L NR++ YF      K  K+ +E+ D + +V +   ES LLE  LI K++P +N+ L++   +PYI +T E  P+I       KK  G Y+GP+ N    + E  +FI +++PLR+CN    + C+YY +GQCLG C K+V + DYE  +K+I  F SG + ++  QL KK   AAE + FE + +  +    +++  E+Q II + K   D+  FY  +  +SI IF      L+ +   +        E + + I ++Y++    LP+ + L       K +SE L +    P +G K++++  A  NA   +  K+  L  +Q++   +++E+   L + + +R+E FD+S+I   + V AMVV+ NG   KN YRK+ +K      DE A++     +EVI RRY         +P++I +DGG+ Q+ AA + L+  EL   IPV+G+ K+DKH+T D +   D   I L+ +S  ++ +  IQDEVHRFAI+F+R   +K    + L +IK +G     KLL+KY ++ KI +ASV+E+  +
  S:     3 SEHIEHKLALLPDKPGCYLMKNINDQIIYVGKAKNLKNRVRSYFKSSHTGKVAKMVSEVADFETIVTSTNKESFLLEITLIQKHQPYFNIKLKKGTGYPYIKITNERDPQIKIV-SKIKKDGGYYFGPYPNVYAAE-ETMHFIQKVYPLRRCNGYQGRPCLYYHMGQCLGACFKEVPKSDYEEQIKKIKSFLSGNTATVKRQLTKKMQLAAENMEFERAAEIRDQLHYIEVTVEKQKIISNDKTPRDLFNFYMDKGWLSIQIFFIRQARLMKREKRLFPIVDTAVEEMTSFILQFYNRRNNILPREILLPKGLPN-KEISEILGVPVRTPVRGEKRNLLAMAHENAQLSLDEKFRLLEMDQSKTTGAMKEITDALGLPEGHRIEAFDHSHIQGADPVSAMVVFINGEPAKNFYRKYKLKTVINHADEAAST-----REVIRRRYSRLLKENKPMPDMIFMDGGEIQMDAAKDILEN-ELGLDIPVVGMVKNDKHQTADLLFGDDDHHINLNPRSQGFYLVQRIQDEVHRFAITFHRRVHTKHSLSSRLDEIKGVGPRTRTKLLKKYGSITKIAQASVDEIHSL 576
>gi|187606216|ref|ZP_02992384.1| excinuclease ABC, C subunit [Exiguobacterium sp. AT1b] >gi|187481730|gb|EDU19766.1| excinuclease ABC, C subunit [Exiguobacterium sp. AT1b] (594 aa)
Score = 845, Expect = 2.6e-88, Identities = 196/575 (34%), Positives = 340/575 (59%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIE----LPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE----IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQ 576
           ++ IK KL  +P +PGCYL K++ G VIYVGKA +L NR++ YF    D+KT +L  EI D +Y+V  +E E+LLLE  LI K+ PKYN+ L++   +PYI +T E +PR+L +    KK  G Y+GP+ N+     E    +++++PLRKC  +P K C+YY IGQCLGPC   V     +  ++EI  F +G++     +L  +  +AAE + FE + +  +  + ++    +Q++I +     D+ G+      + + +F    G ++ +   +   + E  E L + I ++Y +  +     +P+TV L L       L++++  K + P +G KK ++D A  NA   +  K+  L  ++ R L ++ EL + + I +L R++I DN+NI   + V A+VV+E+G   K EYRK+ I+      DY+ M+EV+ RR++        +P+L+++DGG  Q+ AAL+ ++  E    +PV  L KDD+H+T +++   F E    ++L  +S  ++ L  +QDEVHRFAI+F+R+ ++K + ++ L +I  +G  R ++L+  + ++ +I+ AS+E+L +
  S:     4 SDHIKHKLALLPDEPGCYLHKNEYGEVIYVGKAKNLKNRVRSYFTGAHDIKTMRLVAEIRDFEYIVTASELEALLLEMTLIKKHDPKYNIRLKDDKTYPYIKITNEPYPRLLTTR-KLKKDGGHYFGPYPNAYAAN-ETKRLLDKLYPLRKCQPMPKKLCLYYHIGQCLGPCELAVDTDSQKEIVQEIRRFLNGETSETLTKLNVEMGRAAEDMQFERAAELRDQIRAVESIMNKQNMITADPTARDVFGYTLDRGWMCVQVFYMRGGKMIERDVSLFPMHGEPSEELESFIVQFYEQNVVPKEILVPETVRLDL-------LNDAIGTKVMQPKRGAKKQLLDLATKNATIALNEKFELLARDEERTLLAMRELGEAIGIPNLSRVDIIDNANIQGADAVSALVVFEDGKPLKKEYRKYKIRTVQGPDDYETMREVVRRRFRRLLTEDKRLPDLLLIDGGIGQLNAALDVIQN-EFGLDLPVGSLKKDDRHRTSQLL---FGEGGGVVELHPRSSAFYLLQRMQDEVHRFAITFHRSLRTKKMTKSILDEIPGVGPKRRQQLIRHFGSMKQIRLASLEQLKE 573
>gi|161507438|ref|YP_001577392.1| excinuclease ABC subunit C [Lactobacillus helveticus DPC 4571] >gi|189038061|sp|A8YV13|UVRC_LACH4 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|160348427|gb|ABX27101.1| Excinuclease ABC subunit C [Lactobacillus helveticus DPC 4571] (600 aa)
Score = 842, Expect = 5.6e-88, Identities = 205/570 (35%), Positives = 334/570 (58%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK----YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDE----DANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWD------FSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           I++KLK +P KPGCYL KD NG VIYVGK+ +L NR++ YF   +  +  +L  EI D D + V+ + E+ LLE  LI KY+P YN+ L++   +PYI +T+E  P+   +    K   G Y+GP+ N    +  L  FI ++FPLR+C+    + C+YY +GQCLG C KKV +++Y+  +K+I  F +G   ++ + L +K  QA+E+L FE + +  +  K ++   E+Q II +     DI  +Y  ++ ISI IF      LL +    + L  +  ++ ++   + I ++Y +    LPK V +    +   TL+E L +    P +G KK ++D A +NA   + +K+  L     +   + +E+   L +   + +E FD+S+I   + V A+VV+++G  +K  YRK+ +K E    +   +    +EV+ RRY        ++P+LI++DGG+ QV A  + L+  EL+  IPV G+ KDDKH+T+ ++  D         I L+ KS+ ++ +  IQDEVHRFAI+F+R + +K+   + L  IK +G     KLL K+ +L KIKEASV++L
  S:     6 IENKLKLLPEKPGCYLMKDINGTVIYVGKSKNLKNRVRSYFKSKQVGRRAELVREIRDYDIITVSTDKEAFLLEITLIKKYQPYYNVQLKQGTGYPYIEITREHDPQTRLTSIVCKD-GGYYFGPYPNVYAAQATL-KFIQKVFPLRRCHGYQGRPCLYYHMGQCLGACFKKVPQKEYDEQIKKIKRFLNGDIGAVKQDLTQKMEQASEQLEFERAAEIRDQLKYIEETVEKQKIISNDNTQRDIFNYYVDKSWISIQIFFLRQAKLLRRETRMFPLTDI--TDPEDAFTSFIVQFYGQKNRVLPKEVLIPAGFDN-DTLAEVLTVPVRTPQRGQKKSLLDMAKDNAKLKLDDKFRLLELGNRKTKGAQKEIFDALGLPYGHIIESFDHSHIQGADPVSALVVFKDGEPDKTAYRKYKLKGEVEHQNGGDEVRNTREVVRRRYGRLLREHKKMPDLILMDGGQIQVDACEDVLRN-ELNLNIPVAGMVKDDKHRTNHLLFGDPINGVPLKLIPLNPKSEGFYLMTRIQDEVHRFAITFHRRRHAKNALSSRLDSIKGIGPKSRNKLLRKFGSLKKIKEASVDDL 583
>gi|116491096|ref|YP_810640.1| excinuclease ABC subunit C [Oenococcus oeni PSU-1] >gi|118586932|ref|ZP_01544365.1| excinuclease ABC, C subunit [Oenococcus oeni ATCC BAA-1163] >gi|122276722|sp|Q04EZ7|UVRC_OENOB UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|116091821|gb|ABJ56975.1| Excinuclease ABC subunit C [Oenococcus oeni PSU-1] >gi|118432659|gb|EAV39392.1| excinuclease ABC, C subunit [Oenococcus oeni ATCC BAA-1163] (607 aa)
Score = 839, Expect = 1.4e-87, Identities = 191/576 (33%), Positives = 327/576 (56%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +E I+ KL  +P +PG Y  KDKNG +IYVGKA +L NR++ YF  +   KT +L   I D +++V N++ E+ LLEN LI +Y+P +N+ L+ S ++PYI +T E  PR++ + ++ K   GTY+GP+ N      E  +F+   +PLR+CN    + C+YY +GQCLG C + V +++Y+  +  I  F +G++      ++KK  +A++   +E +  + +  K +    E Q ++ +     D+  FY  +  ++I IF    G LL +          + E L + I ++YS+   + PK V L   +   K L+E+L+I    P +G K+D++  A  NA   +++K+  +  N+ +   +++E+   L I   YR E FD+SN   +N V A+VV+E+G+ NKN YR++ ++      +     EVI RRY          P+LI++DGG+ Q+ +A  +L+ L++D  IPV  + K+DKH+T  ++      + LD  S  ++ L  IQDEVHRF I+F+R  ++K+   + L +I  +G     KL+ ++ +L KI +AS+E++  +
  S:     3 SELIEQKLALLPSQPGSYQMKDKNGKIIYVGKAKNLKNRVRSYFKAEHTGKTAELVANIHDFEFIVTNSDKEAFLLENTLIKRYRPYFNIRLKFSGSYPYIEITNERDPRLILA-NTLKHDHGTYFGPYPNVYAAS-ETLHFLEMTYPLRRCNGYQGRPCLYYSMGQCLGACWRTVPQEEYQKNIDAITRFLNGETGKAISDIKKKMKRASDSTEYELAADFRDRLKFIDQTVESQRVLQNDHTPRDLFNFYMDKGWMTIEIFFLRQGRLLRQQKETLALADSVKEELESYIQQFYSQKNAQKPKEV-LVPKNVDTKLLAETLEIPVRTPVRGEKRDLLKLAAKNARITLEDKFRLMELNEEKTTGAMKEITDALKIPHGYRFEAFDHSNTQGSNYVSALVVFEDGLPNKNLYRRYKLRTPTGQDEAKATFEVITRRYTRLRDEGQMYPDLILMDGGEIQLHSAEAALRKLDID--IPVAAMVKNDKHQTADLLNSRGENLFLDPHSQGFYLLQRIQDEVHRFVITFHRQLRTKTNLSSRLDEIAGIGPKSRVKLMRRFGSLPKIADASIEDIEAL 573
>gi|81428665|ref|YP_395665.1| excinuclease ABC subunit C [Lactobacillus sakei subsp. sakei 23K] >gi|90111069|sp|Q38WS5|UVRC_LACSS UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|78610307|emb|CAI55356.1| Excinuclease ABC, subunit C [Lactobacillus sakei subsp. sakei 23K] (592 aa)
Score = 839, Expect = 1.4e-87, Identities = 203/586 (34%), Positives = 334/586 (56%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIK--------DEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
           +E I+ KL  +P  PGCYL KD N  +IYVGKA +L NR++ YF    + KT KL +EI D + ++ +   E+ LLE  LI K++P +N+ L+    +PYI +T E  PR+L + D  KK    Y+GP+ +    + E   F+ R++PLR+C     + C+YY +GQCLG C ++V    Y   +K+I  F +G+  ++ + L +K   AA+++ FE + +  +  + ++   E+Q II +     D+  FY  +  +SI IF      L+ +   +    +  +E L T I ++Y++    LP+ + +    EK + LS+ L++    P +G KK +M+ A  N+  +++ K+  L  +  + + + +E+   L +   + +E FD+S+I  T+ V AMV + +G   K  YRK+ +         +EDAN+     +EVIYRRY         +P+LI++DGG  ++ AA + L+  EL   IPV G+ KD+ HKT  ++  +  + I+LD KS  ++ L  IQDEVHRFAISF+R  + K+   + L  IK +G     KLL+ + ++  IK+ASVEEL  + +   VA+ IK
  S:     3 SEHIEHKLALLPALPGCYLMKDINAQIIYVGKAKNLKNRVRSYFKSSHEGKTAKLVSEIVDFETIITSTNKEAFLLEITLIQKHQPYFNIKLKRGTGYPYIKITNERDPRLLITGD-VKKDGSYYFGPYPDVYAAQ-ETLRFLQRVYPLRRCQGHQGRPCLYYHMGQCLGACFQEVPEAAYTEQIKKIKRFLNGQVDNVKKDLTEKMATAAQEMQFERAAELRDQLRYIEATVEKQKIISNDHTPRDLFAFYMDKGWLSIQIFFIRQARLIRREKRLFPCVNTPEEELATFILQWYNRKNNVLPREILVPDGIEK-QVLSDILQVPIRTPQRGEKKALMEMAQKNSRLVLEEKFRLLELDNRKTVGAQDEIMDALGLPHGHVIEAFDHSHIQGTDPVSAMVTFVDGRAEKKLYRKYKLTQTAERAGANEDANT-----REVIYRRYSRLLKEGKALPDLILMDGGVVELNAAKDVLEN-ELGLTIPVAGMVKDNHHKTASLLFGEADQTIQLDPKSQGFYLLTRIQDEVHRFAISFHRQLRGKNSLSSKLDDIKGVGPKTRTKLLKNFGSMKHIKDASVEELEALGISKTVAQTIK 589
>gi|58337244|ref|YP_193829.1| excinuclease ABC subunit C [Lactobacillus acidophilus NCFM] >gi|75357715|sp|Q5FKH6|UVRC_LACAC UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|58254561|gb|AAV42798.1| excinuclease ABC subunit C [Lactobacillus acidophilus NCFM] (600 aa)
Score = 838, Expect = 1.6e-87, Identities = 205/572 (35%), Positives = 328/572 (57%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDE----DANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWD------FSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           E I++KLK +P KPGCYL KD NG VIYVGK+ +L NR++ YF   +  +  +L  EI D D + V+ + E+ LLE  LI KY+P YN+ L++   +PYI +T+E  P+   +     K  G Y+GP+ N    +  L  FI +++PLR+C+    + C+YY +GQCLG C KKV +++Y+  +K+I  F +G   S+ + L  K  +A+E L FE + +  +  K ++   E+Q II +     DI  +Y  ++ ISI IF      LL +   +       D  +   + I ++Y +    LPK + +  S     TL+E L +    P +G KK ++D A +NA   + +K+  L     +   + +E+   L +   + +E FD+S+I   + V A+VV+++G  +K  YRK+ +K E    +   +    +EV+ RRY        ++P+LI++DGG+ QV A  + L+  EL+  IPV G+ KDDKH+T+ ++  D         I LD KS+ ++ +  IQDEVHRFAI+F+R + +K+   + L  IK +G     KLL  + +L KIKEAS+E+L
  S:     4 ELIENKLKLLPEKPGCYLMKDINGTVIYVGKSKNLKNRVRSYFKSKQVGRRAELVREIRDYDIITVSTDKEAFLLEITLIKKYQPYYNVQLKQGTGYPYIEITREHDPQTRLT-SVVHKDGGYYFGPYPNVYAAQATL-KFIRKVYPLRRCHGYQGRPCLYYHMGQCLGACFKKVPQKEYDEQIKKIKSFLNGDITSVKQDLTTKMEKASENLEFERAAEIRDQLKYIEETVEKQKIISNDNTQRDIFNYYVDKSWISIQIFFLRQAKLLRRETRMFPLTDAADPEDAFTSFIVQFYGQKNRILPKEILIP-SGFDDDTLAEVLNVAVRTPQRGQKKSLLDMAKDNAKLKLDDKFRLLELGNRKTKGAQKEIFDALGLPYGHVIESFDHSHIQGADPVSALVVFKDGEPDKTSYRKYKLKGEVEHQNGGDEVRNTREVVRRRYGRLLREHKKMPDLILMDGGQIQVDACEDVLRN-ELNLNIPVAGMVKDDKHRTNHLLFGDPINGIPLKLIPLDPKSEGFYLMTRIQDEVHRFAITFHRRRHAKNALSSRLDSIKGIGPKSRNKLLRNFGSLKKIKEASIEDL 583
>gi|170017685|ref|YP_001728604.1| excinuclease ABC subunit C [Leuconostoc citreum KM20] >gi|169804542|gb|ACA83160.1| Excinuclease ABC, C subunit [Leuconostoc citreum KM20] (574 aa)
Score = 829, Expect = 2.1e-86, Identities = 191/556 (34%), Positives = 312/556 (56%)
  Q:    22 KDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           KDKNG +IYVGKA +L NR++ YF +D   KT +L   I D DY+V N++ E+ LLEN LI KYKP YN+ L+    +PYI +TKE  P++   ++  K+  G Y+GP+ N    + E   F+ + +PLR+CN    + C+YY++GQCLGPC   V ++ Y+  +  I  F  G + S+ + + +K   AAE L FE +    +  K +    E Q ++       D+  +Y  +  +++ +F      L+ +Y          DE ++  + ++Y++  I+ P  V +    +    LSE L+I    P +G K+D++D A  NA   ++ K+  +  N+ +   ++ E+   L+I    R+E FD+S+      V AMVV+++GV NK+ YRK+ IK      ++   +EVI RRY       GE+P+LI++DGG+ Q+ AA E L+     + +P+  + K+DKHKT  ++     E + L K+S+ +F +  +Q+EVHRFAI+F+R  +SK+   + L  I  +G    +KLL ++ +L KI  AS+E L  I
  S:     2 KDKNGKIIYVGKAKNLKNRVRSYFKQDHSGKTAELVQNITDFDYIVTNSDKEAFLLENELIKKYKPYYNIRLKYGTGYPYIKITKERDPKMALVNE-VKRDGGFYFGPYPNVYAAQ-ETLRFLEKNYPLRRCNGYQGRPCLYYNMGQCLGPCWHDVPQKAYDDQIARIKHFLDGNTASVKKAIAQKMQIAAETLEFERAADLRDQLKYIDETVESQRVLSKDTTPRDLFNYYLDKGWMTVEVFFLRQARLIRQYKQTFSVVGAADEEMMNFMQQFYAQRNIQKPNEVLVPKGIDT-NALSEMLQIPVRVPVRGEKRDLLDLAQKNARIALEEKFRLMQLNEKKTTGAMREITHALNIPMGKRIEAFDHSHTQGVEIVSAMVVFDDGVPNKDLYRKYKIKSVSHADEWSETQEVIRRRYSRILKEGGEMPDLILMDGGEIQLHAAKEVLEDELGLTSLPIAAMVKNDKHKTADLIDGRTGEVVVLSKQSEGFFLIQRVQEEVHRFAINFHRQLRSKNSLASRLDMIDGVGPKTRQKLLREFGSLPKIAGASIEALQAI 555
>gi|12045058|ref|NP_072868.1| excinuclease ABC, C subunit [Mycoplasma genitalium G37] >gi|2507151|sp|P47448|UVRC_MYCGE UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|3844804|gb|AAC71424.1| excinuclease ABC, C subunit [Mycoplasma genitalium G37] >gi|166078748|gb|ABY79366.1| excinuclease ABC, C subunit [synthetic Mycoplasma genitalium JCVI-1.0] (597 aa)
Score = 824, Expect = 7.5e-86, Identities = 207/587 (35%), Positives = 340/587 (57%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTY-YGPFANSNIKKYELYNFINRIFPLRKCN-KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKN-LKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK----YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIP--NLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIK 587
           M   +K KLK  P KPGCYLWKD NG V+YVGKA ++ NR+ QYF K+   KT+ L+++I DVD+ ++ +EN++L LE  LI +Y+P++N++L+++N + Y  +TK + P +  +     +IK T  +GPFA+S  K  E+++ + ++FPLRKC     N  C Y+ +G C+G C++  T++ Y+  +  I  FF+  S  I+  L+  E +A++   FE +Q++L L+K  L++       I  QK+  D IG+  + NV++I IF Y  G L  K    + L      E++  ++T IY +Y      LP  + +SL +  LK +S+SLKI    P  G +K ++ T  +NA   +  K+L+  SN ++     ++L +LL+   ++ +EI D S     + VG M+ +E+G K K+  R++NI +     D +++  ++YRR  +   +   +P  +L+I+DGGK Q+K+  +            +IGL K+  H+TD I+  DF   K+   S L+ +L  IQ EV  FA     NK S    +N L +I  +GK   + L + ++TL+ IK ASV ELSQ +   +A++IK
  S:     1 MTTNLKQKLKTAPKKPGCYLWKDSNGKVLYVGKASNIFNRVHQYFQKNNPYKTQLLSSQISDVDFFILKDENDALNLEAKLINQYQPRFNLVLKQNNGYLYFYITKAKKPTLELARKY--QIKTTKCFGPFASSKFKLREIHDLLLKLFPLRKCAPHQKNHPCFYFQMGLCMGQCMQTDTKEKYQQVISNIEQFFNDPSVVIN-YLKAAEKKASDNQEFEKAQQFLTLQKAVLELTKTHHTTIIKQKSSHDFIGYVFQNNVLAITIFCYEKGELTDKEQAVFTLEQTDIVEVESAIITFIYHHYK--TTPLPSKITVSLDETNLKLISDSLKIGVFKPKNGNEKLILQTVIDNAKHALATKWLKFTSNYDKT-QLHKDLAQLLNTDYIHSLEIIDVSFYDQNHVVGCMLRFEDGKKIKHLSRRYNI-NSLKKGDTNHIALLVYRRILSAMQTKANLPFSDLLIIDGGKAQIKSVKQVFSLFSNVKPPIIIGLVKNKNHQTDHIMLSDFQVKKIAINSPLFHYLATIQTEVDGFAKRSAFNKLSNHQLQNPLLQIPGVGKITAQILFDNFQTLNNIKLASVNELSQFIKKPLAQKIK 589
>gi|104773886|ref|YP_618866.1| excinuclease ABC subunit C [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513892|ref|YP_812798.1| excinuclease ABC subunit C [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122275338|sp|Q04B12|UVRC_LACDB UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|119367661|sp|Q1GAM4|UVRC_LACDA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|103422967|emb|CAI97638.1| Excinuclease ABC, subunit C [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093207|gb|ABJ58360.1| Excinuclease ABC subunit C [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (600 aa)
Score = 823, Expect = 9.3e-86, Identities = 202/575 (35%), Positives = 332/575 (57%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDE----DANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWD------FSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQ 576
           ++ I++KLK +P K GCYL KD NG VIYVGK+ +L NR++ YF   ++ +  +L   I D D +VV+++ E+ LLE  LI KY+P YN+ L+    +PYI +T E++P+   +     K KG Y+GP+ N       L  FI ++FPLR+C+    + C+YY +GQCLG C K+V + +Y+  +K+I  F +G  + + + L  K +QA+  L FE + +  +  K ++   E+Q II +     DI  +Y   + ISI +F      LL +   +     E D  +  ++ I ++Y++     P+ V +    ++   L+ ++ IK   P +G K  +M+ A  NA   + +K+  L   Q +   + EE+ K L +     +E FD+S+I   + V A+VV+++G   K  YRKF +K E    ++  +    +EV+ RRY         +P+LI++DGG+ QV+A  + L+  EL+  IPV G+ KDDKH+T+ ++  D      F  I +D KS+ ++ +  IQDEVHRFAI+F+R   +K+   + L  IK +G     KLL ++ +L KIKEAS+++L +
  S:     3 SQLIENKLKLLPEKAGCYLMKDVNGKVIYVGKSKNLKNRVRSYFKSSQEGRRAELVKNIADYDIIVVDSDKEAFLLEVTLIKKYQPYYNVALKSGTGYPYIEITNEKNPQTRLT-SIVYKDKGYYFGPYPNVYAASATL-KFIQKVFPLRRCSGYTGRPCLYYHMGQCLGSCFKEVPQSEYDEQIKKIKRFLNGDIQEVKKDLTNKMLQASADLEFERAGELRDQLKYIEETVEKQKIISNDHTQRDIFNYYVDRSWISIQVFFLRQAKLLRRESHMFPLTDETDPEDEFMSFIAQFYAQKNRVNPREVLVPKGIDQ-DELAAAIGIKVRTPQRGQKASLMEMARENAQLKLDDKFRLLELGQRKTKGAQEEIFKALGLPYGSYIESFDHSHIQGADPVSALVVFKDGEPFKTGYRKFKLKGEVEHQNSADEVGNTREVVRRRYSRLLKEHERMPDLILMDGGQIQVEACEDVLRN-ELNLDIPVAGMVKDDKHRTNHLLYGDPFKGQPFKLIPMDPKSEGFYLMTRIQDEVHRFAITFHRQTHAKNSLVSRLDSIKGIGPKSRTKLLREFGSLKKIKEASIDDLRK 585
>gi|153813326|ref|ZP_01965994.1| hypothetical protein RUMOBE_03743 [Ruminococcus obeum ATCC 29174] >gi|149830616|gb|EDM85707.1| hypothetical protein RUMOBE_03743 [Ruminococcus obeum ATCC 29174] (616 aa)
Score = 822, Expect = 1.4e-85, Identities = 195/573 (34%), Positives = 349/573 (60%)
  Q:     4 QIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRD--LKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-LP-----NKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIG------FYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTA----SFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQ 576
           QI+++LKK+P KPG YL  D+   +IYVGKA+ L NR++QYF   R+   K +++   I   +Y++ ++E E+L+LE+NLI +++PKYN +L++  ++P+I VT +E +PR+L++    KK K  Y+GP+ +    K ++   + +++ +R CN+ LP     ++ C+YY + QC+GPC     ++ Y+  ++++  F +G  +   +QL +K  +A+E++ FED+ +  +L ++++   ERQ I    + D DII          +E    + +F   +G L+ +  + L         ++L + + ++Y+     +P  + L    E    + E L      K++ + P KG K+ +++ A+ NA  +++    ++   + R + ++ E++  L +K L RME FD SNI     VG+MVVYE G   +++YRKF IK     +DY  M+EV+ RR+ + +     SF  +P+L+++DGG+ QV  AL  L  L +   IPV G+ KDD H+T R + +D  EI +D  S+ +  +  IQDE HRFAI ++R+ +SK    + L  I  +G+ R + L+ +Y +++ I++A+VEEL++
  S:     3 QIEEELKKLPAKPGVYLMHDERDEIIYVGKAISLKNRVRQYFQSSRNKGAKIEQMVTHIARFEYIITDSELEALVLESNLIKEHRPKYNTMLKDDKSYPFIKVTVQEAYPRVLFAR-RMKKDKNRYFGPYTSGGAVK-DVIELVRKLYQVRSCNRNLPRDCGKDRPCLYYHMKQCMGPCTGHADQRAYKENIQKVIRFLNGDFQETIDQLTEKMQKASEEMRFEDAAEARDLIRSIQKIGERQKITAYGEEDRDIIACDMDESLDLREQDAVVQVFFMRDGKLIGRDHFYLRVARGDTRSQVLSSFVKQFYAGTPF-IPGEITLQTEIEDADVIEEWLTSRRKQKVRIVVPKKGTKEKLVELAWENARMVLEKDRERIRREEGRTIGAVHEVEDWLGLKGLNRMEAFDISNISGFESVGSMVVYEKGKPKRSDYRKFRIKSVQGPNDYASMEEVLTRRFTHESNGEFDSFSRMPDLLLMDGGRGQVNIALGVLDKLGIR--IPVCGMVKDDHHRT-RGLYFDNIEIPIDTNSEGFRLITRIQDEAHRFAIEYHRSLRSKEQVHSVLDDIPGIGERRRKALMRRYRSIEGIRDATVEELAE 596
>gi|153854576|ref|ZP_01995846.1| hypothetical protein DORLON_01841 [Dorea longicatena DSM 13814] >gi|149752885|gb|EDM62816.1| hypothetical protein DORLON_01841 [Dorea longicatena DSM 13814] (617 aa)
Score = 821, Expect = 1.7e-85, Identities = 203/576 (35%), Positives = 342/576 (59%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRD--LKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-LPN-----KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD---EILLTLIYEYYSKIA-----IELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY---------KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           N  I+++LKK+P KPG YL  D+   +IYVGKA+ L NR++QYF   R+   K +++   I   +Y+V ++E E+L+LE NLI +++PKYN +L +   +P+I VT  E  PR++ +    KK K  Y+GP+ ++   K +    I +++ +R CN+ LP      + C+ Y I QC  PC   ++R++Y   + E+  F +G    I ++LE+K + A+E L FE + +Y EL  +++  +++Q I  +  +D DII     E   ++V   ++ G  L   D   +  +E D   EIL + I ++Y+        + LP+ +      E+  T     K++   P KG K+ +++ A  NA  ++KN   +L   + R + +++EL+K+L +  + RME +D SN    + VG+MVVYE+G   +N+YRKF IK      DY  M EV+ RR+         ++ T  F   P+LI++DGG+ QV  ALE L+  +L+  IPV G+ KDD H+T R + ++  E+ +D+ S+ +  +  IQDE HRFAI+F+R  +SK    + L  I  +G  R + L+  +E ++ I+ A+V++L ++
  S:     3 NFNIQEELKKLPGKPGVYLMHDEKDAIIYVGKAISLKNRVRQYFQSSRNKGAKIEQMVTHISRFEYIVTDSELEALVLECNLIKEHRPKYNTMLMDDKTYPFIKVTVNEPFPRVMMAR-RMKKDKAKYFGPYTSTGAVK-DTIELIRKLYHIRSCNRSLPKDIGKERPCLNYHIHQCYAPCQGYISREEYRKSIDEVVRFLNGNYDPILKELEEKMLDASENLEFEKAIEYRELLASVQKIAQKQKITDTAGDDRDIIAM-ASEGEDAVVQVFFIRGGRLIGRDHFYLKIAENDTKSEILSSFIKQFYAGTPYIPAELMLPEEIEDQEIIEEWLTTRREHKVRLRIPKKGTKEKLVELAQKNAQMVLKNDKERLKREEGRTIGAVKELEKILGLTGIIRMEAYDISNTNGFDSVGSMVVYEHGKPKRNDYRKFKIKSVQGPDDYASMNEVLTRRFEHGLRERQDESETGGFQAFPDLIMMDGGRGQVNIALEVLE--KLNQHIPVCGMVKDDNHRT-RGLYFNNVELPIDRNSECFRLITRIQDEAHRFAITFHRQLRSKGQVHSILDDIPGVGPARRKDLMRSFENIEAIRNATVDDLKEL 598
>gi|116333985|ref|YP_795512.1| excinuclease ABC subunit C [Lactobacillus brevis ATCC 367] >gi|122269331|sp|Q03QP1|UVRC_LACBA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|116099332|gb|ABJ64481.1| Excinuclease ABC subunit C [Lactobacillus brevis ATCC 367] (605 aa)
Score = 821, Expect = 1.7e-85, Identities = 187/576 (32%), Positives = 316/576 (54%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKT-DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +E ++ KL  +P  PGCYL K+ N  +IYVGKA +L NR++ YF      KT +L +EI D + ++ + + E+ LLE  LI K++P +N+ L+    +PYI +T E  P++L   D  +K    Y+GP+ N    + E  +F+ +++PLR+C     + C+YY +GQCLG C K+V   +Y+  +++I  F +G      + L ++  +AA  + +E +    +  + ++   E+Q II +     DI  FY  +  +SI +F      L+ +   +    +  +E L + I ++Y +    LP+ + +  S +    + E LK+    P +G K+D+++ A  NA  +++ K+  L  ++ +   +++E+   L I   +++E FD+S+I   + V AMVV+ +G  NK  YRK+ ++  D   +     EVI RRY         +P+LI++DGG  Q+ A  E L+  E D  IPV G+ K+D HKT D +   D   + LD KS  ++ +  IQDEVHRFAISF+R   +K    + L +I  +G     KLL K+ +  KI EAS+ E+ ++
  S:     3 SEYLEHKLALLPGLPGCYLMKNINSQIIYVGKAKNLKNRVRSYFKSSHTGKTAQLVSEIVDFETIITSTDKEAFLLEITLIQKHQPYFNIKLKRGTGYPYIKITNERDPQLLLVSD-IRKDGAYYFGPYPNVYAAE-ETMHFLQKVYPLRRCPGHQGRPCLYYHMGQCLGACFKEVPEAEYDQQIRKIKSFLNGNVGHAKKDLTQRMEKAAADMAYERAGDLRDQIRYIEATVEKQKIISNDSTPRDIFNFYLDKGWLSIQVFFIRQARLMKREKRLFPVVNSAEEELASFIVQFYQRKNTVLPREILVPASIDH-DVIEELLKVPVRTPQRGTKRDLLEMAGKNAKLVLEEKFRLLELDEGKTTGAMKEITDALGIAPGHKIEAFDHSHIQGADLVSAMVVFVDGQPNKKLYRKYKLQTVDHADETASTLEVIRRRYGRLLKEHAPMPDLILMDGGDIQMNAVKEVLED-EFDLHIPVAGMVKNDHHKTADLLFGPDDHHVHLDPKSQGFYLVQRIQDEVHRFAISFHRQVHTKHSLSSRLDRIPGVGPKTRNKLLRKFGSTKKISEASMAEIREL 575
>gi|51891309|ref|YP_074000.1| excinuclease ABC subunit C [Symbiobacterium thermophilum IAM 14863] >gi|81389794|sp|Q67T37|UVRC_SYMTH UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|51854998|dbj|BAD39156.1| excinuclease ABC subunit C [Symbiobacterium thermophilum IAM 14863] (629 aa)
Score = 818, Expect = 3.8e-85, Identities = 204/584 (34%), Positives = 347/584 (59%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLA--NEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN---KLPNKKCIYYDIGQCLGPCIKKVTR-QDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELN------SLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTAS---------------------------FGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHK-TDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEIKK 588
           ++++L+ +P +PGCYL+KD +G +IYVGKA +L NR++QYF   R+L  K LA   +I +++++V + E E+L+LE+NLI K+KPKYN+ LR+   +PY+ +T  E+ PR++ +  S KK    Y+GP+ +S    +E      R+FPLR CN   + P + C+ Y IG+CLGPC+    R ++Y   ++++  F  G+++ + E+L  +  QAAE+L FE + +  +  + ++  +E+Q II     D D+I +    +   + +F    G L+ +   +     E+   EIL   I ++YS+    +PK + +S        ++E L      ++    P +G K+ +++    NA E M  +       Q REL        L ELQ  LD+  L +R+E FD S++     V +MVV+E G   K++YR+F +K  D N+D+  M E + RR++   A                            F + P+L+I+DGGK Q+  A   ++ L +D  IP  GLAK+++   T+    W    I+L + S   F L  I+DE HRFAI+++R    ++   + L  +  +G  R + LL+ + +L  I+EASVEE++Q+  + +E+A+ +K+
  S:     3 LEEQLRLLPDRPGCYLFKDASGRIIYVGKARNLKNRVRQYFQSSRNLTAKVLAMVGQIVEIEHIVTDTETEALVLESNLIKKHKPKYNIRLRDDKHYPYLRLTLTEQWPRLVVAR-SMKKDGSRYFGPYTSSQ-AMWETMKLARRLFPLRTCNDPSRYP-RGCLQYHIGRCLGPCLPDFDRHREYAEAVRDLQAFLEGRTQEVLERLRARMEQAAERLEFERAAELRDQIRAIEKVTEKQKIIAHTMVDLDVIAYARLYDEAGVQVFFVRQGKLVGRDQFLMSGADEMTGGEILAAFIQQHYSQTDF-VPKEILVSEDLPDADVIAEWLSAKRGSRVALRCPKRGEKRALVEMVAQNAQEAMTER------RQQRELELAATEGVLRELQAYLDLPRLPHRIECFDVSHVQGAEVVASMVVFEGGRPKKSDYRRFKMK-VDQNNDFANMAEAVGRRFRRGLAERAAQVEGRVRDLEEGRVAEGGAEYGGKFADFPDLLIIDGGKGQLSYARAVMRELGVDH-IPTFGLAKENELLCTEDRPDW----IELPRGSQALFLLQRIRDEAHRFAITYHRKLHRRASTHSRLDDVPGIGPKRKKALLQHFGSLKAIREASVEEVAQVPGITLELAERVKE 622
>gi|167745943|ref|ZP_02418070.1| hypothetical protein ANACAC_00638 [Anaerostipes caccae DSM 14662] >gi|167654458|gb|EDR98587.1| hypothetical protein ANACAC_00638 [Anaerostipes caccae DSM 14662] (627 aa)
Score = 806, Expect = 8.7e-84, Identities = 208/582 (35%), Positives = 349/582 (59%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTK--KLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN-KLP-----NKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDL-ITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY------------KNNTASFG---EIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAKEI 586
           I+++LKK+P KPG Y+  +    +IYVGKA+ L NR++QYF   R+L TK   + + I   +Y++ ++E E+L+LE NLI +++PKYN +L++   +PYI VT  EE+PRI+ +    K+ K  Y+GP+ ++   K ++   + ++F +R C+ KLP     ++ C+YY I QC GPC   ++ +DY   + ++  F +G  K + + LE+K  QAA  L FE + +Y  L K++   ++RQ I      + DII F  ++    + +F   +G LL +    +T      DE L++   + +      LP  ++L    + ++ + E L      ++    P +G K  +++ A  NA  +++    +L   + R + +++E+++LL IK L+RME FD SNI     V +MVV+E+G   K +YRKF +K  D   DY  M+EV+ RR             KN    FG   + P+L+++DGGK QV  A   LK L++D  IPV G+ KDD H+T R + ++  EI   K+S+ +  +  IQDE HRFAI ++R+ ++K    + L +IK +G  R + L++ ++ +  IKEA+ +E+ Q+  +  + AKEI
  S:     4 IEEELKKLPAKPGVYIMHNDKDEIIYVGKAIKLCNRVRQYFQGSRNLTTKIQHMVSHIAYFEYIITDSELEALVLECNLIKEHRPKYNTMLKDDKNYPYIKVTTNEEYPRIMLAR-RMKQDKCKYFGPYTSAGAVK-DIIELLRKLFKIRTCSRKLPKDIGKDRPCLYYQIKQCEGPCQDYISGEDYRKSIDQVLSFLNGNYKDVSDMLEEKMKQAAADLEFEQAAEYRNLLKSIGKIADRQKINSYGFENRDIIAFAKEKQDAVVAVFFIRDGKLLGREHFHMTQDEETTDEELMSAFVKQFYAGTPYLPGEIFLECGMDDMEIVEEWLSKKRGGRVHIRIPLRGEKHRLVELAKENASNVLRQDKEKLKREEKRTIGAVKEIEQLLGIKGLHRMEAFDISNISGFQTVASMVVFEDGKARKRDYRKFRLKTVDGPDDYRSMEEVLTRRLLHGQKEIEELKAKNEDLEFGSFTKFPDLLLMDGGKGQVNVAQRVLKDLKMD--IPVCGMVKDDNHRT-RALYYNNDEIYFPKRSEAFQLVTRIQDEAHRFAIEYHRSLRAKGQVSSVLDEIKGVGPKRRKALMKHFKQIQNIKEATEDEIMQVPGMTRKAAKEI 613
>gi|160893084|ref|ZP_02073872.1| hypothetical protein CLOL250_00629 [Clostridium sp. L2-50] >gi|156865167|gb|EDO58598.1| hypothetical protein CLOL250_00629 [Clostridium sp. L2-50] (604 aa)
Score = 806, Expect = 9.2e-84, Identities = 197/572 (34%), Positives = 333/572 (58%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK--DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-LP-----NKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCK---ENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLK------IKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +++LKK+PH PG YL  +K   +IYVGKA+DL NR+ QYF     R  K +K+ + I   +Y++  +E E+L+LE NLI +++P YN +L +  ++PYI +T  E+ PRIL+SH   +     Y+GP+ N+   K +  + + +++ LR CNK LP     ++ C+YY IGQC  PC   ++++DY   +++   F +G  +   ++LE+K  Q A  + FE + +  +L +++K  + +Q +  +  +D D+I        E VIS+   +  NG ++ +  + +  V      +I+   + +YY+     LPK + L     + + + + L       +  L P KG K  ++  A +NA  ++     +L   Q R   + +EL +L+ +    R+E FD S+I   + V +MVV+ENG    NEYRKF ++  D   DY  M+EV+ RR+ +    F   P+++++DGGK QV  ALE L  L L+  IPV G+ KDD H+T R + ++  E++  K +  +  +  +QDE HRFAI ++R+ +SKS   + L  I  +G  R + L+  ++ + KI+EASV+EL Q+
  S:     5 EEELKKLPHTPGVYLMHNKTDEIIYVGKAIDLYNRVHQYFQAGYKRSPKIEKMVSHIAWFEYIICESEIEALVLECNLIKEHRPHYNTMLTDDKSYPYIKITVNEDFPRILFSHQMHRD-HARYFGPYTNAGAVK-DTIDLLKKLYHLRSCNKKLPQETGLDRPCLYYHIGQCKAPCQGYISKEDYGRQVEQAIHFLTGHHRQTVKELEEKMKQLAADMEFEQAAEVRDLIESIKHIASKQRVDNTTTDDRDVIAMAANNMNEGVISVFFIR--NGKMIGREHFHMTGVQSESYGDIMAAFLKQYYASTPF-LPKEIILEHEVNEQELIEQYLSERRGNLVHILTPQKGDKAKLLKLARDNAFLVLTQDTEKLKREQARTEGAAKELAELIGVPSAKRLEAFDISHISGYHSVASMVVFENGKARPNEYRKFKLRTIDGPDDYASMREVLTRRFTDE--RFKVYPDILMMDGGKGQVNIALEVLNELHLN--IPVCGMVKDDYHRT-RGLYFNNKEVEFPKNTQAFDMVTRLQDEAHRFAIEYHRSLRSKSQVHSILEDIPGIGPARRKDLMGYFKDIAKIREASVDELMQV 586
>gi|110004469|emb|CAK98806.1| putative uvrc protein excinuclease abc subunit c [Spiroplasma citri] (593 aa)
Score = 799, Expect = 5.8e-83, Identities = 209/574 (36%), Positives = 334/574 (58%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDI-IFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK-YDLITV-FYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNS---LEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIV 578
           +K++++ +P KPGCYL+ +    V+YVGKA +L +R+  YF K  + KT +L  EI  ++ ++   E E+L+LE+NLI +YKPKYN+LL +   +PYI++TKE+ P+ LY  +  +K    YYGPF   +  + E+   + R++PLR+C     K C+YY I QC G C+K V+   Y   +K+++ FF G      + LEK+ +QAA+ L FE++ K   L +NL      Q + + +Q +D D+I  Y     + +    Y  G L  K Y+   + F  +  E+    +   Y K  +     V   ++  +L  L ++   +  +P   ++K +M  A  N+ E     Y+Q  +   RELN+   L+ELQ LLD+ +L Y +E+ D +NI +    G ++VY+NG  ++N+YRK+N++  D + D   +  V+ RRY+        +PNLII+DGG  QV A L+ L   +LD  IPVIGL K+++HKTD ++     +I LDK S L+ FL  IQD+VH FAI+ +R +++K+L  + L  I   GK RI+ L   +E++  IK+AS  EL Q++
  S:     7 LKEQVEILPAKPGCYLFYNNYHQVLYVGKAKNLRSRVSSYFNKVYNYKTTRLVQEIVRLETIITKTEKEALILEHNLIKQYKPKYNILLNDDKHYPYIVITKEKDPQYLYVRNIHQKY-ARYYGPFPEGSHAR-EIIKVLERLYPLRRCKGNLGKPCLYYHINQCSGACVKTVSPDYYIKMIKKVHSFFKGNFTETKKLLEKRMLQAADNLQFEEAHKLKLLIRNLDWTLSSQTVEMLNQNDDLDVISLYQTAEHLVLTTLFYRAGKLSYKDYEYYHLDFAEDCQELYRLYLQNIYQKNILPTKIIVNEIIALPELNLLFDN---RVFHPKTPIEKTIMKLATENSYE----SYVQYQTTAQRELNNAEVLKELQMLLDLSELPYLIEMIDIANINDEFVTGGVIVYKNGRLSRNDYRKYNLEIPDQD-DTHRIAAVVTRRYQKVIQEEQALPNLIIMDGGIQQVNACLKELA--KLDLAIPVIGLVKNNQHKTDHLLNLKKEKIYLDKSSRLFLFLTRIQDDVHHFAITSFRRRQTKALTTSILETIPGFGKQRIKLLNHHFESIGAIKKASDAELYQVL 575
>gi|166031032|ref|ZP_02233861.1| hypothetical protein DORFOR_00713 [Dorea formicigenerans ATCC 27755] >gi|166029299|gb|EDR48056.1| hypothetical protein DORFOR_00713 [Dorea formicigenerans ATCC 27755] (612 aa)
Score = 797, Expect = 9.5e-83, Identities = 203/573 (35%), Positives = 335/573 (58%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRD--LKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-LPN-----KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIA-----IELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           I+++LKK+P KPG YL  D+   +IYVGKA+ L NR++QYF   R+   K +++   I   +Y+V ++E E+L+LE NLI +++PKYN +L +  A+P+I VT +E  PR++ +    +K K  Y+GP+ ++   K  +   I +++ +R CN+ LP      + C+ Y I QC  PC   +++++Y   ++E+  F +G    I E+L+ +  +A+E L FE + +Y EL  +++  +++Q I  +  +D DI+          + +F   NG L+ +  + L  V      EIL + I ++Y+        I LP+ +      E+  T  +  K+  + P KG K+ +++ A  NA  ++     ++   + R + +++ELQ LL +  L+RME +D SN      VG+MVVYE G   +N+YRKF IK     +DY  M EV+ RR+ +            SF   P+LI++DGGK QV  ALE L  L LD  IPV G+ KDD H+T R + +   EI +D+ S+ +  +  IQDE HRFAI+F+R  +S+    + L  I  +G  R + L++ +  ++ IK A+VEEL  +
  S:     4 IQEELKKLPGKPGVYLMHDETDKIIYVGKAISLKNRVRQYFQSSRNKGAKIEQMVTHISRFEYIVTDSELEALVLECNLIKEHRPKYNTMLMDDKAYPFIKVTVQEPFPRVMLAR-RVQKDKAKYFGPYTSAGAVKATI-ELIRKLYFIRSCNRRLPKDIGKERPCLNYHIHQCKAPCQGYISKEEYRKSVEEVLHFLNGNYDPILEKLKAQMEEASESLEFERAIEYRELINSVQKIAQKQKITDTAGDDRDIVAVSKDLEDAVVQVFFIRNGRLIGRDHFYLKLVDKETKAEILSSFIKQFYAGTPYIPGQIMLPEEIPDHEIIEEWLTRKKEHKVHLVIPKKGTKEKLVELAEKNARMVLTKDKERIKREEGRTIGAVKELQNLLGLTGLHRMEAYDISNTNGFESVGSMVVYEKGKPKRNDYRKFKIKGVKGANDYASMNEVLTRRFGHGLREKEEGRELGSFTVFPDLILMDGGKGQVNIALEVLDKLNLD--IPVCGMVKDDHHRT-RGLYYHNEEIPIDRNSEAFRLITRIQDEAHRFAITFHRQLRSQGQVHSILDDIPGVGPARRKDLMKHFANIEAIKNATVEELKSL 596
>gi|116494833|ref|YP_806567.1| excinuclease ABC subunit C [Lactobacillus casei ATCC 334] >gi|122263749|sp|Q039J7|UVRC_LACC3 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|116104983|gb|ABJ70125.1| Excinuclease ABC subunit C [Lactobacillus casei ATCC 334] (602 aa)
Score = 796, Expect = 1.5e-82, Identities = 196/584 (33%), Positives = 330/584 (56%)
  Q:     4 QIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDY---MKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLG-KTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
            I+ KL  +P  PG Y  KD NG +IYVGKA +L NR++ YF    D K   + +++ D D++V + + E+ LLE  LI KY+P YN+ L++   +PYI +T E  P+I  +  + +K  G Y+GP+ N    + E  +FI +++PLR+CN    + C+YY +GQCLG C + V  ++Y   ++ I  F +G        L  K  +AA+ L FE + +  +    ++   E+Q II       D+  FY  +  ISI +F      L+ +   +    +   E   + I ++YS+     P+ V +    +  K L++ L+I    P +G K+D+M  A  N+   +++K+  +  +    + +++EL   L++   +  E FD+S+I   + V AMV + +G   KN YRK+ +  +  ++  D     +EVI RRY         +P+LI++DGG+ ++ AA + L+  EL+  IPV G+ K++KHKT  ++  +  + I LD KS  ++ L  IQDEVHRFAI+F+R   +K+   + L  IK +G KTR+ KLL K++T++KIKEA +E++ ++ +  +VA+ +K
  S:     5 HIEHKLSLLPDLPGSYQMKDINGKIIYVGKAKNLKNRVRSYFKSSHDGKVAAMVSQVADFDFIVTSTDKEAFLLEITLIQKYQPYYNIKLKKGTGYPYIKITHERDPKIEIT-GTIRKDGGYYFGPYPNVYAAQ-ETMHFIQKVYPLRRCNGYQGRPCLYYHMGQCLGACFRTVPEKEYTDQIERIKRFLNGNVGKAKASLTAKMERAAKNLQFERAAEIRDQLHYIEQTLEKQKIISHDNTTRDLFNFYMDKGWISIQVFFIRQARLMKRESRLFPVVNTAKEEFESFILQFYSRRNNVKPREVLVPAGLDN-KVLADILEIPVRTPQRGEKRDLMALAAKNSQIKLEDKFRLMELDNRTTIGAMKELMAALNLPMGHVAEAFDHSHIQGADPVSAMVQFVDGQPAKNNYRKYKLDADKTHNGADEAANTREVIRRRYTRLLKERAPLPDLILMDGGEIEMNAAKDVLEN-ELNLDIPVAGMVKNNKHKTAALLFGNADQLINLDPKSQGFYLLERIQDEVHRFAITFHRQLHAKNSLASRLEGIKGVGPKTRL-KLLRKFKTINKIKEAPLEDIQELGISKKVAQALK 589
>gi|191638340|ref|YP_001987506.1| UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) [Lactobacillus casei] >gi|190712642|emb|CAQ66648.1| UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) [Lactobacillus casei BL23] (602 aa)
Score = 795, Expect = 1.7e-82, Identities = 196/584 (33%), Positives = 331/584 (56%)
  Q:     4 QIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDY---MKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLG-KTRIEKLLEKYETLDKIKEASVEELSQI-VPIEVAKEIK 587
            I+ KL  +P  PG Y  KD NG +IYVGKA +L NR++ YF    D K   + +++ D D++V + + E+ LLE  LI KY+P YN+ L++   +PYI +T E  P+I  +  + +K  G Y+GP+ N    + E  +FI +++PLR+CN    + C+YY +GQCLG C + V  ++Y   ++ I  F +G        L  K  +AA+ L FE + +  +    ++   E+Q II       D+  FY  +  ISI +F      L+ +   +    +   E   + I ++YS+     P+ V +  + +  K L++ L+I    P +G K+D+M  A  N+   +++K+  +  +    + +++EL   L++   +  E FD+S+I   + V AMV + +G   KN YRK+ +  +  ++  D     +EVI RRY         +P+LI++DGG+ ++ AA + L+  EL+  IPV G+ K++KHKT  ++  +  + I LD KS  ++ L  IQDEVHRFAI+F+R   +K+   + L  IK +G KTR+ KLL K++T++KIKEA +E++ ++ +  +VA+ +K
  S:     5 HIEHKLSLLPDLPGSYQMKDINGKIIYVGKAKNLKNRVRSYFKSSHDGKVAAMVSQVADFDFIVTSTDKEAFLLEITLIQKYQPYYNIKLKKGTGYPYIKITHERDPKIEIT-GTIRKDGGYYFGPYPNVYAAQ-ETMHFIQKVYPLRRCNGYQGRPCLYYHMGQCLGACFRTVPEKEYTDQIERIKRFLNGNVGKAKASLTAKMERAAKNLQFERAAEIRDQLHYIEQTVEKQKIISHDNTTRDLFNFYMDKGWISIQVFFIRQARLMKRESRLFPVVNTAKEEFESFILQFYSRKNNVKPREVLVPAALDN-KVLADILEIPVRTPQRGEKRDLMALAAKNSQIKLEDKFRLMELDNRTTIGAMKELMAALNLPMGHVAEAFDHSHIQGADPVSAMVQFVDGQPAKNNYRKYKLDADKTHNGADEAANTREVIRRRYTRLLKERAPLPDLILMDGGEIEMNAAKDVLEN-ELNLDIPVAGMVKNNKHKTAALLFGNADQLINLDPKSQGFYLLERIQDEVHRFAITFHRQLHAKNSLASRLEGIKGVGPKTRL-KLLRKFKTINKIKEAPLEDIQELGISKKVAQALK 589
>gi|184155101|ref|YP_001843441.1| excinuclease ABC subunit C [Lactobacillus fermentum IFO 3956] >gi|183226445|dbj|BAG26961.1| excinuclease ABC subunit C [Lactobacillus fermentum IFO 3956] (603 aa)
Score = 793, Expect = 3.0e-82, Identities = 188/573 (32%), Positives = 319/573 (55%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKD-EDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKT-DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           +E ++ KL  +P +PGCYL K+ N  +IYVGKA +L NR++ YF      K   +  E+ D + +V ++  ES LLE  LI K++P YN+ L+    +PYI +T E  P I+      KK    Y+GP+ N    + E  +FI ++FPLR+C+    + C+YY +GQCLG C K+V  ++Y    K I  F +G +  + +QL  +  +AA +L FE + +  +    +++  E+Q II + K   D+  FY  +  +SI +F      L+ +   +       +E + + I ++Y++    LPK + L   L +++++   E L +    P +G K+D++D A  NA+  +  K+  L  ++ +   +++E+   L +   + +E FD+S+I   + V AMVV+ NG   K  YRK+ +    D   +    +EVI+RRY         +P++I++DGG  Q++AA + L+  +L   IPVIG+ K+DKH+T D +   D   + LD +S  ++ +  IQDEVHRFAI+++R   +K    + L +I  +G     KLL+ + +++KI  A VEE+
  S:     3 SEYLEHKLALLPDQPGCYLMKNANAQIIYVGKAKNLKNRVRSYFKSSHTGKVAAMVEEVADFETIVTSSNKESFLLEITLIQKHQPYYNIKLKRGTGYPYIKITNERDP-IIKITGQVKKDGAYYFGPYPNVYAAE-ETVHFIQKVFPLRRCHGYQGRPCLYYHLGQCLGCCFKEVPEEEYAVQTKRIKSFLNGNTAQVKKQLTARMERAAGQLEFERAAEIRDQLHYIEVTVEKQKIISNDKTPRDLFNFYLDKGWLSIQVFFIRQARLMKREKRLFPVVDTAEEEMTSFILQFYNRRNKLLPKEILLPEGLPNQEIE---EILGVPVRTPQRGEKRDLLDMAKENAILSLNEKFRLLEMDRQKTTGAMKEITDELGLPTGHVIEAFDHSHIQGADPVSAMVVFVNGEPAKKLYRKYKLTTVVDHADEAASTREVIFRRYSRLLKEEKPMPDMIMMDGGPIQMEAAKDVLEN-QLGLNIPVIGMVKNDKHQTADLLYGDDAHHVNLDPRSQGFYLVQRIQDEVHRFAITYHRKVHTKHSLSSRLDEIHGVGPRTRNKLLKAFGSINKIAVAPVEEI 573
>gi|158321277|ref|YP_001513784.1| excinuclease ABC subunit C [Alkaliphilus oremlandii OhILAs] >gi|189038017|sp|A8MJ06|UVRC_ALKOO UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|158141476|gb|ABW19788.1| excinuclease ABC, C subunit [Alkaliphilus oremlandii OhILAs] (621 aa)
Score = 791, Expect = 5.1e-82, Identities = 211/573 (36%), Positives = 345/573 (60%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYI-LVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-----LPNKK--CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD---EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +K+KL+ +P KPG Y+ ++    +IYVGKA+ L NR++QYF   K+   K K + + I   +Y+V + E E+L+LE NLI + +PKYN+LLR+   +PYI + T EE+PRIL +    K  K  Y+GP+ N      E  + I+ I+P+R CNK     + NK+  C+ Y I +C+GPC   VT+++Y   + +I  F  GK   +  ++E+K   AA  + FE++ +Y +    L    E+Q I+   + D+D+I     E    I +F    G L+ +   I +  +E D   EI+ + + ++YS  A  +PK + +  S E L  L E L      K+    P KG KK+++D    NA+  M+     +   + +  ++L EL +LLD++++ YR+E +D SNI     VG+MVV+E G     +YR+F IK     +DY  ++E+I RR+K                +   F   P+LI+VDGG  QV +  ++L  L L+  IPV G+ KDD+H+T  +V ++  E+ ++K S L+  +  IQDEVHRFAI+++R+ + K+  ++ L +I  +G+ R + L+  + ++DKIK A+VEEL ++
  S:     4 LKEKLRTLPEKPGVYMMRNDKNEIIYVGKAISLKNRVRQYFQSSKNHPPKVKAMVSHIVTFEYIVTDTELEALILECNLIKENRPKYNVLLRDDKTYPYIKITTNEEYPRILKTRKVIKD-KAKYFGPYTNIGALN-ETLDVIHTIYPIRTCNKNIERMIANKERPCLNYHIKKCIGPCTGLVTKEEYHQMIHDIILFLDGKEDELVRKIEEKMKAAAISMDFENAARYRDQIIALNNIVEKQKIVSVAEQDQDVIAMAKNEGNTWIQVFFIRKGKLVQREHFI-LKDTEDDSNQEIIASFLKQFYSG-ATFVPKEILIEESVEDLNVLEEWLSGKRGNKVSIKVPQKGDKKELLDMVKKNALMTMEQATTVIQLEKEKTEDTLIELAQLLDLEEVPYRIESYDISNIQGVESVGSMVVFEGGKSKNKDYRRFKIKTVKGPNDYASLEEIITRRFKRGLEETQDIIEQSLEVSEGKFAIFPDLIMVDGGFGQVTSVKKALHSLNLN--IPVCGMIKDDRHRTKGLV-YEGEELSIEKTSHLFRLITKIQDEVHRFAITYHRSLRKKTTLQSILEEIPGVGEARRKALMIHFGSIDKIKNATVEELLEV 604
>gi|167761265|ref|ZP_02433392.1| hypothetical protein CLOSCI_03670 [Clostridium scindens ATCC 35704] >gi|167660931|gb|EDS05061.1| hypothetical protein CLOSCI_03670 [Clostridium scindens ATCC 35704] (612 aa)
Score = 790, Expect = 6.5e-82, Identities = 202/573 (35%), Positives = 334/573 (58%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRD--LKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEE-HPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN-KLP-----NKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           I+++LKK+P KPG Y+  D+   +IYVGKA+ L NR++QYF   R+   K +++   I   +Y+V ++E E+L+LE NLI +Y+PKYN +L +  A+P+I VT EE  PR++ +    K  K  Y+GP+ ++   K +    I +++ +R CN KLP      + C+ Y I QC  PC   +++++Y   + E+  F +G    I ++LE++  +A+E L FE + +Y EL  +++  +++Q I  +   D DI+    +E    + +F    G L+ +  + L         EIL + I ++Y+     +P  + L    E L  + E L      +++ + P KG K+ +++ A  NA  ++     +L   + R + +++EL+KLL +  + RME +D SN      VG+MVVYE G   +N+YRKF IK      DY  M+EV+ RR+++             F   P+LI++DGGK QV  AL  L  L L+  IPV G+ KDD H+T R + +   EI +DK S+ +  +  IQDE HRFAI+F+R  +S+    + L  I  +G  R + L+  +E ++ IK A+VE+L ++
  S:     4 IQEELKKLPGKPGVYIMHDEKDNIIYVGKAISLKNRVRQYFQSSRNKGAKIEQMVTHIRRFEYIVTDSELEALVLECNLIKEYRPKYNTMLMDDKAYPFIKVTVEEPFPRVMLARKMVKD-KSKYFGPYTSAGAVK-DTIELIRKLYQIRSCNRKLPRDIGKERPCLNYHIHQCKAPCQGYISQEEYRESVNEVIHFLNGNYDIILKELEERMEEASEALEFEKAIEYRELLTSVQKIAQKQKITDTAGEDRDILAVAVEEEEAVVQVFFIRGGRLIGRDHFYLKIAKGETQSEILSSFIKQFYAGTPY-IPPRLMLPEEIEDLAVIEEWLTKRRGHRVRLIVPKKGTKEKLVELAKKNAQLVLSTDKERLKREEGRTIGAVKELEKLLGLTGIVRMEAYDISNTNGFESVGSMVVYEKGRPKRNDYRKFKIKGVQGADDYASMEEVLTRRFEHGLREKEEGKEMGGFTLFPDLILMDGGKGQVNVALRVLDKLRLN--IPVCGMVKDDSHRT-RGLYYQNEEISIDKDSESFKLITRIQDEAHRFAITFHRQLRSQGQVHSILDDIPGVGPARRKDLMRHFENIEAIKNATVEQLKEL 596
>gi|159896596|ref|YP_001542843.1| excinuclease ABC, C subunit [Herpetosiphon aurantiacus ATCC 23779] >gi|159889635|gb|ABX02715.1| excinuclease ABC, C subunit [Herpetosiphon aurantiacus ATCC 23779] (641 aa)
Score = 785, Expect = 2.2e-81, Identities = 199/584 (34%), Positives = 336/584 (57%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN-------KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY----------------------KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDK--HKTDRIVK-WDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAKEIKKL 589
           +++L+ +P  PG Y+++D+   +IYVGK+  L +R++ YF   R L  KT++L   I D +++  + E E+LLLE NLI K++P+YN+LL++  ++PYI +TKE  PR+L      +   G Y+GPFA ++   Y     +N++F  R CN       +  N+ C+YYDI +CLGPC    T ++Y   + ++  F  GK ++I   L+ K  QAAE L FE +    +  K ++   ERQ ++ +  +D+D+I F   E    + +F Y+ G  L   +  T+  +E +  E L++     +   A ++P  + L    E+ + + + L      K+    P +G KKD++D A  NA + +    LQ ++ + R    L +L++LL++ +L  R+E +D SN   TN VG+MVV+E G   K  YR+F IK  +  +D   + EV+ RR+                       NN  ++  +P+LI++DGG  QV AA ++L     +  IPV+GL K D   H    +VK      I   +       +  I +E HRFAIS++R  ++K +  +++  I  +G  R + L+  + +L+ I+ AS+EEL+ +  +  + A+EIK L
  S:    16 EERLRNLPLSPGVYIYRDQANTIIYVGKSKSLRDRVRSYFGAPRGLTSKTRRLVQNIADFEFITTDTELEALLLEMNLIKKHRPRYNVLLKDDKSYPYIKITKEAWPRVLRVRKVIED-GGIYFGPFAKAS-SVYATIELLNKLFAFRLCNDDMFKKHERRNRACMYYDIKRCLGPCANNCTTEEYSTAINQVRLFLGGKPEAILRDLKVKMNQAAEDLQFERAAYVRDQIKAVERVMERQKVLNTAASDQDVIAFARDEGKAVVQVF-YIRGGKLIGSEPFTLQGTEEEHPEALMSSFLTQFYDAAADIPPNILLPDYPEETQIIEQWLESKGGHKVSLQVPRRGDKKDLVDLAARNASQTLDQLRLQWLNAEQRATAGLSQLRELLNLAELPQRIECYDISNTQGTNSVGSMVVFEQGEPAKKHYRRFKIKTVEGANDVASLSEVLQRRFARADDTGQTDEPESTEQTSAEPTNNDETWAVLPDLILIDGGIGQVNAAAKTLAAAGFEH-IPVVGLVKGDTKGHLPYGLVKPGQRVPIAFAQNDPGLHLVQRIDEEAHRFAISYHRKLRTKGMLRSTMEDIPGIGPKRKKALINAFGSLEGIRNASIEELAAVPGMTRKAAEEIKGL 640
>gi|160878485|ref|YP_001557453.1| excinuclease ABC, C subunit [Clostridium phytofermentans ISDg] >gi|189038041|sp|A9KSS0|UVRC_CLOPH UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|160427151|gb|ABX40714.1| excinuclease ABC, C subunit [Clostridium phytofermentans ISDg] (628 aa)
Score = 785, Expect = 2.8e-81, Identities = 196/573 (34%), Positives = 336/573 (58%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTK--KLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-LPN-----KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLK------TLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           + ++LKK+P KPG Y+  +    +IYVGKA+ L NR++QYF   R+L TK  ++ + I   +Y++V++E E+L+LE NLI +++PKYN +L++  ++PYI VT  E +PR+L++    KK K  Y+GP+ +    K ++ + + R++ +R CN+ LP      + C+YY I QC  PC   ++ ++Y   + E+ +F +G    + + L+ K   A+E L FE++  Y +L  +++  S++Q        D DII F    +     +F   +G +L +  Y +  V       I+   + ++Y+     +P+ + LS   E+ +      +     K++   P KG K+ +++ A  NA  +++    ++   + + + ++  +  +L +  +YRME FD SN      VG+MVVYENG   +N+YRKF IK      DY  M+EV+ RR+ +               +  SF   P+LI++DGG+ QV  ALE +   EL   IPV G+ KDD H+T R + +D  EI +D  S+ +  +  IQDE HRFAI ++R+ +SK+   + L  I  +G+TR   L++ + ++D IK AS+E+L  +
  S:     4 LDEELKKLPAKPGVYIMHNNKDEIIYVGKAISLKNRVRQYFQSSRNLSTKIQQMVSNIDHFEYIIVDSEMEALVLECNLIKEHRPKYNTMLKDDKSYPYIKVTVNEAYPRVLFARQQ-KKDKAKYFGPYTSLGAVK-DILDLLRRLYFIRTCNRNLPKDIGLERPCLYYHIKQCKAPCQGYISEEEYRKSIDEVIEFLNGNYALVTKDLQAKMKAASENLEFEEAAGYRDLILSVEKLSQKQKASDVDGVDRDIIAFASTGDEAVAQVFFIRDGKMLGREHYHITGVANESRSSIMTNFVKQFYAGTPY-IPRELLLSEPLEEEELISEWLSTKRGQKVRIHVPKKGDKERLVELAEKNASLVLQQDSDKIQREEAKTIGAVRHIADMLSLPGIYRMESFDISNTNGFESVGSMVVYENGKPKRNDYRKFKIKSVQGPDDYASMREVLTRRFSHGQKEAEELAKKNIDISHGSFTRYPDLILMDGGRGQVNIALEVMN--ELKLTIPVCGMVKDDNHRT-RGLYFDNVEIPIDTHSEAFRLITRIQDETHRFAIEYHRSLRSKAQVHSILDDIDGVGQTRRRALMKHFASIDAIKAASMEDLMAV 602
>gi|50364916|ref|YP_053341.1| repair endonuclease subunit C [Mesoplasma florum L1] >gi|81391981|sp|Q6F216|UVRC_MESFL UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|50363472|gb|AAT75457.1| repair endonuclease subunit C [Mesoplasma florum L1] (588 aa)
Score = 780, Expect = 1.0e-80, Identities = 214/575 (37%), Positives = 344/575 (59%)
  Q:     4 QIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSE-LDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVE-IMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIV 578
           ++K+K+  +P KPGCYL+ +K+  VIYVGKA +L  R+  YF + ++LKT +L  EI D++Y VV+NE ESLLLE NLI KY+PKYN+LL +  A+PYI++T E+ P   Y     KK   + +GP    +  +  L   + R+FPLR+C     K C++Y IGQC G C K+V ++ Y+  +K +++FF G    +   L  +  +AAE L FE++Q+  E   +L   + +Q++ F  + D D+I ++ ++  I+IV   Y +G LL K + I +++ + + +++ + + + Y K    LP  + +  ++ +L  L+E  K    +P K  +K +   A  NA E I K+K    I+  N     LE  +K    K+ YR+E+FD SNI N   VG+ VVY NG   +NE+RK+NI+ +   SDYD +KE++YRR++        +P+LII+DGG  Q+ AA E +  L L S I VIGL KD+ H T  ++  +  ++ +  K  L+ +L +IQ  V  +A S +R K++ S  ++ L +I+ LGK RI+ L +K+ T+++I+ A  EEL +I+
  S:     2 ELKNKVSNLPSKPGCYLYLNKDKHVIYVGKAKNLKKRVSSYFDRAQNLKTTRLVREIADLEYFVVSNEKESLLLEENLIKKYRPKYNVLLNDDKAYPYIIITNEKDPTYKYVRKLDKKAFRS-FGPLPIGSNARETLIT-LQRLFPLRRCKGNLGKPCLHYFIGQCSGACFKEVNKEYYQEQIKRVDNFFKGNINEVKTLLTNQMHKAAENLQFEEAQRIKEQIISLDFTTTKQNVEFKSQTDVDVISYFIEDEKIAIVTLFYRSGKLLFKDEHIQLYFEQDITDLIDSFMSQIYDKNI--LPDKIIVD-NEVELFDLNEKYKSISTHPIKEDEKIIYKLATENAQEAIRKSKISTTINIGNENELLLELQEKANLQKEPYRLEMFDISNIGNEFIVGSCVVYINGKPARNEFRKYNIESK-FTSDYDRLKEMLYRRFQKALIEKRMLPDLIIMDGGIIQIHAAKEIINALGL-SEIQVIGLVKDEHHNTSFLIDTNEEQVIIKDKPKLFNWLSSIQVRVDEYAKSGFRKKQNNSFLKSDLEQIEGLGKKRIQDLFKKFNTINEIESADQEELFKIL 571
>gi|160939920|ref|ZP_02087267.1| hypothetical protein CLOBOL_04811 [Clostridium bolteae ATCC BAA-613] >gi|158437354|gb|EDP15119.1| hypothetical protein CLOBOL_04811 [Clostridium bolteae ATCC BAA-613] (659 aa)
Score = 779, Expect = 1.2e-80, Identities = 189/572 (33%), Positives = 339/572 (59%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRD--LKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTK-EEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-LPN-----KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLS--LSDEKL----KTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQ 576
           ++++LKK+P  PG YL  +    +IYVGKA+ L NR++QYF   R+   K +++ + I   +Y++ ++E E+L+LE NLI +++P+YN +L++  ++PYI  T  E+ PR+L++ D  K  +  Y+GP+ ++   K  L + I++++ +R CN+ LP      + C+ Y I QC  PC   ++R++Y+    +  DF +G+   + + L++K   A++ L FE + +Y EL  ++K  +++Q I  S   D DI+     E    + +F    G L+ +  + +         EIL + + ++Y+     +P+ ++L   L DE++     +     K++ + P KG K+ +++ A  NA  ++     ++   + R + ++ ++ +L+ I  + RME +D SN      VG+MVVYE+G   +++YRKF IK     +DY  M+EV+ RR+ +               +  SF   P+LI++DGG+ QV  ALE L  L L   IPV G+ KDD H+T R + ++  EI +D+ S+ +  +  IQDE HRFAI ++R+ + K   ++ L  I  +G  R + L+  ++ ++ ++ ASVEEL Q
  S:     4 LEEELKKLPASPGVYLMHNDRDEIIYVGKAISLKNRVRQYFQSSRNKTAKIEQMVSHIAWFEYILTDSELEALVLECNLIKEHRPRYNTMLKDDKSYPYIKATMGEDFPRLLFARDMKKDGRSRYFGPYTSAGAVKDTL-DLIHKLYRIRTCNRNLPKDTGKERPCLNYHIKQCDAPCQGYISREEYQSNFNQALDFLNGRFDPLIKNLQEKMQTASDNLEFERAIEYRELLNSVKQVAQKQKITSSGMEDRDIVAMARDERDAVVQVFFIREGKLIGRDHFHISAATAENEGEILDSFVKQFYAGTPF-IPRELWLQHPLGDEEVISQWLSAKRGQKVRLVVPKKGEKERLVELAARNAALVLSQDKERIKKEELRTIGAINQIGELIGIGGIRRMEAYDISNTSGVESVGSMVVYEDGRPKRSDYRKFRIKTVQGPNDYASMEEVLTRRFSHGMRETEELKEKGADLSMGSFTRFPDLIMMDGGRGQVNIALEVLDKLGLS--IPVCGMVKDDNHRT-RGLYYNNVEIPIDRHSEGFRLITRIQDEAHRFAIEYHRSLRGKGQVKSILDDIPGIGPARRKALMRHFKDIEAVRSASVEELEQ 602
>gi|154484305|ref|ZP_02026753.1| hypothetical protein EUBVEN_02018 [Eubacterium ventriosum ATCC 27560] >gi|149734782|gb|EDM50699.1| hypothetical protein EUBVEN_02018 [Eubacterium ventriosum ATCC 27560] (633 aa)
Score = 778, Expect = 1.4e-80, Identities = 204/583 (34%), Positives = 345/583 (59%)
  Q:     7 DKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD--RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-------------------LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLK------IKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNT---------------ASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAKEIKKL 589
           ++LKK+P  PG YL  D +  VIYVGKAV+L  R+  YF K   R  K + + ++I   +Y++ ++E E+L+LE NLI +Y+PKYN +L +   +PY+++T  E++PRI+ +    KK    Y+GPF +S   K +  + + +++ +R CNK                   +  + C+YY IGQC GPC   ++++DY   + +   F  G      ++LE+K  +A+  L FE + +  +L  ++   +  Q I   Q  D DII +  + N   + +F   NG L+ +  + L TV      +IL + I +YY      +P+ + +    E+ + LS+ L       ++ +NP KG K+ +++ A  NA  +++    +    Q R + ++EE+++L+ I  ++RME +D SN      V +M+VYE+G   +N YRKF IK      DY  M+EV+ RR+++                  SF   P+++++DGGK QV  ALE L  L L   IPV G+ KDD H+T R + ++  EI + K S+ +  +  +QDE HRFAI ++R+ ++K    + L  I  +G  R + L+ ++++++ I+EA+VE+LSQ+  I  +VAK+I K 
  S:     8 EELKKMPQTPGVYLMHDAHDDVIYVGKAVNLKRRVSSYFRKSTKRTTKIESMVSKIRRFEYILTDSELEALILECNLIKEYRPKYNTMLMDDKTYPYVMITVSEDYPRIVLAR-RMKKDNNKYFGPFTSSAAVK-DTIDLLQKMYQIRSCNKAIVSDGTYTADGEYKNIPKINGRPCLYYHIGQCKGPCQGYISKEDYRENINKAIKFLEGNYTLTIKELEEKMQEASANLDFEKAMECRDLINSINHVAGNQKITTHQFEDRDIIAYAEEGNDAVVQVFFVRNGKLIGREHFYLTTVPGDTGKDILTSFIKQYYIGTPF-IPRELLVQEEVEEPELLSQLLSRNQNYTVRIVNPKKGSKEKLVELAAKNAGNLLEQNKEKYRREQKRTVGAVEEIEELIGITGIHRMEAYDISNTNGYESVASMIVYEDGKPKRNNYRKFRIKSVKGPDDYASMREVLTRRFRHGIEEREKLDMEEKDYKLGSFSNFPDILMMDGGKGQVNIALEVLDSLNLH--IPVCGMVKDDNHRT-RGLYYNNEEIPIAKNSEGFRLITRMQDETHRFAIEYHRSLRNKKQVHSILDDISGVGPARRKALMREFKSIEGIREATVEQLSQVDTISEKVAKDIYKF 631
>gi|167036996|ref|YP_001664574.1| excinuclease ABC subunit C [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855830|gb|ABY94238.1| excinuclease ABC, C subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] (615 aa)
Score = 777, Expect = 2.3e-80, Identities = 214/573 (37%), Positives = 348/573 (60%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL-KDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIK---GTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNK------KCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLN------PSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY---------------KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           I++KLK +P KPG Y+ KDK+G +IYVGKAV L NR++QYF  K++ L K K + + + D +Y+V + E E+L+LE NLI KYKPKYN+LL++   +PYI VT  EE+PRI++    T++I+     Y+GP++ S     E    + ++FP+R CNK   K      +C+YY IG C  PC  K+ ++DY   + +   F  GK   + ++L++   +AAE+L FE++ +  +    ++  SE+Q ++   ++++DII      ++  I +F   +G L  +  Y +      E  EI+ + I ++Y   A  +PK +   +  ++ + LSE L  K  N      P +G KK+++D  + NA+E +KN     I  +  +   + EL  L+ +    R+E +D SN    + VG+MVV+ +G   K++YRKFNIK  +   DY+ M+EVI RR+               + + A F E+P+LI VDGG   V A L+ L  L +   IPV G+ KD KH+T  +V     EI +   S  +  +  IQ+E HRFAI+F++ K+SK  F++ L  I  +G+ R + L + ++++++IK ASVE+L ++
  S:     3 IEEKLKLLPEKPGVYIMKDKSGKIIYVGKAVVLKNRVRQYFQNKEKQLPKVKVMLSHVEDFEYIVTDTELEALMLECNLIKKYKPKYNVLLKDDKNYPYIKVTVNEEYPRIMF----TRRIEPDGAKYFGPYS-SAFAVRETIKLVRKMFPIRTCNKNIEKDMGKVRECLYYHIGLCSAPCTNKINKEDYIKLVDQAVLFLDGKRDWLIQKLKEDMKKAAEELRFEEAARIRDQIFAIERTSEKQKVVSVGEDEQDIISMARSADISCIQVFFVRDGKLSGREHYYMKNTEGMERGEIISSFIKQFYEG-APYIPKEIITDVELDESELLSEWLSQKRGNKVFITIPVRGKKKELVDMVYQNALEALKNDI--SIREEISKAQVVLELSNLVGLDYAKRIEAYDISNTRGQDNVGSMVVFVDGKPKKSQYRKFNIKYVEGQDDYESMREVIERRFLHAIEEKELIEKGELEEDKAKFAEMPDLIFVDGGIGHVNAVLQVLSGLGIS--IPVYGMVKDSKHRTRGLVSPQ-GEIDIPMTSKAFRLIAQIQEEAHRFAITFHKEKQSKR-FKSELLNIPGIGEKRAKALYDAFKSIEEIKRASVEDLKKV 598
>gi|150019667|ref|YP_001311921.1| excinuclease ABC subunit C [Clostridium beijerinckii NCIMB 8052] >gi|189038037|sp|A6M2Y5|UVRC_CLOB8 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|149906132|gb|ABR36965.1| excinuclease ABC, C subunit [Clostridium beijerinckii NCIMB 8052] (621 aa)
Score = 776, Expect = 2.5e-80, Identities = 210/576 (36%), Positives = 349/576 (60%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL------PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLI--TVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIK-----FLN-PSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY---------------KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE 581
           K +LK +P++PG YL K+  G +IYVGKA  L NR++QYF   K+   K K +   + + +Y+V ++E E+L+LE NLI KY PKYN+ L++   +P+I VT  E+ PR+  + +  K     Y+GP+ N+    +E  N I +IFPLR C K       P + C+ Y I +C  PC  ++++ +Y+  + EI +  SGK +S+  +L+++   A+  L FE +    +    ++  +E+Q +  SQ+NDED I  Y  E    I +F   +G +  +   +     + E   I+   I  +Y     ++PK +Y+  SDE ++ L E L IK     F+  P KG KK++++   NNA   +     +++ ++   + SL+E+Q+LL++  +  R+E +D SNI   + VG+M+V+ENG    ++YR+F IK   + +DYD M+E++ RR+               K ++  F   P+LI++DGGK QV  ALE L+ L +D  IPV GL KDD H T  I+ ++ +E+ +++ S+L   +  IQDEVHRFAI+++R+ + K    + L  I N+G+ R   LL K+ ++D IK+A+++EL +   I+
  S:     5 KAQLKILPNEPGVYLMKNSLGEIIYVGKAKILKNRVRQYFQNSKNHSEKVKAMVKNVAEFEYIVTDSEMEALILECNLIKKYSPKYNISLKDDKFYPFIKVTTNEDFPRVFITRNYAKD-GNKYFGPYPNAG-DVHETINLIRKIFPLRTCKKSIIEGEKPTRACLNYHIKKCNAPCEGRISKTEYKKMIDEIMEVLSGKDRSLLNKLKEEMQSASGNLEFEKAASLRDKMIAIENIAEKQKVFKSQENDEDFINIYKDEKDCCIQVFFLRDGKITGREHFMIENSSHEEDTTIISQFIISFYGGTP-KVPKNIYIPESDE-IEALEEFLSIKRGSRVFVKVPIKGEKKEMLELVKNNAKVTLDQFKDKILRDKEINMISLKEIQELLELDSIPLRIEAYDISNIQGVDSVGSMIVFENGKAKNSDYRRFRIKTVKSANDYDSMREILDRRFTHGLKEIEEIQNKEIKFSSGKFSNFPDLIMMDGGKGQVNIALEVLEKLGID--IPVCGLVKDDYHATRGII-YNNNELIINRNSNLMQMIRRIQDEVHRFAITYHRSLRDKRTLHSILDDIPNIGQKRRMSLLMKFGSIDNIKKATLDELLETESID 606
>gi|150391815|ref|YP_001321864.1| excinuclease ABC subunit C [Alkaliphilus metalliredigens QYMF] >gi|189038016|sp|A6TVI7|UVRC_ALKMQ UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|149951677|gb|ABR50205.1| excinuclease ABC, C subunit [Alkaliphilus metalliredigens QYMF] (622 aa)
Score = 776, Expect = 2.9e-80, Identities = 205/573 (35%), Positives = 335/573 (58%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-------LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLK------IKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKD-LYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYK----------NNTAS-----FGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           IK++LK +P KPG YL K+K   +IYVGKA+ L NR++QYF    +   K + +   I   +Y+V ++E E+L+LE NLI + +PKYN+LLR+   +PYI VT  E  PR+L +    K  K  Y+GP+ N +    E    I++++P+R C K          + C+ Y I +C+GPC   V  + Y+  + EI  F  GK   + +++E+K  +AAEK+ FE +  Y + R+ L    ERQ ++     D+DII     E    + +F    G L+ +  Y L T    +  EIL   I ++Y +    +PK V +    E  + +++ L       +K   P +G KK ++     NA   M  +      ++ +   ++  LQ+ L + D ++R+E FD SN      VG+MVV+E G     +YR+F IK     +DY  ++E+IYRRYK           NT +     F   P+LI+VDGG  QV +  + L  L +  +IPV G+ KD++H+T  +V ++  EI +++ S L  F+  +QDEVHRFAI+++R+ ++KS+  + L  I  +G+ R + L++ +E++DK+K+A++EEL ++
  S:     4 IKEQLKLLPDKPGVYLMKNKANEIIYVGKAISLKNRVRQYFQSSNNQHPKVRAMVTHINFFEYIVTDSELEALILECNLIKENRPKYNVLLRDDKTYPYIKVTMNETFPRVLKTRKVLKD-KAKYFGPYTNISALN-ETLEVIHQMYPIRVCGKNIEKMIERQERPCLNYHIRKCIGPCTGMVNDETYQQMIHEIILFLGGKEDELIKKIEEKMKRAAEKMDFEGAAHYRDQRQALLDIIERQKVVSVNDIDQDIIAMAKGEQESCVQVFFVRGGKLVQREHYILTTREDEDEKEILSAFIKQFYGETNF-IPKEVLVEREVEDQELMAQWLTNKRGNHVKVRAPLRGEKKSMIQLVKRNAALTMGQREETQRKSKEKTEGAMVVLQEALGLADAIHRVEAFDISNTQGMESVGSMVVFEGGKPKNKDYRRFKIKTIQGANDYGSIEEIIYRRYKRGVDETKAMIENTMTVQEGKFSLFPDLIMVDGGLGQVTSVKKGLAALGI--LIPVCGMVKDERHRTRGLV-YEGKEIPIERPSHLLRFITQVQDEVHRFAITYHRSLRTKSILHSVLEDIPGIGEKRRKSLMKHFESIDKMKQATIEELIEV 604
>gi|169824072|ref|YP_001691683.1| excinuclease ABC subunit C [Finegoldia magna ATCC 29328] >gi|167830877|dbj|BAG07793.1| excinuclease ABC subunit C [Finegoldia magna ATCC 29328] (608 aa)
Score = 775, Expect = 3.1e-80, Identities = 208/573 (36%), Positives = 347/573 (60%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN------KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK-YDLITVFYSELDEILLTLIYEYYSKIAIEL---PKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYL--QLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYK------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           IK +L+K+PHKPG Y+  DKN  +IYVGKA+DL  R+ QYF   + L K   + + +   +Y++VNNE E+L+LE+NLI K  PKYN++LR+   +PYI +T E+ PR+L +    K  K  Y+GPF N+     ++ + I+  + +R CN      +   + C+ Y I +C G C+  V  +DY   L E+ +F +G+   + ++L  K + A++ L FE + K  +   N+++  E+Q+I  ++  D D+I    +   + + +F   NG ++ + + +I   Y E +E    ++ E++ +  I+L   PK +   +  E    + E L      K++   P +G K D+++    NA E + +KY+   L   +NRE N++ +LQ +  +K + R+E +D SN    + VG+M+V++NG K+  +YRKF IK  +   DY   +EV+ RR++          SF E+P++I++DGGK QV  A E L    LD  IP++GL KDDKH+T  I+ ++  EI+L   + LY  L  IQ+E HRFAI+++R    K+  ++ L  I  +G+ R + L++ ++TLD+IK+ASVEEL ++
  S:     4 IKKELQKVPHKPGVYIMHDKNDEIIYVGKAIDLRRRVGQYFDSSKKLAKVAAMVSHVEYFEYIIVNNECEALVLESNLIKKNSPKYNIVLRDDKQYPYIKITNEKFPRVLKTRRVLKD-KAKYFGPFPNAYAVN-DIIDLIHETYKIRTCNLNFDKGQKLKRPCLNYYINRCDGMCVYDVNEEDYNKELLEVENFLNGREDELTKKLTDKMMAASKNLNFELAAKLRDSITNIQVILEKQNITNTKGLDLDMISMAREAETVCVQVFFMRNGKIIERQHFIIDNKYEESNE---HIVGEFFKQFYIDLTYVPKQILTDIEIEDRDLIEEMLTEKKGSKVEIKIPKRGNKTDLLEMVRVNAKEGL-DKYISRHLKRERNRE-NAILDLQDITGVKPIDRIECYDISNTSGVDSVGSMIVFKNGAKSSKDYRKFKIKTVEGADDYASHREVLTRRFRRLLDSDKKDNSFDEMPSIILMDGGKGQVNIAKEVLNEFNLD--IPILGLVKDDKHRTRGII-YENEEIRLKVNTPLYRLLFAIQEETHRFAINYHRKLHEKNFKKSELDNIALIGEKRKKALMKHFKTLDRIKKASVEELCEV 591
>gi|167039707|ref|YP_001662692.1| excinuclease ABC subunit C [Thermoanaerobacter sp. X514] >gi|166853947|gb|ABY92356.1| excinuclease ABC, C subunit [Thermoanaerobacter sp. X514] (615 aa)
Score = 774, Expect = 4.8e-80, Identities = 214/573 (37%), Positives = 348/573 (60%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL-KDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIK---GTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNK------KCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLN------PSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY---------------KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           I++KLK +P KPG Y+ KDK+G +IYVGKAV L NR++QYF  K++ L K K + + + D +Y+V + E E+L+LE NLI KYKPKYN+LL++   +PYI VT  EE+PRI++    T++I+     Y+GP++ S     E    + ++FP+R CNK   K      +C+YY IG C  PC  K+ ++DY   + +   F  GK   + ++L++   +AAE+L FE++ +  +    ++  SE+Q ++   ++++DII      ++  I +F   +G L  +  Y +      E  EI+ + I ++Y   A  +PK +   +  ++ + LSE L  K  N      P +G KK+++D  + NA+E +KN     I  +  +   + EL  L+ +    R+E +D SN    + VG+MVV+ +G   K++YRKFNIK  +   DY+ M+EVI RR+               + + A F E+P+LI VDGG   V A L+ L  L +   IPV G+ KD KH+T  +V     EI +   +  +  +  IQ+E HRFAI+F++ K+SK  F++ L  I  +GK R + L + ++++++IK ASVE+L ++
  S:     3 IEEKLKLLPEKPGVYIMKDKSGKIIYVGKAVVLKNRVRQYFQNKEKQLPKVKVMLSHVEDFEYIVTDTELEALMLECNLIKKYKPKYNVLLKDDKNYPYIKVTVNEEYPRIMF----TRRIEPDGAKYFGPYS-SAFAVRETIKLVRKMFPIRTCNKNIEKDMGKVRECLYYHIGLCSAPCTNKINKEDYIKLVDQAVLFLDGKRDWLIQKLKEDMKKAAEELRFEEAARIRDQIFAIERTSEKQKVVSVGEDEQDIISMARSADISCIQVFFVRDGKLSGREHYYMKNTEGMERGEIISSFIKQFYEG-APYIPKEIITDVELDESELLSEWLSQKRGNKVFITIPVRGKKKELVDMVYQNALEALKNDI--SIREEISKDQVVLELSNLVGLDYAKRIEAYDISNTRGQDNVGSMVVFVDGKPKKSQYRKFNIKYVEGQDDYESMREVIERRFLHAIEEKELIEKGELEEDKAKFAEMPDLIFVDGGIGHVNAVLQVLSGLGIS--IPVYGMVKDSKHRTRGLVSPQ-GEIDIPMTTKAFRLIAQIQEEAHRFAITFHKEKQSKR-FKSELLNIPGIGKKRAKALYDAFKSIEEIKRASVEDLKKV 598
>gi|116625695|ref|YP_827851.1| excinuclease ABC subunit C [Solibacter usitatus Ellin6076] >gi|122939314|sp|Q01S04|UVRC_SOLUE UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|116228857|gb|ABJ87566.1| Excinuclease ABC subunit C [Solibacter usitatus Ellin6076] (623 aa)
Score = 772, Expect = 7.1e-80, Identities = 188/583 (32%), Positives = 337/583 (57%)
  Q:     4 QIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR--DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKC----NKLPNKKCIYYDIGQCLGPCIKKVTRQD-YEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDE-----ILLTLIY--EYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           +++DK+ ++P  PG YL+KD  G VIYVGKA  L NR++ YF +D+  D+KT  L  E CD+DY++V+NE E+L LENNLI +YKP++N+LLR+   +PY+ VT E++PR+ Y     +K    Y+GPF  +N+  + L +FI+R F +  C     +   K C+ + I +CLGPC++ +T  + Y   ++++  F  G+   +   L  +   A+ ++ FE++    +L   ++   ERQ +  ++ +D DI   Y +  ++++ IF   NG ++ + +L      E DE      LL  IY  + +    I +P       + E+L T     +++   P +G KK ++     NA      ++ +++   +R +   E LQ  L++ D   R+E FD S+I  T+KV +MVV+E+G   K++YRKF I+    N D+  M+EV+ RRY         +P L+++DGG  Q+ AA E+L+ + + +  P+  +AK  + +   +   +   + LD+ S +   + +I+DE HRFA++F+R+ ++     + L  I+ +G   ++KLL+++ +L++++ A+  +L+ +V    AK +
  S:     2 ELRDKVGQLPFSPGVYLYKDSGGKVIYVGKAKSLRNRVRSYFSEDKLGDIKTGTLITEACDIDYILVDNEKEALALENNLIKQYKPRFNILLRDDKTYPYVKVTNEKYPRV-YVTRRLRKDGAQYFGPFFPANL-AHRLVHFIHRHFQVPSCKVDLTRFHPKPCLQFHIHRCLGPCVQGLTTDEAYAAAVRDVRLFLDGRHSDLARGLRARMEAASLEMRFEEAAGLRDLITTVEEIEERQKMAAAKGDDVDIFAVYAEPPLVALNIFHLRNGQIVDRRELFWEDQFEYDESLFLSSLLKQIYLDQQFVPAEIHVPVEFEDLEALEELLTEKRQRRVEIRTPQRGQKKALLGLVETNAKHSFDARF-RVLKPSSRAIQ--EALQDALNLPDAPSRIECFDISHIQGTDKVASMVVWEDGKMKKSDYRKFIIRTVVGNDDFASMREVVTRRYSRLQEEKQPMPGLVLIDGGLGQLHAAAEALEAIGI-ADQPLASIAK--REEIIYVFGQEDEPVVLDRFSPILHLVQSIRDEAHRFAVTFHRSLRNTRQLTSELDAIRGVGAKTVQKLLKEFGSLERVRAATETQLATVVGRAAAKRV 591
>gi|153956163|ref|YP_001396928.1| excinuclease ABC subunit C [Clostridium kluyveri DSM 555] >gi|189038039|sp|A5N361|UVRC_CLOK5 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|146349021|gb|EDK35557.1| UvrC [Clostridium kluyveri DSM 555] (622 aa)
Score = 771, Expect = 9.9e-80, Identities = 210/569 (36%), Positives = 340/569 (59%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK-------CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSEL--DEILLTLIYEYYSKIA-----IELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           + +LK +P KPG YL K+  G VIYVGKA  L NR++QYF K ++   K + +   I + +Y+V ++E E+L+LE NLI KY+P+YN+LL++   +P I +T  E+ PRI+ + +  K     Y+GP+ ++    YE    I +IFP+R C KL  KK       C+ Y IG C  PC   +++++Y   +  + DF SGK+K I  +L++     +E + FE + +  +    L+   E+Q I      DED I  +  E    I +F    G ++ +   I     +L   EI+   I E+Y   A     I +P+   + L ++ L    +S K+    P KG KK +++    NA   ++N  L+ I ++     SLEEL ++L++ D+ +R+E +D SNI   + VG MVV+ENG    N+YR+F I +    +DY+ MKE++ RR++N               +   F   P+LI++DGGK QV AALE LK   +D  I V G+ KDDKH+T  ++ +   E+ L++ S++   +  IQDEVHRFA++++R+ +SK +  + L  I N+G  R ++LL+++ +++ IK+AS+EEL
  S:     5 EQQLKILPDKPGVYLMKNSLGEVIYVGKAKILKNRVRQYFQKSKNHSEKVRTMVKHISEFEYIVTDSEMEALVLECNLIKKYRPRYNILLKDDKIYPLIKITLNEDFPRIICARNKIKD-GAKYFGPYISTG-AVYETMEVIKKIFPIRDC-KLNIKKGNVKVRPCLNYHIGLCKAPCTGHISKEEYGKIISGVMDFLSGKNKDIIRKLKEDMDTLSENMEFEKAAELRDKIFALEKIIEKQKITTGGFEDEDFINIHSDEKDSCIQVFFSRTGKIIGREHFIIEDTQDLPKGEIVANFIKEFYGGTAYIAKTIYVPEIYDVQLLEDWLSIKKDS-KVYIKIPQKGDKKAILNLVEKNARTTLQNFKLKFIQDKKMYETSLEELMEILNLDDIPHRIEAYDVSNIQGVDSVGTMVVFENGRPKHNDYRRFKINEVKGANDYESMKEILRRRFQNGMEEIKRIKERKLEFSAGKFSFFPDLILMDGGKIQVSAALEVLKEFNID--ITVCGMVKDDKHRTRGLI-YRNEEMPLNRNSNIIKLITRIQDEVHRFAVTYHRSLRSKRVLHSVLEDIPNVGVKRRKELLKRFLSVENIKKASMEEL 599
>gi|27262180|gb|AAN87371.1| exconuclease ABC subunit C [Heliobacillus mobilis] (630 aa)
Score = 771, Expect = 1.2e-79, Identities = 207/586 (35%), Positives = 348/586 (59%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLP----NKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLS---LSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEE----LQKLLDIKD-LYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNN---------------TASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-----IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           M+  +++KLK +P +PG YL KD+ G VIYVGKA++L NR++ YF   ++L  KT+ L   I D++ +V ++E E+L+LE NLI ++KP+YN++LR+   +PY+ VT +E +PR+L +    +K  G Y+GP+ ++   + E  N +  IFPLR C++       + C+ Y IG+CL PC  KV+R +Y   LK I  F  GK   +  +L ++  QAAE L FE + +     + L+   E+Q ++ +   D+D+I      N + + IF    G L+ +   I     E++  E++   + +YYS+    +P+ + L     S E+ + LS  L      K++   P +G K  +++    NA+  ++    QL + Q R+ +  EE    LQ+ L +++  +R+E FD SN      V +MVV+E G     EYR+F IK  D  +D+  M+EV+ RR+                  +A F  +P+LIIVDGGK Q+ +A E+L+ +  D  IP  GLAK++        +W F E     I L + S   + +  I+DE HRFAI+++R  ++++   + L +I  +G  R   LL  + ++ KI EA++E+L+ +  + +E+A+ +
  S:     1 MHLTLQEKLKNLPDRPGVYLMKDETGRVIYVGKAINLKNRVRSYFQSAKNLTAKTQALVARIQDLETIVTDSELEALILECNLIKEHKPRYNIMLRDDKTYPYLKVTLQETYPRLLMTR-RLEKDGGKYFGPYTSAGAVR-ETLNLLRSIFPLRTCSRKDFDQRKRPCLNYHIGRCLAPCFGKVSRDEYMHMLKNIIAFLEGKEDDLLRRLREEMHQAAEDLEFERAAELRNRIQALEQVMEKQKVVSTDLEDQDVIAMARGFNQVCVQIFFIRGGKLIGREHFILEGTDEMERSEVITAFVKQYYSRSEF-VPREILLQEPLESQEEEEVLSRFLKEKRKGKVEIRVPKRGDKLKLIEMVAKNALLTLE----QLQNEQQRKKSMTEEAVLDLQRYLALEEPPWRIECFDISNTMGKESVASMVVFEGGAPKNAEYRRFRIKTVDGPNDFASMQEVLNRRFSRAREEAQAVEEGQLDPMSAKFAVLPDLIIVDGGKGQLSSARETLRRVGYD-YIPTFGLAKEN--------EWLFHESSSEPIILPRGSRSLYLVQRIRDEAHRFAITYHRKLRAQAQTASVLDEISGIGPKRKTALLRHFGSVKKIAEATLEQLAAVDGMNVEIAERV 615
>gi|153814597|ref|ZP_01967265.1| hypothetical protein RUMTOR_00811 [Ruminococcus torques ATCC 27756] >gi|145848091|gb|EDK25009.1| hypothetical protein RUMTOR_00811 [Ruminococcus torques ATCC 27756] (624 aa)
Score = 769, Expect = 1.6e-79, Identities = 200/576 (34%), Positives = 331/576 (57%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRD--LKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-LPN-----KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYS--ELDEILLTLIYEYYSKIAIELPKTVYLS--LSDEKL----KTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           N  I+++LKK+P +PG YL  D+   +IYVGKA+ L NR++QYF   R+  +K +++   I   +Y+V ++E E+L+LE NLI ++ PKYN +L +   +P+I VT  E  PR+L +    K  K  Y+GP+ ++   + +  + I++++ +R CN+ LP      + C+ Y I QC  PC   ++++DY   + E+  F +G    I ++LE+K   A+E L FE + +Y EL  ++K  +++Q I  S   D DI+    +     + +F    G L+ +        S  +   IL + I +YY+     +P  + +   + D +L     T     K+    P KG K+ +++ A +NA  ++     ++   + R + +++E++ LL I  + RME +D SN      VG+MVVYE G   +N+YRKF IK      DY  M+EV+ RR+ +             F   P+LI++DGGK QV  AL+ L+ L L+  IPV G+ KDD H+T R + +   EI ++K S+ +  +  IQDE HRFAI ++R  + K    + L  I+ +G  R + L+  Y +LD IK AS+EEL+++
  S:    12 NFNIQEELKKLPARPGVYLMHDERDEIIYVGKAISLKNRVRQYFQSSRNKGVKIEQMVTHIRRFEYIVTDSELEALVLECNLIKEHHPKYNTMLMDDKTYPFIKVTVNEPFPRVLLARKMLKD-KAKYFGPYTSAQAVR-DTIDLIHKLYHVRSCNRNLPKDIGKERPCLNYHIKQCDAPCQGYISQEDYGAAIAEVLKFLNGNYDVILKELEEKMNTASENLEFERAIEYRELINSVKKIAQKQKITDSSGEDRDILAAASEGEDAVVQVFFIRGGRLIGRDHFYLRISSGEKTSGILDSFIKQYYAGTPY-IPGELMIQEEIKDRELIETWLTSKRGQKVTVKVPKKGTKEKLVELASDNAKLVLSKDKERMRREEGRTIGAVKEIEALLGISQIRRMEAYDISNTNGFESVGSMVVYERGKPKRNDYRKFKIKGIQGADDYGSMREVLTRRFTHGLKEREENGELGKFTVFPDLILMDGGKGQVNVALQVLEDLNLN--IPVCGMVKDDFHRT-RGLYFQNEEISIEKSSEAFRLITRIQDEAHRFAIEYHRQLRGKGQVHSILDDIEGIGPARRKALMRHYLSLDAIKAASIEELAKL 607
>gi|163847590|ref|YP_001635634.1| excinuclease ABC, C subunit [Chloroflexus aurantiacus J-10-fl] >gi|187599109|ref|ZP_02985343.1| excinuclease ABC, C subunit [Chloroflexus sp. Y-400-fl] >gi|163668879|gb|ABY35245.1| excinuclease ABC, C subunit [Chloroflexus aurantiacus J-10-fl] >gi|187488541|gb|EDU26508.1| excinuclease ABC, C subunit [Chloroflexus sp. Y-400-fl] (651 aa)
Score = 766, Expect = 3.6e-79, Identities = 203/583 (34%), Positives = 351/583 (60%)
  Q:     7 DKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKI---KGTYYGPFANSNIKKYELYNFINRIFPLR---KC-------NKLPNKKCIYYDIGQCLGPCIKK-VTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITV--FYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYK--------------------NNTA-----------SFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKD-DKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAKEIKKL 589
           ++L+ +P +PG YLWKD NG ++YVGK+  L +R++ YF   R L  KT++L + I D D +V  +E E+LLLE NLI +++P YN+LL++   +PYI VT  E+ PR+     +T+++      Y+GP+A+     Y+  + +NR+F  R   +C       ++   K C+YY + +CLGPC+   VT++ Y   +  +  F  GKS  I  +L  +  QAAE+L FE +    +  + ++  SERQ ++ +   D+D+I F  +E   ++V   ++ G  L   +  T+     E DE LLT     + + A  +P  + L+   E+   ++  L      +++   P +G K+ +++ A NNA + ++    Q ++++ R + +L EL+ LL++  L +R+E +D SNI   + V +MVV+E G      YR+F IK     +D   + EVI RR++                    N T+           S+ E+P+L++VDGG+ QV AA  +L+ L     IPV+G+AK  D+++ D +++ D   + L + S     +  I +E HRFAI+++R  +SK+   +SL  I  +G  R   LL+ + +LD I++AS++EL+ +  +  + A+E+K L
  S:    16 ERLRLVPDQPGVYLWKDANGRLLYVGKSKRLRDRMRSYFGSPRSLSGKTRRLVSHIADFDIIVTQSELEALLLEMNLIKQHRPPYNILLKDDKTYPYIKVTVNEDWPRVF----ATRQVLNDGARYFGPYASPG-SVYQALDVLNRLFAFRPPYECKDDKFNRHRKLGKPCLYYQMRRCLGPCVPGLVTKEAYRQAIDAVCRFLEGKSDQIVRELRAQMEQAAEQLEFERAAYLRDRIQAIEKISERQQVLRTVDTDQDVIAF-AREEGSAVVQVLFIRGGKLINAEPFTLQGTEGESDEALLTSFLTQFYQDAPNIPPNLLLADHVEEPMIIASWLQQKSGHRVEITVPRRGEKRQLVELAANNARQKLREIREQWLNSEQRAVAALSELRDLLELPALPHRIECYDVSNIQGQHSVASMVVFERGSPRPAHYRRFKIKTVSGANDVASLHEVISRRFRRAAEALGETQTVTGMVADDDNKTSETGNTDQQALESWAELPDLLLVDGGQAQVAAASAALRDLGFTQ-IPVVGVAKGPDRNRFD-LIRLDCEPLVLARDSKALALIQRIDEEAHRFAITYHRKLRSKATLRSSLEDIPGIGPKRKRALLKAFGSLDAIRQASIDELAAVPGMTRKAAEELKSL 650
>gi|167768134|ref|ZP_02440187.1| hypothetical protein CLOSS21_02689 [Clostridium sp. SS2/1] >gi|167709658|gb|EDS20237.1| hypothetical protein CLOSS21_02689 [Clostridium sp. SS2/1] (622 aa)
Score = 766, Expect = 3.8e-79, Identities = 197/573 (34%), Positives = 335/573 (58%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-LP-----NKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY--------------KNNT-ASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           I+ +LKK+P KPG YL  +    +IYVGKA+ L NR++QYF   R+L  K + +   +   +Y++ ++E E+L+LENNLI ++ PKYN  L++   +PYI VT  EE PRI+ +    K   G Y+GP+ ++     +    + +IF +R CN+ LP     ++ C+YY I QC  PC   +++++Y   ++E   F +G  K + + L++K  +A+++L FE + +Y +L K+++   +RQ I      D DII     +  + + IF    G LL +  + +     S  +E+L   + ++Y+     LP  ++L     + + + E L      K+ F  P +G K  +++ A  NA  +++    ++   + R + ++ E+++LL ++ L RME FD SNI     V +MVV+E G   + +YRKF ++  +   DY  M+EV+ RR+              K+ T  SF + P+++++DGGK QV  AL  L  L LD  IPV G+ KDD H+T R + ++  EI     S+ +  +  IQDE HRFAI ++R+ ++K    + L  IK +G  R ++L++ ++ L +IK A+V EL  +
  S:     4 IQQELKKLPAKPGVYLMHNSKDEIIYVGKAIKLCNRVRQYFQDSRNLSVKIQHMVKNVAYFEYIITDSELEALVLENNLIKEHHPKYNTKLKDDKGYPYIKVTVNEEFPRIMLAR-KMKADGGKYFGPYTSAGAVN-DTIELLRKIFKIRTCNRRLPKDTGKDRPCLYYQIKQCDAPCQGYISKEEYAKQIEETIKFLNGNYKQVAKMLQEKMQKASDELEFEQAMEYRDLLKSIERIMDRQKINTYAFEDRDIIAMAQDDKDVVVSIFFIRQGKLLGREHFHMEADEESSKEEVLGAFVKQFYAGTPY-LPGEIFLEHDISEKEIIEEWLSKKRGAKVHFKIPVRGQKHKMVEMAKENAQNVLRMDREKIKREERRTIGAVHEIEELLGMEGLNRMEAFDISNISGFQTVASMVVFERGKARRRDYRKFRLRTIEGPDDYASMEEVLTRRFLHGKKELEELKEQGKDTTLGSFTKFPDILMMDGGKGQVNVALRVLDHLGLD--IPVCGMVKDDDHRT-RGLYYNNEEIIFAPNSEAFLLVTRIQDEAHRFAIEYHRSLRAKGQVHSVLDDIKGVGPKRRKELMKYFKDLGQIKTATVTELLNV 602
>gi|168185645|ref|ZP_02620280.1| excinuclease ABC, C subunit [Clostridium botulinum C str. Eklund] >gi|169296408|gb|EDS78541.1| excinuclease ABC, C subunit [Clostridium botulinum C str. Eklund] (621 aa)
Score = 766, Expect = 4.0e-79, Identities = 208/567 (36%), Positives = 341/567 (60%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYI-LVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKC------NKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLI---TVFYSELDEILLTLIYEYYSKIAIELPKTVY------LSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEI---------------PNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           +LK IP KPG YL K+  G VIYVGKA  L NR++QYF   K    K + +   I + +Y++ ++E E+L+LE NLI KY+P+YN+LL++   +P++ + T E+ PRI  +    K     Y+GP+  ++   Y+    I +IFPLR C      N  P K C+ Y I  C+ PC   ++R++Y   +K+I D  +GK   +   L+ K  +A+E+L FE++    +    ++   ERQ II S   +ED I  Y +E  +   IF   +G ++ +   I   ++F +  D I+   I E+Y   A  +PK +Y      + L +  L +   S K+    P KG KK ++D   +NA   ++   L+L  ++    N+L+ELQ +L ++++  R+E +D SNI   + VG+M+V++ G    ++YR+F IK     +DYD M+E++ RR+ +      EI               P+LI++DGGK QV  ALE L+ L ++  IPV G+ KDDKHKT  +V ++  EI +   + +  F+  +QDEVHRFAI+++R+ +++ +  + L  I N+G+ R ++LL+K+ +++ IK+AS EEL
  S:     7 QLKIIPEKPGVYLMKNSLGEVIYVGKAKVLKNRVRQYFQNSKSHGSKVRAMVKNIAEFEYIITDSEMEALILECNLIKKYRPRYNILLKDDKHYPFLKITTNEDFPRIFVTRVRAKD-GARYFGPYPETS-AVYDTIELIKKIFPLRTCRLNIKENSEPIKPCLNYHIKLCMAPCAGYISREEYRKIIKKIIDLLNGKDNDVINDLKSKMEKASEELNFEEAATLRDKILAVEKIRERQKIISSNFENEDFINIYSEEVDLCAQIFFIRDGKIMGREHFILDRSIFGNNAD-IISDFIKEFYGGTAF-IPKNIYAPEVMDIELLENWLSSKKGS-KVSIKIPQKGEKKKLLDLVESNAKNTLEQFKLKLKVDKELYSNTLKELQNVLGLEEIPNRIEAYDISNIQGVDSVGSMIVFDKGKPKNSDYRRFKIKTVKGANDYDSMREILTRRFTHGLGEIKEIQKRDLLLSGAKFSIFPDLILMDGGKGQVNIALEVLEKLNIN--IPVCGMVKDDKHKTRGLV-YNNKEINIKSNNKIMQFITRVQDEVHRFAITYHRSLRNRRVLHSVLEDIPNVGQKRRKELLQKFGSIENIKKASYEEL 599
>gi|163815353|ref|ZP_02206728.1| hypothetical protein COPEUT_01517 [Coprococcus eutactus ATCC 27759] >gi|158449327|gb|EDP26322.1| hypothetical protein COPEUT_01517 [Coprococcus eutactus ATCC 27759] (638 aa)
Score = 765, Expect = 5.2e-79, Identities = 190/569 (33%), Positives = 328/569 (57%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK--DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEH-PRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-LPN-----KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYC---KENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           +++LKK+PH PG YL  D    +IYVGKA+DL NR+ QYF     +  K +K+ + I   +Y+V  +E E+L+LE NLI +++P YN +L +   +PYI +T EE  PRILYSH   K+    Y+GP+ NS   K ++   + +++ +R C++ LP      + C+Y+ I QC  PC   ++++DY   +++   F +G    + + LEK+  + A+++ FE + +  +L K+++     Q +  +  +D D+I        E VISI   +  +G ++ +  Y +  V   +   I+ + + +YY+     LPK + +    +    + E L      ++  + P KG K+ ++  A +NA  +M     +L   + R   + +EL +L+ +    R+E FD S+I   + V +MVV+ENG   KN+YRKF ++  D   DY  M+EV+ RR+ +    F   P+++++DGG+ QV  ALE L  L L+  IPV G+ KDD H+T R + ++  EI+    +  +  +  +QDE HRFAI ++R+ +SK+   + L  I  +G  R + LL  ++ +D IK+A++ +L
  S:    28 EEELKKLPHVPGVYLMHDSGDHIIYVGKAIDLYNRVHQYFQAGYKKSPKIQKMVSHIAWFEYIVCGSELEALVLECNLIKEHRPHYNTMLTDDKGYPYIRITVEEDFPRILYSH-QMKRDHSKYFGPYTNSRAVK-DIIELLKKLYHIRSCSRNLPKDIGLERPCLYHQIKQCDAPCQGYISKEDYNNNIQQAISFLNGNHGHVVKDLEKRMRELADEMEFEQASEIRDLIKSIQHIETTQRVGDTSSDDRDVIAMATDLGNECVISIFFVR--SGKMIGREHYHMSGVNAEKYSTIMESFLKQYYASTPY-LPKEIIIEQQIDDYALIEEYLSARCGSQVHIVIPQKGDKQKLLKLAKDNAFLVMNQDADKLKREKERTEGAAKELAQLIGVPSAKRLEAFDISHISGYHSVASMVVFENGRAKKNDYRKFKLRTIDGPDDYASMREVLTRRFTDE--KFNIYPDILMMDGGRGQVNIALEVLGDLGLN--IPVCGMVKDDHHRT-RGLYYNNKEIEFPAGTQAFNMITRLQDEAHRFAIEYHRSLRSKAQIHSVLDDIDGIGPARRKALLAYFKDIDNIKKAAIADL 606
>gi|118443548|ref|YP_877364.1| excinuclease ABC subunit C [Clostridium novyi NT] >gi|189038040|sp|A0PYB2|UVRC_CLONN UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|118134004|gb|ABK61048.1| excinuclease ABC, C subunit [Clostridium novyi NT] (621 aa)
Score = 763, Expect = 8.1e-79, Identities = 206/567 (36%), Positives = 343/567 (60%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYI-LVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKC------NKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLI---TVFYSELDEILLTLIYEYYSKIAIELPKTVYL-SLSD----EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           +LK IP KPG YL K+  G VIYVGKA  L NR++QYF   K+   K + +   I + +Y++ ++E E+L+LE NLI KY+P+YN+LL++   +P++ + T E+ PRI  +    K     Y GP+  ++   YE    I +IFPLR C      N  P K C+ Y I  C  PC   ++R++Y   +K+I D  +GK   +   L+ K  +A+ +L FE++  + +    ++   ERQ II S   +ED I  Y +E  +   IF   +G ++ +   I   ++F +  D I+   I ++Y   A  +PKT+Y+  + D    E   +  +  K+    P KG KK ++D   +NA   ++   L+L  ++    N+L+ELQ +L+++++  R+E +D SNI   + VG+M+V++ G    ++YR+F IK     +DYD M+E++ RR+ +               + A F   P+LI++DGGK QV  ALE L+ L ++  IPV G+ KDDKHKT  +V ++  EI +   + +  F+  +QDEVHRFAI+++R+ +++ +  + L  I N+G+ R ++LL+K+ +++ IK+AS +EL
  S:     7 QLKIIPEKPGVYLMKNSLGEVIYVGKAKVLKNRVRQYFQNSKNHGSKVRAMVKNIAEFEYIITDSEMEALILECNLIKKYRPRYNILLKDDKHYPFLKITTNEDFPRIFVTRVRAKD-GARYLGPYPETS-AVYETIELIKKIFPLRTCRLNIKENGEPVKPCLNYHIKLCTAPCAGYISREEYGKTIKKIIDLLNGKDNEVINDLKIKMEKASSELKFEEAASFRDKLLAVEKIRERQKIISSNFENEDFINMYSEEIDLCAQIFFVRDGKIMGREHFILDRSIFGNNAD-IISNFIKDFYGGTAF-IPKTIYVPEVMDIELLENWLSSKKGSKVSIKIPQKGEKKKILDLVESNAKNTLEQFKLKLKVDKELYSNTLKELQNILELEEIPNRIEAYDISNIQGVDSVGSMIVFDKGKPKNSDYRRFKIKTVKGANDYDSMREILTRRFTHGLEEIKEIQKRNLLLSGAKFSVFPDLILMDGGKGQVNIALEVLEKLNIN--IPVCGMVKDDKHKTRGLV-YNNKEINIKSNNKIMQFITRVQDEVHRFAITYHRSLRNRRVLHSVLEDIPNIGEKRRKELLQKFGSVENIKKASYDEL 599
>gi|89210698|ref|ZP_01189084.1| Excinuclease ABC, C subunit [Halothermothrix orenii H 168] >gi|89159668|gb|EAR79330.1| Excinuclease ABC, C subunit [Halothermothrix orenii H 168] (607 aa)
Score = 762, Expect = 1.2e-78, Identities = 199/573 (34%), Positives = 336/573 (58%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-----LPNKK-CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK-YDLITVFYSELD-EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           I+++LK++P +PG YL KD+ G VIYVGKA  L  R++ YF K +   KTK +   I D DY+V + E E+ +LE NLI KY PK+N+ L++   +PYI VT +E+ PRI  +    K     Y+GPF + N   Y+  + +  +F LR C K      P K+ C+ Y IG+C+GPCI  + R  Y   +  +  F SGK   +  ++EK+  QAAEK  FE + ++ +  + LK  S +Q ++ S+  ++DII    +E    + +    NG L+ + Y L+     E + +I+++ + +YY + A E+P+ + ++    + + L + L      K+K L P KG KK +++ A  NA + +K + ++    + R   +L++L + L +      +E FD SNI  ++ V +MVV+++GV +K +YR+F IK     +D+  M+EV+ RRY       G++P+LI++DGGK Q+ AALE LK + LD  + + GLAK ++   +  +      + + +KS     L  ++DE HRFA+S++R  +S+ L    L +I  +G  R + LL  + +L  I++A++ +L ++
  S:     4 IEEQLKRLPDRPGVYLMKDETGEVIYVGKAKSLRRRVRSYFRKGNHTFKTKIMVKHIADFDYIVTDTEVEAFILEANLIKKYNPKFNIRLKDDKTYPYIKVTVQEDFPRIFKTR-LVKNDGNRYFGPFTDVN-AIYKTIDVLKDLFSLRTCKKNLEAGKPEKRPCLNYHIGKCVGPCIGAIDRNSYRELVDRVCLFLSGKQDELINEVEKEMYQAAEKKNFEKAARFRDAVRALKNISAQQKVMSSKNINQDIIALVEEEGEACVQVLFIRNGRLIGQEYFLMEGVDEESNTDIMVSFLQQYYEQ-APEIPQEIVINTHVSQTELLEDWLQQKKGKKVKILIPLKGEKKRLVEMASKNASQNLKKELIRRKYQKQRNEKALDQLVEYLVLSSKPVHIEGFDISNIQGSDPVASMVVFKDGVPSKADYRRFRIKTVSGPNDFAMMQEVVKRRYSRLLEEEGDLPDLILIDGGKGQLNAALEVLKEMNLD-YLDIAGLAKREE---EVFLPGQKEPVIIPRKSPALHLLQRVRDEAHRFAVSYHRKLRSRRLTHTMLDEIPGVGPKRRKALLSHFGSLGAIRKATIGQLKEV 586
>gi|125975219|ref|YP_001039129.1| excinuclease ABC subunit C [Clostridium thermocellum ATCC 27405] >gi|196253520|ref|ZP_03152144.1| excinuclease ABC, C subunit [Clostridium thermocellum DSM 4150] >gi|189038042|sp|A3DJ07|UVRC_CLOTH UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|125715444|gb|ABN53936.1| Excinuclease ABC subunit C [Clostridium thermocellum ATCC 27405] >gi|196197061|gb|EDX91934.1| excinuclease ABC, C subunit [Clostridium thermocellum DSM 4150] (625 aa)
Score = 757, Expect = 3.9e-78, Identities = 204/573 (35%), Positives = 344/573 (60%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF--LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-LP-----NKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSEL--DEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNR-ELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYK------------------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           I+++LKK+P KPG Y+ KD+NG +IYVGKAV L NR++QYF  L ++  K + +   I + +Y+V + E E+L+LE NLI K++PK+N+LL++   +PYI VT  E+ PRIL +    +K    Y+GP+ ++   + E  + + ++FP++ C+K LP      + C+ Y I QCLGPC   V++++Y   ++++ +F  G+ + I ++LEK   +AA+ L FE + +  +   +LK  +E+Q II +   D+D+I F   E    I +F    G L+ +   I    S++   E++   + ++YS  A  +P  + L    ++++ + + L      K     P +G K  +++    NA+ I  N++ + I  +       +E+L++LL++  L  R+E +D SN  +T  VG+MVV+ENG   K++YR+F IK  +  +DY  M+EVI+RR K                     A FG +P++++VDGG   V A    L+  ELD  IPV G+ KDD H+T  +V  +  E  L K   L  F+  IQDE HRFA+ + R  ++K    + L  I+ +G  R ++L+  + ++  IKEA   E++++
  S:     4 IQEELKKLPDKPGVYIMKDENGEIIYVGKAVVLKNRVRQYFQSLSNQTPKVRAMVAHIKEFEYIVTDTELEALILECNLIKKHRPKFNILLKDDKNYPYIKVTMNEDFPRILMTR-RVEKDGAKYFGPYTSAYAVR-ETIDLVKKLFPVKTCSKVLPRDIGKGRPCLNYHIYQCLGPCQGNVSKEEYRFMMQDVCNFLGGRQEDIIKKLEKDMKEAADNLEFERAARIRDKINSLKHIAEKQKIISTAMEDQDVIAFAKSETDSCIQVFFIRGGKLIGREHFILEGTSDVSDSELMTAFVKQFYSSAAY-VPGQIILQEDIDEMEIIEKWLSGKRGTKTYIKVPRRGEKLKLVEMVSKNAL-IELNQFKERIKKEAALAKEGMEKLKELLNLDRLPRRIEAYDISNTGSTEIVGSMVVFENGSPKKSDYRRFKIKSINVQNDYQSMQEVIFRRLKRAQKEMTEKDEGGGKDVGEKGAGFGTLPDVLLVDGGTGHVNAVRSVLE--ELDFNIPVYGMVKDDNHRTRGLVTGE-REFDLSKDIVLLRFVTAIQDEAHRFALEYNRKLRAKRYSGSVLDNIEGVGPKRKKELIRHFGSVKAIKEAEPGEIAKV 606
>gi|168216567|ref|ZP_02642192.1| excinuclease ABC, C subunit [Clostridium perfringens NCTC 8239] >gi|182381551|gb|EDT79030.1| excinuclease ABC, C subunit [Clostridium perfringens NCTC 8239] (620 aa)
Score = 757, Expect = 3.9e-78, Identities = 201/569 (35%), Positives = 329/569 (57%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYI-LVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL------PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLI--TVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSD----EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEI---------------PNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           + +LK +P KPG Y+ K+  G VIYVGKA  L NR++QYF   K+   K + +   I + +Y+V ++E E+L+LE NLI KY P+YN+ L++   +P+I + T E+ PR+  + +  K     Y+GP+ N     YE+   I ++FPLR C K       P + C+ Y I  C  PC   +++ +Y   + EI +  +G   SI + L+ +  +AAE+L FE + K  +    +++ SE+Q +   ++ DED I  Y  E      +F    G +  +   +   +    ++E++ + I  +Y   A ++PKT+Y+   + D    EK  T     K+    P KG KK+++D   NNA  ++     +++  +    ++L EL  +L +  L  R+E +D SNI   + VG MVV+ENG    ++YR+F IK     +DY+ M+E++ RR+ +      +I               P+LI++DGGK QV  ALE LK   ++  IPV GL KDDKH+T  I+ ++  EI + + S L   +  +QDEVHR+AI+++R+ + K    + L  I  +G+ R   LL K+ ++D IK+AS+EEL
  S:     5 QHQLKILPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQNSKNHSEKVRAMVKNIAEFEYIVTDSEMEALILECNLIKKYSPRYNIALKDDKFYPFIKITTNEDFPRVYVTRNFAKD-GNRYFGPYTNGT-AVYEVMGLIKKLFPLRTCKKAIVEGGEPTRACLNYHINLCKAPCAGYISKDEYWEMIDEIINILNGTDTSIIKNLKLEMEKAAEELEFEKAAKIRDRILAIELISEKQKMFTVKEGDEDFIDLYTDEKDGCAQVFFVREGKVTGREHFMIENIGDDPVEEVISSFIASFYGGTA-QIPKTIYVPEEIEDQELIEKFLTEKRGSKVWIKVPKKGDKKNLLDMVRNNAKIMLDQFKEKMVEEKELNKSALTELADVLGLDSLPARIEAYDISNIQGVDSVGTMVVFENGKAKNSDYRRFKIKSVKGPNDYESMREILSRRFSHGLEEINKIKERNLEYSKGKFCIFPDLIMMDGGKGQVNIALEVLKDFGIE--IPVCGLVKDDKHRTRGII-FNNEEILIRRGSGLMNLITRVQDEVHRYAITYHRSLRDKRTLHSILEDIPRIGEKRRRNLLMKFGSIDNIKKASMEEL 600
>gi|156742924|ref|YP_001433053.1| excinuclease ABC, C subunit [Roseiflexus castenholzii DSM 13941] >gi|156234252|gb|ABU59035.1| excinuclease ABC, C subunit [Roseiflexus castenholzii DSM 13941] (665 aa)
Score = 756, Expect = 6.2e-78, Identities = 192/585 (32%), Positives = 342/585 (58%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK----------CIYYDIGQCLGPCIKKVTRQ-DYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDL-ITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFG------------------------------------------EIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKD-DKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAKEIKKL 589
           ++++L+ +P  PG YLWK+  G +IY+GK+  L +R++ YF +  D   KT +L  +I D   +V +NE E+LLLE  LI +++P++N+LL++  ++PYI VT  E  PRI+ + +   +    Y+GP++++    Y   + +NR+F  R  ++ P+ K          C+YYDI +CLGPC+  +  Q DY   ++ +  F  GKS  + + L ++  +AAE+L FE + +  +  +++++  +RQ ++     D+D+IG   +E +  + + +   G L+S     +     E DE LL      +   A ELP T+ L    + L  + + L      K+    P +G K+ +++ A  NA + +    LQ ++++ R +  L E++ LL +  L  R+E FD SN   ++ VGAMVV+E+G   K+ YRKF IK  +  +D   ++EV+ RR++      G                                          E+P+LI++DGG  QV  AL  L+ L  +  IPV+G+ K  ++ + D ++      I L+++S     +  I +E  RFA  ++R  +SKS   + L +I  +G  R + LL+++ +LD I+ A+V+E++ +  +  + A+E+K L
  S:    15 LEERLRAVPLAPGVYLWKNAQGKIIYIGKSKRLRDRMRSYFARTDDPYGKTARLVAQIADFQVIVTSNELEALLLEMTLIKQHRPRFNVLLKDDKSYPYIKVTLHEPWPRIVATRNPRWEEGARYFGPYSSAG-AVYRTLDQLNRLFAFRPPSRCPDDKFNRHRRLGKPCLYYDIKRCLGPCVPGLVNQNDYRATVESVCRFLEGKSDLVAKILRRQMEEAAERLDFERAARLRDSIRDIELIGQRQQVLRHDDADQDVIGLAREEGMAVVQVLRIRAGKLISAESFPLQNAEGERDESLLASFLTQFYDAAAELPATLLLPAPLDDLAIIEQWLAQKAGRKVALHTPQRGEKRRLVELAEQNARQKLDELRLQWLNSEQRAVAGLTEVRDLLGLSALPTRIECFDVSNTQGSHSVGAMVVFEHGEPKKSRYRKFRIKTVEGANDVASIQEVLRRRFRRAAMVIGEEEQPADERVVNGQTDAAEQEDGEKTDAPGSQSDLERQETWAELPDLILIDGGIGQVNGALHVLRDLCFEH-IPVVGVVKGPNRDRFDLLIPGASDLIVLERESAALRLIRRIDEEADRFAKDYHRKLRSKSATASRLEEIPGIGPKRRQLLLKRFGSLDGIRNATVDEIAAVPGMTRKAAEELKSL 664
>gi|189501493|ref|YP_001957210.1| excinuclease ABC, C subunit [Candidatus Amoebophilus asiaticus 5a2] >gi|189496934|gb|ACE05481.1| excinuclease ABC, C subunit [Candidatus Amoebophilus asiaticus 5a2] (596 aa)
Score = 756, Expect = 6.3e-78, Identities = 196/581 (33%), Positives = 329/581 (56%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR--DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN---------KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDL-ITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE----IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           ++ K+P++PG Y + +K   +IYVGKA DL  R+  YF K++  +LKT+++  EI  + + +VN+E E+LLLENNLI +++P+YN+LL++  +FPYI +T+E  P+++ +     K+ G YYGPF +     Y++ + I  ++ LR CN         K   K C+ Y IG C GPC    T + Y   +++I  F  G   ++ +  ++K  QAA  + ++++Q Y E    L+ +  +  ++  Q  + D+           I   +   G+++   +  I     ELDE +L LI  ++ +     P  + +++        +   K     P  G KK +++ A  N + + +   L+   NQNR   +L  LQ  L +KDL   +E FDNSNI  T+ V AMVV+++G   K EYR FNIK      D+  M+E++ RRY+       ++P+LI++DGGK Q+ AA+ +L+ L +   IP+IG+AK       R+ +  F E    I + K+S     L  I++E HRFAI+F+R+K+SK+  ++ L  I  +G+  I  LL+ + ++  IKEAS++ L+  V  + A +IK+
  S:    10 EIGKLPNQPGVYFFYNKQQQIIYVGKAKDLKKRVSSYFNKNQQDNLKTRRMVEEIAAISFTIVNSEYEALLLENNLIKRFQPRYNILLKDDKSFPYICITRERFPKVITTRQPGAKL-GQYYGPFTDLK-NMYQILDLIKSLYTLRTCNYNLLEENICKHKFKVCLEYHIGHCKGPCEGLQTEEAYNQDIQQIEHFLKGNINAVKKHFKEKMSQAAAAMDYKNAQAYKEKIAALENYQSKSLVVNPQVGNLDVFAIVSDAKAAFISYLQIKEGAIICTQNTEIKKQLEELDEDILPLIILHFREKYASNPSEILVNIP-----IATTFDKAMLTVPRIGDKKKLVELATKNVLFLKREALLRQEDNQNRANKTLVLLQHDLQLKDLPLHIECFDNSNIQGTHPVAAMVVFQHGKPAKKEYRHFNIKTVVGPDDFASMREIVTRRYRRLIEENQKLPDLIVIDGGKGQLGAAVAALQELGIYGQIPIIGIAK-------RLEEIYFPEDSYPIHISKQSPSLKLLQQIRNEAHRFAITFHRDKRSKTSLKSQLESIPGVGEKTITTLLQHFGSVQNIKEASLKALASQVGNKRAIQIKE 593
>gi|110802431|ref|YP_697662.1| excinuclease ABC subunit C [Clostridium perfringens SM101] >gi|119367644|sp|Q0SW38|UVRC_CLOPS UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|110682932|gb|ABG86302.1| excinuclease ABC, C subunit [Clostridium perfringens SM101] (620 aa)
Score = 753, Expect = 1.2e-77, Identities = 202/569 (35%), Positives = 329/569 (57%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYI-LVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL------PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSE--LDEILLTLIYEYYSKIAIELPKTVYL--SLSD----EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEI---------------PNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           + +LK +P KPG Y+ K+  G VIYVGKA  L NR++QYF   K+   K + +   I + +Y+V ++E E+L+LE NLI KY P+YN+ L++   +P+I + T E+ PR+  + +  K     Y+GP+ N     YE+   I ++FPLR C K       P + C+ Y I  C  PC   +++ +Y   + EI +  +G   SI + L+ +  +AAE+L FE + K  +    +++ SE+Q +   ++ DED I  Y  E      +F    G +  +   +    S+  + E++ + I  +Y   A ++PKT+Y+   + D    EK  T     K+    P KG KK+++D   NNA  ++     +++  +    ++L EL  +L +  L  R+E +D SNI   + VG MVV+ENG    ++YR+F IK     +DY+ M+E++ RR+ +      +I               P+LI++DGGK QV  ALE LK   ++  IPV GL KDDKH+T  I+ ++  EI + + S L   +  +QDEVHR+AI+++R+ + K    + L  I  +G+ R   LL K+ ++D IK+AS+EEL
  S:     5 QHQLKILPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQNSKNHSEKVRAMVKNIAEFEYIVTDSEMEALILECNLIKKYSPRYNIALKDDKFYPFIKITTNEDFPRVYVTRNFAKD-GNRYFGPYTNGT-AVYEVMGLIKKLFPLRTCKKAIVEGGEPTRACLNYHINLCKAPCAGYISKAEYWKMIDEIINILNGTDTSIIKNLKLEMEKAAEELEFEKAAKIRDRILAIELISEKQKMFTVKEGDEDFIDLYTDEKDGCAQVFFVREGKVTGREHFMIENISDDPVKEVISSFIASFYGGTA-QIPKTIYVPEEIEDQELIEKFLTEKRGSKVWIKVPKKGDKKNLLDMVRNNAKIMLDQFKEKMVEEKELNKSALIELADVLGLDSLPTRIEAYDISNIQGVDSVGTMVVFENGKAKNSDYRRFKIKSVKGPNDYESMREILSRRFSHGLEEVNKIKERNLEYSKGKFCIFPDLIMMDGGKGQVNIALEVLKDFGIE--IPVCGLVKDDKHRTRGII-FNNEEILIRRGSGLMNLITRVQDEVHRYAITYHRSLRDKRTLHSILEDIPRIGEKRRRNLLMKFGSIDNIKKASMEEL 600
>gi|182624542|ref|ZP_02952325.1| excinuclease ABC, C subunit [Clostridium perfringens D str. JGS1721] >gi|177910350|gb|EDT72731.1| excinuclease ABC, C subunit [Clostridium perfringens D str. JGS1721] (620 aa)
Score = 753, Expect = 1.3e-77, Identities = 201/569 (35%), Positives = 329/569 (57%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYI-LVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL------PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSE--LDEILLTLIYEYYSKIAIELPKTVYL--SLSD----EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEI---------------PNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           + +LK +P KPG Y+ K+  G VIYVGKA  L NR++QYF   K+   K + +   I + +Y+V ++E E+L+LE NLI KY P+YN+ L++   +P+I + T E+ PR+  + +  K     Y+GP+ N     YE+   I ++FPLR C K       P + C+ Y I  C  PC   +++ +Y   + EI +  +G   SI ++L+ +  +AAE+L FE + K  +    +++ SE+Q +   ++ DED I  Y  E      +F    G +  +   +    S+  + E++ + I  +Y   A ++PKT+Y+   + D    EK  T     K+    P  G KK+++D   NNA  ++     +++  +    ++L EL  +L +  L  R+E +D SNI   + VG MVV+ENG    ++YR+F IK     +DY+ M+E++ RR+ +      +I               P+LI++DGGK QV  ALE LK   ++  IPV GL KDDKH+T  I+ ++  EI + + S L   +  +QDEVHR+AI+++R+ + K    + L  I  +G+ R   LL K+ ++D IK+AS+EEL
  S:     5 QHQLKILPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQNSKNHSEKVRAMVKNIAEFEYIVTDSEMEALILECNLIKKYSPRYNIALKDDKFYPFIKITTNEDFPRVYVTRNFAKD-GNRYFGPYTNGT-AVYEVMGLIKKLFPLRTCKKAIVEGGEPTRACLNYHINLCKAPCAGYISKAEYWEMIDEIINILNGTDTSIIKKLKLEMEKAAEELEFEKAAKIRDRILAIELISEKQKMFTVKEGDEDFIDLYTDEKDGCAQVFFVREGKVTGREHFMIENISDDPVKEVISSFIASFYGGTA-QIPKTIYVPEEIEDQELIEKFLTEKRGSKVWIKVPKNGDKKNLLDMVRNNAKIMLDQFKEKMVEEKELNKSALTELADVLGLDSLPARIEAYDISNIQGVDSVGTMVVFENGKAKNSDYRRFKIKSVKGPNDYESMREILSRRFSHGLEEVNKIKERNLEYSKGKFCIFPDLIMMDGGKGQVNIALEVLKDFGIE--IPVCGLVKDDKHRTRGII-FNNEEILIRRGSGLMNLITRVQDEVHRYAITYHRSLRDKRTLHSILEDIPRIGEKRRRNLLMKFGSIDNIKKASMEEL 600
>gi|154499928|ref|ZP_02037966.1| hypothetical protein BACCAP_03585 [Bacteroides capillosus ATCC 29799] >gi|150271526|gb|EDM98783.1| hypothetical protein BACCAP_03585 [Bacteroides capillosus ATCC 29799] (616 aa)
Score = 752, Expect = 1.5e-77, Identities = 187/584 (32%), Positives = 337/584 (57%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF--LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYI-LVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-LP-----NKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK-YDLI-TVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDE----KLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVI---YRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           +++K+K   +P KPG Y+ +DK+ +VIYVGKA  L NR+ QYF  L     KT+ + ++I   D +V ++E E+L+LE++LI +++P YN+LL++   +PYI L   E++PR   ++ +       Y+GP+ +    +  + + +     L  CN+  P      + C+ Y +G C G C   + ++ Y   + +      G+ K + ++++ +  QAAE+L FE + +  +  + +++  +RQ ++     D D++GF+        V+  YV+G L +K +DL+ T    E+ +++  L+ +YY +   +LP+ + L   + DE    +L + +   ++  + P +G K D++  A  NA E    +  +  + + R    LE L K+L + K   RME +D SN    + V +MVVY+N    K +YR+F +KD DA  DY  M++V+   +RRY +    F ++P+L+++DGG+   K A++ L+ L L   IPV G+ KDD+H+T  +V  +  EI +     ++  +  IQ+E HRFAI F+R ++++ +  + L KI  +G+ R   LL+ ++++  IK A++EEL   VP   AK +
  S:     4 DELKEKAHALPLKPGVYIMQDKHNVVIYVGKAKALKNRVSQYFADLASHTEKTRAMVSQIDHFDVIVADSEFEALVLESSLIKRHQPHYNILLKDDKGYPYIRLTVNEDYPRFSLANKAADD-GARYFGPYGSRGSTQ-GIIDALRAALKLPSCNRRFPRDIGKERPCLNYHMGLCDGYCRFGMPQERYRDAIDQAIRLLEGQFKEVGDEIQAEMEQAAEELRFEKAAELRDRYRAIELLGKRQKVMAGSLADTDVVGFHRGTAKSCFVVLHYVDGELAAKDWDLMETPMEEEIADVVSALVRQYYGERN-QLPRQILLPCEIEDEVPLARLLSENAGRRVNLITPQRGAKMDLIRLANKNAEE----EVARWTTKEERTSKLLELLAKMLKLDKPPMRMESYDISNQGADDIVASMVVYQNARPLKRDYRRFKLKDMDAPDDYASMEQVLTRRFRRYLDGDEKFKDLPDLLLIDGGENHAKVAVKVLETLGLS--IPVFGMVKDDRHRTRALVTPEGREIGIQANQAVFSLIGQIQEETHRFAIEFHRQQQNQRVKGSVLDKIPGVGEKRRADLLKHFKSVKNIKAATLEELEAAVPKNTAKAV 599
>gi|168204466|ref|ZP_02630471.1| excinuclease ABC, C subunit [Clostridium perfringens E str. JGS1987] >gi|170664072|gb|EDT16755.1| excinuclease ABC, C subunit [Clostridium perfringens E str. JGS1987] (620 aa)
Score = 752, Expect = 1.7e-77, Identities = 201/569 (35%), Positives = 329/569 (57%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYI-LVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL------PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSE--LDEILLTLIYEYYSKIAIELPKTVYL--SLSD----EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEI---------------PNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           + +LK +P KPG Y+ K+  G VIYVGKA  L NR++QYF   K+   K + +   I + +Y+V ++E E+L+LE NLI KY P+YN+ L++   +P+I + T E+ PR+  + +  K     Y+GP+ N     YE+   I ++FPLR C K       P + C+ Y I  C  PC   +++ +Y   + EI +  +G   SI ++L+ +  +AAE+L FE + K  +    +++ SE+Q +   ++ DED I  Y  E      +F    G +  +   +    S+  + E++ + I  +Y   A ++PKT+Y+   + D    EK  T     K+    P KG KK+++D   NNA  ++     +++  +    ++L EL  +L +  L  R+E +D SNI   + VG MVV+ENG    ++YR+F IK     +DY+ M+E++ RR+ +      +I               P+LI++DGGK QV  ALE LK   ++  IPV GL KD KH+T  I+ ++  EI + + S L   +  +QDEVHR+AI+++R+ + K    + L  I  +G+ R   LL K+ ++D IK+AS+EEL
  S:     5 QHQLKILPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQNSKNHSEKVRAMVKNIAEFEYIVTDSEMEALILECNLIKKYSPRYNIALKDDKFYPFIKITTNEDFPRVYVTRNFAKD-GNRYFGPYTNGT-AVYEVMGLIKKLFPLRTCKKAIVEGGEPTRACLNYHINLCKAPCAGYISKAEYWEMIDEIINILNGTDTSIIKKLKLEMEKAAEELEFEKAAKIRDRILAIELISEKQKMFTVKEGDEDFIDLYTDEKDGCAQVFFVREGKVTGREHFMIENISDDPVKEVISSFIASFYGGTA-QIPKTIYVPEEIEDQELIEKFLTEKRGSKVWIKVPKKGDKKNLLDMVRNNAKIMLDQFKEKMVEEKELNKSALTELADVLGLDSLPVRIEAYDISNIQGVDSVGTMVVFENGKAKNSDYRRFKIKSVKGPNDYESMREILSRRFSHGLEEVNKIKERNLEYSKGKFCIFPDLIMMDGGKGQVNIALEVLKDFGIE--IPVCGLVKDHKHRTRGII-FNNEEILIRRGSGLMNLITRVQDEVHRYAITYHRSLRDKRTLHSILEDIPRIGEKRRRNLLMKFGSIDNIKKASMEEL 600
>gi|110800325|ref|YP_694801.1| excinuclease ABC subunit C [Clostridium perfringens ATCC 13124] >gi|168210457|ref|ZP_02636082.1| excinuclease ABC, C subunit [Clostridium perfringens B str. ATCC 3626] >gi|119367643|sp|Q0TU89|UVRC_CLOP1 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|110674972|gb|ABG83959.1| excinuclease ABC, C subunit [Clostridium perfringens ATCC 13124] >gi|170711527|gb|EDT23709.1| excinuclease ABC, C subunit [Clostridium perfringens B str. ATCC 3626] (620 aa)
Score = 751, Expect = 1.9e-77, Identities = 201/569 (35%), Positives = 329/569 (57%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYI-LVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL------PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSE--LDEILLTLIYEYYSKIAIELPKTVYL--SLSD----EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEI---------------PNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           + +LK +P KPG Y+ K+  G VIYVGKA  L NR++QYF   K+   K + +   I + +Y+V ++E E+L+LE NLI KY P+YN+ L++   +P+I + T E+ PR+  + +  K     Y+GP+ N     YE+   I ++FPLR C K       P + C+ Y I  C  PC   +++ +Y   + EI +  +G   SI ++L+ +  +AAE+L FE + K  +    +++ SE+Q +   ++ DED I  Y  E      +F    G +  +   +    S+  + E++ + I  +Y   A ++PKT+Y+   + D    EK  T     K+    P KG KK+++D   NNA  ++     +++  +    ++L EL  +L +  L  R+E +D SNI   + VG MVV+ENG    ++YR+F IK     +DY+ M+E++ RR+ +      +I               P+LI++DGGK QV  ALE LK   ++  IPV GL KD KH+T  I+ ++  EI + + S L   +  +QDEVHR+AI+++R+ + K    + L  I  +G+ R   LL K+ ++D IK+AS+EEL
  S:     5 QHQLKILPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQNSKNHSEKVRAMVKNIAEFEYIVTDSEMEALILECNLIKKYSPRYNIALKDDKFYPFIKITTNEDFPRVYVTRNFAKD-GNRYFGPYTNGT-AVYEVMGLIKKLFPLRTCKKAIVEGGEPTRACLNYHINLCKAPCAGYISKAEYWEMIDEIINILNGTDTSIIKKLKLEMEKAAEELEFEKAAKIRDRILAIELISEKQKMFTVKEGDEDFIDLYTDEKDGCAQVFFVREGKVTGREHFMIENISDDPVKEVISSFIASFYGGTA-QIPKTIYVPEEIEDQELIEKFLTEKRGSKVWIKVPKKGDKKNLLDMVRNNAKIMLDQFKEKMVEEKELNKSALTELADVLGLDSLPARIEAYDISNIQGVDSVGTMVVFENGKAKNSDYRRFKIKSVKGPNDYESMREILSRRFSHGLEEVNKIKERNLEYSKGKFCIFPDLIMMDGGKGQVNIALEVLKDFGIE--IPVCGLVKDHKHRTRGII-FNNEEILIRRGSGLMNLITRVQDEVHRYAITYHRSLRDKRTLHSILEDIPRIGEKRRRNLLMKFGSIDNIKKASMEEL 600
>gi|20808370|ref|NP_623541.1| excinuclease ABC subunit C [Thermoanaerobacter tengcongensis MB4] >gi|32130303|sp|Q8R8M9|UVRC_THETN UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|20516981|gb|AAM25145.1| Nuclease subunit of the excinuclease complex [Thermoanaerobacter tengcongensis MB4] (617 aa)
Score = 751, Expect = 2.2e-77, Identities = 203/573 (35%), Positives = 343/573 (59%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF--LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIK---GTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNK------KCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLN------PSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY---------------KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +++KLK +P KPG YL KD+ G +IYVGKA  L NR++QYF    +   K K + + + D +Y+V + E E+L+LE NLI KYKPKYN+LL++   +PYI +T  E++PRI++    T+KI      Y+GP+  S     E    + ++FP+R CN    K      +C+YY IG C  PC  ++ +++Y   + +   F  GK + + E+L+++  +AA++L FE++ +  +    ++  SE+Q +    ++++D+I     +++  I +F    G L  +  Y +        +EI+ + I ++Y   +  +PK + + +  E+   L + L  K  N      P +G KK+++D  + NAVE +KN+ L     +  +  ++ EL  LL I+   R+E +D SN+   + VG+MVV+ +G   K+EYRKF IK  +   DY  M+E+I RR+                   A F E+P+LI+VDGG   V AALE ++ L +   +PV G+ KD +H+T  +V     E+++      +  +  IQ+E HRFAI+F+R ++SK  F+  L  IK +G+ R + L E + ++++IK+AS+EEL ++
  S:     3 LQEKLKLLPEKPGVYLMKDEEGNIIYVGKASVLKNRVRQYFQNTDNHPPKVKVMLSHVEDFEYIVTDTELEALMLECNLIKKYKPKYNVLLKDDKNYPYIKITVAEDYPRIMF----TRKIDMDGSKYFGPYG-SAFAVRETIKLVRKMFPIRTCNVNIEKSLGKVRECLYYHIGLCSAPCTGRIEKEEYRKLVDQAVMFLEGKREWLVEKLKEEMQKAADELRFEEAARLRDQIFAIEKISEKQKVTSINEDEQDVISMARSDDIAHIEVFFVREGKLSGREHYYMKNTEGMGREEIISSFIKQFYES-SPSVPKEIIIDVELEEKDLLEDWLSQKRGNRVSITVPLRGKKKELVDMVYQNAVEALKNEILA--REKILKDPAVLELSNLLGIEYPKRIEAYDISNVRGEDNVGSMVVFVDGKPKKSEYRKFTIKYVEGQDDYQSMREMIERRFLHALEEKKQIEEGTLSKEKAKFIEMPDLILVDGGIGHVNAALEVIEKLGIS--VPVYGMVKDSRHRTRGLVGVS-GEVQMPVTGRAFRLVAQIQEEAHRFAITFHRERQSKR-FKTDLLNIKGIGEKRAKVLYEAFGSIEEIKKASLEELKKV 598
>gi|18309334|ref|NP_561268.1| excinuclease ABC subunit C [Clostridium perfringens str. 13] >gi|21363051|sp|Q8XNI1|UVRC_CLOPE UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|18144010|dbj|BAB80058.1| excinuclease ABC subunit C [Clostridium perfringens str. 13] (620 aa)
Score = 750, Expect = 2.5e-77, Identities = 200/569 (35%), Positives = 327/569 (57%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYI-LVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL------PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLI--TVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSD----EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEI---------------PNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           + +LK +P KPG Y+ K+  G VIYVGKA  L NR++QYF   K+   K + +   I + +Y+V ++E E+L+LE NLI KY P+YN+ L++   +P+I + T E+ PR+  + +  K     Y+GP+ N     YE+   I ++FPLR C K       P + C+ Y I  C  PC   +++ +Y   + EI +  +G   SI ++L+ +  +AAE+L FE + K  +    +++ SE+Q +   ++ DED I  Y  E      +F    G +  +   +   +    + E++ + I  +Y   A ++PKT+Y+   + D    EK  T     K+    P KG KK+++D   NNA  ++     +++  +    ++L EL  +L +  L  R+E +D SNI   + VG MVV+ENG    ++YR+F IK     +DY+ M+E++ RR+ +      +I               P+LI++DGGK QV  ALE LK   ++  IPV GL KD KH+T  I+  +  EI + + S L   +  +QDEVHR+AI+++R+ + K    + L  I  +G+ R   LL K+ ++D IK+AS+EEL
  S:     5 QHQLKILPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQNSKNHSEKVRAMVKNIAEFEYIVTDSEMEALILECNLIKKYSPRYNIALKDDKFYPFIKITTNEDFPRVYVTRNFAKD-GNRYFGPYTNGT-AVYEVMGLIKKLFPLRTCKKAIVEGGEPTRACLNYHINLCKAPCAGYISKAEYWEMIDEIINILNGTDTSIIKKLKLEMEKAAEELEFEKAAKIRDRILAIELISEKQKMFTVKEGDEDFIDLYTDEKDGCAQVFFVREGKVTGREHFMIENIGDDPVKEVISSFIASFYGGTA-QIPKTIYVPEEIEDQELIEKFLTEKRGSKVWIKVPKKGDKKNLLDMVRNNAKIMLDQFKEKMVEEKELNKSALTELADVLGLDSLPVRIEAYDISNIQGVDSVGTMVVFENGKAKNSDYRRFKIKSVKGPNDYESMREILSRRFSHGLEEVNKIKERNLEYSNGKFCIFPDLIMMDGGKGQVNIALEVLKGFGIE--IPVCGLVKDHKHRTRGII-LNNEEILIRRGSGLMNLITRVQDEVHRYAITYHRSLRDKRTLHSILEDIPRIGEKRRRNLLMKFGSIDNIKKASMEEL 600
>gi|169344093|ref|ZP_02865079.1| excinuclease ABC, C subunit [Clostridium perfringens C str. JGS1495] >gi|169297828|gb|EDS79925.1| excinuclease ABC, C subunit [Clostridium perfringens C str. JGS1495] (620 aa)
Score = 749, Expect = 3.6e-77, Identities = 200/569 (35%), Positives = 328/569 (57%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYI-LVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL------PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLI--TVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSD----EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEI---------------PNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           + +LK +P KPG Y+ K+  G VIYVGKA  L NR++QYF   K+   K + +   I + +Y+V ++E E+L+LE NLI KY P+YN+ L++   +P+I + T E+ PR+  + +  K     Y+GP+ N     YE+   I ++FPLR C K       P + C+ Y I  C  PC   +++ +Y   + EI +  +G   SI ++L+ +  +AAE+L FE + K  +    +++ SE+Q +   ++ DED I  Y  E      +F    G +  +   +   +    + E++ + I  +Y   A ++PKT+Y+   + D    EK  T     K+    P KG KK+++D   NNA  ++     +++  +    ++L EL  +L +  L  R+E +D SNI   + VG MVV+ENG    ++YR+F IK     +DY+ M+E++ RR+ +      +I               P+LI++DGGK QV  ALE LK   ++  IPV GL KD KH+T  I+ ++  EI + + S L   +  +QDEVHR+AI+++R+ + K    + L  I  +G+ R   LL K+ ++D IK+AS+EEL
  S:     5 QHQLKILPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQNSKNHSEKVRAMVKNIAEFEYIVTDSEMEALILECNLIKKYSPRYNIALKDDKFYPFIKITTNEDFPRVYVTRNFAKD-GNRYFGPYTNGT-AVYEVMGLIKKLFPLRTCKKAIVEGGEPTRACLNYHINLCKAPCAGYISKAEYWEMIDEIINILNGTDTSIIKKLKLEMEKAAEELEFEKAAKIRDRILAIELISEKQKMFTVKEGDEDFIDLYTDEKDGCAQVFFVREGKVTGREHFMIENIGDDPVKEVISSFIASFYGGTA-QIPKTIYVPEEIEDQELIEKFLTEKRGSKVWIKVPKKGDKKNLLDMVRNNAKIMIDQFKEKMVEEKELNKSALTELADVLGLDSLPTRIEAYDISNIQGVDSVGTMVVFENGKAKNSDYRRFKIKSVKGPNDYESMREILSRRFSHGLEEVNKIKERNLEYSKGKFCIFPDLIMMDGGKGQVNIALEVLKDFGIE--IPVCGLVKDHKHRTRGII-FNNEEILIRRGSGLMNLITRVQDEVHRYAITYHRSLRDKRTLHSILEDIPRIGEKRRRNLLMKFGSIDNIKKASMEEL 600
>gi|146296208|ref|YP_001179979.1| excinuclease ABC, C subunit [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409784|gb|ABP66788.1| Excinuclease ABC subunit C [Caldicellulosiruptor saccharolyticus DSM 8903] (593 aa)
Score = 749, Expect = 3.8e-77, Identities = 204/584 (34%), Positives = 351/584 (60%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN-KLPN-----KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSL---SDEKLKTLSESL---KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIK-DLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEIKK 588
           +++KL  +P  PG Y+ KD+NG VIYVGKAV+L NR++QYF   D   KT+ +  +I D +Y+V + E E+L+LE NLI +Y+PKYN+LLR+   + YI +T E  PR++ +    +K    Y+GP+ +    K +    +  +F LR C  K P+     + C+ + I +CLG C   +  ++Y+  +++     SGK   I E+L+KK  + A+ LMFE +Q+      +L+    +Q +I++    ED+I +    + I IV+    NG L++K + +       +E+    + +YYS + + +PK + L     + E ++ + E L   K K + P +G KK +++ A  NA   + NK  Q I  +N  + +L  L+ LL I+ D+ ++E +D SN+   + VG +VV+E+G  NK+ YRKF +K  +   D   +KEV+ RR+  N    G +P+LI++DGG+ QV AA+E L+ L  +  IPV G+ KDD+HKT  ++ +   E+ + + S ++  +  IQ+E HRFA+ ++R  + K L+E+ L +I+ +G+ R  KL   + ++D +++AS+EE+ +   +P ++A +IK+
  S:     4 LQEKLANLPTTPGVYMMKDENGKVIYVGKAVNLRNRVRQYFQNSDMTPKTRLMVKKIKDFEYIVTDTEVEALILECNLIKEYRPKYNVLLRDDKNYQYIKITNEMFPRLVTTR-KVEKDGAKYFGPYVSGYSVK-QTIELLKSLFMLRTCKRKFPDQLGKGRPCLNFYIERCLGVCKGDIPEEEYQKLVEKAVKVLSGKGDEIVEELKKKMFEYADNLMFEKAQEIKNKITSLEQIITKQKVIYADDRSEDVINYAEDSSNICIVVLVIRNGKLINKEEFV---LKNDEEVFERFLEQYYSDV-VSVPKEIILPHEVGNGENIEKMIEKLYGFKAKIVVPKQGEKKQLLEMAKKNAEISLVNK--QRI--ENYYIEALLHLKNLLGIEHDIEKIESYDISNLAGADNVGTLVVFEDGKFNKDLYRKFKLKSFEGQDDIRSVKEVLTRRF-TNLEKHGRLPDLILIDGGQNQVNAAVEVLRSLGFN--IPVAGMVKDDRHKTRDLI-YKGQELNIQRDSLVFKLISTIQEETHRFAVKYHRELRKKHLYESILDEIEGIGEKRKIKLFRIFGSIDNLRKASIEEIVKAADIPYDIALKIKE 589
>gi|168212741|ref|ZP_02638366.1| excinuclease ABC, C subunit [Clostridium perfringens CPE str. F4969] >gi|170715691|gb|EDT27873.1| excinuclease ABC, C subunit [Clostridium perfringens CPE str. F4969] (620 aa)
Score = 748, Expect = 4.9e-77, Identities = 199/569 (34%), Positives = 327/569 (57%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYI-LVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL------PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLI--TVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSD----EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEI---------------PNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           + +LK +P KPG Y+ K+  G VIYVGKA  L NR++QYF   K+   K + +   I + +Y+V ++E E+L+LE NLI KY P+YN+ L++   +P+I + T E+ PR+  + +  K     Y+GP+ N     YE+   I ++FPLR C K       P + C+ Y I  C  PC   +++ +Y   + EI +  +G   SI +  + +  +AAE+L FE + K  +    +++ SE+Q +   ++ DED I  Y  E      +F    G +  +   +   +    ++E++ + I  +Y   A ++PKT+Y+   + D    EK  T     K+    P KG KK+++D   NNA  ++     +++  +    ++L EL  +L +  L  R+E +D SNI   + VG MVV+ENG    ++YR+F IK     +DY+ M+E++ RR+ +      +I               P+LI++DGGK QV  ALE LK   ++  IPV GL KD KH+T  I+ ++  EI + + S L   +  +QDEVHR+AI+++R+ + K    + L  I  +G+ R   LL K+ ++D IK+AS+EEL
  S:     5 QHQLKILPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQNSKNHSEKVRAMVKNIAEFEYIVTDSEMEALILECNLIKKYSPRYNIALKDDKFYPFIKITTNEDFPRVYVTRNFAKD-GNRYFGPYTNGT-AVYEVMGLIKKLFPLRTCKKAIVEGGEPTRACLNYHINLCKAPCAGYISKAEYWEMIDEIINILNGTDTSIIKNFKLEMEKAAEELEFEKAAKIRDRILAIELISEKQKMFTVKEGDEDFIDLYTDEKDGCAQVFFVREGKVTGREHFMIENIGDDPVEEVISSFIASFYGGTA-QIPKTIYVPEEIEDQELIEKFLTEKRGSKVWIKVPKKGDKKNLLDMVRNNAKIMLDQFKEKMVEEKELNKSALTELADVLGLDSLPARIEAYDISNIQGVDSVGTMVVFENGKAKNSDYRRFKIKSVKGPNDYESMREILSRRFSHGLEEVNKIKERNLEYSKGKFCIFPDLIMMDGGKGQVNIALEVLKDFGIE--IPVCGLVKDHKHRTRGII-FNNEEILIRRGSGLMNLITRVQDEVHRYAITYHRSLRDKRTLHSILEDIPRIGEKRRRNLLMKFGSIDNIKKASMEEL 600
>gi|14250931|emb|CAC39227.1| UvrC protein [Eubacterium acidaminophilum] (607 aa)
Score = 744, Expect = 1.3e-76, Identities = 198/582 (34%), Positives = 327/582 (56%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK--DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN-------KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLIT--VFYSELDEILLTLIYEYYSKIAIELPKTVYL---SLSDEKLKTLSESLKIKFLN---PSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           IK +L  +P  PG Y+ KD  G +IY+GKA  L NR++QYF        K + +   I + +Y++ ++E E+L+LE NLI K++PKYN++ R+   +P+I V+  E++PR+L    S ++    Y+GP+ +      ++ + I RI+P+RKC        +   + CI YDIG+C GPC     R+ Y   + EI  F SG+S+++ E +E++   AAE+L FE +  + +   +L++ ++RQ I+     D+D I  Y  E    I +F    G ++ +   +   V   +  E+  + I  +YS     +P  + +   +  DE L++  ES+K + ++   P KG K+++++    NA E    K+  +   ++ +    E    L   +   R+E FD SNI   + VG+MVV+  G K+  EYR+F IK      DY  + E++ RR K  +      P+L+++DGG+ QV   + S   LEL   IPV G+ KDDKH+T  +V  +  EI+L K S LY F+  IQDE HRFAI ++R+ +   L  + L  I  +G+ R   L+  + +++ I+ A +EEL  I  +  EVA+ I
  S:     4 IKKQLSMLPDSPGVYIMKDSTGDIIYIGKAKSLKNRVRQYFGSHGKSSPKVEAMVGNISEFEYIMTDSELEALILECNLIKKHRPKYNIIFRDDKTYPFIKVSVNEDYPRVLKVR-SMREDGAKYFGPYTSEGAVN-DVISLIRRIYPIRKCKNDIKRMIQRGERPCINYDIGKCTGPCRGIDAREQYMQMIDEIVTFLSGRSETLIESIEQQMQVAAERLDFEKAAYFRDKIGSLRILAQRQKIVSKSSVDQDFIAAYFYEGKACIQVFFVREGRIIGREHFVVEDVLEEQKGEVFASFIKHFYSYQGF-IPSEILIESETGEDEVLQSWLESIKGRKVHIKVPQKGEKREMIEMVKKNARE-SAEKFSNVSRLKDSQELLEELRSLLELEETPNRIEAFDISNIQGVDSVGSMVVFTRGRKDSKEYRRFRIKTVQGPDDYSSLYEIVLRRLKKWSGR----PDLMLIDGGRGQV--GVVSRLLLELGVDIPVWGMYKDDKHRTRGLVSLE-REIELKKSSQLYRFICTIQDEAHRFAIDYHRSLRHGKLKRSVLDDIAGVGEKRKLLLISHFRSVENIRNAKLEELKAISGISAEVAERI 594
>gi|149002298|ref|ZP_01827240.1| excinuclease ABC subunit C [Streptococcus pneumoniae SP14-BS69] >gi|147759613|gb|EDK66604.1| excinuclease ABC subunit C [Streptococcus pneumoniae SP14-BS69] (553 aa)
Score = 743, Expect = 1.6e-76, Identities = 169/468 (36%), Positives = 271/468 (57%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALES 468
           MN  IK KL+ +P  PGCY+ KDKNG +IYVGKA +L NR++ YF    D KT+ L +EI D +++V  +  E+LLLE NLI + KPKYN++L++  ++P+I +T E +PR++ +    KK  G Y+GP+ +      E+   ++RIFP RKC   P+K C YY IGQC+   I K     ++   +E++DF  G+   I ++L+ K   AA+ + FE + +Y +L + +     +Q ++     + D+ G+Y  +  + + +F    G L+ +   +  ++++ DE  LT + ++Y + +  +P  V +   + +E +K L +S   K L P +G KK +++ A  NA   ++ K+  L  +  +   ++E L +LL I    R+E FDNSNI  T+ V AMVV+ NG  +K +YRK+ IK      DY  M+EVI RRY          P+LI++DGGK  VK+ L S
  S:     1 MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFRGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKITNERYPRLIITR-QVKKDGGLYFGPYPDVGAAN-EIKRLLDRIFPFRKCTNPPSKVCFYYHIGQCMAHTICKKDEIYFKSMAQEVSDFLKGQDNKIIDELKGKMAAAAQTMEFERAAEYRDLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFNDPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDS---KILKPQRGEKKQLVNLAIKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMVVFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGK--VKSILLS 463
>gi|189460229|ref|ZP_03009014.1| hypothetical protein BACCOP_00866 [Bacteroides coprocola DSM 17136] >gi|189433090|gb|EDV02075.1| hypothetical protein BACCOP_00866 [Bacteroides coprocola DSM 17136] (618 aa)
Score = 743, Expect = 2.0e-76, Identities = 194/587 (33%), Positives = 342/587 (58%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYE-LYNFINRIFPLRKCNKLPNKK---------CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLK---IKFLNPSKGVKKDVMDTAFNNAVE--IMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIV-KWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           NE ++  +  +P  PG Y + +K G++IYVGKA +L  R+  YF K+ +  KT+ L ++I D+ Y+VVN E ++LLLENNLI KYKP+YN+LL++  ++P I V+ E  PR+  +    +    TYYGP+  S+I   + + + I +++PLR C+     +         C+ Y I  C GPCI   +  +Y   + ++ +   G +++I + L K+ +  AE++ FE++QK  E  + ++ +  + +++ S  ++ D+      EN   I      NG +   +     +   L+E    L+     ++ I   +  Y S S E +      ++   + F  P +G KK +++ +  N  +  + + K  + ++ + R +  L+E+Q+ L +  +   +E FDNSNI  ++ V A VV++    +K +YRK+NIK      DY  M+EV+ RRY       GE+P+LI+ DGGK Q++   + ++  EL   IP+ GLAK++KH+T  ++  +    I + + + L+  L NIQDEVHRFAI+F+R+K+SKS   ++L  IK +G+ R   LL++++++ +IK+A+VEEL+ ++    AK +K+
  S:    23 NEYLRGIVLNLPSTPGIYQYLNKEGVIIYVGKAKNLKRRVYSYFSKEHQSAKTRILVSKIADIRYIVVNTEEDALLLENNLIKKYKPRYNVLLKDDKSYPSICVSNEYFPRVFKTRQIIRN-GSTYYGPY--SHIPSMQAVLDLIKKLYPLRTCHLALTPENIRQGKFNVCLEYHIKNCKGPCIGMQSHDEYMDNIAQVKEILKGNTQAISDALMKEMMSLAEEMKFEEAQKVKEKYELIESYRAKSEVVSSILHNIDVFSIEMDENSAYINYLHITNGCINQAFTF--EYKKRLNETKEELL-----QLGIIEMRERYKSCSREIIVPFELDMELNNVTFTIPQRGDKKHLLELSLLNVKQYKVDRLKQAEKLNPEQRSVRLLKEIQEQLQMDKMPMHIECFDNSNIQGSDAVAACVVFKKARPSKKDYRKYNIKTVVGPDDYASMQEVVRRRYSRILEEQGELPDLILTDGGKGQMEVVRQVIED-ELKLQIPIAGLAKNNKHRTSEVLFGFPPMTIGIKQGTPLFHLLENIQDEVHRFAITFHRDKRSKSQIASALDGIKGIGEKRKTALLKEFKSVARIKQATVEELAAVIGEAAAKSVKE 616
>gi|167769119|ref|ZP_02441172.1| hypothetical protein ANACOL_00442 [Anaerotruncus colihominis DSM 17241] >gi|167668759|gb|EDS12889.1| hypothetical protein ANACOL_00442 [Anaerotruncus colihominis DSM 17241] (615 aa)
Score = 742, Expect = 2.4e-76, Identities = 190/563 (33%), Positives = 320/563 (56%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF--LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGT-YYGPFANSNIKKYELYNFINRIFPLRKC-NKLPN-----KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDEKL--KTLSES--LKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRR---YKNNTA---SFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIK 567
           + +K +++P  PG Y+ K+K+G +IY+GKA  L NR+  YF  ++    K  K+ + + D D +V ++E E+L+LE +LI ++ PKYN+LL++   + YI V   ++ RI  +H   K+  G  Y GP+ +S +   E  +  NR+F L  C  K P      + C+ Y I +C+G C+ K++ + Y+  L++  D+  G S    E+L ++    AE + FE + +  +  + +   SE Q ++F++  ++DII     E+    V+ K+    L+ K D +     ++D   L  +  YY+    +LPK + L   ++D +L  + LSE    K++   P +G +  +++ A  NAVE +     Q +    RE+ +L+EL +LL + +   R+E +D SNI +   VG MVV+ENG   +  YRKF IK      DY  M E+I RR   YKN+     +FG +P+LI++DGG+  V A    L+ + +   +P+ G+ KDDKH+T R +     EI +      +  +  IQDEVHR++ISF R +  KS FE SL K + +G+ R  ++   ++T+  I+
  S:    12 LAEKARRLPLLPGVYIMKNKSGEIIYIGKAKALKNRVSSYFRAVEKHHPKVYKMVSHVYDFDSIVTDSEFEALVLECSLIKQHTPKYNILLKDDKGYSYIKVAPRQYGRI--THVFQKEDDGAQYIGPYISSFVVN-ETVDEANRVFMLPTCGKKFPQEFGKARPCLNYHIKRCMGVCMGKISPEAYDEILEQALDYIRGGSARAVERLTEQMNLCAENMQFEKAAQLRDRIRAVTRISESQKVVFAKVANQDIIALARSESETCAVVLKFRGERLVDKQDFLIGATDDIDAARLEFLLRYYTTRRGDLPKKIQLDGDVADVQLAARLLSEQAGYKVEIHIPQRGEQLRLVEMARKNAVERLS----QTVRRAGREVGALDELARLLGLERPPARIEAYDISNIGSDTVVGGMVVFENGRPLRRCYRKFTIKTVAGTDDYASMAEMIGRRFTHYKNDETPDEAFGRLPDLILLDGGRGHVGAIAPVLESMGI--AVPLFGMVKDDKHRT-RAIAQSGGEIAVAPHRSAFTLVSTIQDEVHRYSISFSRARHQKSSFELSLTKCEGIGQKRAAEIFRHFKTIKAIR 586
>gi|196164998|ref|ZP_03125529.1| excinuclease ABC subunit C [Clostridium difficile QCD-23m63] (605 aa)
Score = 741, Expect = 2.8e-76, Identities = 207/573 (36%), Positives = 349/573 (60%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN-------KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKN-DEDIIGFYCKENVISIVIFKYVNGSLLSKYDLIT--VFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRE-----LNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           I++ LKK+P +PG YL KDK   +IYVGKA+ L NR++QYF   K+   K K +   I   +Y++ ++E E+L+LE NLI +Y+PKYN++LR+   +PYI VT  E++PRIL      K  K  Y+GP+ N       L   I+  +P+R C        K   + C+   I +CLGPC   V++++Y   ++EI    SGK + + E L++K  +++    FE++  Y +  K+L+   ++Q I  +  + ++D++      N   + +F   NG ++ +   I   V  S    IL + + ++Y++    +PK + +    E    L E L      K+    P KG KK +++    NAVE     YL+  S+ N+      + +LEEL+++L+++ L  R+E +D SNI   + +G+MVVY N  K+K EYR++ IK     +DYD M E++ RR K+     G +P+LI++DGGK QV A  + L+  ++D  IP+ G+ KDDKH+T  ++  +  EI+LDK ++LY F+ +IQ+EVH +AI+++R+ ++K+L ++ L  I+ +G+ R + LL  ++ +D IK+A++EEL ++
  S:     4 IQEHLKKLPSEPGVYLMKDKYDHIIYVGKAISLKNRVRQYFQSSKNHTSKVKSMVKNIYKFEYIITDSELEALILECNLIKRYRPKYNVVLRDDKTYPYIKVTTNEDYPRILKVRRVLKD-KAKYFGPYTNITAVNDTL-ELISSTYPIRSCKIDIDKAIKNKTRPCLNLHINKCLGPCTGNVSKEEYGKMIEEIIMCLSGKEEKLMELLKEKMNESSMNFRFEEAAVYRDKIKSLEEMIQKQKIDATVSDLNQDVVAMARAHNEACVQVFFIRNGKIVGREHFILEGVMDSPRASILSSFVKQFYNEQEY-IPKELIIEDEIEDSCILEEWLSSKKGQKVTIRVPQKGEKKSLVEMVRKNAVE-----YLEKFSDMNKRKYEKSIGALEELKQILNLEKLPIRIEAYDISNIQGVDSIGSMVVYTNAKKDKKEYRRYKIKTVIGPNDYDSMAEIVDRRLKH-----GNLPDLILLDGGKGQVSAVKKVLELNDVD--IPLWGMYKDDKHRTKGLICKE-KEIELDKTTNLYRFIASIQEEVHNYAITYHRSLRNKALTKSILDDIQGIGEKRKKSLLNHFKDVDAIKKATMEELLEV 585
>gi|126701033|ref|YP_001089930.1| excinuclease ABC subunit C [Clostridium difficile 630] >gi|168715087|ref|ZP_02747364.1| excinuclease ABC subunit C [Clostridium difficile QCD-63q42] >gi|196124916|ref|ZP_03116665.1| excinuclease ABC subunit C [Clostridium difficile ATCC 43255] >gi|119367642|sp|Q180Q8|UVRC_CLOD6 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|115252470|emb|CAJ70313.1| excinuclease ABC subunit C [Clostridium difficile 630] (605 aa)
Score = 740, Expect = 3.9e-76, Identities = 207/573 (36%), Positives = 349/573 (60%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN-------KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKN-DEDIIGFYCKENVISIVIFKYVNGSLLSKYDLIT--VFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRE-----LNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           I++ LKK+P +PG YL KDK   +IYVGKA+ L NR++QYF   K+   K K +   I   +Y++ ++E E+L+LE NLI +Y+PKYN++LR+   +PYI VT  E++PRIL      K  K  Y+GP+ N       L   I+  +P+R C        K   + C+   I +CLGPC   V++++Y   ++EI    SGK + + E L++K  +++    FE++  Y +  K+L+   ++Q I  +  + ++D++      N   + +F   NG ++ +   I   V  S    IL + + ++Y++    +PK + +    E    L E L      K+    P KG KK +++    NAVE     YL+  S+ N+      + +LEEL+++L+++ L  R+E +D SNI   + +G+MVVY N  K+K EYR++ IK     +DYD M E++ RR K+     G +P+LI++DGGK QV A  + L+  ++D  IP+ G+ KDDKH+T  ++  +  EI+LDK ++LY F+ +IQ+EVH +AI+++R+ ++K+L ++ L  I+ +G+ R + LL  ++ +D IK+A++EEL ++
  S:     4 IQEHLKKLPSEPGVYLMKDKYDHIIYVGKAISLKNRVRQYFQSSKNHTSKVKSMVKNIYKFEYIITDSELEALILECNLIKRYRPKYNVVLRDDKTYPYIKVTTNEDYPRILKVRRVLKD-KAKYFGPYTNITAVNDTL-ELISSTYPIRSCKIDIDKAIKNKTRPCLNLHINKCLGPCTGNVSKEEYGKMIEEIIMCLSGKEEKLMELLKEKMNESSMNFRFEEAAVYRDKIKSLEEMIQKQKIDATVSDLNQDVVAMARAHNEACVQVFFIRNGKIVGREHFILEGVMDSPRASILSSFVKQFYNEQEY-IPKELIIEDEIEDSSILEEWLSSKKGQKVTIRVPQKGEKKSLVEMVRKNAVE-----YLEKFSDMNKRKYEKSIGALEELKQILNLEKLPIRIEAYDISNIQGVDSIGSMVVYTNAKKDKKEYRRYKIKTVIGPNDYDSMAEIVDRRLKH-----GNLPDLILLDGGKGQVSAVKKVLELNDVD--IPLWGMYKDDKHRTKGLICKE-KEIELDKTTNLYRFIASIQEEVHNYAITYHRSLRNKALTKSILDDIQGIGEKRKKSLLNHFKDVDAIKKATMEELLEV 585
>gi|187776683|ref|ZP_02993156.1| hypothetical protein CLOSPO_00198 [Clostridium sporogenes ATCC 15579] >gi|187775342|gb|EDU39144.1| hypothetical protein CLOSPO_00198 [Clostridium sporogenes ATCC 15579] (618 aa)
Score = 737, Expect = 8.3e-76, Identities = 201/570 (35%), Positives = 330/570 (57%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR--DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK------LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLIT--VFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSD-----EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +LK +P KPG YL K+  G +IYVGKA  L NR++QYF K +    K K +   I + +Y++ ++E E+L+LE NLI KY+PKYN+LL++   +P+I VT  E+ PR++ +   TK     Y+GP+ + N  K ++   I + FP+R C K       P + C+ + IG C  PC + + + DY   + ++    SGK   I E  +    +AAE L FE +    +    ++   E+Q II +  ++ED I  Y  E      +F   NG ++ +   I    F +    ++   + E+Y   A  +PK +Y+   +     E+  TL +  K     P KG KK+++D    NA   ++N  L+ +  +    N L++L+ +L++K+   R+E FD SNI   + VG+MVV+E G    ++YR+F I       DY  MKE++ RR+++               ++  F   P+LI++DGGK Q+  ALE L    ++  IPV G+ KD+KH+T  ++ ++  EI ++K   +  F+  +QDEVHRFAIS++R+ + K+ F + L  I N+G+ R + LL  ++++D IK+A+ EEL  I
  S:     7 QLKNLPDKPGVYLMKNNLGEIIYVGKAKVLKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYIITDSEMEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLSEDFPRVISTRKVTKD-GSKYFGPYVDGNSVK-DIIELIKKTFPIRTCKKNIVEGAKPTRPCLNHQIGLCKAPCAQYINKSDYREIIDDVIKLLSGKQLDIVENFKINMEKAAENLEFEKAAMLRDKINIIEKIGEKQKIILNNFDNEDYISLYSDEKDTCFQVFFLRNGKIVGREHFIIEDTFDTNSSTLISNFLKEFYGGTAY-IPKIIYVPAVEDRELLEQWLTLKKENKSTIKVPIKGEKKNILDLVQKNAKTTLENFRLKYLQEKVLYDNVLKDLKNILNLKEEPIRIEAFDISNIQGFDSVGSMVVFEKGRAKPSDYRRFKINTVKGVDDYKSMKEILTRRFQHGLSEIKAIQDRKLNFSSGKFSVFPDLILMDGGKGQINIALEVLNSFNIN--IPVCGMVKDNKHRTRGLI-YNGEEIIINKYGSVMKFITRVQDEVHRFAISYHRSLRGKNSFHSLLDDIPNIGEKRKKDLLFNFKSIDNIKKATYEELLSI 602
>gi|168697445|ref|ZP_02729722.1| excinuclease ABC subunit C [Clostridium difficile QCD-37x79] >gi|168724334|ref|ZP_02756611.1| excinuclease ABC subunit C [Clostridium difficile QCD-76w55] >gi|168731676|ref|ZP_02763953.1| excinuclease ABC subunit C [Clostridium difficile QCD-97b34] >gi|196159554|ref|ZP_03120115.1| excinuclease ABC subunit C [Clostridium difficile CIP 107932] (605 aa)
Score = 736, Expect = 1.1e-75, Identities = 206/573 (35%), Positives = 349/573 (60%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN-------KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKN-DEDIIGFYCKENVISIVIFKYVNGSLLSKYDLIT--VFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRE-----LNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           I++ LKK+P +PG YL KDK   +IYVGKA+ L NR++QYF   K+   K K +   I   +Y++ ++E E+L+LE NLI +Y+PKYN++LR+   +PYI VT  E++PRIL      K  K  Y+GP+ N       L   I+  +P+R C        K   + C+   I +CLGPC   V++++Y   ++EI    SGK + + E L++K  +++    FE++  Y +  K+L+   ++Q I  +  + ++D++      N   + +F   NG ++ +   I   V  S    IL + + ++Y++    +PK + +    E    L E L      K+    P KG KK +++    NAVE     YL+  S+ N+      + +LEEL+++L+++ L  R+E +D SNI   + +G+MVVY N  K+K EYR++ IK     +DYD M E++ RR K+     G +P+LI++DGGK QV A  + L+  ++D  IP+ G+ KDDKH+T  ++  +  EI+LDK ++LY F+ +IQ+EVH +AI+++R+ ++K+L ++ L  I+ +G+ R + LL  ++ ++ IK+A++EEL ++
  S:     4 IQEHLKKLPSEPGVYLMKDKYDHIIYVGKAISLKNRVRQYFQSSKNHTSKVKSMVKNIYKFEYIITDSELEALILECNLIKRYRPKYNVVLRDDKTYPYIKVTTNEDYPRILKVRRVLKD-KAKYFGPYTNITAVNDTL-ELISSTYPIRSCKIDIDKAIKNKTRPCLNLHINKCLGPCTGNVSKEEYGKMIEEIIMCLSGKEEKLMELLKEKMNESSMNFRFEEAAVYRDKIKSLEEMIQKQKIDATVSDLNQDVVAMARAHNEACVQVFFIRNGKIVGREHFILEGVMDSPRASILSSFVKQFYNEQEY-IPKELIIEDEIEDSSILEEWLSSKKGQKVTIRVPQKGEKKSLVEMVRKNAVE-----YLEKFSDMNKRKYEKSIGALEELKQILNLEKLPIRIEAYDISNIQGVDSIGSMVVYTNAKKDKKEYRRYKIKTVIGPNDYDSMAEIVDRRLKH-----GNLPDLILLDGGKGQVSAVKKVLELNDVD--IPLWGMYKDDKHRTKGLICKE-KEIELDKTTNLYRFIASIQEEVHNYAITYHRSLRNKALTKSILDDIQGIGEKRKKSLLNHFKDVEAIKKATMEELLEV 585
>gi|167628788|ref|YP_001679287.1| excinuclease ABC subunit C [Heliobacterium modesticaldum Ice1] >gi|167591528|gb|ABZ83276.1| excinuclease abc, c subunit [Heliobacterium modesticaldum Ice1] (635 aa)
Score = 735, Expect = 1.6e-75, Identities = 196/589 (33%), Positives = 342/589 (58%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL-PNKK---CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLS----------LSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEE----LQKLLDIKD-LYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNN---------------TASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-----IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKI------KEASVEELSQIVPIEVAKEIKKL 589
           M+  +++KLK +P KPG YL+KD+ G VIYVGKA++L NR++ YF   R+L  KT+ L   ICD++ +V ++E E+L+LE NLI ++KP+YN++LR+   +PY+ VT +E +PR+L +    +K    Y+GP+ ++   + E    +  +FPLR C++  P+++   C+ + IG+CL PC  +V R++Y   +  I  F  GK + + ++L+ +  +AAE L FE +       + L    E+Q +  +   D+D+I      N + + IF    G LL +   I     E+D  E++   + +YYS+    +P+ + L           L +  L+   +  +++   P +G K  +++    NA+  ++    QL + Q R+ +  EE    LQ+ L + +  +R+E FD SN      V +MVV+E G   K++YR+F IK  +  +D+  M EV+ RR+                  +A F  +P+L+IVDGGK Q+ +A E++     D+ I   GLAK++        +W F E     I L + S   + +  I+DE HRFAI+++R  ++++   ++L  I  +G  R   LL  + ++  I      + A+VE +++ +  +V   +K L
  S:     1 MHIALQEKLKSLPEKPGVYLYKDEAGQVIYVGKAINLKNRVRSYFQSSRNLNAKTQALVARICDLETIVTDSELEALILECNLIKEHKPRYNIMLRDDKTYPYLKVTLQETYPRLLITR-RLEKDGAKYFGPYTSAGAVR-ETVELLRTLFPLRTCSRREPDRRQRPCLNHHIGRCLAPCAGRVPRREYMALIGSIVAFLEGKEEELRKRLQGEMEEAAENLEFERAATLRNRIRALDQVMEKQKVFSTDLADQDVIAMARGFNQVCVQIFFIRGGKLLGREHYILEGTDEMDRSEVITAFVKQYYSRSDF-VPREILLQEPLESAEEEELINRFLREKRQG-RVELRVPKRGDKLKLVEMVAKNALLTLE----QLQNEQQRKKSMTEEAVLDLQRYLGLDEPPWRIECFDISNTMGKESVASMVVFEGGAPKKSDYRRFRIKTVEGPNDFASMAEVLTRRFNRAREEAREVDAGHLDPMSAKFATLPDLVIVDGGKGQLSSAREAMARTGYDN-IATYGLAKEN--------EWLFHESNPDPIILPRGSRALYLIQRIRDEAHRFAITYHRQLRTRAQTASALDGIAGIGPKRRTALLRHFGSVKAIAAATVAQLAAVEGMTEALAEQVLSALKPL 622
>gi|15893799|ref|NP_347148.1| excinuclease ABC subunit C [Clostridium acetobutylicum ATCC 824] >gi|21363070|sp|Q97LP6|UVRC_CLOAB UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|15023370|gb|AAK78488.1|AE007565_7 Excinuclease ABC subunit C [Clostridium acetobutylicum ATCC 824] (623 aa)
Score = 735, Expect = 1.7e-75, Identities = 197/574 (34%), Positives = 338/574 (58%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPN------KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDE--ILLTLIYEYYSKIAIELPKTVYLSLSD-----EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE 581
           +LK +P KPG Y+ K+  G VIYVGKA  L NR++QYF   K+   K K +   I + +Y+V ++E E+L+LE NLI KYKP+YN+LL++   +P+I VT  E+ PRI+ + +  K     Y+GP+ + +   +E  + + RIFP+R C K         + C+ Y I +C  PC   +++++Y   +K+     SGK+  I  +L+++  +A+  L FE +    +     +  +E+Q II     +ED I  Y  E    + +F    G ++ +   I    +  +E  I+   I E+YS  A  +PK++Y S  +     E   T+    K++   P KG KKD+++    N+   ++   ++L+S++    N L E+ +++ ++++ +R+E +D SNI   + VG+M+V+E G    ++YR+F IK     +DYD M+E++ RR+K+               +   F   P+LI++DGGK QV  ALE LK   +D  IPV G+ KDD+H T  I+ ++ +EI +     +  F+  +QDEVHRFAI+++R+ + K +  + L  I  +G+ R + LL+ + +++ IK+A+ EEL +   I+
  S:     7 QLKNLPDKPGVYIMKNSLGEVIYVGKAKILKNRVRQYFRNSKNHSEKVKAMVKNISEFEYIVTDSEIEALILECNLIKKYKPRYNILLKDDKHYPFIKVTMNEDFPRIIVTRNMVKD-GSKYFGPYPDVS-AVHETVDLMRRIFPIRTCKKYIKENGENIRPCLNYHIKRCNAPCAGLISKEEYGEIIKKAVGLISGKNNDIIRELKEEMEKASMNLDFEKAADLRDKMLAAQKVTEKQKIIIGNFENEDYISLYSDEKDSCVQVFFLREGKIVGREHFIVENTAGENEGDIIGEFIKEFYSGTAY-VPKSIYASAGEDLNLLENWLTMKRGSKVEIKIPQKGEKKDIIEMVKRNSKITLEKFKIKLLSDKRLNENILIEMTEVIGLEEVPHRIEAYDISNIQGVDSVGSMIVFEEGKPKNSDYRRFKIKTVKGANDYDSMREILTRRFKHGLEEVNSIVNKNLSLSAGKFCVFPDLILMDGGKGQVNIALEVLKEFNID--IPVCGMVKDDRHNTRGII-YNNNEIDIKSNRKIINFVTRVQDEVHRFAITYHRSLRDKRVLHSVLDDIPYIGEKRRKALLKHFGSIENIKKATYEELMKTPSID 606
>gi|164686654|ref|ZP_02210682.1| hypothetical protein CLOBAR_00249 [Clostridium bartlettii DSM 16795] >gi|164604044|gb|EDQ97509.1| hypothetical protein CLOBAR_00249 [Clostridium bartlettii DSM 16795] (604 aa)
Score = 733, Expect = 2.8e-75, Identities = 209/576 (36%), Positives = 337/576 (58%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN-KLPN------KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKN-DEDIIGFYCKENVISIVIFKYVNGSLLSKYDLIT--VFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQ-NRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI 580
           I+++LK +P +PG YL K+KN  +IYVGKAV L NR++QYF   K+   K K + + I   +Y++ ++E E+L+LE NLI +Y+PKYN+LLR+   +PYI VT  E+ PRI+      K  K  Y+GP+ N       L   I  I+P+R CN  +P       + C+ Y I +C+GPC   V++++Y   + EI  F SGK +++ E L++K    A +  FED+  Y +  KNL+   E+Q I  S  + ++D+I     E    + +F   N  ++ +   I   V  S+ D IL + + ++Y +    +PK + +    E    L + L      K+    P KG KK +      NA+E + NK+  L   +  + + +L +L +LL ++ +  R+E +D SNI   + +G+MVV+ +G K+K EYR+F IK      DY  M E++ RR K+       +P+LI++DGGK QV A    L    L   IP+ G+ KDDKH+T  +V     EI LD+ ++LY F+ +IQ+EVH +AI+++R+ + KSL ++ L  I  +G+ R + LL  ++ ++ IK A+ E+L ++  I
  S:     4 IQEQLKLLPEEPGVYLMKNKNDKIIYVGKAVSLKNRVRQYFQSSKNHSSKVKSMVSNIASFEYIITDSELEALILECNLIKQYRPKYNVLLRDDKTYPYIKVTVNEDFPRIMKVRRVLKD-KAKYFGPYTNVGAVNDTL-EIIRNIYPIRNCNVDIPKAIRNSARPCLNYHIKKCVGPCTGNVSKEEYRKMIDEIILFLSGKEETLIEILKEKMNSCAMEFKFEDAAMYRDKIKNLEEIMEKQKIDASNSDVNQDVIALARTEEEACVQVFFMRNSKIIGREHFILEGVEGSKSDSILGSFVKQFYMEQEY-IPKEIIIDEELEDRYILEQWLSDKKGSKVTITIPQKGEKKGLALMVRKNAMEYL-NKFSHLNKQKYEKSIGALTQLTELLKLETMPKRIEAYDISNIQGVDSIGSMVVFTDGKKDKKEYRRFKIKTIVGPDDYGSMAEILSRRVKHKN-----LPDLILLDGGKGQVSAVQNVLDQNNLQ--IPLWGMFKDDKHRTKGLVN-KSQEIVLDRTTNLYRFVASIQEEVHNYAITYHRSLRKKSLTKSVLDDIPGIGEKRKKNLLSHFKNIESIKAATFEQLLEVESI 588
>gi|182418177|ref|ZP_02949477.1| excinuclease ABC, C subunit [Clostridium butyricum 5521] >gi|182377995|gb|EDT75535.1| excinuclease ABC, C subunit [Clostridium butyricum 5521] (626 aa)
Score = 728, Expect = 1.0e-74, Identities = 202/576 (35%), Positives = 335/576 (58%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYI-LVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL------PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLI--TVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSD-------EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQ--NRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY---------------KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE 581
           K +LK +P KPG YL K+  G +IYVGKA  L NR++QYF   K+   K K +   I + +Y+V ++E E+L+LE NLI K+ PKYN+ L++   +P+I + T E+ PR+  + +  K     Y+GP+ N+    +E    I +IFPLR C KL        + C+ Y I +C  PC   +++ +Y+  + EI D  SG+ KS+  +L+    +A+  L FE +  + +    ++  +E+Q +  SQ NDED I  Y  E   ++ +F   +G +  + + I     Y +   I+   I  +Y     ++PK +Y+ LS+       E+  T+    K+    P KG KK++++   +NA   +     +++ ++  NR      +    LD   + R+E +D SNI   + VG+M+V+E+G    ++YR+F IK     +DYD M+E++ RR+               K ++  F   P+LI++DGGK QV  ALE L+ L ++  IPV GL KDD H T  I+ ++  E+ +++ S+L   +  +QDEVHRFAI+++R+ + K    + L  I N+G+ R   LL K+ ++D IK+A+VEEL +   I+
  S:     5 KAQLKILPDKPGVYLMKNSLGEIIYVGKAKVLKNRVRQYFQNSKNHSEKVKAMVKNIAEFEYIVTDSEMEALILECNLIKKHSPKYNISLKDDKFYPFIKITTNEDFPRVFITRNFAKD-GNRYFGPYPNAG-AVHETIKLIRKIFPLRTCKKLIFENGKHTRPCLNYHIKKCNAPCEGHISKDEYKRMIDEIIDVLSGRDKSLINKLKNDMQEASMNLEFEKAASFRDKILAIESIAEKQKVFKSQDNDEDFINIYKDEKDCAVQVFFLRDGKVTGRENFILENSAYEDDSVIISQFIVSFYGGTP-KVPKNIYIPLSNDDDNDALEEFLTIKRGSKVFVKVPIKGEKKEMLELVKSNAKVTLDQFKDKILRDKEINRLCLEEIQELLELDSMPI-RIEAYDISNIQGVDSVGSMIVFEDGKAKNSDYRRFRIKTVKNANDYDSMREILERRFSHGLKEIKEIQERQLKFSSGKFSNFPDLIMMDGGKGQVNVALEVLQKLGIN--IPVCGLVKDDHHATRGII-YNNKELIINRSSNLMQMIRRVQDEVHRFAITYHRSLRDKKTLHSILDDIPNIGQKRRMALLMKFGSIDNIKKATVEELLETESID 608
>gi|94970144|ref|YP_592192.1| excinuclease ABC subunit C [Acidobacteria bacterium Ellin345] >gi|119367490|sp|Q1ILY2|UVRC_ACIBL UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|94552194|gb|ABF42118.1| Excinuclease ABC subunit C [Acidobacteria bacterium Ellin345] (610 aa)
Score = 728, Expect = 1.1e-74, Identities = 186/574 (32%), Positives = 331/574 (57%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK--DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYI-LVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKC----NKLPNKKCIYYDIGQCLGPCIKKVTRQ-DYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLT---LIYEYYSKIAIEL-------PKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIV 578
           +  K++ +P  PG YL+K+  G +IYVGKA +L +R+  YF++  D + KT  L  E  DV+Y+VV+NE E+L LENNLI + KP++N+LLR+   +PYI L   E+ PR+ Y     KK    YYGPF  +N+  Y + + I+R F +  C     +   + C+ + IG+CLGPC++ +T +  Y   +K++  F  G+   + + L  +  +AAE + FE + KY +L   ++   ++Q I  ++ +D D+ G++ + +++++ +F    G +L + D    F+ +L E+  T      E++S +  ++       P+T+Y+ +  E  + L E L      KI    P +G K+ ++D    NA +    ++ +++  Q   L S+  LQ  L++ +L  R+E FD S+I     V +MVV+E+G   K++YRKF IK      D+  M+EV+ RRYK        +P+L+++DGG  Q+ AA  +L+ + + +  P+  +AK  + +   +   +   I++D  S +   +  I+DE HRFAI+F+R ++      N L +I  +G+  +++LL  + ++  I+ A+   L  +V
  S:     3 LHQKIRTLPTSPGVYLYKNAEGEIIYVGKAKNLRSRVGSYFVRGADENSKTGSLLREAVDVEYIVVDNEKEALALENNLIKQKKPRFNILLRDDKTYPYIKLTMGEKWPRV-YVTRRLKKDGSEYYGPFFPANL-AYRVVDLIHRNFLVPSCYIDLRRYHPRPCLQHYIGRCLGPCVEGLTNEVQYGEAVKDVKLFLEGRHSDLKQSLTARMNKAAEGMQFELAAKYRDLITTVEDLHQKQRIAAAEGDDADVFGYHYENHMVAVNLFHMRGGKVLDRRDF---FFEDLGEMEATGGLNTGEFFSTLLQQIYLDNKYVPRTIYVPVEFEDREALCEILSEQMHRKIDINVPQRGDKRSLIDLVAQNAKQSYDQRF-RVMRPQTDVLKSV--LQDTLELPELPNRIECFDISHIQGAETVASMVVWEDGKMKKSDYRKFIIKTVQGVDDFASMREVVTRRYKRIVEENQPMPSLVLIDGGVGQLHAAAGALEAIGITN-QPLASIAK--REEIIYVHGREDEPIRIDHHSPVLHIIQLIRDEAHRFAITFHRKRREIRDRSNELLEIPGIGEQAMKRLLRHFGSIQSIRTANATSLEAVV 590
>gi|170761411|ref|YP_001788709.1| excinuclease ABC, C subunit [Clostridium botulinum A3 str. Loch Maree] >gi|169408400|gb|ACA56811.1| excinuclease ABC, C subunit [Clostridium botulinum A3 str. Loch Maree] (618 aa)
Score = 725, Expect = 2.3e-74, Identities = 201/570 (35%), Positives = 330/570 (57%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR--DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK------LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLIT--VFYSELDEILLTLIYEYYSKIAIELPKTVYL-SLSDEKLK----TLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +LK +P KPG YL K+  G +IYVGKA  L NR++QYF K +    K K +   I + +Y++ ++E E+L+LE NLI KY+PKYN+LL++   +P+I VT  E+ PR++ +   TK     Y+GP+ + +  K ++   I + FP+R C K         + C+ Y IG C  PC + + + +Y   + ++    SGK   I E  +    +AAE L FE +    +    ++   E+Q II +  ++ED I  Y         +F   NG ++ +   I    F +    ++   + E+Y   A  +PKT+Y+ ++ DE L     TL +  K     P KG KK+++D    NA   ++N  L+ +  +    N L++L+ +L +++   R+E FD SNI   + VG+MVV+E G    ++YR+F I       DY  MKE++ RR+++               ++  F   P+LI++DGGK Q+  ALE L    +D  IPV G+ KD+KH+T  ++ ++  EI ++K   +  F+  +QDEVHRFAIS++R+ + K+ F + L  I N+G+ R + LL  ++++D IK+A+ EEL  I
  S:     7 QLKNLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYIITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVISTRKVTKD-GSKYFGPYVDGSSVK-DIIELIKKTFPIRTCKKNIVEGAKAIRPCLNYQIGLCKAPCAQYIKKSEYREIIDDVIKLLSGKHLDIVENFKLNMEKAAENLEFEKAAMLRDKINIIEKIGEKQKIILNNFDNEDYISLYSDGKDTCFQVFFLRNGKIVGREHFIIEDTFDTNSSTLISNFLKEFYGGTAY-IPKTIYVPNIEDEALLEQWLTLKKESKSTIKIPIKGEKKNILDLVEKNAKTTLENFKLKYLQEKALYDNVLKDLKNILSLQEEPIRIEAFDISNIQGFDSVGSMVVFEKGRAKPSDYRRFKISTVKGADDYKSMKEILTRRFQHGLSEIKSIQDRKLEFSSGKFSVFPDLILMDGGKGQINIALEVLNTFNID--IPVCGMVKDNKHRTRGLI-YNGEEIIINKYGSVMKFITRVQDEVHRFAISYHRSLRGKNSFHSLLDDIPNIGEKRKKDLLFNFKSIDNIKKATYEELLSI 602
>gi|160947769|ref|ZP_02094936.1| hypothetical protein PEPMIC_01704 [Peptostreptococcus micros ATCC 33270] >gi|158446903|gb|EDP23898.1| hypothetical protein PEPMIC_01704 [Peptostreptococcus micros ATCC 33270] (620 aa)
Score = 725, Expect = 2.5e-74, Identities = 213/570 (37%), Positives = 333/570 (58%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLK-TKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFAN-SNIKKYELYNFINRIFPLRKCN------KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLI--TVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEK--------LKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY------KNNTA--SFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           I  +LKK+P  PG Y+  DK+  +IYVGK+V L NR++ YF  +   K  + +   I   +Y++VNNE ESL+LE NLI K +PKYN+ L++   +PYI +T E+ P+IL   D  K+ K  Y+GPF   S+++K  L      I+ +R C       K   + C+ Y +G+C  PC + + R++Y   +K +  F SG +  I E L  +  Q++ K  +E + KY +    +     +Q     +  +  +I +   EN++ + IF   +G ++ +   I   +   E++E+   +I ++Y     ++ K VY+  SDEK        L  +     I   NP KGVK D M     NA EI+        +   + L ++  L+ +LDI +L R+E +D SNI     VG+MVVY+NG K+  +YRKF IK      DY   +E++ RR+      K N+A  SF E P+LI++DGGK  V  A E L  LE +  +PVIGL K+DKH+T  I+  D + I+LD  +++Y FL +IQ+EVHRFAI+++R+ ++K L  + L +IK +G+ +  KLL  + ++  IK+ASVEEL
  S:    10 INYELKKLPDLPGVYIMYDKDDKIIYVGKSVSLKNRVRSYFTTNHKYKKVQAMVEHIHRFEYIIVNNETESLVLEANLIKKNRPKYNINLKDDKQYPYIKITNEKFPKILKVRD-IKEDKAQYFGPFPTISDLEK--LMELSILIYNIRDCKLNFDKGKFLQRPCMSYYLGRCSAPCTQNIDRENYNNDVKRVIKFLSGDTTEIKEILLNRMKQSSAKEEYELAMKYRDFLSEIDYLFTKQIFNIKKFKEYHLISYAYAENILVVAIFIVNDGLVVDRKHFIVENILDLEVEELFSNVIRQFYISHHNKV-KEVYIDYSDEKFLNEISLFLANIFSEKSISVKNPKKGVKFDQMKILQKNANEILTKHIFDNKNINVKYLQAINYLKNILDIDNLDRIECYDISNISGDFNVGSMVVYKNGFKSSKDYRKFKIKTVVGQDDYSSHREMLTRRFNRFLDEKINSAGSSFSEKPDLILMDGGKGHVNVAKEVL--LEKNLDVPVIGLVKNDKHRTKGIIFED-NYIELDINTNIYRFLFDIQEEVHRFAINYHRSLQNKKLQNSVLDEIKGVGEIKKIKLLSHFGSISSIKKASVEEL 598
>gi|118045693|ref|ZP_01514350.1| excinuclease ABC, C subunit [Chloroflexus aggregans DSM 9485] >gi|117997705|gb|EAV11889.1| excinuclease ABC, C subunit [Chloroflexus aggregans DSM 9485] (653 aa)
Score = 725, Expect = 2.5e-74, Identities = 193/583 (33%), Positives = 341/583 (58%)
  Q:     7 DKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKI---KGTYYGPFANSNIKKYELYNFINRIFPLR---KC-------NKLPNKKCIYYDIGQCLGPCIKK-VTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITV--FYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFG---------------------------------EIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKD-DKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEIKKL 589
           ++L+ +P +PG YLWKD  G ++YVGK+  L +R++ YF   R L  KT++L + I D + +V  +E E+LLLE NLI +++P YN+LL++   +PYI VT  EE PR+     +T+++      Y+GP+A++    Y   + +NR+F  R   +C       ++   K C+YY + +CLGPC+   VT++ Y   +  +  F  GKS  I  +L  +  +AAE+L FE +    +  + ++  SERQ ++ +   D+D+I F  +E+  ++V   ++ G  L   +  T+     E DE LLT     + + A  +P ++ L+   E+   ++  L      +++   P +G KK +++ A  NA + ++    Q + ++ R + +L EL+ LL++  L  R+E +D SN      V +MVV+E+G      YR+F IK     +D   ++EVI RR++    + G                                 ++P+L++VDGG  QV A   +L  L     IPV+G+AK  D+++ D +V+     + L + S     +  I +E HRFAI+++R  ++K+   + L +I  +G  R   LL+ + ++D I+ AS++EL+ +  +  + A+E+K L
  S:    16 ERLRLVPDQPGVYLWKDATGRLLYVGKSKRLRDRMRSYFGSPRSLSGKTRRLVSHIADFEIIVTQSELEALLLEMNLIKQHRPPYNILLKDDKTYPYIKVTVNEEWPRVF----ATRQVLNDGARYFGPYASAG-SVYHALDILNRLFAFRPPYECKDDKFNRHRKQGKPCLYYQMRRCLGPCVPGLVTKETYRQAIDSVCRFLEGKSDQIVRELRAQMEEAAERLEFERAAYLRDRIQAIEKISERQQVLRTVDTDQDVIAF-AREDGSAVVQVLFIRGGKLINAEPFTLQGTEDESDEALLTSFLTQFYQHAPSIPPSLLLAEHVEEPLIIASWLQQKSGHRVEITVPRRGEKKQLVEMAAANARQKLREIREQWLHSEQRAVAALSELRDLLELPALPRRIECYDVSNTQGQQSVASMVVFEHGEPRPAHYRRFKIKTVSGANDVASLREVISRRFRRAAEALGDTQQAAAAVEVEGENDSPAEPTDTARQALERWADLPDLLLVDGGVAQVAAVEAALHELGFTQ-IPVVGVAKGPDRNRFD-LVRIGQDPLVLARDSKALALVQRIDEEAHRFAITYHRKLRNKATLRSPLDEIPGIGPKRKRALLKAFGSIDGIRRASIDELAAVPGMTRKAAEELKSL 652
>gi|49475349|ref|YP_033390.1| excinuclease ABC subunit C [Bartonella henselae str. Houston-1] >gi|81648054|sp|Q6G424|UVRC_BARHE UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|49238155|emb|CAF27363.1| Excinuclease ABC subunit c [Bartonella henselae str. Houston-1] (661 aa)
Score = 724, Expect = 2.7e-74, Identities = 199/576 (34%), Positives = 312/576 (54%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK--LPNKK--CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIF------KYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRY-----------------KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI 580
           I++ +K +PHKPG Y   D+NG V+YVGKA +L  R+  Y  +   + +  ++      +++VV + E E+LLLE NLI +  P++N+LLR+  +FPYI++T +     LY H   +  K  Y+GPFA+S+    +  N + R F LR C    L N+   C+ Y I +C  PC  +++ +DY   +K    F SGKS+SI   + +   +AA+   FE +  Y +    L      Q I      + D+     KE +  I +F       + N +   K D    F S   EIL + + ++Y      LPK + LS S E    L+E+       KI    P +G +K +++ A+ NA E + +K L   +   +    + E+ +L       R+EI+DNS+I  TN VGAM+V       KN+YRKFNI+  D     D+  MKEVI RR+                   + ASF   P+LI++DGGK Q+ +    L  L LD+ + V+G+AK  D +   +R      +   L     + +FL  ++DE HRFAI  +R K+ K   +N L +I+N+G TR   LL  + +   I  AS+E+L++++ I
  S:    43 IQEFVKHLPHKPGVYRMVDENGKVLYVGKARNLKKRVSNYTREQGHNNRITRMIRATSHMEFVVTHTEIEALLLEANLIKRLHPRFNVLLRDDKSFPYIIITDDHRAPALYKHRGARTRKAHYFGPFASSSAVT-QTINVLQRAFLLRTCTDSVLENRTRPCLLYQIKRCSAPCTHEISDRDYRELVKGAKSFLSGKSQSIKNDMVQAMHKAAKNFDFEQAAAYRDRLSALSHIQSHQGINPQTIEEADVFAIAQKEGISCIQVFFFRMGQNWGNRAYFPKAD--PSFSSS--EILASFLSQFYDDKP--LPKLILLSESIEDKTLLAEAFSLKANRKISLSLPKQGERKTLVNYAYINAHETLGHK-LAETATHTKLFQGIAEIFQLPHTP--CRIEIYDNSHIMGTNAVGAMIVAGKNGFIKNQYRKFNIRSTDITPGDDFGMMKEVIKRRFSRLIKEHGLPHESKNIQSKDDASFPIWPDLILIDGGKGQINSVHTILSELGLDNFMTVVGIAKGADRRAGRERFFIKGKTPFTLPPCDPILYFLQRLRDEAHRFAIGTHRAKRKKETLKNPLDEIENIGPTRKRALLHHFGSAKAIASASLEDLTKVIGI 646
>gi|83589125|ref|YP_429134.1| excinuclease ABC subunit C [Moorella thermoacetica ATCC 39073] >gi|119367672|sp|Q2RLU8|UVRC_MOOTA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|83572039|gb|ABC18591.1| Excinuclease ABC subunit C [Moorella thermoacetica ATCC 39073] (613 aa)
Score = 723, Expect = 3.7e-74, Identities = 172/570 (30%), Positives = 322/570 (56%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYI-LVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLP----NKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL----YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTAS---FGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           +++KL ++P  PG Y+  D NG +IYVGKA  L NR++ YF      +T+ + + + D +Y++ +NE E+L+LE NLI +++P+YN+ L++  ++PYI + T+E+ PRI  +   T+     Y+GP+ ++   K E    +  +FP+R C   P    ++ C+   IG+CL PC  +V R+ Y   +  +  F  G+  ++ ++L+++   AA +L FE + +  +  + ++   E+Q +  +   D D I F  +      +IF    G ++ +          L   E++  L+ EYYS+  +E+P  + L    E   T++  L      ++    P +G K  ++     NAV +++     L++ + +E  S   L +L +I +L     RME +D SN   +++VGAM V+ +G    + YR+F IK     +D+  ++EV+ RR++        F ++P+ +++DGG  Q+ AA E+++ + +   IP  GLAK++    + + +   SE I+L ++S     L +++DEVHRFAI+++R K+ K+ + + L  I  +G  R + LL  + ++  I +A++E+L
  S:     3 LEEKLARLPDHPGVYIMHDANGAIIYVGKAASLRNRVRSYFRGQHQPRTQAMVSHVADFEYILTDNEVEALILECNLIKQHRPRYNVSLKDDKSYPYIKITTQEDFPRIQITRSVTRD-GSRYFGPYTSAGSLK-ETLKLLRGLFPIRTCRDTPLQPRSRPCLNAHIGRCLAPCAGQVDRETYREAVDNVIMFLEGRHTALVKELKEQMEAAAARLEFEKAARLRDQLRAVQEVCEKQKLAAASGEDADAIAFAREGEAALGLIFFSRGGKVIGRDHFFLTGSEGLSRGEVMAALLKEYYSR-GVEIPPEILLHDEPEDAATIASWLSRLRGGRVNLRVPKRGTKLKLLRLVHENAVSLLQE---HLLTRRRQEEGSRAALLELQEILELPRLPRRMEAYDISNFQGSSQVGAMAVFVDGRPLPSAYRRFQIKTVRGPNDFASLQEVLSRRFRRAAEQDPHFADLPDFVLIDGGLGQLHAARETMEAMGV-GYIPTFGLAKEE----ELLFRVGTSEPIRLPRESKALQILQHLRDEVHRFAITYHRQKREKTAYRSVLDDIPGVGPKRKKALLRHFGSVAAISKATLEDL 582
>gi|28212079|ref|NP_783023.1| excinuclease ABC subunit C [Clostridium tetani E88] >gi|32130290|sp|Q890Y5|UVRC_CLOTE UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|28204522|gb|AAO36960.1| excinuclease ABC subunit C [Clostridium tetani E88] (622 aa)
Score = 723, Expect = 3.9e-74, Identities = 205/574 (35%), Positives = 334/574 (58%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL------PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDE--ILLTLIYEYYSKIAIELPKTVYL-SLSD----EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNA---VEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE 581
           +LK +P KPG YL K+ +  VIYVGKA  L NR+KQYF   K+   K + + + I + +Y++ ++E E+L+LE NLI KY+PKYN+LL++   +PYI +T  E+ PR+  S  +  K    Y+GP+ + +  + E    I +IFP+R C +       P + C+ Y I  C  PC   +++Q Y   + +I    SGK K I ++L+ +  +A+  L FE +    +    +K  +E+Q II     +ED I     E    + +F    G ++ +   I  + S+  E  I+   I ++Y   A  +PKTVY+  + D    E+  T+    K++   P +G K ++++    NA   +E  K KYLQ   ++     +L EL  +L   D+  R+E +D SNI   + VG+MVV+E G   K++YR+F IK  +  +DY  M+E++ RR++                ++  F   P+LI++DGGK  V  ALE LK  EL+  IPV G+ KDD H T  I+ ++  E  +   S+    +  IQDEVHRFAIS++R  + K + ++ L  I N+G  R ++LL+K+ +++ IK+AS+++L +   I+
  S:     7 QLKVLPEKPGVYLMKNSSDEVIYVGKAKILKNRVKQYFQQSKNHSEKVRVMVSNIAEFEYIITDSEMEALILECNLIKKYRPKYNILLKDDKGYPYIKITINEDFPRVFISR-TIAKDGSRYFGPYTDYSAVR-ETIELIKKIFPIRSCKRYIRDGQKPTRPCLNYHIKLCSAPCGAHISKQGYALIINDIVQLLSGKDKDILDKLKNQMEEASNSLQFEKAASLRDKIFAVKKITEKQKIIMGSFQNEDYINIAKDEKDSCVQVFFVREGKIIGREHFILEYTSDEREYKIIAEFIKDFYGGAAF-VPKTVYVPDIEDKYLLEQWLTIRRGSKVEIKVPKRGEKIELLNLVKKNAKLTLEQFKIKYLQ---DKALYEVALAELSDILGFDDMPNRIEAYDISNIQGVDSVGSMVVFEKGRSKKSDYRRFKIKTVEGANDYHSMREILRRRFQRGIEEIQQIQKRNLEFSSGKFSVFPDLILIDGGKGHVNIALEVLK--ELNIEIPVAGMVKDDSHTTRGII-YNNIEKDISLDSNAMKLITRIQDEVHRFAISYHRTLRDKRVLKSILDDIPNIGTIRKKELLKKFGSIESIKKASIDQLLETPSID 606
>gi|167729761|emb|CAO80673.1| Excinuclease ABC, C subunit [Candidatus Cloacamonas acidaminovorans] (601 aa)
Score = 722, Expect = 4.9e-74, Identities = 186/576 (32%), Positives = 322/576 (55%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF-LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-LPNKK----CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEI-FDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +E+I+ KL  +P +PG YLWKDK+G +IY+GKA++L +RIK Y     +DLKT+ L   I D+DY++ N+E ++ +LE  L+ +Y+PKYN++L++   +P++ +T  E  PRI  + +  K     Y+GP+      +  L + +  IFPLR CN+ +P  K    C+ + +G+C  PCI  +++++Y   + ++  FF+G+   + ++L  +   A+ +L FE++ K+ +    ++   +RQ +   +  + DIIGFY +E     VI K  NG+++ +  Y L  + Y E D IL + +  YY+    E+P+ V L  + + +  L+  L  K   P +G K  ++  A  NA  I++   L  +   NR +  ++EL++ L +  L R  +  D S I  ++ V + V +ENG   K  YR F I+  +  +DY  M+E + R            P+LI++DGGK Q+ A+ + L+    +  I +I LA   K   +  V  +   I L + S     L+NI+DE HRFA+S +R ++S+   E+ L  I  +G+     LL++  +++ I  A+ E LS+I
  S:     5 SEEIETKLALLPEQPGVYLWKDKDGTIIYIGKALNLKHRIKNYLNPAGKDLKTEHLIKNIADLDYIITNSEADAFILEATLVKRYRPKYNIMLKDDKRYPFVKITVNEPFPRIFITRELLKD-NAKYFGPYTEVRYLRNTLRD-LEWIFPLRSCNRNIPKIKYKQPCMNFQLGKCPAPCIGNISQKNYAKTVNQLLRFFNGRYTELLDELRTEMQNASAELRFEEAGKFRDRIIAIERIQKRQSVFNVEGGNIDIIGFYREEKRAVCVILKMKNGAIIHQENYPLTNLDYEEPDSILASFLQLYYADRE-EMPEEVLLPFAPKDMDKLNSWLGNKLQIPQRGEKTKLIAMAKTNAFNIVEESKLAHLRKANRTIFPVQELKEALKLPKLPRKIVCMDISTIQGSDTVSSAVFFENGKSKKKYYRHFIIRSIETQNDYAAMQETMARFLTETEKEPQMKPDLIVIDGGKGQLSASEQILRASGKND-ISIIALA---KRAEEVFVPGNEQSIILPRSSSALRLLINIRDEAHRFALSLHRKRRSRRTLESELESISGIGEKNKFLLLKELGSVENIANANRETLSKI 583
>gi|145952560|ref|ZP_01801569.1| hypothetical protein CdifQ_04003934 [Clostridium difficile QCD-32g58] (589 aa)
Score = 722, Expect = 5.4e-74, Identities = 202/565 (35%), Positives = 342/565 (60%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILV-TKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN-------KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKN-DEDIIGFYCKENVISIVIFKYVNGSLLSKYDLIT--VFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQN-----RELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEA 569
           I++ LKK+P +PG YL KDK   +IYVGKA+ L NR++QYF   K+   K K +   I   +Y++ ++E E+L+LE NLI +Y+PKYN++LR+   +PYI V T E++PRIL      K  K  Y+GP+ N       L   I+  +P+R C        K   + C+   I +CLGPC   V++++Y   ++EI    SGK + + E L++K  +++    FE++  Y +  K+L+   ++Q I  +  + ++D++      N   + +F   NG ++ +   I   V  S    IL + + ++Y++    +PK + +    E    L E L      K+    P KG KK +++    NAVE     YL+  S+ N     + + +LEEL+++L+++ L  R+E +D SNI   + +G+MVVY N  K+K EYR++ IK     +DYD M E++ RR K+     G +P+LI++DGGK QV A  + L+  ++D  IP+ G+ KDDKH+T  ++  +  EI+LDK ++LY F+ +IQ+EVH +AI+++R+ ++K+L ++ L  I+ +G+ R + LL  ++ ++ IK++
  S:     4 IQEHLKKLPSEPGVYLMKDKYDHIIYVGKAISLKNRVRQYFQSSKNHTSKVKSMVKNIYKFEYIITDSELEALILECNLIKRYRPKYNVVLRDDKTYPYIKVTTNEDYPRILKVRRVLKD-KAKYFGPYTNITAVNDTL-ELISSTYPIRSCKIDIDKAIKNKTRPCLNLHINKCLGPCTGNVSKEEYGKMIEEIIMCLSGKEEKLMELLKEKMNESSMNFRFEEAAVYRDKIKSLEEMIQKQKIDATVSDLNQDVVAMARAHNEACVQVFFIRNGKIVGREHFILEGVMDSPRASILSSFVKQFYNEQEY-IPKELIIEDEIEDSSILEEWLSSKKGQKVTIRVPQKGEKKSLVEMVRKNAVE-----YLEKFSDMNKRKYEKSIGALEELKQILNLEKLPIRIEAYDISNIQGVDSIGSMVVYTNAKKDKKEYRRYKIKTVIGPNDYDSMAEIVDRRLKH-----GNLPDLILLDGGKGQVSAVKKVLELNDVD--IPLWGMYKDDKHRTKGLICKE-KEIELDKTTNLYRFIASIQEEVHNYAITYHRSLRNKALTKSILDDIQGIGEKRKKSLLNHFKDVEAIKKS 577
>gi|118727208|ref|ZP_01575816.1| excinuclease ABC, C subunit [Clostridium cellulolyticum H10] >gi|118663425|gb|EAV70078.1| excinuclease ABC, C subunit [Clostridium cellulolyticum H10] (613 aa)
Score = 721, Expect = 6.2e-74, Identities = 201/582 (34%), Positives = 331/582 (56%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-LP-----NKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDE----ILLTLIYEYYSKIAIELPKTVYLSLSDE-----KLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYK---------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAKEI 586
           I+++LKK+P K G Y+ KD NG+VIYVGKAV L NR++QYF +  +   K + + +++ + +Y+VV++E E+L+LE  LI KYKPKYN+LL++   +PYI VT  EE+PRIL +    +K    Y+GP++ S     +  + + ++F L+ CNK LP      + C+ Y + QCL PC   V R +Y   +K+I  F  G+   I   L  +   AAE+L FE + +      ++K  SE Q ++F+   D DIIG+      + I +F   NG ++ +   I  F  E +E     L T I ++Y+K+     + V  S  D+     K  T     K+    P +G    ++     NA   +K    +           + +L KLL +++   R+E +D SN  ++  V +MVV+ENG   + EYRKF +K  +  +DY  M+E ++RR              A F ++P+LI+VDGG   V AA + ++  EL     + G+AKDD+H+T  +V +  +E +L     L  F+  IQDE HR A+ + R  + K    + L +I+ +G+TR + L++ ++++  I++A + +L ++  I  ++AK I
  S:     4 IQEELKKLPDKSGVYIMKDANGVVIYVGKAVVLKNRVRQYFQQSANHPPKVQAMVSKVSEFEYIVVDSEVEALMLECTLIKKYKPKYNILLKDDKHYPYIKVTLNEEYPRILKTR-RVEKDGARYFGPYS-SGFAVNDTIDTLKKLFSLKTCNKNLPRDIGKTRPCLNYHMKQCLAPCQGGVNRDEYREMMKKICRFLGGQYDEIINDLRIQMETAAEQLDFEKAAQLRNKITSIKQLSESQKVLFTDLEDRDIIGYSADSTDLCIQVFFVRNGRVIGREHFI--FEGEANEDKGYSLSTFIKQFYTKVQYVPSEIVLQSEVDDSETIAKWLTEKRGFKVALRVPQRGDLVKLVHMVSENAEITLKLHRERQSREGTVHSEGMAQLVKLLGLEEAPARIESYDISNTGSSEIVASMVVFENGRPARQEYRKFKMKSIEQQNDYGSMQETLFRRLNRAKREKEEGTENAKFSKLPDLILVDGGSNHVNAARQVVE--ELGYNFKIAGMAKDDRHRTKSLV-YMGNEYELATNMPLLRFITEIQDETHRVAVEYNRKLREKRYVRSELDEIEGIGQTRKKALIKHFKSVAAIRKADIAQLQEVNGISEKIAKNI 608
>gi|49474108|ref|YP_032150.1| excinuclease ABC subunit C [Bartonella quintana str. Toulouse] >gi|81647123|sp|Q6G041|UVRC_BARQU UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|49239612|emb|CAF25970.1| Excinuclease ABC subunit c [Bartonella quintana str. Toulouse] (678 aa)
Score = 721, Expect = 6.6e-74, Identities = 197/578 (34%), Positives = 315/578 (54%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK--LPNKK--CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIF------KYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIK-----FLN-PSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK-----------------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEV 582
           I++ +K +PHKPG Y   D+NG V+Y+GKA +L  R+  Y  + R + +  ++      +++VV + E E+LLLE NLI +  P++N+LLR+  +FPYI++T+      LY H   +  K  Y+GPFA+S+    +  N + R F LR C    L N+   C+ Y I +C  PC  ++   DY   ++    F SGKS+S+   + +   +AAE L FE +  Y +    L      Q I      + D+     K  +  I +F       + N S   K D     +S   EIL + + ++Y      LPK + LS   E+   L+E+  +K     FL+ P +G +K +++ A+ NA E + +K L   +   + L  + E+ +L      +R+E++DNS++  TN VGAM+V +     KN+YRKFNI+  D     D+  MKEVI RR+                   +   F   PNLI++DGG+ Q+ +    L  L+LD  I V+G+AK  D     +R      +   L     + +FL  ++DE HRFAI  +R K+ K+  +N L +IKN+G TR   LL  + +   +  AS+E+L+++  I V
  S:    60 IQEFVKHLPHKPGVYRMFDENGNVLYIGKARNLKKRVSNYTCEQRHNNRITRMIRATYHMEFVVTHTETEALLLEANLIKRLHPRFNVLLRDDKSFPYIIITENHRAPALYKHRGARTRKAHYFGPFASSSAVT-QTINVLQRAFLLRTCTDSVLENRTRPCLLYQIKRCSAPCTHEINENDYRELVRGAKAFLSGKSQSVKNDMIQAMHKAAEDLDFEQAAVYRDRLSALSHIQSHQGINPQTIEEADVFAIAQKGGITCIQVFFFRMRQNWGNRSYFPKAD---PSFSR-SEILASFLAQFYDDKP--LPKLILLSEEIEEKTLLAEAFSLKANRKIFLSLPKQGERKTLVNHAYINAYEALGHK-LAETATHTKLLQGIAEVFQLPQTP--HRIEVYDNSHLMGTNAVGAMIVADQMGFLKNQYRKFNIRSTDITPGDDFGMMKEVIKRRFSRLIKEHGLPHESNSIKGEDEDCFSIWPNLILIDGGEGQINSVHTILSELKLDDFITVVGIAKGADRGAGHERFFIKGKTPFTLPPHDPILYFLQRLRDEAHRFAIKTHRIKRKKATLKNPLDEIKNIGSTRKRALLHHFGSAKIVASASLEDLTKVTGISV 665
>gi|170756327|ref|YP_001783017.1| excinuclease ABC, C subunit [Clostridium botulinum B1 str. Okra] >gi|169121539|gb|ACA45375.1| excinuclease ABC, C subunit [Clostridium botulinum B1 str. Okra] (618 aa)
Score = 720, Expect = 8.8e-74, Identities = 201/570 (35%), Positives = 329/570 (57%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR--DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK------LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLIT--VFYSELDEILLTLIYEYYSKIAIELPKTVYL-SLSDEKLK----TLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +LK +P KPG YL K+  G +IYVGKA  L NR++QYF K +    K K +   I + +Y++ ++E E+L+LE NLI KY+PKYN+LL++   +P+I VT  E+ PR++ +   TK     Y+GP+ + +  K ++   I + FP+R C K         + C+ Y IG C  PC + + + +Y   + ++    SGK   I E  +    +AAE L FE +    +    ++   E+Q II +  ++ED I  Y         +F   NG ++ +   I    F +    ++   + E+Y   A  +PKT+Y+ S+ DE L     TL +  K     P KG KK+++     NA   ++N  L+ +  +    N L++L+ +L +++   R+E FD SNI   + VG+MVV+E G    ++YR+F I       DY  MKE++ RR+++               ++  F   P+LI++DGGK Q+  ALE L    +D  IPV G+ KD+KH+T  ++ ++  EI ++K   +  F+  +QDEVHRFAIS++R+ + K+ F + L  I N+G+ R + LL  ++++D IK+A+ EEL  I
  S:     7 QLKNLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYIITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVVSTRKVTKD-GSKYFGPYVDGSSVK-DIIELIKKTFPIRTCKKNIVEGAKAIRPCLNYQIGLCKAPCAQYIKKSEYREIIDDVIKLLSGKHLDIVENFKLNMEKAAENLEFEKAAMLRDKINIIEKIGEKQKIILNNFDNEDYISLYSDGKDTCFQVFFLRNGKIVGREHFIIEDTFDTNSSTLISNFLKEFYGGTAY-IPKTIYVPSIEDEALLEQWLTLKKESKSTIKIPIKGEKKNILVLVEKNAKTTLENFKLKYLQEKALYDNVLKDLKNILRLQEEPIRIEAFDISNIQGFDSVGSMVVFEKGRAKPSDYRRFKINTVKGADDYKSMKEILTRRFQHGLSEIKSIQDRKLEFSSGKFSVFPDLILMDGGKGQINIALEVLNTFNID--IPVCGMVKDNKHRTRGLI-YNGEEIIINKYGSVMKFITRVQDEVHRFAISYHRSLRGKNSFHSLLDDIPNIGEKRKKDLLFNFKSIDNIKKATYEELLSI 602
>gi|29348675|ref|NP_812178.1| excinuclease ABC subunit C [Bacteroides thetaiotaomicron VPI-5482] >gi|81443557|sp|Q8A2N9|UVRC_BACTN UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|29340580|gb|AAO78372.1| excinuclease ABC subunit C [Bacteroides thetaiotaomicron VPI-5482] (609 aa)
Score = 718, Expect = 1.4e-73, Identities = 198/587 (33%), Positives = 336/587 (57%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPN---------KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIK---FLNPSKGVKKDVMDTAFNNAVEIMKNKYLQL--ISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIV-KWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           NE ++  +  +P KPG Y + +  G +IYVGKA +L  R+  YF K+ +  KT+ L ++I D+ Y+VVN E ++LLLENNLI KYKP+YN+LL++   +P I V  E  PRI  +    K    +YYGP+++     Y + + I  ++PLR CN   +         K C+ Y I +C GPC+   + +DY   + EI +   G ++ I   L +K  + A ++ FE++QK  E    ++ +  + +++ S  ++ D+      ++  + V + ++    +++      F  E  + L     E  +   IE+ +  Y S S E +      L++    F  P +G KK ++D +  N  +   ++  Q   ++ + R +  L+E+Q  L + K   ++E FDNSNI  ++ V A VV++    +K +YRK+NIK      DY  MKEV+ RRY+        +P+LII DGGK Q++   E ++  EL   IP+ GLAKD+KH+T  ++  +    I + ++S L+  L  IQDEVHRFAI+F+R+K+SK    ++L  IK +G+     LL++++++ +IKEAS+EE+++++    A+ +KK
  S:    10 NEYLRGIVANLPEKPGVYQYLNTEGTIIYVGKAKNLKKRVYSYFSKEHEPGKTRVLVSKIADIRYIVVNTEEDALLLENNLIKKYKPRYNVLLKDDKTYPSICVQNEYFPRIFRTRKIIKN-GSSYYGPYSHLP-SMYAVLDLIKHLYPLRTCNLNLSPENIRAGKFKVCLEYHIKKCAGPCVGLQSHEDYLKNIDEIKEILKGNTQDISRMLVEKMQELANEMKFEEAQKIKEKYLLIENYRSKSEVVSSVLHNIDVFSIEEDDSNSAFVNYLHITNGAINQ-----AFTFEYKKKLNESKEELLTLGIIEM-RERYKSHSREIIVPFELDLELNNVVFTVPQRGDKKKLLDLSILNVKQYKADRLKQAEKLNPEQRSMRLLKEIQNELHLDKPPLQIECFDNSNIQGSDAVAACVVFKKAKPSKKDYRKYNIKTVVGPDDYASMKEVVRRRYQRAIEENSPLPDLIITDGGKGQMEVVREVIED-ELHLNIPIAGLAKDNKHRTSELLFGFPAQTIGIKQQSSLFRLLTQIQDEVHRFAITFHRDKRSKRQVASALDSIKGIGEKTKTALLKEFKSVKRIKEASLEEIAKVIGEVKAQTVKK 604
>gi|188587558|ref|YP_001922471.1| excinuclease ABC, C subunit [Clostridium botulinum E3 str. Alaska E43] >gi|188497839|gb|ACD50975.1| excinuclease ABC, C subunit [Clostridium botulinum E3 str. Alaska E43] (629 aa)
Score = 718, Expect = 1.7e-73, Identities = 211/569 (37%), Positives = 333/569 (58%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL------PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLI--TVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLN------PSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY---------------KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           K++LK +P KPG YL K+  G VIYVGKA  L NR++QYF   K+   K K +   I + +Y++ ++E E+L+LE NLI KY P+YN+LL++   +P+I VT  EE P+I  +    K     Y+GP+ N     YE  N I +IFP+R C K       P + C+ Y I +C  PC   +++ DY   + E+ +  SGK+K +  +L+K    A++ L FE +    +    +    E+Q I  SQ+ DED I  Y  E    + +F   +G +  +   I     Y E   IL   +  +Y     ++PK +Y+   ++  + L E LKIK  +      P  G KK++++   NNA   ++    +L+ ++   +  LEEL++LL++ D+  R+E FD SNI   + VG+M+V+ENG    ++YR+F IK+    ++YD M+E++ RR+               K +   F   P+LI++DGGK QV  A E L   +LD  IP+ GL KDD H T R + ++  EI +++ S+L  F+  +QDEVHRFAI+++R+ + K    + L  I N+G+ R   LL K+ +++ IK A +EEL
  S:    10 KNQLKILPDKPGVYLMKNSLGEVIYVGKAKILKNRVRQYFQNSKNHSEKVKAMVKNIAEFEYIITDSEMEALILECNLIKKYSPRYNILLKDDKFYPFIKVTINEEFPKIFITRKYAKD-GNKYFGPYTNI-ASVYETMNLIKKIFPIRTCKKAITEGGNPTRPCLNYHIKKCNAPCAGYISKDDYRNMISEVMELLSGKNKDLVNKLQKDMEYASQNLEFEKAASLRDKIIAINNIVEKQKIFKSQEGDEDFINLYKDEKDCCVQVFFLRDGKVTGREHFILENSTYQEESSILSQFMISFYGGTP-KVPKHIYIP-KEQDTEILEEFLKIKRGSKVNVKVPKIGSKKEMLELVRNNAKLTLEQFKEKLLMDKKINIGCLEELKELLNLDDIPNRIESFDISNIQGVDSVGSMIVFENGKAKNSDYRRFGIKNVKNGNEYDSMREILERRFTHGLKEVKEIQERNLKFSNGKFSNFPDLIMMDGGKGQVNVAKEVLN--KLDIQIPICGLVKDDHHST-RGIIYNNEEIIINRSSNLMQFIRRVQDEVHRFAITYHRSLRDKRTLHSILEDIPNVGEKRRRALLMKFGSVENIKNAKLEEL 604
>gi|148657260|ref|YP_001277465.1| excinuclease ABC, C subunit [Roseiflexus sp. RS-1] >gi|148569370|gb|ABQ91515.1| Excinuclease ABC subunit C [Roseiflexus sp. RS-1] (669 aa)
Score = 717, Expect = 1.8e-73, Identities = 184/584 (31%), Positives = 337/584 (57%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK----------CIYYDIGQCLGPCIKK-VTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLS-------------KYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFG----------------------------------------------EIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKD-DKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAKEIKKL 589
           +++L+ +P  PG YLWK+  G +IYVGK+  L +R++ YF +  D   KT +L  +I D   +V + E E+LLLE  LI +++P++N+LL++  ++PYI VT  E  PRI  + +   +    Y+GP++++    Y   + +NR+F  R  ++ P+ K          C+YYDI +CLGPC+   V +++Y   ++ +  F  GKS  + + L ++  +AAE+L FE + +  +  +++++ S+RQ ++     D+D+IG   +E +  + +     G L+S               DL+  F ++  +    L       + ++ P  +      E+        KI    P +G K+ +++ A  NA + ++   LQ ++++ R +  L E++ LL +  L  R+E FD SNI  ++ VGAMVV+E G   K+ YRKF IK     +D   ++E++ RR++      G                                              E+P+LI++DGG  Q+  A+++L+ L  D  IPV+G+ K  ++ + D ++      I L++ S     +  I +E  RFA  ++R  +SKS   + L +I  +G  R + LL+++ +L+ I+ A+V+EL+ +  +  + A+E+K +
  S:    16 EERLRAVPLAPGVYLWKNAQGKIIYVGKSKRLRDRMRSYFNQTGDPYGKTARLVEQIADFQVIVTSTELEALLLEMTLIKQHRPRFNVLLKDDKSYPYIKVTLHETWPRIFATRNPRWEEGARYFGPYSSAG-AVYRTLDQLNRLFAFRPPSRCPDDKFNRHRRMGKPCLYYDIKRCLGPCVPGLVNQEEYRATIESVCRFLEGKSDLVVKTLRRQMEEAAERLDFERAARLRDSIRDIELISQRQQVLRHDDADQDVIGLAREEGMAVVQVLCIRAGKLISAESFPLQNAEGERNEDLLASFLTQFYDTAAELPAALLLPMPLDEPAVI------EQWLAQKAGRKITLHTPQRGEKRRLVELAEQNARQKLEELRLQWLNSEQRAVAGLSEVRDLLGLSALPTRIECFDVSNIQGSHAVGAMVVFERGEPKKSRYRKFRIKTVQGANDVASIQEILRRRFRRAAMVIGEEEQQSEAQRMNGSVNGPAEADDQEEAEKTDTPGSHADIERQETWAELPDLILIDGGVGQLNGAIQALRDLRFDH-IPVVGVVKGPNRDRFDLLLPGASDVIVLERDSAALRLIRMIDEEADRFAKDYHRKLRSKSATSSRLEEIPGIGPKRRQLLLKRFGSLEGIRNATVDELAAVPGMTRKAAEELKSM 668
>gi|167752742|ref|ZP_02424869.1| hypothetical protein ALIPUT_01003 [Alistipes putredinis DSM 17216] >gi|167659811|gb|EDS03941.1| hypothetical protein ALIPUT_01003 [Alistipes putredinis DSM 17216] (605 aa)
Score = 716, Expect = 2.3e-73, Identities = 182/580 (31%), Positives = 312/580 (53%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRD--LKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN---------KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYD--LITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNS---LEELQKLLDIKDLYR-MEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIV-PIEVAK 584
           +K+++  +P  PG Y + DKNG +IYVGKA  L  R+  YF+++++   K + L  +I  + ++VV+ E ++LLLEN+LI   +P+YN+LL++   +P+I+V +E  PR+  S     +    Y+GP+ +  +++  +  FI  + PLR C+         K     C+ Y +G C GPC+   + ++Y+  +        G  + +   LEK+   AA  L FE +Q+Y      L  +S +  I+ ++  D D+      ++V      +  +GS++  Y   L T   ++  ++L   I      IA  L K V +       +       + F  P +G K D+++ +  +A  I + + L+ +  +N E ++   +  +QK L +    R +E FDNSN+  TN V + VV+ +G  ++ EYR FNIK      D+  M+E+++RRY    A   E+P+LIIVDGGK Q+ +A   L  L ++  +P++GLA   K   +     D     L +  +    + +I+DE HRF I+F+R K+SK    + L  I+ +G   IE LL  + T++KI+ A  EELS +V P + A+
  S:     9 LKEQVALLPLSPGVYQFLDKNGAIIYVGKAKSLRKRVSSYFMQNKEHSAKVQVLVRQIAAIRHIVVDTETDALLLENSLIKTLQPRYNILLKDDKTYPWIVVRREPFPRV-QSTRILNRDGSQYFGPYGSVMMQR-SILEFIREVIPLRTCSLNLSPAAIAKGRYSVCLQYHLGNCKGPCVGAQSEEEYDALVDMTVSILKGDLRPVRTYLEKEMEAAARNLKFEVAQRYKTRLDALDNYSSKSVIVSARIVDVDVFSLLVDDDVAYCNFLRIRHGSVVGVYTIRLTTGIDTDPAQMLTLAIQHIAETIAGTLAKEVIVPYLPSAAQLFD---GVTFTVPKRGEKLDLLEFSLKSA-RIYRAEQLKNLEIKNPERHTERLMAAMQKELHLDRPPRHIECFDNSNLQGTNPVASCVVFRDGKPSRKEYRHFNIKTVIGADDFASMREIVFRRYSRLIAEGAELPDLIIVDGGKGQLSSAYAVLCELGIEKQVPIVGLA---KRIEEIFFPGDPMPYYLSRTGEPLKVVCHIRDEAHRFGITFHRQKRSKGFIHSELENIEGVGPKTIELLLRHFRTVEKIRTAPAEELSALVGPAKAAR 597
>gi|153938122|ref|YP_001392736.1| excinuclease ABC subunit C [Clostridium botulinum F str. Langeland] >gi|189038038|sp|A7GIX6|UVRC_CLOBL UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|152934018|gb|ABS39516.1| excinuclease ABC, C subunit [Clostridium botulinum F str. Langeland] (618 aa)
Score = 716, Expect = 2.5e-73, Identities = 200/570 (35%), Positives = 329/570 (57%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR--DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK------LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLIT--VFYSELDEILLTLIYEYYSKIAIELPKTVYL-SLSDEKLK----TLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +LK +P KPG YL K+  G +IYVGKA  L NR++QYF K +    K K +   I + +Y++ ++E E+L+LE NLI KY+PKYN+LL++   +P+I VT  E+ PR++ +   TK     Y+GP+ + +  K ++   I + FP+R C K         + C+ Y IG C  PC + + + +Y   + ++    SGK   I E  +    +AAE L FE +    +    ++   E+Q II +  ++ED I  Y         +F   NG ++ +   I    F +    ++   + E+Y   A  +PKT+Y+ ++ DE L     TL +  K     P KG KK+++     NA   ++N  L+ +  +    N L++L+ +L +++   R+E FD SNI   + VG+MVV+E G    ++YR+F I       DY  MKE++ RR+++               ++  F   P+LI++DGGK Q+  ALE L    +D  IPV G+ KD+KH+T  ++ ++  EI ++K   +  F+  +QDEVHRFAIS++R+ + K+ F + L  I N+G+ R + LL  ++++D IK+A+ EEL  I
  S:     7 QLKNLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYIITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVVSTRKVTKD-GSKYFGPYVDGSSVK-DIIELIKKTFPIRTCKKNIVEGAKAIRPCLNYQIGLCKAPCAQYIKKSEYREIIDDVIKLLSGKHLDIVENFKLNMERAAENLEFEKAAMLRDKINIIEKIGEKQKIILNNFDNEDYISLYSDGKDTCFQVFFLRNGKIVGREHFIIEDTFDTNSSTLISNFLKEFYGGTAY-IPKTIYVPNIEDEALLEQWLTLKKESKSTIKIPIKGEKKNILVLVEKNAKTTLENFKLKYLQEKALYDNVLKDLKNILRLQEEPIRIEAFDISNIQGFDSVGSMVVFEKGRAKPSDYRRFKINTVKGADDYKSMKEILTRRFQHGLSEIKSIQDRKLEFSSGKFSVFPDLILMDGGKGQINIALEVLNTFNID--IPVCGMVKDNKHRTRGLI-YNGEEIIINKYGSVMKFITRVQDEVHRFAISYHRSLRGKNSFHSLLDDIPNIGEKRKKDLLFNFKSIDNIKKATYEELLSI 602
>gi|168334892|ref|ZP_02693013.1| excinuclease ABC, C subunit [Epulopiscium sp. 'N.t. morphotype B'] (602 aa)
Score = 716, Expect = 2.5e-73, Identities = 205/575 (35%), Positives = 332/575 (57%)
  Q:    12 IPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRD--LKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK-LP-----NKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLI--TVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           +P  PG YL KD    VIYVGKA +L NR+ QYF K+++   KT K+ + I   +Y+V N E E+L+LE NLI KY PKYN+ L++   +PYI +  K   PRI       K     Y+GP+ ++    +E+   I +++ LR  NK LP     N++C+ + IG+C GPCIK +T ++Y   + EI +F SG  +    +L+++  +A++ + FE +    +    +    ++Q +  + K+++DI+ +    N   I ++   +G L+ +   I       E   +    I  +Y++ A  +P+ + + +   +++ L   L      ++   +P KG K ++++ A  NA      +  QL         +L +LQ+ L++ K + R+E FD SN      VGAMVV+ENGV  K++YRKF IK     +DY  M+E++ RRYKN  A  G++P++I +DGGK QV AA + L    L+  I V G+ KD+KH+T  ++  D +EI L K S L+  +  IQDEVHRFAI ++R  K +    + L +IK +G  R + LL  ++++  +KEAS+EEL Q +P +VAK +
  S:     4 LPTTPGVYLMKDDLDEVIYVGKAKNLKNRVSQYFQKNKNHSAKTIKMVSNIASYEYIVTNTEVEALILECNLIKKYSPKYNIRLKDDKRYPYIKINIKSPFPRIQVVRKIIKD-DAKYFGPYTDAT-SMWEMIELIKQLWQLRSXNKKLPKDIGKNRECLNFHIGRCSGPCIKNITAREYHKIVDEIVEFLSGDYRKXVTELKQRMSEASDAMNFELAATLRDQLIAIAKLEQKQTVDTASKDNQDIVAYAEGTNDALIQVYFVRSGKLVGREHFILRDATGDEAKTLFRNFILXFYAE-ATFVPREIVVQVIPAEVELLENYLSDKRGARVVITSPKKGTKFNLLELAKKNAELTFFEQGDQLKKKLENTKLALSQLQEALNLEKPIIRIEAFDISNTSGVYPVGAMVVFENGVPKKSDYRKFKIKTVRGQNDYAAMEEMLSRRYKN--AEEGKVPDMIFMDGGKSQVAAAKKVLVKYNLE--ILVCGMVKDEKHRTFGLLYED-NEIVLPKFSKLFKLVTRIQDEVHRFAIEYHR--KLRGNIHSVLDEIKGVGPVRKKILLLNFKSVYNLKEASLEELEQYIPKDVAKNV 586
>gi|168178938|ref|ZP_02613602.1| excinuclease ABC, C subunit [Clostridium botulinum NCTC 2916] >gi|182670244|gb|EDT82220.1| excinuclease ABC, C subunit [Clostridium botulinum NCTC 2916] (618 aa)
Score = 716, Expect = 2.6e-73, Identities = 200/570 (35%), Positives = 329/570 (57%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR--DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK------LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLIT--VFYSELDEILLTLIYEYYSKIAIELPKTVYL-SLSDEKLK----TLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +LK +P KPG YL K+  G +IYVGKA  L NR++QYF K +    K K +   I + +Y++ ++E E+L+LE NLI KY+PKYN+LL++   +P+I VT  E+ PR++ +   TK     Y+GP+ + +  K ++   I + FP+R C K         + C+ Y IG C  PC + + + +Y   + ++    SGK   I E  +    +AAE L FE +    +    ++   E+Q II +  ++ED I  Y         +F   NG ++ +   I    F +    ++   + E+Y   A  +PKT+Y+ ++ DE L     TL +  K     P KG KK+++     NA   ++N  L+ +  +    N L++L+ +L +++   R+E FD SNI   + VG+MVV+E G    ++YR+F I       DY  MKE++ RR+++               ++  F   P+LI++DGGK Q+  ALE L    +D  IPV G+ KD+KH+T  ++ ++  EI ++K   +  F+  +QDEVHRFAIS++R+ + K+ F + L  I N+G+ R + LL  ++++D IK+A+ EEL  I
  S:     7 QLKNLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYIITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVVSTRKVTKD-GSKYFGPYVDGSSVK-DIIELIKKTFPIRTCKKNIVEGAKAIRPCLNYQIGLCKAPCAQYIKKSEYREIIDDVIKLLSGKHLDIVENFKLNMEKAAENLEFEKAAMLRDKINIIEKIGEKQKIILNNFDNEDYISLYSDGKDTCFQVFFLRNGKIVGREHFIIEDTFDTNSSTLISNFLKEFYGGTAY-IPKTIYVPNIEDEALLEQWLTLKKESKSTIKIPIKGEKKNILVLVEKNAKTTLENFKLKYLQEKALYDNVLKDLKNILRLQEEPIRIEAFDISNIQGFDSVGSMVVFEKGRAKPSDYRRFKINTVKGADDYKSMKEILTRRFQHGLSEIKSIQDRKLEFSSGKFSVFPDLILMDGGKGQINIALEVLNTFNID--IPVCGMVKDNKHRTRGLI-YNGEEIIINKYGSVMKFITRVQDEVHRFAISYHRSLRGKNSFHSLLDDIPNIGEKRKKDLLFNFKSIDNIKKATYEELLSI 602
>gi|160883396|ref|ZP_02064399.1| hypothetical protein BACOVA_01365 [Bacteroides ovatus ATCC 8483] >gi|156111116|gb|EDO12861.1| hypothetical protein BACOVA_01365 [Bacteroides ovatus ATCC 8483] (611 aa)
Score = 715, Expect = 3.2e-73, Identities = 199/587 (33%), Positives = 335/587 (57%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKC--NKLPN-------KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYV-NGSLLSKYDL-ITVFYSELDEILLTL----IYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQL--ISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIV-KWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           NE +K  +  +P KPG Y + +  G +IYVGKA +L  R+  YF K+ +  KT+ L ++I D+ Y+VVN E ++LLLENNLI KYKP+YN+LL++   +P I V  E  PR+  +    +    +YYGP+++     Y + + I  ++PLR C  N  P          C+ Y I  C GPCI   +++DY   + EI +   G ++ I   L ++    A ++ FE++QK  E    ++ +  + +++ +  ++ D+      E+  + + + ++ NG++   +        +E  E LLTL    + E Y   + E+     L L         E   I F  P +G KK ++D +  N  +   ++  Q   ++ + R +  ++E+Q+ L + +   ++E FDNSNI  ++ V A VV++    +K +YRK+NIK      DY  MKEV+ RRY+        +P+LII DGGK Q++   E ++  EL+  IP+ GLAKD++H+T  ++  +    I + ++S L+  L  IQDEVHRFAISF+R+K+SK    ++L  IK +G+     LL++++++ +IKEAS EE+S ++    AK +K+
  S:    10 NEYLKGIVANLPEKPGIYQYLNTEGTIIYVGKAKNLKKRVYSYFSKEHEPGKTRVLVSKIADIRYIVVNTEEDALLLENNLIKKYKPRYNVLLKDDKTYPSICVQNEYFPRVFRTRKIIRN-GSSYYGPYSHIP-SMYAVLDLIKHLYPLRTCSLNLTPENIRAGKFNVCLEYHIKNCAGPCIGLQSQEDYLKNIDEIKEILKGNTQEISRMLLERMQTLAGEMKFEEAQKVKEKYLLIENYRSKSEVVSAVLHNIDVFSIEEDESNSAFINYLHITNGAINQAFTFEYKKKLNESKEELLTLGIIEMRERYKSQSREIIVPFELDL---------ELNNIVFTVPQRGDKKKLLDLSILNVKQYKADRLKQAEKLNPEQRSMRLMKEIQQELHLDRPPLQIECFDNSNIQGSDAVAACVVFKKAKPSKKDYRKYNIKTVVGPDDYASMKEVVRRRYQRAIEENTPLPDLIITDGGKGQMEVVREVIED-ELNLTIPIAGLAKDNRHRTSELLFGFPPQTIGIKQQSPLFRLLTQIQDEVHRFAISFHRDKRSKRQVASALDNIKGIGEKTKTALLKEFKSVKRIKEASFEEISAVIGEAKAKTVKE 604
>gi|148381321|ref|YP_001255862.1| excinuclease ABC subunit C [Clostridium botulinum A str. ATCC 3502] >gi|153931930|ref|YP_001385697.1| excinuclease ABC subunit C [Clostridium botulinum A str. ATCC 19397] >gi|153936269|ref|YP_001389103.1| excinuclease ABC subunit C [Clostridium botulinum A str. Hall] >gi|148290805|emb|CAL84939.1| excinuclease ABC subunit C [Clostridium botulinum A str. ATCC 3502] >gi|152927974|gb|ABS33474.1| excinuclease ABC, C subunit [Clostridium botulinum A str. ATCC 19397] >gi|152932183|gb|ABS37682.1| excinuclease ABC, C subunit [Clostridium botulinum A str. Hall] (618 aa)
Score = 715, Expect = 3.4e-73, Identities = 200/570 (35%), Positives = 329/570 (57%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR--DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK------LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLIT--VFYSELDEILLTLIYEYYSKIAIELPKTVYL-SLSDEKLK----TLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +LK +P KPG YL K+  G +IYVGKA  L NR++QYF K +    K K +   I + +Y++ ++E E+L+LE NLI KY+PKYN+LL++   +P+I VT  E+ PR++ +   TK     Y+GP+ + +  K ++   I + FP+R C K         + C+ Y IG C  PC + + + +Y   + ++    SGK   I E  +    +AAE L FE +    +    ++   E+Q II +  ++ED I  Y         +F   NG ++ +   I    F +    ++   + E+Y   A  +PKT+Y+ ++ DE L     TL +  K     P KG KK+++     NA   ++N  L+ +  +    N L++L+ +L +++   R+E FD SNI   + VG+MVV+E G    ++YR+F I       DY  MKE++ RR+++               ++  F   P+LI++DGGK Q+  ALE L    +D  IPV G+ KD+KH+T  ++ ++  EI ++K   +  F+  +QDEVHRFAIS++R+ + K+ F + L  I N+G+ R + LL  ++++D IK+A+ EEL  I
  S:     7 QLKNLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYIITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVISTRKVTKD-GSKYFGPYVDGSSVK-DIIELIKKTFPIRTCKKNIVEEAKAIRPCLNYQIGLCKAPCAQYIKKSEYRETIDDVIKLLSGKHLDIVENFKLNMEKAAENLEFEKAAMLRDKINIIEKIGEKQKIILNNFDNEDYISLYSDGKDTCFQVFFLRNGKIVGREHFIIEDTFDTNSSTLISNFLKEFYGGTAY-IPKTIYVPNIEDEALLEQWLTLKKESKSTIKIPIKGEKKNILVLVEKNAKTTLENFKLKYLQEKALYDNVLKDLKNILRLQEEPIRIEAFDISNIQGFDSVGSMVVFEKGRAKPSDYRRFKINTVKGADDYKSMKEILTRRFQHGLSEIKSIQDRKLEFSSGKFSVFPDLILMDGGKGQINIALEVLNAFNID--IPVCGMVKDNKHRTRGLI-YNGEEIIINKYGSVMKFITRVQDEVHRFAISYHRSLRGKNSFHSLLDDIPNIGEKRKKDLLFNFKSIDNIKKATYEELLSI 602
>gi|163812347|ref|ZP_02204021.1| excinuclease ABC, C subunit [Dehalococcoides sp. VS] >gi|157404001|gb|EDO70047.1| excinuclease ABC, C subunit [Dehalococcoides sp. VS] (607 aa)
Score = 714, Expect = 4.0e-73, Identities = 198/588 (33%), Positives = 334/588 (56%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL-PNKK---CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTV-YLSLSDEKL--KTLSESL--KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIK-DLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY----KNNTA-SFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE--VAKEIKKL 589
           +E +++++  +P  PG YL K+  G +IYVGKA  L +R+K YF     L  KT++L ++I +++Y++  +E E+L+LE NLI +++P +N+ L++   FPY+ +T  E+ PRI Y   S     G Y+GPFA++   ++ L   +  +F  R CN+  P K+   C+ YDI QCL PC  K+++QDY+  + +   F  GK   + + L K   +A+ +L +E +    +   ++K   E Q +      ++D I F  + ++  + +F    G L+ +  + L      +  +IL   + ++Y       PK V    LSD ++  K LSE    K++     +G  KD+++    NA E +K   ++ +S+     ++LEELQ  L +     R+E +D SNI  TN VG+MVV+ENG   K  YR+F IK      D+  +KEVI RR+    K+N   SF   P+L+++DGGK Q+ +  E+L  L L+    VIGLAK+ +   +  +    + I+L   S     L  ++DE HRFA+ ++ N + KS   ++L  I  +G +R   L++ + ++  I++AS++ELSQ+  I   +A  IK+L
  S:     3 SETLQNQIASLPENPGVYLMKNAQGEIIYVGKAAVLKDRVKSYFAPPSRLEPKTRQLVSQINELEYLITGSEQEALILELNLIKRHRPYFNVRLKDDKGFPYLKITLNEKWPRI-YITRSMADDGGRYFGPFASTRSVRHTL-QVLKELFRFRSCNRTEPEKRSRPCLEYDIHQCLSPCTGKISKQDYDHLISQAILFLEGKQDKVLKLLNKLMNEASARLDYETAALRRDQISSIKEVIEGQQLAARVSGEQDAIAFAQEGDLSMVQVFFIRRGKLIGRESFSLQGTREEKPGDILSEFVKQFYHSSTQIPPKIVTQYPLSDREILEKWLSERRGGKVQITAGLRGQPKDLINIVAENAREQLKQARIKNLSSAVTLTDALEELQTALGLPLPPQRIEGYDISNIQGTNAVGSMVVFENGKPQKAHYRRFRIKTVKGADDFSMLKEVISRRFGRLNKDNAGESFARRPSLMLIDGGKGQLSSVKETLDTLGLEG-QAVIGLAKEFE---EIYLPGKSAPIRLTANSPALQLLQRVRDEAHRFALGYHLNIRHKSGLTSTLDGIPGIGPSRRRLLIKTFGSVAGIRQASLDELSQVKGINQALALSIKEL 606
>gi|167764034|ref|ZP_02436161.1| hypothetical protein BACSTE_02417 [Bacteroides stercoris ATCC 43183] >gi|167698150|gb|EDS14729.1| hypothetical protein BACSTE_02417 [Bacteroides stercoris ATCC 43183] (606 aa)
Score = 713, Expect = 6.3e-73, Identities = 200/586 (34%), Positives = 335/586 (57%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK---------CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIK---FLNPSKGVKKDVMDTAFNNAVEIMKNKYLQL--ISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIV-KWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIK 587
           N+ +K  +  +P  PG Y + +  G +IYVGKA +L  R+  YF ++ +  KT+ L ++I D+ Y+VVN E ++LLLENNLI KYKP+YN+LL++   +P I V  E  PR+  +    +    +YYGP+++     Y + + I  ++PLR CN   + +         C+ Y I  C GPCI K  +++Y   + EI +   G ++ I+  L ++  + A ++ FE++QK  E    L+ +  + +++ +  ++ D+  F  +E+      F  +N   ++   +   F  E  + L     E  S   IE+ +  Y SLS E +      +++K   F  P +G KK +++ +  N  +   ++  Q   ++ + R +  L+E+Q+ L +  L  R+E FDNSNI  ++ V   VV+  G  +K +YRK+NIK  +   DY  MKEV+ RRY+        +P+L+I DGGK Q+ A  E +  L LD  IP+ GLAKD KH+T  ++  +    I L + S L+  L  IQDEVHRFAI+F+R+K+SK    ++L +IK +G+     LL++++++ +IKEAS E++ +++    AK IK
  S:     7 NDYLKGIVLNLPESPGIYQYLNAEGTIIYVGKAKNLKRRVSSYFNREHEPGKTRVLVSKIADIRYIVVNTEEDALLLENNLIKKYKPRYNVLLKDDKTYPSICVQNEYFPRVFKTRRIIRN-GSSYYGPYSHIP-SMYAVLDLIKHLYPLRTCNLNLSPENIRAGKFNVCLEYHIKNCAGPCIGKQNQEEYLKNIAEIKEILKGNTQEIERMLYQQMQELAAEMKFEEAQKIKEKYLLLENYRSKSEVVSNVLHNIDV--FSIEEDTDEKSAF--INYLHITNGAINQAFTFEYKKRLNETKEELLSLGIIEM-RERYKSLSREIIVPFELDMELKDVIFTIPQRGDKKKLLELSILNVKQYKADRLKQAEKLNPEQRTVRLLKEIQQELHLDRLPMRIECFDNSNIQGSDPVAGCVVFIKGKPSKKDYRKYNIKTVEGPDDYTSMKEVVKRRYQRAIEENAPLPDLLITDGGKGQMSAVKEVVDELNLD--IPIAGLAKDGKHRTSELLYGFPPQTIGLKQNSPLFRLLTQIQDEVHRFAITFHRDKRSKRQIASALDEIKGIGEKTKNALLKEFKSVKRIKEASAEDIVKVIGEAKAKIIK 600
>gi|57234009|ref|YP_181929.1| excinuclease ABC, C subunit [Dehalococcoides ethenogenes 195] >gi|90111066|sp|Q3Z770|UVRC_DEHE1 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|57224457|gb|AAW39514.1| excinuclease ABC, C subunit [Dehalococcoides ethenogenes 195] (607 aa)
Score = 712, Expect = 6.8e-73, Identities = 200/588 (34%), Positives = 334/588 (56%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL-PNKK---CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTV-YLSLSDEKL--KTLSESL--KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIK-DLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY----KNNTA-SFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLN---------IQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE--VAKEIKKL 589
           +E +++++  +P  PG YL K+  G +IYVGKA  L +R+K YF+    L  KT++L ++I +++Y++  +E E+L+LE NLI +++P +N+ L++   FPY+ +T  E+ PRI Y   S     G Y+GPFA++   ++ L   +  +F  R CN+  P K+   C+ YDI QCL PC  K+++QDY+  + +   F  GK   + + L K   +A+ +L +E +    +   ++K   E Q +      ++D I F  + ++  + +F    G L+ +  + L      +  +IL   + ++Y       PK V    LSD ++  K LSE    K++     +G  KD+++    NA E +K   ++ +S+     ++LEELQ  L +     R+E +D SNI  TN VG+MVV+ENG   K  YR+F IK      D+  +KEVI RR+    K+N   SF   P+L+++DGGK Q+ +  E+L  L L+    VIGLAK            +F EI L  KS+    + N         ++DE HRFA+ ++ N + KS   ++L  I  +G +R   L++ + ++  I++AS++EL Q+  I   +A  IK+L
  S:     3 SETLQNQIASLPENPGVYLMKNAQGEIIYVGKAAVLKDRVKSYFVPPSRLEPKTRQLVSQINELEYLITGSEQEALILELNLIKRHRPYFNVRLKDDKGFPYLKITLNEKWPRI-YITRSMADDGGRYFGPFASTRSVRHTL-QVLKELFRFRSCNRTEPEKRSRPCLEYDIHQCLSPCTGKISKQDYDHLISQAILFLEGKQDKVLKLLAKLMNEASARLDYETAALRRDQISSIKEVIEGQQLAARVSGEQDAIAFAQEGDLSMVQVFFIRRGKLIGRESFSLQGTREEKPGDILSEFVKQFYHSSTQIPPKIVTQYPLSDREILEKWLSERRGGKVQITAGLRGQPKDLINIVAENAREQLKQARIKNLSSAATLTDALEELQTALGLPLPPQRIEGYDISNIQGTNAVGSMVVFENGKPQKAHYRRFRIKTVKGADDFSMLKEVISRRFGRLNKDNAGESFARRPSLMLIDGGKGQLSSVKETLDTLGLEG-QAVIGLAK------------EFEEIYLPGKSEPIRLMANSPALQLLQRVRDEAHRFALGYHLNIRHKSGLTSALDGIPGIGPSRRRLLIKTFGSVSGIRQASLDELLQVKGINQALALSIKEL 606
>gi|187934936|ref|YP_001887530.1| excinuclease ABC, C subunit [Clostridium botulinum B str. Eklund 17B] >gi|187723089|gb|ACD24310.1| excinuclease ABC, C subunit [Clostridium botulinum B str. Eklund 17B] (626 aa)
Score = 712, Expect = 7.0e-73, Identities = 209/569 (36%), Positives = 335/569 (58%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL------PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLI--TVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLN------PSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           K++LK +P +PG YL K+  G VIYVGKA  L NR++QYF   K+   K K +   I + +Y++ ++E E+L+LE NLI KY P+YN+LL++   +P+I VT  EE P+I  +    K     Y+GP+ N     YE  N I +IFP+R C K       P + C+ Y I +C  PC   +++ +Y   + E+ +  SGK+K +  +L+K    A++ L FE +    +    +    E+Q +  SQ+ DED I  Y  E    + +F   +G +  +   I     Y E   IL   +  +Y     ++PK +Y+   ++  + L E LKIK  +      P KG KK++++   NNA   ++    +L+ ++      LEEL++LL++ D+  R+E FD SNI   + VG+M+V+ENG    ++YR+F+IK+    ++YD M+E++ RR+ +               +   F   P+LI++DGGK QV  A E L   +LD  IPV GL KDD+H T R + ++  EI +++ S+L  F+  +QDEVHRFAI+++R+ + K    + L  I N+G+ R   LL K+ +++ IK A +EEL
  S:     7 KNQLKILPDEPGVYLMKNSLGEVIYVGKAKILKNRVRQYFQNSKNHSEKVKAMVKNISEFEYIITDSEMEALILECNLIKKYSPRYNILLKDDKFYPFIKVTINEEFPKIFITRKYAKD-GNKYFGPYTNI-ASVYETMNLIKKIFPIRTCKKTITEGGNPTRPCLNYHIKKCNAPCAGYISKDEYRNMISEVMELLSGKNKDLVNKLQKDMEDASKSLEFEKAASLRDKIIAINNIVEKQKVFKSQEGDEDFINLYKDEKDCCVQVFFLRDGKVTGREHFILENSTYQEESSILSQFMISFYGGTP-KVPKHIYIP-KEQDTEILEEFLKIKRGSKVNVKVPKKGSKKEMLELVKNNAKLTLEQFKEKLLMDKKINRGCLEELKELLNLDDIPNRIESFDISNIQGVDSVGSMIVFENGKAKNSDYRRFSIKNVKNGNEYDSMREILERRFVHGLKEVKEIQERNLQFSNGKFSNFPDLIMMDGGKGQVNVAKEVLN--KLDIQIPVCGLVKDDRHST-RGIIYNNEEIIINRSSNLMQFIRRVQDEVHRFAITYHRSLRDKRTLHSILEDIPNIGEKRRRALLMKFGSVENIKNAKLEEL 601
>gi|168181969|ref|ZP_02616633.1| excinuclease ABC, C subunit [Clostridium botulinum Bf] >gi|182674896|gb|EDT86857.1| excinuclease ABC, C subunit [Clostridium botulinum Bf] (618 aa)
Score = 711, Expect = 8.4e-73, Identities = 199/574 (34%), Positives = 331/574 (57%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR--DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK------LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLIT--VFYSELDEILLTLIYEYYSKIAIELPKTVYL-SLSDEKLK----TLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE 581
           +LK +P KPG YL K+  G +IYVGKA  L NR++QYF K +    K K +   I + +Y++ ++E E+L+LE NLI KY+PKYN+LL++   +P+I VT  E+ PR++ +   TK     Y+GP+ + +  K ++   I + FP+R C K         + C+ Y IG C  PC + + + +Y   + ++    SGK   I E  +    +AA  L FE +    +    ++   E+Q II +  ++ED I  Y         +F   NG ++ +   I    F +    ++   + E+Y   A  +PKT+Y+ ++ DE L     TL +  K     P KG KK+++D    NA   ++N  L+ +  +    N L++L+ +L +++   R+E FD SNI   + VG+MVV+E G    ++YR+F I       DY  MKE++ RR+++               ++  F   P+LI++DGGK Q+  ALE L    ++  IPV G+ KD+KH+T  ++ ++  EI ++K   +  F+  +QDEVHRFAIS++R+ + K+ F + L  I N+G+ R + LL  ++++D IK+A+ EEL  I  ++
  S:     7 QLKNLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYIITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVISTRKVTKD-GSKYFGPYVDGSSVK-DIIELIKKTFPIRTCKKNIVEGAKAIRPCLNYQIGLCKAPCAQYIKKSEYREIIDDVIKLLSGKHLDIVENFKLNMEKAAGNLEFEKAAMLRDKINIIEKIGEKQKIILNNFDNEDYISLYSDGKDTCFQVFFLRNGKIVGREHFIIEDTFDTNSSTLISNFLKEFYGGTAY-IPKTIYVPNIEDEVLLEQWLTLKKESKSTIKIPIKGEKKNILDLVEKNAKTTLENFKLKYLQEKALYDNVLKDLKNILRLQEEPIRIEAFDISNIQGFDSVGSMVVFEKGRAKPSDYRRFKINTVKGADDYKSMKEILTRRFQHGLSEIKSIQDRKLEFSSGKFSVFPDLILMDGGKGQINIALEVLNTFNIN--IPVCGMVKDNKHRTRGLI-YNGEEIIINKYGSVMKFITRVQDEVHRFAISYHRSLRGKNSFHSLLDDIPNIGEKRKKDLLFNFKSIDNIKKATYEELLSISSMD 606
>gi|193213289|ref|YP_001999242.1| excinuclease ABC, C subunit [Chlorobaculum parvum NCIB 8327] >gi|193086766|gb|ACF12042.1| excinuclease ABC, C subunit [Chlorobaculum parvum NCIB 8327] (629 aa)
Score = 710, Expect = 1.1e-72, Identities = 186/586 (31%), Positives = 324/586 (55%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD--RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN-KLPNKK--------CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL-SKYDLIT-VFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTL----------SESLKIKFLNPSKGVKKDVMDTAFNNAV----EIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           E + +KL  +P  PG Y + +  G VIYVGKA +L NR++ YF     +  KT  L + I D++ ++ ++E E+L+LENNLI + KP+YN+ L++  ++PY+++T E  PRI  +    ++    Y+GP+  ++  +  L + I  IFP+R C  KL  +         C+ Y I +C GPC    + ++Y+  ++EI     GK+ ++   L  +  Q A +L FE++       + LK ++ERQ ++ ++  D D+      E     VIF+   G L+ S++  +T    + L  +L + +  YY +    +P+ ++L     + +            +   +++F  P  G K  ++    +NA     E M  K L+     +R+  +LE L+++L +  L  R+E FDNS+   T+ V +MV +  G   K++YRKF +K  + + DY  M+E + RRY    A    +P+L+++DGGK QV  A ++L+ L +D  +PV GLA   K   +  V  +     L K S     L  ++DE HRFAI+++R  +S       L  IK +G+   EKLL ++ +++ + +AS+EELS++   + A+ I +
  S:    15 ETLAEKLASLPTSPGVYRFSNAAGTVIYVGKARNLRNRVRSYFNSQGRQPGKTAVLVSHIADLNVIITSSEVEALILENNLIKELKPRYNVNLKDDKSYPYVVITNERFPRIFLTR-QVRRDGSQYFGPYTEASQLRLIL-DLIGSIFPVRSCKYKLTEEAVAAGKYRVCLDYHIHKCKGPCEGLQSEEEYQAMIREIVTLLKGKTSALVRDLTAEMQQKAAELKFEEAATLKAQIEGLKRYAERQKVVSNEPVDRDVFAIATGEEDACGVIFRIREGKLIGSRHTYLTNTGNTPLPNLLASFLEHYYLETPDLIPQEIFLQAELPEEELEALRQLLASRQTGQRQVRFTVPRIGEKAQLIAMCLDNAEHHLHEFMVQKRLR--GEMSRKSPALESLKQVLHLDKLPERIECFDNSHFQGTDYVSSMVTFVLGKPKKSDYRKFKLKSFEGSDDYAAMQEAVTRRYSGTLAEELPMPDLVLIDGGKGQVNVAWKALQELGID--VPVAGLA---KRLEEIFVPNERDPYNLPKTSPALKLLQQLRDEAHRFAITYHRKLRSDRTIRTELTGIKGVGEKSAEKLLSRFGSVETVAKASIEELSEVTGRKTAESIYR 619
>gi|160888680|ref|ZP_02069683.1| hypothetical protein BACUNI_01097 [Bacteroides uniformis ATCC 8492] >gi|156861994|gb|EDO55425.1| hypothetical protein BACUNI_01097 [Bacteroides uniformis ATCC 8492] (606 aa)
Score = 710, Expect = 1.4e-72, Identities = 198/586 (33%), Positives = 333/586 (56%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKC--NKLPNK-------KCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIK---FLNPSKGVKKDVMDTAFNNAVEIMKNKYLQL--ISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIV-KWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIK 587
           N+ +K  +  +P  PG Y + +  G +IYVGKA +L  R+  YF ++ +  KT+ L ++I D+ Y+VVN E ++LLLENNLI KYKP+YN+LL++   +P I V  E  PR+  +    +    +YYGP+++     Y L + I  ++PLR C  N  P          C+ Y I  C GPCI K ++++Y   + EI +   G ++ I+  L ++  + A ++ FE++QK  +    L+ +  + +++ +  ++ D+       +  S     +VN   ++   +   F  E  + L     E  S   IE+ +  Y SLS E +      +++K   F  P +G KK +++ +  N  +   ++  Q   ++ + R +  L+E+Q+ L +  L  ++E FDNSNI  ++ V   VV+  G  +K +YRK+NIK  +   DY  MKEV+ RRY+        +P+L+I DGGK Q+ A  E +  L L+  IP+ GLAKD KH+T  ++  +    I L + + L+  L  IQDEVHRFAI+F+R+K+SK    ++L +IK +G+     LL++++++ +I+EAS EEL+ +V    AK I+
  S:     7 NDYLKGIVSNLPESPGIYQYLNTEGTIIYVGKAKNLKRRVSSYFNREHEPGKTRVLVSKIADIRYIVVNTEEDALLLENNLIKKYKPRYNVLLKDDKTYPSICVQNEYFPRVFRTRKIIRN-GSSYYGPYSHIP-SMYALLDLIKHLYPLRTCHLNLSPENIRARKFNVCLEYHIKNCAGPCIGKQSQEEYLKNIAEIKEILKGNTQEIERMLFQQMQELAAEMKFEEAQKIKKKYLLLENYRAKSEVVSNVLHNIDVFSIEEDSDEKS----AFVNYLHITNGAINQAFTFEYKKRLNESKEELLSLGIIEM-RERYKSLSREIIVPFELDMELKDVVFTIPQRGDKKKLLELSILNVKQYKADRLKQAEKLNPEQRTVRLLKEIQQELHLDRLPMQIECFDNSNIQGSDPVAGCVVFVKGKPSKKDYRKYNIKTVEGPDDYASMKEVVKRRYQRAIEEKAPLPDLLITDGGKGQMSAVKEVIDELGLN--IPIAGLAKDGKHRTSELLYGYPPQTIGLKQNTPLFRLLTQIQDEVHRFAITFHRDKRSKRQIASALDEIKGIGEKTKSALLKEFKSVKRIREASAEELAAVVGEAKAKIIQ 600
>gi|121602255|ref|YP_988831.1| excinuclease ABC subunit C [Bartonella bacilliformis KC583] >gi|120614432|gb|ABM45033.1| excinuclease ABC, C subunit [Bartonella bacilliformis KC583] (658 aa)
Score = 709, Expect = 1.7e-72, Identities = 199/582 (34%), Positives = 312/582 (53%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK--LPNKK--CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIF------KYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK---------------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           I++ +K +PHKPG Y   ++ G V+YVGKA +L  R+  Y  +   + +  ++      +++VV + E E+LLLE NLI + +P++N+LLR+  +FPYI++T +     LY H   +  K  Y+GPFA+++    +  N + R F LR C    L N+   C+ Y I +C  PC  ++   DY   +KE   F SGKS+SI + + +   +AAE L FE +  Y +    L      Q I      + D+     +  +  I +F       + N +   K D    F S   EIL + I ++Y    I  PK + LS   E+   L+E+L      KI    P  G +K +++ A+ NA E +  K L   S   +   +L E+ +L    +  R+E++DNS+I  TN VG M+V       KN+YRKFNI+  D     D   MKEVI RR+                 +  SF   P+LI++DGG+ Q       L  L +D ++ V+G+AK  D +   +R          L  +  + +FL  ++DE HRFAI  +R K+ K  F+N L +I N+G TR   LL  + +   I  ASVE+L+++  + I +A+ I
  S:    44 IQEFVKHLPHKPGVYRMFNEYGDVLYVGKARNLKKRVSNYTHEHGHNNRIIRMIRATSHMEFVVTHTEIEALLLEANLIKRLQPRFNILLRDDKSFPYIIITDDHRIPALYKHRGARTRKAHYFGPFASASAVT-QTINVLQRAFLLRTCTDSVLENRTRPCLLYQIKRCSAPCTNEINNSDYIKLVKEARAFLSGKSQSIKQDMVQAMHKAAENLDFERAANYRDRLSALSHVQSHQGINPRTIEEADVFAIAQQGGITCIQVFFFRMGQNWGNQAYFPKAD--PSFSSA--EILASFIAQFYDNKPI--PKLILLSEEIEEAVLLTEALSLKAHCKISLSLPRNGERKTLINHAYTNAHEALGRK-LSETSTYTKLFQNLAEIFQLPRTPN--RLEVYDNSHIMGTNAVGIMIVANQTGFIKNQYRKFNIRSTDITPGDDLGMMKEVIERRFSRLIKTYGLPTQNKDIEDENSFPMWPDLILIDGGEGQTNIVRTILSKLGVDDLVTVVGIAKGTDREAGRERFFIQGKPSFTLSPRDPILYFLQRLRDEAHRFAIGTHRTKRKKETFKNPLDEINNIGPTRKRALLNYFGSTKAIANASVEDLTKVSGISITIAQNI 653
>gi|167750941|ref|ZP_02423068.1| hypothetical protein EUBSIR_01926 [Eubacterium siraeum DSM 15702] >gi|167656120|gb|EDS00250.1| hypothetical protein EUBSIR_01926 [Eubacterium siraeum DSM 15702] (585 aa)
Score = 709, Expect = 1.8e-72, Identities = 192/565 (33%), Positives = 309/565 (54%)
  Q:    22 KDKNGIVIYVGKAVDLANRIKQYF--LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL------PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYR-MEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYR---RYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAKEI 586
           KDK G +IYVGKA  L NR+  YF  L+  + KT+KL   I D D++V  +E ++L+LE +LI +Y PKYN+LL++   + YI +TKE +PRI Y+ +   K    Y GPF +    K +  + +NRIF    C+K+        + C+ Y I +C+G C  K+ + +Y   +    ++    SK+  E+L ++  +A+E L FE + K  +    ++   + QDI   +  D D++       + SI +  Y  G +  K +       +  ++    + EYYS     +PK +Y+    E    L E        K+      +G     +  A  NA E +  K    +    +E+N+LE+L KLL +  +   +E +D SN+   ++VG M+VY NG   K  YRKF IK+    +DY  M+EV+ R   RY +   SF  +P+LI++DGGK  V A  + L  + +   IP+ GL KDDKH+T R +     EI+++    L+  + NIQDEVHRF++SF +    K  +E  L KIK +G+ +   L++ ++T   +K+AS +E++ +  +  E AKEI
  S:     2 KDKTGRIIYVGKAKALKNRVTTYFHALESHNAKTRKLVENIYDFDFIVTPSELDALVLECSLIKQYNPKYNILLKDDKGYNYIKITKEPYPRISYALNCNDK-NAEYLGPFTSGFTAK-QAVDEVNRIFMFPSCHKVFPRDFRKERPCLNYHIKRCMGVCTGKIKQDEYNSLIHSAIEYMQNGSKASVERLTEQMYEASENLEFEKAAKLRDRINAIEKMKDGQDIFSDKTYDFDVVALAQNVELASIAVMCYRGGRITDKMNFFIGDEYDPGQMRSDFLVEYYSARTDAIPKQIYIDKEMEDSAILEEYFSALCGHKVTVTVAQRGEGLSRVLLAKQNASEYLSMK----VGRTVKEINALEDLAKLLGLPKIPTVIESYDISNLGEDSRVGGMIVYRNGRPYKAGYRKFTIKNVIGQNDYACMQEVLQRRIQRYLDGDESFAPLPDLILLDGGKGHVHAVQQVLDSMNVS--IPLYGLVKDDKHRT-RAIAAQGEEIQINANRKLFSLMTNIQDEVHRFSLSFQQQTHKKKTYELELTKIKGIGEAKALALIKHFKTKQALKDASPDEIASVAKVKEEKAKEI 577
>gi|150009554|ref|YP_001304297.1| excinuclease ABC subunit C [Parabacteroides distasonis ATCC 8503] >gi|149937978|gb|ABR44675.1| excinuclease ABC subunit C [Parabacteroides distasonis ATCC 8503] (611 aa)
Score = 708, Expect = 2.2e-72, Identities = 199/587 (33%), Positives = 324/587 (55%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLP----------NKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQL--ISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSD--LYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           +E IK  L  IP KPGCY + D+NG +IYVGKA +L  R+  YF K  D  KT+ L  +I D+ Y+VV+ E ++LLLENNLI +Y+P+YN+LL++   +P I+V  E  PR+  + +  +     YYGP+ +    K  L   +  ++PLR C K P           K C+ Y I +C GPC    + ++Y+  + EI +   G    I + L ++    A +L FE++QK  E  + ++ +  +  ++    ++ D+      ++   +      NG+++  Y     +   LDE    L+     ++      T    +   KL    E+  + F  P +G KK ++D +  N  +   ++  Q   ++ + R    L+E+Q+ L ++ L   +E FDNSNI  ++ V A VV++ G  +K EYRK+NIK      DY  MKEV+ RRY         +P+LII DGGK Q++  + S+   EL   IP+ GLAKD KH+T  ++ + F  + +  + D  L+  L  IQDEVHRFAI+F+++K+SK+  ++ L  IK +G+     LL  ++++ +IKEAS EEL  ++    AK +++
  S:     6 DEHIKTILSVIPEKPGCYQYFDENGTIIYVGKAKNLKRRVSSYFNKVHDSNKTRVLVKQIRDIKYIVVDTEEDALLLENNLIKQYRPRYNVLLKDDKTYPSIVVKNEYFPRVFQTRNIVRD-GSQYYGPYPSLFTAKVML-QMLKELYPLRTC-KYPLTPESIAQGRYKVCLEYHIKRCKGPCEGLQSLEEYQQNISEIKEILRGNISQISKHLYEEMQSLAAELKFEEAQKIKEKYEVIENYRSKSTVVTPMLHNIDVFTIIENDHSAYVNFMHIGNGAIVQAYTF--EYKKRLDESKEELLSLGIIEMRNRFKSTAREIIVPFKLDMQLEN--VTFTIPQRGDKKKLLDLSEMNVKQFKVDRLKQAEKLNPEQRNTRILKEIQEALHLEKLPAHIECFDNSNIQGSDAVAACVVFKMGKPSKQEYRKYNIKTVVGPDDYASMKEVVRRRYGRAIEERSPLPDLIITDGGKGQME-VVRSVVEDELGLSIPIAGLAKDGKHRTSELL-FGFPPVTVGMRLDSPLFHLLTRIQDEVHRFAITFHKDKRSKTQTKSELDTIKGIGEKTKVLLLRHFKSVKRIKEASFEELKSVIGEAKAKALQE 599
>gi|53711389|ref|YP_097381.1| excinuclease ABC subunit C [Bacteroides fragilis YCH46] >gi|60679707|ref|YP_209851.1| putative excinuclease UvrC protein [Bacteroides fragilis NCTC 9343] >gi|81317219|sp|Q5LIY7|UVRC_BACFN UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|81383989|sp|Q650H7|UVRC_BACFR UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|52214254|dbj|BAD46847.1| excinuclease ABC subunit C [Bacteroides fragilis YCH46] >gi|60491141|emb|CAH05889.1| putative excinuclease UvrC protein [Bacteroides fragilis NCTC 9343] (608 aa)
Score = 706, Expect = 3.6e-72, Identities = 200/587 (34%), Positives = 340/587 (57%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK---------CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFY----SELDEILLTL----IYEYYSKIAIEL--PKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQL--ISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIV-KWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           +E +K  +  +P KPG Y + +  G +IYVGKA +L  R+  YF K+    KT+ L ++I D+ Y+VVN+E ++LLLENNLI KYKP+YN+LL++   +P I V  E  PR+  +    +    +YYGP+++S    + + + I  ++PLR CN   + +         C+ Y I  C GPCI   ++++Y   + EI +   G ++ I   L ++    A ++ FE++QK  E    ++ +  + +++ S  ++ D+  F  +E+        Y++ +  +     T  Y    +E  E LLTL    + E Y   + E+  P  + + L+D           + F  P +G KK +++ +  N  +   ++  Q   ++ + R +  ++E+Q+ L +  L  ++E FDNSNI  T+ V A VV++    +K++YRK+NIK      DY  MKEV+ RRY+        +P+LII DGGK Q++   + ++ L+LD  IP+ GLAKD KH+T  ++  +    I + + S L+  L  IQDEVHRFAI+F+R+K+SK    ++L  IK +G+     LL++++++ +IKEA++EE+S I+    AK IK+
  S:    10 SEYLKGIVSNLPEKPGIYQYLNAEGTIIYVGKAKNLKRRVYSYFSKEHQPGKTRVLVSKIADIRYIVVNSEEDALLLENNLIKKYKPRYNVLLKDDKTYPSICVQNEYFPRVFKTRRIIRN-GSSYYGPYSHSP-SMHAVLDLIKHLYPLRTCNLNLSPENIRAGKFNVCLEYHIKNCAGPCIGLQSQEEYLKNIAEIKEILKGNTQEISRLLYQRMQDLAAEMKFEEAQKVKEKYALIENYRSKSEVVSSVLHNIDV--FSIEEDGEKSAFINYLHITNGAINQAFTFEYKKKLNETKEELLTLGIIEMRERYKSASREIIVPFDIEIELND-----------VTFTIPQRGDKKKLLELSLLNVKQYKADRMKQAEKLNPEQRSMRLMKEIQQELHLDRLPMQIECFDNSNIQGTDAVAACVVFKKAKPSKSDYRKYNIKTVVGADDYASMKEVVRRRYQRAIEEESPLPDLIITDGGKGQMEVVRQVMEELQLD--IPIAGLAKDRKHRTSEVLFGFPPQTIGIKQHSPLFRLLEQIQDEVHRFAITFHRDKRSKRQVASALDNIKGIGEKTKTALLKEFKSVKRIKEATIEEVSAIIGESKAKIIKE 603
>gi|189347284|ref|YP_001943813.1| excinuclease ABC, C subunit [Chlorobium limicola DSM 245] >gi|189341431|gb|ACD90834.1| excinuclease ABC, C subunit [Chlorobium limicola DSM 245] (619 aa)
Score = 705, Expect = 5.1e-72, Identities = 198/588 (33%), Positives = 321/588 (54%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN------KLPNKK---CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL-SKYDLITVFYSELDEILLTLIYE-YYSKIAIELPKTVYL-----SLSDEKLKTLSESLK---------IKFLNPSKGVKKDVMDTAFNNAVEIMKNKYL---QLISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKKL 589
           N  I +K+  +P  PG Y +++ +G VIYVGKA +L NR++ YF   R L  KT  +   I D++ ++ ++E E+L+LENNLI + KP+YN+ L++   +PY+++T E  PRI  +    K+    ++GP+  +   +  L + I  IFPLR C        + + K   C+ Y I +C GPC    +  DY   ++E+     G++  +   L +K  + A +L FE + +      +LK ++ERQ ++     D D+I     E+    VIFK   G LL S+   +     E + +LL    E YY +    +P  + L     + ++E LK+   + K         I+ + P  G K  ++D    NA   ++ +YL   Q      RE   L +LQ+LL + K   R+E FDNS+   T+ V +MV + +G   K+EYRKF ++  + + DY  M+EV+ RRY  + A     P+LI+VDGGK QV  A   L    L+  IPVIGLAK    + + I     S+   L K S     L  ++DE HRFA++++R  +S+   +  L  I  +G+    KLL+ + ++ +I EAS+E+L        A++I ++
  S:     6 NSSIPEKIATLPTSPGVYQFRNASGKVIYVGKAKNLRNRVRSYFRDSRQLYGKTLVMVGHIADLEVIITSSEVEALILENNLIKELKPRYNVNLKDDKTYPYLVITNEPFPRIFLTR-YIKRDGSIWFGPYTEARQLRLIL-DLIGSIFPLRSCKHRFTAESIASGKFRVCLDYHIHKCKGPCEGFQSEADYRQMIEEVVRLLKGRTSGLIRSLTEKMHEHAAELKFEAAAEIRSQLDSLKRYAERQKVVSPDGADRDVIALAAGEDDACAVIFKIREGKLLGSQRIYMNNTGGETETVLLAKAAENYYLETIDTIPDEILLQHTLVAENEETLKSFVAAKKLAEPGRKTAIRIVVPQIGEKAHLLDMCHRNARHHLE-EYLIQKQKRGEAAREHAGLNDLQELLHLEKPPERIECFDNSHFQGTDYVSSMVCFVHGKPKKSEYRKFRLRTIEGSDDYAAMEEVLNRRYTGSLAEELPFPDLIVVDGGKGQVNIAHRILAESGLN--IPVIGLAK----RLEEIFLPHVSDPFNLPKTSPALRMLQQLRDEAHRFAVTYHRKLRSERTLQTELTAIAGIGEKTAHKLLQHFGSVKRISEASLEDLVSAAGRNTAEKIHRV 616
>gi|150003780|ref|YP_001298524.1| excinuclease ABC subunit C [Bacteroides vulgatus ATCC 8482] >gi|149932204|gb|ABR38902.1| excinuclease ABC subunit C [Bacteroides vulgatus ATCC 8482] (606 aa)
Score = 703, Expect = 7.1e-72, Identities = 192/587 (32%), Positives = 330/587 (56%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKC--NKLPNK-------KCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDL-----ITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVE--IMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFS--EIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           N+ +K  +  +P  PG Y + +  G +IYVGKA +L  R+  YF ++  + KT+ L ++I D+ Y+VV  E ++LLLENNLI KYKP+YN+LL++   +P I V+ E  PRI  +    +    +YYGP+++       + + I +++P+R C  N  P          C+ Y I  C GPCI + + ++Y   + EI +   G ++ + + L ++    A ++ FE++QK  E    ++ +  + +++ S  ++ D+     +EN   I      NG +   +       +     EL ++ +  + E Y   + E+     L +         E   + F  P +G KK ++D +  N  +  + + K  + ++ + R +  ++E+Q+ L +K L   +E FDNSNI  ++ V A VV++    +K EYRK+ IK      DY  MKEV+ RRY         +P+LII DGGK Q++   E ++  EL   IP+ GLAKD KH+T  ++ + F    I + + + L+  L NIQ+EVHRFAI+F+R+K+SKS   ++L  IK +G+ R   LL+ ++++ +I++AS+EE++ +V    AK IK+
  S:     9 NDYLKGIVLNLPDSPGIYQYLNSEGTIIYVGKAKNLKRRVSSYFNREHPNGKTRLLVSKIADIRYIVVKTEEDALLLENNLIKKYKPRYNVLLKDDKTYPSICVSNEYFPRIFKTRQVIRN-GSSYYGPYSHMP-SMLAVMDLIKKLYPIRTCKLNLSPENIRAGKFNVCLEYHIKNCKGPCIGQQSHEEYMKNIGEIKNILKGDTQIVSDLLMEEMQALAAEMKFEEAQKIKEKYDLIENYRSKSEVVNSIIHNVDVFSIEMEENSAYINYLHITNGCINQAFTFEYKKRLNETKEELLQLGIIEMRERYKSTSREIIVPFELDM---------EMNNVSFTVPQRGEKKHLLDLSVMNVKQYKVDRLKQAEKLNPEQRSVRLMKEIQEQLHMKKLPNHIECFDNSNIQGSDAVAACVVFKKAKPSKKEYRKYIIKTVTGPDDYASMKEVVRRRYSRAIEEGSPLPDLIITDGGKGQMEVVREVIED-ELHLDIPIAGLAKDRKHRTSELL-YGFPPLTIGVKQSTPLFHLLENIQNEVHRFAITFHRDKRSKSQVASALDNIKGIGEKRKTALLKTFKSVSRIRQASLEEIAAVVGEAAAKNIKE 602
>gi|24373426|ref|NP_717469.1| excinuclease ABC subunit C [Shewanella oneidensis MR-1] >gi|32130299|sp|Q8EFV4|UVRC_SHEON UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|24347704|gb|AAN54913.1|AE015629_7 excinuclease ABC, C subunit [Shewanella oneidensis MR-1] (609 aa)
Score = 703, Expect = 8.2e-72, Identities = 188/578 (32%), Positives = 329/578 (56%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK----CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYYSKIAIE--LPKTVYLSLSDEKLKTL----SESLKIKFLNPSKGVKKD---VMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIK-DLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL--KFLELDSIIPVIGLAKDDKHKT--DRIVKWDF-SEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           L+ +    G Y   D  G VIYVGKA DL  R+  YF K+  ++KT+ L + I  +D  + ++E ++LLLEN+ I +Y PKYN+LLR+  ++PYIL+++ EHPR+ Y H   ++ KG Y+GP+ N    +  L+  + ++FP+R+C+ L  K     C+ Y + +C  PC+ KV+  +Y+  +K  + F  GK K +  +L  K  +AAE+  +E + ++ +    L+  +E+Q++      D D+IG +    +    +     G +    S Y  +    ++++E+L + + ++Y    I+  +PK V +S   E+L  L    SE+L  KF +    V+ D    +  A  NA     N  +  +S++N        L+++L++   + RME FD S+    + V + VV+     +K EYR++NI+      DY  MK+ I RR+    AS G+IP+++ +DGG  Q++ A + +  KF+ LD    +IG+AK +  K   + ++  D  +   L+  S     + +I+DE HRFAI+ +RN++ K+   ++L  I  +G  R + LL+    L ++K ASV EL+++  + IE+A+ I
  S:    11 LRTVTSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRKNLGNVKTQALVSHIHHIDVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEHPRLAY-HRGPQREKGHYFGPYPNGGAVRESLH-LMQKLFPIRQCDDLYYKSRTRPCLQYQLSRCSAPCVGKVSNAEYDEQVKLASLFLKGKDKQVISELVAKMEEAAEQQAYEQAARFRDQIMALRRVAEQQEVS-GNTGDMDVIGVHYASGIACFHLLFIREGKIFGSRSYYPTVPA-QTDIEEVLRSFLLQFYLNADIQRTIPKEVVISHHFEELHELEAAVSEALNKKF-SIKTNVRADRASFLRLAITNAT----NAVMTRLSHKNTVEQRFVLLEEILELNAPIQRMECFDISHTMGESTVASCVVFNREGPHKAEYRRYNIEGITPGDDYAAMKQAISRRFDKIDAS-GKIPDILFIDGGLGQLRIAQQIVDEKFVNLDKAPQLIGVAKGESRKPGLETLIFGDTETSFSLEDDSPALHLIQHIRDESHRFAITGHRNRRQKTRNTSTLESIPGIGPKRRKALLQHLGGLQEVKGASVAELAKVPGISIEMAQTI 603
>gi|193215119|ref|YP_001996318.1| excinuclease ABC, C subunit [Chloroherpeton thalassium ATCC 35110] >gi|193088596|gb|ACF13871.1| excinuclease ABC, C subunit [Chloroherpeton thalassium ATCC 35110] (640 aa)
Score = 703, Expect = 9.0e-72, Identities = 197/586 (33%), Positives = 330/586 (56%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF--LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN---------KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDE-----ILLTLIYEYYSKIAIELPKTVYLS-----------LSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNR--------ELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIK----LDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           ++E ++ KLK +P  PG Y +KDK+  VIYVGKA +L  R++ YF  L +   KT+ L   I D++ ++   E E+L+LENNLI + KP+YN+ L++  ++PYI+VT E  PR+  + +  ++    YYGP+  +   +  L + I+ IF +R C+             K C+ Y I +CLGPC    +R+DY+  + E+     GK+K I   LE +    A++L FE + +     + L+ +S RQ ++ + + D DI     + +     +FK  +G LL        ++S +++     ++  L+ +YY +    LP  ++ +           L  +++  + E  K+ F+ P  G K  ++D    NA  ++    LQ    Q R         + SLE   +L   K   R+E FDNSN   T+ V +M+ + +G   K++YR+F IK  +  +D+  M E+I RRY  + A    +P+LI+VDGGK Q+ +A   L+   +   +PVIGLAK       R+ +  F   +    L K S     L  ++DE HRFAI+F+R  +SK   +  L +I+ +GKT+ EKLL+ + ++ ++K+AS E L++ V  + A+ I
  S:    26 LSEALQFKLKNLPTSPGVYQFKDKDERVIYVGKAKNLRARVQSYFRNLSEHSGKTRLLVRRIMDLELILTGTEVEALILENNLIKQLKPRYNINLKDDKSYPYIVVTNEPFPRVFPTRN-VRRDGSKYYGPYTETRQMRM-LLDAISEIFQVRSCSLNMTDENIAARKFKVCLDYHIKKCLGPCEALQSREDYDAMIDEVKKLLRGKTKDIVRSLESRMKNYAKELKFEYAAEIKRQLEALERYSARQKVLTTDEIDRDIFAVAREGDDACGTVFKVRDGKLLGSQHF---YFSNVEDEPMANLVGRLLEKYYLETTDILPNEIFTAEQPSNQDAIEALLQKRMSEIGEQKKVHFVIPQIGDKAKLVDMCAANAKHLLSEYQLQ---KQKRGEAKAIPHAVRSLERDLRL--AKPPRRIECFDNSNFQGTDPVASMICFVDGKPKKSDYRRFKIKTVEGANDFASMAEIIERRYTGSLAESLPMPDLIVVDGGKGQLSSAYAVLQKSGVG--VPVIGLAK-------RLEEVFFPNEQLPHNLPKTSSSLKLLQQVRDEAHRFAITFHRELRSKRTLQTELTEIEGIGKTKAEKLLKTFGSVAEVKKASAEALAEAVGKKAAERI 631
>gi|113969890|ref|YP_733683.1| excinuclease ABC subunit C [Shewanella sp. MR-4] >gi|119367835|sp|Q0HJZ1|UVRC_SHESM UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|113884574|gb|ABI38626.1| excinuclease ABC, C subunit [Shewanella sp. MR-4] (609 aa)
Score = 702, Expect = 1.1e-71, Identities = 188/578 (32%), Positives = 328/578 (56%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK----CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYYSKIAIE--LPKTVYLSLSDEKLKTL----SESLKIKFLNPSKGVKKD---VMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIK-DLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL--KFLELDSIIPVIGLAKDDKHKT--DRIVKWDF-SEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           L+ +    G Y   D  G VIYVGKA DL  R+  YF K+  ++KT+ L + I  +D  + ++E ++LLLEN+ I +Y PKYN+LLR+  ++PYI +++ EHPR+ Y H   ++ KG Y+GP+ N    +  L+  + ++FP+R+C+ L  K     C+ Y + +C  PC+ KV+  +Y+  +K  + F  GK K +  +L  K  +AAE+  +E + ++ +    L+  +E+Q++      D D+IG +    +    +     G +    S Y  +    ++++E+L + + ++Y    I+  +PK V +S   E+L  L    SE+L  KF +    V+ D    +  A  NA     N  +  +S++N        L+++L++   + RME FD S+    + V + VV+     +K EYR++NI+      DY  MK+ I RR+    AS G+IP+++ +DGG  Q++ A + +  KF+ LD    +IG+AK +  K   + ++  D  S   L+  S     + +I+DE HRFAI+ +RN++ K+   ++L  I  +G  R + LL+    L ++K ASV EL+++  + IE+A+ I
  S:    11 LRTVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRKNLGNVKTQALVSHIHHIDVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYIFLSQHEHPRLAY-HRGPQREKGYYFGPYPNGGAVRESLH-LMQKLFPIRQCDDLYYKSRTRPCLQYQLSRCSAPCVGKVSNAEYDEQVKLASLFLKGKDKQVISELVAKMEEAAEQQAYEQAARFRDQIMALRRVAEQQEVS-GNTGDMDVIGVHYASGIACFHLLFIREGKIFGSRSYYPTVPA-QTDIEEVLRSFLLQFYLNADIQRTIPKEVVISHHFEELHELEAAVSEALNKKF-SIKTNVRADRASFLRLALTNAT----NAVMTRLSHKNTVEQRFVLLEEILELNAPIQRMECFDISHTMGESTVASCVVFNREGPHKAEYRRYNIEGITPGDDYAAMKQAISRRFDKIDAS-GKIPDILFIDGGLGQLRIAQQIVDEKFVNLDKAPQLIGVAKGESRKPGLETLIFGDTESSFSLEDDSPALHLIQHIRDESHRFAITGHRNRRQKTRNTSTLESIPGIGPKRRKALLQHLGGLQEVKGASVAELAKVPGISIEMAQTI 603
>gi|194334457|ref|YP_002016317.1| excinuclease ABC, C subunit [Prosthecochloris aestuarii DSM 271] >gi|194312275|gb|ACF46670.1| excinuclease ABC, C subunit [Prosthecochloris aestuarii DSM 271] (616 aa)
Score = 702, Expect = 1.1e-71, Identities = 192/581 (33%), Positives = 326/581 (56%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK---------CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDE-----ILLTLIYEYYSKIAIELPKTVYLSL---SDE--KLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNR-ELN----SLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           + KL  +P  PG Y +K+  G +IYVGKA ++ +R++ YF +   +  KTK L N I D+D ++ ++E E+L+LENNLI   KP+YN+ L++   +PY+++T E  PRIL +    K+   TY+GP+  +  +   + + I+ IFP+RKC     K+         C+ Y I  C GPC  K   +DY   ++EI     GK+ ++   L  +  + A++L FE++ +     + L+ ++ERQ ++     D D+ G    ++    VIFK   G LL    +   ++S +D+     +L   + +YY +    +P+ ++L L    DE   L+ L+  + ++F+ P  G K  ++    +NA   ++     LI  Q R EL+    +L+ LQ+ L + +   R+E FDNS+   T+   +MV +  G   K++YRKF +   + + DY  M+E + RRY  +      +P+LI++DGGK QV  A + L+ L L+  IPVIGLAK    + + I   +  +   L K S     L  I+DE HRFAI+++R  ++K   +  L  I  +G+    KLLE + ++++I +A  EE+  +   + A+ I
  S:    13 EKKLSNLPTCPGVYQFKNNQGTIIYVGKAKNIRSRVRSYFREGPHISGKTKVLVNHIADIDIILTSSEVEALILENNLIKDLKPRYNINLKDDKTYPYLVITNEAFPRILITR-QVKRDGSTYFGPYTEAR-QLRSVLDLISTIFPVRKCKLKLTKENIESGRFSVCLNYHIHTCKGPCEGKQREEDYLRMIEEIKGLLKGKTGALIRTLSAEMHRYADELRFEEAAELKIQIEGLRKYTERQKVVSKDPVDRDVFGIAQHQDDACGVIFKIREGKLLGSQRM---YFSNVDDEQHETLLRKCLEKYYLETPDLIPQEIFLPLPIDDDEVMALRELTGDINLRFIVPKIGEKAKLVAMCIDNARHHLEE---YLIEKQKRGELSRIVPALQALQETLHLSRQPERIECFDNSHFQGTDYTSSMVCFVGGKPRKSDYRKFKLNSFEGSDDYAAMQEAVTRRYSGSLQDELPLPDLIVIDGGKGQVNTAWKVLQELGLE--IPVIGLAK----RLEEIFLPNTPDPYNLAKTSPALKLLQQIRDEAHRFAITYHRKLRTKRTIQTGLTDIAGIGEKSAMKLLEHFGSIEQIAKAEKEEILAVTGPKTAEAI 607
>gi|91792795|ref|YP_562446.1| excinuclease ABC subunit C [Shewanella denitrificans OS217] >gi|119367833|sp|Q12PA3|UVRC_SHEDO UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|91714797|gb|ABE54723.1| excinuclease ABC, C subunit [Shewanella denitrificans OS217] (609 aa)
Score = 701, Expect = 1.2e-71, Identities = 180/578 (31%), Positives = 322/578 (55%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYYSKIAIE--LPKTVYLSLS----DEKLKTLSESLKIKFLNPS--KGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAA--LESLKFLELDSIIPVIGLAKDDKHKTDR---IVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           LK +    G Y   D  G VIYVGKA DL  R+  YF  +  ++KT+ L + I ++D  + ++E ++LLLEN+ I +Y PKYN+LLR+  ++PY+ ++  +HPR+ Y H   ++ KG Y+GP+ N    +  L N + ++FP+R+C+ L      + C+ Y +G+C  PC+ KVT +DY   ++  + F  GK + +   L  K  QAAE+  +E +  Y +    L+  +E+Q++    K D D+IG + ++ +    +    +G +    S Y  +    +++DE+L   I ++Y    ++  LP  V LS S     E    ++E+L+ KF+  +  +G +   +  A  NA   +  +    ++++N +      L++ L++   + RME FD S+    + V + VV+     +K +YR++NI       DY  M++ I RR+ +   + G++P+++ +DGG  Q++ A  +   K   LD    +IG+ K +  K      +      +  L   S  +  +L+I+DE HRFAI+ +RNK+ K+   +SL  I  +G  R + LL+    L ++K ASV EL+++  + +E+A+ I
  S:    10 LKNLSSSAGVYRMYDAKGEVIYVGKAKDLKKRLSSYFRANLGNIKTQALVSHITNIDVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYLFLSGHKHPRLAY-HRGPQREKGRYFGPYPNGGAVRESL-NLLQKLFPIRQCDDLYYKARTRPCLQYQLGRCSAPCVNKVTDEDYAEQVQLASLFLQGKDQQVVTNLVTKMEQAAEEFHYEQAAAYRDQITALRKVAEQQEVSLD-KGDMDVIGVHYEKAIACFHMLFIRSGKIFGSRSYYPSVPA-QTDIDEVLSAFISQFYLNADVQRTLPNEVILSQSFSDKAELESAIAEALEKKFIIKTQVRGERASFLRLALTNATNAVTTR----LADKNTQEQRFSLLEEALELGHSIGRMECFDISHTMGESTVASCVVFNREGPHKADYRRYNISGITGGDDYAAMEQAINRRF-DKIDTNGKVPDIVFIDGGLGQLRIAQGIVDEKCAHLDRPPLLIGVTKGEGRKAGLETFVFGGSEQQFNLPSDSGAFHLILHIRDESHRFAITGHRNKRQKTRNTSSLESIAGVGPKRRKALLQHLGGLQEVKGASVAELTKVPGISLEMAQTI 602
>gi|119356545|ref|YP_911189.1| excinuclease ABC subunit C [Chlorobium phaeobacteroides DSM 266] >gi|189038035|sp|A1BED8|UVRC_CHLPD UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|119353894|gb|ABL64765.1| Excinuclease ABC subunit C [Chlorobium phaeobacteroides DSM 266] (631 aa)
Score = 700, Expect = 1.6e-71, Identities = 189/568 (33%), Positives = 312/568 (54%)
  Q:     7 DKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKC---------NKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLI--TVFYSELDEILLTLIYEYYSKIAIELPKTVYLS--LSDEKLKTLSESL------------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQN--RELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           DK+  +P  PG Y +K+  G VIY+GKA +L NR++ YF   + L  KT  +  +I D++ ++ ++E E+L+LENNLI + KP+YN+ L++   +PY+++T E  PRIL +    KK   T++GP+  +  +   + +FI  IFP+R C         ++   K C+ Y I +C GPC   +T ++Y   + EI     GK+ +    L ++ +  A++L FE + +      +LK ++ERQ ++ S   D D+     + +    V+FK   G LL    L         + ++L  ++  YY +    LP  ++L   L  E+ +TL   L             I+   P  G K  ++     NA   ++   +Q        RE + L  L +LL + K   R+E FDNS+   T+ V +MV + +G   K++YRKF +K    + DY  M EV+ RRY    +    +P+LI+VDGGK Q+  A++ L  L+LD  IPVIGLAK    + + I     S+   L K S     +  ++DE HRFA++++R  +++   E  L  I+ +G+   +KLL  + ++D I+ A V+EL
  S:    19 DKVASLPSSPGVYQFKNAQGRVIYIGKAKNLRNRVRSYFRNPQQLFGKTLVMVGKIADIEVIITSSEVEALILENNLIKELKPRYNVNLKDDKTYPYLVITNEPFPRILVTR-QVKKDGSTWFGPYTEAR-QLRSILDFIGSIFPIRSCKLRLSPENISRGKFKVCLDYHIHKCKGPCEGLLTEEEYLLMIVEITRLLKGKTSATIRSLNERMLSFAKELKFEQAAELKTQIDSLKRYAERQKVVTSDTLDRDVFAVASRNDDGCGVVFKIREGKLLGSERLYMNNTEGVSVQDLLARVVERYYLETCNLLPDEIFLQTELPAEEKETLENLLISKISAEGKQKRTIRLTVPIIGEKAHLIQLCRENARHHLEEYLIQKQKRGEALREHSGLIALAELLHLPKTPNRIECFDNSHFHGTDYVSSMVAFVHGKAKKSDYRKFKLKTVQGSDDYAAMHEVLTRRYSGTLSVELPLPDLIVVDGGKGQLSTAVKVLVSLKLD--IPVIGLAK----RIEEIFTPHTSDPFNLPKTSPALKLIQQLRDEAHRFAVTYHRKLRTERTLETELTTIQGIGEKTAQKLLRHFGSVDLIRTAGVDEL 609
>gi|163751600|ref|ZP_02158821.1| excinuclease ABC subunit C [Shewanella benthica KT99] >gi|161328512|gb|EDP99666.1| excinuclease ABC subunit C [Shewanella benthica KT99] (609 aa)
Score = 700, Expect = 1.9e-71, Identities = 181/578 (31%), Positives = 323/578 (55%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLS--KYDLITVFYSELDEILLTLIYEYY--SKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKD-LYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL--KFLELDSIIPVIGLAKDDKHKTD-RIVKWDFSEIKLDKKSD--LYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           LK +   PG Y   D   +VIYVGKA DL  R+  YF K+   +KT+ L + I ++D  V ++E ++L+LEN+ I +Y P+YN+LLR+  ++PYIL++  +HPR+ Y H  +K+ KGTY+GP+ N    +  L+  + +IFP+R+C+ L     ++ C+ Y IG+C  PC+ K++ ++YE  +K  + F  GK++ +  +L  K    A+ L +E +  Y +    L+  +E+Q+ +     D D+IG +    V    +    NG +     Y       +++DE+L   + ++Y        +PK + LS S + L  L +++      K++     +  + + +  A  NA   +  +    +S++N        L++ LD+   + RME FD S+    + V + VV+     NK +YR +NI       DY  MK+ I RR+ +     G+IP+++ +DGG  Q++ A + +  KF  LD+   +IG+AK +  K     + +  +E+     +D      + +I+DE HRFAI+ +RNK+ K+   ++L  I  +G  R + LL+    L ++K ASV E++++  + +++AK+I
  S:    11 LKSVSSSPGVYRMYDAEDVVIYVGKAKDLKKRLSSYFRKNLVHVKTQALVSHIANIDVTVTHSETDALILENDYIKQYMPRYNVLLRDDKSYPYILLSHHKHPRLAY-HRGSKRDKGTYFGPYPNGGAVRESLH-LMQKIFPIRQCDDLYYKSRSRPCLQYQIGRCSAPCVDKISSEEYEAQVKLASLFLKGKNQQVMVELVSKMEACAQSLEYEKAASYRDQISALRRVAEQQE-VSGTSGDMDVIGAHYASGVACFHLLFIRNGKIFGSRSYYPSVPDQTDMDEVLSAFMIQFYLNGDSQRTVPKEILLSQSFDDLPQLEKAIQTALDKKVEIKTNVRSERANFLRLAVTNATNAVNTR----LSHKNTVEQRFLLLEEALDMTTRVQRMECFDISHTMGESTVASCVVFNREGPNKADYRHYNINGITPGDDYAAMKQAITRRF-DKIDKTGKIPDILFIDGGLGQLRIAQKIIDEKFAHLDTAPMLIGIAKGEGRKPGLETLIYGENELSFSIAADSGALHLIQHIRDESHRFAITGHRNKRQKTRNTSTLESIAGVGPKRRKALLQFLGGLQEVKNASVAEMAKVPGISVDMAKKI 603
>gi|110634325|ref|YP_674533.1| excinuclease ABC subunit C [Mesorhizobium sp. BNC1] >gi|119367666|sp|Q11GV7|UVRC_MESSB UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|110285309|gb|ABG63368.1| Excinuclease ABC subunit C [Mesorhizobium sp. BNC1] (653 aa)
Score = 699, Expect = 2.4e-71, Identities = 179/575 (31%), Positives = 305/575 (53%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL-KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD------EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRY----------------KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           E I+  +K++P+ PG Y   +  G V+YVGKA  L  R+  Y   +    + +++  E   +++VV   E E+LLLE NLI + +P++N+L+R+  +FPYIL+T       ++ H   +  +G Y+GPFA++      + N + R F LR C     +   + C+ Y I +C GPC ++++ +DY   +KE  DF SG+S ++  ++     +A++ L FE +  Y +    L      Q I      + D+   + +     I +F +  G           ++ + D      E+L + + ++Y       P+ + LS   E    L+E+L      K++   P++G KKD+ D A  NA E +  + L   S+Q R L  L E   L       R+E++DNS+I  TN VGAM+V       KN+YRKFNI+  +     D+  M+EV+ RR+                +++ ASF   P+LI++DGG+ Q+ A  + L  L +  ++  IG+AK  D     +R          L  +  + +F+  ++DE HRFAI  +R ++ K + +N L +I  +G  R   LL  + T   +  A+VE+L ++
  S:    33 EVIQAVVKRLPNAPGVYRMVNTEGDVLYVGKARSLKKRVTNYAQGRGHSNRIERMIRETATMEFVVTRTETEALLLEANLIKRLRPRFNVLMRDDKSFPYILLTGNHPAPGIFKHRGARSRRGDYFGPFASAGAVGRTI-NSLQRAFLLRTCTDSVFESRTRPCLLYQIKRCSGPCTREISVEDYATLVKEAKDFLSGRSSTVKAEIATAMQEASQALDFERAAIYRDRLAALSHVQSHQGINPQGLEEADVFAIHQEGGQTCIQVFFFRTGQNWGN----RAYFPKADPALGHGEVLGSFLAQFYDDKPC--PRLILLSHPVEDQDLLAEALSARAGRKVQVSVPARGEKKDLTDHALQNAREALGRR-LAETSSQARLLEGLAETFGLEAAPR--RIEVYDNSHIMGTNAVGAMIVAGPEGFVKNQYRKFNIRSAEITPGDDFGMMREVMQRRFARLIKEQGLPGNGSEAEDSDASFPAWPDLILIDGGQGQMSAVRQILDDLGIADLVTAIGVAKGVDRDAGRERFFMEGRPPFTLPPRDPVLYFVQRLRDEAHRFAIGSHRARRKKEMVKNPLDEIAGIGPGRKRALLHHFGTAKAVSRAAVEDLMEV 634
>gi|114047120|ref|YP_737670.1| excinuclease ABC subunit C [Shewanella sp. MR-7] >gi|119367836|sp|Q0HW92|UVRC_SHESR UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|113888562|gb|ABI42613.1| Excinuclease ABC subunit C [Shewanella sp. MR-7] (609 aa)
Score = 698, Expect = 2.9e-71, Identities = 188/578 (32%), Positives = 327/578 (56%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK----CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYYSKIAIE--LPKTVYLSLSDEKLKTL----SESLKIKFLNPSKGVKKD---VMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIK-DLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL--KFLELDSIIPVIGLAKDDKHKT--DRIVKWDF-SEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           L+ +    G Y   D  G VIYVGKA DL  R+  YF K+  ++KT+ L + I  +D  + ++E ++LLLEN+ I +Y PKYN+LLR+  ++PYI +++ EHPR+ Y H    + KG Y+GP+ N    +  L+  + ++FP+R+C+ L  K     C+ Y + +C  PC+ KV+  +Y+  +K  + F  GK K +  +L  K  +AAE+  +E + ++ +    L+  +E+Q++      D D+IG +    +    +     G +    S Y  +    ++++E+L + + ++Y    I+  +PK V +S   E+L  L    SE+L  KF +    V+ D    +  A  NA     N  +  +S++N        L+++L++   + RME FD S+    + V + VV+     +K EYR++NI+      DY  MK+ I RR+    AS G+IP+++ +DGG  Q++ A + +  KF+ LD    +IG+AK +  K   + ++  D  S   L+  S     + +I+DE HRFAI+ +RN++ K+   ++L  I  +G  R + LL+    L ++K ASV EL+++  + IE+A+ I
  S:    11 LRTVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRKNLGNVKTQALVSHIHHIDVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYIFLSQHEHPRLAY-HRGPLREKGYYFGPYPNGGAVRESLH-LMQKLFPIRQCDDLYYKSRTRPCLQYQLSRCSAPCVGKVSNAEYDEQVKLASLFLKGKDKQVISELVAKMEEAAEQQAYEQAARFRDQIMALRRVAEQQEVS-GNTGDMDVIGVHYASGIACFHLLFIREGKIFGSRSYYPTVPA-QTDIEEVLRSFLLQFYLNADIQRTIPKEVVISHHFEELHELEAAVSEALNKKF-SIKTNVRADRASFLRLALTNAT----NAVMTRLSHKNTVEQRFVLLEEILELNAPIQRMECFDISHTMGESTVASCVVFNREGPHKAEYRRYNIEGITPGDDYAAMKQAISRRFDKIDAS-GKIPDILFIDGGLGQLRIAQQIVDEKFVNLDKAPQLIGVAKGESRKPGLETLIFGDTESSFSLEDDSPALHLIQHIRDESHRFAITGHRNRRQKTRNTSTLESIPGIGPKRRKALLQHLGGLQEVKGASVAELAKVPGISIEMAQTI 603
>gi|194337093|ref|YP_002018887.1| excinuclease ABC, C subunit [Pelodictyon phaeoclathratiforme BU-1] >gi|194309570|gb|ACF44270.1| excinuclease ABC, C subunit [Pelodictyon phaeoclathratiforme BU-1] (627 aa)
Score = 697, Expect = 4.0e-71, Identities = 196/568 (34%), Positives = 311/568 (54%)
  Q:     7 DKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN------KLPNKK---CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL-SKYDLITVFYSELDEILLTLIYEYYSKIAIEL-PKTVYLSLS-----DEKLKTL---------SESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQN--RELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           +KL  +P  PG Y +++ +G VIYVGKA +L NR++ YF   + L  KT  L   I D + ++ ++E E+L+LENN+I + KP+YN+ L++   +PY+++T E  PRIL S    +K   T++GP+  S  + + + + I  IFP+R C        +  KK   C+ Y I +C GPC  + + ++Y   + EI     GK+ ++   L       A +L FE + +     ++LK ++ERQ ++     D D+      E     V+FK   G LL S+   +     E D  L   + E Y    +EL P  + L  S     +E L+ L          E   I+FL P  G K  +++    NA   ++   +Q        RE   L  L++LL +  L  R+E FDNS++  T+ V +M+ +E G   K +YRKF I   + + DY  M+EVI RRY  + +S    P+LI+VDGGK QV  A ++L  L L   IP+IGLAK  +       +  F+   L K S     L  ++DE HRFAI+++R  +S+ + +  L  I  +G+    KLLE++ ++D + +A++EEL
  S:    19 EKLGTLPPSPGVYQFRNSSGRVIYVGKAKNLRNRVRSYFRNQQQLYGKTLVLVTHIADFEVIITSSEVEALILENNMIKELKPRYNVNLKDDKTYPYLVITNEPFPRILISRQR-RKDGSTWFGPYTESR-QLHSILDLIGSIFPVRSCKFRLSEENIATKKYKVCLDYHIHKCKGPCEGRQSEEEYLLMIAEITRLLKGKTSTMIRSLTSAMQLFARELKFERAAEIKMQLESLKRYAERQKVVAGDGLDRDVFAVATGEEDGCGVVFKIREGKLLGSQRIYMNNVTGETDSGLQARVMEKYYLETLELLPDEILLQESLGADEEETLRALFSEKEREEAQEKKNIRFLVPQIGEKAHLVEMCRQNARHHLEEYLIQKQKRGEAAREHYGLTALKELLHLPKLPQRIECFDNSHLQGTDYVSSMICFEKGKPKKADYRKFKINSFEGSDDYAAMEEVIRRRYSGSLSSKLPWPDLIVVDGGKGQVNIAFQTLNALGLS--IPIIGLAKRIEEIFTPQARDPFN---LPKTSPALKLLQQMRDEAHRFAITYHRKLRSERMLQTELTTIAGIGEKTAFKLLERFGSVDAVAQATLEEL 609
>gi|167624269|ref|YP_001674563.1| excinuclease ABC subunit C [Shewanella halifaxensis HAW-EB4] >gi|189038091|sp|B0TIW9|UVRC_SHEHH UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|167354291|gb|ABZ76904.1| excinuclease ABC, C subunit [Shewanella halifaxensis HAW-EB4] (609 aa)
Score = 697, Expect = 4.2e-71, Identities = 186/578 (32%), Positives = 318/578 (55%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYY--SKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL--KFLELDSIIPVIGLAKDDKHK---TDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           LK +   PG Y   D   +VIYVGKA DL  R+  YF K+  ++KT+ L + I ++D  V ++E ++L+LEN+ I +Y PKYN+LLR+  ++PYIL++  +HPR+ Y H   K+ KG Y+GP+ N    +  L+  + +IFP+R+C+ L     ++ C+ Y IG+C  PC+ KV+ +DY+  ++    F  GK   +   L  K  QAA  + +E +  Y +    L+  SE+Q++  +   D D+IG Y    V    +     G +    S Y  + V  +E+ E+L + + ++Y  S      PK + +S   E+   L++++      K++     +G +   +  A  NA   +  +     + + R L   E ++    I+   RME FD S+    + V + VV+     +K +YR++NI       DY  MK+ I RR+ +  +S G+IP+++ +DGG  Q++ A + +  KF+ LD+   +IG+AK +  K      I   +     L   S     + +I+DE HRFAI+ +RNK+ K+   ++L  I  +G  R + LL+    L ++K ASV EL ++  + +E+A+ I
  S:    11 LKTVTSSPGVYRMYDAKAVVIYVGKAKDLKKRLSSYFRKNLTNVKTQALVSHIANIDVTVTHSETDALILENDYIKQYMPKYNVLLRDDKSYPYILLSNHKHPRLAY-HRGPKRDKGLYFGPYPNGGAVRESLH-LLQKIFPIRQCDDLYYKSRSRPCLQYQIGRCSAPCVGKVSLEDYQEQVRLATLFLKGKDHQVMSVLVGKMEQAASDMRYEQAALYRDQITALRRVSEQQEVS-NASGDMDVIGAYYASGVACFHLLFIREGKIFGSRSYYPKVPV-NTEVSEVLRSFMLQFYLNSDSQRLTPKEILISEPFEEQDELAKAIQAAQNKKVEIKTQVRGERASFLRLALTNATNAVNTRLSHKNTIEQRFLLLEEAIESTNKIQ---RMECFDISHTMGESTVASCVVFNREGPSKADYRRYNITGITPGDDYAAMKQAITRRF-DKISSSGKIPDILFIDGGIGQLRIAQKVVDEKFVALDNAPTLIGVAKGEGRKPGLETLIYGENEESFTLPADSGALHLIQHIRDESHRFAITGHRNKRQKTRNTSTLESIAGVGPKRRKALLQYLGGLQEVKGASVSELVKVPGISLEMAQTI 603
>gi|88711870|ref|ZP_01105958.1| excinuclease ABC, C subunit [Flavobacteriales bacterium HTCC2170] >gi|88710811|gb|EAR03043.1| excinuclease ABC, C subunit [Flavobacteriales bacterium HTCC2170] (596 aa)
Score = 696, Expect = 5.0e-71, Identities = 197/582 (33%), Positives = 331/582 (56%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN------KLPNKK---CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDL-ITVFYSELDEILLTL-IYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQL-ISNQNRELNS-LEELQKLLDIKDLYR-MEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE----IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           +K ++  +P+ PG Y + D+   ++YVGKA +L  R+  YF K+ +  KT+ L  +I  + ++VV+ E+++LLLE+NLI KY+P+YN+LL++  ++P+I + KE  PRI  +    K     Y+GP+ +    K  L   I  ++PLR CN      K+ + K   C+ Y +G CLGPC    +  DY+  + EI     G  KS  +  + +    A+ ++FE++Q+  +    L+ +  +  I+  + N+ D+      ++   +   +   G+++  + + I     E DE LL L I+E   +   E  K +YL       K + E   IK   P  G K+ ++D +  NA    + ++ Q+ I +  R  N  + ++QK + +    R +E FDNSNI  +N V A VV++NG  +K EYR +NIK      D+  M+EV+YRRYK        +P LI++DGGK Q+ +AL+SL  L L   I +IG+AK       R+ +  F E    + LDKKS+    +  +++E HRF I+ +RNK+SK+   ++L  I  +G+     LL+K++++ +IKEAS+E+++Q+V I  AK+I
  S:     6 LKIQISTLPNSPGVYQFYDEADTILYVGKAKNLKKRVSSYFNKNHEYGKTRILVKKIRSIKHIVVSTESDALLLESNLIKKYRPRYNVLLKDDKSYPWICIKKERFPRIFPTRKLIKD-GSEYFGPYTSMYTVK-TLLELIRNVYPLRTCNYDLSEEKIKSGKYKLCLEYHLGNCLGPCEGLQSSSDYDKQIDEIRSILKGNFKSSLQSFKNQMKLLADDMLFEEAQQIKDKIAVLENYQSKTTIVNPKINNVDVFSIIADDSFAYVNFLQISLGAIIRSHTMEIKKKLEEKDEDLLQLAIFEIRQRFNSE-SKEIYLPF-----KVVVEP-HIKVTVPKLGDKRKILDLSIRNAKYFRQERFNQIKIVDPERHTNRIMAQMQKDIRLSTEPRHIECFDNSNIQGSNPVAACVVFKNGKPSKKEYRHYNIKTVVGPDDFASMEEVVYRRYKRLLDETQPLPQLIVIDGGKGQLSSALKSLDILGLRGKIAIIGIAK-------RLEEIYFPEDPIPLYLDKKSESLKIIQQLRNEAHRFGITLHRNKRSKAAINSTLENINGVGEKTARDLLKKFKSVKRIKEASIEDIAQVVGISKAKKI 590
>gi|124008163|ref|ZP_01692861.1| excinuclease ABC, C subunit [Microscilla marina ATCC 23134] >gi|123986411|gb|EAY26224.1| excinuclease ABC, C subunit [Microscilla marina ATCC 23134] (601 aa)
Score = 696, Expect = 5.6e-71, Identities = 201/575 (34%), Positives = 315/575 (54%)
  Q:     4 QIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD--RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK---------CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKN-DEDIIGFYCKENVISIVIFKYVNGSLLSKYDL-ITVFYSELDEILLTLI-YEYYSKIAIELPKTVY---LSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNS--LEELQKLLDIKDLYR-MEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRI-VKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIV 578
           QI+  LK++P   G Y + DKN +++YVGKA +L NR+  YF K    + KT  L  +I  VDY VVN+E ++LLLENNLI  Y+PKYN+LL++   +PYIL+T E  P+++ +    +K KG +YGPF N       +   I  ++ +R CN   +K+         C+ Y +G C  PC    + +DY   L+       G    +   L+++ +  AEKL FE ++   +   +L  F  +  ++   K  D D+      EN   +   K  NG+++    + I     E +E +LTL+ +     I    P+ +    L++SD++              P  G KK ++  +  N +   K K  Q +  Q ++ +   LEELQ++L +K+L R +E FDNSNI     V +MV + NG   K  YR FNIK      D+  MKE+++RRYK       E+P LI++DGGK Q+ AA E+LK L+L   I +IG+AK    K + I    D   + + KKS     L  ++DE HRFAI F+RNK+S     + L  I+ +G+  I  LL  ++T++ + +AS +E++++V
  S:     3 QIEATLKQLPTNAGVYKFFDKNNVLLYVGKAKNLKNRVNSYFNKSAQHNRKTINLVKQIAHVDYTVVNSEFDALLLENNLIKNYQPKYNILLKDDKTYPYILITNEPFPKLVVTR-KLEKNKGRFYGPFTNLKAMN-AIVELIRELYTIRTCNLHLSKENIQQNKFKLCLEYHLGNCQAPCEGLQSEEDYLKDLEHAKHIMKGNIHIVKTYLKEQMLAYAEKLEFEKAESQKQKLASLDKFQSKSLVVNPNKVIDTDVFSIISDENYSYVNFLKIKNGAIIHTQSIEIAKKLDETEEEILTLVAFNLRDTIGSNAPEIITNLPLNISDDRFTNTI---------PKIGDKKKLLSLSQKNVLYYKKEKIQQRLLRQGKDKSRVVLEELQQVLRMKELPRHIECFDNSNIQGIYPVASMVFFRNGFPYKKGYRHFNIKTVVGPDDFASMKEIVHRRYKRLLYEKAELPQLIVIDGGKGQLSAACEALKELDLYGEITIIGIAK----KLEEIYFPEDSIPLHISKKSPALKLLQKVRDEAHRFAIEFHRNKRSNDSLHSELEAIEGVGEKTITSLLRHFKTVNNVAQASTQEIAKVV 583
>gi|116748697|ref|YP_845384.1| excinuclease ABC, C subunit [Syntrophobacter fumaroxidans MPOB] >gi|116697761|gb|ABK16949.1| excinuclease ABC, C subunit [Syntrophobacter fumaroxidans MPOB] (677 aa)
Score = 696, Expect = 5.9e-71, Identities = 184/579 (31%), Positives = 314/579 (54%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK----LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDL-ITVFYSELDEILLTLIYEYYSK-----IAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWD--FSEIKLDKKS---------DLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           K    PH PG YL+KD +G V+YVGKA+DL  RI  YF     +  KT+ L  +  D++YVV +NE E+LLLE +LI K++P+YN++LR+   +P + +  +E  PR+       ++    Y+GP+ +S     E    ++++FPLR C         + C+ Y +G+CLG C  +V+ +DY   + E+  F  GK+  + +QL ++   AAE L FE +  Y +  + +    E+Q I+  +  ++D+IG +  E    + I     G+L  + D  +     E  E+L   I ++Y +       I +P  V      E+  T  +  +++     +G ++++++ A  NA E    +Y      Q R++  L+ LQ++L + +   RM   D SNI   + VGA+VV+  G  +K+ YR++ I  +    D   M EVI R  KN+ A   E  +L+++DGGK Q+      ++ L     +P+I +AK+   +TDR  K    + +I L  +          D+   L  ++DE HRFAIS Y++     L  ++L  +  +G  R   L+  + ++  ++EASVE+++Q+  VP  VA+ I
  S:    71 KTASFPHLPGVYLFKDASGAVLYVGKAIDLRKRIASYFKSTGPIPVKTRALMGKAADMEYVVTSNEKEALLLEASLIKKHRPRYNVVLRDDKNYPALRIDPREPFPRLEVVR-RFQRDGALYFGPY-HSAYALRETLRLLHQLFPLRLCKGKRLLARERPCLNYSLGRCLGACAGRVSPEDYHKMVDEVVLFLQGKTDVLQQQLRRRMADAAEALNFELAAYYRDRLQGIASMLEKQHIVSDRFLNQDVIGLHVGEEGAELAILFVRKGTLTGQRDFDLRDAQGEPMELLTAFIQQFYREDRYIPDEIVVPAPVEAEALLEEWLTELKGKRVRVWAARRGDRRELLEIAGKNARE----RYTSRRKWQKRDVTMLQNLQRILKLPRAPLRMACVDISNIQGRHAVGAVVVFSEGSPDKDSYRRYRIHGKTEPDDPAMMAEVIERLLKND-APLAESLDLLVLDGGKSQLNRIRRLMEELGAAEGLPLISIAKEK--ETDRGEKGRGLYEKIYLPGRKNPLFLHHYPDILHLLQRLRDEAHRFAISHYKSLHRNDLLASALDAVPGVGPKRSRLLIRHFGSMKALREASVEDIAQVPGVPPTVARTI 667
>gi|120599189|ref|YP_963763.1| excinuclease ABC subunit C [Shewanella sp. W3-18-1] >gi|189038097|sp|A1RKL4|UVRC_SHESW UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|120559282|gb|ABM25209.1| excinuclease ABC, C subunit [Shewanella sp. W3-18-1] (609 aa)
Score = 695, Expect = 5.9e-71, Identities = 190/578 (32%), Positives = 330/578 (57%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRD-LKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYYSKIAIE--LPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDV-MDTA--FNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKD-LYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL--KFLELDSIIPVIGLAKDDKHKT--DRIVKWDF-SEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           L+ +    G Y   D  G VIYVGKA DL  R+  YF K+ D +KT+ L + I  +D  + ++E ++LLLEN+ I +Y PKYN+LLR+  ++PYIL+++ EHPR+ Y H   ++ KG Y+GP+ N    +  L+  + ++FP+R+C+ L     ++ C+ Y + +C  PC+ KV+  DY+  +K  + F  GK + +   L  K  QAA++  +E + ++ +    L+  +E+Q++  + K D D+IG +    +    +     G +    S Y  +    +++DE+L + I ++Y    I+  +PK V +S + E+L  L  ++ I  LN    +K +V  D A     AV    N  +  +S++N        L+++L++   +YRME FD S+    + V + VV+     +K EYR++NI+      DY  MK+ I RR+    A  G+IP+++ +DGG  Q++ A + +  KF+ LD    +IG+AK +  K   + ++  D  +   L+  S     + +I+DE HRFAI+ +RN++ K+   ++L  I  +G  R + LL+    L ++K ASV EL ++  + IE+A+ I
  S:    11 LRTVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRKNLDNVKTQALVSHIHHIDVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEHPRLAY-HRGPQREKGHYFGPYPNGGAVRESLH-LMQKLFPIRQCDDLYYKSRSRPCLQYQLSRCSAPCVGKVSNADYDEQVKLASLFLKGKDQQVISTLVAKMEQAAQQQEYEQAARFRDQIMALRKVAEQQEVS-NNKGDMDVIGVHYASGIACFHLLFIREGKIFGSRSYYPSVPA-QTDMDEVLRSFILQFYLNADIQRTIPKEVVISHNFEELHELEAAVSIA-LNKKFSIKTNVRADRASFLRLAVTNATNAVITRLSHKNTVEQRFVLLEEILELSTPIYRMECFDISHTMGESTVASCVVFNREGPHKGEYRRYNIEGITPGDDYAAMKQAITRRFDKIEAG-GKIPDILFIDGGLGQLRIAQKIVDEKFVHLDKAPQLIGVAKGEGRKPGLETLILGDTETSFSLEGDSPALHLIQHIRDESHRFAITGHRNRRQKTRNTSTLESIPGIGPKRRKALLQHLGGLQEVKGASVAELVKVPGISIEMAQTI 603
>gi|159027472|emb|CAO89437.1| uvrC [Microcystis aeruginosa PCC 7806] (625 aa)
Score = 695, Expect = 6.7e-71, Identities = 183/584 (31%), Positives = 334/584 (57%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTK--KLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHD-STKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK--LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKN-DEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD-EILLTLIYEYYSKI-AIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAV-EIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDA----NSDYDYMKEVIYRRYK------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAKEI 586
           ++++++L++IP +PG Y  +D+NG ++Y+GK+  L +R++ YF   + L  +   +  ++ +++++V + E ESL LE NLI +++P +N LL++   +PYI +T  E +PRI  +   S    K  YYGP+ ++ + +Y L+  I R FPLR+  +    ++ C+ YDIG+C G C K ++ QDY   L+++   F G++  + ++L  K + A+E L FE +    +  + L+  +  Q +         D I     E    I +F+  +G L+ +        S  + EIL  ++ E+Y  +  +E+P  + L     + + L+  L      K++   P +  K D++     NA+ E+ K K      + +R+L SL++L  +LD+  L +R+E +D S+I  +N V + VV+ +GV     YR + IK+ +     + D+  + EVI RR++      +N A   + P+L+++DGGK Q+ A +  L  + L   + V+ LAK    + +  +  + S ++ DK+      L  ++DE HRFA+SF+R ++ +    + L +I  LG  R + LL  + +LD I+EAS+E+L Q+  I  ++AKEI
  S:    15 DRLENRLREIPLEPGVYFLRDQNGEILYIGKSKKLRSRVRSYFRPSQPLSPRIALMVRQVTEIEFIVTDTEAESLALEANLIKQHQPHFNTLLKDDKKYPYICITWSETYPRIFITRKRSINNQKDRYYGPYVDTRLLRYTLH-LIKRTFPLRQRPQPLFKDRPCLNYDIGRCPGVCQKLISPQDYRETLQKVAMIFQGRTGELLDKLATKMLAASENLDFEQAATIRDQIRGLQALNTDQKVSLPDDTVSRDAIALAKDEQHCCIQLFQVRSGRLVGRLGFFADSQSANEGEILQKVLEEHYLSVEGVEIPSEILLPCELPEGEVLAGWLREKKGRKVELTVPQRQSKADLLAMVEKNALYELEKTK-----RSADRDLQSLQDLAVILDLPALPHRIEGYDISHIQGSNAVASSVVFIDGVAANQHYRHYKIKNPEVKIGHSDDFASLAEVIRRRFRRYAENPDNIAESDDFPDLVMIDGGKGQLSAVVTVLGEMNLLEQVKVVSLAK---QREEIFLPGESSPLETDKEQPGVQLLRRVRDEAHRFAVSFHRQQRMQKSRRSRLDEIPGLGFKRQKDLLAHFHSLDYIREASLEQLQQVTGIGEQLAKEI 618
>gi|166362764|ref|YP_001655037.1| excinuclease ABC subunit C [Microcystis aeruginosa NIES-843] >gi|189038065|sp|B0JFQ0|UVRC_MICAN UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|166085137|dbj|BAF99844.1| excinuclease ABC subunit C [Microcystis aeruginosa NIES-843] (625 aa)
Score = 694, Expect = 8.4e-71, Identities = 183/584 (31%), Positives = 334/584 (57%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTK--KLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDS-TKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK--LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKN-DEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD-EILLTLIYEYYSKI-AIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAV-EIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDA----NSDYDYMKEVIYRRYK------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAKEI 586
           ++++++L++IP +PG Y  +D+NG ++Y+GK+  L +R++ YF   + L  +   +  ++ +++++V + E ESL LE NLI +++P +N LL++   +PYI +T  E +PRI  +        K  YYGP+ ++ + +Y L+  I R FPLR+  +    ++ C+ YDIG+C G C K ++ QDY   L+++   F G++  + E+L  K + A+E L FE +    +  + L+  +  Q +         D I     E    I +F+  +G L+ +        S  + EIL  ++ E+Y  +  +E+P  + L     + + L+  L      K++   P +  K D++     NA+ E+ K K      + +R+L SL++L  +LD+  L +R+E +D S+I  +N V + VV+ +GV     YR + IK+ +     + D+  + EVI RR++      +N A   + P+L+++DGGK Q+ A +  L  + L   + V+ LAK    + +  +  + S ++ DK+      L  ++DE HRFA+SF+R ++ +    + L +I  LG  R ++LL  + +LD I+EAS+E+L Q+  I  ++AKEI
  S:    15 DRLENRLREIPLEPGVYFLRDQNGEILYIGKSKKLRSRVRSYFRPSQPLSPRIALMVRQVTEIEFIVTDTEAESLALEANLIKQHQPHFNTLLKDDKKYPYICITWSETYPRIFITRKRRINNQKDRYYGPYVDTRLLRYTLH-LIKRTFPLRQRPQPLFKDRPCLNYDIGRCPGVCQKLISPQDYRETLQKVAMIFQGRTGELLEKLATKMLAASENLDFEQAATIRDQIRGLQALNTDQKVSLPDDTVSRDAIALAKDEQHCCIQLFQVRSGRLVGRLGFFADSQSANEGEILQKVLEEHYLSVEGVEIPSEILLPCELPEGEVLAGWLREKKGRKVELTVPQRQSKADLLAMVEKNALYELEKTK-----RSADRDLQSLQDLAVILDLPALPHRIEGYDISHIQGSNAVASGVVFIDGVAANQHYRHYKIKNPEVKIGHSDDFASLAEVIRRRFRRYAENPDNIAESDDFPDLVMIDGGKGQLSAVVAVLGEMNLLEQVKVVSLAK---QREEIFLPGESSPLETDKEQPGVQLLRRVRDEAHRFAVSFHRQQRMQKSRRSRLDEIPGLGFKRQKELLAHFHSLDYIREASLEQLQQVTGIGEQLAKEI 618
>gi|153807188|ref|ZP_01959856.1| hypothetical protein BACCAC_01466 [Bacteroides caccae ATCC 43185] >gi|149130308|gb|EDM21518.1| hypothetical protein BACCAC_01466 [Bacteroides caccae ATCC 43185] (609 aa)
Score = 694, Expect = 8.9e-71, Identities = 193/587 (32%), Positives = 333/587 (56%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKC--NKLPNK-------KCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIK---FLNPSKGVKKDVMDTAFNNAVEIMKNKYLQL--ISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIV-KWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           N+ +K  +  +P KPG Y + +  G +IYVGKA +L  R+  YF K+ +  KT+ L ++I D+ Y+VVN E ++LLLENNLI KYKP+YN+LL++   +P I V  E  PRI  +    +    +YYGP+++     Y + + I  ++PLR C  N  P          C+ Y I  C GPCI   ++++Y   + EI +   G ++ I   L +K    A ++ FE++QK  E    ++ +  + +++ +  ++ D+      ++  + + + ++    +++      F  E  + L     E  +   IE+ +  Y S S E +      L++    F  P +G KK ++D +  N  +   ++  Q   ++ + R +  ++E+Q+ L + +   ++E FDNSNI  ++ V A VV++    +K +YRK+NIK      DY  MKEV+ RRY+        +P+LII DGGK Q++   E ++  EL   IP+ GLAKD++H+T  ++  +    I + + + L+  L  IQDEVHRFAISF+R+K+SK    ++L  IK +G+     LL++++++ +IKEAS+E++S I+    AK +K+
  S:    10 NKYLKGIVANLPEKPGIYQYLNAEGTIIYVGKAKNLKKRVYSYFSKEHEPGKTRVLVSKIADIRYIVVNTEEDALLLENNLIKKYKPRYNVLLKDDKTYPSICVQNEYFPRIFRTRKIIRN-GSSYYGPYSHIP-SMYAVLDLIKHLYPLRTCSLNLTPENIRAGKFNVCLEYHIKNCAGPCIGLQSQEEYLKNIDEIKEILKGNTQEISRMLLEKMQTLAGEMKFEEAQKIKEKYLLIENYRSKSEVVSAVLHNIDVFSIEEDDSNSAFINYLHITNGAINQ-----AFTFEYKKKLNESKEELLTLGIIEM-RERYKSRSREIIVPFELDLELNNVVFTVPQRGDKKKLLDLSILNVKQYKADRMKQAEKLNPEQRSMRLMKEIQQELHLERPPLQIECFDNSNIQGSDAVAACVVFKKAKPSKKDYRKYNIKTVVGPDDYASMKEVVKRRYQRAIEESSPLPDLIITDGGKGQMEVVREVIED-ELGLNIPIAGLAKDNRHRTSELLFGFPPQTIGIKQHTPLFRLLTQIQDEVHRFAISFHRDKRSKRQVASALDSIKGIGEKTKTALLKEFKSVKRIKEASLEDISAIIGEAKAKTVKE 604
>gi|77165121|ref|YP_343646.1| excinuclease ABC subunit C [Nitrosococcus oceani ATCC 19707] >gi|90111071|sp|Q3JAN0|UVRC_NITOC UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|76883435|gb|ABA58116.1| Excinuclease ABC subunit C [Nitrosococcus oceani ATCC 19707] (599 aa)
Score = 694, Expect = 9.2e-71, Identities = 187/585 (31%), Positives = 311/585 (53%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSEL--DEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDR---IVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           N  I D L+ +   PG Y   D  G V+YVGKA +L  RIK YF   +   K   L  +ICD+   V + ENE+L+LE+NLI   +P+YN+LLR+  ++PYI ++ ++ PR+ + H   K++ G Y+GP+ N     ++    + R+FP+R+C     +  ++ C+ Y I +C  PC+  ++++DY   ++ +  F  G+ + +  +L  +  +A+ +L FE +  Y +   +L+    RQ  I  +K D D++G    E +  + +F    G  L     +      L  +E+L T I +YY  +  E P  + LS   + +  L+E L      KI  + P +G K   +  A  NA +I  N++L   SN      SL++L  L +     R+E FD S+I  T  V + VV++     K +YR+FNI       DY  +++ + RR+K     F   P+L+++DGGK Q+  +L  LK + +  I  V+G+AK  + K       +    + + +   S     L +I+DE HRFAI  +R +++K    + L  I  LG  R  KLL +   L +I  A VE+L+QI  + +E+A+ I
  S:     3 NFDIDDFLRNLTPCPGVYRMLDAKGKVLYVGKAKNLKRRIKSYFRNSKLAPKIHVLVKQICDIKITVTHTENEALILESNLIKALQPRYNVLLRDDKSYPYIFLSADDFPRLGF-HRGVKQVSGQYFGPYPNIR-SVWQTLKLLQRVFPVRQCEDNFYRNRSRPCLQYQIKRCTAPCVGLISKKDYSQDIQHVVMFLKGRDQQVINELVIRMEEASGQLAFEQAAYYRDRIASLRQIQARQ-YISGEKKDIDVLGVALTEKMACVEVFFIRGGHNLGNKTFLPKLEGNLTPEELLSTFIAQYY--LNRETPPILILSHQPKDMGLLTEVLSKQAGRKIALIKPVRGPKVQWIKMALANA-KINLNQHLAEKSNITARFKSLQQLLSLANFPQ--RIECFDVSHIQGTATVASCVVFDREGPRKADYRRFNITGIIPGDDYGALRQALMRRFKKKEGVF---PDLLVIDGGKGQINQSLRVLKEIGITEIT-VLGIAKGPERKAGNETLFLAGYENPVMVTSDSPALHILQHIRDEAHRFAIVSHRKRRAKGGKLSLLEGISGLGPKRRRKLLIQLGGLQEITRAGVEDLAQIEGISLELAQRI 593
>gi|160875788|ref|YP_001555104.1| excinuclease ABC subunit C [Shewanella baltica OS195] >gi|189038090|sp|A9L582|UVRC_SHEB9 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|160861310|gb|ABX49844.1| excinuclease ABC, C subunit [Shewanella baltica OS195] (609 aa)
Score = 694, Expect = 9.5e-71, Identities = 188/578 (32%), Positives = 328/578 (56%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYYSKIAIE--LPKTVYLSLSDEKLKTL----SESLKIKFLNPSKGVKKD---VMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKD-LYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL--KFLELDSIIPVIGLAKDDKHKT--DRIVKWDF-SEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           L+ +    G Y   D    VIYVGKA DL  R+  YF K+  ++KT+ L + I  +D  + ++E ++LLLEN+ I +Y PKYN+LLR+  ++PYIL+++ EHPR+ Y H   ++ KG Y+GP+ N    +  L+  + ++FP+R+C+ L     ++ C+ Y I +C  PC+ KV+  DY+  +K  + F  GK + +   L  K   AAE+  +E + ++ +    L+  +E+Q++  + K D D+IG +    +    +     G +    S Y  +    +++DE+L + I ++Y    I+  +PK V +S + E+L  L    SE+L  KF +    V+ D    +  A  NA     N  +  +S++N        L+++L++   + RME FD S+    + V + VV+     +K EYR++NI+      DY  MK+ + RR+    A  G+IP+++ +DGG  Q++ A + +  KF+ LD    +IG+AK +  K   + ++  D  +   L+  S     + +I+DE HRFAI+ +RN++ K+   ++L  I  +G  R + LL+    L ++K ASV EL ++  + IE+A+ I
  S:    11 LRTVSSSAGVYRMYDVKNDVIYVGKAKDLKKRLTSYFRKNLANVKTQALVSHIHHIDVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEHPRLAY-HRGPQREKGHYFGPYPNGGAVRESLH-LMQKLFPIRQCDDLYYKSRSRPCLQYQISRCSAPCVGKVSNADYDEQVKLASLFLKGKDQQVISALVDKMELAAERQAYEQAARFRDQIMALRKVAEQQEVS-NNKGDMDVIGVHYSSGIACFHLLFIREGKIFGSRSYYPSVPA-QTDMDEVLRSFILQFYLNADIQRTIPKEVVISHNFEELHELEAAISEALDKKF-SIKTNVRADRASFLRLAVTNAT----NAVVTRLSHKNTVEQRFVLLEEILELSTPIQRMECFDISHTMGESTVASCVVFNREGPHKGEYRRYNIEGITPGDDYAAMKQAVSRRFDKIEAG-GKIPDILFIDGGLGQLRIAQKIVDEKFVHLDKAPQLIGVAKGEGRKPGLETLILGDTETSFSLEGDSPALHLIQHIRDESHRFAITGHRNRRQKTRNTSTLESIPGIGPKRRKALLQHLGGLQEVKGASVAELVKVPGISIEMAQTI 603
>gi|85712392|ref|ZP_01043442.1| excinuclease ABC subunit C [Idiomarina baltica OS145] >gi|85693835|gb|EAQ31783.1| excinuclease ABC subunit C [Idiomarina baltica OS145] (605 aa)
Score = 694, Expect = 1.0e-70, Identities = 183/575 (31%), Positives = 323/575 (56%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRD-LKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL----SKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKL------KTLSESL--KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKL-LDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHK---TDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           L+ + H+PG Y   D++G VIYVGKA DL  R+  YF +  D +KT+ L  +I D+D  V N E E+L+LEN  I KY+P+YN+LLR+  ++PYI++T   HPR+ + H   ++ KG Y+GPF N    +  L   + ++FP+R+C     +  ++ C+ Y + +CL PC+   T ++Y+  ++    F +GK++ + +QL  +   A+E L FE + +Y +    L+   ER  +  +Q+ + D+IGF  + N ++ V   ++  + L    S +  +    S+ +E+L   + ++Y   +        + L DE        + L E++  K++ L+  +G +K     A  NAV  ++ K L   S  NR  ++L+++ +L + I+   RME FD S+      V + VV++     K++YR++NI       DY  M + + +RY +N    G IP+++ +DGGK Q+  A         D+ + +IG+AK +  K      I+      I L+K +     + +I+DE HRFAI+ +R K++K    +SL +I+ +G  R +K+L+    L ++K AS+++L+ +  I  A
  S:    11 LRHLTHQPGVYRMYDESGDVIYVGKAKDLRKRVSSYFREKVDRVKTQVLVKQIADMDVTVTNTEAEALILENTFIKKYRPRYNVLLRDDKSYPYIIMTDHTHPRLGF-HRGARRQKGEYFGPFPNGAAVRESL-RLMQKLFPIRQCEDAYYRARSRPCLQYQLKRCLAPCVNVCTDEEYDEQVQLARQFLNGKNQQVIDQLVTRMENASESLDFERAARYRDQIAMLRRTQERNSVTGAQE-ELDVIGF-ARGNGVTTVQMLFIRDNHLQGSRSYFPKVPADTSD-EEVLQAFLLQFYLNQSSGRKTPAEIVLPDEIKHDPVLGEVLGEAVGRKVRLLHNVRGERKQYQQLAKKNAVNALEGK-LNQQSTMNRRTSALQQVLELGIPIQ---RMECFDISHTMGQQTVASCVVFDQNGPKKSDYRRYNITGITPGDDYAAMAKALAKRY-DNAKENGNIPDILFIDGGKGQLAQAENYFADWGKDAPM-LIGVAKGESRKPGLETLIMAGSHETIPLNKDASALHLIQHIRDESHRFAITGHRQKRNKVKRTSSLEEIEGIGAKRRQKILKNLGGLQEVKNASIDQLANVPGISRA 595
>gi|163724359|ref|ZP_02131889.1| excinuclease ABC, C subunit [Desulfatibacillum alkenivorans AK-01] >gi|161402198|gb|EDQ26436.1| excinuclease ABC, C subunit [Desulfatibacillum alkenivorans AK-01] (603 aa)
Score = 693, Expect = 1.0e-70, Identities = 192/583 (32%), Positives = 330/583 (56%)
  Q:     4 QIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK--DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILV-TKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKC-NKLP---NKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDD---KHKTDRIVK-WDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEV--AKEI 586
           +I+ KL  + + PG YL KD++G +IYVGKA  L  R+  YFL+  +RDLKT  L  +I   D ++V  E E+L+LE NLI K+KP+YN+LL++   FP + +  +  +PR+       KK    Y+GPF+++   +  L   IN+ F LRKC  K P   N+ C+ Y +GQCLGPC   V R +Y   + E+  F  G++  + ++++++   A+E+  +E + +  +    ++   E+Q  + +   D D+IG   +E   S +   Y+ G  L     Y+   V  ++  E +   + +YY K    +P  V++    E ++ + + L      ++    P +G K  +++ A  NA E +K++    IS++N   + LE LQK L + +   R+E FD S+      V +M+V+E+G + K+EYR FNI   D   DY  M EV+ RR+  +       P+++++DGGK Q+      L  L +     VI +AK D   K   D+I +    + +   +  D+  FL  ++DE HRFAI+ +R K++K++ +++L  +  +G+ R + LL  + ++ ++KEAS E+++Q+  I V  A+EI
  S:     3 EIEKKLATLSNGPGVYLMKDESGEIIYVGKARSLKKRVSSYFLEKPNRDLKTGILVKKIASFDAILVTTEKEALILEANLIRKHKPRYNILLKDGKRFPSLRIDVRTSYPRLEVVR-KVKKDGAIYFGPFSSAGKLRSTL-KIINKTFQLRKCKQKEPPKRNRPCLNYQMGQCLGPCCLPVDRDEYLDMVNEVILFLKGRTNDLLQKIKEQMAAASERQEYELAARLRDRMFAIQATVEKQAAVTTDFVDRDVIGID-REPEGSAISVLYIRGGFLLGSRNYNFDEVLGTD-SESIQAFLRQYYDKDRF-IPDEVFVPCQLENMELMEQWLTETAEKRVVLHWPQRGEKTRLIEMANENAHEALKDR----ISSENVFKSLLERLQKRLRMDRPPRRIECFDISHTGGNQTVASMIVFEDGKEAKSEYRTFNIDSLDHPDDYAAMHEVMARRFSPDKD--WPTPDVLLIDGGKGQLSITASVLDGLGVMGAFEVISIAKKDEAQKETMDKIYRPGQANPVVFGRDGDVLLFLQRVRDEAHRFAITTHRKKRAKTIRKSALDSVPGIGEKRKKALLRHFGSIKRLKEASPEDIAQVPGISVKRAQEI 597
>gi|85707930|ref|ZP_01038996.1| excinuclease ABC subunit C [Erythrobacter sp. NAP1] >gi|85689464|gb|EAQ29467.1| excinuclease ABC subunit C [Erythrobacter sp. NAP1] (653 aa)
Score = 693, Expect = 1.1e-70, Identities = 185/584 (31%), Positives = 312/584 (53%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTK--KLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKE-EHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDE--ILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL-------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQ--NRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN----------NTASFGEI-PNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDF---SEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           E I++ +K +   PG Y   D  G V+YVGKA  L  R+  Y  +   L T+  ++ ++   ++ V  N+E E+LLLE  LI +++P +N+LLR+  +FP+IL+  + E PRI + H   ++ KG YYGPFA++      L N + ++F LR C        ++ C+ Y I +C  PC+ +++ +DY+  + +  DF +GKS  +   LEK+  +AAE+L FE +    +  +        Q I      D D+     K   I +  F    G              ++ E  +L  ++ ++Y ++    P  + L   D     L E+        K++   P +G ++ +M  A  NAV+ +  +  +  +    NREL    EL +  +     R+E++DNS+I     VGAMVV       K++YRKFNI++   N D+  M+EV+ RR++N             S   I P+L+++DGGK QV + +E L+ L +   +PV+G+AK   H  +    + F    E  L   S + F+   ++DEVHR+ I  +R K+SK++  + L +I  +G  R   LL  + T  K++ A++E+L +   V   VA++I
  S:    39 EAIRETVKTLKPVPGVYRMLDARGDVLYVGKARSLKARVANY-TQVNQLTTRLMRMVSQCRSMEIVTTNSEAEALLLEAQLIKRFRPPFNVLLRDDKSFPFILLRADHEFPRI-HKHRGARRAKGNYYGPFASAGSVNTTL-NALQKLFLLRSCTDSFFNNRDRPCLLYQIKRCSAPCVDRISVEDYDALVSQAKDFLAGKSSQVQADLEKQMAKAAEELDFETAAILRDRLRAATFIQGSQAINAKAVGDADVFALAAKGGQICVQAFFIRGGQNWGHRAFFPSHTKDVGEAQVLADVMLQFYEEVP---PPPMVLVDRDLPEGELMEAALTEIADKKVQISIPQRGDRRKLMAQASRNAVDALDRRLAETGTKAKVNRELAEFLELGEPPE-----RIEVYDNSHIQGAKAVGAMVVASPEGFEKSQYRKFNIREAQTNDDFGMMREVMRRRFRNLAENPDGESGKKNSHETIWPDLVLIDGGKGQVSSVMEVLEELGIADEVPVVGIAKGPHHGREGREVFHFPDGREKTLPTNSPVLFYAQRLRDEVHRYVIGAHRAKRSKAITASPLDEIPGIGPARKRALLLHFGTASKVRAAALEDLQRAPGVSDAVARKI 645
>gi|153009916|ref|YP_001371131.1| excinuclease ABC subunit C [Ochrobactrum anthropi ATCC 49188] >gi|151561804|gb|ABS15302.1| excinuclease ABC, C subunit [Ochrobactrum anthropi ATCC 49188] (691 aa)
Score = 693, Expect = 1.2e-70, Identities = 181/575 (31%), Positives = 299/575 (52%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK---------------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           +K++P+ PG Y   + +G V+YVGKA +L  R+  Y        +  ++  E   +++VV   E E+LLLE NLI + +P++N+L+R+  +FPYIL+T +     ++ H   +  KG Y+GPFA++      + N + R F LR C     +   + C+ + I +C GPC  +++ +DY   + E   F SGKS+S+ + L      A+  L FE +  Y +    L      Q I      + D+   + +  +  I +F +  G             S L   E+L   + ++Y       P+ V LS + E+   ++E+L      K++   P +G KKD++D A  NA E +  + L   S+Q R L  + E   L   +   R+E++DNS+I  TN VG M+V       KN+YRKFNI+  D     D+  M+EVI RR+                  T +F   P++I++DGG+ QV A  + L  L +  ++  IG+AK  D +   +R          L  +  + +F+  ++DE HRFAI  +R ++ K + +N L +I  +G +R   LL  + T   +  A+V +L QI  I  A
  S:    79 VKRLPNNPGVYRMFNSDGDVLYVGKARNLKKRVSNYARGIGHSNRITRMIRETVTMEFVVTRTETEALLLEANLIKRLRPRFNVLMRDDKSFPYILLTGDHRAPGIFKHRGARSRKGDYFGPFASAGAVGRTI-NALQRAFLLRTCTDSVFETRTRPCLLFQIKRCSGPCTHEISDEDYAELVNEAKAFLSGKSQSVKDHLATAMQAASADLDFEHAAVYRDRLAALSHVQSHQGINPQTVEEADVFAIHQEGGMTCIQVFFFRTGQNWGNRAYFPKADSSLGPAEVLGAFLSQFYDDKPC--PRLVLLSETVEEQSLIAEALSTRAGHKVQVNVPQRGEKKDLVDHALTNAREALGRR-LAETSSQARLLQGMAETFGL--SQPPRRIEVYDNSHIMGTNAVGGMIVAGPEGFVKNQYRKFNIRSTDITPGDDFGMMREVIERRFSRLVKEHGTPEEPADAEVTDTFPAWPDVILIDGGQGQVGAVRQILGELGISHLVNAIGIAKGVDREAGRERFFVEGKQAFTLPPRDPVLYFIQRLRDEAHRFAIGTHRARRKKEMVKNPLDEIAGIGPSRKRALLHHFGTAKAVSRAAVADLMQIEGISEA 679
>gi|189464896|ref|ZP_03013681.1| hypothetical protein BACINT_01240 [Bacteroides intestinalis DSM 17393] >gi|189437170|gb|EDV06155.1| hypothetical protein BACINT_01240 [Bacteroides intestinalis DSM 17393] (611 aa)
Score = 693, Expect = 1.3e-70, Identities = 197/587 (33%), Positives = 326/587 (55%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKC---------NKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIK---FLNPSKGVKKDVMDTAFNNAVEIMKNKYLQL--ISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIV-KWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           +E +K  +  +P  PG Y + +  G++IYVGKA +L  R+  YF K+ +  KT+ L ++I D+ Y+VVN E ++LLLENNLI KY+P+YN+LL++   +P I V  E  PR+  +    +    +YYGP+++       L + I  ++PLR C         N      C+ Y I  C GPCI K +  DY   + EI +   G ++ I   L ++  + A  + FE++QK  E    ++ +  + +++ +  ++ D+       +  S     +VN   ++   +   F  E  + L     E      IE+ +  Y SLS E +      +++K   F  P +G KK ++D +  N  +   ++  Q   ++ + R +  ++E+Q  L +  L  ++E FDNSNI  ++ V A VV++    +K +YRK+NIK      DY  MKEV+ RRY+        +P+L+I DGGK Q+ A  E L  L L+  IP+ GLAKD KH+T  ++  +    I L + + L+  L  IQDEVHRFAI+F+R+K+SK    + L +IK +G+     LL++++++ +IKEAS+E L+++     AK IK+
  S:    10 SEYLKGIVLNLPESPGIYQYLNTEGVIIYVGKAKNLKRRVSSYFNKEHEPGKTRVLVSKIADIRYIVVNTEEDALLLENNLIKKYRPRYNVLLKDDKTYPSICVQNEYFPRVFKTRKIIRN-GSSYYGPYSHIP-SMNALLDLIKHLYPLRTCSLNLSPENINAGKFNVCLEYHIKNCAGPCIGKQSLDDYLKNIGEIKEILKGNTQEIQRHLFQQMQELATDMKFEEAQKVKEKYMLIENYRAKSEVVSNILHNIDVFSIEEDSDEKS----AFVNYLHITNGAINQAFTFEYKKRLNETKEELLELGIIEM-RERYKSLSREIIVPFEVDMELKDVVFTIPQRGDKKKLLDLSILNVKQYKADRMKQAEKLNPEQRNVRLMKEIQDELHLDRLPMQIECFDNSNIQGSDPVAACVVFKKAKPSKQDYRKYNIKTVVGADDYASMKEVVKRRYQRAIEENAPLPDLLITDGGKGQMSAVKEVLDELNLN--IPIAGLAKDGKHRTSELLYGFPPQTIGLKQNTPLFRLLTQIQDEVHRFAITFHRDKRSKRQIASELDEIKGIGEKTKAALLKEFKSVKRIKEASLEALAKVTGEAKAKVIKE 604
>gi|153001116|ref|YP_001366797.1| excinuclease ABC subunit C [Shewanella baltica OS185] >gi|189038089|sp|A6WPJ5|UVRC_SHEB8 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|151365734|gb|ABS08734.1| excinuclease ABC, C subunit [Shewanella baltica OS185] (609 aa)
Score = 692, Expect = 1.4e-70, Identities = 187/578 (32%), Positives = 328/578 (56%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYYSKIAIE--LPKTVYLSLSDEKLKTL----SESLKIKFLNPSKGVKKD---VMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKD-LYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL--KFLELDSIIPVIGLAKDDKHKT--DRIVKWDF-SEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           L+ +    G Y   D    VIYVGKA DL  R+  YF K+  ++KT+ L + I  +D  + ++E ++LLLEN+ I +Y PKYN+LLR+  ++PYIL+++ EHPR+ Y H   ++ KG Y+GP+ N    +  L+  + ++FP+R+C+ L     ++ C+ Y + +C  PC+ KV+  DY+  +K  + F  GK + +   L  K   AAE+  +E + ++ +    L+  +E+Q++  + K D D+IG +    +    +     G +    S Y  +    +++DE+L + I ++Y    I+  +PK V +S + E+L  L    SE+L  KF +    V+ D    +  A  NA     N  +  +S++N        L+++L++   + RME FD S+    + V + VV+     +K EYR++NI+      DY  MK+ + RR+    A  G+IP+++ +DGG  Q++ A + +  KF+ LD    +IG+AK +  K   + ++  D  +   L+  S     + +I+DE HRFAI+ +RN++ K+   ++L  I  +G  R + LL+    L ++K ASV EL ++  + IE+A+ I
  S:    11 LRTVSSSAGVYRMYDVKNDVIYVGKAKDLKKRLTSYFRKNLANVKTQALVSHIHHIDVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEHPRLAY-HRGPQREKGHYFGPYPNGGAVRESLH-LMQKLFPIRQCDDLYYKSRSRPCLQYQLSRCSAPCVGKVSNADYDEQVKLASLFLKGKDQQVISALVDKMELAAERQAYEQAARFRDQIMALRKVAEQQEVS-NNKGDMDVIGVHYSSGIACFHLLFIREGKIFGSRSYYPSVPA-QTDMDEVLRSFILQFYLNADIQRTIPKEVVISHNFEELHELEAAVSEALDKKF-SIKTNVRADRASFLRLAVTNAT----NAVVTRLSHKNTVEQRFVLLEEILELSTPIQRMECFDISHTMGESTVASCVVFNREGPHKGEYRRYNIEGITPGDDYAAMKQAVSRRFDKIEAG-GKIPDILFIDGGLGQLRIAQKIVDEKFVHLDKAPQLIGVAKGEGRKPGLETLILGDTETSFSLEGDSPALHLIQHIRDESHRFAITGHRNRRQKTRNTSTLESIPGIGPKRRKALLQHLGGLQEVKGASVAELVKVPGISIEMAQTI 603
>gi|117920057|ref|YP_869249.1| excinuclease ABC subunit C [Shewanella sp. ANA-3] >gi|189038095|sp|A0KVM4|UVRC_SHESA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|117612389|gb|ABK47843.1| Excinuclease ABC subunit C [Shewanella sp. ANA-3] (609 aa)
Score = 692, Expect = 1.5e-70, Identities = 186/578 (32%), Positives = 327/578 (56%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK----CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYYSKIAIE--LPKTVYLSLSDEKLKTL----SESLKIKFLNPSKGVKKD---VMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIK-DLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL--KFLELDSIIPVIGLAKDDKHKT--DRIVKWDF-SEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           L+ +    G Y   D  G VIYVGKA DL  R+  YF K+  ++KT+ L + I  +D  + ++E ++LLLEN+ I +Y PKYN+LLR+  ++PYI +++ EHPR+ Y H   ++ KG Y+GP+ N    +  L+  + ++FP+R+C+ L  K     C+ Y + +C  PC+ KV+  +Y+  +K  + F  GK K +  +L  K  +AA +  +E + ++ +    L+  +E+Q++      D D+IG +    +    +     G +    S Y  +    ++++E+L + + ++Y    I+  +PK V +S   E+L  L    SE+L  KF +    V+ D    +  A  NA     N  +  +S++N        L+++L++   + RME FD S+    + V + VV+     +K EYR++NI+      DY  MK+ I RR+    AS G+IP+++ +DGG  Q++ A + +  KF+ LD    +IG+AK +  K   + ++  D  +   L+  S     + +I+DE HRFAI+ +RN++ K+   ++L  I  +G  R + LL+    L ++K ASV EL+++  + IE+A+ I
  S:    11 LRMVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRKNLGNVKTQALVSHIHHIDVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYIFLSQHEHPRLAY-HRGPQREKGYYFGPYPNGGAVRESLH-LMQKLFPIRQCDDLYYKSRTRPCLQYQLSRCSAPCVGKVSNAEYDEQVKLASLFLKGKDKQVISELVAKMEEAAGQQAYEQAARFRDQIMALRRVAEQQEVS-GNTGDMDVIGVHYASGIACFHLLFIREGKIFGSRSYYPTVPA-QTDIEEVLRSFLLQFYLNADIQRTIPKEVVISHHFEELHELEAAVSEALNKKF-SIKTNVRADRASFLRLALTNAT----NAVMTRLSHKNTVEQRFVLLEEILELNAPIQRMECFDISHTMGESTVASCVVFNREGPHKAEYRRYNIEGITPGDDYAAMKQAISRRFDKIDAS-GKIPDILFIDGGLGQLRIAQQIVDEKFVNLDKAPQLIGVAKGESRKPGLETLIFGDTETSFSLEDDSPALHLIQHIRDESHRFAITGHRNRRQKTRNTSTLESIPGIGPKRRKALLQHLGGLQEVKGASVAELAKVPGISIEMAQTI 603
>gi|78186373|ref|YP_374416.1| excinuclease ABC subunit C [Pelodictyon luteolum DSM 273] >gi|119367681|sp|Q3B5K8|UVRC_PELLD UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|78166275|gb|ABB23373.1| Excinuclease ABC subunit C [Pelodictyon luteolum DSM 273] (628 aa)
Score = 692, Expect = 1.7e-70, Identities = 191/573 (33%), Positives = 325/573 (56%)
  Q:     4 QIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN---------KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL-SKYDLITVFYSELDEILLTLIYE-YYSKIAIELPKTVYLS----LSD-EKLKTLSESLK---------IKFLNPSKGVKKDVMDTAFNNAVEIMKNKYL---QLISNQNRELNSLEELQKLLDIKD-LYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKD-EDA-----NSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFS-EIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQ 576
           ++++ +  +P  PG Y +K+  G VIYVGKA ++ +R++ YF   R L  KT+ L   I D++ ++ ++E E+L+LENNLI + KP+YN+ L++   +P++++T E  PR+  S + T+  K T++GP+  +  +   +   I  IFP+R C             +K C+ Y IG+C GPC       +Y   + EI     G++  + ++L +K + AA +L FE++ +     ++L+ +++RQ ++ +   D D+      ++    V+F+   G +L +++ ++T    E ++ LL  + E YY K    +P+ V LS    L D E L+ LS   +         +KF  P  G K  +++    NA   +  +YL   Q      RE   ++ L + L ++    R+E FDNS++  T+ V +MV + NG   K+ YRKF ++  E+A     + DY  M++V+ RRY  +      +P+LI+VDGGK Q  +A + L  L +   +PVIGLAK    + + +   D      L K S     L  ++DE HRFAI+++RN +SK   E  L  I  +G+     LLE++ ++D +  AS EELSQ
  S:    11 ELRETVASLPTGPGIYQFKNSAGKVIYVGKAKNIRSRVRSYFRDPRQLTGKTQVLVGHITDLEIIITSSEVEALILENNLIKELKPRYNVNLKDDKTYPWLVITGEPFPRVFISRNRTRD-KSTWFGPYTEAG-QLRSILELIGSIFPVRSCRYSLTPENIAAKKHKLCLDYHIGKCKGPCEGLQNEAEYLEMIGEIVRLLKGRTAGLLKELHEKMLTAAAELRFEEAAELKMQLQSLRRYADRQKMVAADGMDRDVSAIASGDDEACGVVFRIREGKMLGARHFILTNTAGEPEKKLLGKVLEGYYLKSPEAMPEEVLLSAQLDLEDTESLQALSREREEECPTRRKAVKFTVPQIGEKAHLVEMCRQNARHHLA-EYLVQKQKRGEAAREHYGVKALGESLHLETPPKRIECFDNSHLQGTDYVSSMVCFVNGKPLKSAYRKFRLQSLEEACGTGSSDDYAAMEQVLGRRYGGSLQDELPLPDLIVVDGGKGQANSAKKVLDRLGI--TVPVIGLAK----RLEEVFTPDADGPFNLPKTSPALKLLQQLRDEAHRFAITYHRNIRSKRTLETGLTTIPGVGEKIAFALLERFGSVDGVAAASAEELSQ 612
>gi|170726504|ref|YP_001760530.1| excinuclease ABC, C subunit [Shewanella woodyi ATCC 51908] >gi|169811851|gb|ACA86435.1| excinuclease ABC, C subunit [Shewanella woodyi ATCC 51908] (609 aa)
Score = 691, Expect = 1.8e-70, Identities = 184/578 (31%), Positives = 315/578 (54%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYYSKIAIE--LPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL--KFLELDSIIPVIGLAKDDKHK---TDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           L+ +   PG Y   D    VIYVGKA DL  R+  YF K+  ++KT  L + I ++D  V ++E ++LLLEN+ I +Y P+YN+LLR+  ++PYIL++  +HPR+ Y H   K+ KG+Y+GP+ N    +  L+  + +IFP+R+C     K  ++ C+ Y IG+C  PC+ K+  ++Y   +K  + F  G+ + +  +L  K   AA  L +E + ++ +    L+  +E+Q++  +   D D+IG Y    V    +    +G +    S Y  +    +ELDE+L + + ++Y     +  +PK + LS     L  L +++      K++     +  +   +  A  NA   + N  L   S   +    LEE  ++   K + RME FD S+    + V + VV+     NK EYR++NI       DY  MK+ + RR+ N   S G++P+++ +DGG  Q++ A + +  KF  LD    +IG+AK +  K      I   +     L   S     + +I+DE HRFAI+ +RNK+ K+   ++L  I  +G  R + LL+    + ++K ASV EL+++  + +E+A+ I
  S:    10 LQSVSSSPGVYRMYDSEETVIYVGKAKDLKKRLTSYFRKNLPNVKTHALVSHIANIDVTVTHSETDALLLENDYIKQYMPRYNVLLRDDKSYPYILLSHHKHPRLAY-HRGPKRHKGSYFGPYPNGGAVRESLH-LMQKIFPIRQCEDVYYKARSRPCLQYQIGRCSAPCVAKINDEEYAAQVKLASLFLKGRDQQVMSELVLKMETAAHMLEYEQAARFRDQISALRRVAEQQEVSHTS-GDMDVIGAYYASGVACFHLLFIRDGKIFGSRSYYPKVPA-QTELDEVLSSFMLQFYLNADSQRTVPKEILLSHDFADLPVLVDAIQSALDKKVEIKTKVRSERAKFLKLALTNATNAV-NTRLSHKSTVEQRFLLLEEAIEV--SKAVTRMECFDISHTMGESTVASCVVFNREGPNKAEYRRYNISGITPGDDYAAMKQALTRRFDNIEKS-GKVPDILFIDGGTGQLRIAQKVVDEKFANLDVAPLLIGVAKGEGRKPGLETLIYGENEQSFTLPADSGALHLIQHIRDESHRFAITGHRNKRQKTRNTSTLESIAGVGPKRRKALLQYLGGIQEVKGASVSELAKVPGISVEMAQTI 602
>gi|146292740|ref|YP_001183164.1| excinuclease ABC subunit C [Shewanella putrefaciens CN-32] >gi|189038094|sp|A4Y5Y2|UVRC_SHEPC UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|145564430|gb|ABP75365.1| Excinuclease ABC subunit C [Shewanella putrefaciens CN-32] (609 aa)
Score = 691, Expect = 2.0e-70, Identities = 189/578 (32%), Positives = 330/578 (57%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRD-LKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYYSKIAIE--LPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDV-MDTA--FNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKD-LYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL--KFLELDSIIPVIGLAKDDKHKT--DRIVKWDF-SEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           L+ +    G Y   D  G VIYVGKA DL  R+  YF K+ D +KT+ L + I  +D  + ++E ++LLLEN+ I +Y PKYN+LLR+  ++PYIL+++ EHPR+ Y H   ++ KG Y+GP+ N    +  L+  + ++FP+R+C+ L     ++ C+ Y + +C  PC+ KV+  DY+  +K  + F  GK + +   L  K  QAA++  +E + ++ +    L+  +E+Q++  + K D D+IG +    +    +     G +    S Y  +    +++DE+L + I ++Y    I+  +PK V +S + E+L  L  ++ I  LN    +K +V  D A     AV    N  +  +S++N        L+++L++   ++RME FD S+    + V + VV+     +K EYR++NI+      DY  MK+ I RR+    A  G+IP+++ +DGG  Q++ A + +  KF+ LD    +IG+AK +  K   + ++  D  +   L+  S     + +I+DE HRFAI+ +RN++ K+   ++L  I  +G  R + LL+    L ++K ASV EL ++  + IE+A+ I
  S:    11 LRTVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRKNLDNVKTQALVSHIHHIDVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEHPRLAY-HRGPQREKGHYFGPYPNGGAVRESLH-LMQKLFPIRQCDDLYYKSRSRPCLQYQLSRCSAPCVGKVSNADYDEQVKLASLFLKGKDQQVISTLVAKMEQAAQQQEYEQAARFRDQIMALRKVAEQQEVS-NNKGDMDVIGVHYASGIACFHLLFIREGKIFGSRSYYPSVPA-QTDMDEVLRSFILQFYLNADIQRTIPKEVVISHNFEELHELEAAVSIA-LNKKFSIKTNVRADRASFLRLAVTNATNAVITRLSHKNTVEQRFVLLEEILELSTPIHRMECFDISHTMGESSVASCVVFNREGPHKGEYRRYNIEGITPGDDYAAMKQAITRRFDKIEAG-GKIPDILFIDGGLGQLRIAQKIVDEKFVHLDKAPQLIGVAKGEGRKPGLETLILGDTETSFSLEGDSPALHLIQHIRDESHRFAITGHRNRRQKTRNTSTLESIPGIGPKRRKALLQHLGGLQEVKGASVAELVKVPGISIEMAQTI 603
>gi|163842969|ref|YP_001627373.1| excinuclease ABC subunit C [Brucella suis ATCC 23445] >gi|163673692|gb|ABY37803.1| excinuclease ABC, C subunit [Brucella suis ATCC 23445] (690 aa)
Score = 691, Expect = 2.1e-70, Identities = 182/575 (31%), Positives = 296/575 (51%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK-------------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           +K++P+ PG Y   + +G V+YVGKA +L  R+  Y        +  ++  E   +++VV   E E+LLLE NLI + +P++N+L+R+  +FPYIL+T       ++ H   +  KG Y+GPFA++      + N + R F LR C     +   + C+ Y I +C  PC  +++ +DY   + E   F SGKS+S+ + L      A+  L FE +  Y +    L      Q I      + D+   + +  +  I +F +  G             S L   E+L   + ++Y       PK V LS + E+   ++E+L      K++   P +G KK+++  A  NA E +  + L   S+Q R L  L E   L   +   R+E++DNS+I  TN VG M+V       KN+YRKFNI+  D     D+  M+EVI RR+               N  +F   P++I++DGG+ QV A  + L  + +  ++  IG+AK  D +   +R          L  +  + +F+  ++DE HRFAI  +R ++ K +  N L +I  +G TR   LL  + T   +  A+VE+L QI  I  A
  S:    80 MKRLPNNPGVYRMFNSDGDVLYVGKARNLKKRVSNYARGIGHSNRITRMIRETVTMEFVVTRTETEALLLEANLIKRLRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASAGAVGRTI-NALQRAFLLRTCTDSVFETRTRPCLLYQIKRCSAPCTYEISDEDYAGLVAEAKAFLSGKSQSVKDHLAAAMQAASADLDFEHAAVYRDRLAALSHVQSHQGINPQTVEEADVFAIHQEGGMTCIQVFFFRTGQNWGNRAYFPKADSSLGPAEVLGAFLSQFYDDKPC--PKLVLLSETVEEQSLITEALSTRAGHKVQVSVPQRGEKKELVQHALTNAREALGRR-LAETSSQARLLQGLAETFGL--PRAPRRIEVYDNSHIMGTNAVGGMIVAGPEGFVKNQYRKFNIRSTDITPGDDFGMMREVIERRFSRLVKEHGTPAGEVENPDAFPAWPDVILIDGGQGQVGAVRQILGEMGISDLVTAIGIAKGVDREAGRERFFMEGKQPFTLPPRDPVLYFIQRLRDEAHRFAIGTHRARRKKEMVRNPLDEIAGIGPTRKRALLHHFGTAKAVSRAAVEDLMQIDGISEA 678
>gi|21674621|ref|NP_662686.1| excinuclease ABC, subunit C [Chlorobium tepidum TLS] >gi|32130301|sp|Q8KBI0|UVRC_CHLTE UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|21647822|gb|AAM73028.1| excinuclease ABC, subunit C [Chlorobium tepidum TLS] (626 aa)
Score = 691, Expect = 2.2e-70, Identities = 183/584 (31%), Positives = 322/584 (55%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD--RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN-KLPNKK--------CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYD--LITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTL----------SESLKIKFLNPSKGVKKDVMDTAFNNAV----EIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRI-VKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIKK 588
           + +KL  +P  PG Y + +  G VIYVGKA +L NR++ YF     +  KT  + + I D++ ++ ++E E+L+LENNLI + KP+YN+ L++  ++P++++T E  PRI  +    ++    Y+GP+  ++  +  L + I  IFP+R C  KL  +         C+ Y I +C GPC    + ++Y+  ++EI     GK+ ++   L  +  + A++L FE++       + LK ++ERQ I+ ++  D D+      E+    V+F+   G L+      L     + L  +L + +  YY +    +P+ + L     + +            +E  +++F  P  G K  ++    +NA     E M  K L+      R+  +LE L+++L +  L  R+E FDNS+   T+ V +MV + +G   K++YRKF +K  + + DY  M+E + RRY  + A    +P+L+++DGGK QV  A + L+ L LD  +PV GLAK    + + I V  +     L K S     L  ++DE HRFAI+++R  +S       L  IK +G+   EKLL+ + +++ + +AS++ELS +   + A+ I +
  S:    16 LAEKLATLPTSPGVYRFSNAAGTVIYVGKARNLRNRVRSYFNSQGRQPGKTAVMVSHIADLNVIITSSEVEALILENNLIKELKPRYNVNLKDDKSYPWLVITNERFPRIFLTR-QVRRDGSLYFGPYTEASQLRLIL-DLIGSIFPVRSCKYKLTEEAVASGRYRVCLDYHIHKCKGPCEGLQSEEEYQAMIREIVTLLKGKTSALLRDLSAEMQKKAKELKFEEAAALKAQIEGLKRYAERQKIVSTEAIDRDVFAVAAGEDDACGVVFRIREGKLIGSRHTYLSNTGNTPLPNLLASFVEHYYLETPDLIPQELMLQAELPEEELEALRQLLSSRQTERRQVRFTVPRIGEKAHLIAMCLDNAKHHLHEFMVQKKLR--GEIARKSPALESLKQVLHLGKLPERIECFDNSHFQGTDYVSSMVTFVSGKPKKSDYRKFRLKSFEGSDDYAAMREAVTRRYGGSLAGELPLPDLVLIDGGKGQVNVAWQVLQELGLD--LPVAGLAK----RLEEIYVPNEPDPYNLPKTSPALKLLQQLRDEAHRFAITYHRKLRSDRTIRTELTGIKGVGEKSAEKLLKHFGSVESVSKASIDELSAVAGRKTAESIYR 618
>gi|163754371|ref|ZP_02161493.1| excinuclease ABC, C subunit [Kordia algicida OT-1] >gi|161325312|gb|EDP96639.1| excinuclease ABC, C subunit [Kordia algicida OT-1] (596 aa)
Score = 690, Expect = 2.3e-70, Identities = 197/586 (33%), Positives = 327/586 (55%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN-KLPNKK--------CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDL-ITVFYSELDEILLTL-IYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQL-ISNQNRELNS-LEELQKLLDIKDLYR-MEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           M E ++ +LK +P  PG Y + DK+G ++YVGKA +L  R+  YF K+ +  KT+ L  +I  + ++VV  E ++LLLENNLI KY+P+YN++L++  ++P+I +  E  PR+  +    K     Y+GP+ +    +  L + I  ++PLR CN  L  +K        C+ Y +G CLGPC    T Q Y+  +  I +   G  K    Q + +    AE + FE +QK  E    L+ +  +  ++  + ++ D+      E+   I   +   GS++  + + I     E D+ LL L I E + +      K +Y+    E    + E  KI    P  G KK +++ +  NA      ++ Q+ +++ ++ +N  + +++K L + +  R +E FDNSNI  +N V A VV++NG  +K EYR FNIK      D+  M+EV+YRRYK        +P LI++DGGK Q+ +AL+SL  L L   I +IG+A   K   +     D   + LDKKS+    + ++++E HRF I+F+RNK+S S   + L  I  +G+  I +LL+K++++ +I EAS+E++S +V    AK+I
  S:     1 MTEALQLQLKTLPTNPGVYQYYDKDGKLLYVGKAKNLKKRVASYFTKNHEYGKTRVLVKKIVSIKHIVVATETDALLLENNLIKKYQPRYNVMLKDDKSYPWICIKNERFPRVFPTRRVIKD-GSEYFGPYTSMKTVR-TLLDLIKGLYPLRTCNYDLSQEKINAGKYKVCLEYHLGNCLGPCEGYQTIQSYDEQIVAIREIIKGNFKDSLNQFKAQMKTYAEAMEFEQAQKVKEKIDILENYQAKSTVVNPKISNVDVFTIVSDESFGYINFLQLSLGSIIRSHTMEIKKKLDETDKELLELAITEIHQRFKTN-SKELYVPFEVE----VGEKFKITI--PKLGDKKRILELSLRNAKYHRMERFKQIKLTDPDKHVNRIMAQMKKDLRLSEEPRHIECFDNSNIQGSNPVAACVVFKNGKPSKKEYRHFNIKTVVGPDDFASMEEVVYRRYKRLVEEKQPLPQLIVIDGGKGQLSSALKSLDALNLRGKIAIIGIA---KRLEEIYYPGDSIPLYLDKKSETLKIIQHLRNEAHRFGITFHRNKRSNSALNSELETIAGIGEKTIVELLKKFKSVKRISEASLEDISAVVGNSRAKKI 589
>gi|124547159|ref|ZP_01706112.1| excinuclease ABC, C subunit [Shewanella putrefaciens 200] >gi|124509459|gb|EAY53538.1| excinuclease ABC, C subunit [Shewanella putrefaciens 200] (609 aa)
Score = 690, Expect = 2.4e-70, Identities = 189/578 (32%), Positives = 330/578 (57%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRD-LKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYYSKIAIE--LPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDV-MDTA--FNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKD-LYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL--KFLELDSIIPVIGLAKDDKHKT--DRIVKWDF-SEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           L+ +    G Y   D  G VIYVGKA DL  R+  YF K+ D +KT+ L + I  +D  + ++E ++LLLEN+ I +Y PKYN+LLR+  ++PYIL+++ EHPR+ Y H   ++ KG Y+GP+ N    +  L+  + ++FP+R+C+ L     ++ C+ Y + +C  PC+ KV+  DY+  +K  + F  GK + +   L  K  QAA++  +E + ++ +    L+  +E+Q++  + K D D+IG +    +    +     G +    S Y  +    +++DE+L + I ++Y    I+  +PK V +S + E+L  L  ++ I  LN    +K +V  D A     AV    N  +  +S++N        L+++L++   ++RME FD S+    + V + VV+     +K EYR++NI+      DY  MK+ I RR+    A  G+IP+++ +DGG  Q++ A + +  KF+ LD    +IG+AK +  K   + ++  D  +   L+  S     + +I+DE HRFAI+ +RN++ K+   ++L  I  +G  R + LL+    L ++K ASV EL ++  + IE+A+ I
  S:    11 LRTVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRKNLDNVKTQALVSHIHHIDVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEHPRLAY-HRGPQREKGHYFGPYPNGGAVRESLH-LMQKLFPIRQCDDLYYKSRSRPCLQYQLSRCSAPCVGKVSNADYDEQVKLASLFLKGKDQQVISTLVAKMEQAAQQQEYEQAARFRDQIMALRKVAEQQEVS-NNKGDMDVIGVHYASGIACFHLLFIREGKIFGSRSYYPSVPA-QTDMDEVLRSFILQFYLNADIQRTIPKEVVISHNFEELHELEAAVSIA-LNKKFSIKTNVRADRASFLRLAVTNATNAVITRLSHKNTVEQRFVLLEEILELSTPIHRMECFDISHTMGESTVASCVVFNREGPHKGEYRRYNIEGITPGDDYAAMKQAITRRFDKIEAG-GKIPDILFIDGGLGQLRIAQKIVDEKFVHLDKAPQLIGVAKGEGRKPGLETLILGDTETSFSLEGDSPALHLIQHIRDESHRFAITGHRNRRQKTRNTSTLESIPGIGPKRRKALLQHLGGLQEVKGASVAELVKVPGISIEMAQTI 603
>gi|161486699|ref|NP_697713.2| excinuclease ABC subunit C [Brucella suis 1330] (690 aa)
Score = 690, Expect = 2.5e-70, Identities = 182/575 (31%), Positives = 296/575 (51%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK-------------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           +K++P+ PG Y   + +G V+YVGKA +L  R+  Y        +  ++  E   +++VV   E E+LLLE NLI + +P++N+L+R+  +FPYIL+T       ++ H   +  KG Y+GPFA++      + N + R F LR C     +   + C+ Y I +C  PC  +++ +DY   + E   F SGKS+S+ + L      A+  L FE +  Y +    L      Q I      + D+   + +  +  I +F +  G             S L   E+L   + ++Y       PK V LS + E+   ++E+L      K++   P +G KK+++  A  NA E +  + L   S+Q R L  L E   L   +   R+E++DNS+I  TN VG M+V       KN+YRKFNI+  D     D+  M+EVI RR+               N  +F   P++I++DGG+ QV A  + L  + +  ++  IG+AK  D +   +R          L  +  + +F+  ++DE HRFAI  +R ++ K +  N L +I  +G TR   LL  + T   +  A+VE+L QI  I  A
  S:    80 MKRLPNNPGVYRMFNSDGDVLYVGKARNLKKRVSNYARGIGHSNRITRMIRETVTMEFVVTRTETEALLLEANLIKRSRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASAGAVGRTI-NALQRAFLLRTCTDSVFETRTRPCLLYQIKRCSAPCTYEISDEDYAGLVAEAKAFLSGKSQSVKDHLAAAMQAASADLDFEHAAVYRDRLAALSHVQSHQGINPQTVEEADVFAIHQEGGMTCIQVFFFRTGQNWGNRAYFPKADSSLGPAEVLGAFLSQFYDDKPC--PKLVLLSETVEEQSLITEALSTRAGHKVQVSVPQRGEKKELVQHALTNAREALGRR-LAETSSQARLLQGLAETFGL--PRAPRRIEVYDNSHIMGTNAVGGMIVAGPEGFVKNQYRKFNIRSTDITPGDDFGMMREVIERRFSRLVKEHGTPAGEVENPDAFPAWPDVILIDGGQGQVGAVRQILGEMGISDLVTAIGIAKGVDREAGRERFFMEGKQPFTLPPRDPVLYFIQRLRDEAHRFAIGTHRARRKKEMVRNPLDEIAGIGPTRKRALLHHFGTAKAVSRAAVEDLMQIDGISEA 678
>gi|169198595|ref|ZP_02857904.1| excinuclease ABC, C subunit [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169087724|gb|EDS67439.1| excinuclease ABC, C subunit [Rhizobium leguminosarum bv. trifolii WSM2304] (680 aa)
Score = 690, Expect = 2.6e-70, Identities = 183/584 (31%), Positives = 305/584 (52%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL-KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD------EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYKN-------------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE--VAKEI 586
           E I + +K++P+ PG Y   +  G V+YVGKA  L  R+  Y + +    +  ++  +  ++++V    E E+LLLE NLI + +P++N+LLR+  +FPYIL+T +     ++ H   +  KG Y+GPFA++      + N + R F +R C     +   + C+ Y I +C GPC  +V+   Y   ++E  DF SGKS+ +   + +   QAAE L FE +  Y +    L      Q I  +   + D+   + +  V  I +F +  G           ++ + D      E+L   + ++Y    +  PK + LS + E+++ L+ +L      K+  L P +G K+D++D    NA E    K L   ++Q+R L   +E   L       R+EI+DNS+I  TN VG MVV       KN+YRKFNIK  D     D+  MKEV+ RR+                         F   P++I++DGG+ Q+ A    L  L +   +  IG+AK  D     +R          L  +  + +F+  ++DE HRFAI  +R ++ K + +N L +I  +G +R   LL+ + T   +  A++ +L  +  I   VAK++
  S:    55 ELIGEFVKRLPNSPGVYRMFNAEGDVLYVGKARSLKKRVGNYAVGRVHSNRIAQMVRQTANMEFVTTRTETEALLLEANLIKRLRPRFNVLLRDDKSFPYILITGDHRAPAIFKHRGARARKGDYFGPFASAGAVGRTI-NSLQRAFLIRTCTDSVFETRTRPCLLYQIKRCSGPCTHEVSDAGYGELVQEAKDFLSGKSQKVKSHMAEAMNQAAEDLDFERAAIYRDRLAALSHVQSHQGINPAGVEEADVFAIHHEGGVSCIQVFFFRTGQNWGN----RAYFPKADPQLSGAEVLNAFLAQFYDDKPV--PKQIMLSETIEEMELLAAALSEKAGHKVAILVPRRGEKRDLVDHVVGNAREAHGRK-LAETASQSRLLEGFKETFGLAYAPQ--RIEIYDNSHIMGTNAVGGMVVAGPEGFVKNQYRKFNIKSTDITPGDDFGMMKEVMTRRFSRLIKEEGIPDRTAQATAADAADMPFPTWPDVILIDGGQGQMTAVRAILTELGITDSVTAIGIAKGVDRDAGRERFFPPGRESFTLPPRDPVLYFVQRMRDEAHRFAIGSHRARRKKEMVKNPLDEIGGIGPSRKRALLQHFGTAKAVSRAALSDLMAVEGISEAVAKQV 670
>gi|38258795|sp|Q8G1L5|UVRC_BRUSU UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|23347500|gb|AAN29628.1| excinuclease ABC, C subunit [Brucella suis 1330] (611 aa)
Score = 690, Expect = 2.7e-70, Identities = 182/575 (31%), Positives = 296/575 (51%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK-------------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           +K++P+ PG Y   + +G V+YVGKA +L  R+  Y        +  ++  E   +++VV   E E+LLLE NLI + +P++N+L+R+  +FPYIL+T       ++ H   +  KG Y+GPFA++      + N + R F LR C     +   + C+ Y I +C  PC  +++ +DY   + E   F SGKS+S+ + L      A+  L FE +  Y +    L      Q I      + D+   + +  +  I +F +  G             S L   E+L   + ++Y       PK V LS + E+   ++E+L      K++   P +G KK+++  A  NA E +  + L   S+Q R L  L E   L   +   R+E++DNS+I  TN VG M+V       KN+YRKFNI+  D     D+  M+EVI RR+               N  +F   P++I++DGG+ QV A  + L  + +  ++  IG+AK  D +   +R          L  +  + +F+  ++DE HRFAI  +R ++ K +  N L +I  +G TR   LL  + T   +  A+VE+L QI  I  A
  S:     1 MKRLPNNPGVYRMFNSDGDVLYVGKARNLKKRVSNYARGIGHSNRITRMIRETVTMEFVVTRTETEALLLEANLIKRSRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASAGAVGRTI-NALQRAFLLRTCTDSVFETRTRPCLLYQIKRCSAPCTYEISDEDYAGLVAEAKAFLSGKSQSVKDHLAAAMQAASADLDFEHAAVYRDRLAALSHVQSHQGINPQTVEEADVFAIHQEGGMTCIQVFFFRTGQNWGNRAYFPKADSSLGPAEVLGAFLSQFYDDKPC--PKLVLLSETVEEQSLITEALSTRAGHKVQVSVPQRGEKKELVQHALTNAREALGRR-LAETSSQARLLQGLAETFGL--PRAPRRIEVYDNSHIMGTNAVGGMIVAGPEGFVKNQYRKFNIRSTDITPGDDFGMMREVIERRFSRLVKEHGTPAGEVENPDAFPAWPDVILIDGGQGQVGAVRQILGEMGISDLVTAIGIAKGVDREAGRERFFMEGKQPFTLPPRDPVLYFIQRLRDEAHRFAIGTHRARRKKEMVRNPLDEIAGIGPTRKRALLHHFGTAKAVSRAAVEDLMQIDGISEA 599
>gi|38258822|sp|Q8YGA9|UVRC_BRUME UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|90111059|sp|Q2YN35|UVRC_BRUA2 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|82615689|emb|CAJ10676.1| Excinuclease ABC, C subunit, N-terminal:Helix-hairpin-helix motif:Excinuclease ABC, C subunit, C-terminal:UvrB/UvrC protein:H... [Brucella melitensis biovar Abortus 2308] (611 aa)
Score = 689, Expect = 3.1e-70, Identities = 182/575 (31%), Positives = 296/575 (51%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK-------------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           +K++P+ PG Y   + +G V+YVGKA +L  R+  Y        +  ++  E   +++VV   E E+LLLE NLI + +P++N+L+R+  +FPYIL+T       ++ H   +  KG Y+GPFA++      + N + R F LR C     +   + C+ Y I +C  PC  +++ +DY   + E   F SGKS+S+ + L      A+  L FE +  Y +    L      Q I      + D+   + +  +  I +F +  G             S L   E+L   + ++Y       PK V LS + E+   ++E+L      K++   P +G KK+++  A  NA E +  + L   S+Q R L  L E   L   +   R+E++DNS+I  TN VG M+V       KN+YRKFNI+  D     D+  M+EVI RR+               N  +F   P++I++DGG+ QV A  + L  + +  ++  IG+AK  D +   +R          L  +  + +F+  ++DE HRFAI  +R ++ K +  N L +I  +G TR   LL  + T   +  A+VE+L QI  I  A
  S:     1 MKRLPNNPGVYRMFNSDGGVLYVGKARNLKKRVSNYARGIGHSNRITRMIRETVTMEFVVTRTETEALLLEANLIKRLRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASAGAVGRTI-NALQRAFLLRTCTDSVFETRTRPCLLYQIKRCSAPCTYEISDEDYAGLVAEAKAFLSGKSQSVKDHLAAAMQAASADLDFEHAAVYRDRLAALSHVQSHQGINPQTVEEADVFAIHQEGGMTCIQVFFFRTGQNWGNRAYFPKADSSLGPAEVLGAFLSQFYDDKPC--PKLVLLSETVEEQSLITEALSTRAGHKVQVSVPQRGEKKELVQHALTNAREALGRR-LAETSSQARLLQGLAETFGL--PRAPRRIEVYDNSHIMGTNAVGGMIVAGPEGFVKNQYRKFNIRSTDITPGDDFGMMREVIERRFSRLVKEHGTPAGEVKNPDAFPAWPDVILIDGGQGQVGAVRQILGEMGISDLVTAIGIAKGVDREAGRERFFMEGKQPFTLPPRDPVLYFIQRLRDEAHRFAIGTHRARRKKEIVRNPLDEIAGIGPTRKRALLHHFGTAKAVSRAAVEDLMQIDGISEA 599
>gi|148560017|ref|YP_001258680.1| excinuclease ABC subunit C [Brucella ovis ATCC 25840] >gi|148371274|gb|ABQ61253.1| excinuclease ABC, C subunit [Brucella ovis ATCC 25840] (690 aa)
Score = 689, Expect = 3.1e-70, Identities = 182/575 (31%), Positives = 296/575 (51%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK-------------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           +K++P+ PG Y   + +G V+YVGKA +L  R+  Y        +  ++  E   +++VV   E E+LLLE NLI + +P++N+L+R+  +FPYIL+T       ++ H   +  KG Y+GPFA++      + N + R F LR C     +   + C+ Y I +C  PC  +++ +DY   + E   F SGKS+S+ + L      A+  L FE +  Y +    L      Q I      + D+   + +  +  I +F +  G             S L   E+L   + ++Y       PK V LS + E+   ++E+L      K++   P +G KK+++  A  NA E +  + L   S+Q R L  L E   L   +   R+E++DNS+I  TN VG M+V       KN+YRKFNI+  D     D+  M+EVI RR+               N  +F   P++I++DGG+ QV A  + L  + +  ++  IG+AK  D +   +R          L  +  + +F+  ++DE HRFAI  +R ++ K +  N L +I  +G TR   LL  + T   +  A+VE+L QI  I  A
  S:    80 VKRLPNNPGVYRMFNSDGDVLYVGKARNLKKRVSNYARGIGHSNRITRMIRETVTMEFVVTRTETEALLLEANLIKRLRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASAGAVGRTI-NALQRAFLLRTCTDSVFETRTRPCLLYQIKRCSAPCTYEISDEDYAGLVAEAKAFLSGKSQSVKDHLAAAMQAASADLDFEHAAVYRDRLAALSHVQSHQGINPQTVEEADVFAIHQEGGMTCIQVFFFRTGQNWGNRAYFPKADSSLGPAEVLGAFLSQFYDDKPC--PKLVLLSETVEEQSLITEALSTRAGHKVQVSVPQRGEKKELVQHALTNAREALGRR-LAETSSQARLLQGLAETFGL--PRAPRRIEVYDNSHIMGTNAVGGMIVAGPEGFVKNQYRKFNIRSTDITPGDDFGMMREVIERRFSRLVKEHGTPAGEVENPDAFPAWPDVILIDGGQGQVGAVRQILGEMGISDLVTAIGIAKGVDREAGRERFFMEGKQPFTLPPRDPVLYFIQRLRDEAHRFAIGTHRARRKKEMVRNPLDEIAGIGPTRKRALLHHFGTAKAVSRAAVEDLVQIDGISEA 678
>gi|163868037|ref|YP_001609241.1| excinuclease ABC subunit C [Bartonella tribocorum CIP 105476] >gi|161017688|emb|CAK01246.1| excinuclease ABC subunit C [Bartonella tribocorum CIP 105476] (661 aa)
Score = 689, Expect = 3.3e-70, Identities = 187/579 (32%), Positives = 313/579 (54%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD------EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRY-----------KNNTAS------FGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKD-DKHK-TDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           I++ ++ +PHKPG Y    +NG ++YVGKA +L  R+  Y  +   + +  ++      ++++V + E E+LLLE NLI +  P +N+LLR+  +FPYI++T +     LY H   +  K  Y+GPFA+++     ++  + R F LR C         + C+ + I +C  PC  ++   DY+  ++E   F SGK +S+   + +   +AAE L FE +  Y +    L      Q I      + D+     KE +  I +F +  G           ++ + D      EIL + + ++Y      LPK++ LS   E+   L+E+L      KI    P +G +K +++ A+ NA E +++K L   +   + L  L E  +L       R+E++DNS+I  TN VGAM+V       KN+YRKFNI+  D     D+  MKEVI RR+           KN+         F   P+LI++DGG+ Q+ +    L  L+L+++I V+G+AK  D+H   +R             +  + +FL  ++DE H FAI  +R K+ K+ F+N L +I+N+G TR   LL  + +   + +AS+E+L ++  I  A
  S:    43 IQEFVRHLPHKPGVYRMIGENGDILYVGKARNLKKRVSNYAREQGHNNRITRMIRATYHMEFIVTHTETEALLLEANLIKRLHPHFNVLLRDDKSFPYIMITNDHRAPALYKHRGARTQKAHYFGPFASASAVTQTIH-VLQRAFLLRTCTDTIFENRTRPCLLHQIKRCSAPCTHEINDIDYKELVREAKAFLSGKDQSVKNDMVQAMHKAAENLDFEQAASYRDRLSALSHIQSHQGINPQTIKEADVFAIAQKEGMTCIQVFFFRMGQNWGN----RAYFPKADPSFSRTEILASFLTQFYDDKP--LPKSILLSEEIEEKTLLTEALSLKANHKISLSLPKQGERKTLVNHAYLNAQEALEHK-LAETATHTKLLQGLAETFQLPFPPR--RIEVYDNSHIMGTNSVGAMIVAGQMGFVKNQYRKFNIRSTDITPGDDFGMMKEVIKRRFSRLIKEHDLPNKNHDIHNQENDLFPIWPDLILIDGGEGQINSVHTILTELQLNNLITVVGIAKGVDRHAGRERFFIKGTPPFTFPPRDPILYFLQRLRDEAHHFAIGTHRIKRKKATFKNPLDEIENIGPTRKRALLHHFGSAKAVADASLEDLKKVTGISAA 649
>gi|37525944|ref|NP_929288.1| excinuclease ABC subunit C [Photorhabdus luminescens subsp. laumondii TTO1] >gi|81419566|sp|Q7N5C7|UVRC_PHOLL UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|36785373|emb|CAE14320.1| excinuclease ABC subunit C [Photorhabdus luminescens subsp. laumondii TTO1] (610 aa)
Score = 689, Expect = 3.3e-70, Identities = 192/583 (32%), Positives = 316/583 (54%)
  Q:     1 MNEQIKDK--LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQD-YEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYYSKIAIE--LPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFL--ELDSIIP-VIGLAKDDKHKTDRIVKWDFSE---IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           M EQ   K  LK +  +PG Y   D +G VIYVGKA DL  R+  YF       KT+ L   I  +D  V + E E+LLLE+N I  Y+P+YN+LLR+  ++PYI ++ ++HPR L  +   K  KG Y+GPF N++  +  L   + ++FP+R+C     +  ++ C+ Y IG+CLGPC+K +  +D Y+  +  I  F SGK + +  +L ++  QA+++L FED+ +Y +  + ++  +ERQ  +    +D D+I       +  + +     G +L   S Y  I    + LDEI+ T + ++Y + +    LP  + L  +  +   LS+SL      KI      +G K   +  A  NA   +  +    +S Q+     L+ L KL+ +  + RME FD S+      V + VV+++    ++EYR++NI       DY  M +V+ RRY        +IP++I +DGGK Q+  A++  + L  E D   P +IG+AK    K      +  +E   I L   S     + +I+DE H  AI+ +R ++SK    ++L  I+ +G  R + LL+    L  ++ ASVEE++++  I  A
  S:     1 MTEQFDSKTFLKTVTSQPGVYRMYDTSGTVIYVGKAKDLKKRLASYFRAQVTSRKTESLVKNIVQIDVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPYIFLSADKHPR-LAMYRGAKHFKGEYFGPFPNTHAVRESLI-LLQKLFPIRQCEDSVYRNRSRPCLQYQIGRCLGPCVKGLVSEDEYQQQVDYIRLFLSGKDQQVLTRLIERMEQASQQLKFEDAARYRDQIQAVRQVTERQ-FVSGTDDDLDVISVAFDAGMACLHVLFIRQGKVLGSRSYYPKIPT-GTTLDEIVQTFLGQFYLQGSQNRTLPSEILLDFTLPEKDILSDSLSEISGRKIHIQTRPRGDKARYLKLARTNATIALSTR----LSQQSTIHQRLDSLTKLVKLAKIQRMECFDISHTMGEQTVASCVVFDSNGPLRSEYRRYNISGITPGDDYAAMNQVLRRRY-GKALDESKIPDIIFIDGGKGQLAQAIDVFQSLDVEWDKTRPQLIGVAKGSDRKAGLETLFFATEDKSIALPPDSPALHVIQHIRDESHNHAITGHRQRRSKVRNTSTLESIEGVGPKRRQMLLKYMGGLQPLRNASVEEIAKVPTISYA 599
>gi|110636600|ref|YP_676807.1| excinuclease ABC, subunit C [Cytophaga hutchinsonii ATCC 33406] >gi|119367645|sp|Q11YP9|UVRC_CYTH3 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|110279281|gb|ABG57467.1| excinuclease ABC, subunit C [Cytophaga hutchinsonii ATCC 33406] (596 aa)
Score = 689, Expect = 3.4e-70, Identities = 191/576 (33%), Positives = 319/576 (55%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK---------CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLS--KYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSK-SLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIV 578
           E I+  LK++P  PG Y +      +IYVGKA  L  R+  YF   K+ D KT+ +  +I   +Y +VN+E E+LLLENNLI + KPKYN+LLR+   +P+I ++  + P +  +    KK KG Y+GP+  S    + L   + + F +R C+    K+         C+ Y IG C GPC  K  ++DY+  + ++ +   G   S+ +  ++K + AAE + FE +Q + E   ++    +   I+    N+ ++     + N  S+     ++GS++     ++  V     +E+L+  ++E + +   +  K +  ++   +L  LS   K+    P +G KK ++D +  NA   +     Q    +  E+  L+ LQ  L +K+L   +E FDNSNI  TN V AMV Y+NG  +K +YR FNIK  +  +D+  M E++YRRYK         P LII+DGGK Q+  A ++LK L +   IP++ +AK+ +   +     D   + LDKKS+    +  I+DE HRFAI+F+R K+SK +L +     +  +G   ++KLL  ++T+ +IKEAS+E+L+ ++
  S:     5 EDIRSLLKELPSSPGVYRFYSIEKELIYVGKAKSLRKRVANYFTNKKNLDQKTRSMVRKIYHAEYTLVNSEYEALLLENNLIKENKPKYNVLLRDDKTYPFICLSSADFPTLTTTRKIDKK-KGEYFGPYT-SGRAMHSLVESLRKTFFIRTCDLNLTKQNIDAHKFKVCLEYHIGNCKGPCEGKQEKEDYDVSIIQVRNILKGNFSSVKKYYQEKMLSAAEDMQFEKAQFFKERYNSVLGLEKSSLIVNPDINNLEVYTIVKRLNRASVNFMSILHGSIIKARTIEMKAVLDETEEELLMHALFEIHEE-GWDSTKEIICNI---ELPILSTYCKVSI--PQRGDKKKLIDLSLKNAWHTLTRYDDQ--KKEKPEIRVLKTLQADLSLKELPAHIECFDNSNIQGTNPVAAMVCYKNGKPSKKDYRHFNIKTVEGPNDFASMYEIVYRRYKRMGEEGLPFPTLIIIDGGKGQLSFACQALKDLNIYGQIPIVSIAKNLE---ELFFPGDNDPLYLDKKSESLKLIQQIRDETHRFAITFHRQKRSKDALLKTEFENLVGIGPGTVKKLLTHFKTVKRIKEASIEQLTPVI 582
>gi|157375591|ref|YP_001474191.1| excinuclease ABC subunit C [Shewanella sediminis HAW-EB3] >gi|189038096|sp|A8FW40|UVRC_SHESH UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|157317965|gb|ABV37063.1| excinuclease ABC, C subunit [Shewanella sediminis HAW-EB3] (609 aa)
Score = 689, Expect = 3.6e-70, Identities = 183/578 (31%), Positives = 320/578 (55%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF-LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYY--SKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLY-RMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL--KFLELDSIIPVIGLAKDDKHK---TDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           LK +   PG Y   D+ G VIYVGKA DL  R+  YF +   ++KT+ L + I ++D  V ++E ++L+LEN+ I +Y P+YN+LLR+  ++PYIL++  +HPR+ Y H   K+ KG+Y+GP+ N    +  L+  + +IFP+R+C+ L     ++ C+ Y IG+C  PC+ KV+ ++Y   +K  + F  GK   +  +L  K   +A  L +E +  Y +    L+  +E+Q++  +   D D+IG Y    V    +     G +    S Y  +    +ELDE+L   + ++Y  S     +PK + LS   + L  L  ++      K++     +  + + +  A  NA   +  +    +S++N        L++ L++  L  RME FD S+    + V + VV++    NK +YR++NI       DY  MK+ I RR+ +     G+IP+L+ +DGG  Q++ A + +  KF+++D    +IG+AK +  K      I   +     +   S     + +I+DE HRFAI+ +RNK+ K+   ++L  I  +G  R + LL+    + ++K ASV EL+++  + +E+A+ I
  S:    11 LKTVSSSPGVYRMYDEEGTVIYVGKAKDLKKRLSSYFRVNLPNVKTQALVSHIANIDVTVTHSETDALILENDYIKQYMPRYNVLLRDDKSYPYILLSDHKHPRLAY-HRGPKRDKGSYFGPYPNGGAVRESLH-LLQKIFPIRQCDDLYYKSRSRPCLQYQIGRCSAPCVNKVSDEEYAVQVKLASLFLKGKDLQVMTELVSKMEASALALEYEQAASYRDQIAALRRVAEQQEVS-NTSGDMDVIGAYYASGVACFHLLFIREGKIFGSRSYYPSVPA-ETELDEVLSAFMIQFYLNSDSQRTVPKEILLSHGFDDLPELERAIQTALEKKVEIKTNVRSERANFLRLAVTNATNAVNTR----LSHKNTVEQRFLLLEEALEVSTLIQRMECFDISHTMGESTVASCVVFDREGPNKADYRRYNINGITPGDDYAAMKQAITRRF-DKIDKNGKIPDLLFIDGGTGQLRIAQKIVDEKFVDIDKTPMLIGVAKGEGRKPGLETLIYGENEQSFTIPADSGALHLIQHIRDESHRFAITGHRNKRQKTRNTSTLESIAGVGPKRRKALLQYLGGIQEVKGASVAELAKVPGISLEMAQTI 603
>gi|169830506|ref|YP_001716488.1| excinuclease ABC, C subunit [Candidatus Desulforudis audaxviator MP104C] >gi|169637350|gb|ACA58856.1| excinuclease ABC, C subunit [Candidatus Desulforudis audaxviator MP104C] (614 aa)
Score = 688, Expect = 3.9e-70, Identities = 176/571 (30%), Positives = 310/571 (54%)
  Q:     7 DKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL---PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSE---RQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKY--DLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDAN-SDYDYMKEVIYRRY---------------KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +K+K  P KPG YL++   G V+YVGKAV L NR++ YF   R  K + L  +  DV+ +V  +E E+L+LE+NLI +++P+YN++L++  ++PY+ VT +EE+PRI  +    +     Y+GP+  S    +E    + ++FPLR C +      + C+ + IG+CLGPC   V  + Y   ++E+  F  G+   +   L +K   AA  L FE   +  ELR  L+   +   RQ I+   + D D++      N   +++ +  +G LL ++  DL  +      E+L   + +YY +  +  P+ +      E+   ++E L      +++   P +G K++++  A  NA E       Q+   ++      E    L   +   R+E +D SN+     VG MVV+E+G     EYR+F +++     +D+  M+EV+ RR+                +  A F  +P+L++VDGGK Q+ AALE L+    ++ +PV  L K++    ++I     S+ + +   S   F L +++DE HRFA+  +R  +S+    + L +I  +G  R   L + + +LD +K A++ EL+ +
  S:     5 EKVKHFPDKPGVYLFRGARGEVLYVGKAVSLKNRVRSYFTGARSDKVQALVGKTRDVECLVTGSEIEALILESNLIKEHRPRYNVVLKDDKSYPYLKVTVQEEYPRIFLTRAQPRD-GARYFGPYP-SAAAVHETVRLLKKLFPLRSCRQTRFRQQRPCLNHHIGRCLGPCSGTVDPERYRAMVQEVLLFLEGRHADLVRGLARKMEAAAANLEFE---RAAELRDQLRAVEQVLARQSIVSPGREDRDVLALARDGNRGRVIVLEIRDGKLLGRHSLDLQGIAERSDAEVLAAFLKQYYREAGLIPPEVLLPVPLGEEQGLIAEWLGLRRQGRVRLHVPRRGRKRELVRLAEQNAAEARA----QMEFERDAGEALAELAAVLGLDQAPARLEGYDISNLQGAQTVGVMVVFEDGRPAPGEYRQFRVRETAGTPNDFAAMREVVARRFARAREEGKLIATGRLSSRDARFHRLPDLVLVDGGKGQLSAALEGLRETGFEA-VPVFALTKEE----EKIFAPGRSDPVPVPPGSQALFLLQHLRDEAHRFAVDTHRRTRSRESLRSLLEEIDGIGPARRRALQKAFPSLDALKGATLAELAAV 593
>gi|161611214|ref|YP_221454.2| excinuclease ABC subunit C [Brucella abortus bv. 1 str. 9-941] >gi|162002877|ref|YP_414162.2| excinuclease ABC subunit A [Brucella melitensis biovar Abortus 2308] >gi|189023910|ref|YP_001934678.1| excinuclease ABC subunit C [Brucella abortus S19] >gi|189019482|gb|ACD72204.1| excinuclease ABC subunit C [Brucella abortus S19] (690 aa)
Score = 688, Expect = 3.9e-70, Identities = 182/575 (31%), Positives = 296/575 (51%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK-------------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           +K++P+ PG Y   + +G V+YVGKA +L  R+  Y        +  ++  E   +++VV   E E+LLLE NLI + +P++N+L+R+  +FPYIL+T       ++ H   +  KG Y+GPFA++      + N + R F LR C     +   + C+ Y I +C  PC  +++ +DY   + E   F SGKS+S+ + L      A+  L FE +  Y +    L      Q I      + D+   + +  +  I +F +  G             S L   E+L   + ++Y       PK V LS + E+   ++E+L      K++   P +G KK+++  A  NA E +  + L   S+Q R L  L E   L   +   R+E++DNS+I  TN VG M+V       KN+YRKFNI+  D     D+  M+EVI RR+               N  +F   P++I++DGG+ QV A  + L  + +  ++  IG+AK  D +   +R          L  +  + +F+  ++DE HRFAI  +R ++ K +  N L +I  +G TR   LL  + T   +  A+VE+L QI  I  A
  S:    80 VKRLPNNPGVYRMFNSDGGVLYVGKARNLKKRVSNYARGIGHSNRITRMIRETVTMEFVVTRTETEALLLEANLIKRLRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASAGAVGRTI-NALQRAFLLRTCTDSVFETRTRPCLLYQIKRCSAPCTYEISDEDYAGLVAEAKAFLSGKSQSVKDHLAAAMQAASADLDFEHAAVYRDRLAALSHVQSHQGINPQTVEEADVFAIHQEGGMTCIQVFFFRTGQNWGNRAYFPKADSSLGPAEVLGAFLSQFYDDKPC--PKLVLLSETVEEQSLITEALSTRAGHKVQVSVPQRGEKKELVQHALTNAREALGRR-LAETSSQARLLQGLAETFGL--PRAPRRIEVYDNSHIMGTNAVGGMIVAGPEGFVKNQYRKFNIRSTDITPGDDFGMMREVIERRFSRLVKEHGTPAGEVKNPDAFPAWPDVILIDGGQGQVGAVRQILGEMGISDLVTAIGIAKGVDREAGRERFFMEGKQPFTLPPRDPVLYFIQRLRDEAHRFAIGTHRARRKKEIVRNPLDEIAGIGPTRKRALLHHFGTAKAVSRAAVEDLMQIDGISEA 678
>gi|17987534|ref|NP_540168.1| excinuclease ABC subunit C [Brucella melitensis 16M] >gi|17983236|gb|AAL52432.1| EXCINUCLEASE ABC SUBUNIT C [Brucella melitensis 16M] (685 aa)
Score = 688, Expect = 4.0e-70, Identities = 182/575 (31%), Positives = 296/575 (51%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK-------------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           +K++P+ PG Y   + +G V+YVGKA +L  R+  Y        +  ++  E   +++VV   E E+LLLE NLI + +P++N+L+R+  +FPYIL+T       ++ H   +  KG Y+GPFA++      + N + R F LR C     +   + C+ Y I +C  PC  +++ +DY   + E   F SGKS+S+ + L      A+  L FE +  Y +    L      Q I      + D+   + +  +  I +F +  G             S L   E+L   + ++Y       PK V LS + E+   ++E+L      K++   P +G KK+++  A  NA E +  + L   S+Q R L  L E   L   +   R+E++DNS+I  TN VG M+V       KN+YRKFNI+  D     D+  M+EVI RR+               N  +F   P++I++DGG+ QV A  + L  + +  ++  IG+AK  D +   +R          L  +  + +F+  ++DE HRFAI  +R ++ K +  N L +I  +G TR   LL  + T   +  A+VE+L QI  I  A
  S:    75 VKRLPNNPGVYRMFNSDGGVLYVGKARNLKKRVSNYARGIGHSNRITRMIRETVTMEFVVTRTETEALLLEANLIKRLRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASAGAVGRTI-NALQRAFLLRTCTDSVFETRTRPCLLYQIKRCSAPCTYEISDEDYAGLVAEAKAFLSGKSQSVKDHLAAAMQAASADLDFEHAAVYRDRLAALSHVQSHQGINPQTVEEADVFAIHQEGGMTCIQVFFFRTGQNWGNRAYFPKADSSLGPAEVLGAFLSQFYDDKPC--PKLVLLSETVEEQSLITEALSTRAGHKVQVSVPQRGEKKELVQHALTNAREALGRR-LAETSSQARLLQGLAETFGL--PRAPRRIEVYDNSHIMGTNAVGGMIVAGPEGFVKNQYRKFNIRSTDITPGDDFGMMREVIERRFSRLVKEHGTPAGEVKNPDAFPAWPDVILIDGGQGQVGAVRQILGEMGISDLVTAIGIAKGVDREAGRERFFMEGKQPFTLPPRDPVLYFIQRLRDEAHRFAIGTHRARRKKEIVRNPLDEIAGIGPTRKRALLHHFGTAKAVSRAAVEDLMQIDGISEA 673
>gi|91773432|ref|YP_566124.1| excinuclease ABC subunit C [Methanococcoides burtonii DSM 6242] >gi|119367668|sp|Q12W02|UVRC_METBU UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|91712447|gb|ABE52374.1| Excinuclease ABC subunit C [Methanococcoides burtonii DSM 6242] (604 aa)
Score = 688, Expect = 4.1e-70, Identities = 192/573 (33%), Positives = 320/573 (55%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL--KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK----CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGK-SKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVF---YSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKL--KTLSE--SLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE--IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           ++  +  IP  PG YL KD +  +IY+GKA  L  R+ QYF   K+   KT+ +  +I DVDY+V  +E  +L+LE NL+ K +P YN+ L++   +PY+ VT   + P+I  +          Y+GP+ N    +  L + I++IF +++CN+  + K    C+ Y I +C  PC   +T ++Y   + E    F G+ S +I E  EK  I A  +  +E +    +    LK  S RQ    +  +D DII     +  + + IF   +G+++ K D+   +      +  +    I +YY    +     V   + +++L  K LSE  +  ++   P +G KK +M+ A  NA   ++  +L+  S++ + L +L +L+  L +  L   +E FD SNI  T+ VG+MVV+ENG+   ++YR FNIK      D+  M EV+ RRY +  A   ++P+LI++DGG  QV AA+ SLK L+LD  IP++GLAK  +H    IV  D ++  + L   S+    L+ ++DE HRFA+S +R +++  L  + L  I  +G +R + LL  + ++++I+ ASVEEL+ +
  S:     1 MRPDISNIPELPGVYLMKDISDNIIYIGKAKSLKKRVSQYFQSSKNHSSKTRAMVRKIADVDYIVTESEVAALILEANLVKKNRPHYNIDLKDDKRYPYVKVTVNTKFPKIFITRRRLMD-GALYFGPYTNVKPVRQTL-DMISQIFRIKRCNRRVDGKGKRACLNYHIDRCYAPCNGSITPEEYRNNVMEAVKLFKGETSGTIKELQEKMNIHAIAQ-EYESAAVIRDQIDALKSLS-RQQTATAGNDDSDIIATASDDETVFVQIFYIRDGNMVGKADMSLSWGDATGNIARVTEEFIKQYYQDAPVPPEILVQYPIPEKELVIKWLSEKAARSVQIQVPQRGNKKRLMEMAEQNAQMTLEQSHLKQ-SDKEQALQALLQLRDALALSTLPAHIEGFDISNISGTDAVGSMVVFENGLPANSKYRHFNIKTVKGIDDFAMMAEVVKRRYTHQKAEKDKLPDLILIDGGPGQVSAAMGSLKELQLD--IPLVGLAKRFEHI---IVPKDGTDEVVILPHTSEALKVLMRVRDESHRFAVSSHRRRRTARLSHSELDTIPGIGASRKKALLNHFSSIEQIRHASVEELTAV 581
>gi|149277111|ref|ZP_01883253.1| excinuclease ABC, C subunit [Pedobacter sp. BAL39] >gi|149231988|gb|EDM37365.1| excinuclease ABC, C subunit [Pedobacter sp. BAL39] (600 aa)
Score = 688, Expect = 4.3e-70, Identities = 191/573 (33%), Positives = 320/573 (55%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK---------CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDL-ITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDE---KLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNS-------LEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIV 578
           K  L  IPHKPG Y + D    +IY+GKA DL NR+  YF++DR L  KT+ L ++I  + + +V+ E ++ LLEN+LI K++P+YN++L++   +P+I++ KE  PR+ ++ +  K    TY+GP+A+  +  + + + I   + LR CN    +K         C+ Y IG C GPC    +  DY+  ++EI +  +GK  ++ + +++    AA +L FE + +Y +    L+ +  +  ++ S   + D++     E    +   K +NGS++    + I     E DE LLTL        AI   +T + S S E       + E   ++F  P  G KK +++ +  N +   K K      NQ  +LN        L +LQK L +  L   +E FDNSN      V A+VV+++   +K +YR FN+K  +  +D+  M+E ++RRYK        +P LII+DGGK Q+ +A+ SLK L L + + V+G+A   K   +     D   + LDKKS+    +  ++DE HRF I+F+R K+ +   +  L +I+ +GKT  +KLL +++++ KIK A+  EL  ++
  S:     7 KKVLADIPHKPGVYQYWDVEDTLIYIGKAKDLRNRVGSYFIQDRQLNGKTRVLVSKIRKITFTIVDTEIDAWLLENSLIKKHQPRYNIMLKDDKTYPWIIIKKEPFPRVYWTRNRVKD-GSTYFGPYASVGMM-HTILDLIKETYTLRTCNLPLTQKNITDGKFKVCLEYQIGNCKGPCQAYQSEPDYDKNIEEIKEILNGKISNVIKDVKQVIRDAAAELNFEYAHQYQKKLLVLEKYQSKSTVVSSAITNIDVVSIASDERYAFVNYLKVMNGSIIQTQTIEIKKRLDETDEELLTL--------AITEFRTKFNSTSKEVIVPFDIVLEDSNLRFTVPKLGEKKKLLELSQKNVLFFKKEKL-----NQYEKLNPDLRTERILGQLQKDLGMAKLPVHIECFDNSNFQGKYPVSAIVVFKDAKPSKKDYRHFNVKTVEGPNDFATMEEAVFRRYKRMLEEEDTLPQLIIIDGGKGQLSSAMSSLKKLGLANKVMVVGIA---KRLEELFFPNDPYPLYLDKKSESLKLIQQLRDEAHRFGITFHRKKRDQGTLKTELEQIEGIGKTTADKLLRQFKSVKKIKAATEPELQTVL 584
>gi|154494271|ref|ZP_02033591.1| hypothetical protein PARMER_03622 [Parabacteroides merdae ATCC 43184] >gi|154085955|gb|EDN85000.1| hypothetical protein PARMER_03622 [Parabacteroides merdae ATCC 43184] (601 aa)
Score = 688, Expect = 4.4e-70, Identities = 195/576 (33%), Positives = 321/576 (55%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN---------KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEI---LLTL-IYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVE--IMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIV-KWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIV 578
           E IK+ L  IP  PGCY + D+ G +IYVGKA +L  R+  YF K+ D  KT+ L  +I D+ Y VV+ E ++LLLENNLI +Y+P+YN+LL++   +P I+V  E  PR+  + +  +     YYGP+ +    K  L   +  ++PLR C          K   K C+ Y I  C GPC    T ++Y+  + EI +   G    I + L ++  + A +L FE++QK  E  + ++ +  +  ++    ++ D+      EN   I      NG+++  Y     +   LDE    LL+L I E  ++      + +     D +L+ +S ++      P +G KK +++ +  N  +  + K K  + ++ + R    L+E+Q+ L +  L   +E FDNSNI  ++ V A VV++    +K +YRK+NIK      DY  MKEV+ RRY+        +P+LII DGGK Q++   E ++  EL   IP+ GLAKD KH+T  ++  +    I +  +S ++ F   IQDEVHRFAI+F+++K+SKS  ++ L  IK +G+     LL  ++++ +I+EA  +EL +++
  S:     6 EHIKNILSVIPESPGCYQYFDEKGTIIYVGKAKNLKRRVSSYFNKEHDSNKTRVLVKQIRDIKYFVVDTEEDALLLENNLIKQYRPRYNVLLKDDKTYPSIVVKNEYFPRVFQTRNIVRD-GSRYYGPYPSIYTAKVML-QMLKELYPLRTCKYPLTPESIAKGRYKVCLEYHIKHCKGPCEGLQTLEEYQQNISEIKEILRGNISQISKHLYEEMQKLAGELRFEEAQKIKEKYEVIENYRSKSTVVTPMLHNIDVFSLAENENSAYINYLHIGNGAIVQAYTF--EYKKRLDESKEELLSLGIIEMRNRFKSTAREIIVPFPLDIELENVSITV------PQRGDKKKLVELSEMNVKQYKVDKLKQAEKLNPEQRSTRLLKEIQETLHLPKLPAHIECFDNSNIQGSDAVAACVVFKMAKPSKKDYRKYNIKTVVGPDDYASMKEVVRRRYQRAIVEETPLPDLIITDGGKGQMEVVREVIQD-ELHLDIPIAGLAKDGKHRTSELLFGFPPETIGMPIQSFMFKFFTQIQDEVHRFAITFHKDKRSKSQTKSELDTIKGIGEKTKVLLLRHFKSVKRIREAGFDELKEVI 588
>gi|75497050|sp|Q57E41|UVRC_BRUAB UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|62195793|gb|AAX74093.1| UvrC, excinuclease ABC, C subunit [Brucella abortus biovar 1 str. 9-941] (627 aa)
Score = 688, Expect = 4.4e-70, Identities = 182/575 (31%), Positives = 296/575 (51%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK-------------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           +K++P+ PG Y   + +G V+YVGKA +L  R+  Y        +  ++  E   +++VV   E E+LLLE NLI + +P++N+L+R+  +FPYIL+T       ++ H   +  KG Y+GPFA++      + N + R F LR C     +   + C+ Y I +C  PC  +++ +DY   + E   F SGKS+S+ + L      A+  L FE +  Y +    L      Q I      + D+   + +  +  I +F +  G             S L   E+L   + ++Y       PK V LS + E+   ++E+L      K++   P +G KK+++  A  NA E +  + L   S+Q R L  L E   L   +   R+E++DNS+I  TN VG M+V       KN+YRKFNI+  D     D+  M+EVI RR+               N  +F   P++I++DGG+ QV A  + L  + +  ++  IG+AK  D +   +R          L  +  + +F+  ++DE HRFAI  +R ++ K +  N L +I  +G TR   LL  + T   +  A+VE+L QI  I  A
  S:    17 VKRLPNNPGVYRMFNSDGGVLYVGKARNLKKRVSNYARGIGHSNRITRMIRETVTMEFVVTRTETEALLLEANLIKRLRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASAGAVGRTI-NALQRAFLLRTCTDSVFETRTRPCLLYQIKRCSAPCTYEISDEDYAGLVAEAKAFLSGKSQSVKDHLAAAMQAASADLDFEHAAVYRDRLAALSHVQSHQGINPQTVEEADVFAIHQEGGMTCIQVFFFRTGQNWGNRAYFPKADSSLGPAEVLGAFLSQFYDDKPC--PKLVLLSETVEEQSLITEALSTRAGHKVQVSVPQRGEKKELVQHALTNAREALGRR-LAETSSQARLLQGLAETFGL--PRAPRRIEVYDNSHIMGTNAVGGMIVAGPEGFVKNQYRKFNIRSTDITPGDDFGMMREVIERRFSRLVKEHGTPAGEVKNPDAFPAWPDVILIDGGQGQVGAVRQILGEMGISDLVTAIGIAKGVDREAGRERFFMEGKQPFTLPPRDPVLYFIQRLRDEAHRFAIGTHRARRKKEIVRNPLDEIAGIGPTRKRALLHHFGTAKAVSRAAVEDLMQIDGISEA 615
>gi|161618668|ref|YP_001592555.1| excinuclease ABC subunit C [Brucella canis ATCC 23365] >gi|161335479|gb|ABX61784.1| excinuclease ABC, C subunit [Brucella canis ATCC 23365] (690 aa)
Score = 688, Expect = 4.9e-70, Identities = 182/575 (31%), Positives = 296/575 (51%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK-------------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           +K++P+ PG Y   + +G V+YVGKA +L  R+  Y        +  ++  E   +++VV   E E+LLLE NLI + +P++N+L+R+  +FPYIL+T       ++ H   +  KG Y+GPFA++      + N + R F LR C     +   + C+ Y I +C  PC  +++ +DY   + E   F SGKS+S+ + L      A+  L FE +  Y +    L      Q I      + D+   + +  +  I +F +  G             S L   E+L   + ++Y       PK V LS + E+   ++E+L      K++   P +G KK+++  A  NA E +  + L   S+Q R L  L E   L   +   R+E++DNS+I  TN VG M+V       KN+YRKFNI+  D     D+  M+EVI RR+               N  +F   P++I++DGG+ QV A  + L  + +  ++  IG+AK  D +   +R          L  +  + +F+  ++DE HRFAI  +R ++ K +  N L +I  +G TR   LL  + T   +  A+VE+L QI  I  A
  S:    80 MKRLPNNPGVYRMFNSDGDVLYVGKARNLKKRVSNYARGIGHSNRITRMIRETVTMEFVVTRTETEALLLEANLIKRLRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASAGAVGRTI-NALQRAFLLRTCTDSVFETRTRPCLLYQIKRCSAPCTYEISDEDYAGLVAEAKAFLSGKSQSVKDHLAAAMQAASADLDFEHAAVYRDRLAALSHVQSHQGINPQTVEEADVFAIHQEGGMTCIQVFFFRTGQNWGNRAYFPKADSSLGPAEVLGAFLSQFYDDKPC--PKLVLLSETVEEQFLITEALSTRAGHKVQVSVPQRGEKKELVQHALTNAREALGRR-LAETSSQARLLQGLAETFGL--PRAPRRIEVYDNSHIMGTNAVGGMIVAGPEGFVKNQYRKFNIRSTDITPGDDFGMMREVIERRFSRLVKEHGTPAGEVENPDAFPAWPDVILIDGGQGQVGAVRQILGEMGISDLVTAIGIAKGVDREAGRERFFMEGKQPFTLPPRDPVLYFIQRLRDEAHRFAIGTHRARRKKEMVRNPLDEIAGIGPTRKRALLHHFGTAKAVSRAAVEDLMQIDGISEA 678
>gi|126174774|ref|YP_001050923.1| excinuclease ABC subunit C [Shewanella baltica OS155] >gi|189038088|sp|A3D5P1|UVRC_SHEB5 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|125997979|gb|ABN62054.1| excinuclease ABC, C subunit [Shewanella baltica OS155] (609 aa)
Score = 687, Expect = 5.2e-70, Identities = 186/578 (32%), Positives = 328/578 (56%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYYSKIAIE--LPKTVYLSLSDEKLKTL----SESLKIKFLNPSKGVKKD---VMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKD-LYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL--KFLELDSIIPVIGLAKDDKHKT--DRIVKWDF-SEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           L+ +    G Y   D    VIYVGKA DL  R+  YF K+  ++KT+ L + I  ++  + ++E ++LLLEN+ I +Y PKYN+LLR+  ++PYIL+++ EHPR+ Y H   ++ KG Y+GP+ N    +  L+  + ++FP+R+C+ L     ++ C+ Y + +C  PC+ KV+  DY+  +K  + F  GK + +   L  K   AAE+  +E + ++ +    L+  +E+Q++  + K D D+IG +    +    +     G +    S Y  +    +++DE+L + I ++Y    I+  +PK V +S + E+L  L    SE+L  KF +    V+ D    +  A  NA     N  +  +S++N        L+++L++   + RME FD S+    + V + VV+     +K EYR++NI+      DY  MK+ + RR+    A  G+IP+++ +DGG  Q++ A + +  KF+ LD    +IG+AK +  K   + ++  D  +   L+  S     + +I+DE HRFAI+ +RN++ K+   ++L  I  +G  R + LL+    L ++K ASV EL ++  + IE+A+ I
  S:    11 LRTVSSSAGVYRMYDVKNDVIYVGKAKDLKKRLTSYFRKNLANVKTQALVSHIHHINVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEHPRLAY-HRGPQREKGHYFGPYPNGGAVRESLH-LMQKLFPIRQCDDLYYKSRSRPCLQYQLSRCSAPCVGKVSNADYDEQVKLASLFLKGKDQQVISALVDKMELAAERQAYEQAARFRDQIMALRKVAEQQEVS-NNKGDMDVIGVHYSSGIACFHLLFIREGKIFGSRSYYPSVPA-QTDMDEVLRSFILQFYLNADIQRTIPKEVVISHNFEELHELEAAVSEALDKKF-SIKTNVRADRASFLRLAVTNAT----NAVVTRLSHKNTVEQRFVLLEEILELSTPIQRMECFDISHTMGESTVASCVVFNREGPHKGEYRRYNIEGITPGDDYAAMKQAVSRRFDKIEAG-GKIPDILFIDGGLGQLRIAQKIVDEKFVHLDKAPQLIGVAKGEGRKPGLETLILGDTETSFSLEGDSPALHLIQHIRDESHRFAIAGHRNRRQKTRNTSTLESIPGIGPKRRKALLQHLGGLQEVKGASVAELVKVPGISIEMAQTI 603
>gi|157961777|ref|YP_001501811.1| excinuclease ABC subunit C [Shewanella pealeana ATCC 700345] >gi|189038093|sp|A8H3Y9|UVRC_SHEPA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|157846777|gb|ABV87276.1| excinuclease ABC, C subunit [Shewanella pealeana ATCC 700345] (609 aa)
Score = 687, Expect = 5.6e-70, Identities = 183/578 (31%), Positives = 322/578 (55%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYY--SKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL--KFLELDSIIPVIGLAKDDKHKT--DRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           LK +   PG Y   D    VIYVGKA DL  R+  YF K+  ++KT+ L + I ++D  V ++E ++L+LEN+ I +Y PKYN+LLR+  ++PYIL++  +HPR+ Y H   K+ KG Y+GP+ N    +  L+  + +IFP+R+C+ L     ++ C+ Y IG+C  PC+  V+ +DY+  ++    F  GK++ +   L +K  QA+  + +E +  Y +    L+  SE+Q++  +   D D+IG Y    V    +     G +    S Y  + V  +E+ E+L + + ++Y  S      PK + +S + E+   L++++      K++     +G +   +  A  NA   +  +     + + R L   E ++    I+   RME FD S+    + V + VV+     +K +YR++NI       DY  MK+ I RR+   T   G+IP+++ +DGG  Q++ A + +  +F+ LD+   +IG+AK +  K   + ++  +  E   L   S     + +I+DE HRFAI+ +RNK+ K+   ++L  I  +G  R + LL+    L ++K ASV EL+++  + +E+A+ I
  S:    11 LKTVTSSPGVYRMYDAKDAVIYVGKAKDLKKRLSSYFRKNLANVKTQALVSHIANIDVTVTHSETDALILENDYIKQYMPKYNVLLRDDKSYPYILLSNHQHPRLAY-HRGPKRDKGQYFGPYPNGGAVRESLH-LMQKIFPIRQCDDLYYKSRSRPCLQYQIGRCSAPCVDLVSEEDYQEQVRLATLFLKGKNQQVMSVLVQKMEQASSDMRYEQAALYRDQITALRRVSEQQEVS-NASGDMDVIGAYYASGVACFHLLFIREGKIFGSRSYYPKVPV-NTEVSEVLRSFMLQFYLNSDSQRLTPKEILISDAFEEQAELADAIQSAQNKKVEIKTQVRGERASFLRLALTNATNAVNTRLSHKNTIEQRFLLLEEAIESTNKIQ---RMECFDISHTMGESTVASCVVFNREGPSKADYRRYNITGITPGDDYAAMKQAITRRFDKITEK-GKIPDILFIDGGIGQLRIAQKVVDEQFVALDNAPTLIGVAKGEGRKPGLETLIYGESEESFSLPADSGALHLIQHIRDESHRFAITGHRNKRQKTRNTSTLETIAGVGPKRRKALLQYLGGLQEVKGASVSELAKVPGISLEMAQTI 603
>gi|78485489|ref|YP_391414.1| excinuclease ABC, C subunit [Thiomicrospira crunogena XCL-2] >gi|119367857|sp|Q31GI3|UVRC_THICR UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|78363775|gb|ABB41740.1| Excinuclease ABC subunit C [Thiomicrospira crunogena XCL-2] (613 aa)
Score = 686, Expect = 8.3e-70, Identities = 191/569 (33%), Positives = 313/569 (55%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILV-TKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKK-VTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSEL---DEILLTLIYEYYSKIAIELPKTVYLS--LSDE-KLKT-LSESLKIKFLNPSKGVK---KDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTD-RIVKWDFSEIKLD-KKSDLYFFLLN-IQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           LK +  +PG YL  D +G +IYVGKA +L  R+  YF K   ++KT+ L +++  ++  V + E+E+L+LEN LI ++KP+YN+L R+  ++PYI V T ++ P + Y H   K+  G Y+GPF N++     L+  + +IFP+R+C +      ++ C+ Y I +C GPC++  VT  +Y   ++    F  GKS  + E L  K  QA+++  FE +  Y +    L+    +  I      D D++    + N + + I  Y  G+L    +       +     EI+   I ++Y  I + +P+ + +S  L D+  L+T LSE  K K ++  K V    K +M  A  NA   +K +  Q  S   R + SL+++  L    +   ME FD S+      V + VV+  GV N + YRKFNI+      DY  M + I RRY         +P+LI++DGGK Q+  A++  K LELD+ +P++ +AK +  K    I+   F+E  +D +  D+   LLN I+DE HRFAI+ +R+++ K+   + L  I  +G     KLL  +  L ++K A+V EL ++
  S:    15 LKHLTERPGVYLMYDASGQIIYVGKAKNLKRRVSSYFKKRHEEIKTETLVSQVASIEVTVTDTESEALILENTLIKRHKPRYNILFRDDKSYPYIFVSTGKKFPSLSY-HRGAKRKVGRYFGPFPNASAVHQTLHA-LQKIFPVRQCTESVFNHRSRPCLQYQIKRCSGPCVEGLVTEAEYNEDVQHTIAFLEGKSFDVIESLGHKMQQASDEFEFEKAALYRDKISALRAIQSQHLINQPGSKDTDVVALAEEANQVCVSIMMYRGGNLWGSQNYFPKIGGQSINPGEIISAFITQHY--IDLPIPQMILVSDVLEDKSSLETWLSEQKKAK-VSIRKAVSQTHKGLMKLALTNAQSGLKQQLTQKASQAER-VKSLQDVLALASPPN--HMECFDISHTQGNQTVASCVVFNEGVPNTSAYRKFNIEGIQPGDDYAAMHQAITRRYSRVKKEGLPLPDLIVIDGGKGQLNKAIDVFKTLELDN-LPLVSVAKGEGRKAGLEILYTPFNEEGIDLEADDIALHLLNYIRDEAHRFAITSHRSRRQKAQTHSRLEDIPGVGAKTRHKLLTHFGGLTEVKNAAVSELQKV 594
>gi|15806371|ref|NP_295077.1| excinuclease ABC, subunit C [Deinococcus radiodurans R1] >gi|81551289|sp|Q9RUN0|UVRC_DEIRA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|6459106|gb|AAF10924.1|AE001981_9 excinuclease ABC, subunit C [Deinococcus radiodurans R1] (617 aa)
Score = 685, Expect = 8.8e-70, Identities = 172/583 (29%), Positives = 330/583 (56%)
  Q:     7 DKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF-LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK----CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNL-KMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSE--LDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIV-------KWDF---SEIKLDKKSDL------YFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEIKKL 589
           D L  +P  PG Y+++ K G+ IY+GKA +L +R+ Q+F    +  K  KLA  +   +++   NE E+L+LE NLI +++P YN+LL++   +P++ +T E +P ++ +    K     YYGP+ +++  +  + + I+ +FPLRK + LP +K    C+ Y +G+CLGPCI      +Y   ++++     G++  +  +L++    AA+   FE + +  +  + + K+F   Q    S++ D D +G         + +F+   G ++ +         E  L EI+   + +YY++ A  +P  + L    E     SE L      +++   P +G K D+++ A  NA   + ++   L   +  +   L+ L+ +L + +  +R+E +DNSN+F TN V  MVV+E G   + E+R+F ++  +   DY+ MK+ IYRR+  + A    +P+L+++DGG+ QV AAL++LK  E    +PV+GLAK    + +R++       +W     +E+ +D++  L         L+ ++DEVH +A+S++R  + + +  +    +  +G+ R + LLE + +L+ +  A VE ++ +  + +  A+ +K+ 
  S:     4 DDLPVLPTTPGVYIFR-KGGVPIYIGKANNLRSRVSQHFKAGGKSGKFTKLAESL---EFISAANEVEALVLEANLIKQHRPHYNVLLKDDKHYPFLKLTNEAYPMLVVTRRVLKD-GANYYGPYPDASAVR-RVKHLIDTMFPLRKNSGLPMQKKPRPCLNYHMGRCLGPCIDAAQPDEYRQAVEDVKALLEGRAAPVIARLKEDMKVAAQGQDFEQAARLRDRVQAVEKLFGTEQHAFVSEETDLDFLGAAQAGEFAMVQLFRMRGGRVVGRDKRFLTGADETGLGEIIGAFVADYYTQ-ATHVPPLILLPAEYEDAALWSEFLSRQAGRRVEMRTPKRGDKTDLIEMAQRNAAVGLDSEMALL--ERRGDHPGLDALKDVLALPERPWRIEGYDNSNLFGTNIVSGMVVFEGGRSRRGEHRRFKVRGLEHPDDYESMKQTIYRRFTGSLADKLPLPDLMLIDGGRGQVNAALDALK--EAGVQVPVVGLAK----REERLILPGRYGAQWWLETGTEVGVDRELLLPHTHPALRMLIGVRDEVHNYAVSYHRKLRGEGMLRSVFDDLPGIGQKRRDALLEHFTSLEDLAAAPVEHIAAVPGMTLRAAQSVKEF 604
>gi|127512753|ref|YP_001093950.1| excinuclease ABC subunit C [Shewanella loihica PV-4] >gi|189038092|sp|A3QDZ3|UVRC_SHELP UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|126638048|gb|ABO23691.1| excinuclease ABC, C subunit [Shewanella loihica PV-4] (609 aa)
Score = 685, Expect = 9.3e-70, Identities = 181/578 (31%), Positives = 316/578 (54%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLS--KYDLITVFYSELDEILLTLIYEYYSKIAIE--LPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLD-IKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL--KFLELDSIIPVIGLAKDDKHKTD-RIVKWDFSEI--KLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           LK +    G Y   D  G+VIYVGKA DL  R+  YF ++  ++KT+ L + I ++D  +  +E ++L+LEN+ I +Y P+YN+LLR+  ++PYI ++   HPR+ Y H   ++ KG Y+GP+ N    +  L+  + ++FP+R+C+ L     ++ C+ Y I +C  PC+ K++ +DY   +K  + F  GK + +   L  K  QAA  L +ED+ +Y +    L+  +E+Q++  S   D D+IG Y    +    +    NG +     Y       +E+ E+L   + ++Y  +  +  LP+ + +S   E +  L E++      ++      +  +   +  A  NA    KN     +S+QN        L++ L+  + + RME FD S+    + V + VV+     +K EYR++NI       DY  MK+ I RR+    A  G+IP+++ +DGG  Q++ A + +  KF  LD    +IG+AK +  K     + +  +E+   L   S     + +I+DE HRFAI+ +RNK+ K+   ++L  I  +G  R + LL+    L ++K ASV +LS++  + +E+A+ I
  S:    11 LKTVSSSAGVYRMYDAQGVVIYVGKAKDLKKRLSSYFRRNLPNVKTQALVSHIANIDVTLTPSETDALILENDYIKQYMPRYNVLLRDDKSYPYIFLSGHRHPRLAY-HRGPQREKGHYFGPYPNGGAVRESLH-LMQKLFPIRQCDDLYYKARSRPCLQYQIARCSAPCVGKISDEDYAEQVKLASLFLRGKDQQVIATLVGKMEQAAMDLNYEDAARYRDQISALRRVAEQQEVS-SDSGDMDVIGAYYASGIACFHLLFIRNGKIFGSRSYYPSVPDETEVSEVLRAFMLQFYLNVDSQRTLPREIVVSHEFEDIHELEEAIAQASNRRLLIKTKVRSERASFLRIADANA----KNAVETRLSHQNTVEERFLLLEEALEQSQAINRMECFDISHTMGESTVASCVVFNREGPSKGEYRRYNISGITPGDDYAAMKQAIGRRFDKIEAD-GKIPDILFIDGGMGQLRIAQKVVNEKFAHLDVAPTLIGVAKGEGRKPGLETLIYGENEVAFSLPADSGALHLIQHIRDESHRFAITGHRNKRQKTRNTSTLESIPGVGPKRRKALLQYLGGLQQVKGASVAQLSKVPGISLEMAQTI 603
>gi|90419512|ref|ZP_01227422.1| excinuclease ABC, C subunit, uvrC [Aurantimonas sp. SI85-9A1] >gi|90336449|gb|EAS50190.1| excinuclease ABC, C subunit, uvrC [Aurantimonas sp. SI85-9A1] (688 aa)
Score = 684, Expect = 1.1e-69, Identities = 181/581 (31%), Positives = 302/581 (51%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF-LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLN------PSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYKNNTASFGEI------------------------PNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           E I    K++P++PG Y    K+G V+YVGKA  L  R+  Y  L     +  ++  E   +++V    E E+LLLE NLI + +P+YN+LLR+  +FPYILV+++     +  H   +  KG+Y+GPFA++      + N + R F LR C     +   + C+ + I +C  PC  +++  DY+  ++E   F SG+S  I   +     +A++ L FE +  Y +    L      Q I  +   + D+   + +  +  I +F +  G             S L+  E+L   + ++Y    +  P+ V L L  +    L+E+L +K  +      P++G+K+D++D A  NA E +  + L   S+Q R L  + E   L   +   R+E++DNS+I  T  VG M+V       KN YRKFNI+ +D     D+  MKEV+ RR+       G++                        P+L+++DGGK Q+ A  E L  L +   +  IG+AK  D     +R V  +     L  +  + +FL  ++DE HRFAI  +R ++ K L +N L +I  +G +R   LL  + T   +  A++ +L ++  I  A
  S:    60 ELIAALAKRLPNQPGVYRMFGKDGDVLYVGKARSLKKRVANYTRLGGHTQRIARMIRETRQMEFVTTRTETEALLLEANLIKRLRPRYNVLLRDDKSFPYILVSEDHEAPAIMKHRGARSRKGSYFGPFASAGAVGRTI-NSLQRAFLLRTCTDSVYESRTRPCLLHQIKRCSAPCTGEISIADYDGLVREAKAFLSGRSNQIKNGMSAAMQEASDDLDFERAAIYRDRLAALSHVQSHQGINPTGIEEADVFAIHQEGGMTCIQVFFFRTGQNWGNRAYFPKADSSLEPSEVLGAFLAQFYDDKPV--PRLVLLPLMVDDGPLLAEALSLKASHRVQIGVPARGLKRDLVDHATANAREALGRR-LAETSSQARLLKGVAETFGL--ARTPRRIEVYDNSHIMGTAAVGGMIVAGPQGFAKNHYRKFNIRGDDITPGDDFGMMKEVMRRRFSRLIKEHGDVPLSAQTEDEEDPQDALSDSSMPAWPDLVLIDGGKGQISAVREILDELGIADRVTTIGVAKGVDRDAGRERFVTGEREPFSLPPRDPVLYFLQRLRDEAHRFAIGTHRARRKKELVKNPLDEIGGIGPSRKRALLHHFGTAKAVSRAALSDLREVEGISAA 675
>gi|147669666|ref|YP_001214484.1| excinuclease ABC subunit C [Dehalococcoides sp. BAV1] >gi|189038046|sp|A5FQB7|UVRC_DEHSB UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|146270614|gb|ABQ17606.1| Excinuclease ABC subunit C [Dehalococcoides sp. BAV1] (607 aa)
Score = 684, Expect = 1.2e-69, Identities = 193/588 (32%), Positives = 330/588 (56%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL-PNKK---CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTV-YLSLSDEKL--KTLSESL--KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIK-DLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY-----KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDK-----HKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE--VAKEIKKL 589
           NE +++++  +P  PG YL K+  G +IYVGKA  L +R+K YF+    L  KT +L ++I +++Y++  +E E+L+LE NLI +++P +N+ L++   FPY+ +T  E+ PRI Y   S     G Y+GPFAN+   ++ L   +  +F  R CN+  P K+   C+ YDI QCL PC  K+++ DY+  + +   F  GK   + + L +   +A+ +L +E +    +   ++K   E Q +      ++D I F  + ++  + +F    G L+ +  + L      +  +IL     ++Y       PK V    +SD ++  K LS+    K+      +G  K++++    NA E +K   ++ +S+     ++L ELQ  L +     R+E +D SNI  TN VG+MVV+ENG   K  YR+F IK      D+  +KEVI RR+     ++   SF  +P+L+++DGGK Q+ +  E+L  L L+    VIGLAK+ +     HK++         I+L   S     L  ++DE HRFA+ ++ + + KS   ++L  I  +G +R   L++ + ++  I++AS E+LSQ+  I   +A  IK+L
  S:     3 NETLQNQIASLPENPGVYLMKNAQGEIIYVGKAAVLKDRVKSYFVPPSRLTPKTCQLVSQINELEYLITGSEQEALILELNLIKRHRPYFNVRLKDDKGFPYLKITLNEKWPRI-YITRSMADDGGRYFGPFANTRSVRHTL-QVLKELFRFRSCNRTEPEKRSRPCLEYDIHQCLSPCTGKISKSDYDHLISQAILFLEGKQDQVLKLLIRLMNEASARLDYETAALRRDQIASIKEVIEGQQLAARVTGEQDAIAFAQEGDLSMVQVFFIRRGKLIGRESFCLQGTREEKPGDILSEFAKQFYHSSTQIPPKIVTQYPVSDREILEKWLSQRRGDKVHITAGLRGQPKELINIVAENAREQLKQARIKNLSSSVTLTDALAELQTALGLSLPPQRIEGYDISNIQGTNAVGSMVVFENGKPQKAHYRRFRIKTVKGADDFSMLKEVISRRFGRVHREDAGESFARLPSLMLIDGGKGQLSSVKETLDKLGLEG-QAVIGLAKEFEEIYLPHKSE--------PIRLAANSPALQLLQRVRDEAHRFALGYHLHIRQKSGLTSALDGIPGVGPSRRRLLIKTFGSVAGIRQASFEKLSQVKGINQALALSIKEL 606
>gi|20092138|ref|NP_618213.1| excinuclease ABC subunit C [Methanosarcina acetivorans C2A] >gi|30173457|sp|Q8TKS2|UVRC_METAC UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|19917360|gb|AAM06693.1| excinuclease ABC, subunit C [Methanosarcina acetivorans C2A] (516 aa)
Score = 684, Expect = 1.2e-69, Identities = 179/531 (33%), Positives = 300/531 (56%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFL-----------NPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYR-MEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFE 539
           L+ +PH PGCYL+KD+ G+V+YVGKA DL  R+  YF K D D KT  L      +D++V N E E+LLLEN LI K+ P+YN+LL++S  +  I +T E+ PRI  +  +T    G ++GPF ++  + Y ++  + + F LR C K+P++ C+ Y IG C GPCI  ++ ++Y   +K       G    + E +EK+  + A K MFE +    +    L+   E+Q++   +K+DEDI+ +  ++N + +++FK   G+L  K D +  F    ++ L   + +YYS+   + P+ + +       + L ESL ++FL            P +G KK+++D A       +KN  +    ++ +    LE LQ  L +  L   +E FD S++  T+ VG+MV +  G  +K+ YR+F I+  +   D+  + EV+ RRY        E+P+LII+DGGK Q+ +A + L+ L++   +P+I +AK ++      +K   S + + +      F+  I+DE HRFAI++ R  + KSL +
  S:     4 LEALPHLPGCYLFKDEEGVVLYVGKAKDLKKRVSSYFQKRDHDPKTTSLVQAARGLDFIVTNTEVEALLLENTLIKKHWPRYNILLKDSKRYACIHLTGEKFPRIRIARKNTGD--GEFFGPFVSAKERDY-IFEVVRKTFQLRTCKKMPSRACLRYHIGACSGPCIGSISEEEYGEKVKRATSVLKGNIGELIESMEKEMKKMAAKQMFEQAMALRDEISALEYLQEKQNMERQKKHDEDILNYIVRDNTVYLMLFKVYKGTLEDKQDYVFAFG---EDFLQEFLVQYYSE--NDPPEELIVP------QVLEESL-VEFLAHVKGKKVKVTVPKQGEKKELLDLA-------LKNVEIGFFGDRKK----LESLQSKLSLPKLPNVIECFDISHLSGTSTVGSMVQFRGGRPDKHNYRRFKIESVEGIDDFASIAEVVRRRYSRLLEDKHEMPDLIIIDGGKGQLSSAFQELRKLKIR--VPIISIAKREEELYVPGLK---SPLPIKRNEKASLFVQEIRDEAHRFAITYNRLLRQKSLIK 516
>gi|15964924|ref|NP_385277.1| excinuclease ABC subunit C [Sinorhizobium meliloti 1021] >gi|81634822|sp|Q92QX2|UVRC_RHIME UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|15074103|emb|CAC45750.1| Probable excinuclease ABC subunit C [Sinorhizobium meliloti 1021] (674 aa)
Score = 684, Expect = 1.2e-69, Identities = 180/575 (31%), Positives = 294/575 (51%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL-KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD------EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK---------------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           E I+  +K++P+ PG Y   ++ G V+YVGKA  L  R+  Y   +    +  ++  E   +++V    E E+LLLE NLI + +P++N+LLR+  +FPYI+VT +     LY H   +  KG Y+GPFA++      + N + R F LR C     +   + C+ Y I +C  PC  +V+  DY   + E  DF SGKS+++   +     +A+E L FE +  Y +    L      Q I  +   + D+   + +  +  I +F +  G           ++ + D      E+L   + ++Y       P+ V L    E+ + L+++L      K+  L P +G KKD+++ A  NA E    K L   ++Q R L       +L  +    R+EI+DNS+I  TN VG MVV       K +YRKFNIK  D     D+  M+EV+ RR+                   A F   P++I++DGG+ Q+ A    LK L ++  +  IG+AK  D     +R          L  +  + +F+  ++DE HRFAI  +R ++ K + +N L +I  +G TR   LL  + T   +  A + +L  +
  S:    53 ELIQAFVKRLPNGPGVYRMLNEAGDVLYVGKARSLKKRVSNYAQGRGHSNRIARMVRETAHMEFVTTRTEIEALLLEANLIKRLRPRFNVLLRDDKSFPYIVVTGDTRAPALYKHRGARSRKGDYFGPFASAGAVGRTI-NSLQRAFLLRTCTDSVFETRTRPCLLYQIKRCSAPCTNEVSDADYAELVSEAKDFLSGKSQAVKATIASAMAEASENLDFERAALYRDRLAALSHVQSHQGINPAGVEEADVFATHHEGGISCIQVFFFRTGQNWGN----RAYFPKADPSIPPAEVLSAFLAQFYDDKPC--PRQVLLCAPVEEQELLAQALSEKSGYKVSILVPQRGEKKDLVEHALANAREAHGRK-LAETASQGRLLEGFAATFQLPYVPR--RIEIYDNSHIMGTNAVGGMVVAGPEGFVKGQYRKFNIKSTDITPGDDFGMMREVMTRRFSRLLKEEGKPDRSAEPGEDAGFPAWPDVILIDGGQGQMTAVRTILKELGIEDCVTAIGVAKGVDRDAGRERFFAEGRESFTLPPRDPVLYFIQRLRDEAHRFAIGSHRARRKKEMVKNPLDEIAGIGPTRKRALLTHFGTAKAVSRAGINDLMSV 653
>gi|163759154|ref|ZP_02166240.1| excinuclease ABC subunit C [Hoeflea phototrophica DFL-43] >gi|162283558|gb|EDQ33843.1| excinuclease ABC subunit C [Hoeflea phototrophica DFL-43] (701 aa)
Score = 683, Expect = 1.5e-69, Identities = 180/581 (30%), Positives = 302/581 (51%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL-KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD------EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYKNNTASFGE------------------------IPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           E I+  +K +P++PG Y   ++ G V+YVGKA  L  R+  Y   +    +  ++  +  ++++V    E E+LLLE NLI + KP++N+L+R+  +FPYILVT +     ++ H   +  KG+Y+GPFA++      + N + R F LR C     +   + C+ Y I +C GPC  ++  + Y   + E  DF SG+S+++  QL +    A+E L FE +  Y +    L      Q I      + D+   +    +  I +F +  G           ++ + D      EIL   I ++Y       P+ + +S   E    L+E+L      K+    P +G K++++D   +NA E    ++L   ++Q R L  L E   L   +   R+E++DNS+I  TN VG M+V       KN+YRKFNIK  D     D+  M+EV+ RR+       GE                         P+L+++DGGK Q+ A  + L+ L +   I  IG+AK  D +   +R       +  L  +  + +F+  ++DE HRFAI  +R ++ K + +N L +I  +G +R   LL  + T   +  A V++L ++  I  A
  S:    72 EVIQAFVKHLPNQPGVYRMINEAGDVLYVGKARSLKKRVTNYAQGRGHSNRITRMIAQTANMEFVTTRTETEALLLEANLIKRLKPRFNVLMRDDKSFPYILVTADHEAPAIFKHRGARSRKGSYFGPFASAGAVGRTI-NALQRAFLLRTCTDSVYESRTRPCLLYQIKRCAGPCTGEIDAEGYARLVSEAKDFLSGRSQTVKAQLSRAMQDASEDLDFERAAVYRDRLSALSHVQSHQGINPQTVEEADVFAIHHDAGMACIQVFFFRTGQNWGN----RAYFPKADPSLAPGEILGAFIGQFYDDKPT--PRMILVSNDFEDRPLLAEALSVRMERKVTISEPQRGEKRELVDQVLSNARE-AHGRHLAETASQARLLEGLAETFAL--PRPPRRIEVYDNSHIMGTNAVGGMIVAGPEGFVKNQYRKFNIKSTDITPGDDFGMMREVMQRRFSRLIKDHGEEGPNQPDSADDADTDAAAQAGMPAWPDLVLIDGGKGQMSAVRKILEELGIAGKITAIGVAKGMDREAGRERFFVEGKPDFTLPPRDPVLYFVQRLRDEAHRFAIGTHRARRKKEMIKNPLDEIGGIGPSRKRALLHHFGTAKAVSRAGVDDLIKVEGISEA 687
>gi|167925613|ref|ZP_02512704.1| excinuclease ABC subunit C [Mycoplasma mycoides subsp. mycoides LC str. GM12] (584 aa)
Score = 683, Expect = 1.6e-69, Identities = 203/574 (35%), Positives = 320/574 (55%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSE-LDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDV-MDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIV 578
           +K ++  +P+KPGCYL+ +K+  VIYVGKA +L  R+  YF K  ++KT +L  EI D+ Y +V+NE ESLLLE NLI KY PKYN+LL +   +PYI++T ++ P   Y     KK    Y      SN +   L   + R+FPLR C    NK C+YY + QC G C K+V    YE  +K+++ FF G+   + + L K+  +A++ L FE +Q+  +   +L   + +Q++      + D+I +   ++ I  V+  Y  G L  K + I  +  + L E+  + + + Y K    +   V L  ++ +L  L ++L ++F + S   + DV +  A  NA++ +    +    N   E+  LE+L+++ +  K L R+EIFD SNI+N    GA +VY N    +NE+RK+NI D    SDY  MK ++ +R+        ++P+LIIVDGG  Q+ AA E L  L L   I VIGL+KDD HKT  ++      I +     LY FL ++Q  V  +A S +R KK  +   + +  IK +GK    KL + ++T+D IK AS +EL++++
  S:     3 LKQQVDLLPNKPGCYLFFNKDNDVIYVGKAKNLKKRVSTYFNKAYNIKTTRLVREITDLKYFIVDNEKESLLLEKNLIKKYHPKYNVLLNDDKTYPYIIITNQKDPMYKYVRKYDKKALKNYGPLPIGSNARSILLT--LQRLFPLRMCQGNLNKPCLYYHLNQCSGACFKQVDLSYYEYQIKQVDKFFKGEINQVKQTLIKQMQKASDNLQFEQAQRIKDQITSLDFITAKQNVDIVTNKNIDVINYEINQDKICFVMLFYRLGQLTYKDEYIQNYEGQNLSELFNSYLQQIYQK---NIYPDVLLIPNEIELLDLDQNL-LEFSSYSLNKQDDVFIKLAKQNAIDSLNKSVISHNVNSGDEIEILEQLKQISNASKYLKRIEIFDISNIYNQFITGACIVYINAKPIRNEFRKYNI-DSSYTSDYARMKFMLEKRFLKRIKEKEQLPDLIIVDGGIIQIHAAKEVLNKLNLK--IDVIGLSKDDHHKTRYLIDIFEQTIDIKNFKKLYNFLTSLQIRVDEYAKSGFR-KKYHNQLNDQILLIKGVGKKTNLKLYKHFKTIDNIKNASFDELNKVI 569
>gi|73748905|ref|YP_308144.1| excinuclease ABC, C subunit [Dehalococcoides sp. CBDB1] >gi|90111067|sp|Q3ZYA3|UVRC_DEHSC UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|73660621|emb|CAI83228.1| excinuclease ABC, C subunit [Dehalococcoides sp. CBDB1] (607 aa)
Score = 683, Expect = 1.8e-69, Identities = 192/588 (32%), Positives = 329/588 (55%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK----CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTV-YLSLSDEKL--KTLSESL--KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIK-DLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY-----KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDK-----HKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE--VAKEIKKL 589
           NE +++++  +P  PG YL K+  G +IYVGKA  L +R+K YF+    L  KT +L ++I +++Y++  +E E+L+LE NLI +++P +N+ L++   FPY+ +T  E+ PRI Y   S     G Y+GPFAN+   ++ L   +  +F  R CN+   +K    C+ YDI QCL PC  K+++ DY+  + +   F  GK   + + L +   +A+ +L +E +    +   ++K   E Q +      ++D I F  + ++  + +F    G L+ +  + L      +  +IL     ++Y       PK V    +SD ++  K LS+    K+      +G  K++++    NA E +K   ++ +S+     ++L ELQ  L +     R+E +D SNI  TN VG+MVV+ENG   K  YR+F IK      D+  +KEVI RR+     ++   SF  +P+L+++DGGK Q+ +  E+L  L L+    VIGLAK+ +     HK++         I+L   S     L  ++DE HRFA+ ++ + + KS   ++L  I  +G +R   L++ + ++  I++AS E+LSQ+  I   +A  IK+L
  S:     3 NETLQNQIASLPENPGVYLMKNAQGEIIYVGKAAVLKDRVKSYFVPPSRLTPKTCQLVSQINELEYLITGSEQEALILELNLIKRHRPYFNVRLKDDKGFPYLKITLNEKWPRI-YITRSMADDGGRYFGPFANTRSVRHTL-QVLKELFRFRSCNRTEPEKHSRPCLEYDIHQCLSPCTGKISKSDYDHLISQAILFLEGKQDQVLKLLIRLMNEASARLDYETAALRRDQIASIKEVIEGQQLAARVTGEQDAIAFAQEGDLSMVQVFFIRRGKLIGRESFCLQGTREEKPGDILSEFAKQFYHSSTQIPPKIVTQYPVSDREILEKWLSQRRGDKVHITAGLRGQPKELINIVAENAREQLKQARIKNLSSSVTLTDALAELQTALGLSLPPQRIEGYDISNIQGTNAVGSMVVFENGKPQKAHYRRFRIKTVKGADDFSMLKEVISRRFGRVHREDAGESFARLPSLMLIDGGKGQLSSVKETLDKLGLEG-QAVIGLAKEFEEIYLPHKSE--------PIRLAANSPALQLLQRVRDEAHRFALGYHLHIRQKSGLTSALDGIPGVGPSRRRLLIKTFGSVAGIRQASFEKLSQVKGINQALALSIKEL 606
>gi|94496331|ref|ZP_01302908.1| excinuclease ABC, C subunit [Sphingomonas sp. SKA58] >gi|94424077|gb|EAT09101.1| excinuclease ABC, C subunit [Sphingomonas sp. SKA58] (637 aa)
Score = 683, Expect = 1.8e-69, Identities = 182/574 (31%), Positives = 314/574 (54%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEH--PRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSEL--DEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKD-EDANSDYDYMKEVIYRRY-----KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKH-KTDRIV--KWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQ 576
           E I+  LK +P +PG Y   D  G V+YVGKA  L NR+  Y   DR   + +++  +   +  V  N+E E+LLLE  LI +Y+P YN+LLR+  +FP+IL+ +++H  PR+   H   +K +G YYGPFA++      + N + ++F LR C        ++ C+ Y I +C  PC+ ++    Y   +++  DF  GKS ++ ++L     QA++ + FE +    +  K L      Q I      D DI     K   + I  F    G          V  +++  +E+L + + ++Y ++    P+ +       + + ++ +L      K++   P +G +  ++  A  NAVE + ++ L   ++Q R L+ + E   L  + D  R+EI+DNS+I   + +GAMVV       KN YRKFN+K+ E +N D+  M+E+  RR+     ++     GE P+L+++DGGK Q+ AA   L+ L ++ +  +IG+AK   H +  R V    D  EI       + F+L  ++DE HRFAI  +R K+SK++  +SL ++  +G  R + LL  + T   +++A++E+L++
  S:    31 EAIRTVLKTLPIRPGVYRMHDARGDVLYVGKARALKNRVANYTQVDRLPKRLQRMVAQTRSMTIVTTNSEAEALLLEAQLIKRYRPPYNVLLRDDKSFPFILL-RDDHAFPRV-QKHRGARKYQGRYYGPFASAGSVTRTI-NALQKLFLLRSCTDSFFANRSRPCLLYQIKRCSAPCVDRIDEAGYAELVRDAQDFLGGKSTAVQKKLGAAMQQASDAMDFEQAAVIRDRLKALTFIQGSQAINAEGLGDADIFALAEKGGAMCIQAFFIRGGQNWGHRSFFPVHTADVATEEVLESFMAQFYEEVPP--PRLILADRQPAECELMALALSERAGGKVRIEVPQRGERTRLIKQAQRNAVEAL-DRRLAETTSQGRILDEMVETFGLEGVPD--RIEIYDNSHIQGAHALGAMVVAGPEGFRKNAYRKFNMKNPEISNDDFAMMREMFERRFGRAAREDPDRDSGEWPDLVLIDGGKGQLSAARGILEDLGIEDVC-MIGVAKGPHHGREGREVFHLMDGREITFPLNHPVLFYLQRLRDEAHRFAIGAHRAKRSKAITVSSLDEVPGIGPARKKALLMHFGTARAVRDAALEDLAK 619
>gi|56551568|ref|YP_162407.1| excinuclease ABC subunit C [Zymomonas mobilis subsp. mobilis ZM4] >gi|81355285|sp|Q5NPR4|UVRC_ZYMMO UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|56543142|gb|AAV89296.1| excinuclease complex nuclease subunit [Zymomonas mobilis subsp. mobilis ZM4] (664 aa)
Score = 681, Expect = 2.6e-69, Identities = 193/579 (33%), Positives = 311/579 (53%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF-LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKE-EHPRI--LYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK--LPNKK--CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYS-KIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDAN--SDYDYMKEVIYRRY-----KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           I + LK +P +PG Y   D  G ++YVGKA  L NR+  Y  +     + +++ ++   +  V    E+E+LLLE  LI +Y+P YN+LLR+  +FPYIL+ ++   P+   L  H   K+ KG YYGPFA+++     L N + ++F LR C+     N+K  C+ Y I +C  PC+ +++  DY     +  DF +GKS  + ++L     QA+  L +E +  Y +  K L      Q I      + DI G  C+  +  I +F   N        Y L  +    L++++ + + ++Y  KIA   PK +  +        L ++L      ++KF  P +G  K ++D A  NA E + ++ L   S Q + L  +  L  L  I D  R+E++DNS+I  +N VG M+V       +N YRKFNIK    N   D++ M+EV+ RR+      +   S  E P+L+++DGGK QV A  + L    + S I ++G++K  D     +     D SE  L   S L F+L  ++DE HRFAI  +R K++K+L  + L ++  +G +R + LL  + T   +K AS+ EL ++  I  A
  S:    54 IGNVLKTLPLRPGVYRMYDSKGNILYVGKARALRNRVANYTQISGLSRRIQRMVSQTRSMTIVTTVTESEALLLEAQLIKRYRPPYNILLRDDKSFPYILLKEDGTFPQFPSLQRHRGVKRAKGKYYGPFASADSVTLTL-NSLQKLFLLRSCSDSFFRNRKRPCLLYQIKRCSAPCVGRISEDDYRDLAVDTRDFLAGKSTHVQKKLVTAMEQASNDLNYELAAVYRDRLKALAFIQSHQSINSGNLRNADIFGIECRAGLACIQVFFIRNRQNWGHHAYYLNHIDEQPLEDVMQSFLGQFYEDKIA---PKDILTNYLPSDKNVLEDALSSQRDYRVKFYQPQRGELKKLVDQAVRNAKEAI-DRRLAEASTQKQLLKEMVNLFHLDKIPD--RIEVYDNSHIMGSNMVGGMIVAGPEGFRRNSYRKFNIKSPSINPGDDFEMMREVLTRRFSRLERSDPDHSSSEWPDLLLIDGGKGQVHAVKDILAEQGI-SDIAIVGISKGPDRNAGREHFHLVDGSEYALPPNSGLLFYLQRLRDEAHRFAIGTHRAKRAKNLTSSPLDEVPGIGPSRKKALLLHFGTARDVKNASLSELEKVNGISSA 650
>gi|13476555|ref|NP_108125.1| excinuclease ABC subunit C [Mesorhizobium loti MAFF303099] >gi|81776470|sp|Q984P3|UVRC_RHILO UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|14027316|dbj|BAB54270.1| excinuclease ABC subunit C [Mesorhizobium loti MAFF303099] (688 aa)
Score = 681, Expect = 2.7e-69, Identities = 189/582 (32%), Positives = 308/582 (52%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQY----FLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNG------SLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK-----------NNTA--------------SFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAK 584
           E I+  +K++P+ PG Y   +  G V+YVGKA  L  R+  Y    F  +R     ++  E   +++VV   E E+LLLE NLI + +P++N+L+R+  +FPYIL+T +     +Y H   +  KG Y+GPFA++      + N + R F LR C     +   + C+ Y I +C GPC  +++ + Y   + E  DF SG+S+ +  ++     QA+E L FE +  Y +    L      Q I  +  ++ D+   + +   + I +F +  G      +   K D       E  E+L + + ++Y       P+ + LS   E  + L E+L      K+    P +G KKD+ D A  NA E +  + L   S Q R L    E   L   K   R+E++DNS+I  TN VGAMVV       KN+YRKFNI+  +     D+  M+EV+ RR+            N+ A              SF   P++I++DGG+ Q+ A  + L  L ++  +  IG+AK  D     +R          L  +  + +F+  ++DEVHRFAI  +R ++ K + ++ L +I  +G  R   LL  + T   +  A++E+L ++  I  +VAK
  S:    60 EVIQTLVKRLPNAPGVYRMMNAAGDVLYVGKARSLKKRVTNYAQGRFHTNR---IGRMVRETSTMEFVVTRTEIEALLLEANLIKRLRPRFNVLMRDDKSFPYILLTGDHVSPGIYKHRGARSRKGDYFGPFASAGAVGRTI-NSLQRAFLLRSCTNSFYENRTRPCLLYQIKRCAGPCTGEISHEGYAELVAEAKDFLSGRSQKVKTEISAAMQQASEDLDFERAAIYRDRLAALSHVQSHQGINPATVDEADVFAIHQEGGQVCIQVFFFRTGQNWGNRAYFPKADPAL----EAAEVLGSFLAQFYDDKPT--PRNILLSRGVEDQELLGEALSTRAGRKVTISVPQRGEKKDLTDNALQNAREALGRR-LAETSTQGRLLAGFAETFGL--AKPPVRIEVYDNSHIMGTNAVGAMVVAGPEGFVKNQYRKFNIRSTEITPGDDFGMMREVMERRFSRLLKEHGDVAPNDAASAEAGDDIEDDISGSFPAWPDVILIDGGQGQMTAVRKILADLGIEDRVVAIGIAKGQDRDAGRERFFVKGRDSFSLPVRDPVLYFVQRLRDEVHRFAIGSHRARRKKEMVKSPLDEIAGIGPGRKRALLLAFGTAKAVSRAAIEDLRKVDGISEQVAK 679
>gi|121996832|ref|YP_001001619.1| excinuclease ABC, C subunit [Halorhodospira halophila SL1] >gi|121588237|gb|ABM60817.1| Excinuclease ABC subunit C [Halorhodospira halophila SL1] (613 aa)
Score = 681, Expect = 3.1e-69, Identities = 168/575 (29%), Positives = 316/575 (54%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYI-LVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL--SKYDLITVFYSELDEILLTLIYEYY-SKIAIELPKTVYLSLSDEKLKTLSESLK------IKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIK-DLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDR---IVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           E ++++++ +P +PG Y      G +IYVGKA +L  R+  YF   R   KT++L   I DV   V + E E+L+LENNLI +++P+YN+LLR+  ++PYI L + ++ PR+ Y H   ++  G ++GP+ NSN  + E   ++ ++FP+R+C     +  ++ C+ Y I +C  PC+  ++ +DY   ++++  F  G+S  +  +L ++  +AAE L FE + +  +   NL+   +RQ +   + ++ DI+    + +   + +F    GS L    Y   T   S   +IL + + ++Y  ++A   P  V ++    + + L ++L+      +   +  +G ++  ++ A  NA   +  +     S Q R       L +++D      R+E FD S+      V + VV+      K++YR+FNI++  A  DY  M + + RRY+   +    +P+L+++DGGK QV  A + L  L +D  + ++G+AK  + +      ++     EI+L   S     L  ++DE HRFA+S +R ++ K+  E+ L +I  LG  R + LL+ +  +  I++A +E+L+++
  S:    13 EALRERVRGLPERPGVYRMLSAEGTIIYVGKARNLRRRVSSYFTPSRKTPKTERLVQLIADVQITVTHTEAEALILENNLIKEHRPRYNVLLRDDKSYPYIYLSSHQQFPRLGY-HRGARQGAGRFFGPYPNSNAVR-ETLGYLQKVFPIRQCRDTFFRNRSRPCLQYQIRRCTAPCVGYISEEDYRRDVRDVEFFLEGRSGEVIAELVRRMEEAAENLEFEQAARLRDRIANLRHIQQRQYVAQDRDDNMDIVACVAEGDTACVQVFFIRGGSSLGNQSYFPNTPSGSRESDILASFLAQHYLGRVA---PPEVVINRPVREQRLLEQALRTASGGTVAIRHRVRGDRRRWVEMAEENARYALSARSASTASQQRR----YSALAEVIDSDAPPERIECFDISHTAGEATVASCVVFNREGPVKSDYRRFNIRNVTAGDDYAAMHQALTRRYRRVKSGEAPLPDLLLIDGGKGQVAQARDVLDELGIDG-VALMGIAKGPERRPGEETLLLDDGEREIELPADSPALHLLQQVRDEAHRFAVSGHRQRRGKARRESILEEIPGLGPKRRQSLLKHFGGIQGIRQAGIEDLARV 596
>gi|87199082|ref|YP_496339.1| excinuclease ABC subunit C [Novosphingobium aromaticivorans DSM 12444] >gi|119367680|sp|Q2G9G8|UVRC_NOVAD UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|87134763|gb|ABD25505.1| Excinuclease ABC subunit C [Novosphingobium aromaticivorans DSM 12444] (658 aa)
Score = 680, Expect = 3.4e-69, Identities = 178/579 (30%), Positives = 316/579 (54%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEE-HPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK----LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSE---LDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY-----KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDF---SEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           I++ ++ +  KPG Y   D  G V+YVGKA  L NR+  Y   +R   + +++ ++   +  V  N+E E+LLLE  LI +++P YN+LLR+  +FP+IL+  +   PRI   H   +K KG YYGPFA++      + N + ++F LR CN       ++ C+ Y I +C  PC+ +++  DY   +++  DF  GKS ++  ++E +  +AAE L FE +    +  +        Q I      + D+     K   +++  F ++ G     +      ++E    +E++ + + ++Y ++       V  +L +  L  L+E+L      K++   P +G ++ +M+ A  NAVE +  +    ++    +   + EL + L++ ++  R+EI+DNS+I  TN +GAMVV       K +YRK+NIK    N D+  M+EV+ RR+     ++     G  P+L+++DGGK Q+ A  E+L  L ++  +P++ +AK   H  +    + F    E  L   S + F L  ++DEVHRFAI  +R K+S+++  + L +I  +G  R   LL  + T  K++ AS+E+L +   +  A
  S:    53 IRETVQTLKPKPGVYRMLDARGDVLYVGKARALKNRVANYTQVERLPNRLRRMVSQTRSMTIVTTNSEAEALLLEAQLIKRFRPPYNVLLRDDKSFPFILLRGDHAFPRI-SKHRGARKAKGNYYGPFASAGSVNTTI-NALQKLFLLRSCNDGFMARRDRPCLLYQIRRCSAPCVGRISEADYGELVRQAKDFLGGKSGAVQREIEAQMHKAAEDLDFERAAMLRDRLRAATFIQGSQAINAEGVGNADVFAMATKGGQVAVQAF-FIRGGQNWGHRAFFPSHTEGLSEEEVMTSFLAQFYEEVPPARLILVDRALPEADL--LAEALCEAAGGKVEISVPQRGDRRRLMEQAQRNAVEALDRR----MAESGTKAKVMRELAEFLELPEVPQRIEIYDNSHIQGTNALGAMVVAGPEGFVKGQYRKWNIKLAQTNDDFAMMREVMTRRFGRAQEEDPDRESGNWPDLVLIDGGKGQMSAVKEALGELGIED-VPLVAIAKGPHHGREGREVFHFPDGREKMLPVNSPVLFQLQVMRDEVHRFAIGAHRAKRSRAITASPLDEIPGIGPARKRALLLHFGTAGKVRAASLEDLQRAPGVSAA 645
>gi|163787198|ref|ZP_02181645.1| excinuclease ABC, C subunit [Flavobacteriales bacterium ALC-1] >gi|159877086|gb|EDP71143.1| excinuclease ABC, C subunit [Flavobacteriales bacterium ALC-1] (597 aa)
Score = 680, Expect = 3.6e-69, Identities = 194/579 (33%), Positives = 319/579 (55%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN------KLPNKK---CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDL-----ITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQL-ISNQNRELNS-LEELQKLLDIKDLYR-MEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFS-EIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           ++K +PH+PG Y + D +  +IYVGKA ++  R+  YF K  +  KT+ L   I  V ++VV  EN++LLLENNLI KY+PKYN++L++  ++P+I + KE  PR+ +S     K    Y+GP+ +    K  L   I  ++ LR CN      K+   K   C+ Y +G C GPC    T ++Y   +  I +   G  K   +Q   +  Q AE + FED+QK  E  + L+ +  +  I+  + +D D+      E    +   +   GS++  + L     +    +EL E+ +T I + ++  + E+     ++L ++          IK   P  G KK ++D +  NA+    +K  Q+ I + +R  N  + +++  L + +  R +E FDNSNI  T+ V A VV++NG  +K +YR FNIK      D+  M+EV+YRRYK        +P LII+DGGK Q+ +AL+SL  L L   I +IG+AK    + + +   D S  + LDKKS+    +  +++E HRF I  +RN++SKS     L  I  +G+  I  L+++++T+ +I  A ++EL  +V +  A +I
  S:     9 QIKTLPHQPGVYQYFDADEKLIYVGKAKNIKKRVSSYFTKHHEYGKTRVLVKNIASVKHIVVETENDALLLENNLIKKYQPKYNVMLKDDKSYPWICIKKERFPRV-FSTRRVFKDGSEYFGPYTSMKTVK-TLLGLIKGLYQLRTCNYDLSEAKIKAGKYKVCLEYHLGNCKGPCEGYETEEEYHSNITAIREILKGNFKDSLQQFRIQMKQHAENMQFEDAQKIKEKLEVLENYQAKSTIVNPKISDVDVFSIVSDETYAYVNFLQLSYGSIIRSHTLELKKKLQESDTELLELAITEIRQRFNSNSKEIYVPFKVNLGEQ----------IKVTIPKLGDKKSILDLSRRNAMYYRMDKLKQMKIVDPDRHANRIMAQMKADLRLSEEPRHIECFDNSNIQGTHPVAACVVFKNGKPSKKDYRHFNIKTVVGPDDFASMEEVVYRRYKRLVEEKQPLPQLIIIDGGKGQLSSALKSLDNLGLRGKIAIIGIAK----RLEELFYPDDSIPLYLDKKSETLKIIQQLRNEAHRFGIEHHRNRRSKSALTTELENISGVGEQTIIDLMKRFKTVKRIANAKLDELEAVVGVSRANKI 590
>gi|86134938|ref|ZP_01053520.1| excinuclease ABC, C subunit [Tenacibaculum sp. MED152] >gi|85821801|gb|EAQ42948.1| excinuclease ABC, C subunit [Polaribacter dokdonensis MED152] (601 aa)
Score = 679, Expect = 4.3e-69, Identities = 201/578 (34%), Positives = 315/578 (54%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKC---------NKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDL-ITVFYSELDEILLTL-IYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNA--VEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYR-MEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIV 578
           MN  ++ ++K +P  PG Y + DK   +IYVGKA +L  R+  YF K  D  KT+ L   I  V ++VVN E ++LLLENNLI KYKPKYN+LL++   +P+I + KE  PR+  +    K     YYGP+ +    K  L   I  ++ LR C         N    K C+ Y +G CLGPC    T   Y   +KEI +   G  K   E+L    +  AEK+ FE +Q+  E    L  +  +  I+    N+ D+      +        K  NGS++  +   I     E D+ LL L I+E   +     P+ +Y+         + E++K+    P  G KK +++ +  NA   ++ + K ++++         + +++  L +K+  R +E FDNSNI  TN V A VV+ +G  +K EYR +NIK      D+  M+EV++RRYK   +    +P LII+DGGK Q+ +A++SL+ L L   I +IG+AK  ++ +  D     D   + LDKKS+       +++E HRF I+F+RNK+SKS  ++ L  I ++GK  I  LL K+++  ++KEAS++EL  ++
  S:     1 MNTSLELQIKTLPSSPGVYQYFDKEEKLIYVGKAKNLKKRVSSYFTKTHDSGKTRVLVKNINTVKHIVVNTETDALLLENNLIKKYKPKYNVLLKDDKTYPWICIKKERFPRVFMTRRVIKD-GSEYYGPYTSVRTIK-ALLELIKELYTLRTCKYDLSREKINTGKYKVCLEYHLGNCLGPCEALETEAHYNNSIKEIRNIIKGNFKESLERLNTLMMGFAEKMEFEKAQRIKEKLDRLSNYQAKSTIVNPTINNVDVFSIISDKTHGYANFIKISNGSIIQSHTTEIKKKLEESDKELLELFIFEIRQRYNSTSPE-IYVPFQ----VNIGENVKVTI--PKVGDKKRIVELSERNAKYYKLEQLKQIKIVDPDRHVKRIMAQMKADLRLKEEPRHIECFDNSNIQGTNPVAACVVFRDGKPSKKEYRHYNIKTVVGPDDFASMEEVVFRRYKRLLSEGESLPQLIIIDGGKGQLSSAVKSLEILGLRGKIAIIGIAKRLEEIYYPD-----DPIPLYLDKKSETLKITQFLRNEAHRFGITFHRNKRSKSAIQSELESIPDVGKQTITTLLRKFKSAKRVKEASLDELKAVI 581
>gi|6116772|dbj|BAA85760.1| UVR-C protein [Deinococcus radiodurans] (610 aa)
Score = 679, Expect = 4.6e-69, Identities = 170/578 (29%), Positives = 328/578 (56%)
  Q:    12 IPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF-LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK----CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNL-KMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSE--LDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIV-------KWDF---SEIKLDKKSDL------YFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEIKKL 589
           +P  PG Y+++ K G+ IY+GKA +L +R+ Q+F    +  K  KLA  +   +++   NE E+L+LE NLI +++P YN+LL++   +P++ +T E +P ++ +    K     YYGP+ +++  +  + + I+ +FPLRK + LP +K    C+ Y +G+CLGPCI      +Y   ++++     G++  +  +L++    AA+   FE + +  +  + + K+F   Q    S++ D D +G         + +F+   G ++ +         E  L EI+   + +YY++ A  +P  + L    E     SE L      +++   P +G K D+++ A  NA   + ++   L   +  +   L+ L+ +L + +  +R+E +DNSN+F TN V  MVV+E G   + E+R+F ++  +   DY+ MK+ IYRR+  + A    +P+L+++DGG+ QV AAL++LK  E    +PV+GLAK    + +R++       +W     +E+ +D++  L         L+ ++DEVH +A+S++R  + + +  +    +  +G+ R + LLE + +L+ +  A VE ++ +  + +  A+ +K+ 
  S:     2 LPTTPGVYIFR-KGGVPIYIGKANNLRSRVSQHFKAGGKSGKFTKLAESL---EFISAANEVEALVLEANLIKQHRPHYNVLLKDDKHYPFLKLTNEAYPMLVVTRRVLKD-GANYYGPYPDASAVR-RVKHLIDTMFPLRKNSGLPMQKKPRPCLNYHMGRCLGPCIDAAQPDEYRQAVEDVKALLEGRAAPVIARLKEDMKVAAQGQDFEQAARLRDRVQAVEKLFGTEQHAFVSEETDLDFLGAAQAGEFAMVQLFRMRGGRVVGRDKRFLTGADETGLGEIIGAFVADYYTQ-ATHVPPLILLPAEYEDAALWSEFLSRQAGRRVEMRTPKRGDKTDLIEMAQRNAAVGLDSEMALL--ERRGDHPGLDALKDVLALPERPWRIEGYDNSNLFGTNIVSGMVVFEGGRSRRGEHRRFKVRGLEHPDDYESMKQTIYRRFTGSLADKLPLPDLMLIDGGRGQVNAALDALK--EAGVQVPVVGLAK----REERLILPGRYGAQWWLETGTEVGVDRELLLPHTHPALRMLIGVRDEVHNYAVSYHRKLRGEGMLRSVFDDLPGIGQKRRDALLEHFTSLEDLAAAPVEHIAAVPGMTLRAAQSVKEF 597
>gi|114705636|ref|ZP_01438539.1| excinuclease ABC subunit C [Fulvimarina pelagi HTCC2506] >gi|114538482|gb|EAU41603.1| excinuclease ABC subunit C [Fulvimarina pelagi HTCC2506] (716 aa)
Score = 679, Expect = 4.7e-69, Identities = 186/575 (32%), Positives = 308/575 (53%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF-LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNG------SLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRY--------------KNNTASFGEI--------------PNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKW--DFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           E I   +K++P++PG Y     +G V+YVGKA  L  R+  Y  L     +  ++      +++V    E E+LLLE NLI + KP++N+L+R+  +FPYILVT +     +  H   +  KG+++GPFA++      + N + R F LR C     +   + C+ + I +C GPC  +++++DY   +K+   F SG+S  + E + ++   A++ L FE +  + +    L   S  Q I      + D+   + +  +  + +F +  G      +   K D       E D +L   I ++Y            + L DE L  L+E+L      K++   P++G K+D++D A +NA E +  K L   S+Q R L  L+E   L   +   R+E+FDNS+I  TN +GAM+V       KN+YRKFNIK  +     D+  MKEV+ RR+              K   A   EI              P+L+++DGGK Q+ A    L+ L +   +  IG+AK  D +   +R ++   DFS   L  +  + +F+  ++DE HRFAI  +R K+ K + +N L +I  +G TR   LL+ + T   +  A + +L  +
  S:    85 ELIAALVKRLPNQPGVYRMFGSDGDVLYVGKARSLKKRVASYARLGGHTQRIARMIRLTRQMEFVTTRTETEALLLEANLIKRLKPRFNVLMRDDKSFPYILVTDDHQAPAIVKHRGARNRKGSFFGPFASAGAVDRTI-NSLQRAFLLRTCTDSVFESRTRPCLLHQIKRCAGPCTGEISQEDYRSLVKQAKGFLSGRSGQVKEAMAEQMTSASDDLDFERAALFRDRLAALSHVSSHQGINPQSVEEADVFAIHQEGGLTCVQVFFFRTGQNWGNRAYFPKADPSL----EPDAVLGAFIAQFYDDKPAPRLILSQVKLDDEAL--LAEALAIKAERKVRIEKPARGAKRDLVDHAASNAKEALGRK-LAETSSQARLLEGLKETFSLE--RTPRRIEVFDNSHIMGTNAIGAMIVAGPEGFVKNQYRKFNIKSTEITPGDDFGMMKEVMTRRFSRLIKDHADEMPGAKPEPAPDTEIDEPEDLADTPFPAWPDLVLIDGGKGQMSAVRSILEELGIADKVMTIGVAKGVDREAGRERFIQGAKDFS---LPPRDPVLYFVQRMRDEAHRFAIGTHRAKRKKEMIKNPLDEIAGIGPTRKRALLQHFGTAKAVSRAGLPDLRAV 697
>gi|149185958|ref|ZP_01864273.1| excinuclease ABC subunit C [Erythrobacter sp. SD-21] >gi|148830519|gb|EDL48955.1| excinuclease ABC subunit C [Erythrobacter sp. SD-21] (655 aa)
Score = 679, Expect = 4.7e-69, Identities = 185/582 (31%), Positives = 314/582 (53%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF-LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEH--PRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSEL--DEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLN------PSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYK--------NNTASFGE-----IPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDF---SEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE--VAKEI 586
           I++ +K +  +PG Y   D  G V+YVGKA  L  R+  Y  +K    + +++ ++   ++ VV N+E E+LLLE  LI +Y+P +N+LLR+  +FP+IL+ + +H  PRI   H   ++ KG YYGPFA++      L N + ++F LR C        ++ C+ Y I +C  PC+ ++    Y+  + E  DF SGKS ++   +EK+  +AAE L FE +    +  +        Q I  S   D D+     K   I +  F    G              +L  DE+L  ++ ++Y ++    P+T+ +     + + ++E+L  K  +      P +G ++ +M  A  NAVE ++ +  +  +   R     E L+     +   R+EI+DNS+I     +GAMVV       K +YRKFNI     N D+  M+EV+ RR++        ++ A  G+      P+L+++DGGK QV + +  L+ L +   +PVIG+AK   H  +    + F    E  L   S L F+L  ++DEVHR+AI  +R K+S+++  + L +I  +G  R   LL  + T  K++ A++++L +   I   VA++I
  S:    41 IRETVKTLKPRPGVYRMLDTRGDVLYVGKARSLKARVANYTQVKGLSNRLQRMVSQCRAMEIVVTNSEAEALLLEAQLIKRYRPPFNVLLRDDKSFPFILL-RADHAFPRI-QKHRGARRAKGNYYGPFASAGSVNKTL-NALQKLFLLRSCTDSFFNNRDRPCLLYQIKRCSAPCVGRIDEAGYDALVNEAKDFLSGKSSAVQANIEKQMAKAAEDLDFETAAILRDRLRAATFIQGSQAINASGVGDADVFALAAKGGQIGVQAFFIRGGQNWGHKAFFPKNTGDLEHDEVLSDVLLQFYEEVPP--PRTILVDRDLAEQELIAEALAEKAGHAVAISIPQRGDRRKLMSQAQRNAVESLERRLAESGTKAQRLRELAEFLELEEPPQ---RIEIYDNSHIQGDKALGAMVVASPEGFEKGQYRKFNINTAQTNDDFGMMREVMSRRFRKLAETERDSDGAPGGKGHEAIWPDLLLIDGGKGQVSSVMGVLEDLGIAEQVPVIGIAKGPHHGREGREVFHFPDGREKTLPVNSQLLFYLQTLRDEVHRYAIGAHRAKRSRAITASPLDEIPGIGPARKRALLLHFGTAGKVRAAALDDLKRAPGISAGVAQQI 647
>gi|108804832|ref|YP_644769.1| excinuclease ABC subunit C [Rubrobacter xylanophilus DSM 9941] >gi|119367830|sp|Q1AUH1|UVRC_RUBXD UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|108766075|gb|ABG04957.1| Excinuclease ABC subunit C [Rubrobacter xylanophilus DSM 9941] (611 aa)
Score = 679, Expect = 4.7e-69, Identities = 175/575 (30%), Positives = 322/575 (56%)
  Q:    12 IPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTK--KLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTK-EEHPRILYS---HDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN-KLPNKK----CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEK-LKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTA---SFGEIPNLIIVDGGKPQVKAALESLKFLELDSI---IPVIGLAKDDKHKTDR------IVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           +P  PG Y+++D  G V+YVGKA ++ +R+  YF +  D + K  +L   +  +D++    E E+L+LE NLI +++P++N  LR+  ++PYI+VT  +E+PR+  +   HD   +    Y+GPF ++    +   + +N+ F  RKC    P ++    C+ Y IG+   PCI  V++++Y   + ++  F  G+   +  + E++  +AA ++ FE + +  +    L+   +RQ    + ++  D +G Y +     + IF    G ++ +   +   Y E D   + L+ + +YY   A+  P+ V +S  DE+ L  ++E L      +++   P +G K+ V++ A +NA   ++++     + ++R  ++L+ L++ L +  L  R+E +D SN   TN V +MVV++ G   K++YR+F IK  +   D   M EV+ RR +   A    F   P+LI++DGGK Q+ A  E L+ L        IPV  LAK ++   +       ++  D +E++L         L  ++DE HRFA +++R  + +++  + L  +  +G  R  ++LE + T     EAS+EEL  +  +P  VA+EI
  S:    12 LPASPGVYIFRDGEGRVLYVGKARNIRSRVASYFTRSGDGRPKIAELRERVRQIDFIAARGETEALVLEANLIKRHRPRFNASLRDDKSYPYIVVTTGDEYPRVFATRGPHDPRHR----YFGPFPSAG-SVHATLDVLNKTFRFRKCRGPEPGRRSGIPCLNYHIGRSAAPCIGAVSKEEYGAIIADVIAFLEGRVDGLIREREEQMRRAAAEMDFERAARLRDEAAALRHVRDRQQATIASEDSFDAVGAYAEGEEACVQIFAVREGRIVGRDSFLLDNYGEQDAESVALSFVPQYYETAAV--PREVLVSSPDEEALAPIAEHLSRLRGTRVEVRRPQRGDKRRVLELALHNARMGLEHERAMSEARRSRLSSTLDRLREELALPRLPMRIECYDISNTMGTNSVASMVVFQGGRPAKDQYRRFRIKTVEGADDPASMAEVVRRRLERLLAGDEKFSPAPDLILLDGGKGQLSAVAEVLEGLGSGGRLPDIPVRALAKREEEVFEPGRPGPVVLAPDSAELRL---------LQRVRDEAHRFANAYHRKLRGRAMTASVLDDLPGVGPVRKRRILEHFGTPQAFLEASLEELEAVPGLPGRVAREI 605
>gi|103486571|ref|YP_616132.1| excinuclease ABC subunit C [Sphingopyxis alaskensis RB2256] >gi|119367841|sp|Q1GU73|UVRC_SPHAL UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|98976648|gb|ABF52799.1| Excinuclease ABC subunit C [Sphingopyxis alaskensis RB2256] (644 aa)
Score = 679, Expect = 4.9e-69, Identities = 178/581 (30%), Positives = 306/581 (52%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILV-TKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSEL--DEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKD-LYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIK--DEDANSDYDYMKEVIYRRY-----KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKW--DFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           E I+  ++K+P +PG Y   D  G V+YVGKA  L NR+  Y    R   + +++  +   ++ V   +E E+LLLE  LI +Y+P YN+LLR+  +FP+IL+ T  + PR+   H   ++ KG YYGPFA++      L N + + F LR C        ++ C+ Y I +C  PC+ +++++DY   + +  DF  G+S ++ ++L +   +AA+ + FE +    +  K L      Q +      D D+     K   + I  F    G             + +   E++ + + ++Y    +  PK + +    ++   L+E+L      K++   P +G +K ++D A  NA E +  +  +  S+   +L    EL  L D+++   R+EI+DNS+I  T+ +GAMVV       K  YRKFNIK  +     D+  M+EV  RR+     ++   + GE P+L+++DGGK QV A       L +D  +P +G+AK       R   +  D  E  L   + + F++  ++DE HRFAI  +R K++K++  + L ++  +G  R + LL  + T   IK AS+E+L +   +  A
  S:    36 EVIRSVVRKLPARPGVYRMLDARGDVLYVGKARALRNRVTSYTQVARLPQRLQRMVAQTRAMEIVTTTSEAEALLLEAQLIKRYRPPYNVLLRDDKSFPFILLRTDHDFPRV-QKHRGARRAKGRYYGPFASAGSVARTL-NALQKTFLLRSCTDSFFANRSRPCLLYQIRRCSAPCVDRISKEDYAGLVSDAQDFLEGRSTAVQKRLGEAMTRAADAMDFEQAAVLRDRLKALTFIQGSQSVHADGLGDADVFALAAKGGQLCIAGFFIRGGQNWGHRSFFPAHVAGVPETEVMASFLMQFYE--GVPPPKLILVDREPDESALLAEALGETAGRKVEISVPQRGNRKRLLDQAVRNAGEELDRRLAE--SSSQAKLG--RELADLFDLENPPQRIEIYDNSHIQGTSALGAMVVAGPEGWMKGAYRKFNIKRAETQPGDDFAMMREVFQRRFARAIEEDPERTKGEWPDLVLIDGGKGQVSAVAAVFSELGIDD-LPFVGVAKGPDRNAGRETFYLPDGREFTLPTNNAVLFYIQRLRDEAHRFAIGAHRAKRAKAMGSSPLDEVPGIGPARKKALLMHFGTTRAIKGASLEDLQKAPGVSAA 631
>gi|110596791|ref|ZP_01385081.1| excinuclease ABC, C subunit [Chlorobium ferrooxidans DSM 13031] >gi|110341478|gb|EAT59938.1| excinuclease ABC, C subunit [Chlorobium ferrooxidans DSM 13031] (637 aa)
Score = 678, Expect = 6.0e-69, Identities = 190/582 (32%), Positives = 314/582 (53%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPN---------KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL-SKYDLITVFYSELDEILLTLIYEYYSKIAIEL-PKTVYLS--LSDEKLKTLSESL------------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQN--RELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKD-----DKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           +K+KL  +P  PG Y + +  G VIYVGKA +L NR++ YF   + L  KT  L + I + + ++ ++E E+L+LENNLI + KP+YN+ L++   +PY+++T E  PRI  +    ++   T++GP+  +  +   + + +  IFP+R C    +         K C+ Y I +C GPC    + ++Y   + EI     G++ ++   L ++    A +L FE + +      +LK ++ERQ ++     D D+      E+    V+FK   G LL S+   +     E +E+L + + E Y    +EL P  + L   L+DE+   L   L            +I+FL P  G K  +M+    NA   ++   +Q        RE   L  L++LL +  +  R+E FDNS++  T+ V +MV +E G   K++YRKF +K    + DY  M+EVI+RRY  + A    +P+LIIVDGGK QV  A  +L  L +    PVIGLAK        H  D           L K S     L  ++DE HRFA++++R  +++   +  L  I+ +G+    KLL+++ + D +  A++EEL      + A+ +
  S:    27 LKEKLSSLPSSPGVYQFINDKGRVIYVGKAKNLRNRVRSYFRNPQQLFGKTLVLVSHIDNFEVIITSSEVEALILENNLIKELKPRYNVNLKDDKTYPYLVITNEPFPRIFLTR-QVRRDGSTWFGPYTEAG-QLRTILDLLGSIFPIRSCKHRLSPENIAAHKFKVCLDYHIHKCKGPCEGLQSEEEYLLMIGEIIRLLKGRTSAMIRTLTERMQYFAAELKFEQAAELKAQLDSLKRYAERQKVVSGDALDRDVFAVASGEDDACGVVFKIREGKLLGSQRIYMNNTSGESEEVLQSRVLEKYYLETLELIPDEILLRKPLTDEEESALRALLTEKQKEEKQEKKQIRFLVPQIGEKAHLMEMCHQNARHHLEEYLIQKQKRGEAAREHYGLIALKELLHLSVIPQRIECFDNSHLQGTDYVSSMVCFEKGKPKKSDYRKFKLKSFQGSDDYAAMEEVIHRRYGGSLARELALPDLIIVDGGKGQVNTAFTALNALGISC--PVIGLAKRIEEIFTPHAPD--------PFNLPKTSPALKLLQQLRDEAHRFAVTYHRKLRTERTLQTELTTIEGIGEKTAFKLLKQFGSADAVSRATIEELQAATGAKSAQAV 631
>gi|42560845|ref|NP_975296.1| excinuclease ABC subunit C [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|81400734|sp|Q6MTU8|UVRC_MYCMS UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|42492341|emb|CAE76938.1| excinuclease ABC subunit C [Mycoplasma mycoides subsp. mycoides SC str. PG1] (584 aa)
Score = 678, Expect = 6.5e-69, Identities = 199/574 (34%), Positives = 320/574 (55%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSE-LDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDV-MDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIV 578
           +K ++  +P+KPGCYL+ +K+  VIYVGKA +L  R+  YF K  ++KT +L  EI D+ Y +V+NE ESLLLE NLI KY PKYN+LL +   +PYI++T ++ P   Y     KK    Y      SN +   L   + R+FPLR C    NK C+YY + QC G C K+V    YE  +K+++ FF G+   + + L K+  +A++ L FE +Q+  +   +L   + +Q++      + D++ +   ++ I  VI  Y  G L  K + I  +  + L E+  + + + Y K    +   V L  ++ +L  L ++L ++F + S   + DV +  A  NA++ +    +    N   E+  LE+L+++ +  K L R+E+FD SNI++    GA +VY N    +NE+RK+NI D    SD+  MK ++ +R+        ++P+L+IVDGG  Q+ AA E L  L L   I VIGL+KDD HKT  ++      I +     LY FL ++Q  V  +A S +R KK  +   + +  IK +GK    KL + ++T+D IK AS +EL++++
  S:     3 LKQQVDLLPNKPGCYLFFNKDNDVIYVGKAKNLKKRVSTYFNKAYNIKTTRLVREITDLKYFIVDNEKESLLLEKNLIKKYHPKYNVLLNDDKTYPYIIITNQKDPMYKYVRKYDKKALKNYGPLPIGSNARSILLT--LQRLFPLRMCQGNLNKPCLYYHLNQCSGACFKQVDPSYYEYQIKQVDKFFKGEINQVKQTLVKQMQKASDNLQFEQAQRIKDQITSLDFITAKQNVDIVTNKNIDVVNYEINQDKICFVILFYRLGQLTYKDEYIQNYEGQNLSELFNSYLQQIYQK---NIYPDVLLIPNEIELLDLDQNL-LEFSSYSLNKQDDVFIKLAKQNAIDSLNKSVISHNVNSGDEIEILEQLKQISNASKYLKRIEVFDISNIYSQFITGACIVYINAKPIRNEFRKYNI-DPSYTSDFSRMKFMLEKRFLKQIKEKEQLPDLVIVDGGIIQIHAAKEVLNKLNLK--IDVIGLSKDDHHKTRYLIDIFEQTIDIKNFKKLYNFLTSLQIRVDEYAKSGFR-KKYHNQLNDQILLIKGVGKKTNLKLYKHFKTIDNIKNASFDELNKVI 569
>gi|15678469|ref|NP_275584.1| excinuclease ABC subunit C [Methanothermobacter thermautotrophicus str. Delta H] >gi|8134792|sp|O26541|UVRC_METTH UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|2621507|gb|AAB84947.1| excinuclease ABC subunit C [Methanothermobacter thermautotrophicus str. Delta H] (579 aa)
Score = 678, Expect = 6.5e-69, Identities = 173/585 (29%), Positives = 325/585 (55%)
  Q:     4 QIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEK---LKTLSE--SLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAKEIKK 588
           ++KD  +K+P   G Y+++D++  V+YVGK++ +  R+  YF +  + + + +   +  ++Y++  NE E+L+LE+NLI +Y+P YN+ L++   +P+I +T EE+PR+L    +  +    YYGPF ++   +  L   I  +F +R C ++ +  C+   I  C  PC  +++R+DY   +++++ FF G+ + + E LE++  +A+E+L FE + +  +  ++++   ERQ   F+   D+DI+      +  ++V+ +  +G +  K D I    +   EIL   + +YY+ I   +P  +      E     + LSE    ++K  +P  G  + +++ A+ NA  I+K K         R  ++L +L+  L + ++  RME  D SNI   +  G++ V+ +G  +   YR++ I  +  + DY  M+E++ RRY +        P+L+++DGGK Q+  ALE+LK   +   +PV+G+AK    K + +     SE  +D        L +++DE HRFA+ ++R  + +   E+ L  I+ +G  R   LLE + +LD +++ASVEEL+ I  +  EVA+ I +
  S:     3 RVKDP-EKLPDATGVYIFRDRDDRVLYVGKSISIRKRVSSYFREQENPRLRIMMRHLESIEYILTQNEKEALILESNLIKRYRPPYNVRLKDDKRYPFIKITDEEYPRVLIVR-TIGRDSARYYGPFTDTGAVRRTL-KLIKSLFRIRSCRRM-DGPCLNSQIDLCYAPCDGRISREDYREIIEKVDLFFQGRYQEVIEVLEEEMKEASERLEFERAARIRDQIESIREVMERQHASFTDSIDQDIVALERGGDTSAVVVLQIRDGKITGKDDFILRGSAPRTEILEAFLKQYYA-IPRRVPSEILTQYPVEDGVIAEWLSELRGEEVKIHSPEGGAGRRLLNIAWKNASVILKQK--------GRVRDALLQLKDDLKLPEIPRRMEGLDISNIAGESATGSVAVFIDGKPSSGSYRRYRISAQGPD-DYAMMRELVERRYSSPEL---RKPDLVLIDGGKGQLGVALEALKNCGVH--VPVVGIAK----KREEVYLPGLSE-PVDVDDGALQILRHLRDEAHRFAVKYHRTIRDRDSLESELDGIRGVGPVRKRALLEHFGSLDGVRDASVEELASIPGMTREVAERIHR 571
>gi|114569323|ref|YP_756003.1| excinuclease ABC subunit C [Maricaulis maris MCS10] >gi|119367665|sp|Q0ARM2|UVRC_MARMM UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|114339785|gb|ABI65065.1| excinuclease ABC, C subunit [Maricaulis maris MCS10] (633 aa)
Score = 677, Expect = 7.7e-69, Identities = 174/579 (30%), Positives = 310/579 (53%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEIC-------DVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCK--ENVISIVIFK----YVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDA--NSDYDYMKEVIYRRYK---NNTASFGEIPNLIIVDGGKPQVKAALESLKFLEL--DSIIPVIGLAKDDKHKTDRIVKW--DFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           I D ++ +P KPG Y    ++G V+YVGKA +L NR+  Y         +  +N I         +++VV   E E+LLLE NLI   KP++N+LLR+  +FPYIL+ K+     L  H   +K KG Y+GPFA+       L N + + F +R C+    +  ++ C+ + I +C GPC+  +    Y+  + +  DF  G+S ++ E L+ +  QA+E + FE + K  +  + +   +  Q I      + D++  +    ++ + +  F+    + N S   ++D+     +E  E+L   I ++Y       P  + LS   E+ + L E+L      K+    P +G K+ ++D    NA E +  +    ++    +   L+ +Q++ D+ DL  R+E++DNS+I  TN +GAM+V       KN YR+FN+K +DA  N D+  MK ++ RR+            +P+L+++DGGK Q+ + +E  + L +  ++ I +  +AK  +    R   +       KL  K  + ++L  ++DE HRFAI  +R K+ K + +N L  I  +G +R + LL  + +   ++ A++ +L  +  I  A
  S:    28 IADYVRNLPPKPGVYRMFGEDGAVLYVGKARNLKNRVSNY------ANGRGHSNRIALMIGLTRKMEFVVTQTETEALLLEANLIKSLKPRFNILLRDDKSFPYILIRKDHPAAQLTKHRGARKAKGDYFGPFASVGAVNQTL-NTLQKAFLVRTCSDSVYEGRSRACMLHQIKRCAGPCVDLIDPAAYDELVGQATDFLRGRSNALREDLQTRMAQASEAMDFETAAKLRDRIRAIAAVTTDQGINPDGVEEADVVAVHSDGGKSCVQVFFFRAGQNWGNQSFFPRHDM----EAEPAEVLAAFIAQFYDDKPA--PALILLSHEIEEAELLGEALSLRTERKVSLHTPRRGEKRKLVDRTLTNAREALARR----MAESASQTQLLKGVQRVFDLTDLPQRIEVYDNSHIQGTNALGAMIVAGPEGFEKNHYRRFNMKGDDAATNDDFAMMKAMLKRRFSRLLKERDDGAPVPDLVLIDGGKGQLSSVMEIAEELGITDETGITIAAIAKGPERDAGREAFYLPGKPPFKLPMKDPVLYYLQRLRDEAHRFAIGGHRAKRKKQMTDNPLDGIDGIGPSRKKALLAHFGSAKAVRNAALADLEAVDGISRA 622
>gi|73670178|ref|YP_306193.1| excinuclease ABC subunit C [Methanosarcina barkeri str. Fusaro] >gi|119367667|sp|Q468S9|UVRC_METBF UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|72397340|gb|AAZ71613.1| Excinuclease ABC subunit C [Methanosarcina barkeri str. Fusaro] (519 aa)
Score = 677, Expect = 8.4e-69, Identities = 173/529 (32%), Positives = 293/529 (55%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSE-LDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYR-MEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSL 537
           L+ +PH PGCYL+K++ G VIYVGKA DL  R+  YF K + D KT  L   +   D++V N E E+ LLEN LI K+ P+YN+LL++S  +  I +T+E+ PRI  S    K   G+++GPF ++  + Y ++  + + F LR C K+P + C+ Y I  C GPCI  ++ +DY   +K+      G  + + E +EK   + A +  FE +    +    L+   E+Q++   +K++EDI+ +  +++ + +++FK   G+L  K D +  F    L+E L+    E      + LP+ +  SL D    +  +  K+K   P +G KK+++D A       +KN  +    ++ +    LE LQ  L +  L   +E FD S++  T+ VG+MV +  G  +K+ YR+F I+  +   D+  + EV+ RRY        ++P+LII+DGGK Q+ +A + L+ L++   +P+I +AK ++      +K   S + + K+     F+  I+DE HRFAI++ R  + KS+
  S:     4 LEALPHLPGCYLFKNEEGTVIYVGKAKDLKKRVSSYFQKREHDPKTASLIEAVRGFDFIVTNTEVEAFLLENTLIKKHWPRYNILLKDSKRYACIHLTEEKFPRIRLSR--KKADNGSFFGPFVSAKERDY-IFEVVRKTFQLRTCKKMPKRACLRYHIAACSGPCIGAISAEDYAEKVKKAASVLKGNIRELIESMEKDMRELASRQQFEQAMALRDEIAALEYLQEKQNMERQKKHNEDILNYIVRDDTVYLMLFKVYKGTLEDKQDYVFAFGENFLEEFLVQYYSENEPPEELILPEPLEESLVD--FLSHVKGTKVKVTVPKQGEKKELLDLA-------LKNVEIGFFGDRKK----LEALQSKLSLPKLPNVIECFDISHLSGTSTVGSMVQFRGGRPDKHNYRRFKIESVEGIDDFASIAEVVRRRYSRLLEDKHDLPDLIIIDGGKGQLSSAFQELRKLKVR--VPLISIAKREEEIYVPGIK---SPLPIKKEEKASLFVQEIRDEAHRFAITYNRLLRQKSM 514
>gi|120437498|ref|YP_863184.1| UvrABC system protein C [Gramella forsetii KT0803] >gi|189038058|sp|A0M672|UVRC_GRAFK UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|117579648|emb|CAL68117.1| UvrABC system protein C [Gramella forsetii KT0803] (597 aa)
Score = 677, Expect = 9.0e-69, Identities = 181/571 (31%), Positives = 320/571 (56%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN------KLPNKK---CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDL-----ITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQL-ISNQNRELNS-LEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIV 578
           +LK +P+ PG Y + DKNG ++YVGKA +L  R+  YF K+ D  +   +  +IC++ ++VV +E ++LLLENNLI K++P++N++L++   +P+I +  E  PR+  +    K     YYGPF +       L + I  ++ LR CN      K+ N K   C+ Y +G CLGPC      ++Y   ++ I     G  K   ++   +  Q +EK+ FED+Q+       L+ +  +  ++  + N+ D+      E    +   +  +G+++  + +     +     EL E+ +  I + +S  + E+     + + +E          +K + P  G KK +++ +  NA    + ++ Q+ I + +R +N  + ++++ L + K+   +E FDNSNI  TN V A VV++NG  +K +YRKFNIK  +   D+  M+EV++RRY+       ++P LIIVDGGK Q+ + +++L+ L L   I +IG+A   K   +     D   + LDKKS+    +  +++E HRF I+F+RNK+SK+     L  I+ +G+  + +LL  + +L +IKEAS +EL+ +V
  S:     9 QLKTLPNSPGVYQYFDKNGKILYVGKAKNLKKRVTSYFNKNHDSHRIGVMVKKICEIKHIVVASETDALLLENNLIKKHQPRFNVMLKDDKTYPWICIKNERFPRVFPTRRLIKD-GSEYYGPFTSFKTVN-TLLDLIKGLYKLRTCNYDLAEDKIRNGKYKVCLEYHLGNCLGPCEGFQPEEEYNNNIEAIRQIVKGNFKDSLQRFRNQMKQHSEKMEFEDAQRIKNKIDVLENYQAKSTVVNPRINNVDVFSVVSDEGYGYVNFLQLSHGAIIRSHTIEMKKKLDESDRELLELAIVEIRQRFSSNSTEIYVPFKVDVGEE----------LKIVIPKLGDKKKIVELSQRNAKYFRQERFKQMKIVDPDRHVNRVMAQMKEDLRLGKEPRHIECFDNSNIQGTNPVAACVVFKNGKPSKKDYRKFNIKTVEGPDDFASMEEVVFRRYRRLLNEGEDLPELIIVDGGKGQLSSGVKALETLGLRGKIAIIGIA---KRLEEIFYPEDSIPLYLDKKSETLKIIQQLRNEAHRFGITFHRNKRSKTALNTELESIQGIGEKTVVELLTHFRSLKRIKEASQKELADVV 582
>gi|194682867|emb|CAR43195.1| UvrABC system protein C (excinuclease ABC subunit C) [Proteus mirabilis HI4320] (610 aa)
Score = 676, Expect = 1.0e-68, Identities = 182/575 (31%), Positives = 313/575 (54%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKK-VTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLS--KYDLITVFYSELDEILLTLIYEYYSKIAI--ELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELD---SIIPVIGLAKDDKHKT---DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           L ++  +PG Y   D +G VIYVGKA DL  R+  YF       KT+ L   I ++D  V + E E+LLLE++ I +Y+P+YN+LLR+  ++PYI ++ ++HPR L S+   K  KG Y+GPF NS +   E    + ++FP+R+C     +  ++ C+ Y IG+CL PC+K  V+ ++Y   +  +  F SG    + E L K+  +A++ L FE++ +  +    ++  +E+Q  + +  +D D+I       +  + +  +  G +L    Y       + LDE++ T I ++Y + +    LP  + L  + E    L+ES+      KI      +G +   +  A  NA   +  K ++  S  ++  NS   L  LL++K++ RME FD S+      V + VV++     K+EYR++NI       DY  M +V+ RRY  +     +IP++I +DGGK Q+  A++  + L++D   S   +IG+AK    K        K +   + L   S     + +I+DE HR AI+ +R +++K    +SL  I+ +G  R + LL+    L  +++ASVEE++++  I  A
  S:    11 LSRVTSQPGVYRMYDASGTVIYVGKAKDLKKRLSSYFRAQVNSRKTEALVKCIANIDVTVTHTETEALLLEHSYIQRYQPRYNVLLRDDKSYPYIYLSADKHPR-LASYRGAKHAKGEYFGPFPNS-LAVRETLALMQKLFPIRQCEDSVYRNRSRPCLQYQIGRCLAPCVKGYVSDEEYAQQVNYVRLFLSGDDSQVIEGLIKRMEEASQALRFEEAARIRDQIHAVRQVTEKQ-FVANIGDDLDVISVAFNGAIACVYVLFFRQGKVLGSRSYFPKVPANTSLDEVVQTFIGQFYLQGSAIRTLPTEILLDFNLEDKTILAESISSIAGRKIHIQTKPRGDRARYLKLARTNAATALATKQVEQ-STISQRYNS---LMSLLEMKEIKRMECFDISHTMGEQTVASCVVFDMNGPLKSEYRRYNISGITPGDDYAAMNQVLTRRYGKSLEE-SKIPDIIFIDGGKGQLAQAIDVFQSLDVDWDKSHPKLIGVAKGSDRKAGLETLFFKPEGEGVALPSDSPALHLIQHIRDESHRHAITGHRQRRAKVKNTSSLESIEGVGPKRRQMLLKYMGGLQALRDASVEEIAKVPTISTA 599
>gi|119774745|ref|YP_927485.1| excinuclease ABC subunit C [Shewanella amazonensis SB2B] >gi|119767245|gb|ABL99815.1| Excinuclease ABC subunit C [Shewanella amazonensis SB2B] (606 aa)
Score = 676, Expect = 1.1e-68, Identities = 174/578 (30%), Positives = 310/578 (53%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVF--YSELDEILLTLIYEYY--SKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL--KFLELDSIIPVIGLAKDDKHK---TDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           LK +    G Y   D    VIYVGKA DL  R+  YF  +  ++KT+ L + I ++D  + ++E E+L+LEN+ I +Y PKYN+LLR+  ++PYIL++  +HPR+ Y H   ++ KG Y+GP+ N    +  L N + ++FP+R+C     +  ++ C+ Y IG+C  PC+ K++ +DY+  ++    F  GK + +   L  K   AA  + +E + +Y +  + L+  +E+Q+ +  Q+ D D+IG      +    I     G +             +EL E+L   + ++Y  ++    +PK V L    E L  L  ++      +++     +  +   +  A  NA   +  K     + + R    +E L+++L +   + RME FD S+    + V + VV+     NK EYR++NI       DY  M + + RR+ +     G++P+++ +DGG  Q++AA+  +  KF ELD    ++G+AK +  K      I     +E  L+  +     + +I+DE HRFAI+ +R K+ ++   ++L  I  +G  R + LL+    L ++K ASV EL+++  +  E+A+ I
  S:     8 LKTVSSASGVYRMYDAAAEVIYVGKAKDLKKRLSSYFRTNLPNIKTQALVSNIANIDVTLTHSETEALILENDYIKQYMPKYNVLLRDDKSYPYILLSGHKHPRLAY-HRGAQREKGEYFGPYPNGGAVRESL-NLMQKLFPIRQCEDAYYRARSRPCLQYQIGRCSAPCVGKISDEDYDEQVRLATLFLRGKDQQVIASLVGKMEAAALAMEYEAAARYRDQIQALRKVAEQQN-VSGQQGDMDVIGVNYASGIACFHILFIREGKIFGSRSYFPAVPDATELGEVLRAFMLQFYLGNEAHRSIPKEVLLGEEFEDLHELEAAMQDSLGHRLEIKTKVRADRAAFLRLANTNAANAVVTKLAHKSTVEQR----MELLEEVLGLGAPIQRMECFDISHTMGESTVASCVVFNREGPNKGEYRRYNISGITGGDDYAAMAQALSRRF-DKIERTGKVPDVLFIDGGLGQLRAAMTIVNDKFAELDRQPLLVGVAKGESRKPGLETLIFGGSEAEFSLESDNPALHLIQHIRDESHRFAITGHRAKRQQTRNTSTLESIPGIGPKRRKALLQYLGGLQQVKNASVAELAKVPGISAEMAQTI 600
>gi|159184627|ref|NP_354147.2| excinuclease ABC subunit C [Agrobacterium tumefaciens str. C58] >gi|159139925|gb|AAK86932.2| excinuclease ABC chain C [Agrobacterium tumefaciens str. C58] (642 aa)
Score = 675, Expect = 1.3e-68, Identities = 185/582 (31%), Positives = 305/582 (52%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEI---CDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD------EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRY--------KNNTAS-----------FGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE--VAKEI 586
           I + +K +P+ PG Y   ++ G V+YVGKA  L  R+  Y      + + ++A  +     +++V    E E+LLLE NLI + +P++N+LLR+  +FPYIL+T +     ++ H   +  KG Y+GPFA++      + N + R F +R C     +   + C+ Y I +C GPC  +V+ + Y   +KE  DF SGKS+++   + ++  +A+E L FE +  Y +    L      Q I  +   + D+   + +  +  I +F +  G           ++ + D      EIL   + ++Y    +  PK + LS + E+ + L+ +L      K+    P +G KKD+ D    NA E    K L   S+Q R L    E   L  +    R+EI+DNS+I  TN VG MVV       KN+YRKFNIK  D     D+  M+EV+ RR+        K + A            F   P++I++DGG+ Q+ A    L  L +   +  IG+AK  D +   +R      S+  L  +  + +F+  ++DE HRFAI  +R ++ K +  N L +I  +G  R   LL+ + T   +  A + +L  +  I   VA++I
  S:    19 IGEFVKHLPNSPGVYRMFNEAGDVLYVGKARSLKKRVGNY--AQGRVHSNRIAQMVRFTTHMEFVTTRTETEALLLEANLIKRLRPRFNVLLRDDKSFPYILITADNRAPAIFKHRGARARKGDYFGPFASAGAVGRTI-NSLQRAFLIRTCTDSVFETRTRPCLLYQIKRCSGPCTHEVSDEGYAELVKEAKDFLSGKSQAVKTAIARQMNEASEDLDFERAAIYRDRLAALSHVQSHQGINPAGIEEADVFAIHHEGGISCIQVFFFRTGQNWGN----RAYFPKADPSLPGSEILNAFLAQFYDDKPV--PKQILLSETVEEQELLAAALGEKAGHKVTISVPQRGEKKDITDHVLANAREAHGRK-LAETSSQARLLKGFAETFNLPYVPR--RIEIYDNSHIMGTNAVGGMVVAGPEGFVKNQYRKFNIKSTDITPGDDFGMMREVMTRRFSRLLKEEGKPDRAQTPTPEEAADLPFPAWPDVILIDGGQGQMTAVRAILDELGIRDCVTAIGVAKGVDREAGRERFFADGRSDFSLPPRDPVLYFIQRMRDEAHRFAIGSHRARRKKEMVRNPLDEISGIGPGRKRSLLQHFGTAKAVSRAGLNDLMTVTGISETVARQI 632
>gi|119367493|sp|Q8UGA9|UVRC_AGRT5 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) (681 aa)
Score = 675, Expect = 1.3e-68, Identities = 185/582 (31%), Positives = 305/582 (52%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEI---CDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD------EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRY--------KNNTAS-----------FGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE--VAKEI 586
           I + +K +P+ PG Y   ++ G V+YVGKA  L  R+  Y      + + ++A  +     +++V    E E+LLLE NLI + +P++N+LLR+  +FPYIL+T +     ++ H   +  KG Y+GPFA++      + N + R F +R C     +   + C+ Y I +C GPC  +V+ + Y   +KE  DF SGKS+++   + ++  +A+E L FE +  Y +    L      Q I  +   + D+   + +  +  I +F +  G           ++ + D      EIL   + ++Y    +  PK + LS + E+ + L+ +L      K+    P +G KKD+ D    NA E    K L   S+Q R L    E   L  +    R+EI+DNS+I  TN VG MVV       KN+YRKFNIK  D     D+  M+EV+ RR+        K + A            F   P++I++DGG+ Q+ A    L  L +   +  IG+AK  D +   +R      S+  L  +  + +F+  ++DE HRFAI  +R ++ K +  N L +I  +G  R   LL+ + T   +  A + +L  +  I   VA++I
  S:    58 IGEFVKHLPNSPGVYRMFNEAGDVLYVGKARSLKKRVGNY--AQGRVHSNRIAQMVRFTTHMEFVTTRTETEALLLEANLIKRLRPRFNVLLRDDKSFPYILITADNRAPAIFKHRGARARKGDYFGPFASAGAVGRTI-NSLQRAFLIRTCTDSVFETRTRPCLLYQIKRCSGPCTHEVSDEGYAELVKEAKDFLSGKSQAVKTAIARQMNEASEDLDFERAAIYRDRLAALSHVQSHQGINPAGIEEADVFAIHHEGGISCIQVFFFRTGQNWGN----RAYFPKADPSLPGSEILNAFLAQFYDDKPV--PKQILLSETVEEQELLAAALGEKAGHKVTISVPQRGEKKDITDHVLANAREAHGRK-LAETSSQARLLKGFAETFNLPYVPR--RIEIYDNSHIMGTNAVGGMVVAGPEGFVKNQYRKFNIKSTDITPGDDFGMMREVMTRRFSRLLKEEGKPDRAQTPTPEEAADLPFPAWPDVILIDGGQGQMTAVRAILDELGIRDCVTAIGVAKGVDREAGRERFFADGRSDFSLPPRDPVLYFIQRMRDEAHRFAIGSHRARRKKEMVRNPLDEISGIGPGRKRSLLQHFGTAKAVSRAGLNDLMTVTGISETVARQI 671
>gi|84515713|ref|ZP_01003074.1| excinuclease ABC subunit C [Loktanella vestfoldensis SKA53] >gi|84510155|gb|EAQ06611.1| excinuclease ABC subunit C [Loktanella vestfoldensis SKA53] (622 aa)
Score = 675, Expect = 1.5e-68, Identities = 182/573 (31%), Positives = 302/573 (52%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLS--LSDEKL--KTLSESL--KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK-----NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLA--------KDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           I   L+ +   PG Y   D +  V+YVGKA +L  R+  Y        +  ++ +E   + ++    E E+LLLE NLI + KP+YN+LLR+  +FP ILVTK+    ++  H   K  KG YYGPFA +      L   + R+F LR C+    +   + C+ Y I +C GPC   +++ DY   +KE  +F  G++K I E L  +   A+E+++FE +    +  K L      Q I      + D+I  +       + +F          +D       E D  E++   + ++Y+    E P+ + LS  L ++ L    L+E    KI+ + P +G K +++  A  NA E +  K +   + Q+R L  L E   L  +    R+E++DNS+I   + VGAMVV      +KN+YRKFNI+ ED     D+  MKEV+ RR++     +   S G  P+L+++DGG+ QV A  + +  + + S IP++G+A        K++ H+T + V      + L     + +F+  ++DEVHRFAI  +R K+SK++    L  +  +G TR   LL  + +   +  A++ +L  +
  S:    16 IHGYLRSLDSSPGVYRMLDADSRVLYVGKARNLRARVSNYARPGPHSPRIARMISETASMMFLTTRTETEALLLEQNLIKQLKPRYNVLLRDDKSFPNILVTKDHDFPMIRKHRGAKSQKGDYYGPFAGAGAVNRTLSQ-LQRVFLLRNCSDSDFETRTRPCLQYQIKRCSGPCCGMISKPDYALSVKEAENFLQGRTKGIQEALATQMQAASEEMLFERAAALRDRIKALTQVQSAQGINPQNTAEADVIALHTDGGQACVQVFFIRANQNWGNHDYYPRISGEEDMAEVMEAFVGQFYA--GREPPRMLILSHGLDNDDLMAAALAEKAGRKIEIVVPQRGEKAELVQNALRNARESLARK-MSETATQSRLLKGLAEAFDLPKVPQ--RIEVYDNSHIQGAHAVGAMVVAGPDGFDKNQYRKFNIRGEDLTPGDDFGMMKEVLTRRFQRLIKEDPDRSTGTWPDLLLIDGGQGQVSAVRQIMDDMGV-SDIPMVGVAKGLDRDAGKEEFHRTGKPV------MALRHNDPVLYFIQRMRDEVHRFAIGTHRAKRSKAIGATPLDDVPGVGATRKRALLAHFGSAKAVARANLADLKAV 603
>gi|183598704|ref|ZP_02960197.1| hypothetical protein PROSTU_02116 [Providencia stuartii ATCC 25827] >gi|188020895|gb|EDU58935.1| hypothetical protein PROSTU_02116 [Providencia stuartii ATCC 25827] (610 aa)
Score = 675, Expect = 1.5e-68, Identities = 182/583 (31%), Positives = 314/583 (53%)
  Q:     1 MNEQIKDK--LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKK-VTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSE--LDEILLTLIYEYYSKIAIE--LPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELD---SIIPVIGLAKDDKHKT---DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           M+EQ + K  LK + ++PG Y   D  G VIYVGKA DL  R+  YF  +    KT++L   I  +D  V + E E+LLLE+N I  Y+P+YN+LLR+  ++PYI ++KE HPR L  H   K  KG Y+GPF NS   + E    + ++FP+R+C     K  ++ C+ Y IG+CLGPC+K  V+ ++YE  +  +  F +GK + +   L ++  +A++ L FE++ ++ +  + ++  +E+Q  +    +D D+IG   +  +  I +     G +L          ++  L+E++ T + ++Y + +    LP  + L  +  +   L++SL      KI+     +G +   +  A  NA   +  K  Q  +   R    +  L K + +  + RME FD S+      V + VV++     K+EYR++NI       DY  M +V+ RRY  +     ++P++I +DGGK Q+  A +    L++D   +   +IG+AK    K        K +   + L   S     + +I+DE H  AI+ +R +++K    ++L  I+ +G  R + LL+    L  +K AS+EE++++  I  A
  S:     1 MSEQFEPKAFLKTVTNQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRTNVSSRKTEQLVKNIASIDVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPYIFLSKETHPR-LSMHRGAKHAKGEYFGPFPNSYAVR-ETLALMQKLFPIRQCEDSVYKNRSRPCLQYQIGRCLGPCVKGLVSDEEYEQQVNYVRLFLTGKDQQVLTGLIERMEKASQALRFEEAARFRDQIQAVRAVTEQQ-FVSGDSDDLDVIGVAFEAGLACIHVLFIRQGKVLGSRSYYPKIPADTLLEEVVQTFLGQFYLQGSENRTLPGEILLDFALPEKTLLADSLSHIAGRKIQIQTQPRGARARYLKLARTNASTALLTKLAQQSTIHQR----MSSLAKTVGLDSIARMECFDISHTMGEQTVASCVVFDKNGPVKSEYRRYNITGITPGDDYAAMHQVLTRRYGKHIDE-SKVPDIIFIDGGKGQLGQAKDVFNSLDVDWDKNRPLLIGVAKGSDRKAGLETLFFKPEGEGVALPPDSPALHVIQHIRDESHNHAITGHRQRRAKVKNTSALESIEGVGPKRRQMLLKYMGGLQPLKNASIEEIAKVPSISYA 599
>gi|167358831|ref|ZP_02293481.1| excinuclease ABC, C subunit [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167074342|gb|EDR78168.1| excinuclease ABC, C subunit [Rhizobium leguminosarum bv. trifolii WSM1325] (680 aa)
Score = 673, Expect = 2.2e-68, Identities = 181/584 (30%), Positives = 300/584 (51%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL-KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD------EILLTLIYEYYSK----IAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK---------NNTAS----------FGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE--VAKEI 586
           E I + +K++P+ PG Y   +  G V+YVGKA  L  R+  Y + +    +  ++  +  ++++V    E E+LLLE NLI + +P++N+LLR+  +FPYIL+T +     ++ H   +  KG Y+GPFA++      + N + R F +R C     +   + C+ Y I +C GPC  +V+   Y   ++E  DF SGKS+ +   + +   QAAE L FE +  Y +    L      Q I  +   + D+   + +  +  I +F +  G           ++ + D      E+L + + ++Y        I L +TV          +     K+  L P +G K+D++D    NA E    K L   ++Q+R L   +E   L       R+EI+DNS+I  TN VG MVV       KN+YRKFNIK  D     D+  MKEV+ RR+          + TA           F   P++I++DGG+ Q+ A    L  L +   +  IG+AK  D     +R          L  +  + +F+  ++DE HRFAI  +R ++ K + +N L +I  +G +R   LL+ + T   +  A++ +L  +  I   VAK++
  S:    55 ELIGEFVKRLPNSPGVYRMFNAEGDVLYVGKARSLKKRVNNYAVGRVHSNRIAQMVRQTANMEFVTTRTETEALLLEANLIKRLRPRFNVLLRDDKSFPYILITGDHRAPAIFKHRGARARKGDYFGPFASAGAVGRTI-NSLQRAFLIRTCTDSVFETRTRPCLLYQIKRCSGPCTHEVSDGGYGELVQEAKDFLSGKSQKVKSHMAEAMNQAAEDLDFERAAIYRDRLAALSHVQSHQGINPAGVEEADVFAIHHEGGISCIQVFFFRTGQNWGN----RAYFPKADPQLSSAEVLNSFLAQFYDDKPVPKQIMLSQTVEELELLAAALSEKAGHKVSILVPQRGEKRDLVDHVVGNAREAHGRK-LAETASQSRLLEGFKETFGLAYAPQ--RIEIYDNSHIMGTNAVGGMVVAGPEGFVKNQYRKFNIKSTDITPGDDFGMMKEVMSRRFSRLIKEDGIPDRTAQVATPDAADMPFPTWPDVILIDGGQGQMTAVRAILAELGITDSVTAIGIAKGVDRDAGRERFFPPGRESFTLPPRDPVLYFIQRMRDEAHRFAIGSHRARRKKEMIKNPLDEIGGIGPSRKRALLQHFGTAKAVSRAALSDLMAVEGISEAVAKQV 670
>gi|118591881|ref|ZP_01549276.1| excinuclease ABC subunit C [Stappia aggregata IAM 12614] >gi|118435524|gb|EAV42170.1| excinuclease ABC subunit C [Stappia aggregata IAM 12614] (659 aa)
Score = 673, Expect = 2.5e-68, Identities = 191/581 (32%), Positives = 315/581 (54%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF-LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNG------SLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLS--LSDEKL--KTLSESL--KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRY---------------------KNNTASFGEI----------PNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           E I D++K++P+ PG Y   D+NG V+YVGKA  L  R+  Y  L+ +  +  ++      +++VV   E E+LLLE NLI + +P++N+LLR+  +FPYILVT +     +  H   +K KG Y+GPFA++      + N + + F +R C+    +  ++ C+ Y I +C GPC  ++   DY   + E   F SG+S+ I  QL K+   A+  L FE +  Y +    L      Q I      + D+   + +     + +F +  G      +   K D     + E D IL + + ++Y       P+ + LS  LS++ L  + L+E    K+    P +G KK+++D A  NA E +  + L   S+Q R L  + E   L   +   R+E++DNS+I  TN VG M+V       K +YRKFNIK ED     DY  M+EV+ RR+                     ++  AS  E           P L+++DGG+ Q+ AA E+L+ L +   +P++G+AK  D     ++          L ++  + +F+  ++DE HRFAI  +R ++ K +  N L +I  +G TR + LL  + T   + +A V++L+ +  I  A
  S:    27 EVIADEVKRLPNGPGVYRMLDENGEVLYVGKARSLKKRVTSYTRLQGQSNRIMRMILATAAMEFVVTQTEPEALLLEANLIKRLRPRFNVLLRDDKSFPYILVTGDHESPAIVKHRGARKRKGDYFGPFASAGAVDRTI-NALQKAFLIRTCSDSYYENRSRPCLQYQIKRCAGPCTGEIDPADYAGLVSEAKAFLSGRSQLIKTQLAKQMEAASADLEFERAAIYRDRLSALSHIQAHQGINPQSVEEADVFAIHQEGGQTCVQVFFFRTGQNWGNRAYFPKAD---KSFEEAD-ILESFLAQFYDDKPA--PRQILLSHELSEQDLLAQALTERTGRKVDVACPKRGEKKELVDHALTNAREALGRR-LAETSSQARLLKGVAEAFDL--AQPPRRIEVYDNSHIMGTNAVGGMIVAGLEGFAKGQYRKFNIKSEDLVPGDDYGMMREVLTRRFSRLLKEHAREDSKPQADDPTLEDADASDLEAVPTDTGVPAWPELVLIDGGQGQLTAARETLESLGITD-VPLVGIAKGPDRDAGREKFFIPGRQSFMLPERDPVLYFVQRLRDEAHRFAIGSHRARRKKDITRNPLDEIAGVGPTRKKALLRHFGTAKAVSKAGVDDLAAVPGISEA 648
>gi|56459762|ref|YP_155043.1| excinuclease ABC subunit C [Idiomarina loihiensis L2TR] >gi|81363435|sp|Q5R0A6|UVRC_IDILO UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|56178772|gb|AAV81494.1| Nuclease subunit of the excinuclease complex, UvrC [Idiomarina loihiensis L2TR] (612 aa)
Score = 673, Expect = 2.7e-68, Identities = 178/569 (31%), Positives = 311/569 (54%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRD-LKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLS---KYDLITVFYSELDEILLTLIYEYY--SKIAIELPKTVYLSLSDEKLKTLSE------SLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIK-DLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPV-IGLAKDDKHK---TDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           L+ + H+PG Y   D++G VIYVGKA DL  R+  YF +  D +KT+ L  +I  +D  V N E E+L+LEN+ I KY+P+YN+LLR+  ++PYI++T  +HP++ + H   ++ KG Y+GPF N +  +  L N + ++FP+R+C+    +   + C+ Y + +CL PC+   T  +Y   +     F  GK++ + ++L  K  QA+  L FE + ++ +    L+   ER  +  SQ+ + D+IG   + N ++ V   ++  + L     Y       +  DE+L   + ++Y       ++P+ V L +  +    L+E      S  +K  +  +G K+     A  NAV  ++++ L   S  NR   +   LQ++L+    + RME FD S+      V + VV++     K++YR++NI       DY  M + + +RY +N    G IP+++ +DGGK Q+  A     F +     PV IG+AK +  K      I+      I L K +     + +I+DE HRFAI+ +R K++K    ++L +I  +G  R + +L+    L ++K AS+++L+ +
  S:    16 LRHLTHQPGVYRMYDESGDVIYVGKAKDLRKRVSSYFREKVDRMKTQVLVKQIASMDVTVTNTEAEALILENSFIKKYRPRYNVLLRDDKSYPYIILTSHQHPKLGF-HRGARRAKGDYFGPFPNGSAVRESL-NLLQKLFPIRQCDDSYYRARTRPCLQYQLKRCLAPCVNVCTDDEYNEQVALAKQFLQGKNQQVIDELMNKMEQASTDLDFERAARFRDQIAALRKTQERNSVTGSQQ-ELDVIGL-ARGNGMTTVQMLFIRDNHLQGSRSYFPKVPTDTPDDEVLRAFLLQFYLSDTAGRKIPREVVLPVDVQPDNVLAEVMSDALSQPVKLQSSVRGDKRQYQSLAQKNAVNALESR-LNQQSTMNRRTQA---LQQVLEFGVPIQRMECFDISHTMGQQTVASCVVFDQNGPKKSDYRRYNITGITPGDDYAAMSKALAKRY-DNAKEQGNIPDILFIDGGKGQLAQAENY--FNDWGKEAPVLIGVAKGESRKPGLETLIMAGSHETIPLSKDASALHLIQHIRDESHRFAITGHRQKRAKVKKTSTLEQIDGVGAKRRQAILKNLGGLQEVKNASIDKLASV 594
>gi|45657622|ref|YP_001708.1| nucleotide excision repair subunit C [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|59799053|sp|Q72RI9|UVRC_LEPIC UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|45600862|gb|AAS70345.1| nucleotide excision repair subunit C [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (609 aa)
Score = 672, Expect = 3.0e-68, Identities = 180/570 (31%), Positives = 321/570 (56%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL-----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDE---KLKTLSESL----KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           I +K+K +   PGCYLWK K G V+YVGKA +L  R++ Y  ++  D+KTK L  EI D+D++    E E+L+LE  LI K+ P++N+ L++   +PYI V+  E   ++Y     K     Y+GP+++    + E  + I RIFP+RK  ++     P + C+ +D+G+CLGPC   +  +DY+  + ++  F  G+ +S+   L  K   A+E+L FE + +Y ++ + ++ F E+Q ++  +  DED+IGF  K++   +++ +   G L +K  + +  V  +E  EIL     +YY   ++ +P  +++   + DE    +  L E      KIKF  P  G K+ ++  A  NA E+  ++ L L ++   +  SL+E+Q++  ++ L + +E +D S+   +  V + V++  G   K  YRK+NI+  +  +D   + EVI RR +      G  P+LI++DGG  Q+  A E+      +  IP++GLAK    + +     +      D  S     L +++DE HRF +S +R++++K    + + ++ ++G  R + LL+ +    KI+EA+ EEL
  S:    10 ILEKIKNLGASPGCYLWKSKKGEVLYVGKAKNLDKRVRSYLKENHPDVKTKVLQREIFDLDWIATGTEKEALILEATLIKKHNPRFNVRLKDDKKYPYICVSLSEPYPMVYVTRKLKDNGDRYFGPYSDVKSTR-ETLDIILRIFPVRKTRQVLPLPRPRRPCLNFDMGRCLGPCQGNIPVEDYKVIIDQVIQFLEGRKESLVSDLNIKMSNASERLDFEKAARYRDMLQRIQNFREKQTVVSLEGGDEDVIGFARKQDEGQVILLEIRGGRLETKKSFPIQGVLDAENSEILGAFFRDYYLNASL-VPPCIFIPADIQDEVIPVIDVLQEKTGFRPKIKF--PKGGDKRSLLKIAEKNA-ELGLSERL-LATHYRDQTASLKEIQEMFSLERLPHIIECYDISHFQGSQPVASGVMFVEGKPFKQGYRKYNIRGYEGINDPGMIHEVISRRLQRIINEEGVFPDLIVIDGGLTQLTKACEAAVEAGAEG-IPMVGLAKK---REEIFFPGENEPFIFDMNSPGMKLLRHLRDEAHRFGVSHHRSRRNKETMRSLIQEVPDIGFKRSKLLLQHFSGEKKIEEATKEEL 587
>gi|160933337|ref|ZP_02080725.1| hypothetical protein CLOLEP_02182 [Clostridium leptum DSM 753] >gi|156867214|gb|EDO60586.1| hypothetical protein CLOLEP_02182 [Clostridium leptum DSM 753] (628 aa)
Score = 672, Expect = 3.2e-68, Identities = 181/572 (31%), Positives = 311/572 (54%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF--LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIK--GTYYGPFANSNIKKYELYNFINRIFPLRKCN-KLPN-----KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVI---FKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLK------IKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY------KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQ 576
           ++ +   +P  PG YL K+ +  +IY+GKA  L NR+ QYF   K+   K +K+ +++   DY++ ++E E+L+LE +LI ++ PKYN+LL++   + YI VT + + RI    ++ +K+     Y GP+ +S   K  + +   +IF L  C+ K P      + C+ Y I QC  PC  K++ ++YE Y+ E  +F  G S    + + ++  +AAE L FE + +  +    +K  + +Q ++ ++  ++D++         +      F++  G L  + + +    ++        + +YY++  +  P  V L    E  + L + L       +K   P KG +  ++D    NA E    K  Q      RE+ +L+EL +LL + +    +E +D SN+  +  V  MV +ENG   K+ YRKF IK  +   DY  M+EVI RR       K+    FG +P+LI++DGGK  V A    L+   L   IP+ G+ KDDKH+T R +  D  EI ++     +  +  IQDEVHRFAI ++R  + ++   +SL  I  +G +R + LL+ ++T+  I +A ++EL Q
  S:     8 LRTRAMALPAAPGVYLMKNASNEIIYIGKAKALKNRVSQYFGSPKNHPPKVRKMVSQVDHFDYILTDSEFEALVLECSLIKQHTPKYNILLKDDKGYHYIKVTPKPYRRIF---EAKQKLNDGAEYIGPYTSSFSVKQSV-DEARKIFKLPTCSRKFPQEIGRGRPCLNYFIKQCCAPCRGKLSEEEYEGYVDEALEFLKGGSVVSVKDMTQQMNEAAENLEFERAARIRDRISAVKRITAKQKVVATKVREQDVVAMAQAAGAAAHACVVVFRFSGGRLCDQEEFMLGEIADGKTTRAEFLQQYYAQRTV--PPQVTLDGEVEGKEALRQWLSEKAGRSVKLTVPQKGEQAHLVDMCRRNASE----KLAQQAGRTGREMGALDELGRLLGLAQPPEYIEAYDISNLAGSGNVAGMVAFENGRPLKSAYRKFKIKGFEGQDDYASMQEVISRRLQEYQEKKDTGEGFGRLPDLILLDGGKGHVAAVRPVLEAFGLQ--IPLFGMVKDDKHRT-RAIARDGGEIAINSSRQAFTLVSQIQDEVHRFAIGYHRQTRKRTALSSSLTSIPGIGPSRAKALLKSFKTIKNIAQAELKELEQ 592
>gi|119370546|sp|Q6A9J8|UVRC_PROAC UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) (672 aa)
Score = 671, Expect = 3.6e-68, Identities = 182/566 (32%), Positives = 310/566 (54%)
  Q:    12 IPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKC-----NKLPN--KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSE-----LDEILLTLIYEYYSKIAI--------ELPKTVYLSLSDEKLKTLSESLK------IKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN------------------------NTAS---FGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           IP +PG Y + D +G VIYVGKA +L NR+  YF     L  +T+++      V + VV NE ESL LE   I ++ P++N++ R+  ++P++  T  +E+PR+     +  K    YYGPF  +   +  +   + R+FP+R C     N+  N  + C+   IG+C  PC++++T + +     E  DF +G++  I ++LE +  +A+E L FE +    +    L    ER  ++     D D+I        + + IF    G +  +   +     +     L E  LT +Y   +             +P  V +S        +S  L       ++   P +G K  +MDT   NA E +    L+  S+      +LEE+Q+ L + +   RME +D S+I  TN VG+MVV+E+G+  K+EYR+F+IK  + + D+  M EV+ RR +                          T S   F   P+LI+VDGG PQV AA + L+   L+  I + GLAK  +       +W    + L + S+  + L  ++DE HRFAI+F+R+K+SK++ E+ L  +  LG+TR + L+  + ++  +++A+V+++ ++
  S:    14 IPTQPGVYRFSDAHGQVIYVGKAKNLRNRLNSYFQDISALHPRTQRMVTTAAHVQWTVVQNEVESLQLEYTWIKEFDPRFNVMYRDDKSYPWLCFTWTDEYPRVFVGRGAHHK-GWRYYGPFGQAWAIRDTVETLL-RVFPMRSCSTGVFNRAKNQGRPCLLGYIGKCSAPCVERITSEAHREIADEFCDFMAGRTTKIVKRLESQMAEASENLEFERAAVIRDSLGALSKTLERNAVVLGDGTDADVISMALDPLEVGVKIFHVRGGRIRGERGWVADRADDADEAELMETFLTQLYGVNASDGQVRDDGHGNAVPPLVLVSAEPTNPDVMSTILSSERGSHVEIRVPRRGDKATLMDTVTRNAQETLAQHKLKRASDLATRTRALEEIQESLGLDRAPLRMESYDISHIQGTNVVGSMVVFEDGMPRKSEYRRFSIKGFEGSDDFAAMHEVLSRRLRRLIEDRDAMAAAQTPDGDVGSLIDPTTGSPRKFAYAPHLIVVDGGAPQVHAAQQVLEEFGLEDEIALCGLAKRLEEVWLPDEEW---PVILPRTSEGLYLLQRLRDEAHRFAITFHRSKRSKAMVESVLDGVSGLGETRRKALVSHFGSVRSLRKATVDDIVEV 631
>gi|50842299|ref|YP_055526.1| excinuclease ABC subunit C [Propionibacterium acnes KPA171202] >gi|50839901|gb|AAT82568.1| excinuclease ABC subunit C [Propionibacterium acnes KPA171202] (686 aa)
Score = 671, Expect = 3.7e-68, Identities = 182/566 (32%), Positives = 310/566 (54%)
  Q:    12 IPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKC-----NKLPN--KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSE-----LDEILLTLIYEYYSKIAI--------ELPKTVYLSLSDEKLKTLSESLK------IKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN------------------------NTAS---FGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           IP +PG Y + D +G VIYVGKA +L NR+  YF     L  +T+++      V + VV NE ESL LE   I ++ P++N++ R+  ++P++  T  +E+PR+     +  K    YYGPF  +   +  +   + R+FP+R C     N+  N  + C+   IG+C  PC++++T + +     E  DF +G++  I ++LE +  +A+E L FE +    +    L    ER  ++     D D+I        + + IF    G +  +   +     +     L E  LT +Y   +             +P  V +S        +S  L       ++   P +G K  +MDT   NA E +    L+  S+      +LEE+Q+ L + +   RME +D S+I  TN VG+MVV+E+G+  K+EYR+F+IK  + + D+  M EV+ RR +                          T S   F   P+LI+VDGG PQV AA + L+   L+  I + GLAK  +       +W    + L + S+  + L  ++DE HRFAI+F+R+K+SK++ E+ L  +  LG+TR + L+  + ++  +++A+V+++ ++
  S:    28 IPTQPGVYRFSDAHGQVIYVGKAKNLRNRLNSYFQDISALHPRTQRMVTTAAHVQWTVVQNEVESLQLEYTWIKEFDPRFNVMYRDDKSYPWLCFTWTDEYPRVFVGRGAHHK-GWRYYGPFGQAWAIRDTVETLL-RVFPMRSCSTGVFNRAKNQGRPCLLGYIGKCSAPCVERITSEAHREIADEFCDFMAGRTTKIVKRLESQMAEASENLEFERAAVIRDSLGALSKTLERNAVVLGDGTDADVISMALDPLEVGVKIFHVRGGRIRGERGWVADRADDADEAELMETFLTQLYGVNASDGQVRDDGHGNAVPPLVLVSAEPTNPDVMSTILSSERGSHVEIRVPRRGDKATLMDTVTRNAQETLAQHKLKRASDLATRTRALEEIQESLGLDRAPLRMESYDISHIQGTNVVGSMVVFEDGMPRKSEYRRFSIKGFEGSDDFAAMHEVLSRRLRRLIEDRDAMAAAQTPDGDVGSLIDPTTGSPRKFAYAPHLIVVDGGAPQVHAAQQVLEEFGLEDEIALCGLAKRLEEVWLPDEEW---PVILPRTSEGLYLLQRLRDEAHRFAITFHRSKRSKAMVESVLDGVSGLGETRRKALVSHFGSVRSLRKATVDDIVEV 645
>gi|24214866|ref|NP_712347.1| excinuclease ABC, subunit C [Leptospira interrogans serovar Lai str. 56601] >gi|59799067|sp|Q8F479|UVRC_LEPIN UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|24195885|gb|AAN49365.1|AE011387_6 excinuclease ABC, subunit C [Leptospira interrogans serovar Lai str. 56601] (609 aa)
Score = 671, Expect = 4.0e-68, Identities = 180/570 (31%), Positives = 321/570 (56%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL-----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSDE---KLKTLSESL----KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           I +K+K +   PGCYLWK K G V+YVGKA +L  R++ Y  ++  D+KTK L  EI D+D++    E E+L+LE  LI K+ P++N+ L++   +PYI V+  E   ++Y     K     Y+GP+++    + E  + I RIFP+RK  ++     P + C+ +D+G+CLGPC   +  +DY+  + ++  F  G+ +S+   L  K   A+E+L FE + +Y ++ + ++ F E+Q ++  +  DED+IGF  K++   +++ +   G L +K  + +  V  +E  EIL     +YY   ++ +P  +++   + DE    +  L E      KIKF  P  G K+ ++  A  NA E+  ++ L L ++   +  SL+E+Q++  ++ L + +E +D S+   +  V + V++  G   K  YRK+NI+  +  +D   + EVI RR +      G  P+LI++DGG  Q+  A E+      +  IP++GLAK    + +     +      D  S     L +++DE HRF +S +R++++K    + + ++ ++G  R + LL+ +    KI+EA+ EEL
  S:    10 ILEKIKNLGASPGCYLWKSKKGEVLYVGKAKNLDKRVRSYLKENHPDVKTKVLQREIFDLDWIATGTEKEALILEATLIKKHNPRFNVRLKDDKKYPYICVSLSEPYPMVYVTRKLKDNGDRYFGPYSDVKSTR-ETLDIILRIFPVRKTRQVLPLPRPRRPCLNFDMGRCLGPCQGNIPVEDYKVIIDQVIQFLEGRKESLVSDLNIKMSNASERLDFEKAARYRDMLQRIQNFREKQTVVSLEGGDEDVIGFARKQDEGQVILLEIRGGRLETKKSFPIQGVLDAENSEILGAFFRDYYLNASL-VPPCIFIPADIQDEVIPVIDVLQEKTGFRPKIKF--PKGGDKRSLLKIAEKNA-ELGLSERL-LATHYRDQTASLKEIQEMFSLERLPHIIECYDISHFQGSQPVASGVMFVEGKPFKQGYRKYNIQGYEGINDPGMIHEVISRRLQRIINEEGVFPDLIVIDGGLTQLTKACEAAVEAGAEG-IPMVGLAKK---REEIFFPGENEPFIFDMNSPGMKLLRHLRDEAHRFGVSHHRSRRNKETMRSLIQEVPDIGFKRSKLLLQHFSGEKKIEEATKEEL 587
>gi|116251353|ref|YP_767191.1| excinuclease ABC subunit C [Rhizobium leguminosarum bv. viciae 3841] >gi|119367822|sp|Q1MIX8|UVRC_RHIL3 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|115256001|emb|CAK07082.1| putative uvrABC system protein C [Rhizobium leguminosarum bv. viciae 3841] (680 aa)
Score = 671, Expect = 4.1e-68, Identities = 180/584 (30%), Positives = 300/584 (51%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL-KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD------EILLTLIYEYYSK----IAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK---------NNTAS----------FGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE--VAKEI 586
           E I + +K++P+ PG Y   +  G V+YVGKA  L  R+  Y + +    +  ++  +  ++++V    E E+LLLE NLI + +P++N+LLR+  +FPYIL+T +     ++ H   +  KG Y+GPFA++      + N + R F +R C     +   + C+ Y I +C GPC  +V+   Y   ++E  DF SGKS+ +   + +   QAAE L FE +  Y +    L      Q I  +   + D+   + +  +  I +F +  G           ++ + D      E+L + + ++Y        I L +TV          +     K+  L P +G K+D++D    NA E    K L   ++Q+R L   +E   L       R+EI+DNS+I  TN VG MVV       KN+YRKFNIK  D     D+  MKEV+ RR+          + TA           F   P++I++DGG+ Q+ A    L  L +   +  IG+AK  D     +R          L  +  + +F+  ++DE HRFAI  +R ++ K + +N L +I  +G +R   LL+ + T   +  A++ +L  +  I   VA+++
  S:    55 ELIGEFVKRLPNSPGVYRMFNAEGDVLYVGKARSLKKRVNNYAVGRVHSNRIAQMVRQTANMEFVTTRTETEALLLEANLIKRLRPRFNVLLRDDKSFPYILITGDHRAPAIFKHRGARARKGDYFGPFASAGAVGRTI-NSLQRAFLIRTCTDSVFETRTRPCLLYQIKRCSGPCTHEVSDGGYGELVQEAKDFLSGKSQKVKSHMAEAMNQAAEDLDFERAAIYRDRLAALSHVQSHQGINPAGVEEADVFAIHHEGGISCIQVFFFRTGQNWGN----RAYFPKADPQLSSAEVLNSFLAQFYDDKPVPKQIMLSQTVEELELLAAALSEKAGHKVSMLVPQRGEKRDLVDHVVGNAREAHGRK-LAETASQSRLLEGFKETFGLAYAPQ--RIEIYDNSHIMGTNAVGGMVVAGPEGFVKNQYRKFNIKSTDITPGDDFGMMKEVMTRRFSRLIKEEGIPDRTAQVATPDAADMPFPTWPDVILIDGGQGQMTAVRAILAELGITDSVTAIGIAKGVDRDAGRERFFPPGRESFTLPPRDPVLYFIQRMRDEAHRFAIGSHRARRKKEMIKNPLDEIGGIGPSRKRALLQHFGTAKAVSRAALSDLMAVEGISEAVARQV 670
>gi|153093488|gb|EDN74468.1| exinuclease UvrC [Mannheimia haemolytica PHL213] (612 aa)
Score = 669, Expect = 6.5e-68, Identities = 190/578 (32%), Positives = 314/578 (54%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKV-TRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYS--ELDEILLTLIYEYYSKIAIE--LPKTVYLSLSDEKLKTLSESL------KIKFL-NPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFL--ELDSIIP-VIGLAKDDKHK----TDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           K  L  +PH+PG Y   D  G +IYVGKA DL  R+  YF       KT+ L   + +++  + ++E E+LLLE+N I + +PKYN+LLR+  ++PYIL+TK +HPR L +   +KKI G Y+GP+ N    + E  N + +IFP+R+C     K  ++ C+ Y IG+CL PC++   +  +Y+  +  +  F  GK   + E L +K   AAE L FE + ++ +  ++++   E+Q +   + +D DII    +  +  + I     G +L          S  +L E+  T + ++Y ++     +P  + +     + K LSE L      K+  L N  +G K+  +  A  NA+  +  +  Q    Q+R     + L+++L + ++ RME FD S+      V + VV++     K++YR+FNI+      DY  M++ + +RY N      +IP++I +DGGK Q+  AL+    L  E D   P +IG+AK  + K    T  I KWD  EI L   S     + +I+DE H+ AIS +R K+ K+  E+ L  I  +G  R + LL+    +  +K A++EE+  +  I  A
  S:     7 KSFLLNVPHQPGVYRMYDSKGTIIYVGKAKDLKKRLASYFRSQLSSKKTEALVANLANIETTITHSETEALLLEHNYIKENQPKYNVLLRDDKSYPYILLTKHKHPR-LTAFRGSKKIAGEYFGPYPNVTAVR-ETLNLLQKIFPIRQCEDTYYKNRSRPCLQYQIGRCLAPCVEGCYSPVEYDQQVNLVRLFLQGKDHQVVEHLVQKMEDAAEALDFEGAARFRDQIQSVRAVQEKQFVSNDRLDDLDIISIVYQNGIACVHILFVRQGKVLGNRSYFPKVPSNTDLTELADTFVGQFYLQMNQHRTIPNQIVIDHQLSESKALSEILSEQAGHKVSILDNAIRGDKQRYLALARTNAMAALVLQLKQESHIQSR----YQALKEMLKMSEIKRMECFDISHTMGNQTVASCVVFDENGPLKSDYRRFNIEGITGGDDYAAMEQALLKRY-NRELPPEKIPDIIFIDGGKGQLNRALDVFAKLDVEWDKSKPLLIGVAKGVERKAGLETLIISKWD-KEIHLPPDSLALHLIQHIRDESHQHAISGHRKKRQKAFTESGLESIAGVGAKRRQALLKYLGGMQGVKSATLEEIQSVPGISKA 600
>gi|190891161|ref|YP_001977703.1| excinuclease ABC protein, C subunit [Rhizobium etli CIAT 652] >gi|190696440|gb|ACE90525.1| excinuclease ABC protein, C subunit [Rhizobium etli CIAT 652] (679 aa)
Score = 669, Expect = 7.9e-68, Identities = 180/584 (30%), Positives = 297/584 (50%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL-KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD------EILLTLIYEYYSK----IAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYKN-------------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE--VAKEI 586
           E I + +K++P+ PG Y   +  G V+YVGKA  L  R+  Y + +    +  ++  +  ++++V    E E+LLLE NLI + +P++N+LLR+  +FPYIL+T +     ++ H   +  KG Y+GPFA++      + N + R F +R C     +   + C+ Y I +C GPC  +V+ + Y   ++E  DF SGKS+ +   + +   QAAE L FE +  Y +    L      Q I  +   + D+   + +  V  I +F +  G           ++ + D      E+L   + ++Y        I L +TV          +     K+  L P +G K+D++D    NA E    K L   ++Q+R L   +E   L       R+EI+DNS+I  TN VG MVV       KN+YRKFNIK  D     D+  MKEV+ RR+                         F   P++I++DGG+ Q+ A    L  L L   +  IG+AK  D     +R          L  +  + +F+  ++DE HRFAI  +R ++ K + +N L +I  +G +R   LL+ + T   +  A++ +L  +  I   VA+++
  S:    54 ELIGEFVKRLPNSPGVYRMFNAEGDVLYVGKARSLKKRVGNYAVGRVHSNRIAQMVRQTANMEFVTTRTETEALLLEANLIKRLRPRFNVLLRDDKSFPYILITGDHRAPAIFKHRGARARKGDYFGPFASAGAVGRTI-NSLQRAFLIRTCTDSVFETRTRPCLLYQIKRCSGPCTHEVSDEGYGELVQEAKDFLSGKSQKVKSHMAEAMNQAAEDLDFERAAIYRDRLAALSHVQSHQGINPAGVEEADVFAIHHEGGVSCIQVFFFRTGQNWGN----RAYFPKADPQLSGAEVLNAFLAQFYDDKPVPKQIMLSETVEELELLAAALSEKAGHKVSILVPQRGEKRDLVDHVVGNAREGHGRK-LAETASQSRLLEGFKETFGLAYAPQ--RIEIYDNSHIMGTNAVGGMVVAGPEGFVKNQYRKFNIKSTDITPGDDFGMMKEVMTRRFSRLIKEEGIPDRTAQATAADAADMPFPAWPDVILIDGGQGQMTAVRAILAELGLTDSVTAIGIAKGVDRDAGRERFFPPGRESFTLPPRDPVLYFIQRMRDEAHRFAIGSHRARRKKEMVKNPLDEIGGIGPSRKRALLQHFGTAKAVSRAALSDLMAVEGISEAVARQV 669
>gi|167856418|ref|ZP_02479141.1| UvrABC system protein C [Haemophilus parasuis 29755] >gi|167852459|gb|EDS23750.1| UvrABC system protein C [Haemophilus parasuis 29755] (591 aa)
Score = 668, Expect = 8.7e-68, Identities = 185/561 (32%), Positives = 308/561 (54%)
  Q:    23 DKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKV-TRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVF--YSELDEILLTLIYEYYSKIAIE--LPKTVYLSLS----DEKLKTLSESL--KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFL--ELDSIIP-VIGLAKDDKHK----TDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           D  G +IYVGKA DL  R+  YF  +    KT+ L ++I  +D  + ++E E+LLLE+N I + +PKYN+LLR+  ++PYIL+TK +HPR L S   +KKI G Y+GP+ N+   + E  N + ++FP+R+C     K  ++ C+ Y IG+CL PC++ V ++++Y+  ++ +  F  GK + + E L  K  +AAE L FE + ++ +  + +++ +E+Q +   + +D DII    +  +  + I     G +L           ++E  E+  T I ++Y ++     +P  + +  S    D   K LSE    K+   +  +G K   +  A  NA+  +  +  Q    Q R     E LQ +L +  + RME FD S+      V + VV++     K++YR+FNI+      DY  M++ + +RY        +IP++I +DGGK Q+  AL++   L  E D   P +IG+AK  + K    T  I KWD  EI L   S     + +I+DE H  AIS +R K+ K+  E+ L  I  +G  R   LL+    +  +K A+++E+  +  I V+
  S:     3 DDKGTIIYVGKAKDLKKRLSSYFRSNLASRKTEALVSQIAHIDTTITHSETEALLLEHNYIKENQPKYNVLLRDDKSYPYILLTKHQHPR-LASFRGSKKIAGEYFGPYPNAGAVR-ETLNLLQKLFPIRQCEDSYYKNRSRPCLQYQIGRCLAPCVEGVYSQREYDQQVEYVRLFLQGKDQQVIEHLIGKMEKAAEDLDFEAAARFRDQIQQMRVVTEKQFVSNERLDDLDIISIAYQHGIACVHILFVRQGKMLGSRSYFPKVPNHTEFAELSDTFIGQFYLQMNQHRTIPHQIIIDHSVSEVDALEKVLSEQAGHKVSITDKVRGEKSRYLALAKTNAMAALTLQLKQDARIQTR----YEALQAVLSLPKIARMECFDISHTMGEQTVASCVVFDENGPLKSDYRRFNIEGITGGDDYAAMEQALLKRYDKPLPP-EKIPDIIFIDGGKGQLNRALDTFANLKVEWDKSKPLLIGVAKGVERKAGLETLLISKWD-KEIHLPPDSPALHLIQHIRDESHNHAISGHRKKRQKAFTESGLEAIAGVGAKRRHLLLKYLGGMQGVKSATLDEIKSVPGISVS 578
>gi|86143737|ref|ZP_01062113.1| excinuclease ABC, C subunit [Flavobacterium sp. MED217] >gi|85829780|gb|EAQ48242.1| excinuclease ABC, C subunit [Leeuwenhoekiella blandensis MED217] (601 aa)
Score = 668, Expect = 9.7e-68, Identities = 185/579 (31%), Positives = 311/579 (53%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRD-LKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK---------CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDL-ITVFYSELDEILLTL----IYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQL-ISNQNRELNSL-EELQKLLDIK-DLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           +LK +P  PG Y + DK G ++YVGKA +L  R+  YF K  D  +T  L  +I  + ++VVN+E ++LLLENN+I  Y+PKYN++L++  ++P+I +  E  PR+  +    K     YYGP+  S    + L + I  ++PLR CN   +K+         C+ Y +G CLGPC  K++ + Y   +  I D   G  K    +   +    AE + FED+Q+  E  + L+ +  +  ++    N+ D+      E    +   +  +G+++  + L +     E D  LL +    I + ++  + E+     L L D           I+   P  G KK +++ +  NA      ++ Q  I + +R +N L  +++  L +  +   +E FDNSNI  TN V A VV+++G  +K +YRKFNIK      D+  M+EV++RRY+        +P LIIVDGGK Q+ + +++L+ L L   I +IG+A   K   +     D   + LDKKS+    +  +++E HRF I+F+RN++SK+     L  I  +G+  + +LL  + ++ K+K+AS   LS+++    AK I
  S:     9 QLKTLPSSPGVYQYYDKKGKLLYVGKAKNLKKRVSSYFNKKHDNARTHMLVKKIVTIKHIVVNSETDALLLENNMIKNYQPKYNVMLKDDKSYPWICIKNERFPRVFPTRRLIKD-GSEYYGPYT-SMKTVHTLLDLIKGLYPLRTCNYDLSKEKIESGKYKVCLEYHLGNCLGPCEDKISAKTYHDNIDAIRDIVKGNFKDSLHRFRSQMKAHAEAMEFEDAQRIKEKIEVLEGYQAKSTVVNPSINNVDVFSIVSDEGYGYVNFLQLSHGAIIRSHTLELKKKLDESDAELLAIGIIEIRQRFNSQSSEIYVPFDLDLGD----------GIRVTVPKLGDKKRIVELSERNAKYFRMERFKQTKIVDPDRHVNRLMAQMKSDLRLSVEPRHIECFDNSNIQGTNPVAACVVFKDGKPSKKDYRKFNIKTVTGPDDFASMEEVVFRRYRRLLNEDEPLPQLIIVDGGKGQLSSGVKALEALGLRGKIAIIGIA---KRLEELFYPGDSIPLYLDKKSETLKVIQQLRNEAHRFGITFHRNQRSKAAINTELETIPGIGEKTVIELLRHFRSVSKVKKASAAALSEVIGPAKAKII 590
>gi|145219356|ref|YP_001130065.1| excinuclease ABC subunit C [Prosthecochloris vibrioformis DSM 265] >gi|145205520|gb|ABP36563.1| Excinuclease ABC subunit C [Prosthecochloris vibrioformis DSM 265] (636 aa)
Score = 667, Expect = 1.3e-67, Identities = 185/572 (32%), Positives = 311/572 (54%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK--DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKC------NKLPNKK---CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL-SKYDLITVFYSELDEILLTLIYE-YYSKIAIELPKTVYLSLSD-------------EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNA----VEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQ 576
           +++K+  +P +PG Y +++  G VIYVGKA +L +R++ YF     +  KT+ L   I D++ ++ ++E E+L+LENNLI + KP+YN+ L++   +P++++T E  PRI  + + T+  +  ++GP+  +  +   + + I+ IFP+R C        + +KK   C+ Y I +C GPC       DY   + EI     GK+  +   L +K + AAE L FE++ +      +LK +SERQ I+ +   D D +     E+    V+F+   G +L S++ ++T    E +  +L  + E +Y K A  +P  V L                 E+        +++F  P  G K  ++D    NA     E M  K  Q      RE +  + L + L +++   R+E FDNS++  T+ V AMV +  G   K  YRKF +   + + DY  M+E I RRY  + +    +P+LIIVDGGK QV  A ++L  L +   +PVIGLA   K   +  + +      L K S     L  ++DE HRFAIS++R  + K   +  L  I+ +G+     LLE++ + + +  A++EEL++
  S:    26 LREKIASLPKEPGVYQFRNDKGRVIYVGKAKNLRSRVRSYFSNPLQQSGKTQVLVTHIRDLEIIITSSEVEALILENNLIKELKPRYNINLKDDKTYPWLVITAEPFPRIFITRNRTRD-RSIWFGPYTEAG-QLRTILDLISSIFPVRSCRHPLTPENIASKKYKLCLDYHIHKCKGPCEGLQEEGDYLEMIGEIVRLLKGKTAGLRRDLHEKMLTAAEDLRFEEAAEIKLQLDSLKRYSERQKIVAADGADRDAVAVAIGEDEACGVVFRIREGKMLGSQHFILTNTKGESEATILGRVLETHYLKTADLMPDEVLLPELPEEEAAEALRALGREQQGEGGRQKEMRFTVPQIGEKAHLLDMCRQNARHHLAEYMVQK--QKRGEAAREHSGSKALAEALHLENTPNRIECFDNSHLQGTDYVSAMVCFVMGRPLKGGYRKFKLNSFEGSDDYAAMEEAINRRYGGSLSKELPLPDLIIVDGGKGQVNTARKALDALGVS--VPVIGLA---KRLEEIFIPFTPDPFNLPKTSPALKLLQQLRDESHRFAISYHRTLRRKRTLQTELTAIEGIGEKTAFTLLERFGSAEGVAAATLEELAK 619
>gi|91199963|emb|CAJ73005.1| similar to uvrABC system protein C (UvrC exinuclease) [Candidatus Kuenenia stuttgartiensis] (610 aa)
Score = 666, Expect = 1.4e-67, Identities = 186/579 (32%), Positives = 332/579 (57%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK---DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEE---HPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSL--LSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE----------IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           KLK +P  PG YL KD    VIYVGKA +L NR++ YF K   DR L T+ L   + D+D+V+   E E+L+LENN I ++KPK+N+ LR+   F  I +   +   +P+++   +    +   Y+GP+A++   + E   +IN   P+RKC     K   K C+YY I +CLGPC   + R  Y+  + ++     GK + +   L K+  + +++L +E + K  +  ++++   E+Q I      D D+ G+Y  +N + I +    +G++  ++ Y L ++ ++ ++E+  + + ++YS+    +P  V + ++      L E L      K+    P +G K  +++ A  NA+   K    Q   N +R L +L+++  L ++ +  R+E FD SNIF    VG+MV ++ G+ +K++Y++F IK  D   DY  M EV+ RRYK      G++P+L++VDGGK Q+  AL   + L ++    ++ L+KD       I K +  E          I L   S +  FL  I+DE HRFAI+++R  + K  +++ L +I  +G  R + L++++ +++ I+ A++ +L++I  +P ++A E+
  S:     6 KLKNVPVSPGVYLMKDAKHKVIYVGKAKNLKNRVRSYFQKGTGDR-LYTEYLIKHVVDIDFVLTETEKEALILENNFIKQFKPKFNINLRDDKNFLCIKLETNKDFPYPKVVRQKEDDGAM---YFGPYASARAVR-ETLRYINDTIPVRKCRDNAFKSRTKPCLYYQIHKCLGPCCGLIDRAGYKTLIDQVILLLKGKQEDLISILRKQMYEESKQLRYEKAAKLRDQIQSIEQTVEKQRINSLTFIDRDVFGYYLTDNDVYIEVMFIRSGNMEDIASYRL-SINHTTIEEVFRSFLNQFYSQTRF-IPSEVIIPVNSPDAVLLEEWLTERKGKKVSVFCPKRGDKLRLIEMAQKNAMNAYKVSQTQ-DDNYSRTLQALKDVIGLRNLPE--RIECFDISNIFGKQAVGSMVTFKCGMPDKSKYKRFRIKTVDQIDDYAMMHEVLLRRYKRAVEE-GDLPDLVMVDGGKGQLGVALRVFEELAIND-TDLLALSKD--RGKSGIPKGEQGEQVHAPHIPHPILLPSSSPVLLFLAKIRDEAHRFAIAYHRKLRDKEYYKSPLDEIPGIGIIRKKALIKRFGSIEGIRNATINQLTEIGKLPAKLANEV 600
>gi|171853837|emb|CAM11786.1| Nuclease subunit of the excinuclease complex [Candidatus Phytoplasma australiense] (597 aa)
Score = 666, Expect = 1.5e-67, Identities = 192/580 (33%), Positives = 327/580 (56%)
  Q:     7 DKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYY-SKIAIEL---PKTVYLSLSDE-----------KLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAV-EIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           +K+K +P  PGCYL+K+KN  +IYVGKA  L  R++ YF+K  + KT  +  EI DV YV+ NNE E+L+LE NLI ++ PKYN  L +   +PY+ +T+E+ P++  S           +GP+ N N  K E    ++ ++PLR+C     K C+++ I QCLGPC  K    DY P ++ I +F  G +K I ++++    +A+++  +E +Q+Y ++  +++  +++Q I   +  + DI+ +   ++ I+I I K   G+++  +  +  +     E +   +  YY SK+  EL    K  +   S E             + LS++LK K +    G KK +   A  NA  ++M+N  L    +Q  +  +L++L  + + KD+ R+++FDNS +F    V A +V++     K  YR F+IKD D N ++   +EV+ R Y+         PNLI+VDGG  Q+KA  ++L  L LD  I +  L K+DKH+ + ++    ++I L  K  L+ FL  + +EVHRF + F+   K+K  ++  L +IK +G  R + +L  + + + +K+AS E   +   I ++KEI
  S:     6 EKIKNLPLNPGCYLFKNKNNTIIYVGKAKKLRKRVQSYFIKGHNRKTTCMVQEISDVFYVITNNEQEALILEANLIKEHTPKYNFKLLDDKTYPYLEITQEKDPQLKISRFKKIPPGKVLFGPYPNLNSTK-ETLKLLHFLYPLRRCPLSAKKPCLHFHINQCLGPCALK--NVDYRPNIEAITNFLKGDTKIILKKIKLLMQEASQQRFYEKAQEYRDMLIHIQNTTKKQIISHQKIKNCDILAYVYNDDQIAIQILKMQQGNIVDSHRSVFSYVGYPQENINNYLALYYQSKLKPELIITGKNTHNLTSPESNTQQQEAILFSAELLSQTLKTKVVVAKIGDKKKLYSLALKNAQNDLMQNNLLYQSKDQAIQ-EALDQLAIIFN-KDIKRIDVFDNSQLFGQAFVSARIVFDQFDFKKPLYRVFHIKDNDPN-EFTSFEEVLTRSYQKKDKEELVKPNLILVDGGLWQLKAGFQALNQLNLD--IALGALQKNDKHQLECLLT-SHNKIALTPKPRLFAFLKRLSEEVHRFVVKFHHKTKNKLDYQTVLSQIKGIGAKRHKIILNHFNSWEDLKKASWETFEK---IGISKEI 589
>gi|114331403|ref|YP_747625.1| excinuclease ABC, C subunit [Nitrosomonas eutropha C91] >gi|122313779|sp|Q0AG72|UVRC_NITEC UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|114308417|gb|ABI59660.1| Excinuclease ABC subunit C [Nitrosomonas eutropha C91] (604 aa)
Score = 666, Expect = 1.6e-67, Identities = 167/565 (29%), Positives = 298/565 (52%)
  Q:    12 IPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKC-NKLPNKK---CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYC--KENVISIVIFKYVNGSLLSKYDLI--TVFYSELDEILLTLIYEYYSKIAIE----LPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHK---TDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQ 576
           +P +PG Y   +  G VIYVGKA+DL  R+  YF K     + + + ++I  ++  V  +E E+LLLENNLI    P+YN+L R+  ++PY+L+T    PR+ +   +    +  Y+GPF N+ + K  +   + ++F LR C N + N +   C+ + I +C  PC+  +T + Y   +     F  GK   + + +E+K  +A+++  +E +  + +  + L+M  E+Q +  S+  D D+I       ++ +++ +    +G  L              +  +L   + ++Y   ++     L K + ++L  +KL +     K+       G ++  +D A  NA   ++ K +Q  S ++R    L+ LQ++L++  L R+E FD S+      + + VVY++      EYR++NI       DY  M++V+ RRY       G++P+LI++DGGK Q+  A E +  L L+  IP++G+AK +  K      I+ W    + L         +  I+DE HRFAI  +R K++K+   +SL +I  +G  R + LL ++  L  +K AS+EEL Q
  S:    15 LPSQPGVYRMLNAAGDVIYVGKAIDLRKRVSSYFQKSNLSPRIQLMVSQITGIETTVTRSEAEALLLENNLIKSLAPRYNILFRDDKSYPYLLLTNHAFPRLAFYRGALDN-RHQYFGPFPNAGVVKSSI-QLLQKVFRLRTCENSVFNNRTRPCLLHQIKRCSAPCVNLITPEAYREDVNSAALFLQGKQDEVLKTIEQKMFEASDRQAYEQAVLFRDQMQALRMIQEKQFVDSSRALDADVIACTTGTDKHTVAVNLVMIRSGRHLGDKTFFPQNTHEDSISTVLEAFVSQHYLNRSVPPLIILGKKIRVTLL-QKLLSEQAGHKVTLTINPIGERRKWLDMATENAQLALRQKQIQQASQEDR----LQALQEVLNLPGLARIECFDISHTMGEATMASCVVYDHYAMRNGEYRRYNITGITPGDDYAAMRDVLQRRYAKIAMEEGKLPDLILIDGGKGQIGVASEVMIELGLND-IPLVGVAKGEARKPGLEQLILPWQEETLHLPNDHPALHLIQQIRDEAHRFAIQGHRAKRAKTRKTSSLEQIAGIGSKRRQNLLTRFGGLKGVKNASIEELQQ 587
>gi|28898718|ref|NP_798323.1| excinuclease ABC subunit C [Vibrio parahaemolyticus RIMD 2210633] >gi|32130286|sp|Q87NC4|UVRC_VIBPA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|28806936|dbj|BAC60207.1| excinuclease ABC, subunit C [Vibrio parahaemolyticus RIMD 2210633] (610 aa)
Score = 666, Expect = 1.6e-67, Identities = 182/569 (31%), Positives = 308/569 (54%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKK-VTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYY--SKIAIELPKTVYLS--LSDEK---LKTLSE--SLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELD-SIIPV-IGLAKDDKHKT--DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           LK + H+PG Y   + + +VIYVGKA DL  R+  YF K  D  KT+ L + I  +D  V + E E+L+LE+N I +Y PKYN+LLR+  ++PYIL++  +HPR L  H   KK KG Y+GP+ +S   + E  + + +IFP+R+C         + C+ Y IG+C GPC+   ++ ++Y   +  +  F  GK + + +QL +K   A+++L FED+ K+ +  + ++   E+Q +     +D D++GF  +  +  I I     G +L   S +  I    S+  E+  + + +YY     A  +P  + L+  L+D+     K LSE    K+ F     G +   +  +  NA+  +  K    ++   R     + L++ L ++ + RME FD S+    + + + VV+ N    K EYR++NI       DY  M + + RRY        +IP++I +DGGK Q+  A E +     D    P+ IG+AK    K   + ++  D  E  L   +     + +I+DE H  AI+ +R K+ K+   ++L  I+ +G  R + LL+    L ++K ASVEE++++
  S:    11 LKTVTHQPGVYRMYNADAVVIYVGKAKDLQKRLSSYFRKKVDSEKTRALVSNIAKIDVTVTHTETEALILEHNYIKQYLPKYNVLLRDDKSYPYILISGHKHPR-LSMHRGAKKRKGEYFGPYPDSGAVR-ETLHLLQKIFPVRQCEDTVYSNRTRPCLMYQIGRCAGPCVSSIISDEEYAELVGFVRLFLQGKDQQVLKQLIEKMEVASQQLRFEDAAKFRDQIQAIRRVQEQQYVSEDSMDDMDVLGFAQENGIACIHILMIRQGKVLGSRSHFPKIPQNTSQ-QEVFDSFLTQYYLSHNEARTIPSRIILNQELADDLEPIQKALSEVAGRKVHFHTSPTGARGRYLKLSNTNALTAITTKINHKMTINQR----FKALRETLGMESIMRMECFDISHTMGESTIASCVVFNNEGPVKQEYRRYNITGITGGDDYAAMGQALERRYSKQL-DVEKIPDIIFIDGGKGQLNRAHEIIAQYWGDWPKRPIMIGIAKGVTRKPGLETLITVDGEEFNLPSDAPALHLIQHIRDESHNHAIAGHRAKRGKTRRTSALEGIEGVGPKRRQALLKYMGGLQELKRASVEEIAKV 593
>gi|188995802|ref|YP_001930054.1| excinuclease ABC C subunit [Porphyromonas gingivalis ATCC 33277] >gi|188595482|dbj|BAG34457.1| excinuclease ABC C subunit [Porphyromonas gingivalis ATCC 33277] (600 aa)
Score = 665, Expect = 2.0e-67, Identities = 186/576 (32%), Positives = 314/576 (54%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN-KLPNKK--------CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVY-LSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVE--IMKNKYLQLISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAK 584
           L  +P KPGCY + D++G VIYVGKA +L  R+  YF K+  D KT+ L  +I  + Y+VV++E ++LLLEN+LI +Y+P+YN+LL++   +P I++ +E  PRI  + D  KK    Y+GP+  + I K  +   +  I+P+R C   L  +K        C+ Y I +C GPCI   T  +YE  + EI D   G    +      +    +E+L FE++Q   E  + L+ +  +  ++    ++ D+  +   E+   I      +G +   Y L   +  +++E    L+    +++        + + L  +      ES+      P +G K+ +++ +  N  +  + K K  + ++ + R L+ +  +QK L + +    +E FDNSNI  T+ V A VV++ G  +K +YRKF++K  +  +D+  M+E+I R Y   T     +P+LI+VDGGK Q+ AA E+L  L L   IP+IGLA   +   +     D   + LDKKS+    + +++DE HRF I F+R+ +SK   ++ L  IK +GK   E LL  ++++ +I+ A  EELS ++    AK
  S:    11 LPTLPEKPGCYQYFDEDGKVIYVGKAKNLRRRVSSYFYKEHADRKTRILVRQIRSIKYIVVDSEGDALLLENSLIKEYQPRYNVLLKDGKTYPSIVIKREPFPRIFATRD-IKKDGSEYFGPYPGALIAK-GMLRLVKEIYPIRTCKLDLREEKIRQGRYRVCLQYHIKKCKGPCIGNQTSNEYESNVSEIRDLLRGNLHRLVRMYRDRMQAYSEELRFEEAQICKERIELLERYEAKHTVVPRNIDNVDVFSYDEDEHTAYINYMHIEHGGINRVYTL--EYRKQIEESKEELLAAAITELRQRFESNAHEIVLPFDTGWQTGESITTTI--PRRGDKRKLLELSEKNVAQYKLDKLKRAEKLNPEQRALHIVHGIQKDLHLDRPPKHIECFDNSNIQGTSPVAACVVFKMGKPSKKDYRKFHVKTVEGPNDFASMREIISRHYTRLTEENLPLPDLIVVDGGKGQLSAAYETLDKLGLIGKIPIIGLA---ERLEEIFFPKDPVPLILDKKSETLKVIQHLRDEAHRFGIGFHRDVRSKKQIQSELDNIKGIGKKTKEDLLRHFKSVKRIRSAEEEELSALIGRNKAK 591
>gi|86608727|ref|YP_477489.1| excinuclease ABC subunit C [Synechococcus sp. JA-2-3B'a(2-13)] >gi|119367851|sp|Q2JM21|UVRC_SYNJB UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|86557269|gb|ABD02226.1| excinuclease ABC, C subunit [Synechococcus sp. JA-2-3B'a(2-13)] (623 aa)
Score = 665, Expect = 2.3e-67, Identities = 168/584 (28%), Positives = 334/584 (57%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRI-LYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK--LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKN-DEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLI----YEYYSKIAI--------ELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNA-VEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDA----NSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAKEIKK 588
           ++ +LK+IP +PG YL +D    ++YVGK+  L +R++ YF    DL  + +++  ++C+++++V +NE+E+L LE+NLI  ++P YN+LL++   +PY+ +T  E +P++ +  H    + +  YYGP+ +  + ++ L   + RIFPLR+  K    ++ C+ YDIG+C G C   ++ ++Y   L ++   F G++  +  +L++K IQAAE+  +E + +Y +  + L+   E Q +         D +     ++   I +F+   G L+ +   +     +   ++L       Y+Y   + I        ELP   +L    E   +  +  K+  + P +  K ++++    NA +E+ + + L      +R+  +LE L ++LD+ D+  R+E +D S+I  ++ V + VV+ +G+  K  YR++ I++ +     + D+    EV  RR+   T    + P+L+++DGGK Q+ A +  L  L LD  +PVI LAK ++   +  +  +   ++L  +      L  ++DE HRFA++F+R ++      ++L +I  LGK R + L+E++ ++ +I+ AS ++L+Q+  I  ++A++I +
  S:    12 LESRLKEIPAEPGVYLMRDATDQILYVGKSKKLRSRVRSYFRFTSDLSPRIQRMVAQVCEIEFIVTDNESEALALEDNLIKTHQPPYNVLLKDDKKYPYLCITWSEPYPQLYITRHRRLDRNQDKYYGPYTDVGLLRHTL-GLVKRIFPLRQRPKPLYKDRTCLNYDIGRCPGVCQGLISPEEYRKTLTQVAMIFQGQTDELIRELQEKMIQAAEQENYEAAARYRDQIRGLEQLGESQKVSLPNSTVSRDALALAMNDSRACIQLFQVRAGKLVGRLGFVAENRGDDPGLILQRALQEHYQYCDPVEIPSEILTQYELPDHDFL----ESWLSQKKGRKVSLVAPQRQSKAELIELVERNAQLELTRTQRL-----ADRDAAALERLAEVLDLPDVPRRLEAYDISHIQGSDAVASQVVFIDGLPAKQHYRRYKIRNPEVRPGHSDDFASHAEVARRRFSKMTPE--DQPDLVLIDGGKGQLSAVMAVLADLGLDH-LPVIALAKREE---EIFLPGNPVPLRLPAQDPARLLLQRLRDEAHRFALAFHRQQRKARQHASTLDEIPGLGKYRQKLLMEEFRSIARIQVASEDQLAQVPGIGPKIARQIYR 606
>gi|21229392|ref|NP_635314.1| excinuclease ABC subunit C [Methanosarcina mazei Go1] >gi|30173452|sp|Q8PRZ8|UVRC_METMA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|20907983|gb|AAM32986.1| Excinuclease ABC, subunit C [Methanosarcina mazei Go1] (523 aa)
Score = 664, Expect = 2.5e-67, Identities = 178/531 (33%), Positives = 297/531 (55%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSE--SLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYR-MEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFE 539
           L+ +PH PGCYL+KD+ GIV+YVGKA DL  R+  YF K D D KT  L      +D++V N E E+ LLEN LI K+ P+YN++L++S  +  I +T E+ PRI  +  +T +  G ++GPF ++  + Y ++  + + F LR C K+P++ C+ Y IG C GPCI  V+ ++Y   +K+      G  + + E +E +  + A K MFE + +  +    L+   E+Q++   +K DEDI+ +  ++N + +++FK   G+L  K D +  F  +  E  L    +YYS+        V   L +  ++ L+     K+K   P +G KK+++D        ++KN  +    ++ +    LE LQ  L +  +   +E FD S++  T  VG+MV +  G  +K+ YR+F I+  +   D+  + EV+ RRY        E+P+LII+DGGK Q+ +A + L+ L +   +P+I +AK ++      +K     IK D+K+ L  F+  I+DE HRFAI++ R  + K+L +
  S:    10 LEALPHLPGCYLFKDEEGIVLYVGKAKDLKKRVSSYFQKRDHDPKTASLMQFARGLDFIVTNTEVEAFLLENTLIKKHWPRYNIMLKDSKRYACIHLTGEKFPRIRIARKNTGE--GEFFGPFVSARERDY-IFEVVRKTFQLRTCRKMPSRACLRYHIGACSGPCISSVSVEEYGEKVKKAISVLKGNIRELIESMETEMKEMAAKQMFEQAMELRDEIAALEYLQEKQNMERQKKYDEDILNYIVRDNNVYLMLFKVYKGTLEDKQDFVFAFGEDFLEEFLV---QYYSENDPPEELIVPEPLDESLVEFLAHVKGKKVKVAVPKQGDKKELLDL-------VLKNVEIGFFGDRKK----LEALQSKLSLPKIPNVIECFDISHLSGTATVGSMVQFRGGRPDKHNYRRFKIESVEGIDDFASIAEVVRRRYSRLLEDKHEMPDLIIIDGGKGQLSSAFQELRKLRVK--VPIISIAKREEEIYVPGLKSPLP-IKKDEKASL--FVQEIRDEAHRFAINYNRLLRQKALIQ 522
>gi|30248937|ref|NP_841007.1| uvrC nuclease subunit of the excinuclease complex [Nitrosomonas europaea ATCC 19718] >gi|81436207|sp|Q820N6|UVRC_NITEU UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|30138554|emb|CAD84844.1| uvrC Nuclease subunit of the excinuclease complex [Nitrosomonas europaea ATCC 19718] (604 aa)
Score = 664, Expect = 2.6e-67, Identities = 165/565 (29%), Positives = 298/565 (52%)
  Q:    12 IPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCK--ENVISIVIFKYVNGSLLSKYDLI--TVFYSELDEILLTLIYEYYSKIAIE----LPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHK---TDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQ 576
           +P +PG Y   +  G VIYVGKA+DL  R+  YF K     + + + ++I  ++  V  +E E+LLLENNLI    P+YN+L R+  ++PY+L+T+   PR+ +   +    +  Y+GPF N+ + K  +   + ++F LR C         + C+ Y I +C GPC+  +T + Y+  +K    F  GK   + + +E+K   A+++  +E + +  +  + L+   E+Q +   +  D D+I    +   + +++ +    +G  L         V+ +++  +L   + ++Y   ++     L + + ++L  +KL +     KI       G ++  +D A  NA   ++   +Q  S ++R    L+ LQ+ L++  L R+E FD S+      + + VVY+       EYR++NI       DY  M++V+ RRY       G++P+LI++DGGK Q++ A E +  L L+  IP++G+AK +  K      I+ W    + L         +  I+DE HRFAI  +R K++K+   ++L +I  +G  R + LL ++  L  +K AS+EEL Q
  S:    15 LPAQPGVYRMLNAAGDVIYVGKAIDLRKRVSSYFQKSGLSPRIQLMVSQIAGIETTVTRSEAEALLLENNLIKSLAPRYNILFRDDKSYPYLLLTRHIFPRLAFYRGALDD-RHQYFGPFPNAGVVKSSI-QLLQKVFRLRTCENSVFDHRTRPCLLYQIKRCSGPCVGLITPEAYQQDVKSAAMFLQGKQDEVLKTIEQKMFTASDQQDYEQAAQLRDQMQALRKIQEKQFVDSGKALDADVIACAIEPDSHAVAVNLVMIRSGRHLGDKTFFPQNVYEADISTVLEAFVTQHYLNRSVPPLIILGQKIRVTLL-QKLLSDQAGHKITLTTNPIGERRKWLDMAAENAQLALQQMLIQQASQEDR----LQALQEALNLPGLARIECFDISHTMGEATIASCVVYDRFAMRNGEYRRYNITGIVPGDDYAAMRDVLQRRYAKLAMEEGKLPDLILIDGGKGQIRVASEVMIELGLND-IPLVGVAKGETRKPGLEQLILPWQEEALHLPDDHPALHLIQQIRDEAHRFAIQGHRAKRAKTRKISTLEQISGIGTKRRQSLLTRFGGLKGVKNASIEELQQ 587
>gi|114565821|ref|YP_752975.1| excinuclease ABC, C subunit [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|119367856|sp|Q0B0A0|UVRC_SYNWW UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|114336756|gb|ABI67604.1| Excinuclease ABC subunit C [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (601 aa)
Score = 664, Expect = 2.7e-67, Identities = 180/576 (31%), Positives = 325/576 (56%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK--CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLK------IKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +E +K++LKK+P +PG YL+K++ G V+YVGKA  L  R++ YF     +  K K +   + D D++V ++E E+L+LENNLI  YKP+YN+ LR+  ++PYI VT  ++ PR+  + +    +   Y+GP+ +    +  L   +N +F LR C  + +++  C+  D+G+CL PC  +++ ++Y   ++ +  F  G  + I  + EK+   AA  L FE + +  +  ++L+   E+Q I  +   + D++G    E    +++FK  +G ++ K  + L      + +E +   I  YY +   ++P  + LS    + K +   LK      ++   P +G KK V++    NA  +++ K  +    +N++L +L  L ++LD++ +  R+E FD S++     V +MVV+  G   K  YR F I+ +  N+D   + E + RR +N      +F   P+LI+VDGG  QV A    L+ + LD  IP+  LA+    K + I +   S+ + L  + +    L  ++DE HRFAI + R +++K +  ++L +I  +GK R + LL  + ++ KIKEAS++E++ +
  S:     3 DEMLKERLKKVPLQPGVYLFKNQEGQVLYVGKARVLRQRMRSYFQAPERMHPKVKAMMAWVSDFDFIVTHSEMEALILENNLIKSYKPRYNIDLRDDKSYPYIKVTVADKFPRVYLAREKKDGVS-RYFGPYTDVTSLRDTL-KLLNGVFGLRSCRTMKSRRRPCLNRDMGKCLSPCSGEISEEEYSQKVQALITFLEGDFQEIVREKEKEMAMAARSLEFEKAARLRDQIQSLRQLGEKQKIELASPYELDLVGMLSGEKENLVLVFKVRSGKIVGKDTFWLKRPIQEDENEAMEFFIKHYYDENP-DIPPEILLSHLPSESKLVEAWLKSRVSHRVELRVPQRGEKKQVLNMLLENARLLLEEKQRE----ENKQLAALSHLARVLDLEVVPNRLECFDVSHLAGEETVASMVVFVGGQPEKKAYRHFKIRTQQ-NNDTASLAETVRRRLENARQANPAFLPEPDLILVDGGLGQVNAVAAVLQEMNLD--IPLFALAE----KNEEIYRPGKSQPLVLAARDNGLQLLQRLRDEAHRFAIEYNRKRRAKKIRSSALDEIPGIGKQRKKNLLVHFTSVAKIKEASLDEIAAV 582
>gi|34541586|ref|NP_906065.1| excinuclease ABC, C subunit [Porphyromonas gingivalis W83] >gi|81416896|sp|Q7MTG8|UVRC_PORGI UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|34397903|gb|AAQ66964.1| excinuclease ABC, C subunit [Porphyromonas gingivalis W83] (599 aa)
Score = 663, Expect = 3.2e-67, Identities = 186/576 (32%), Positives = 313/576 (54%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN-KLPNKK--------CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVY-LSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVE--IMKNKYLQLISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAK 584
           L  +P KPGCY + D++G VIYVGKA +L  R+  YF K+  D KT+ L  +I  + Y+VV++E ++LLLEN+LI +Y+P+YN+LL++   +P I++ +E  PRI  + D  KK    Y+GP+  + I K  +   +  I+P+R C   L  +K        C+ Y I +C GPCI   T  +YE  + EI D   G    +      +    +E L FE++Q   E  + L+ +  +  ++    ++ D+  +   E+   I      +G +   Y L   +  +++E    L+    +++        + + L  +      ES+      P +G K+ +++ +  N  +  + K K  + ++ + R L+ +  +QK L + +    +E FDNSNI  T+ V A VV++ G  +K +YRKF++K  +  +D+  M+E+I R Y   T     +P+LI+VDGGK Q+ AA E+L  L L   IP+IGLA   +   +     D   + LDKKS+    + +++DE HRF I F+R+ +SK   ++ L  IK +GK   E LL  ++++ +I+ A  EELS ++    AK
  S:    10 LPTLPEKPGCYQYFDEDGKVIYVGKAKNLRRRVSSYFYKEHADRKTRILVRQIRSIKYIVVDSEGDALLLENSLIKEYQPRYNVLLKDGKTYPSIVIKREPFPRIFATRD-IKKDGSEYFGPYPGALIAK-GMLRLVKEIYPIRTCKLDLREEKIRQGRYRVCLQYHIKKCKGPCIGNQTSNEYESNVSEIRDLLRGNLHRLVRMYRDRMQVYSEGLRFEEAQICKERIELLERYEAKHTVVPRNIDNVDVFSYDEDEHTAYINYMHIEHGGINRVYTL--EYRKQIEESKEELLAAAITELRQRFESNAHEIVLPFDTGWQTGESITTTI--PRRGDKRKLLELSEKNVAQYKLDKLKRAEKLNPEQRALHIVHGIQKDLHLDRPPKHIECFDNSNIQGTSPVAACVVFKMGKPSKKDYRKFHVKTVEGPNDFASMREIISRHYTRLTEENLPLPDLIVVDGGKGQLSAAYETLDKLGLIGKIPIIGLA---ERLEEIFFPKDPVPLILDKKSETLKVIQHLRDEAHRFGIGFHRDVRSKKQIQSELDNIKGIGKKTKEDLLRHFKSVKRIRSAEEEELSALIGRNKAK 590
>gi|85059149|ref|YP_454851.1| excinuclease ABC subunit C [Sodalis glossinidius str. 'morsitans'] >gi|119367840|sp|Q2NTS9|UVRC_SODGM UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|84779669|dbj|BAE74446.1| excinuclease ABC subunit C [Sodalis glossinidius str. 'morsitans'] (610 aa)
Score = 663, Expect = 3.7e-67, Identities = 182/578 (31%), Positives = 310/578 (53%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKK-VTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYYSKIAI--ELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQV---KAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           K  L  +  +PG Y   D +G VIYVGKA DL  R+  YF       KT+ L   I  +D  + + E E+LLLE+N I  Y+P+YN+LLR+  ++P+I ++ + HPRI  SH   K  KG Y+GPF N    K E    + ++FP+R+C     +  ++ C+ Y IG+CLGPC+   V+ ++Y+  ++ +  F SGK + +  QL ++   A+  L FED+    +  + ++  +E+Q  +   + D D+IG      +  + +     G +L   S +  + V  +EL E++ T + ++Y + +    LP  + L  +  +   L+ SL      KI+     +G +   +  A  NA   +  K    +S Q+     L  L +LL I+ + RME FD S+    + + + V+++     + EYR++NI+      DY  M +V+ RRY        +IP+++I+DGGK Q+   KA  E L+     S + ++G+AK  D K   + +      E + L   S     + +I+D+ H  AI+ +RNK++K    ++L  I+ +G  R + LL+    L  ++ ASVEE++Q+  I  A
  S:     8 KQFLSTVTSQPGVYSMYDLSGTVIYVGKAKDLKKRLASYFRAQVASRKTEALVKSIHHIDVTITHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSGDAHPRIT-SHRGAKHAKGDYFGPFPNGYAVK-ETLALLQKLFPIRQCEDSVYRNRSRPCLQYQIGRCLGPCVAGLVSDEEYQQQVEYVRLFLSGKDQQVLNQLVERMELASRALNFEDAAHARDQIQAVRRVTEKQ-FVSGDREDLDVIGVSFDAGMACVHVLFIRQGKVLGSRSYFPKVPV-GTELAEVVQTFVGQFYLQGSQMRSLPGEILLDFTLPEKTLLAASLSEQAGRKIQIQTQPRGDRARYLKLARTNAATALVTK----LSQQSTVHQRLAALAELLGIQAINRMECFDISHTMGEHTIASCVIFDGNGSVRAEYRRYNIEGITPGDDYAAMDQVLRRRYGKALEE-KKIPDVVIIDGGKGQLGMAKAVFEQLEVPWDKSRVVLLGVAKGVDRKAGLETLFLQPHGEGMALPPDSPALHVIQHIRDDSHNHAITGHRNKRAKVKNTSALELIEGVGPRRRQSLLKYMGGLQPLRNASVEEIAQVPGISGA 599
>gi|134300888|ref|YP_001114384.1| excinuclease ABC subunit C [Desulfotomaculum reducens MI-1] >gi|134053588|gb|ABO51559.1| Excinuclease ABC subunit C [Desulfotomaculum reducens MI-1] (588 aa)
Score = 663, Expect = 3.9e-67, Identities = 189/547 (34%), Positives = 308/547 (56%)
  Q:    31 VGKAVDLANRIKQYFLK--DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLP----NKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNL---KMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKD-LYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN---------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELD-SIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +GKAV L NR++ YF     +  K K +     D+D++V ++E E+L+LENNLI +++PKYN+LL++   +PYI VT +EE PR+ Y      K +  Y+GPF N      E    + +IFPLR C +      ++ C+ Y I +CLGPC   V RQ Y   + E+  F  G+ + + ++L ++  +AAEKL FE   K  ELR  L   +   ERQ ++ +   D+D+I      +   + +F    G L+ +  Y L      E  EI+ T I ++Y++    +P  V +S    K + L   L      K+    P +G K  +++ A  NA+  ++   LQ  +N+     +L EL   L +++  +RME +D SNI  T  V +MVV+E G   K++YR+F I+  +  +D+  M E + RR+                   A F  +P+LII+DGGK Q+ AA +++  LE   + I   GLAK+++             I+L ++S     L  ++DE HRFA++++R  ++K   ++ L +I  +G  R  +L + Y+ L+ IK+ASVEEL++I
  S:     1 MGKAVSLKNRVRSYFQAGAKQAPKVKAMLGRAVDLDFIVTDSEMEALILENNLIKEHRPKYNILLKDDKTYPYIKVTVQEEFPRV-YLTRRVLKDRARYFGPFTNVGAVN-ETMRLLKKIFPLRTCKQRKLSPRDRPCLNYHIKRCLGPCCNLVERQTYRETVNEVVLFLEGRQEDLMKRLRQRMEEAAEKLEFE---KAAELRDQLLAVEKIVERQKVVSTDLVDQDVIAMARGFDESCLTVFFIRGGKLIGREHYFLEGTDTLERGEIMTTFIQQFYNQTEF-IPAEVLISEEIAKPELLRSWLSELRGSKVTIKAPKRGDKHKLVEMAAQNALLSLEQAKLQRQANREAVDGALAELMAALGLENPPHRMECYDISNIQGTETVSSMVVFEEGRPKKDQYRRFKIRWVEGPNDFASMHETLTRRFSRAKEEQDLLSRGELTPKQAKFTRLPDLIIIDGGKGQLSAARQAM--LEQGFAHIATFGLAKEEEL---LFAPGRPDPIRLPRESKGLQMLQRLRDEAHRFAVTYHRKLRTKRNLKSLLDEIDGIGAVRRRELYKAYKNLESIKQASVEELAKI 571
>gi|170076867|ref|YP_001733505.1| excinuclease ABC, C subunit [Synechococcus sp. PCC 7002] >gi|169884536|gb|ACA98249.1| excinuclease ABC, C subunit [Synechococcus sp. PCC 7002] (623 aa)
Score = 662, Expect = 4.7e-67, Identities = 175/584 (29%), Positives = 326/584 (55%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR--DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGT-YYGPFANSNIKKYELYNFINRIFPLRKCNK--LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIF-SQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYS--------ELDEILLTLIYEYYSKI-AIELPKTVYLS--LSD----EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNA-VEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDA----NSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAKEI 586
           E+++ +L++IP +PG Y    + G ++Y+GK+  L NR++ YF   R    + + +  ++ D++++V + E E+L LE NLI +++P YN+LL++   +PY+ +T  E++PR   +       KG  YYGP+ ++ + ++ L   + RIFPLR+  +    ++ C+ YDIG+C G C + ++ Q+Y   ++++   F G+S  + E L  +  QAAE L FE + +  +  K +   +  Q +     +   D I     E+  +I +F+   G L+ +    T            E  +IL  ++  +Y+ +  +E+P  + +   L D    EK        K++   P + +K D++     NA  E+ + +         + L +LE+L  LLD+ +L  R+E +D S+I  +N V + VV+ +G+  K +YR + IK+ +     + D+  M E++ RR+K       + P+LI++DGGK Q+   +  L+ L L   + VI LAK  +      + ++ + +K +K+      L  ++DE HRFA+SF+R ++ KS   + L  I  LG  R ++LL  + +LD ++EA  E+++++  I   +A+EI
  S:    14 ERLQQRLREIPTEPGVYFMHSRQGDILYIGKSKTLRNRVRSYFRDARLHSPRIEMMVQQVADIEFIVTDTEAEALALEANLIKQHQPYYNVLLKDDKKYPYVCITWSEDYPRFFITRKRHIGSKGDRYYGPYVDTRLLRHTL-GLMKRIFPLRQRRQPLFKHRPCLNYDIGRCPGVCQQLISPQEYRQTVQKVAMVFQGRSGELIETLTAQMAQAAENLQFEKAAQIRDQIKAIGALNADQKVSLPDDRVSRDAIALAADEHHCAIQLFQVRAGRLVGRLGFFTPLPENLGPDLTVEYGKILQHVLETHYANVDGVEIPAEILVQYPLRDQEWLEKFLGDRRGNKVQIRQPQRQLKADLIAMVERNAQYELSRTQ-----RTATKNLAALEDLASLLDLPELPKRIEGYDISHIQGSNAVASQVVFIDGIPAKQDYRHYKIKNPEIHIGRSDDFASMAEIMRRRFKKGLEK--DCPDLIMIDGGKGQLSTVMGVLEELNLADKLNVISLAKKQEQV---YLPYESNPLKSEKEQPGIQLLRRVRDEAHRFAVSFHRQQRLKSSRRSQLDDIPGLGHHRKKQLLAHFHSLDYLREAKPEQIAEVKGIGSHLAQEI 616
>gi|88801846|ref|ZP_01117374.1| excinuclease ABC, C subunit [Polaribacter irgensii 23-P] >gi|88782504|gb|EAR13681.1| excinuclease ABC, C subunit [Polaribacter irgensii 23-P] (598 aa)
Score = 662, Expect = 4.7e-67, Identities = 192/574 (33%), Positives = 313/574 (54%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN---------KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDL-ITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNA--VEIMKNKYLQLISNQNRELNSLEELQKLLDIK-DLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEEL 574
           M   ++ ++K +P++PG Y + DKN ++IY+GKA +L  R+  YF K  +  KTK L  +I  + ++VV  E ++LLLENNLI K+KP+YN+LL++   +P+I + KE  PRI  +    K     Y+GPF +    +  L + I  ++PLR CN         +  +K C+ Y +  C G C    T   Y   +KEI +   G  K   ++ ++     AEK+ FE++QK  E    L  +  +  II    N+ D+      E        K  NG+++  +   I    +E D+ LL L      +    +   +Y     +    + ESLK+    P  G KK +++ +  NA   ++ + K +Q++         + +++K L +  +   +E FDNSNI  T+ V A VV+++G  +K EYR +NIK      D+  M+EV++RRYK        +P LIIVDGGK Q+ + L+SL+ L L   I +IG+AK  ++ +  D     D   + LDKKS+       +++E HRF I+F+RNK+SK+  ++ L +I N+G   I  LL K+++  ++KEAS+E+L
  S:     1 MTPSLELQIKTLPNEPGVYQYFDKNEVIIYIGKAKNLKKRVGSYFSKTHENGKTKVLVTKIVSIKHIVVETETDALLLENNLIKKHKPRYNILLKDDKTYPWICIKKERFPRIFMTRRVIKD-GSEYFGPFTSIKTVRV-LLDLIKELYPLRTCNFDLSYQNVSEGKHKVCLEYHLKNCKGACEGLETESHYNNSIKEIRNIIKGNFKESLDKFQEMMFLFAEKMEFEEAQKIKEKLNLLGNYQSKSTIINPAINNVDVFSIISDETHGYANFLKISNGAIIQSHTTEIKKKLAETDKELLELFIVEVRQRFNSISPEIYTPFKVD----VGESLKVTV--PILGDKKRIVELSERNAKYYKLEQLKQVQIVDPDRHVKRIMAQMKKDLRLTVEPRHIECFDNSNIQGTHPVAACVVFKDGKPSKKEYRHYNIKTVVGPDDFGSMEEVVFRRYKRLLEEKQPLPQLIIVDGGKGQLSSGLKSLELLGLRGKIAIIGIAKRLEEIYYPD-----DPIPLYLDKKSETLKITQYLRNEAHRFGITFHRNKRSKTAVKSELEEIPNVGVQTITTLLRKFKSAKRVKEASLEDL 577
>gi|86357117|ref|YP_469009.1| excinuclease ABC subunit C [Rhizobium etli CFN 42] >gi|119367821|sp|Q2KA54|UVRC_RHIEC UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|86281219|gb|ABC90282.1| excinuclease ABC subunit C protein [Rhizobium etli CFN 42] (679 aa)
Score = 662, Expect = 5.0e-67, Identities = 184/584 (31%), Positives = 307/584 (52%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL-KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD------EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYKN-------------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE--VAKEI 586
           E I + +K++P+ PG Y   +  G V+YVGKA  L  R+  Y + +    +  ++  +  ++++V    E E+LLLE NLI + +P++N+LLR+  +FPYIL+T +     ++ H   +  KG Y+GPFA++      + N + R F +R C     +   + C+ Y I +C GPC  +V+ + Y   ++E  DF SGKS+ +   + +   QAAE L FE +  Y +    L      Q I  +  ++ D+   + +  V  I +F +  G           ++ + D      E+L   + ++Y    +  PK + LS + E+L+ L+ +L      K+  L P +G K+D++D    NA E    K L   ++Q+R L   +E   L       R+EI+DNS+I  TN VG MVV       KN+YRKFNIK  D     D+  MKEV+ RR+                         F   P++I++DGG+ Q+ A    L  L +   +  IG+AK  D     +R          L  +  + +F+  ++DE HRFAI  +R ++ K + +N L +I  +G +R   LL+ + T   +  A++ +L  +  I   VAK++
  S:    54 ELIGEFVKRLPNSPGVYRMLNAEGDVLYVGKARSLKKRVGNYAVGRVHSNRIAQMVRQTANMEFVTTRTETEALLLEANLIKRLRPRFNVLLRDDKSFPYILITGDHRAPAIFKHRGARARKGDYFGPFASAGAVGRTI-NSLQRAFLIRTCTDSVFETRTRPCLLYQIKRCSGPCTHEVSDEGYAELVQEAKDFLSGKSQKVKSHMAEAMNQAAEDLDFERAAIYRDRLAALSHVQSHQGINPAGVDEADVFAIHHEGGVSCIQVFFFRTGQNWGN----RAYFPKADPQLSSAEVLNAFLAQFYDDKPV--PKQIMLSETAEELELLAAALSEKAGHKVSILVPRRGEKRDLVDHVVGNAREAHGRK-LAETASQSRLLEGFKETFGLAYAPQ--RIEIYDNSHIMGTNAVGGMVVAGPEGFVKNQYRKFNIKSTDITPGDDFGMMKEVMTRRFSRLIKEEGIPDRTAQAAAADAADMPFPAWPDVILIDGGQGQMTAVRAILAELGITDSVTAIGIAKGVDRDAGRERFFAPGRESFTLPPRDPVLYFIQRMRDEAHRFAIGSHRVRRKKEMVKNPLDEIGGIGPSRKRALLQHFGTAKAVSRAALSDLMAVEGISEAVAKQV 669
>gi|34496760|ref|NP_900975.1| excinuclease ABC subunit C [Chromobacterium violaceum ATCC 12472] >gi|81656372|sp|Q7NYG9|UVRC_CHRVO UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|34102615|gb|AAQ58980.1| excinuclease ABC subunit C [Chromobacterium violaceum ATCC 12472] (601 aa)
Score = 661, Expect = 5.8e-67, Identities = 164/572 (28%), Positives = 294/572 (51%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQ-KNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD---EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL--KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHK---TDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           ++ L+ +P  PG Y   D  G V+YVGKA+DL  R+  YF K D   + + +  +I  ++  V  +E E+L+LENNLI    P+YN+L R+  ++PY++ +    P++ Y     KK    Y+GP+ N    + E    + ++F LR C        ++ C+ Y I +C GPC+  +++++Y   +     F +G+   +  +L ++   AAE + FE + +  +  + L    E+Q +  +Q + D D++    ++ V  + +     G  L       +   E D   EIL   I ++Y    +     V   + D   + L E    K+  +    G ++  ++ A  NA    +   LQ + ++  +   L +L ++L+++D  R E FD S+      V + VVY+ G     EYR+FNI       DY  M+EV+ RRY       G +P+ + +DGGK QV  ALE L  L L+  +P++G+AK ++ K      I+ +    ++L +       +  ++DE HRFAI+ +R +++K+   ++L  I  +G  R ++LL ++  L  +  ASV++L+Q+
  S:     9 RNVLQNLPTLPGVYRMLDAAGKVLYVGKAIDLKRRVSSYFQKNDLSPRIQLMVRQIASIETTVTRSEAEALILENNLIKALAPRYNILFRDDKSYPYLMFSGHAFPQMAYYRGEPKK-PNQYFGPYPNGYAVR-ESIQILQKVFRLRTCEDAVFANRSRPCLLYQIKRCSGPCVDHISKEEYAADVASAVAFLNGRQSELINELTRRMTAAAEAMAFEQAAELRDQIQALARVQEKQFVASNQSQQDCDVVAARVRDGVPCVNLVMIRGGRHLGDKSHFPI-GGEADTEQEILEAFIGQHYQHAGVPAALVVNGVVDDALQQFLQERAGRKVYIVGNPIGERRVWLEMAEKNA----ELAILQRLGSKATQAQRLAQLNEVLELEDAGRFECFDISHTMGEATVASCVVYDKGAMQPTEYRRFNITTAAPGDDYAAMREVLSRRYGKLAEGEGRLPDAVFIDGGKGQVGVALEVLGELGLN--LPIVGIAKGEERKPGLETLILPYLEKTLQLRQDHPALHLIQTVRDEAHRFAITGHRARRAKARTSSTLEDIPGIGAKRRQQLLTRFGGLRGVATASVDDLAQV 585
>gi|148557385|ref|YP_001264967.1| excinuclease ABC subunit C [Sphingomonas wittichii RW1] >gi|148502575|gb|ABQ70829.1| Excinuclease ABC subunit C [Sphingomonas wittichii RW1] (642 aa)
Score = 660, Expect = 7.0e-67, Identities = 179/572 (31%), Positives = 303/572 (52%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEH--PRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSEL--DEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDA--NSDYDYMKEVIYRRY-----KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQ 576
           I++ LK +P +PG Y  +D  G V+YVGKA  L NR+  Y    R   +  ++  +   +  V  N+E E+LLLE  LI +Y+P YN+LLR+  +FP+IL+ +E+H  PRI   H   ++ KG Y+GPFA++      L N + ++F LR C        ++ C+ Y I +C  PC+ ++   DY   + +   F +GKS  + ++L +    AAE + +E +  Y +  + L      Q I      D D+    CK   + I  F    G             +++   E+L + + ++Y ++    P+ V +     + + L+++L      K++   P +G ++ +M+ A  NA E + ++ L   + Q R    + +L +L    D  R+E++DNS+I  TN VGAM+V       K  YRKFNIK  +     D+  M+EV+ RR+     ++     GE P+L+++DGGK Q+ A  E L+ + +   +PV+G++K  D     +        E  L   S L F L  ++DE HRFAI  +R K++ S  ++ L  +  +G  R + LL  + T   ++ AS+E+L +
  S:    36 IRNVLKTLPARPGVYRMQDARGDVLYVGKARALKNRVANYTQVARLPKRLSRMVAQTRSMTIVTTNSEAEALLLEAQLIKRYRPPYNVLLRDDKSFPFILL-REDHAFPRI-QKHRGARRAKGQYFGPFASAGSVTRTL-NALQKLFLLRSCTDSFFANRDRPCLLYQIKRCSAPCVGRIDEADYAELVDDSKAFLAGKSTQVQKKLGEAMSAAAEAMDYELAAVYRDRLRALTFIQGSQAINAEGVADADVFALDCKAGTVCIQAFFIRGGQNWGHRAFFPAHTADVPEPEVLASFLMQFYEEVPP--PRLVLVGGEPAEAELLAQALGERAGRKVQIKVPQRGEQRKLMEQARRNAREAL-DRRLAESTTQGRIFQEMADLFELEGPPD--RIEVYDNSHIMGTNMVGAMIVAGPEGFRKGSYRKFNIKRPETAPGDDFAMMREVLERRFARLEKEDPERRSGEWPDLLLIDGGKGQLGAVCEVLEEMGVQD-VPVVGISKGPDRNAGREHFHLPGGREAMLPPNSPLLFHLQRLRDEAHRFAIGAHRTKRAASFTKSPLDDVPGIGPARKKALLMHFGTARAVRAASLEDLER 622
>gi|119471718|ref|ZP_01614078.1| excinuclease ABC subunit C [Alteromonadales bacterium TW-7] >gi|119445341|gb|EAW26629.1| excinuclease ABC subunit C [Alteromonadales bacterium TW-7] (607 aa)
Score = 660, Expect = 7.4e-67, Identities = 181/569 (31%), Positives = 298/569 (52%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAI--ELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHK---TDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           LK +  +PG Y   D +  VIYVGKA  L  R+  YF  +  D KT+ L + I D++  + N E E+LLLENNLI KY+P+YN+LLR+  ++PYIL+T  +HPR+ + H  ++KIKG Y+GPF ++      L   + +IFP+R+C     +  ++ C+ Y + +C  PC+ KVT QDY   +  +  F +GKS  +  +L KK   A+ +L FE + K  +    L+   E+Q I      + D++GF     +  I +    +  +L    Y       S   EIL + + +YY        + K + L    E+   LSE+L      K+     ++G +   +  A  NA+  +  K     S Q+       +L+  L + D+ RME FD S+    N V + VV+++   N  EYR++N+       DY  M+  + +RY N      +IP++I +DGGK Q+  A +         +  ++G+AK    K      +V      I +D  +     + +I+DE HRFAI+ +RNK+ K   ++ L +I  +G  R + LL+    +  +K A++E+L ++
  S:    10 LKTLSSEPGVYRMLDSDNQVIYVGKAKQLKKRVSSYFRSNITDSKTRVLVSNINDIEVTLTNTETEALLLENNLIKKYQPRYNILLRDDKSYPYILLTNHKHPRLAF-HRGSRKIKGEYFGPFPSAGAVSESL-RLMQKIFPVRQCEDAYYRARSRPCLQYQLKRCSAPCVNKVTEQDYSEQVDYVRKFLTGKSDEVIAELIKKMEAASAELNFELAAKVRDQIMLLRKMQEQQSIS-GNFAEMDVVGFAHLNGLNGIHLLMIRDHKVLGSKTYFPKVPKDSSEQEILTSFLGQYYLAPGATGRIAKEIILPFEIEESSALSEALTQISDRKVALKVVTRGERAQYLQLANKNALNSIAVKQ----STQDSINKRYAQLKATLRLDDIARMECFDISHTMGENTVASCVVFDSQGPNTKEYRRYNVTGITGGDDYAAMEFALNKRY-NKLVDEDKIPDVIFIDGGKGQLGRAEQYFSNWSHSKMPLLVGVAKGTSRKPGLETLLVDGGRKTIPMDSDAPALHLIQHIRDESHRFAIAGHRNKRQKQRTQSLLEEINGVGSKRRQTLLKYLGGMQGVKAANIEQLKKV 588
>gi|83319764|ref|YP_424239.1| excinuclease ABC, C subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|119367673|sp|Q2SSM4|UVRC_MYCCT UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|83283650|gb|ABC01582.1| excinuclease ABC, C subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] (584 aa)
Score = 659, Expect = 9.6e-67, Identities = 202/574 (35%), Positives = 315/574 (54%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSE-LDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDV-MDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIV 578
           +K+++  + +KPGCYL+ +K+  VIYVGKA +L  R+  YF K  ++KT +L  EI  + Y +V+NE ESLLLE NLI KY+PKYN+LL +   +PYI++T ++ P   Y     KK    Y      SN +   L   + R+FPLR C     K C+YY + QC G C K V    YE  +K+++ FF G+   + + L K+  +A++ L FE +++  +   +L   + +Q++      + D++ +   E  I  V+  Y  G L  K + I  +  + LDE+L + + + Y K    L   V L + +E      +   ++F + S   + D+ +  A  NAV+ +    L    N   EL  L++LQ++ +I K   R+EIFD SNI+N    GA +VY N    +NE+RK+NI D    SDY  MK ++ +R+        ++P+LIIVDGG  Q+ AA E L  L L   I VIGL+KD+ HKT  ++      I +     LY FL ++Q  V  +A S +R KK  +   + +  IK +GK    KL + ++T+D IK AS +EL++I+
  S:     3 LKEQVDLLTNKPGCYLFLNKDNEVIYVGKAKNLKKRVSTYFNKAYNIKTTRLIREITHLKYFIVDNEKESLLLEKNLIKKYRPKYNVLLNDDKTYPYIIITNQKDPMYKYVRKYEKKALRNYGPLPIGSNARSILLT--LQRLFPLRMCKGDLKKPCLYYHLNQCSGACFKTVDSSYYEYQIKQVDKFFKGEINQVKQTLVKQMQKASDNLQFEQAKRIKDQITSLDFITAKQNVDIVTNKNIDVVNYEINEEKICFVMLFYRLGQLTYKDEYIQNYEGQDLDELLNSYLQQIYQK---NLYPDVLL-IPNEIDLLDLDENLLEFSSYSFNNQDDIFIKLAKQNAVDSLNKSILSNNVNSGDELEILDQLQQISNINKYPKRIEIFDISNIYNQFITGACIVYINAKPVRNEFRKYNI-DSQYTSDYARMKFMLEKRFLKRIKEKEQLPDLIIVDGGIIQIHAAKEVLNKLNLK--INVIGLSKDNNHKTRYLIDIFEQTIDIKNFKKLYNFLTSLQIRVDEYAKSGFR-KKYHNQLNDQILLIKGVGKKTNLKLYKHFKTIDNIKNASFDELNKII 569
>gi|86604931|ref|YP_473694.1| excinuclease ABC subunit C [Synechococcus sp. JA-3-3Ab] >gi|119367850|sp|Q2JXP8|UVRC_SYNJA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|86553473|gb|ABC98431.1| excinuclease ABC, C subunit [Synechococcus sp. JA-3-3Ab] (621 aa)
Score = 659, Expect = 9.7e-67, Identities = 173/586 (29%), Positives = 331/586 (56%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRI-LYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK--LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKN-DEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLI----YEYYSKIAI--------ELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNA-VEIMKNKYLQLISNQNRELNSLEELQKLLDIKD-LYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDA----NSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVK-WDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAKEIKK 588
           E ++ +LK+IP +PG YL +D    ++YVGK+  L +R++ YF    DL  + +++  ++C+++++V +NE+E+L LE+NLI  Y+P YN+LL+E   +PY+ +T  E +P+I +  H    + +  YYGP+ +  + +Y L   + RIFPLR+  K    ++ C+ YDIG+C G C   ++ + Y   + ++   F G++  +  +L++K  QAA++  +E + +Y +  + L+   + Q +         D I     ++   I +F+   G L+ +   +     +   ++L  +    Y+Y   + I        ELP   +L    E   +  +  K+  L P +  K ++++    NA +E+ +++ L       RE  +LE L ++LD+ +   R+E +D S+I  ++ VG+ VV+ +G+  K  YR++ I++       + D+    EV  RR+   T+   + P+L+++DGGK Q+ A +  L  L LD  +PV  LAK    + + I +  D   ++L  +      L  ++DE HRFA++++R ++      + L +I  LGK R + L+E + +L +I+ A+ E+L+Q+  I  ++A++I +
  S:    10 EVLESRLKEIPAEPGVYLMRDATDQILYVGKSKKLRSRVRSYFRFTGDLSPRIQRMVVQVCEIEFIVTDNESEALALEDNLIKTYQPPYNVLLKEDKKYPYLCITWSEPYPQIYITRHRRLNQNQDKYYGPYTDVGLLRYTL-GLVKRIFPLRQRPKPLYKDRPCLNYDIGRCPGVCQGLISPEAYRKTVAQVAMIFQGQTDELIRELKEKMAQAAQQENYEAAARYRDQIRGLEQLGQSQKVSLPNSTASRDAIALAMNDSRACIQLFQVRAGKLVGRLGFVAENRGDDPALILQRVLQEHYQYCDPVEIPSEILTQYELPDRDFL----ESWLSQKKGRKVSLLAPQRQSKAELIELVERNAQLELARSQRL-----AEREAAALERLAEVLDLPEPPRRLEAYDISHIQGSDAVGSQVVFIDGLPAKQHYRRYKIRNPQVRPGHSDDFASHAEVARRRFSKMTSE--DQPDLVLIDGGKGQLAAVMAVLAELGLDH-LPVFALAK----REEEIFRPGDPEPLRLPPQDPARLLLQRLRDEAHRFALAYHRQQRKLRQQASVLEEIPGLGKQRQKLLMEAFRSLARIQVATEEQLAQVPGIGPKLARQIYR 606
>gi|89070175|ref|ZP_01157503.1| excinuclease ABC subunit C [Oceanicola granulosus HTCC2516] >gi|89044191|gb|EAR50342.1| excinuclease ABC subunit C [Oceanicola granulosus HTCC2516] (617 aa)
Score = 659, Expect = 1.0e-66, Identities = 176/573 (30%), Positives = 299/573 (52%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD--RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK-----NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLA--------KDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           I+  LK +   PG Y   D    V+YVGKA +L  R+  Y         +  ++  E   + ++    E E+LLLE NLI + KPK+N+LLR+  +FP ILV++E     +  H   KK KG+YYGPFA++      L N + ++F LR C+    +   + C+ Y I +C  PC+  + +  YE  + +   F SGK+ S+  QL ++  +A+E + FE +    +  + L      Q I     ++ D+I  +       + +F   +      +D       E D  EI+   + ++Y+    E P+ + LS   ++   ++++L      K++   P +G K +++ +A  NA E +  K +   + Q R L  L +  +L  +    R+E++DNS+I     VGAM+V       KN+YRKFNI+ ++     D+  MKEV+ RR+K     +     G  P+L+++DGG  QV A    +  L ++  IP+IG+A        K++ H+T R VK       L     + +F+  ++DE HRFAI  +R K++K++  N L  I  +G TR   LL  + +   +  A++ +L  +
  S:    10 IRAYLKTLDSSPGVYRMLDDQSRVLYVGKARNLKARVSNYSRPSPQHSARIARMIRETASMMFLTTRTETEALLLEQNLIKQLKPKFNVLLRDDKSFPNILVSREHDFPQIKKHRGAKKEKGSYYGPFASAGAVNRTL-NQLQKVFLLRNCSDSTFETRTRPCLLYQIKRCSAPCVGYIDKAGYEALVGDAQRFLSGKTTSVQNQLAQQMQEASEAMEFERAAALRDRIRALTQVQSSQGINPQTTSEADVIALHVDGGQACVQVFFIRSNQNWGNHDYYPRISGEEDPAEIIEAFVGQFYAN--REPPRLLLLSHGLDEPDLMAQALCEQRGGKVEISVPQRGEKAELVGSALRNARESLGRK-MSETATQGRLLKGLADAFELPAVPQ--RIEVYDNSHIQGAYAVGAMIVAGPEGLEKNQYRKFNIRGDELTPGDDFGMMKEVLTRRFKRLLKEDPDRQSGTWPDLLLIDGGAGQVSAVHAIMAELGVED-IPMIGVAKGVDRDLGKEEFHRTGRTVK------ALRHNDPVLYFVQRLRDEAHRFAIGTHRAKRAKAVSANPLDDIAGVGATRKRALLAHFGSAKAVGRAALADLKAV 598
>gi|71082792|ref|YP_265511.1| excinuclease ABC subunit C [Candidatus Pelagibacter ubique HTCC1062] >gi|91762785|ref|ZP_01264750.1| excinuclease ABC subunit C [Candidatus Pelagibacter ubique HTCC1002] >gi|90110993|sp|Q4FPI1|UVRC_PELUB UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|71061905|gb|AAZ20908.1| excinuclease ABC chain C [Candidatus Pelagibacter ubique HTCC1062] >gi|91718587|gb|EAS85237.1| excinuclease ABC subunit C [Candidatus Pelagibacter ubique HTCC1002] (611 aa)
Score = 659, Expect = 1.1e-66, Identities = 191/582 (32%), Positives = 318/582 (54%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL-KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYV------NGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLK------IKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKD-LYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDE-DANSDYDYMKEVIYRRYKNNTASFGE---IPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDD-KHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIE--VAKEI 586
           I+ +L  IP  PG Y   D   +++YVGKA +L NR+K Y   K+  ++T ++ ++   ++     NE+E+LLLE NLI K+KPK+N+LL++  +FP++ ++ ++    +  H   K  +G Y+GPFA++    + +   + +IF +R C+    K   + CI Y I +C GPC+  + ++DY+  + +   F SGKS+ I + L K+  +A+EKL FE +  + +  K+L +    Q I  +   D D+I  Y +     I +F Y       N +   K+D        L EI+ + + ++Y    +  PK + ++   E  K + E+L       I      KG K  V+  A  NA E +  K    I   N   N  E + K  D+K+ L  +E++DNS+I  TN VGAM+ + N    K  YRKF+IK + +   D+  +KEV+ RR+K      G    +P+LI++DGGK Q  +A E L    L   +P+I +AK   ++  D    +     K DK     FF+  ++DE HRFAI+ +R K++K + ++ L +I  +G  R   LL  + +   ++ AS +E+  +  +E  VAK+I
  S:    11 IRKELPLIPKSPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQTFKLEITTTANESEALLLEANLIKKHKPKFNILLKDDKSFPFVFISNKDQWAQVTKHRGKKDKEGFYFGPFASAGTANWTI-KMLQKIFQIRVCDDSTFKNRKRPCILYQIKRCSGPCVDYIDKEDYKKSVDQAIQFVSGKSRDIQKNLSKQMEEASEKLDFERASIFRDRIKSLNIIQSSQRINEANLIDADVIAAYKESGKTCIQVFFYRSKQNWGNQAYFPKHDP----DQSLSEIMSSFLMQFYENKNV--PKLIIINTEIEDKKLIEETLSKKENSAISINVAKKGTKAKVIAMAEKNAKESLNRK----IYETNNNKNLFEGVAKKFDLKNGLNLVEVYDNSHISGTNSVGAMITFGNEGFVKKRYRKFDIKTKGNEQDDFAMLKEVLTRRFKRAMLEKGNYLTLPDLILIDGGKGQYSSAKEVLDEFGLHD-LPMIAIAKGKLRNSGDETFFYKGKSFKFDKNDPTLFFMQRLRDEAHRFAITSHRAKRAKGITKSLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKI 605
>gi|83858529|ref|ZP_00952051.1| excinuclease ABC subunit C [Oceanicaulis alexandrii HTCC2633] >gi|83853352|gb|EAP91204.1| excinuclease ABC subunit C [Oceanicaulis alexandrii HTCC2633] (636 aa)
Score = 659, Expect = 1.1e-66, Identities = 174/575 (30%), Positives = 305/575 (53%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEIC---DVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSEL--DEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIK------FLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDA--NSDYDYMKEVIYRRY---KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFS-EIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           E I D +K +   PG Y    ++G V+YVGKA  L NR+  Y        T ++A  I     +++V+   E E+LLLE NLI + KP++N+LLR+  +FPYIL+ ++     L  H   +K KG Y+GPFA+ +     L N + + F +R C     +   + C+ Y I +C GPC+  V+  DY+  ++E  DF SG+S S+ ++L+ +   A+E L FE + K  +  + +   + +QD+      D D+I  + +     + IF +  G       L      +   DE+L   I ++Y       P+ +  S   ++ + L+E+L ++         P +G KK +++ A  NA E +  + L    +Q + L+ +  +  L +  +  R+E++DNS+I  TN +GAM+V       K  YR+FN+K +DA  N D+  M+ +I RR+   +        +P+LI++DGGK Q+ + +E ++ L +D +         D+     +        I++     + ++L  I+DE HRFAI+ +R K++K + EN L +I  +G TR   LL+ + +   +  A++ +L  +
  S:    32 EIIADYVKNLSQGPGVYRMYGEDGEVLYVGKAKKLKNRVSNY--AKSGGHTNRIALMISLTRSMEFVLTRTETEALLLEANLIKRLKPRFNILLRDDKSFPYILIRRDHESAQLTKHRGARKAKGDYFGPFASPSAVNNTL-NTLQKAFGIRTCTDSVYEGRTRPCMLYQIKRCAGPCVDLVSPSDYDELVREAKDFLSGRSNSLRQRLQDEMTAASENLDFETAAKLRDRIRAIAAVTSQQDVNPDGVEDADVIALHQEGGKTCVQIFFFRAGQNWGNRALYPKHEQDAAPDEVLSAFIAQFYDDKPA--PRLILTSSDPQQAELLAEALTLRAGHPVEIRTPKRGSKKALVEAAERNAKEAL-GRNLAESRSQAQLLDGVARVFGLEERPE--RIEVYDNSHIQGTNALGAMIVAGPEGFEKQSYRRFNMKGDDAATNDDFAMMQAMIRRRFTRLQKEREEGAPVPDLILIDGGKGQLSSVMEVMEELGVDDVAVAAVAKGPDRDAGREVFYMPGKPPIRMPMNDPVLYYLQRIRDEAHRFAITGHRAKRAKQMRENPLDEIDGVGATRKSALLKHFGSAKAVSRANLADLEAV 619
>gi|126662636|ref|ZP_01733635.1| excinuclease ABC, C subunit [Flavobacteria bacterium BAL38] >gi|126626015|gb|EAZ96704.1| excinuclease ABC, C subunit [Flavobacteria bacterium BAL38] (605 aa)
Score = 658, Expect = 1.2e-66, Identities = 185/586 (31%), Positives = 323/586 (55%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRD-LKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN---KLPN------KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDL-----ITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNA--VEIMKNKYLQLISNQNRELNSLEELQKLLDIK-DLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           M   ++ +++ +P  PG Y + DK G ++YVGKA +L  R++ YF K+ D  KT  L  +I  + ++VV  E ++LLLENNLI K +P+YN+LLR+   +P+I +  E  PRI +S     K    Y+GP+  S    + + + I  ++PLR CN     PN      K C+ Y IG C GPC    + ++Y+  +++I     G  K   +  ++     A ++ FE++QK  E  + L+ +  R  I+  + ++ D+      E +  +   +  +G+++  + L     +     EL E+ +  + E +   A E+     + L D ++        IK   P  G KK +++ +  NA    + + K +Q++  +      + ++QK L +  +   +E FDNSNI  TN V A VV+++G  +K +YR FNIK  +  +D+  M+EV+YRRYK        +P LII+DGGK Q+ +AL+S+  L L   I +IG+A   K   +     D + + LDKKS+    +  +++E HRF I+ +R+K+SKS   NSL  I  +G+  +  L++ ++++ +++ A  + +S++V +  AK+I
  S:     1 MQTLLELQIQTLPDNPGVYQYYDKEGKILYVGKAKNLKKRVQSYFTKNHDNYKTSVLVKKIVTIKHIVVPTETDALLLENNLIKKLQPRYNVLLRDDKTYPWICIKNERFPRI-FSTRKMIKDGSEYFGPYT-SFKTVHTILDLIKELYPLRTCNYDLSKPNIDFGKFKVCLEYHIGNCKGPCEDYESAENYQNQVEKIRQILKGNFKESLKDFKRLMTDLAMEMKFEEAQKIKEKIEVLENYQSRSTILNPKISNLDVFSIISDETMAYVNFLQISHGAIVRSHTLELKKKLDETNEELLELAVVELRERFHLNAREIVVPFPIDLGDPEVS------GIKVTVPQLGDKKQILELSERNAKYYRLDQLKQIQIVDPERHTNRIMAQMQKDLRLSVEPRHIECFDNSNIQGTNPVAACVVFKDGKPSKKDYRHFNIKTVEGPNDFASMEEVVYRRYKRMLDENQPLPQLIIIDGGKGQLSSALKSIDDLGLRGKIAIIGIA---KRLEELFYPGDSAPLYLDKKSETLKVIQFLRNEAHRFGITHHRDKRSKSALTNSLESIPGIGEKTMITLMKHFKSVKRLQIADEKAISEVVGLSKAKKI 593
>gi|54309405|ref|YP_130425.1| excinuclease ABC subunit C [Photobacterium profundum SS9] >gi|81399352|sp|Q6LQ03|UVRC_PHOPR UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|46913841|emb|CAG20623.1| putative excinuclease ABC, subunit C [Photobacterium profundum SS9] (616 aa)
Score = 658, Expect = 1.2e-66, Identities = 187/578 (32%), Positives = 306/578 (52%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF-LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKK-VTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYS--ELDEILLTLIYEYYSKIAIE--LPKTVYL--SLSDEK---LKTLSE--SLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLK-FLELDSIIP-VIGLAKDDKHKT--DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           K  LK + H+PG Y   D  G VIYVGKA DL  R+  YF +     KT+ L   IC VD  V + E E+L+LE+N I  Y PKYN+LLR+  ++PYI ++   HPR L  H  TKK KG Y+GP+ ++   +  L+  + ++FP+R+C        ++ C+ Y IG+CL PC+K+ +T +DYE  +     F  GK + +   L +K  QA++ L FE +  + +  + L+   E+Q +    ++D D+IG   +  +  I       G +L          S  EL E+L + I ++Y   A    +P  + L  +L D+     +TLS+    KI+     +G +   +  A  NA+  + +K    ++   R      EL+K L+++ + RME FD S+      V + VV+      K +YR++NI       DY  M +V+ RRY        +IP++I +DGG+ Q+  A   +K F++     P +IG+AK    K   + ++     E  L   S     + +I+DE H  AIS +R +++K    ++L  ++ +G  R + LL+    L ++K AS EE++++  I  A
  S:    13 KSFLKTVTHQPGVYRMYDAVGDVIYVGKAKDLKKRLSSYFRINVAGEKTRALVKNICKVDVTVTHTETEALILEHNYIKLYLPKYNVLLRDDKSYPYIFLSNHHHPR-LSIHRGTKKRKGEYFGPYPDAGAVRESLH-LMQKLFPIRQCEDSVYANRSRPCLMYQIGRCLAPCVKELITEKDYEDQVSFARLFLQGKDRQVIASLVEKMEQASQSLNFEQAATFRDQIQALRRVQEQQFVSHDSEDDLDVIGIAHQNGMACIHALYIRQGKILGSRSYFPKMPSDAELTEVLSSFITQFYLNQAEGRVIPSVIILGENLGDDAAVITETLSDIAGRKIELKVNPRGNRARYLKLAQTNAMTALTSKLSHKMTIHER----FSELRKALNLETISRMECFDISHTMGEKTVASCVVFNQEGPFKQDYRRYNITGITGGDDYAAMGQVLERRYGKPMEP-EKIPDIIFIDGGRGQLSRAYNVVKPFMDEWPKQPLLIGIAKGVTRKAGLETLIFITGEEFSLPSDSPALHLIQHIRDESHNHAISGHRAQRAKVRKRSALEDVEGIGPKRRQALLKFMGGLHELKRASREEIAKVPGISKA 604
>gi|150396006|ref|YP_001326473.1| excinuclease ABC subunit C [Sinorhizobium medicae WSM419] >gi|150027521|gb|ABR59638.1| excinuclease ABC, C subunit [Sinorhizobium medicae WSM419] (674 aa)
Score = 658, Expect = 1.3e-66, Identities = 174/578 (30%), Positives = 293/578 (50%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL-KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD------EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK---------------NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI 580
           E I+  +K +P+ PG Y   ++ G V+YVGKA  L  R+  Y   +    +  ++  E  ++++V    E E+LLLE NLI + +P++N+LLR+  +FPYI++T +     LY H   +  KG Y+GPFA++      + N + R F LR C     +   + C+ + I +C  PC  +++  DY   + E  DF SGKS+++   +     +A+E L FE +  Y +    L      Q I  +   + D+   + +  +  I +F +  G           ++ + D      E+L   + ++Y       P+ + L  + ++   L+++L      K+  L P +G KKD+++ A  NA E    K L   ++Q R L       +L  +    R+EI+DNS+I  TN VG MVV       K +YRKFNI+  D     D+  M+EV+ RR+                   A F   P++I++DGG+ Q+ A    L  L ++  +  IG+AK  D     +R          L  +  + +F+  ++DE HRFAI  +R ++ K +  N L +I  +G TR   LL  + T   +  A + +L  +  I
  S:    53 ELIQAFVKVLPNGPGVYRMLNEAGDVLYVGKARSLKKRVSSYAQGRGHSNRIARMVRETANMEFVTTRTEIEALLLEANLIKRLRPRFNVLLRDDKSFPYIVLTGDTRAPALYKHRGARSRKGDYFGPFASAGAVGRTI-NSLQRAFLLRTCTDSVFETRTRPCLLHQIKRCSAPCTNEISDDDYAELVSEAKDFLSGKSQAVKATIATAMSEASENLDFERAALYRDRLAALSHVQSHQGINPAGVEEADVFAIHHEGGISCIQVFFFRTGQNWGN----RAYFPKADPSLTPAEVLSAFLAQFYDDKPC--PRQILLCATVDEQDLLAQALSEKSGYKVSILVPQRGEKKDLVEHALGNAREAHGRK-LAETASQERLLEGFAATFQLPYVPR--RIEIYDNSHIMGTNAVGGMVVAGPEGFVKGQYRKFNIRSTDITPGDDFGMMREVMTRRFSRLLKEEGKPDRAAEPGEDAGFPAWPDVILIDGGQGQMTAVRTILGELGIEDCVTAIGVAKGVDRDAGRERFFASGREGFTLPPRDPVLYFIQRLRDEAHRFAIGSHRARRKKEMVRNPLDEIAGIGPTRKRALLTHFGTAKAVSRAGINDLMSVSGI 656
>gi|126734014|ref|ZP_01749761.1| excinuclease ABC subunit C [Roseobacter sp. CCS2] >gi|126716880|gb|EBA13744.1| excinuclease ABC subunit C [Roseobacter sp. CCS2] (622 aa)
Score = 657, Expect = 1.7e-66, Identities = 177/573 (30%), Positives = 300/573 (52%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDR-DLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK-----NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLA--------KDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           I   L+ +   PG Y   D +  V+YVGKA +L  R+  Y    +   +  ++  E   + ++    E E+LLLE NLI + KP+YN+LLR+  +FP ILVTK+    ++  H   KK +G YYGPFA +      L N + R+F LR C+    +   + C+ Y I +C GPC   +   DYE  +++   F  G++K I E L K+   A+E + FE +    +  K L      Q I      + D+I  +       + +F          +D       + D  E++   + ++YS    E P+ + LS   +    ++++L      K++ + P +G K +++  A  NA E +  K +   + Q R L  + E  ++   +   R+E++DNS+I   + VGAMVV      +KN+YRKFNI+ +D     D+  MKEV+ RR++     +   + G  P+L+++DGG+ QV A  E +  L + S IP++G+A        K++ H+T + V      + L     + +F+  ++DEVHRFAI  +R K+SK++    L  +  +G TR   LL  + +   +  A++ +L  +
  S:    16 IHGYLRTLDSSPGVYRMLDADSRVLYVGKARNLKARVSNYARPGQHSPRITRMIRETASMMFLTTRTETEALLLEQNLIKQLKPRYNVLLRDDKSFPNILVTKDHAFPMIKKHRGAKKQQGNYYGPFAGAGAVNRTL-NQLQRVFLLRNCSDSDFETRTRPCLQYQIKRCSGPCCGLIAEGDYEASVRDAEKFLQGRTKGIQEALAKQMQDASEAMEFERAAALRDRIKALTQVQSAQGINPQNTPEADVIALHRDGGQACVQVFFIRANQNWGNHDYYPRVSGDEDPSEVMEAFVGQFYSN--REPPRMLILSHGLDSDDLMADALAEKAERKVEIIVPQRGEKAELVQNALRNARESLARK-MSETATQARLLKGVAEAFEM--DRAPQRIEVYDNSHIQGAHAVGAMVVAGPDGFDKNQYRKFNIRGDDLTPGDDFGMMKEVLTRRFQRLLKEDPERTLGTWPDLLLIDGGQGQVSAVREIMNDLGV-SDIPMVGVAKGEDRDAGKEEFHRTGKPV------MALRHNDPVLYFIQRMRDEVHRFAIGTHRAKRSKAIGATPLDDVPGVGATRKRALLAHFGSAKAVARANLADLKAV 603
>gi|117925176|ref|YP_865793.1| excinuclease ABC subunit C [Magnetococcus sp. MC-1] >gi|117608932|gb|ABK44387.1| Excinuclease ABC subunit C [Magnetococcus sp. MC-1] (617 aa)
Score = 657, Expect = 1.9e-66, Identities = 168/575 (29%), Positives = 315/575 (54%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF--LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYI-LVTKEEHPRI-LYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLP----NKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLK------IKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDR---IVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +++K  +K++P KPG Y + D  G ++YVGKA  L  R+  YF  L     KT  +  +I  +++    NEN++L+LE NLI  ++P+YN+LL+++ ++PY+ L T   +PR+ LY  D  +K +G ++GP+ +++  + E  N++ +IFP+R+C        ++ C+ Y I +C GPC  ++    Y   + ++  F  GK K +   L++   QAA+   FE + +  +    ++   ER+ +  S + D D++          + +F    G  L           E D  EIL   + ++Y  +    P  + L    ++ + L E+L       +K   P +G ++ +++ A  NA + +K    Q  S+++     LE LQ+L ++ +   R+EI+DNS+I + + VGAMVV+      KN+YRKFN++   A  D   M EV+ RR+K      G  P+L+++DGG  Q+ AA++ ++ L++D  +    +AK  +    R    +    + + L   + L  FL  ++DE HRF I ++R +++K    + L  I  +G  R + L++++ ++  +++A++ E++ +
  S:    13 QRLKRDVKQLPLKPGVYRFYDDAGQLLYVGKAKALRKRVSSYFNHLAGHSPKTVVMVKQIMRLEFTTTANENDALVLEANLIKAHQPRYNVLLKDNKSYPYLHLTTDHAYPRLALYRGD--RKARGRFFGPYPSAHAVR-ETLNWLQKIFPVRQCEDSQFNHRSRPCLQYQIHRCGGPCCDRIDVTSYGAMVSQVTLFLEGKDKQLVNTLKEAMWQAAQARDFEGAARLRDRIAGIEHVQERRRLNLSGEIDLDVMSVAVGLKKAVVQVFFIRAGINLGNRAFFLERGEEDDPSEILQAFVSQFY--LDKPPPPEILLEHLPQQQEMLEEALSARLGKAVKLRQPQRGERRRLLEMAVENAQQALK----QYQSSRDHVRTQLEALQELFNLAEPPQRIEIYDNSHIQDQHAVGAMVVFGADGFEKNQYRKFNLEASSAPDDTARMIEVLTRRFKRLKEGEGRWPDLVLLDGGIAQLNAAMKVVEELQIDG-VAFSAIAKGPQRHAGREQLFLPDRPNPLILPHDAPLLHFLQVVRDESHRFVIGYHRTRRAKGQTSSRLDGIAGVGAQRKKALIKQFGSVKGVRQATLAEIAAL 597
>gi|15643035|ref|NP_228078.1| excinuclease ABC, subunit C [Thermotoga maritima MSB8] >gi|8134799|sp|Q9WYA3|UVRC_THEMA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|4980761|gb|AAD35353.1|AE001708_21 excinuclease ABC, subunit C [Thermotoga maritima MSB8] (557 aa)
Score = 656, Expect = 2.2e-66, Identities = 184/586 (31%), Positives = 331/586 (56%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKI-KGTYYGPFANSNIKKYELYNFINRIFPLRKCN---KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGV-KKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIV-PIEVAKEI 586
           M E+I+ K+   P +PG Y++K+K G+ IY+GKA  L+NR++ Y L  +  K  ++  E  +++ +VV NE E+ +LE NLI KY+PKYN+ L++++ +PYI ++ +E P   Y     +K+  GTY+GP+ +    +  L   + +I   R C    K   + C  Y +G+C+GPCI  +  + +E  ++++ +F SG  + + + L++K    ++ L FE++ KY +L  NL    E Q ++F +  + D++           V+ +  NG L+ K     + +      +   I EYY     ++PKT+ L    +++     SL  +++ P +   ++D+++ A  N    +K + L+          +LEEL KLL++KD  YR+E  D S++     V ++VV+E+G   K +YR++ I ++D   DY+ ++ V+ RRY  +      +PNL+ VDGG  QV AA+E+LK  E+    PV+GLAK ++      V ++  EI L     +   L+ I+DE HRFA+S++R ++ K    + L  +  +G  R +KL+E + +L+ I+ AS+EE+++++   E+A+ +
  S:     1 MKEKIRKKILLAPEEPGVYIFKNK-GVPIYIGKAKRLSNRLRSY-LNPQTEKVFRIGEEADELETIVVMNEREAFILEANLIKKYRPKYNVRLKDTDFYPYIRISDDEIP---YVEIVKRKLWDGTYFGPYTSVQFVR-NLLEILQKIMGFRTCKSDLKRIKRPCFLYHLGRCIGPCIGNI--ESHEEAIRKLREFLSGNMEEVFDYLKEKMETHSKMLDFENAAKYRDLLLNLSNVLESQGVVFEENINCDVLVHAHD----LFVVLRVRNGYLVGK-----ISFEMEGGNVEDFIREYYISGRGDIPKTLILESDLDEMDY--SSLGFEYVGPPRSTTEEDLLEKAKKNLENELKMRGLRK--------EALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKI-EQDHPDDYESIRTVVKRRYSKHP-----LPNLLFVDGGIGQVNAAIEALK--EIGKDCPVVGLAKKEE-----TVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRV 553
>gi|146298489|ref|YP_001193080.1| excinuclease ABC, C subunit [Flavobacterium johnsoniae UW101] >gi|189038052|sp|A5FM03|UVRC_FLAJO UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|146152907|gb|ABQ03761.1| excinuclease ABC, C subunit [Flavobacterium johnsoniae UW101] (597 aa)
Score = 656, Expect = 2.3e-66, Identities = 189/575 (32%), Positives = 310/575 (53%)
  Q:    12 IPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPN---------KKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDL-ITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL--KIKFLNPSKGVKKDVMDTAFNNA--VEIMKNKYLQLISNQNRELNSLEELQKLLDIK-DLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           +P  PG Y + DK+G ++YVGKA +L  R+  YF K  D  KT  L  +I  + ++VV  E ++LLLENNLI   +P+YN+LLR+  ++P+I + KE   RI  +    K     Y+GP+ N  +  Y + + I  ++PLR CN   +         K C+ Y IG C GPC      ++Y+  +  I +   G  K   +  +K     A+ L FE++QK  E  + L+ +  R  I+  +  + D+      E+   +   +  +GS++  + L +     E DE LL L         IEL +   L +S E +      L   IK   P  G KK ++D +  NA    I + K LQ++         + ++QK L +  +   +E FDNSNI  TN V A VV+++G  +K +YR FN+K  +   D+  M E++YRRYK        +P LII+DGGK Q+ +AL+S+  L L   + +IG+A   K   +     D   + LDKKS+    +  +++E HRF I+F+R+K+SK+   +S+  I  +G+  +  L++ ++++ ++K A+ +E+S +V +  AK+I
  S:    13 LPDNPGVYQYYDKDGKILYVGKAKNLKKRVSSYFNKIHDTAKTNVLVKKIVTIKHIVVPTETDALLLENNLIKTLQPRYNVLLRDDKSYPWICIKKEPFSRIFLTRRMVKD-GSEYFGPYTNFKMV-YTILDLIKELYPLRTCNYDLSQSNIDSGKFKVCLEYHIGNCKGPCEGLEPLEEYQRQVNAIREILKGNFKESLKDFKKLMNNYAQNLQFEEAQKIKEKIEVLENYQSRSTIVNPKITNIDVFSIISDESAAYVNFLQISHGSIIRSHTLEMKKKLDESDEELLELA-------IIELRERFQL-MSKEIIVPFEIDLGENIKTTVPQLGDKKQILDLSIRNAKFYRIEQLKQLQIVDPDRHVNRIMAQMQKDLRLPVEPRHIECFDNSNIQGTNPVAACVVFKDGKPSKKDYRHFNVKTVEGPDDFASMTEIVYRRYKRLLDENQPLPQLIIIDGGKGQLSSALKSIDELGLRGKVAIIGIA---KRLEELFYPGDSIPLYLDKKSETLKVIQQLRNEAHRFGITFHRDKRSKAALNSSVESIPGIGEKTMLTLIQHFKSVKRLKLATEKEISAVVGVSKAKKI 590
>gi|165975733|ref|YP_001651326.1| excinuclease ABC subunit C [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|165875834|gb|ABY68882.1| excinuclease ABC, subunit C [Actinobacillus pleuropneumoniae serovar 3 str. JL03] (610 aa)
Score = 656, Expect = 2.5e-66, Identities = 186/571 (32%), Positives = 310/571 (54%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQ-DYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVF--YSELDEILLTLIYEYY----------SKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKD---VMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLEL--DSIIP-VIGLAKDDKHK----TDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVP 579
           L  +PH PG Y   D    +IYVGKA DL  R+  YF       KT+ L   I  ++  + ++E E+LLLE+N I + +PKYN+LLR+  ++PYIL+TK +HPRI  S   +KK+ G Y+GP+ N+   + E  N + ++FP+R+C     K  ++ C+ Y IG+CL PC++    Q +Y+  +  +  F  GK   + E L +K   AA++L FE + ++ +  ++++   E+Q +   + +D DII    +  +  + I    +G +L            ++L E+  T + ++Y          ++I I+ P +   +L+D     LSE    K     K ++ D    +  A  NA   +  +  Q    + R     + L+ LL++ ++ RME FD S+      V + VV++     K++YR+FNI+      DY  M++ + +RY  +     +IP++I +DGGK Q+  ALE+   L +  D   P +IG+AK  + K    T  I KWD  EI L   S     + +I+DE H  AI+ +R K+ K+  E+ L  I  +G  R + LL+    +  +K A++EE+ Q VP
  S:     8 LADVPHLPGVYRMYDAKNTIIYVGKAKDLKKRLSSYFRSQLASKKTEALVANIHHIETTITHSETEALLLEHNYIKENQPKYNVLLRDDKSYPYILLTKHQHPRIT-SFRGSKKVAGEYFGPYPNAGAVR-ETLNLLQKLFPIRQCEDSYYKNRSRPCLQYQIGRCLAPCVESYYSQAEYDNQVNLVRLFLQGKDGQVIEHLVQKMENAAQELDFEAAARFRDQIQSVRAVQEKQFVSNERLDDLDIISIAYQHGIACVHILFVRHGKVLGNRSYFPKVPNNTDLSELADTFVGQFYLQMNQHRTIPNQIIIDQPLSESAALAD----VLSEQAGHKVSIADKNIRGDKSRYLALAKTNAEAALTLQLKQDTHIRQR----YDSLKTLLNLAEIKRMECFDISHTMGNQTVASCVVFDENGPLKSDYRRFNIEGITGGDDYAAMEQALLKRYSRHLEE-EKIPDIIFIDGGKGQLNRALETFASLNVSWDKRKPLLIGVAKGVERKAGLETLLISKWD-KEIHLPPDSPALHLIQHIRDESHNHAITGHRKKRQKAFTESGLESIAGVGAKRRQALLKYLGGMQGVKAATLEEI-QSVP 593
>gi|153803514|ref|ZP_01958100.1| excinuclease ABC, subunit C [Vibrio cholerae MZO-3] >gi|124120950|gb|EAY39693.1| excinuclease ABC, subunit C [Vibrio cholerae MZO-3] (610 aa)
Score = 655, Expect = 2.6e-66, Identities = 183/575 (31%), Positives = 306/575 (53%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKK-VTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYY--SKIAIELPKTVYLSLSDEKLKTLSESLKIKF-----------LNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLK--FLELDSIIPVIGLAKDDKHKT--DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           LK + ++PG Y   +    VIYVGKA DL  R+  YF K+ D  KTK L + I  +D  V + E E+L+LE+N I +Y PKYN+LLR+  ++PYI ++  +HPR L SH   KK +G Y+GP+ +S   + E  + I +IFP+R+C         + C+ Y IG+C GPC+K  ++ Q Y+  +  +  F  GK   +   L +K  QA+ +L FED+ K  +  + ++   E+Q +      D D++GF  +  +  I I     G +L   S +  I    S++ E+  + + +YY     A  +P  + L   +  L   +E+L+I             +NP+ G +   +  A  NA+  +  K    ++   R     + LQ+ L +  + RME FD S+    + + + VV+      K EYR++NI       DY  M +V+ RRY     S  +IP++I +DGGK Q+  A E +   + +      +IG+AK    K   + ++  D  E  L   +     + +I+DE H  AI+ +R ++ K+   ++L  I+ +G  R + LL+    + ++K ASVEE++++  I  A
  S:    11 LKTVTNQPGVYRMYNAEAEVIYVGKAKDLKKRLTSYFRKNLDSEKTKALVSNIAKIDVTVTHTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFLSAHKHPR-LSSHRGAKKRRGEYFGPYPDSGAVR-ETLHLIQKIFPVRQCEDTVYSNRTRPCLMYQIGRCAGPCVKGLISDQGYQEIVHXLRLFLQGKDNQVLSILVEKMEQASRELRFEDAAKARDQIQAIRRVQEQQFVSDDSLEDLDVLGFAQENGIACIHILMIRQGKVLGSRSHFPKIPSDTSQV-EVFESFLSQYYLSHSEARSIPARIIL---NRGLTEETEALQIAISELAGRKVTFHVNPT-GTRGRYLKLANTNALTAITTKMNHKMTISQR----FKALQEELGMDAITRMECFDISHTMGESTMASCVVFNQEGPLKQEYRRYNITGITGGDDYAAMAQVLERRYSKQLDS-SKIPDIIFIDGGKGQLNRAYEIISSCWQDWPKYPKIIGIAKGVTRKPGLETLITIDGDEFHLPSDAPALHLIQHIRDESHNHAIAGHRAQRGKTRRTSTLEGIEGVGPKRRQALLKYLGGMQELKRASVEEIAKVPGISHA 599
>gi|85858550|ref|YP_460752.1| nuclease subunit of the excinuclease complex [Syntrophus aciditrophicus SB] >gi|119367849|sp|Q2LR71|UVRC_SYNAS UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|85721641|gb|ABC76584.1| nuclease subunit of the excinuclease complex [Syntrophus aciditrophicus SB] (618 aa)
Score = 655, Expect = 2.9e-66, Identities = 186/575 (32%), Positives = 312/575 (54%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL-KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL-SKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLK------IKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYR-MEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKL---DKKSDLY--------FFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +Q++ ++   P  PG YL KD  G ++YVGKA +L +R + YF   D       L + I D+++++   E E+L+LENNLI ++ P+YN+  R+  A+  I     E  PR        +K    Y+GP+ +S   + E   F+  IFPLR C     K   + C+ Y I +CL PC+ ++  +DY   +++   F  G+  ++  +L ++   AAE++ +E++    +  + ++   ERQ ++     D+DI G Y + ++I + I     G +L S+   +  F  E  ++L +L+ +YY + ++++P+ + +  S E  + + E L+      +  L P KG   +++  A  NA    K +   L  +      SL  L + L ++   R +E FD SNI     V AMV +++G   K+ YR+F I+      DY  M E + RRY+        +P+LI+VDGGK Q+  A   LK L + S   VIGLAK+  +        + SE ++    KK  LY        F L  I+DE HRFA+S++R+ K++S F + L  I  +G+ R + LL  +  L +I+EA+VEEL+Q+
  S:     4 QQLEGRIDIAPRTPGVYLMKDAAGKILYVGKAKNLKSRTRAYFSGTDSRAMIPFLVSRIHDIEFILTETEKEALILENNLIKEHHPRYNICFRDDKAYFNIRADLNEPFPRFQLVR-RPRKDGAKYFGPYPSSASAR-ETLQFLQSIFPLRTCRDAELKSRTRPCLEYQIKRCLAPCVGRINSEDYLQMVRDGVSFLEGRGNNLLRELRERMKMAAEQMNYEEAAFLRDRIRAIEETLERQRMVSMTFKDQDIFGLYREGHLIQVCILLIRQGKILGSRLLPLLKFEGETADMLSSLLMQYYDQ-SVDIPQEILIPASIEDRQVIREWLEEKRGKGLSILIPRKGRGLELLHIAEQNAEHGFKMERKSLDDSD----ESLRLLMERLHLRRFPRKIEAFDISNIGGRLAVAAMVTFQDGRPLKSGYRRFRIRTVHGADDYAMMYEALKRRYQGKE----NLPDLIVVDGGKGQLAVAFSLLKDLSI-SGQDVIGLAKERVNGVTVQGGVNKSEDRVYLPHKKEALYLSRWPAVLFLLQRIRDEAHRFAVSYHRSLKTRSDFMSLLDDIPGVGEVRKKALLLSFGDLARIREATVEELTQV 591
>gi|162139923|ref|YP_340422.2| excinuclease ABC subunit C [Pseudoalteromonas haloplanktis TAC125] >gi|119367818|sp|Q3IIM0|UVRC_PSEHT UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) (607 aa)
Score = 655, Expect = 3.0e-66, Identities = 179/569 (31%), Positives = 301/569 (52%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYY------SKIAIELPKTVYLSLSD---EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHK---TDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           LK +  +PG Y   D +  VIYVGKA  L  R+  YF  +  D KT+ L + IC+V+  + N E E+LLLENNLI KY+P+YN+LLR+  ++PYIL+T  +HPR+ + H  ++K+KG Y+GPF ++      L   + +IFP+R+C     +  ++ C+ Y + +C  PC+ KV+ +DY   +  +  F +GKS  +   L KK   A+++L FE + K  +    L+   E+Q I      + D++GF     +  I +    +  +L    Y       S   EIL + + +YY       +IA E+     +  SD   + L  +SE  K+     ++G +   +  A  NA+  +  K     S Q+       +L+  L + D+ RME FD S+    N V + VV+++   N  EYR++N+       DY  M+  + +RY N      +IP++I +DGGK Q+  A +         +  ++G+AK    K      ++      I +D  +     + +I+DE HRFAI+ +RNK+ K   ++ L +I  +G  R + LL+    +  +K A++E+L ++
  S:    10 LKTLSSEPGVYCMLDSDNQVIYVGKAKHLKKRVSSYFRSNITDSKTRVLVSNICNVEVTLTNTETEALLLENNLIKKYQPRYNILLRDDKSYPYILLTNHKHPRLAF-HRGSRKVKGEYFGPFPSAGAVSESL-RLMQKIFPIRQCEDVYYRARSRPCLQYQLKRCSAPCVNKVSDEDYTEQVDYVRKFLTGKSHEVIADLIKKMEAASQQLNFELAAKVRDQIMLLRKMQEQQSIS-GNFAEMDVVGFAHLNGLNGIHLLMIRDHKVLGSKTYFPKVPKDSSEQEILTSFLGQYYLAPGATGRIAKEIILPFEIQESDVLGQALTQISER-KVTLKVVTRGERAQYLQLANKNALNSITVKQ----STQDSINKRYAQLKATLRLDDITRMECFDISHTMGENTVASCVVFDSQGPNTKEYRRYNVTGITGGDDYAAMEFALNKRY-NKLVDEDKIPDVIFIDGGKGQLGRAEQYFATWPHAKMPLLVGVAKGTSRKPGLETLLIDGGRKTIPMDSDAPALHLIQHIRDESHRFAIAGHRNKRQKQRTQSLLEEINGVGAKRRQTLLKYLGGMQGVKAANIEQLKKV 588
>gi|149369500|ref|ZP_01889352.1| excinuclease ABC, C subunit [unidentified eubacterium SCB49] >gi|149356927|gb|EDM45482.1| excinuclease ABC, C subunit [unidentified eubacterium SCB49] (597 aa)
Score = 654, Expect = 3.9e-66, Identities = 185/583 (31%), Positives = 311/583 (53%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRD-LKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN------KLPNKK---CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDL-ITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNA--VEIMKNKYLQLISNQNRELNSLEELQKLLDIK-DLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEIK 587
           +K ++  +P  PG Y + DK+  ++Y+GKA +L  R++ YF K+ D  KT+ L  +I  + ++VV  E ++LLLENNLI KY+PKYN+LL++   +P+I +  E  PR+  +    K     Y+GP+ N       L   I  ++PLR CN      K+ N K   C+ Y +G CLGPC    + + Y   +  I +   G  K      +K+  Q A++L+FE++QK  E    L+ +  +  ++     + D+      E+   +   +   G+++  + L I     E D+ LL +      +    L K +Y          +S    +K   P  G KK ++D +  NA    + + K  +++     E   + +++K L +  +   +E FDNSNI  TN V A VV++NG  +K +YRKF+IK  +   D+  M+EV+YRRYK        +P LII+DGGK Q+ ++L++L  L L   I +IG+A   K   +     D   + LDKKS+    +  +++E HRF I+F+R  +SK     +L  I  +G+  + +LL K+++  +I  AS +EL++++    AK++K
  S:     6 LKLQVSTLPSTPGVYQYYDKDDKLLYIGKAKNLKKRVQSYFNKEHDHAKTRILVRKIKSIKHIVVETETDALLLENNLIKKYQPKYNILLKDDKTYPWICIKNERFPRVFPTRRLIKD-GSEYFGPYTNFKTIN-ALLELIKGLYPLRNCNFDLAEDKIRNGKYKVCLEYHLGNCLGPCEGLYSEKFYNENIAAIRNILKGNFKESLHLFKKQMHQFADELLFEEAQKVKEKIDALENYQSKSMVVHPTITNVDVFSIISDESYAYVNYLQVSYGAIIRSHTLEIKKKLDETDKELLEMSVLEIRQRFNSLSKEIYTPFK------ISIETGVKMHIPKVGDKKKILDLSIRNAKYYRLERFKQSKIVDPDRHEKRIMAQMKKDLRLSVEPRHIECFDNSNIQGTNPVAACVVFKNGKPSKKDYRKFHIKTVEGPDDFASMEEVVYRRYKRLVEEKQPLPQLIIIDGGKGQLSSSLKALDDLGLRGKIAIIGIA---KRLEELFYPDDPIPLYLDKKSETLKIIQQLRNEAHRFGITFHRQLRSKEALNTALETIPGIGEKTVIELLTKFKSHKRIGTASFDELAEVIGASRAKKVK 591
>gi|126647169|ref|ZP_01719679.1| excinuclease ABC, C subunit [Algoriphagus sp. PR1] >gi|126577217|gb|EAZ81465.1| excinuclease ABC, C subunit [Algoriphagus sp. PR1] (601 aa)
Score = 654, Expect = 4.2e-66, Identities = 190/567 (33%), Positives = 310/567 (54%)
  Q:    12 IPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF--LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN------KLPNKK---CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSL-LSKYDLITVFYSELDE-ILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLY-RMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIV 578
           +P +PG Y + +    +IYVGKA +L  R+  YF  +   +LKTK++  EI  ++  +VN+E ++LLLENNLI K +PKYN+LLR+   +PY+L+TKE  PRI  +     K +GTY+GPFA+       + + I  +F +R C       K+  +K   C+ Y IG C GPC+      +Y   +++      G         +++  + AE L FE +QK  +    L+ +  +  +      + D+      E    +   +  NG++ +SK   +     E DE +LLT +     +   +  + +     +E ++ L+ +L      P  G KK +++ +  NA+   K K L    N++++   + +LQ+ L + D+   +E FDNSNI  TN V +MV + NG     EYR F+IK     +D+  MKEV+ RRYK        +P LI++DGGK Q+ +++E+LK L +   +P+IG+A   K   +     D   I +DKKS+    L  I+DE HRFAI+F+R+ +SK+ F   L  I+ +GK   EKLL  ++++ KIKEA+  EL +++
  S:    14 LPDQPGVYRYFNAANELIYVGKAKNLKKRVSSYFNKISGLNLKTKRMVREIQRIEITMVNSELDALLLENNLIKKTQPKYNILLRDDKTYPYLLLTKENFPRIFQTRKYIPK-RGTYFGPFASVKAMN-NVLDLIRELFTIRTCKLDLSPYKIAEEKYKVCLEYHIGNCQGPCVGLQKESNYLKDIEQAKHILKGNLGVAKSHFKQEMQKMAENLEFEKAQKLKDKLILLEKYQAKSLVASPNIANLDVCTIVTDEKNAYVNYLRIKNGAMNVSKNVELKKKLDETDEQLLLTALIRLQDQFQSDAKEVLINIDIEEPIEGLNLTL------PKIGDKKKLIELSLKNALYYKKEKALLKGLNEDKKDRVIRQLQQDLSLPDIPDHIECFDNSNIQGTNPVASMVCFLNGKPAVKEYRHFHIKTVVGANDFASMKEVVGRRYKRLLEEDKPLPKLIVIDGGKGQLSSSVEALKELGIYGKMPIIGIA---KRLEEIYFPGDSYPIHIDKKSESLRLLQRIRDEAHRFAITFHRDVRSKNAFGTQLTDIEGIGKNTAEKLLSHFKSIKKIKEANETELIEVI 583
>gi|89095317|ref|ZP_01168236.1| excinuclease ABC subunit C [Oceanospirillum sp. MED92] >gi|89080436|gb|EAR59689.1| excinuclease ABC subunit C [Oceanospirillum sp. MED92] (613 aa)
Score = 653, Expect = 4.8e-66, Identities = 186/578 (32%), Positives = 324/578 (56%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF-LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVY--LSLSDEKL--KTLSESL--KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKT--DRIVKWDF-SEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           LK++  +PG Y   D    ++Y+GKA +L NR+  YF      +KT+ L ++I DV   V N+E E+LLLE NLI +Y+P YN+LLR+  ++PYI ++ K+ +P + +S  + +K  G Y+GP+ +    +  L N + +IF +R+C     K  ++ C+ Y I +C  PC++ ++ Q+Y+  +K    F  GK+K++ +++ ++   A+E+L FE +  Y +   +L+   E+Q +   Q  D D+IG   +   + + +     G ++   S Y  +++  +  DEI+   I ++Y     E+P  +     LSDE      L+E+   K+   +  +G +      A  NA E   + YL   +N+    N   ELQ+LL + D+  R+E FD S+      V + VV++     K++YR FNI+      DY  M + ++RRY        ++P+L+IVDGGK QV  A+E L  L++  ++ VIG+AK    K   + ++  D   E  L+  S     L +I+DE HRFAI+ +R ++ K+   + L  I  +G  R  +LL  +  + +I+ ASVEE++++  + + +A+EI
  S:    16 LKQLTKRPGVYQMYDAQEKLLYIGKAKNLKNRVSSYFRATGLSVKTRSLVSKIADVQITVTNSETEALLLEQNLIKEYRPPYNILLRDDKSYPYIFISDKDTYPAVRFSRGAKRK-SGKYFGPYPSGGAVRDSL-NLLQKIFRIRQCEESFFKNRSRPCLQYQIKRCTAPCVEAISPQEYQEDIKHAAMFLEGKNKAVMDEIAQEMEAASEQLNFEQAALYRDQLVSLQKVQEQQYVTGLQ-GDADVIGCDLQPGGVCLHMLFVRGGRVIGSKSHYPKVSIEETR-DEIVSAFIAQWYLGAQREIPAYIITPFELSDEDCLKAALAEARDKKVALSHNVRGERSGWQKLAQTNA-EQQLSSYL---ANKKNIYNRYLELQELLGLDDIPTRLECFDISHSSGEATVASCVVFDKNGPLKSDYRHFNIEGITPGDDYAAMYQALHRRYSRIKKEEAKLPDLLIVDGGKGQVTQAMEVLDELQIAQVL-VIGIAKGPTRKAGFEVLISGDTGDETVLENDSGALHLLQHIRDEAHRFAITGHRARRGKARKRSVLEDIPGVGPKRRRELLRHFGGIQEIQRASVEEIAKVSTISLTIAEEI 605
>gi|46446331|ref|YP_007696.1| putative excinuclease ABC subunit C [Candidatus Protochlamydia amoebophila UWE25] >gi|81627340|sp|Q6MDC8|UVRC_PARUW UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|46399972|emb|CAF23421.1| putative Excinuclease ABC subunit C [Candidatus Protochlamydia amoebophila UWE25] (610 aa)
Score = 653, Expect = 5.2e-66, Identities = 182/576 (31%), Positives = 320/576 (55%)
  Q:     8 KLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRD--LKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRI--LYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLP----NKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL-SKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYL--SLSD----EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKD-DKHKTDRIVKWDFS-----EIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           K+   P  PG YL K++ G V+YVGKA +L  R+KQYF+  RD  L    L  +I  ++ +VV +E E+LLLENNLI ++KP+YN LL++  ++  + +++ +      L  +  T +  G Y+GP+ ++   +  L + +NR+FPLR+C+        + C+ Y + +C+GPC +K T+ +Y+ +L     F  G++K + + L ++    +E+L FE +   L   + ++   E Q +     +D D IG +     + +V+  +  G L+ S++        E  E+L + + ++Y   A E+P  + L   +SD    E++ +     K+    P +G KK +++ A  NA  + K +  +    +     +L E+Q+LL + +   R+E FDNSNI  +  V +MV + +G+K+   YR + +K      DY  M EV+ RRYK       ++P+L++VDGGK Q+  A++  + L +   + ++GLAK+  +H      +  F+      I L   S + F L  I+DE HR AISF+R ++SK   +++L  I  +G  + + LL  + +L KI+ A+  EL ++  I  A
  S:     7 KIDLFPTLPGVYLMKNEEGEVLYVGKAKNLRQRVKQYFVPGRDGRLMIPYLVAKINYIETIVVTSEKEALLLENNLIKQHKPRYNALLKDDKSYIALKISQNDAWATVRLVRYKGTPEPDGLYFGPYTSAQAARQTL-DLLNRLFPLRQCSDQEFARRTRPCLLYQMKRCVGPCTQKCTKGEYQQHLDRTIKFLRGQNKDVLKDLYEEMRLLSEQLEFEKANHLLRTIRYIEKTIESQYVDRPLGHDADAIGLFRYGEHVVVVLMIFRGGKLVGSRHFEFDNIIEEDHELLTSFLLQHYEG-ATEIPSEILLPSKISDEHPVEEILSARREQKVNLQIPQRGEKKALIEIAQKNAEALFKTQKDEATLRE----KTLLEMQELLFLTNYPTRIECFDNSNIAGSEPVSSMVAFTDGLKDSKRYRTYRLKIGSKPDDYAAMYEVLTRRYKRAKEE-NDMPDLVVVDGGKGQLNIAIKVFEELNITG-VDLLGLAKEAGRHDKGMTAEQVFTCYQKEPILLKANSPILFLLQKIRDEAHRVAISFHRKRRSKKTLKSALDDIPGIGPAKRKTLLTHFGSLKKIELAADAELREVKGISAA 596
>gi|158334297|ref|YP_001515469.1| excinuclease ABC subunit C [Acaryochloris marina MBIC11017] >gi|189038013|sp|B0C2T9|UVRC_ACAM1 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|158304538|gb|ABW26155.1| excinuclease ABC, C subunit [Acaryochloris marina MBIC11017] (626 aa)
Score = 653, Expect = 5.7e-66, Identities = 169/584 (28%), Positives = 329/584 (56%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF--LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDST-KKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK--LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKN-DEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYE--YYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNA-VEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANS----DYDYMKEVIYRRYKNNTAS-------FGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAKEI 586
           ++++ +LK+IP +PG Y  +D N  ++Y+GK+  L NR++ YF  ++D   + + + +++ D++++V + E E+L LE NLI +++P +N+LL++   +PY+ VT  + +PRI  +      K +  YYGP+ +    +  L   + R+FPLR+  K    ++ C+ Y+IG+C G C   +T + Y   L+++   F G++  +   L  +  QAAE L FE + +  +  K L+     Q +         D I     + +  + +F+  +G L+ +   +    S    ++L  + E  Y S   +ELP  + +     + + L+  L      K+    P + +K ++++    NA  E+ + +      +++R LN+L++L +LLD+ +L +R+E +D S+I  ++ V + VV+ +G+  K  YR++ I++ +  +    D+  + EV++RR++    S         + P+L+++DGGK Q+ A LESL  +E+   + +I LA   K + +     +   +  D +      +  ++DE HRFAISF+R K+ + +  + L  I  LG  R ++LL  + ++D I+EAS E+L  +  I  ++A++I
  S:    15 DRLEARLKEIPPEPGVYFMRDANDDILYIGKSKKLRNRVRSYFRQIQDHPPRIELMVHQVADIEFIVTDTEAEALALEANLIKQHQPHFNVLLKDDKKYPYLCVTWSQTYPRIFITRKRRLGKAQDKYYGPYVDVWQLRQTL-RLVKRLFPLRQRRKPLFKDRPCLNYEIGRCPGVCQALITPEAYRQILQKVVMIFQGRTSELINTLSLQMEQAAEDLNFEQAARLRDQIKGLQGLGVDQKVALPDDTVSRDAIALAADDQIACVQLFQIRSGRLVGRLGFMADAQSGSLGMILQHVLEAHYGSAEPVELPLEILVQTELPETELLASYLSQRKERKVSITCPQRQIKAELIEMVERNAQYELARTQ-----KSRDRTLNALQDLAELLDLPELPHRIECYDISHIQGSDAVASQVVFIDGLPAKQHYRRYKIRNPNVKAGHSDDFASLAEVLHRRFRQYHLSPEQPRQGTSDWPDLVVIDGGKGQLSAVLESLTKIEVVEDLQIISLA---KQREEIFQPGESQPLPTDPEQPGVQLIRRLRDEAHRFAISFHRKKRLERMRRSRLDDIPGLGHHRQKELLAAFRSIDYIREASPEQLKAVPTIGPQLAQKI 619
>gi|196477485|gb|ACG77013.1| UvrC, excinuclease ABC, C subunit [Phenylobacterium zucineum HLK1] (662 aa)
Score = 652, Expect = 6.1e-66, Identities = 170/573 (29%), Positives = 309/573 (53%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEI---CDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD------EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK---NNTASFGEI--PNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           IKD+++++P +PG Y    ++G V+YVGKA  L  R+ QY        T+++A+ +     +++V    E ++LLLE NLI + KP++N+LLR+  +FP I++ ++     L  H     IKG Y+GPFA++      L N + + F LR C+    +   + C+ + I +C  PC   ++ +DY   + E   F  GKS+++ E++  +   AAE L FE + +  +  + L   ++ Q I     ++ D+   + +     + +F +  G           ++  +D      +++   + ++Y    I  P+ + +++   + + LSE+       K++   P +G K+ ++  A  NA E +  K  +  S Q++ L  + E   L    +  R+E++DNS+I  TN VG M+V       K++YRKFNI+  +     DY  M+EV+ RR+          GE   P+L+++DGG+ Q+ AA+E +  L +D  IPV+G+AK  D     +R          L+ KS + ++L  ++DE HRFAI  +R +++  + +N L +I  +G  R   LL  + +   +  ASV +L+++
  S:    57 IKDEVRRLPDRPGVYRMIGEDGEVLYVGKARSLKKRVLQY--AQGRFHTQRIAHMVDLTRAMEFVTTRTETDALLLEINLIKQLKPRFNVLLRDDKSFPEIVIRRDHAAPQLRKHRGAHSIKGDYFGPFASAWAVNRTL-NTLQKAFLLRSCSDSVYETRTRPCMLHQIRRCSAPCTGLISLEDYNALVDEAGAFLRGKSRAVMERMAGEMQAAAEDLEFERAARLRDRIRALASVAQEQQINPETVDEADVFALHAEGGQACVQVFFFRAGQNWGN----RAYFPRVDKSDEDPDVMGAFLGQFYDDKPI--PRMILVNVVPAECELLSEAFCQKSGRKVEISRPQRGEKRQIVQHALTNAREALGRKMAE-SSAQSKLLAGVCEAFGLEGSPE--RIEVYDNSHIMGTNAVGGMIVAGPEGFQKSQYRKFNIRSSELTPGDDYGMMREVLRRRFSRLVKEEEEGGEAVRPDLVLIDGGRGQLDAAMEVMADLGVDD-IPVVGVAKGPDRDAGLERFFMPGKEPFMLEPKSPVLYYLQRLRDEAHRFAIGSHRTRRAMDMKKNPLDEIDGVGPGRKRALLHTFGSARGVSRASVADLAKV 644
>gi|148269795|ref|YP_001244255.1| excinuclease ABC, C subunit [Thermotoga petrophila RKU-1] >gi|189038126|sp|A5IKF6|UVRC_THEP1 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|147735339|gb|ABQ46679.1| Excinuclease ABC subunit C [Thermotoga petrophila RKU-1] (557 aa)
Score = 652, Expect = 6.2e-66, Identities = 186/586 (31%), Positives = 329/586 (56%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIK-GTYYGPFANSNIKKYELYNFINRIFPLRKCN---KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGV-KKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIV-PIEVAKEI 586
           M E+I+ K+   P +PG Y++K+K G+ IY+GKA  L++R++ Y L  +  K  ++  E  +++ +VV NE E+ +LE NLI KY+PKYN+ L+++N +PYI ++ +E P   Y     +K++ GTY+GP+ +    +  L   + +I   R C    K   + C  Y +G+C GPCI  +  + +   ++ + +F SG  + + + L++K    +  L FE++ KY +L  NL    E Q ++F +    D++           V+ +  NG L+ K     + +      +   I EYY     ++PKT+ L    +++     SL  +++ P +   ++D+++ A  N    +K + L+          +LEEL KLL++KD  YR+E  D S++     V ++VV+E+G   K++YR++ I ++D   DY+ ++ V+ RRY  +      +PNL+ VDGG  QV AA+E+LK  E+    PV+GLAK ++      V ++  EIKL     +   L+ I+DE HRFA+S++R ++ K    + L  +  +G  R +KL+E + +L+ I+ AS+EE+++++   E+AK I
  S:     1 MKEKIRKKILLAPEEPGVYIFKNK-GVPIYIGKAKRLSSRLRSY-LNPQTEKVFRIVEEADELETIVVMNEREAFILEANLIKKYRPKYNVRLKDTNFYPYIRISDDEIP---YVEIVKRKLRDGTYFGPYTSVQFVR-NLLEILQKIMGFRTCKSDLKRIKRPCFLYHLGRCTGPCIGNI--ESHGEAVRRLKEFLSGNMEEVFDYLKEKMETHSRMLDFENAAKYRDLLLNLSNVLESQGVVFEESISCDVLVHAHD----LFVVLRVRNGYLVGK-----ISFEMEGGNVEDFIREYYVSGRGDIPKTLILESDLDEMDY--SSLGFEYVGPPRSTTEEDLLEKAKKNLENELKMRGLRK--------EALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKSDYRRYKI-EQDHPDDYESIRTVVKRRYSKHP-----LPNLLFVDGGIGQVNAAVEALK--EIGKDCPVVGLAKKEE-----TVVFENREIKLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDSVPGIGPIRKKKLIEYFGSLENIRSASLEEIARVIGSAEIAKRI 553
>gi|15641227|ref|NP_230859.1| excinuclease ABC subunit C [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121729871|ref|ZP_01682299.1| excinuclease ABC, subunit C [Vibrio cholerae V52] >gi|147674383|ref|YP_001216784.1| excinuclease ABC subunit C [Vibrio cholerae O395] >gi|153224464|ref|ZP_01954461.1| excinuclease ABC, subunit C [Vibrio cholerae MAK 757] >gi|194531328|ref|YP_002066791.1| excinuclease ABC, subunit C [Vibrio cholerae MO10] >gi|189038129|sp|A5F1X2|UVRC_VIBC3 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|21264129|sp|Q9KSP2|UVRC_VIBCH UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|9655694|gb|AAF94373.1| excinuclease ABC, subunit C [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121628380|gb|EAX60880.1| excinuclease ABC, subunit C [Vibrio cholerae V52] >gi|124117602|gb|EAY36345.1| excinuclease ABC, subunit C [Vibrio cholerae MAK 757] >gi|125617238|gb|EAZ45816.1| excinuclease ABC, subunit C [Vibrio cholerae MO10] >gi|146316266|gb|ABQ20805.1| excinuclease ABC, subunit C [Vibrio cholerae O395] (610 aa)
Score = 652, Expect = 6.7e-66, Identities = 183/575 (31%), Positives = 306/575 (53%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKK-VTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYY--SKIAIELPKTVYLSLSDEKLKTLSESLKIKF-----------LNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLK--FLELDSIIPVIGLAKDDKHKT--DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           LK + ++PG Y   +    VIYVGKA DL  R+  YF K+ D  KTK L + I  +D  V + E E+L+LE+N I +Y PKYN+LLR+  ++PYI ++  +HPR L SH   KK +G Y+GP+ +S   + E  + I +IFP+R+C         + C+ Y IG+C GPC+K  ++ Q Y+  +  +  F  GK   +   L +K  QA+ +L FED+ K  +  + ++   E+Q +      D D++GF  +  +  I I     G +L   S +  I    S++ E+  + + +YY     A  +P  + L   +  L   +E+L+I             +NP+ G +   +  A  NA+  +  K    ++   R     + LQ+ L +  + RME FD S+    + + + VV+      K EYR++NI       DY  M +V+ RRY     S  +IP++I +DGGK Q+  A E +   + +      +IG+AK    K   + ++  D  E  L   +     + +I+DE H  AI+ +R ++ K+   ++L  I+ +G  R + LL+    + ++K ASVEE++++  I  A
  S:    11 LKTVTNQPGVYRMYNAEAEVIYVGKAKDLKKRLTSYFRKNLDSEKTKALVSNIAKIDVTVTHTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFLSAHKHPR-LSSHRGAKKRRGEYFGPYPDSGAVR-ETLHLIQKIFPVRQCEDTVYSNRTRPCLMYQIGRCAGPCVKGLISDQGYQEIVHYLRLFLQGKDNQVLSILVEKMEQASRELRFEDAAKARDQIQAIRRVQEQQFVSDDSLEDLDVLGFAQENGIACIHILMIRQGKVLGSRSHFPKIPSDTSQV-EVFESFLSQYYLSHSEARSIPARIIL---NRGLTEETEALQIAISELAGRKVTFHVNPT-GTRGRYLKLANTNALTAITTKMNHKMTISQR----FKALQEELGMDAITRMECFDISHTMGESTMASCVVFNQEGPLKQEYRRYNITGITGGDDYAAMAQVLERRYSKQLDS-SKIPDIIFIDGGKGQLNRAYEIISSCWQDWPKYPKIIGIAKGVTRKPGLETLITIDGDEFHLPSDAPALHLIQHIRDESHNHAIAGHRAQRGKTRRTSTLEGIEGVGPKRRQALLKYLGGMQELKRASVEEIAKVPGISHA 599
>gi|150421954|gb|EDN13928.1| excinuclease ABC, subunit C [Vibrio cholerae AM-19226] (610 aa)
Score = 652, Expect = 6.9e-66, Identities = 183/575 (31%), Positives = 306/575 (53%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL-KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKK-VTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYY--SKIAIELPKTVYLSLSDEKLKTLSESLKIKF-----------LNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLK--FLELDSIIPVIGLAKDDKHKT--DRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           LK + ++PG Y   +    VIYVGKA DL  R+  YF K+ D  KTK L + I  +D  V + E E+L+LE+N I +Y PKYN+LLR+  ++PYI ++  +HPR L SH   KK +G Y+GP+ +S   + E  + I +IFP+R+C         + C+ Y IG+C GPC+K  ++ Q Y+  +  +  F  GK   +   L +K  QA+ +L FED+ K  +  + ++   E+Q +      D D++GF  +  +  I I     G +L   S +  I    S++ E+  + + +YY     A  +P  + L   +  L   +E+L+I             +NP+ G +   +  A  NA+  +  K    ++   R     + LQ+ L +  + RME FD S+    + + + VV+      K EYR++NI       DY  M +V+ RRY     S  +IP++I +DGGK Q+  A E +   + +      +IG+AK    K   + ++  D  E  L   +     + +I+DE H  AI+ +R ++ K+   ++L  I+ +G  R + LL+    + ++K ASVEE++++  I  A
  S:    11 LKTVTNQPGVYRMYNAEAEVIYVGKAKDLKKRLTSYFRKNLDSEKTKALVSNIAKIDVTVTHTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFLSAHKHPR-LSSHRGAKKRRGEYFGPYPDSGAVR-ETLHLIQKIFPVRQCEDTVYSNRTRPCLMYQIGRCAGPCVKGLISDQGYQEIVHYLRLFLQGKDNQVLSILVEKMEQASRELRFEDAAKARDQIQAIRRVQEQQFVSDDSLEDLDVLGFAQENGIACIHILMIRQGKVLGSRSHFPKIPSDTSQV-EVFESFLSQYYLSHSEARSIPARIIL---NRGLTEETEALQIAISELAGRKVTFHVNPT-GTRGRYLKLANTNALTAITTKINHKMTISQR----FKALQEELGMDAITRMECFDISHTMGESTMASCVVFNQEGPLKQEYRRYNITGITGGDDYAAMAQVLERRYSKQLDS-SKIPDIIFIDGGKGQLNRAYEIISSCWQDWPKYPKIIGIAKGVTRKPGLETLITIDGDEFHLPSDAPALHLIQHIRDESHNHAIAGHRAQRGKTRRTSTLEGIEGVGPKRRQALLKYLGGMQELKRASVEEIAKVPGISHA 599
>gi|139439822|ref|ZP_01773199.1| Hypothetical protein COLAER_02230 [Collinsella aerofaciens ATCC 25986] >gi|133774837|gb|EBA38657.1| Hypothetical protein COLAER_02230 [Collinsella aerofaciens ATCC 25986] (601 aa)
Score = 652, Expect = 7.3e-66, Identities = 174/548 (31%), Positives = 302/548 (55%)
  Q:    41 IKQYF-LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEE-HPRILYSHDSTKKIKGT-YYGPFANSNIKKYELYNFINRIFPL--------RKCNKL-----------------PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLT--LIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIK------FLNPSKGVKKDVMDTAFNNAVE-----IMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDE-DANSDYDYMKEVIYRRYKNNTAS---FGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEIKK 588
           ++QY  L+D   K   +   +   DY+VV  E+E+L+LE NLI +Y P +N+ L++  ++P+I +TK +  P I Y+ +  K   GT Y+GP+ +S   + E  + + ++ P+        R+C ++                   + C  Y +G+  G C+  ++  DY   +K +  F SG  K + ++L  +  +AAE L FE + +     + ++   +RQ ++F    D D+IGFY +E + +  +F    G  +   + I     ++DE  L    +  YY + A ++P  + LS+  E  + L E L  K         P +G K  ++D A  NA       +M+  Y    +NQ               +    R+E FD S +  T  V +MVV+ NG  +K +YR+F I+ E D  +D+  M EV+ RRY     +   FG  P+L++VDGGKPQ+ AA++ L+ L LD  IPV GLAK D+   +  V WD + + L   S   + +  ++DE HRFAI+F+R  + K++  + L  +  +G TR   ++  + ++ +++ AS +E++++  VP +VAK + +
  S:     1 MRQYVTLQDERQKIPLMMQLVASFDYIVVETEHEALVLERNLIGQYHPYFNVDLKDDKSYPFIAITKSDLFPAIKYTRERHKP--GTRYFGPYTDSRAAR-ETIDTLRKVIPICSASCAEWRRCRRIVESHKGEEDIVNMICAQNGRPCFDYHVGRGPGACVGAISPADYAKNVKRVERFLSGHRKDVVDELTSEMTEAAETLDFERAARVKRRLEVIRGLDDRQQVVFPSSVDIDVIGFYREETISAACVFVVREGRTVRTCEFILDKGLDVDEEELQSGFLKRYYDETA-DIPAEINLSVELEDAEALGEWLAGKRERSCHLHRPQRGEKHRLLDMASKNARHALMRYMMRTGYADDRTNQALLELESALALPAPPL----RIECFDISTLHGTFTVASMVVFTNGRADKGQYRRFKIQAELDEANDFVSMSEVLGRRYAPERMADERFGSRPDLLVVDGGKPQLTAAIKQLEALGLD--IPVCGLAKADE---EVFVPWDETPVVLPTGSASLYLIKQVRDESHRFAITFHRELRDKAMTVSVLDDVPGVGPTRKRAIMRHFGSMKRLRAASEQEIAEVRGVPADVAKAVHE 582
>gi|163745640|ref|ZP_02153000.1| excinuclease ABC subunit C [Oceanibulbus indolifex HEL-45] >gi|161382458|gb|EDQ06867.1| excinuclease ABC subunit C [Oceanibulbus indolifex HEL-45] (622 aa)
Score = 651, Expect = 8.5e-66, Identities = 181/573 (31%), Positives = 299/573 (52%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL-KDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKE-EHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK----LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRYK-----NNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLA--------KDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           I+  LK +   PG Y   D    V+YVGKA +L  R+  Y        +  ++      + ++    E E+LLLE NLI + KPK+N+LLR+  +FP ILVT + ++P+I   H   KK KG+YYGPFA++      L N + R+F LR C+        + C+ + I +C  PC+ K++ +DY   +++   F SGKS  I  +L +   +A+E + FE +    +  K L      Q I     N+ DII  + +     + +F           D      +++D  E+L   I ++Y     E P+ + LS   E    ++E+L      K++ L P +G K +++D A  NA E +  K  +  + Q + L  L E   L   +   R+E++DNS+I  TN VGAM+V       KN+YRKFNI+ +D     D+  MKEV++RR+K     +   S G  P+L+++DGG  QV A    +    ++  IP++G+A        K++ H+  + V      + L     + +F+  ++DE HRFAI  +R K++K +    L  +  +G  R   LL  + +   +  A++ +L  +
  S:    16 IQAYLKSLDSSPGVYRMLDSESRVLYVGKARNLRARVSSYARPTGHSGRISRMIANTASMMFLTTKTETEALLLEQNLIKQLKPKFNVLLRDDKSFPNILVTADHDYPQI-KKHRGAKKEKGSYYGPFASAGAVNRTL-NQLQRVFLLRDCSNSMFDSRTRPCLQHQIKRCSAPCVGKISAEDYRQTVRDAERFLSGKSTEIQGRLARDMAEASEAMEFERAAALRDRIKALTQVQTAQGINPQGVNEADIIALHMEGGQACVQVFFIRANQNWGNRDYYPRVGADVDAAEVLEAFIGQFYD--TREPPRQLILSNEIENPDLMAEALSGKIGRKVELLVPQRGEKAELVDGALRNARESLARKMAE-TATQTKLLQGLVEAFDL--PRSPERIEVYDNSHIQGTNAVGAMIVAGPEGMMKNQYRKFNIRGDDLTPGDDFGMMKEVLHRRFKRLIKEDPDRSRGLWPDLLLIDGGAGQVSAVASIMAQHGVED-IPMVGVAKGIDRDAGKEEFHRVGKRV------MALRHNDPVLYFVQRLRDEAHRFAIGTHRAKRAKGISATPLDDVPGVGAARKRALLAHFGSAKAVGRANLSDLKAV 603
>gi|183221458|ref|YP_001839454.1| excinuclease ABC subunit C [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189911545|ref|YP_001963100.1| Excinuclease ABC, subunit C [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167776221|gb|ABZ94522.1| Excinuclease ABC, subunit C [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167779880|gb|ABZ98178.1| UvrABC system protein C (UvrC protein; Excinuclease ABC subunit C) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (614 aa)
Score = 651, Expect = 8.7e-66, Identities = 183/575 (31%), Positives = 319/575 (55%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILV-TKEEHPRILYSHDSTKKIKGT---YYGPFANSNIKKYELYNFINRIFPLRKCN-KLP----NKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLS---------DEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYR-MEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           + I++K+K +   PGCYLWK++ G VIYVGKA+ L +R++ Y   + +D KT+ L  E+ D+D++    E E+LLLE  LI KY PK+N+ L++   +P++ V T E++P +      T+K+K     Y+GPF +    +  L   I+RIFP+RK   KLP     + C+ + +G+CLGPC   VT+  Y   + EI  F  GK + +   L+K  + A+ K+ +E +    +  + +    E+Q ++     DEDI+G   +E+   I+I +   G L  K  + L  + +S+ +E   + + +YY  + + LP  VYL  S         +  L+    S+K+KF  P  G KK ++  A  NA   +  + L   +    +  +++ELQ+ L++  L R +E +D S+   +  V + V++  G   K  YR + ++  +  +D   + EVI RR  +       +P+LI++DGG  Q+  A E+   L+L   IP++GLAK  +       K  +S    D+ S +   L N++DE HRF ++F R ++ K   ++ L  I ++G +R + +L  ++   K+ +A+ +EL ++
  S:     8 KTIQEKIKNLGSLPGCYLWKNELGQVIYVGKALKLQSRVRSYLNPNQKDRKTRALFVELYDLDWIATGTEKEALLLEATLIKKYNPKFNVRLKDDKKYPFLCVSTSEDYPMVFL----TRKVKDNGDRYFGPFTDVKAARDTL-ELIHRIFPIRKTKLKLPLPKPQRPCLNFHMGRCLGPCQGNVTKDTYSELVDEILRFLEGKKERLVADLKKAMMDASSKMEYERAGFLKQRIEKINQLREKQTVVSMDGGDEDILGISKREDEGQILILEVRGGRLEGKKSFPLTGLSFSDDEEAFTSFLRDYYLNVTV-LPSVVYLPTSAKGNYDVFLEAILEKFGTSIKLKF--PEMGPKKSLLRLAEKNADLSLTERILA--TKLRDQTVAMKELQEKLNLPTLPRTIECYDISHFQGSLPVASGVMFVEGKPYKPGYRHYKMRGYEGINDPGMIHEVIARRLSHLVNEEEPLPDLIVIDGGLTQLSRAAEAANALDLGH-IPMVGLAKKREEIYFPGEKHPYS---FDQHSPMMRLLRNLRDEAHRFGVTFQRLQRKKKALKSILDDIPDIGASRRKSILMYFQAKKKVTDATRQELEKV 590
>gi|113954278|ref|YP_730568.1| excinuclease ABC subunit C [Synechococcus sp. CC9311] >gi|119367853|sp|Q0IAF4|UVRC_SYNS3 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|113881629|gb|ABI46587.1| excinuclease ABC, C subunit [Synechococcus sp. CC9311] (651 aa)
Score = 651, Expect = 9.3e-66, Identities = 174/585 (29%), Positives = 342/585 (58%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIK-GTYYGPFANSNIKKYELYNFINRIFPLRKCNK--LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKN-DEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDE--ILLTLIYEYYSKI-AIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQL-ISNQNRELNSL--EELQKLLDIKD-LYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANS----DYDYMKEVIYRRYKN----------------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLL-NIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEIK 587
           E+++ +LK IP +PGCYL +D +  ++YVGK+  L +R++ YF    DL  + + +  +IC+++++V ++E E+L LE+NLI   +P +N+LL++   +PY+ +T  E++PRI  +     +     +YGP+ +  + +  L+  + R+FPLR+  +   PN+ C+ Y IG+C G C +KV+ +DY   L+++   F G+S  + + L ++  + AE+L FE + +  +  + +   +  Q +     +   D++     ++  +I +F+   G L+ +        ++L    IL  +I E+YS++ A+E+P  V +     + + ++E L      K++ L+P +  K D++D        +M+N   +L  + Q++E  +L  E+L +LL++     R+E +D S+I  ++ V + VV+ +G+  K  YR++ I+     +    D+  M E++ RR++                       N     + P+++++DGGK Q+ A +E+L+ L+L   + V  LAK    + + I   +  +    +   L   LL  ++DE HRFA++F+R ++ + +  + L  I  LG  R+  LL  ++++D I+ ASV++L Q   V + +AK+I+
  S:    10 ERLEQRLKDIPTEPGCYLMRDADDRLLYVGKSKTLRSRVRSYFRSSHDLSPRIRLMVRQICEIEFIVTDSEAEALALESNLIKNQQPHFNVLLKDDKKYPYLCITWSEDYPRIFITRRRRFRSPLDRFYGPYVDVGLLRRTLF-LVKRVFPLRQRPRPLYPNRTCLNYSIGRCPGVCQEKVSSEDYHQILRKVAMVFQGRSDELRQLLNQQMERYAERLDFESAARIRDQLQGIDQLTADQKMSLPDASVSRDVLAVAQDDHFAAIQLFQMRAGKLVGRLGF-AADATDLQAGLILQRVIEEHYSQVDAVEIPPEVLVQHELPQQRLIAEWLSEQRERKVQVLHPQRRQKADLIDL-------VMRNAEFELGRARQSQEQQALANEDLAQLLELATPPRRIEGYDISHIQGSDAVASQVVFIDGLPAKQHYRRYKIQSSSIQAGHSDDFMAMAEIMRRRFRKWARVKAEGADLDQVRRQSSSSLNMDGLHDWPDVVMIDGGKGQLSAVMEALRELDLHEDLVVCSLAK----QREEIFLPEAKQPLESEPDQLGVSLLRRLRDEAHRFAVTFHRQQRGQRMKRSRLSDIPGLGPKRVRDLLAHFQSIDAIQLASVDQLHQAPGVGLSLAKQIR 630
>gi|170288481|ref|YP_001738719.1| excinuclease ABC, C subunit [Thermotoga sp. RQ2] >gi|170175984|gb|ACB09036.1| excinuclease ABC, C subunit [Thermotoga sp. RQ2] (557 aa)
Score = 651, Expect = 9.7e-66, Identities = 185/586 (31%), Positives = 331/586 (56%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIK-GTYYGPFANSNIKKYELYNFINRIFPLRKCN---KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGV-KKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIV-PIEVAKEI 586
           M E+I+ K+     +PG Y++K+K G+ IY+GKA  L++R++ Y L  +  K  ++  E  +++ +VV NE E+ +LE NLI KY+PKYN+ L+++N +PYI ++ +E P   Y     +K++ GTY+GP+ +    +  L   + +I   R C    K   + C  Y +G+C+GPCI  +  + +E  ++++ +F SG  + + + L++K    ++ L FE++ KY +L  NL    E Q ++F +  + D++           V+ +  NG L+ K        S  D      I EYY     ++PKT+ L    +++     SL  +++ P +   ++D+++ A  N    +K + L+          +LEEL KLL++KD  YR+E  D S++     V ++VV+E+G   K++YR++ I ++D   DY+ ++ V+ RRY  +      +PNL+ VDGG  QV AA+E+LK  E+    PV+GLAK ++      V ++  EI L     +   L+ I+DE HRFA+S++R ++ K    + L  +  +G  R +KL+E + +L+ I+ AS+EE+++++   E+A+ +
  S:     1 MKEKIRKKILLASEEPGVYIFKNK-GVPIYIGKAKRLSSRLRSY-LNPQTEKVFRIVEEADELETIVVMNEREAFILEANLIKKYRPKYNVRLKDTNFYPYIRISDDEIP---YVEIVKRKLRDGTYFGPYTSVQFVR-NLLEILQKIMGFRTCKSDLKRIKRPCFLYHLGRCIGPCIGNI--ESHEEAIRKLREFLSGNMEEVFDYLKEKMETHSKMLDFENAAKYRDLLLNLSNVLESQGVVFEENINCDVLVHAHD----LFVVLRVRNGYLVGKISFEMEGGSVED-----FIREYYISGRGDIPKTLILESDLDEMDY--SSLGFEYVGPPRSTTEEDLLEKAKKNLENELKMRGLRK--------EALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKSDYRRYKI-EQDHPDDYESIRTVVKRRYSKHP-----LPNLLFVDGGIGQVNAAIEALK--EIGKDCPVVGLAKKEE-----TVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRV 553
>gi|33861439|ref|NP_893000.1| excinuclease ABC subunit C [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|81576027|sp|Q7V1I9|UVRC_PROMP UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|33634016|emb|CAE19341.1| Excinuclease ABC subunit C (UvrC) [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (656 aa)
Score = 650, Expect = 1.0e-65, Identities = 190/573 (33%), Positives = 339/573 (59%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKK--LANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDSTKKIK-GTYYGPFANSNIKKYELYNFINRIFPLRKCNK--LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKN-DEDIIGFYCKENVISIVIFKYVNGSLLSKYDLIT-VFYSELDEILLTLIYEYYSKI-AIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDA----NSDYDYMKEVIYRRYKNNTA---SFGEI-------------------PNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE-IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           +K +L +IP   GCYL+KD +  ++Y+GK+  L NR+  YF    +L  +   +  +I +++ +V ++E E+L LE+NLI   KP +N+LL++   +PY+ +T  E++PRI  +     +     YYGP+ +  + +  L+  I +IFPLR+  +    ++ C+ Y IG+C G C + ++ +DY+  +K+++  F G++  ++  LE+K  Q +  L FE++ K  +    LK+ +E Q I     + + DI G   + N+ SI IF+  +G L+ +      +  S+  EIL  ++ E+Y  +  +E+P  + L  +  K  T+ E L      K+K + P +  K + ++    NA    K +  ++++      +S+E+L ++L++ +   R+E +D S+I  T+ V + VV+ +G+ +K  YRK+ IKD +     + D+  + EVIYRR+K  +      G+I                   P+LI++DGGK Q+ AAL++L  L+L   + +  LAK    K + I    FS+ +  D+       L  ++DE HRFA+SF+RNK+S  +  + L +I  LG +RI+ LLE + ++D I+ AS EELS++
  S:    32 LKSRLSEIPKSSGCYLFKDIDNNLLYIGKSKTLRNRVSSYFNNYAELSPRLSLMVRQITEIEIIVTDSEYEALNLESNLIKTNKPYFNILLKDDKKYPYLCITWSEQYPRIFITRKRRNRNNFDRYYGPYVDVGLLRKTLF-IIKKIFPLRQRPRPVYKDRTCLNYSIGRCPGVCQEIISSEDYKKTMKQVSMIFQGRNDDLEVFLERKMNQYSNDLEFENAAKIRDQISGLKLLTESQKISIPDSSINRDIFGIVSENNISSIQIFQMRSGKLIGRIGYTQKIDNSDETEILQRVLEEHYINVEGVEIPSEILLQFNLPKHNTIEEWLSELRQKKVKLIIPKRNKKFETVEMVLKNA----KLELERILNGIQDNESSIEDLTQILELTNQPRRIEGYDISHIQGTDPVASQVVFIDGIPSKQNYRKYKIKDPNIFIGHSDDFASIYEVIYRRFKKWSKFKIDGGDISSLQDKKKSTLENDLLTDWPDLIMIDGGKGQLNAALKALTQLDLHEEVNICSLAK----KNEEIFIPGFSKSLDTDQNQKGLLLLRRVRDEAHRFALSFHRNKRSARMNRSQLSQIPGLGPSRIKDLLEHFNSIDAIRIASREELSKV 638
>gi|91776156|ref|YP_545912.1| excinuclease ABC subunit C [Methylobacillus flagellatus KT] >gi|119367669|sp|Q1H0B6|UVRC_METFK UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|91710143|gb|ABE50071.1| Excinuclease ABC subunit C [Methylobacillus flagellatus KT] (599 aa)
Score = 650, Expect = 1.0e-65, Identities = 175/572 (30%), Positives = 297/572 (51%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLI--TVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLK-TLSESL--KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSE----IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           K  LK +P+ PG Y   +    VIYVGKA DL  R+  YF K+    +T+ + + I  ++  V  +E E+LLLENNLI  + P+YN+L R+  ++PYI +T +  PR+ + H   ++   +Y+GPF N+ +   E    + ++F LR C        ++ C+ + I +C  PC+  ++ +DY   +   + F  GK + + ++L +K  +AAEK+ +E +  Y +  ++L+    +Q +     +D D+I     E    + +     G  L            ++L+  +   + ++Y   AI     V  SL    L+   SE    +I+      G K+  +  A  NA   +  +  Q  +NQ   LN+L E   L +  +  R+E FD S+      V + VV++ G    +EYR++NI       DY  M++V+ RRY+   A  G+ P+L+ +DGGK Q+  A+E L  + L   I ++G+AK ++ K   + +  F E    + L K       L  I+DE HRFAI+ +R K+ K+   +SL  I  +G  R + LL ++  LD +K ASV+E++Q+
  S:     5 KPVLKNLPNLPGVYRMINAQDEVIYVGKARDLKKRVSSYFQKNLPSARTRLMVSNIARIETTVTRSEAEALLLENNLIKGFMPRYNVLFRDDKSYPYIALTGDTFPRLAF-HRGAQRKGSSYFGPFPNA-VAVRESIQLLQKVFRLRTCENTVFANRSRPCLLHQIERCTAPCVGFISEEDYRRDVMHASLFLQGKEQQVMDELGEKMNEAAEKMEYELAAVYRDRIQSLRQVQAKQFVSDFNVSDADVIACAELEGQWCVNLVMIRGGHHLGDKSFFPKNADGADLETTMEAFLEQHYMAGAIPPLLIVGASLETAALEEVFSEQAGRRIRINTHPIGDKRVWLKMAHTNAQLALSQRIAQQ-ANQQSRLNALREALGLPESTE--RIECFDISHTMGEATVASCVVFDKGAMQSSEYRRYNITGITPGDDYAAMRDVLTRRYRKVAAGEGKRPDLVFIDGGKGQLGVAVEVLNEVGLPD-IQLVGIAKGEERKPG-LEQMFFPEREEPVSLKKDHPGLHLLQQIRDEAHRFAITGHRAKRGKARMHSSLEDISGIGAKRRKSLLTRFGGLDGVKNASVDEIAQV 583
>gi|196257385|ref|ZP_03155921.1| excinuclease ABC, C subunit [Cyanothece sp. PCC 7822] >gi|196200985|gb|EDX95804.1| excinuclease ABC, C subunit [Cyanothece sp. PCC 7822] (631 aa)
Score = 650, Expect = 1.3e-65, Identities = 182/585 (31%), Positives = 342/585 (58%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLA---NEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDST-KKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK--LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLK-MFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLI--------TVFYSELDEILLTLIYE-YYSKIAIELPKTVYLS--LSDEK--LKTLSE--SLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDA----NSDYDYMKEVIYRRYKNNT-----------ASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAKEI 586
           +E+++++LK+IP +PG Y  +DKNG ++Y+GK+  L +R++ YF ++  + + +LA    ++ D++++V + E E+L LE NLI +++P +N+LL++   +PY+ +T  E++PRI  +        K  YYGP+ ++ + +Y L + I RIFPLR+  K    ++ C+ YDIG+C G C   ++ Q+Y   ++++   F G++  +   L+K+  +AA  L FE +    +  K L+ +FSE++  +       D+I          I +F+   G L+ +            TV  ++   IL  ++ E Y+    +E+P  + L   LSD++   K LSE    K+  + P +  K ++++    NA    K +  +   + +R L ++E+L  +LD++ +  R+E +D S+I  +N V + VV+ +GV  K  YR + IK+ +     + D+  + EVI RR++  +               ++P+LI++DGGK Q+ A +E L+ L L S + V+ LA   K + +  +  +   +  D +      L  ++DE HRFA+SF+R ++      + L +I  LG  R ++LL  + ++D I++A+V +L ++  I  ++A+EI
  S:     8 SEKLENRLKEIPLEPGVYFMRDKNGDILYIGKSKKLRSRVRSYF-RNFPVLSPRLALMVQQVADIEFIVTDTEAEALALEANLIKQHQPYFNVLLKDDKKYPYVCITWSEDYPRIFITRKRRLDNEKDRYYGPYVDTGLLRYTL-SIIKRIFPLRQRPKPLFKDRPCLNYDIGRCPGVCQLLISSQEYHKTVQQVAMIFQGRTGELIHTLQKQMEEAANGLNFEKAAVIRDQIKALESLFSEQKVALPDDTVSRDVIAGAADGQHCCIQLFQIRAGRLVGRLGFFVDIKQPDETVTQTDQGAILQRVLEEHYWLADPVEIPSEILLQYPLSDQESLKKWLSERKGKKVNLIVPQRQTKAELIEMVQRNA----KYELERTQRHSDRNLKAMEDLAAILDLEAVPKRIEGYDISHIQGSNAVASQVVFIDGVAAKQHYRHYKIKNPEVKIGHSDDFASLAEVIRRRFRKYSQKTSPPTPFLQGEGSDLPDLIMIDGGKGQLSAVVEVLQELNLLSELRVVSLA---KQREEIFLPGESEPLATDAEQPGVQLLRRVRDEAHRFAVSFHRQQRITHSRRSRLDEIPGLGFGRQKQLLAHFHSVDYIRQATVSQLMEVSGIGEQLAQEI 624
>gi|56698457|ref|YP_168831.1| excinuclease ABC subunit C [Silicibacter pomeroyi DSS-3] >gi|81348818|sp|Q5LMC7|UVRC_SILPO UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|56680194|gb|AAV96860.1| UvrABC system protein C [Silicibacter pomeroyi DSS-3] (623 aa)
Score = 650, Expect = 1.3e-65, Identities = 173/573 (30%), Positives = 291/573 (50%)
  Q:     5 IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD------EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDED--ANSDYDYMKEVIYRRY-----KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           I+D L+ +   PG Y   D    V+YVGKA +L  R+  Y       + +++  E   + ++    E E+LLLE NLI + KPKYN+LLR+  +FP ILV K+     +  H   KK KGTY+GPFA++      L N + + F LR C     +   + C+ Y I +C  PC+  ++ QDY   +K+   F SG+S  + E+L ++ + A+E + FE +    +  + L      Q I      + D++  + +     + +F           D    FY  +       E++   + ++Y     E P+ + LS + E    ++E+L      K++ L P +G K +++  A  NA E +  + +   + Q + L  L E   L       R+E++DNS+I  TN VG M+V       KN+YRKFNI+ +D     D+  MKEV+ RR+     ++     G  P+L+++DGG  QV A  E +    +   IP++G+AK  D  H  +   +       L +   + +F+  ++DE HRFAI  +R K++K++    L  I  +G  R   LL  + +   +  A + +L+ +
  S:    19 IQDYLRNLSGAPGVYRMLDAQARVLYVGKARNLKARVSNYARPGHSPRIERMIRETASMMFLTTRTETEALLLEQNLIKQLKPKYNVLLRDDKSFPNILVAKDHSFAQIKKHRGAKKEKGTYFGPFASAGAVNRTL-NQLQKAFLLRNCTDAVFESRTRPCLLYQIKRCSAPCVGLISDQDYAAAVKDAERFLSGRSTRVQEELAEQMMAASEAMEFERAAALRDRIRALTTVQGTQGINPRGVAEADVVALHLENGQACVQVFFIRANQNWGNRD----FYPRVGEDVSAAEVMEAFLGQFYDN--KEPPRQLILSDAIENADLMTEALSEKAGRKVELLVPQRGEKAELVSGALRNARESLARR-MSESATQTKLLGGLAEAFDLDGPPQ--RIEVYDNSHIQGTNAVGGMIVAGPEGFLKNQYRKFNIRGDDLTPGDDFGMMKEVLTRRFTRLLKEDPDRDKGLWPDLLLIDGGAGQVSAVHEIMMAHGVQD-IPMVGVAKGIDRDHGKEEFHRTGQRPFALKRNDPVLYFIQRLRDEAHRFAIGTHRAKRAKAVSATPLDDIPGVGAARKRALLAHFGSAKAVSRADLADLTAV 605
>gi|190149548|ref|YP_001968073.1| UvrABC system protein C [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|189914679|gb|ACE60931.1| UvrABC system protein C [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (610 aa)
Score = 649, Expect = 1.5e-65, Identities = 185/571 (32%), Positives = 310/571 (54%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQ-DYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVF--YSELDEILLTLIYEYY----------SKIAIELPKTVYLSLSDEKLKTLSESLKIKFLNPSKGVKKD---VMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLEL--DSIIP-VIGLAKDDKHK----TDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVP 579
           L  +PH PG Y   D    +IYVGKA DL  R+  YF       KT+ L   I  ++  + ++E E+LLLE+N I + +PKYN+LLR+  ++PYIL+TK +HPRI  S   +KK+ G Y+GP+ N+   + E  N + ++FP+R+C     K  ++ C+ Y IG+CL PC++    Q +Y+  +  +  F  GK   + E L +K   AA++L FE + ++ +  ++++   E+Q +   + +D DII    +  +  + I    +G +L            ++L E+  T + ++Y          ++I I+ P +   +L++     LSE    K     K ++ D    +  A  NA   +  +  Q    + R     + L+ LL++ ++ RME FD S+      V + VV++     K++YR+FNI+      DY  M++ + +RY  +     +IP++I +DGGK Q+  ALE+   L +  D   P +IG+AK  + K    T  I KWD  EI L   S     + +I+DE H  AI+ +R K+ K+  E+ L  I  +G  R + LL+    +  +K A++EE+ Q VP
  S:     8 LADVPHLPGVYRMYDAKNTIIYVGKAKDLKKRLSSYFRSQLASKKTEALVANIHHIETTITHSETEALLLEHNYIKENQPKYNVLLRDDKSYPYILLTKHQHPRIT-SFRGSKKVAGEYFGPYPNAGAVR-ETLNLLQKLFPIRQCEDSYYKNRSRPCLQYQIGRCLAPCVEGYYSQAEYDNQVNLVRLFLQGKDGQVVEHLVQKMENAAQELDFEAAARFRDQIQSVRAVQEKQFVSNERLDDLDIISIAYQHGIACVHILFVRHGKVLGNRSYFPKVPNNTDLTELADTFVGQFYLQMNQHRTIPNQIIIDQPLSEATALAN----VLSEQAGHKVSIADKNIRGDKSRYLALAKTNAEAALTLQLKQDTHIRQR----YDSLKALLNLAEIKRMECFDISHTMGNQTVASCVVFDENGPLKSDYRRFNIEGITGGDDYAAMEQALLKRYGRHLEE-EKIPDIIFIDGGKGQLNRALETFASLNVSWDKRKPLLIGVAKGVERKAGLETLLISKWD-KEIHLPPDSPALHLIQHIRDESHNHAITGHRKKRQKAFTESGLESIAGVGAKRRQALLKYLGGMQGVKSATLEEI-QSVP 593
>gi|27382581|ref|NP_774110.1| excinuclease ABC subunit C [Bradyrhizobium japonicum USDA 110] >gi|81734657|sp|Q89DG9|UVRC_BRAJA UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|27355753|dbj|BAC52735.1| excinuclease ABC chain C [Bradyrhizobium japonicum USDA 110] (686 aa)
Score = 648, Expect = 1.9e-65, Identities = 185/585 (31%), Positives = 307/585 (52%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD--RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEE-HPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDII------GFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDE--DANSDYDYMKEVIYRRYKN-----------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           +E I+  ++  P  PG Y   + N  V+YVGKA ++  R+  Y  +   +  +  ++      V+ V  N E E+LLLE NLI + +P++N+ LR+  +FPYIL+T +   P+IL  H   +   G Y+GPFA++      +   + R F +R C     +  ++ C+ Y I +C GPC +++    Y   ++E  DF SGKS ++ ++L  +  +AA +L FE +  Y +    L     +Q I      + D+       GF C E         + N +   + +    F  E  E+L + + ++Y       PK + LS   E+ + L+ +L      KI+   P +G KK+++  A  NA E +  K L   + Q R L+++     L       R+E++DNS+I  TN VGAM+V       KN+YRKFNIK E      DY  M+EV+ RR+K                F + P+L+I+DGG+ Q+ A  E    L L   + ++ +AK  D     + +   +   IKL+ +  + +F+  ++DE HRF I  +R  + K + E  L +I  +G +R   LL  + TL +I+ AS+ +L ++  V  E A+ I
  S:    69 HEAIERAVRLAPTSPGVYRMLNANADVLYVGKAKNVKKRLSNYARQSAPQPARILRMIAATVTVEIVSTNTETEALLLEANLIKQLRPRFNVQLRDDKSFPYILITGDHWAPQIL-KHRGAQTRPGRYFGPFASAGAVNRTI-TALQRAFLIRSCTDSFFESRSRPCLLYQIRRCAGPCTREIDFPGYTTLVREATDFLSGKSHAVKQELAGEMEKAANELEFETAALYRDRLAALSAIQSQQGINPRTVEEADVFAIHQEGGFSCVEVFFFRTGQNWGNRAYFPRAE--KTFTPE--EVLGSFLAQFYDDKPP--PKNILLSHEIEESELLANALSIKAGHKIEVTAPKRGEKKELVAHALTNAREALGRK-LADTATQGRLLDAMATTLSLPHAPK--RIEVYDNSHIQGTNAVGAMIVAGPDGFVKNQYRKFNIKSEGLTPGDDYGMMREVLERRFKRLINPPEEGAKVKDDDFPQWPDLVIIDGGRGQLNAVREIFANLGLTQ-VSLMSVAKGPDRDAGRETLFMPEREAIKLEPRDPVLYFIQRLRDEAHRFVIGSHRKLRKKDIREAGLQEIPGIGPSRKRALLHHFGTLKEIERASIADLGKVPGVSAESARRI 677
>gi|114563814|ref|YP_751327.1| excinuclease ABC subunit C [Shewanella frigidimarina NCIMB 400] >gi|119367834|sp|Q07ZS6|UVRC_SHEFN UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|114335107|gb|ABI72489.1| excinuclease ABC, C subunit [Shewanella frigidimarina NCIMB 400] (610 aa)
Score = 648, Expect = 2.0e-65, Identities = 182/581 (31%), Positives = 314/581 (54%)
  Q:     6 KDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYF-LKDRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLL---SKYDLITVFYSELDEILLTLIYEYYSKIAIE--LPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAA--LESLKFLELDSIIPVIGLAKDDKHKTD-RIVKWDFSEIKLDKKSD--LYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI--VPIEVAKEI 586
           K  LK +   PG Y   DK+  VIYVGKA DL  R+  YF +   ++KT+ L + I  +D  V ++E ++LLLEN+ I +Y PKYN+LLR+  ++PYIL++  +HPR+ Y H   K+ KG Y+GP+ N    +  L+  I ++FP+R+C+ L     ++ C+ Y + +C  PC+  V+  +Y   +K    F  GK K +  QL  K   AA  + +E + +Y +    L+  +E+Q++  + K D D+IG      +    +    +G +    S Y  +    +E++E+L + + ++Y    I+  +PK V LS   + +  L  S+      K +     +G + + +  A  NA   +  K     + + R     E L+    IK   RME FD S+    + V + VV+     +K +YR++NI       DY  M++ I RR+ +   + G++P+L+ +DGG  Q++ A  +   K + +D    +I + K +  K          SE   +  SD   +  +L+I+DE HRFAI+ +RNK+ K+   ++L  I  +G  R + LL+    + ++K ASV EL+++  + +E+A+ I
  S:     8 KSFLKNVTSAPGVYRMYDKHQQVIYVGKAKDLKKRLSSYFRVNIANVKTQALVSHIDHIDVTVTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSGHKHPRLAY-HRGPKREKGHYFGPYPNGGAVRESLH-LIQKLFPIRQCDDLYYKSRSRPCLQYQLDRCSAPCVGIVSDDEYSEQVKLAGLFLRGKDKQVISQLVAKMETAAIDMEYERAAQYRDQITALRRVAEQQEVS-NHKGDMDVIGVDYASGIACFHLLFIRDGKIFGSRSYYPSVPA-ETEIEEVLSSFLGQFYLNADIQRTIPKEVILSHHFDGITELQASIEHALDKKFELKTQVRGDRANFLRLAMTNASNAVATKLSHKNTVEQRFQLLEEALELNEPIK---RMECFDISHTMGESTVASCVVFNREGPHKADYRRYNITGITGGDDYAAMEQAISRRF-DKIDNNGKVPDLVFIDGGIGQLRVAQTIVDEKCVNIDHPPLLICVTKGEGRKAGLETFTVGGSEQTFEVASDSPAFHLMLHIRDESHRFAITGHRNKRQKTRNTSTLESIAGVGPKRRKALLQHLGGIQEVKGASVAELTKVPGISLEMAQTI 603
>gi|188586645|ref|YP_001918190.1| excinuclease ABC, C subunit [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179351332|gb|ACB85602.1| excinuclease ABC, C subunit [Natranaerobius thermophilus JW/NM-WN-LF] (685 aa)
Score = 647, Expect = 2.2e-65, Identities = 195/575 (33%), Positives = 345/575 (60%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLK-DRDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEE-HPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKLPNKK-----CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVIS------------IVIFKYVNGSLLSK--YDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLS--LSDEKL--KTLSESL--KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY----------------------------KNNTAS-------------FGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           E +++KL  +P KPG YL K K G VIYVGKA++L NR++ YF   ++ +K + +  +I D++ +V ++E E+L+LENNLI KY+PKYN+ LR+   +PY+ +T EE +PR++ +    K   G Y+GP+ N+   + E    + ++FP+R C     K      C+ Y I +CL PC +KV+R +Y   +++I     GK + +  +LE+K   AAE++ FE + +Y   +  L+   ++Q I+  ++ D DII    +E +              + IF    G L+ +  + + T      +++L + I +YY++ A+ +PK + +S  L++++L    L+E    K++   P +G K  +M+ A  NA   +K + L+    +     +L+EL   L + ++ +R+E +D S+      V +MVV+E G   K +YRKF I+      D+  M+EV+ RR+                            K+N +              F  +P+LI++DGGK Q+ +A++ ++ +   S IPVI LAK ++   +  V    + +K    S+    L  I+DE HRFA+S++R  + K+   + L ++  +G  R ++L E Y +L++IK+AS++EL+ +
  S:     4 EDLQEKLANLPEKPGVYLMKSKQGRVIYVGKAINLKNRVRSYFNSGNKAVKVQVMTPKISDIETIVTDSELEALILENNLIKKYRPKYNVSLRDDKNYPYLKITTEEDYPRLIIARRMGKH--GRYFGPYPNAGAVR-ETIKLLRKLFPVRTCKGETPKNQGKRPCLNYFINRCLAPCNEKVSRDEYREMIQDIISVLEGKEEELLNELERKMNLAAEEMEFEKAAEYRNQKAALEKIRQKQKIVSERREDYDIIALGFEEKIDDTSDTDDSTEEACVQIFYIRGGKLMGRNNFRVSTGALEGAEDMLTSFIKQYYAQ-ALHVPKQILVSHPLTEKELIESWLAEKREGKVEVKVPQRGEKYQLMNMAIKNAELELKQQELESEKERKMTEGALKELALKLSLSEIPFRVEGYDISHTQGEETVASMVVFEGGKSKKKDYRKFRIRTTAGPDDFKAMEEVLRRRFHRAKKEEQEYLMAAETKQDSEYDAREGNKDNISQYNSGTEYSEYDFKFAVLPDLIVIDGGKGQLSSAVKVMEEVGY-SQIPVISLAKREE---EIFVPERSTSLKFPSNSEALKLLQRIRDEAHRFAVSYHRKSRGKATLTSLLDEVPEIGSRRKKELFEHYSSLNEIKQASIDELANL 639
>gi|169335028|ref|ZP_02862221.1| hypothetical protein ANASTE_01434 [Anaerofustis stercorihominis DSM 17244] >gi|169257766|gb|EDS71732.1| hypothetical protein ANASTE_01434 [Anaerofustis stercorihominis DSM 17244] (622 aa)
Score = 647, Expect = 2.4e-65, Identities = 195/586 (33%), Positives = 336/586 (57%)
  Q:     2 NEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKTK--KLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRIL----YSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK------LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSE------SLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL--YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRY---------KNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLN-IQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPI--EVAKEIK 587
           ++ + +K+K +P   G YL KD+NG +IYVGKA  L NR+ QYF K+ +   K  K+   I D +Y++ NNE E+L+LE NLI KY+P YN+L+R+   +PYI +T K+E+P++     Y +D  K     Y+GP+AN+   K +  + IN ++P+  C K           C+ Y IGQCLG C   +  + Y  Y+KEI D  +GK+  I + LE K    +E L FE++ K  +    ++     Q++  +  ++ DI+G    E++  + ++   +  ++ + + I    +E D  E+L   I ++Y+     +P  + +    E +  + +      S K++   P KG KK ++  A +NA   ++N   +       E  ++EE+ K  +I     +R E +D SN    + VG MVV++   +N   YRKF +K  +  +DY  M EV++RR           ++   F  +P++I VDGG   V A    +   + +  I V+GL K++KHK   +VK +  E +  +  +    LLN I +EVHRFAI +++N +SKS  + +L +I+ +GK +   LL+ ++ ++++K AS+EE+ ++  +  E+AK++K
  S:     6 SKNLNNKIKLLPENSGVYLMKDENGTIIYVGKAKVLKNRVTQYFRKNSNHTPKVLKMVENIADFEYIITNNEMEALILECNLIKKYRPYYNILMRDDKTYPYIKITIKDEYPKLFVTRKYINDGNK-----YFGPYANATYAK-KAVSTINELYPIAMCKKELKSGVKKGNVCLNYHIGQCLGVCQGNIDTKLYNRYIKEIIDILNGKTSKIIQSLENKMNGYSENLDFENAGKVRDKIFAIRGLKSEQNVSNANADNMDILGLAMAEDMACVQVYALRDKKIVGRENYILKGQNEKDVSEVLAAFIKQFYTNTPF-IPPLILVEKEFEDIDNIKDLLTNLKSKKVEIKVPVKGEKKKLLKLATDNAKLNLENIIGKEKQKALMEKKAVEEINKYANISKEGNFRYEAYDISNTSGVDSVGVMVVFDGAKRNYKAYRKFKVKSIEGPNDYGSMVEVVFRRLNRAQKELKQNDDNPRFLPLPDVIFVDGGIGHVNAVKNVVDTFDFN--IKVLGLGKNNKHKLKEVVK-NNEEARNIRDFEFAGKLLNDISEEVHRFAIDYHKNLRSKSFLKTTLEEIEGIGKVKCRNLLKHFKNMEELKNASIEEIVKVDGMNEELAKKVK 616
>gi|59712233|ref|YP_205009.1| excinuclease ABC subunit C [Vibrio fischeri ES114] >gi|75353751|sp|Q5E4C5|UVRC_VIBF1 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|59480334|gb|AAW86121.1| excinuclease UvrABC, endonuclease subunit [Vibrio fischeri ES114] (608 aa)
Score = 647, Expect = 2.6e-65, Identities = 180/569 (31%), Positives = 299/569 (52%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNKL----PNKKCIYYDIGQCLGPCIKK-VTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELD--EILLTLIYEYY--SKIAIELPKTVYLSLS------DEKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESL-KFLELDSIIP-VIGLAK--DDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQI 577
           LK + H+PG Y   +    VIYVGKA DL  R+  YF  +    KTK L + I  VD  V ++E E+L+LE+N I +Y PKYN+LLR+  ++PYI +++ +HPRI   H   K+ KG Y+GP+ +S   +  L+  I ++FP+R+C        ++ C+ + IG+CL PC+K  V+ ++Y+     I  F  GK + + + L K+   A++ L FE +    +  + ++   E+Q +     +D D++GF  +  +  + +     G +L          +  D  E+ L+ + +YY        +P  V  S        +  L  LS    I  LNP KG+K   +  A  NA+  + +K    ++   R     ++L++ L +  + RME FD S+      V + VV+      K+EYR++NI       DY  M +V+ RRY        +IP++I +DGGK Q+  A E + K  E     P ++G+AK    KH  + +VK    E  +   S     + +I+DE H  AI  +R +++K    ++L  I  +G  R + LL+    L ++K ASVEE++++
  S:    10 LKSVTHQPGVYRMYNAEADVIYVGKAKDLKKRLSSYFRSNVPSEKTKALVSHIHQVDVTVTHSETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFISQHKHPRISI-HRGVKRKKGEYFGPYPDSGAVRESLH-LIQKLFPIRQCEDSVYANRHRPCLMHQIGRCLAPCVKGIVSDEEYKEQTDFIRLFLQGKDRQVIQTLVKQMESASQSLNFEKAAIIRDQIQAMRRVQEQQYVSDDSGDDLDVLGFAIENGLACVHLLMIRQGKILGSRSFFPKIPANTDKEEVFLSFLTQYYLNHTQGRTIPNRVVTSFEFNSEDLERALTELSGRKVIFQLNP-KGIKGRYLKLADTNALTALTSKSNHKLTMYQR----FKQLEEALVLSSIQRMECFDISHTMGEKTVASCVVFNQEGPVKSEYRRYNIAGITGGDDYAAMAQVLERRYSKQL-DIDKIPDIIFIDGGKGQLNRAYEVISKHWEDWPKQPLLLGIAKGVTRKHGLETLVKISGEEFSMPSDSPALHLIQHIRDESHNHAIGGHRAQRAKVRKTSTLQNIDGVGPKRRQALLQYLGGLQELKSASVEEIAKV 590
>gi|87124468|ref|ZP_01080317.1| excinuclease ABC, C subunit [Synechococcus sp. RS9917] >gi|86168040|gb|EAQ69298.1| excinuclease ABC, C subunit [Synechococcus sp. RS9917] (659 aa)
Score = 647, Expect = 2.6e-65, Identities = 161/573 (28%), Positives = 328/573 (57%)
  Q:     3 EQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVT-KEEHPRILYSHDST-KKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK--LPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKN-DEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSELDE--ILLTLIYEYYSKI-AIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDI-KDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANS----DYDYMKEVIYR------------------RYKNNTA----SFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELS 575
           E++  +LK+IP +PGCYL +D++  ++YVGK+  L +R++ YF    DL  + + +  ++C+++++V ++E E+L LE+NLI  ++P +N+LL++   +PY+ +T  E +PR+  +     +     +YGP+ +  + +  L+  + R+FPLR+  +   P++ C+ + IG+C G C +K++ ++Y   L+++   F G+S  +   L ++  + AE+L FE + +  +  + L   +  Q +     +   D++   C + V ++ +F+   G L+ +    T   + L+   IL  +I E+YS++ A+E+P  + +     +   L + L      +++   P +  K D+++    NA    + + L+    Q ++  + E+L +LL++ +   R+E +D S+I  ++ V + VV+ +G+  K  YRK+ I+     +    D+  M EVI R                  R++  +A       + P+++++DGGK Q+ A +E+L+ L+LD  + V  LA   K + +  +  +   ++ +        L  ++DE HRFA+SF+R ++ + +  + L  I  LG  R+  LL  + ++D I+ A +E L+
  S:     4 ERLDRRLKEIPAQPGCYLMRDQDDRILYVGKSKSLRSRVRSYFRSRHDLSPRIRLMTRQVCEIEFIVTDSEAEALALESNLIKNHQPHFNVLLKDDKKYPYLCITWSEPYPRLFITRRRRFRSPLDRFYGPYVDVGLLRRTLF-LVKRVFPLRQRPRPLYPDRTCLNHAIGRCPGVCQEKISSEEYHRILRKVAMVFQGRSDELQTLLTEQMERYAERLDFEAAARIRDQLQGLDQLTADQKMSLPDSSVSRDVLALACDQRVAAVQLFQMRAGKLVGRLGF-TADAAGLEPGLILQRVIEEHYSQLDAVEIPPELLVQYPLPQRLLLEDWLGEQRERRVQIHCPQRRQKADLIELVQRNA----EFELLRAQRGQEQQALATEDLAQLLELPRPPRRIEGYDISHIQGSDAVASQVVFIDGLPAKQHYRKYKIRSSSVRAGHSDDFMSMAEVIRRRFRRWARAKAEGADLGALRHRGGSALQTDGLNDWPDVVMIDGGKGQLSAVMEALRELDLDQDLTVCSLA---KQREEIFLPGERQPLESEPDQLGVALLRRLRDEAHRFAVSFHRQQRGERMKRSRLSDIPGLGPKRVRDLLGHFHSIDAIQLAPIERLA 610
>gi|116670629|ref|YP_831562.1| excinuclease ABC subunit C [Arthrobacter sp. FB24] >gi|189038021|sp|A0JWP2|UVRC_ARTS2 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|116610738|gb|ABK03462.1| Excinuclease ABC subunit C [Arthrobacter sp. FB24] (669 aa)
Score = 646, Expect = 3.2e-65, Identities = 188/565 (33%), Positives = 311/565 (55%)
  Q:    11 KIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTK-EEHPRILYSHDSTKKIKGT-YYGPFANSNIKKYELYNFINRIFPLRKCN-------KLPNKKCIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGS-------LLSKYDLITVFYSELDEILLTLIYEYYSKIAIELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMK-NKYLQLISNQNRELNSLEELQKLLDIK-DLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKN------------------------------------NTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAKDDKHKTDRIVKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELS 575
           +IP  PG Y ++D +G VIYVGKA  L +R+  YF     L  KT  + +    V++ VV +E ESL LE   I ++KP++N++ R+   +PY+ VT  E+ PR+       +K  GT Y+GP+    I+  E  + + R+FP+R C+       +   + C+   I +C  PC+ +VT +++    ++   F  G++K    +LEK    A  +L +E + +  +    L+   ER  ++ ++  D D+   +  E   ++ +F    G        ++ K +  T    +L E LL  +Y    +    LP+ V +         L++ L      K+    P +G K  +M T   NA   +K +K  +     NR L +L+ELQ+ LD+   L R+E FD S++  TN V +MVV E+G+  K++YRKF+I    A  D   M +V+ RR++N                                      A F   PNL++VDGGKPQV AA  +L  L +D +  V+GLAK  + +   +   DF  I L + S+  + L  I+DE HRFAI+F+R K+ K++  ++L  +  LG+ + + LL ++ ++  I+ AS  EL+
  S:    13 EIPTNPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFANPGGLLPKTYAMVHAASSVEWTVVASELESLQLEYTWIKEFKPRFNVVFRDDKTYPYLAVTMGEKFPRVQVLRGERRK--GTRYFGPYTAGAIR--ETMDTLLRVFPVRSCSPGVLKRAQASGRPCLLGYIDKCAAPCVGRVTPEEHRALAEDFCSFMGGEAKRFIGRLEKDMAAAVAELDYERAARVRDDIIALRKVFERNAVVLAEDTDADVFALHEDELEAAVQVFHVRGGRVRGQRGWVVEKVEDFTT--PDLVEHLLQQVYGEEGETQGRLPREVLVPEEPSNAAELAQWLAGLRGAKVDIRVPRRGDKAALMSTVRENAEHALKLHKSRRAGDLTNRSL-ALQELQEALDLPVALLRIECFDISHVQGTNVVASMVVVEDGLPKKSDYRKFSITGAAAVDDTAAMHDVLTRRFRNYLQEKAAQAEAAQLPGHQAALEAMAVASMQDTTTPAPRAKFAYPPNLVVVDGGKPQVNAAARALAELGIDDVY-VVGLAK--RLEEVWLPDSDFPVI-LPRTSEGLYLLQRIRDEAHRFAITFHRQKRGKAMTVSALDSVPGLGEAKRKALLAQFGSVKSIRTASAAELA 628
>gi|108761605|ref|YP_630852.1| excinuclease ABC, C subunit [Myxococcus xanthus DK 1622] >gi|119367676|sp|Q1D921|UVRC_MYXXD UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|108465485|gb|ABF90670.1| excinuclease ABC, C subunit [Myxococcus xanthus DK 1622] (646 aa)
Score = 646, Expect = 3.5e-65, Identities = 179/586 (30%), Positives = 327/586 (55%)
  Q:     1 MNEQIKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDLKT--KKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEE-HPRI----LYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCNK--LPNKK--CIYYDIGQCLGPCIKKVTRQDYEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFYSEL--DEILLTLIYEYYSKIAIELPKTVYLSLSD------EKLKTLSESLKIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDL-YRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLELDSIIPVIGLAK-----------DDKHKTDRI-VKWDFSEIKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVAKEI 586
           M+ ++ +KL  +P +PG YL KD+ G VIYVGKA++L +R++ YF +  D +     L   + D++ V+V+NE E+LLLEN LI K++P++N+LL++   F  + + + + +PR+     Y  D  +     Y+GP++++   + E    +NR F LR C    L N+K  C+ + IG+C  PC+  V ++DY   + E+  F  GK+  + E L  +  +AA++L FE++ +  +    ++   ERQ +  +   D+D+  F+ + + I   +  +V    L+          E   +E++ + +  YY + +    + +     +      E L T  +  +++ L P +G K D++  A  NA    +  +++    ++     L  LQ+ L +++   RME FD S+   +  V + V   +G  +K+ YRK+ IK  +   D+  M EVI RR K       ++P+L+++DGGK Q+ +A  ++K + ++S+  V+GLAK           +     +RI V      I L + S   F L  ++DE HRFAI+F +    KS   ++L  I  +G+TR ++LL  + +L ++ +AS+EEL+++V   +A+ +
  S:     1 MDAKLLEKLDALPTEPGVYLMKDRRGQVIYVGKAINLRSRVRSYFNRTGDTRVFVSLLDQLLGDLETVLVSNEKEALLLENELIKKHRPRFNVLLKDDKQFISLRLDRTQPYPRLEVVRKYERDGAR-----YFGPYSSAGAIR-ETLRVVNRFFRLRTCTDHVLANRKRPCLLHQIGRCPAPCVYPVPQEDYHRSVDEVVMFLEGKAGELVEGLRLRMKRAAQELKFEEAARIRDQLNAIERSLERQKVATTDFKDQDVFAFHREGDRILFYVL-WVRQGRLNGGQAFPFGSQEFPDEELIASFVNLYYDQGSFVPEEVLLPLELEDGTGGLEALLTERKGERVRVLVPKRGEKLDLVKMAAKNA----EQAFVERRRTKDETDTVLSRLQQRLGLRNFPCRMECFDISHFQGSAIVASQVAVTDGDADKSRYRKYKIKTLEKQDDFASMYEVISRRLKKGLED-NDLPDLLVIDGGKGQLASAHAAMKDVGVESV-DVVGLAKSRDLEVFDRDAESARSPERIFVVGRKDPIVLSQNSAEMFMLTRMRDEAHRFAITFQKQVLRKSRVRSALEDIPGVGETRRKQLLRHFGSLKRVGDASIEELAEVVGPAMAERV 605
>gi|157370091|ref|YP_001478080.1| excinuclease ABC subunit C [Serratia proteamaculans 568] >gi|189038087|sp|A8GCW2|UVRC_SERP5 UvrABC system protein C (Protein uvrC) (Excinuclease ABC subunit C) >gi|157321855|gb|ABV40952.1| excinuclease ABC, C subunit [Serratia proteamaculans 568] (610 aa)
Score = 645, Expect = 3.8e-65, Identities = 178/575 (30%), Positives = 302/575 (52%)
  Q:     9 LKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKD-RDLKTKKLANEICDVDYVVVNNENESLLLENNLIAKYKPKYNMLLRESNAFPYILVTKEEHPRILYSHDSTKKIKGTYYGPFANSNIKKYELYNFINRIFPLRKCN----KLPNKKCIYYDIGQCLGPCIKKVTRQD-YEPYLKEINDFFSGKSKSIDEQLEKKEIQAAEKLMFEDSQKYLELRKNLKMFSERQDIIFSQKNDEDIIGFYCKENVISIVIFKYVNGSLLSKYDLITVFY--SELDEILLTLIYEYYSKIAI--ELPKTVYLSLSDEKLKTLSESL------KIKFLNPSKGVKKDVMDTAFNNAVEIMKNKYLQLISNQNRELNSLEELQKLLDIKDLYRMEIFDNSNIFNTNKVGAMVVYENGVKNKNEYRKFNIKDEDANSDYDYMKEVIYRRYKNNTASFGEIPNLIIVDGGKPQVKAALESLKFLEL--DSIIP-VIGLAKDDKHKTDRIVKWDFSE---IKLDKKSDLYFFLLNIQDEVHRFAISFYRNKKSKSLFENSLYKIKNLGKTRIEKLLEKYETLDKIKEASVEELSQIVPIEVA 583
           L  +  +PG Y   D  G VIYVGKA DL  R+  YF +     KT+ L   I  +D  V + E E+LLLE+N I  Y+P+YN+LLR+  ++P I ++ + HPR L  H   K  KG Y+GPF NS   + E    + ++FP+R+C     +  ++ C+ Y IG+CLGPC+  +  +D Y   +  +  F SGK + +  QL ++   A++ L FE++ +  +  + ++  +ERQ  +    +D D+IG   +  +  + +     G +L            +E+ E++ T + ++Y + +    LP  + L  +  + + L+ESL      KI+  +  +G +   +  A  NA   +  K    +S Q+     L EL K+L++ ++ RME FD S+      V + VV++     ++EYR++NI