>gi|26553581|ref|NP_757515.1| exonuclease [Mycoplasma penetrans HF-2] >gi|26453587|dbj|BAC43919.1| exonuclease: possibly DNA polymerase III [Mycoplasma penetrans HF-2] (178 aa)
Score = 831, Expect = 1.3e-87, Identities = 178/178 (100%), Positives = 178/178 (100%)
  Q:     1 MLKDLFKDRKIVIFDIKTTEEGLDSEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRLKSFIIS 178
           MLKDLFKDRKIVIFDIKTTEEGLDSEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRLKSFIIS
  S:     1 MLKDLFKDRKIVIFDIKTTEEGLDSEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRLKSFIIS 178
>gi|12044881|ref|NP_072691.1| DNA polymerase III PolC [Mycoplasma genitalium G37] >gi|1352298|sp|P47277|DPO3_MYCGE DNA polymerase III polC-type (PolIII) >gi|3844641|gb|AAC71247.1| DNA polymerase III, alpha subunit, Gram-positive type [Mycoplasma genitalium G37] >gi|166078825|gb|ABY79443.1| DNA polymerase III, alpha subunit, Gram-positive type [synthetic Mycoplasma genitalium JCVI-1.0] (1451 aa)
Score = 194, Expect = 1.2e-13, Identities = 54/168 (32%), Positives = 89/168 (52%)
  Q:     6 FKDRKIVIFDIKTTE-EGLDSEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISE---IDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRLK 173
             D   VIFDI+TT   G   +++ F+AR   NN  +    FF+  DK IP  I    +IT++ +E  GID+   LE +     D ++  +NG NF  P L+  +++  YN++      ID L L+  +       +L  + +KL + +++ERL  + Y T  L+K++F  K
  S:   411 LSDATFVIFDIETTGLHGRYDDVIEFSARKIKNNSEIDHQQFFLKIDKPIPKTITEITKITDEMLEG-GIDQQQGLEKIRNYLDDCVMVAHNGINFDLPFLQTQFEK--YNIKPLTNPLIDTLCLSWALNPLFSSHTLSNICSKLKLEFDDERLHRAEYDTEALKKVFFYFK 579
>gi|71893884|ref|YP_279330.1| DNA polymerase III PolC [Mycoplasma hyopneumoniae J] >gi|71852011|gb|AAZ44619.1| DNA polymerase III alpha subunit [Mycoplasma hyopneumoniae J] (1468 aa)
Score = 167, Expect = 1.5e-10, Identities = 52/165 (31%), Positives = 85/165 (51%)
  Q:     5 LFKDRKIVIFDIKTTE-EGLDSEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKE-CGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIW 169
           +F   K VIFD++TT      +EI+ F A    N   + KH FFI    KIP  I +   I+ K I+   I    ALE +T I +D++L  +N   F F  LE+ +++    +L+   ID L++++ +   +   SL+ +A +  + Y+EE    + Y   +L  IW
  S:   404 IFDKLKFVIFDLETTGLSAFYNEIVEFGAVVLQNGIEIEKHQFFIKPTGKIPPAITKITGISQKMIDETAISWEIALEKITKIIKDSVLVAHNA-AFDFSFLEQFFRQKAKKSLKNPIIDTLEVSRFLNPNEKSHSLKNVAKRYEIEYDEEIAHRADYDAKILTTIW 569
>gi|54020575|ref|YP_116058.1| DNA polymerase III PolC [Mycoplasma hyopneumoniae 232] >gi|53987748|gb|AAV27949.1| DNA polymerase III, alpha chain [Mycoplasma hyopneumoniae 232] (1469 aa)
Score = 167, Expect = 1.6e-10, Identities = 52/165 (31%), Positives = 85/165 (51%)
  Q:     5 LFKDRKIVIFDIKTTE-EGLDSEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKE-CGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIW 169
           +F   K VIFD++TT      +EI+ F A    N   + KH FFI    KIP  I +   I+ K I+   I    ALE +T I +D++L  +N   F F  LE+ +++    +L+   ID L++++ +   +   SL+ +A +  + Y+EE    + Y   +L  IW
  S:   405 IFDKLKFVIFDLETTGLSAFYNEIVEFGAVVLQNGIEIEKHQFFIKPTGKIPPAITKITGISQKMIDETAISWEIALEKITKIIKDSVLVAHNA-AFDFSFLEQFFRQKAKKSLKNPIIDTLEVSRFLNPNEKSHSLKNVAKRYEIEYDEEIAHRADYDAKILTTIW 570
>gi|72080863|ref|YP_287921.1| DNA polymerase III PolC [Mycoplasma hyopneumoniae 7448] (1420 aa)
Score = 165, Expect = 2.5e-10, Identities = 52/165 (31%), Positives = 84/165 (50%)
  Q:     5 LFKDRKIVIFDIKTTE-EGLDSEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKE-CGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIW 169
           +F   K VIFD++TT      +EI+ F A    N   + KH FFI    KIP  I +   I+ K I+   I    ALE +T I +D++L  +N   F F  LE+ +++    +L+   ID L++++ +   +   SL+ +A +  + Y EE    + Y   +L  IW
  S:   356 IFDKLKFVIFDLETTGLSAFYNEIIEFGAVVLQNGIEIEKHQFFIKPTGKIPPAITKITGISQKMIDETAISWEIALEKITKIIKDSVLVAHNA-AFDFSFLEQFFRQKAKKSLKNPIIDTLEVSRFLNPNEKSHSLKNVAKRYEIEYAEEIAHRADYDAKILTTIW 521
>gi|144575503|gb|AAZ53898.2| DNA polymerase III alpha subunit [Mycoplasma hyopneumoniae 7448] (1469 aa)
Score = 165, Expect = 2.5e-10, Identities = 52/165 (31%), Positives = 84/165 (50%)
  Q:     5 LFKDRKIVIFDIKTTE-EGLDSEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKE-CGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIW 169
           +F   K VIFD++TT      +EI+ F A    N   + KH FFI    KIP  I +   I+ K I+   I    ALE +T I +D++L  +N   F F  LE+ +++    +L+   ID L++++ +   +   SL+ +A +  + Y EE    + Y   +L  IW
  S:   405 IFDKLKFVIFDLETTGLSAFYNEIIEFGAVVLQNGIEIEKHQFFIKPTGKIPPAITKITGISQKMIDETAISWEIALEKITKIIKDSVLVAHNA-AFDFSFLEQFFRQKAKKSLKNPIIDTLEVSRFLNPNEKSHSLKNVAKRYEIEYAEEIAHRADYDAKILTTIW 570
>gi|66879834|ref|ZP_00404824.1| COG2176: DNA polymerase III, alpha subunit (gram-positive type) [Mycoplasma genitalium G-37] (156 aa)
Score = 151, Expect = 9.8e-09, Identities = 38/112 (33%), Positives = 60/112 (53%)
  Q:     6 FKDRKIVIFDIKTTE-EGLDSEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQ 117
             D   VIFDI+TT   G   +++ F+AR   NN  +    FF+  DK IP  I    +IT++ +E  GID+   LE +     D ++  +NG NF  P L+  +++  YN++
  S:    33 LSDATFVIFDIETTGLHGRYDDVIEFSARKIKNNSEIDHQQFFLKIDKPIPKTITEITKITDEMLEG-GIDQQQGLEKIRNYLDDCVMVAHNGINFDLPFLQTQFEK--YNIK 142
>gi|13507773|ref|NP_109722.1| DNA polymerase III PolC [Mycoplasma pneumoniae M129] >gi|2494192|sp|P75080|DPO3_MYCPN DNA polymerase III polC-type (PolIII) >gi|1673778|gb|AAB95768.1| DNA polymerase III (dnaE) alpha chain [Mycoplasma pneumoniae M129] (1443 aa)
Score = 149, Expect = 1.9e-08, Identities = 47/167 (28%), Positives = 83/167 (49%)
  Q:     3 KDLFKDRKIVIFDIKTTE-EGLDSEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN---LQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIW 169
           K   KD   VIFDI+TT   G    ++ FA     +N  V +  FF+  D  +P  +    +IT  ++E +G+++ + LE +       ++  +NG +F  P L+  +++  YN   L    ID L L+  +       +L  +  KL   +++ERL  + Y T  L+K++
  S:   400 KTKLKDATFVIFDIETTGLHGRYDSVIEFAGIKVKHNREVERMQFFLKIDGPLPAAVTEITKITQAQLE-DGMEQQAGLEKLRAWLDGCVMVAHNGLSFDLPFLQTQFEK--YNIAPLTNPLIDTLALSWALNPGFASHTLSNICAKLKFDFDDERLHRADYDTQALKKVF 567
>gi|71894029|ref|YP_278137.1| DNA polymerase III PolC [Mycoplasma synoviae 53] >gi|71850817|gb|AAZ43426.1| DNA polymerase III alpha subunit [Mycoplasma synoviae 53] (1451 aa)
Score = 136, Expect = 5.1e-07, Identities = 44/160 (27%), Positives = 78/160 (48%)
  Q:    10 KIVIFDIKTTE-EGLDSEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIW 169
           + V+FDI+TT       EI+ FAA    N  +V K + FI + +K+     R   ITN+ ++ +GI+   AL+ +  +  + +   +N +     L+EK  +      + + ID+L +++ +    D  +L E    L V Y+ E+   + Y T VL   W
  S:   410 RYVVFDIETTSLSAYHGEIIEFAATIIENKAVVDKVDIFIKSKEKLSHFTTRLTSITNEMLDQKGIELKEALQKIYDVLNNNVAVAHNANFDYNFLIEKFDQNNMQAPKCTFIDSLVVSRILFEHRDKHNLNEFCRNLSVNYDTEKAHRALYDTEVLADAW 570
>gi|47458892|ref|YP_015754.1| DNA polymerase III PolC [Mycoplasma mobile 163K] >gi|47458220|gb|AAT27543.1| DNA polymerase III alpha subunit [Mycoplasma mobile 163K] (1433 aa)
Score = 126, Expect = 7.7e-06, Identities = 52/165 (31%), Positives = 83/165 (50%)
  Q:     5 LFKDRKIVIFDIKTTEEGLD---SEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGD---NFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIW 169
           L K+   V+FD++TT  GL     +I+ F A+  +N +++    FF+  +K+I   I     I N+ +E+  I +  AL+ +     D  +  +N     NF+   +EK Y     NLQI  ID L ++K I       SLE LA++ G+ Y       + Y   VL K+W
  S:   394 LIKNETYVVFDLETT--GLSPIFDDIIEFGAQKILNGKVIDTLQFFVKPNKEISEKITLITGIKNQDVEN-AISEKEALKKILEFMGDHTVVAHNATFDMNFINEKIEK-YNFQESNLQI--IDTLVVSKIIEPEAKKFSLENLASRSGIIYNSTEAHRADYDADVLAKVW 558
>gi|15829146|ref|NP_326506.1| DNA polymerase III PolC [Mycoplasma pulmonis UAB CTIP] >gi|14424449|sp|P47729|DPO3_MYCPU DNA polymerase III polC-type (PolIII) >gi|14090090|emb|CAC13848.1| DNA POLYMERASE III, ALPHA CHAIN POLC-TYPE (POLIII) [Mycoplasma pulmonis] (1435 aa)
Score = 121, Expect = 3.2e-05, Identities = 53/168 (31%), Positives = 87/168 (51%)
  Q:     2 LKDLFKDRKI-----VIFDIKTTE-EGLDSEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISE---IDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIW 169
           LKD F D KI     V++DI+TT    + +E++ F A    N  ++  H+FFI    K+     +   IT + +E +G +   ALE ++ IF+  I+  +N   F    L++ + +   N++  E   ID L LAK +        L E+A+KL V Y+      + Y + VL  I+
  S:   390 LKDKFFDYKILDQEYVVYDIETTGLSPMLNELIQFGASVIKNGRIIETHHFFIKPKSKLDSFTTKLTGITQEHLE-KGYELQEALEKISSIFKARIMVAHNA-AFDHNFLKQKFID--NNIEFEEMISIDTLNLAKVLNPIYRSYRLGEVASKLSVVYDPSIAHRADYDSSVLTNIF 562
>gi|487436|gb|AAA18178.1| DNA polymerase III [Mycoplasma pulmonis] >gi|1090178|prf||2018296A DNA polymerase III (1435 aa)
Score = 121, Expect = 3.3e-05, Identities = 53/168 (31%), Positives = 87/168 (51%)
  Q:     2 LKDLFKDRKI-----VIFDIKTTE-EGLDSEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISE---IDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIW 169
           LKD F D KI     V++DI+TT    + +E++ F A    N  ++  H+FFI    K+     +   IT + +E +G +   ALE ++ IF+  I+  +N   F    L++ + +   N++  E   ID L LAK +        L E+A+KL V Y+      + Y + VL  I+
  S:   390 LKDKFFDYKILDQEYVVYDIETTGLSPMLNELIQFGASVIKNGRIIETHHFFIKPKSKLDSFTTKLTGITQEHLE-KGYELQEALEKISSIFKARIMVAHNA-AFDHNFLKQKFID--NNIEFEEMISIDTLNLAKVLNPIYRSYRLGEVASKLSVVYDPSIAHRADYDSSVLTNIF 562
>gi|193216948|ref|YP_002000190.1| DNA polymerase III subunit alpha [Mycoplasma arthritidis 158L3-1] >gi|193002271|gb|ACF07486.1| DNA polymerase III subunit alpha [Mycoplasma arthritidis 158L3-1] (1438 aa)
Score = 117, Expect = 9.9e-05, Identities = 45/158 (28%), Positives = 71/158 (44%)
  Q:    12 VIFDIKTTEEGLD---SEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIW 169
           V+FD++TT  GL    +EI+ F A    N  +   H FFI   K IP +I    +IT+  + + G  +   +  +  I ++ I   +N    +    E   K    N +I  ID+L +A+ +I       LE +A K  V Y       + Y   VL  +W
  S:   406 VVFDLETT--GLSPRFNEIIEFGASIIENGIIKESHQFFIKPTKPIPPSITEITKITDNTV-ANGYSQEEGVRKIYDILKNRICVAHNAKFDINVCKENFLKYGLDNSKIIGIDSLAIARFLIDEAKSYRLEIVAKKFNVYYARNEAHRADYDANVLANVW 563
>gi|188592849|ref|ZP_03006110.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 10] (1442 aa)
Score = 112, Expect = 3.7e-04, Identities = 52/171 (30%), Positives = 87/171 (50%)
  Q:     8 DRKIVIFDIKTTEEGLD---SEILYFAARTYINNEMV-SKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN-LQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRLKSFIIS 178
           D   VIFDI+TT  GL     EI+ F A    NN+ +  K  FF+   ++I  NI     I N+++ ++ ID+ +AL  +  IF + IL  +NG +F    + +   + G   L+   ID L +++ I  F     L  +  K  V Y +E    + Y  MVL  ++  +K+ +++
  S:   406 DATYVIFDIETT--GLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNI-NQEMVNDAIDEKTALLKIKEIFANHILVAHNGISFDINFINQRLLKWGLEPLENPSIDTLMISRAINPFKSH-RLGAICKKYEVDYNDEVAHRADYDAMVLADVFKIMKNSLVN 577
>gi|188569210|ref|ZP_03005726.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 2] (1442 aa)
Score = 112, Expect = 3.7e-04, Identities = 52/171 (30%), Positives = 87/171 (50%)
  Q:     8 DRKIVIFDIKTTEEGLD---SEILYFAARTYINNEMV-SKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN-LQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRLKSFIIS 178
           D   VIFDI+TT  GL     EI+ F A    NN+ +  K  FF+   ++I  NI     I N+++ ++ ID+ +AL  +  IF + IL  +NG +F    + +   + G   L+   ID L +++ I  F     L  +  K  V Y +E    + Y  MVL  ++  +K+ +++
  S:   406 DATYVIFDIETT--GLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNI-NQEMVNDAIDEKTALLKIKEIFANHILVAHNGISFDINFINQRLLKWGLEPLENPSIDTLMISRAINPFKSH-RLGAICKKYEVDYNDEVAHRADYDAMVLADVFKIMKNSLVN 577
>gi|195867849|ref|ZP_03079848.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|195660426|gb|EDX53684.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (1442 aa)
Score = 112, Expect = 3.8e-04, Identities = 52/171 (30%), Positives = 87/171 (50%)
  Q:     8 DRKIVIFDIKTTEEGLD---SEILYFAARTYINNEMV-SKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN-LQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRLKSFIIS 178
           D   VIFDI+TT  GL     EI+ F A    NN+ +  K  FF+   ++I  NI     I N+++ ++ ID+ +AL  +  IF + IL  +NG +F    + +   + G   L+   ID L +++ I  F     L  +  K  V Y +E    + Y  MVL  ++  +K+ +++
  S:   406 DATYVIFDIETT--GLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNI-NQEMVNDAIDEKTALLKIKEIFANHILVAHNGISFDINFINQRLLKWGLEPLENPSIDTLMISRAINPFKSH-RLGAICKKYEVDYNDEVAHRADYDAMVLADVFKIMKNSLVN 577
>gi|171920838|ref|ZP_02932008.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|171903036|gb|EDT49325.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 13 str. ATCC 33698] (1442 aa)
Score = 112, Expect = 3.8e-04, Identities = 52/171 (30%), Positives = 87/171 (50%)
  Q:     8 DRKIVIFDIKTTEEGLD---SEILYFAARTYINNEMV-SKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN-LQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRLKSFIIS 178
           D   VIFDI+TT  GL     EI+ F A    NN+ +  K  FF+   ++I  NI     I N+++ ++ ID+ +AL  +  IF + IL  +NG +F    + +   + G   L+   ID L +++ I  F     L  +  K  V Y +E    + Y  MVL  ++  +K+ +++
  S:   406 DATYVIFDIETT--GLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNI-NQEMVNDAIDEKTALLKIKEIFANHILVAHNGISFDINFINQRLLKWGLEPLENPSIDTLMISRAINPFKSH-RLGAICKKYEVDYNDEVAHRADYDAMVLADVFKIMKNSLVN 577
>gi|185178976|ref|ZP_02964733.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188039591|ref|ZP_02998308.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 8] >gi|184209258|gb|EDU06301.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 5 str. ATCC 27817] (1442 aa)
Score = 111, Expect = 4.0e-04, Identities = 52/171 (30%), Positives = 87/171 (50%)
  Q:     8 DRKIVIFDIKTTEEGLD---SEILYFAARTYINNEMV-SKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN-LQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRLKSFIIS 178
           D   VIFDI+TT  GL     EI+ F A    NN+ +  K  FF+   ++I  NI     I N+++ ++ ID+ +AL  +  IF + IL  +NG +F    + +   + G   L+   ID L +++ I  F     L  +  K  V Y +E    + Y  MVL  ++  +K+ +++
  S:   406 DATYVIFDIETT--GLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNI-NQEMVNDAIDEKTALLKIKEIFDNHILVAHNGISFDINFINQRLLKWGLKPLKNPSIDTLMISRAINPFKSH-RLGAICKKYEVDYNDEVAHRADYDAMVLADVFKIMKNSLVN 577
>gi|13357937|ref|NP_078211.1| DNA polymerase III PolC [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762156|ref|YP_001752460.1| DNA polymerase III, alpha subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|13959349|sp|Q9PQB4|DPO3_UREPA DNA polymerase III polC-type (PolIII) >gi|11279168|pir||C82898 DNA polymerase III alpha chain 1 UU377 [imported] - Ureaplasma urealyticum >gi|6899360|gb|AAF30786.1|AE002135_2 DNA polymerase III alpha chain 1 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827733|gb|ACA32995.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma parvum serovar 3 str. ATCC 27815] (1442 aa)
Score = 111, Expect = 4.1e-04, Identities = 51/163 (31%), Positives = 81/163 (49%)
  Q:    12 VIFDIKTTEEGLD---SEILYFAARTYINNEMV-SKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN-LQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRLKS 174
           VIFDI+TT  GL     EI+ F A    NN+ +  K  FFI   ++I  N+     I+ + + +  ID+ +AL  +  IF D IL  +NG NF    + +   + G   L+   ID L +++ I  F     L  +  K  V Y +E    + Y  +VL  ++  +K+
  S:   410 VIFDIETT--GLFPNFDEIIEFGAVIMQNNKQIGEKIQFFIKPIQQINENVTNLTNISQEMVNN-AIDEKTALLKIKEIFDDHILVAHNGINFDINFINQRLLKWGLEPLKNPSIDTLMISRAINPFKSH-RLGAICKKYEVDYNDESAHRADYDAIVLADVFKVMKN 573
>gi|188518224|ref|ZP_03003759.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188998138|gb|EDU67235.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (1442 aa)
Score = 108, Expect = 8.8e-04, Identities = 51/171 (29%), Positives = 86/171 (50%)
  Q:     8 DRKIVIFDIKTTEEGLD---SEILYFAARTYINNEMV-SKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN-LQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRLKSFIIS 178
           D   VIFDI+TT  GL     EI+ F A    NN+ +  K  FF+   ++I  NI     I+ + + ++ ID+ +AL  +  IF + IL  +NG +F    + +   + G   L+   ID L +++ I  F     L  +  K  V Y +E    + Y  MVL  ++  +K+ +++
  S:   406 DATYVIFDIETT--GLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNISQEMV-NDAIDEKTALLKIKEIFANHILVAHNGISFDINFINQRLLKWGLEPLKNPSIDTLMISRAINPFKSH-RLGAICKKYEVDYNDEVAHRADYDAMVLADVFKIMKNSLVN 577
>gi|188524415|ref|ZP_03004436.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530975|ref|ZP_03005237.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|195659873|gb|EDX53253.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (1442 aa)
Score = 108, Expect = 9.6e-04, Identities = 51/171 (29%), Positives = 86/171 (50%)
  Q:     8 DRKIVIFDIKTTEEGLD---SEILYFAARTYINNEMV-SKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN-LQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRLKSFIIS 178
           D   VIFDI+TT  GL     EI+ F A    NN+ +  K  FF+   ++I  NI     I+ + + ++ ID+ +AL  +  IF + IL  +NG +F    + +   + G   L+   ID L +++ I  F     L  +  K  V Y +E    + Y  MVL  ++  +K+ +++
  S:   406 DATYVIFDIETT--GLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNISQEMV-NDAIDEKTALLKIKEIFANHILVAHNGISFDINFINQRLLKWGLEPLKNPSIDTLMISRAINPFKSH-RLGAICKKYEVDYNDEVAHRADYDAMVLADVFKIMKNSLVN 577
>gi|171920237|ref|ZP_02690314.2| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902634|gb|EDT48923.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma parvum serovar 1 str. ATCC 27813] (1442 aa)
Score = 108, Expect = 9.9e-04, Identities = 52/171 (30%), Positives = 84/171 (49%)
  Q:     8 DRKIVIFDIKTTEEGLD---SEILYFAARTYINNEMV-SKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN-LQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRLKSFIIS 178
           D   VIFDI+TT  GL     EI+ F A    NN+ +  K  FF+   ++I  NI     I+ + + +  ID+ +AL  +  IF + IL  +NG NF    + +   + G   L+   ID L +++ I  F     L  +  K  V Y +E    + Y  MVL   +  +K+ +++
  S:   406 DATYVIFDIETT--GLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNISQEMVNN-AIDEKTALLKIKEIFDNHILVAHNGINFDINFINQRLLKWGLEPLKNPSIDTLMISRAINPFKSH-RLGAICKKYEVDYNDEVAHRADYDAMVLADAFKIMKNSLVN 577
>gi|15896683|ref|NP_350032.1| DNA polymerase III (alpha subunit) [Clostridium acetobutylicum ATCC 824] >gi|15026532|gb|AAK81372.1|AE007841_7 DNA polymerase III (alpha subunit) [Clostridium acetobutylicum ATCC 824] (1452 aa)
Score = 108, Expect = 1.1e-03, Identities = 43/170 (25%), Positives = 77/170 (45%)
  Q:     3 KDLFKDRKIVIFDIKTTEEGLDSE-ILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIE-SEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYE-EERLLGSPYTTMVLEKIWFRL 172
           KD   D    + D++TT     +E I       Y N +++ K + F+  +K IP  ++    IT+  ++ +E IDK+     M    + ++L  +N  +F    L+   K  GY    + +D L LA+ +        L  +A  LG++ E   R L    TT+ + K+   +
  S:   420 KDQSIDTTYCVLDLETTGFSPKTEKITEIGIMKYENGKVIDKFSLFVNPEKPIPARVVEVTNITDDMVKNAETIDKV--FPKMLEFIKGSVLVAHNA-SFDIGFLKHNAKVLGYEFDFTYLDTLSLAQAVFPQYKSYKLGRIAKNLGIKVEVAHRALDDVDTTVKVFKVMLEI 589
>gi|183508608|ref|ZP_02958116.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|182676065|gb|EDT87970.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma parvum serovar 14 str. ATCC 33697] (1442 aa)
Score = 108, Expect = 1.1e-03, Identities = 50/163 (30%), Positives = 81/163 (49%)
  Q:    12 VIFDIKTTEEGLD---SEILYFAARTYINNEMV-SKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN-LQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRLKS 174
           VIFDI+TT  GL     EI+ F A    NN+ +  K  FF+   ++I  N+     I+ + + +  ID+ +AL  +  IF D IL  +NG NF    + +   + G   L+   ID L +++ I  F     L  +  K  V Y +E    + Y  +VL  ++  +K+
  S:   410 VIFDIETT--GLFPNFDEIIEFGAVIMQNNKQIGEKIQFFVKPIQQINENVTNLTNISQEMVNN-AIDEKTALLKIKEIFDDHILVAHNGINFDINFINQRLLKWGLEPLKNPSIDTLMISRAINPFKSH-RLGAICKKYEVDYNDEIAHRADYDAIVLTDVFKVMKN 573
>gi|188024469|ref|ZP_02997117.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188018579|gb|EDU56619.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 7 str. ATCC 27819] (1442 aa)
Score = 106, Expect = 1.9e-03, Identities = 51/171 (29%), Positives = 85/171 (49%)
  Q:     8 DRKIVIFDIKTTEEGLD---SEILYFAARTYINNEMV-SKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN-LQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRLKSFIIS 178
           D   VIFDI+TT  GL     EI+ F A    NN+ +  K  FF+   ++I  NI     I+ + + ++ ID+ +AL  +  IF + IL  +NG +F    + +   + G   L+   ID L + + I  F     L  +  K  V Y +E    + Y  MVL  ++  +K+ +++
  S:   406 DATYVIFDIETT--GLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNISQEMV-NDAIDEKTALLKIKEIFANHILVAHNGISFDINFINQRLLKWGLEPLKNPSIDTLMILRAINPFKSH-RLGAICKKYEVDYNDEVAHRADYDAMVLADVFKIMKNSLVN 577
>gi|78044072|ref|YP_360592.1| DNA polymerase III, alpha subunit [Carboxydothermus hydrogenoformans Z-2901] >gi|77996187|gb|ABB15086.1| DNA polymerase III, alpha subunit, Gram-positive type [Carboxydothermus hydrogenoformans Z-2901] (1407 aa)
Score = 101, Expect = 5.8e-03, Identities = 37/123 (30%), Positives = 55/123 (44%)
  Q:     6 FKDRKIVIFDIKTTEEGLDS---EILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAK 128
            K+  IV FD +T+  GL S   EI+   A    + E+    +  I   K I   I     ITN  +E EG+D   A+E        +IL  +N   F +  L +  K  G+  + S +D L L +
  S:   389 LKETPIVAFDFETS--GLSSQRDEIIEIGAVKIFDGEIKETFSVLIRPQKPISAKISELTGITNDLLEKEGLDFGEAIEKFLRFCDGSILLAHNA-AFDYGFLRQALKRLGHERKFSVVDNLALVR 511
>gi|186701836|ref|ZP_02971504.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186701125|gb|EDU19407.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma parvum serovar 6 str. ATCC 27818] (1442 aa)
Score = 100, Expect = 8.1e-03, Identities = 50/167 (29%), Positives = 81/167 (48%)
  Q:     8 DRKIVIFDIKTTEEGLD---SEILYFAARTYINNEMV-SKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN-LQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRLKS 174
           D   VIFDI+TT  GL     EI+ F A    NN+ +  K  F +   ++I  NI     I+ + + +  ID+ +AL  +  IF + IL  +NG NF    + +   + G   L+   ID L +++ I  F     L  +  K  V Y +E    + Y  +VL  ++  +K+
  S:   406 DATYVIFDIETT--GLFPNFDEIIEFGAIIMQNNKQIGDKIQFLVKPIQQINENITNLTNISQEMVNN-AIDEKTALLKIKEIFDNHILVAHNGINFDINFINQRLLKWGLEPLKNPSIDTLMISRAINPFKSH-RLGAICKKYEVDYNDEIAHRADYDAIVLADVFKVMKN 573
>gi|168187912|ref|ZP_02622547.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium botulinum C str. Eklund] >gi|169294244|gb|EDS76377.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium botulinum C str. Eklund] (1441 aa)
Score = 99, Expect = 1.1e-02, Identities = 41/144 (28%), Positives = 66/144 (45%)
  Q:     8 DRKIVIFDIKTTEEGLDSE---ILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKI-ESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYE 151
           D   V+FD++TT  G  S+   I+ F A    N  ++   + F+  + KIP  I     ITN+ + ++E IDK+  L       +D +L  +N  NF    + K   +       + +D + LAK +        L  +A  LGV  E
  S:   425 DDTFVVFDLETT--GFSSQYDKIIEFGAVKIKNGNIIDSFSAFVNPEMKIPYRITELTSITNEDVKDAETIDKV--LPKFMKFAEDTVLVAHN-SNFDMSFIRKNCNDLNIECNYTVMDTIPLAKFLFPELKRYKLNTIAKHLGVSLE 567
>gi|147820793|emb|CAN69639.1| hypothetical protein [Vitis vinifera] (437 aa)
Score = 98, Expect = 1.4e-02, Identities = 30/97 (30%), Positives = 51/97 (52%)
  Q:     1 MLKDLFKDRKIVIFDIKTTEEGLDSEILYFAARTYINN--EMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALE--NMTYIFQDAILFTYNG 97
           ML++ F+ RK  + D   T+EGL +   +FA ++Y     ++ S   F   + + I GN  RKY +  KK+     +K  + E  N+ ++ + AIL    G
  S:     8 MLQEPFRKRKWCLRDFADTQEGLRN---HFATKSYSRRAAKLASTLRFSAPSLRHISGNFRRKYTLLYKKVAKSLRNKRRSTESANLAFLLKAAILMVIYG 105
>gi|160944143|ref|ZP_02091373.1| hypothetical protein FAEPRAM212_01645 [Faecalibacterium prausnitzii M21/2] >gi|158444819|gb|EDP21823.1| hypothetical protein FAEPRAM212_01645 [Faecalibacterium prausnitzii M21/2] (1417 aa)
Score = 98, Expect = 1.5e-02, Identities = 39/129 (30%), Positives = 57/129 (44%)
  Q:     2 LKDLFKDRKIVIFDIKTTEEGLDSEILYF---AARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQI 130
           +KD   D +  +FD +TT  GLD  + Y     A    N E+V + + F+   K I   I     ITN+ +     +K  ALE       D IL  +N   F    L    K  G  L+ + ID L +A+ +
  S:   388 VKDQPLDGEFCVFDTETT--GLDPGVEYLTEIGAVIIRNGEVVEEFDTFVKPGKPITPKITELTGITNEMVADAPSEK-EALEAFLAFAGDRILVGHNVHAFDMRFLRAAAKRSGIKLEPTYIDTLTMAQTM 516
>gi|118443832|ref|YP_878213.1| DNA polymerase III PolC [Clostridium novyi NT] >gi|118134288|gb|ABK61332.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium novyi NT] (1444 aa)
Score = 95, Expect = 3.3e-02, Identities = 41/144 (28%), Positives = 65/144 (45%)
  Q:     8 DRKIVIFDIKTTEEGLDSE---ILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKI-ESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYE 151
           D   V+FD++TT  G  S+   I+ F A    N  ++   + F+  + KIP  I     ITN  + ++E IDK+  L       +  +L  +N  NF    + K  K+       + +D + LAK +        L  +A  LGV  E
  S:   428 DDTFVVFDLETT--GFSSQYDKIIEFGAVKIKNGNIIDSFSAFVNPEIKIPYKITELTSITNDDVKDAETIDKV--LPKFIKFAEGTVLVAHN-SNFDMSFIRKNCKDLNIECNYTVMDTIPLAKFLFPELKRYKLNTIAKHLGVSLE 570
>gi|104773929|ref|YP_618909.1| hypothetical protein Ldb0875 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103423010|emb|CAI97696.1| Hypothetical protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (290 aa)
Score = 95, Expect = 3.4e-02, Identities = 41/142 (28%), Positives = 66/142 (46%)
  Q:     7 KDRKIVIFDIKTTEEGLDSE---ILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEI-DALKLAKQIIGFDDDISLEELATKLGV 148
           K +  V  DI+TT  GL++E   IL   A  +   E        I  D  +P  I+    IT++ +  EG+    ALE +T    +  +  YN   F    L + Y++CG     +EI D L + K+   F D+  L+ + +  G+
  S:   122 KPKGFVAVDIETT--GLNTETDQILSIGAVKHDGTEFYR----LIKQDIDVPKQIVELTGITSEMLSKEGVPLQDALEELTDFVGNVPIVGYNF-RFDSAFLNRDYRKCGMQELKNEIKDLLPVVKRKEKFLDNYKLQTVLSNYGI 260
>gi|50365104|ref|YP_053529.1| DNA polymerase III alpha subunit [Mesoplasma florum L1] >gi|50363660|gb|AAT75645.1| DNA polymerase III alpha subunit [Mesoplasma florum L1] (1493 aa)
Score = 94, Expect = 4.2e-02, Identities = 45/166 (27%), Positives = 82/166 (49%)
  Q:     7 KDRKIVIFDIKTTEEGLD---SEILYFAARTYIN-NEMVSKHNFFIATDKKIPGNIIRKYRITNKKIE-SEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGY-NLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRL 172
           ++ K+V+FD++TT  GL    +EI+ F A  +       +K+++     + +    I    IT + +E  + ID     + +  + +D+IL  +N  NF F  L  + K  GY +LQ + ID L L++ +        L  +  K G+ Y+E       Y   VL  ++F++
  S:   436 RESKMVVFDLETT--GLSPEFNEIIEFGAVVFDPVTGKTTKYDYLFKPKQPLKQFTIDLTNITPEMLEDKKNID--DDFDKIYELIKDSILVAHNA-NFDFNFLNSLSKRLGYGDLQNTVIDTLTLSRLVRPALKSHRLGAVCKKFGILYDEHVAHRGDYDADVLNDLFFKI 602
>gi|116513938|ref|YP_812844.1| 3'-5' exonuclease and CRISPR-associated Cas2 family protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116093253|gb|ABJ58406.1| 3'-5' exonuclease with to CRISPR-associated protein from COG1343 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (290 aa)
Score = 94, Expect = 4.3e-02, Identities = 41/142 (28%), Positives = 67/142 (47%)
  Q:     7 KDRKIVIFDIKTTEEGLDSE---ILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEI-DALKLAKQIIGFDDDISLEELATKLGV 148
           K ++ V  DI+TT  GL++E   IL   A  +   E        I  D  +P  I+    IT++ +  EG+    ALE +T    +  +  YN   F    L + Y++CG     +EI D L + K+   F D+  L+ + +  G+
  S:   122 KQKRFVAVDIETT--GLNTESDQILSIGAVKHDGIEFYR----LIKQDIDVPKQIVELTGITSEMLSKEGVPLQDALEELTDFVGNVPIVGYNF-RFDSVFLNRDYRKCGMQELKNEIKDLLPVVKRREKFLDNYKLQTVLSNYGI 260
>gi|146297347|ref|YP_001181118.1| DNA polymerase III, alpha subunit [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410923|gb|ABP67927.1| DNA polymerase III catalytic subunit, PolC type [Caldicellulosiruptor saccharolyticus DSM 8903] (1402 aa)
Score = 94, Expect = 4.4e-02, Identities = 38/124 (30%), Positives = 63/124 (50%)
  Q:     8 DRKIVIFDIKTTEEGLDSE---ILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQD----AILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQII 131
           D   V+ DI+TT  G D++   I+   A    N E+V + + F+  + KIP   IR   +T   I    +D    L +    F+     AIL  +N   F    L++ Y+ECG     + ID L+L+++++
  S:   387 DTTFVVVDIETT--GFDNQKDRIIEIGAVKIENGEIVDRFSTFVDPEGKIP---IRISELTG--IYQNMVDNAPKLSDAILEFEKFCSGAILVAHNA-QFDIGFLKRSYQECGLIFDYTYIDTLELSRRVL 509
>gi|167770615|ref|ZP_02442668.1| hypothetical protein ANACOL_01961 [Anaerotruncus colihominis DSM 17241] >gi|167667210|gb|EDS11340.1| hypothetical protein ANACOL_01961 [Anaerotruncus colihominis DSM 17241] (1445 aa)
Score = 94, Expect = 4.5e-02, Identities = 36/141 (25%), Positives = 64/141 (45%)
  Q:     8 DRKIVIFDIKTTEEGLDSE-ILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIF---QDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGV 148
           D ++++FD++TT     +E I    A    N E+V + N F+  ++ IP  I     IT+  +    ++   AL    Y F     A+L  +N   F    L +  + CG     + ID + L++ +        L+ +A  LG+
  S:   423 DSEMIVFDLETTGLSAATERITEIGAVKLRNGEIVDRFNTFVNPERSIPPKITELTGITDDDVRGAPLEG-EALRQF-YAFCGGSSAVLIAHNAP-FDTSFLRQCARRCGMEYNFTAIDTVVLSRSLFPELKKHKLDIVAKHLGL 564
>gi|147861572|emb|CAN81457.1| hypothetical protein [Vitis vinifera] (177 aa)
Score = 93, Expect = 4.9e-02, Identities = 26/68 (38%), Positives = 38/68 (55%)
  Q:     1 MLKDLFKDRKIVIFDIKTTEEGLDSEILYFAARTYINN--EMVSKHNFFIATDKKIPGNIIRKYRITNKK 68
           ML+ LF+ RK  + D   T+EGL +   +FAA+ Y     ++ S   F  ++ + I GN  RKY I  KK
  S:    88 MLQGLFRKRKWCLRDFTDTQEGLRN---HFAAKGYSRRAAKLASTLRFSASSLRHISGNFRRKYTILYKK 154
>gi|150018035|ref|YP_001310289.1| DNA polymerase III, alpha subunit [Clostridium beijerinckii NCIMB 8052] >gi|149904500|gb|ABR35333.1| DNA polymerase III, alpha subunit [Clostridium beijerinckii NCIMB 8052] (1446 aa)
Score = 91, Expect = 9.7e-02, Identities = 35/144 (24%), Positives = 65/144 (45%)
  Q:     8 DRKIVIFDIKTTEEGLDSE-ILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIE-SEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYE 151
           D    + D++TT     +E I         + +++ K + F+   K IP  ++   +IT+  ++ +E IDK+     +    + ++L  +N D F    L+   K  GY    + ID L LA+ +        L  +A  LG++ E
  S:   420 DTVYCVLDLETTGFSPQTEKITEIGVMKIKDGKVIDKFSTFVNPQKSIPMRVVEVTKITDDMVKNAETIDKV--FPKLLEFIEGSVLVAHNAD-FDIGFLKHNAKVLGYEFDFTYIDTLGLAQDVFPDYKSYKLGRIAKNLGIKVE 562
>gi|169350436|ref|ZP_02867374.1| hypothetical protein CLOSPI_01204 [Clostridium spiroforme DSM 1552] >gi|169292756|gb|EDS74889.1| hypothetical protein CLOSPI_01204 [Clostridium spiroforme DSM 1552] (1439 aa)
Score = 90, Expect = 1.1e-01, Identities = 44/158 (27%), Positives = 71/158 (44%)
  Q:    12 VIFDIKTTEEGLDSE-ILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESE-GIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIW 169
           V FD++TT   +  + I  F A    N E++ +   FI   K I   I     ITN+ +++E  IDK+  L  +   F D IL  +N    V  L E + +     ++   ID+L LA+ I+       L  +     V Y++E    + Y   VL  ++
  S:   403 VAFDLETTGLSVIHDGITEFGAVKIKNGEVIDRMQKFINPGKTISSRISSLTNITNEMVKNEPTIDKV--LPEIMEFFGDCILVAHNASFDVGFLNENLRRSNMSEIKNPIIDSLALARAILKPMKSYRLGNVCRSYRVNYDDEVAHRADYDAKVLGDVF 560
>gi|116696325|ref|YP_841901.1| putative exonuclease [Ralstonia eutropha H16] >gi|113530824|emb|CAJ97171.1| putative exonuclease [Ralstonia eutropha H16] (220 aa)
Score = 90, Expect = 1.2e-01, Identities = 29/89 (32%), Positives = 46/89 (51%)
  Q:    10 KIVIFDIKTTEEGLDSE---ILYFAA-RTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGD 98
           + V+FDI+TT  GLDSE   IL   A R   N+         +   +K+P  I     IT + IE+EG+   SA+++      +  L ++N +
  S:    51 RFVVFDIETT--GLDSERHEILEIGAIRVNRNSNNHDTFQVLVKPSRKVPKKITELTGITPEMIEAEGVSLESAVQDFAKFAGNLRLVSFNAE 141
>gi|71004978|ref|XP_757155.1| hypothetical protein UM01008.1 [Ustilago maydis 521] >gi|74704124|sp|Q4PFV5|DPOE_USTMA DNA polymerase epsilon catalytic subunit A (DNA polymerase II subunit A) >gi|46096785|gb|EAK82018.1| hypothetical protein UM01008.1 [Ustilago maydis 521] (2305 aa)
Score = 90, Expect = 1.2e-01, Identities = 41/121 (33%), Positives = 67/121 (55%)
  Q:     1 MLKDLFK--DRKIVIFDIKTTEEGL---DSEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGI-------DKMSALENMTYIFQDA---ILFTYNGDNFVFPLLEKIYKECGYNLQISEI 121
           M+KD  K  D  ++ FDI+TT++ L   D+E       +Y    M+    F I T+++I    I  +  T +  E EG        D++  L+     F++A   ++ TYNGD F FP ++   +  G N+ +SEI
  S:   305 MVKDRVKRADPVVMAFDIETTKQPLKFPDAETDAVMMISY----MIDGQGFLI-TNREIVSEDIEDFEYTPRD-EYEGPFIIFNEPDELGVLQRFFSHFREARPTVVATYNGDLFDFPFIDARARAHGLNM-MSEI 433
>gi|109648713|ref|ZP_01372612.1| DNA polymerase III, alpha subunit [Desulfitobacterium hafniense DCB-2] >gi|109640010|gb|EAT49566.1| DNA polymerase III, alpha subunit [Desulfitobacterium hafniense DCB-2] (1447 aa)
Score = 89, Expect = 1.6e-01, Identities = 37/136 (27%), Positives = 65/136 (47%)
  Q:    16 IKTTEEGLDSEILYFAARTYINNEM----------VSKHNFFIATDKKIPGNIIRKYRITNKKI-ESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYE 151
           I TT   LD E   F+A T    E+          + +   F+  +K IP  ++    IT+  + ++E ID++     +    + ++L  +N D F    L+   K  GY+   + +D L LAK++        L  +A  LG++ E
  S:   420 IDTTYCVLDLETTGFSAATEKITEIGIMKIQGGKIIDQFGCFVNPEKPIPARVVEVTNITDDMVRDAETIDQV--FPKILNFIEGSVLVAHNAD-FDMGFLKHNAKVLGYDFDYTYLDTLSLAKELFPDYKTYKLGRIAKNLGIKVE 563
>gi|89897057|ref|YP_520544.1| hypothetical protein DSY4311 [Desulfitobacterium hafniense Y51] >gi|89336505|dbj|BAE86100.1| hypothetical protein [Desulfitobacterium hafniense Y51] (1447 aa)
Score = 89, Expect = 1.6e-01, Identities = 37/136 (27%), Positives = 65/136 (47%)
  Q:    16 IKTTEEGLDSEILYFAARTYINNEM----------VSKHNFFIATDKKIPGNIIRKYRITNKKI-ESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYE 151
           I TT   LD E   F+A T    E+          + +   F+  +K IP  ++    IT+  + ++E ID++     +    + ++L  +N D F    L+   K  GY+   + +D L LAK++        L  +A  LG++ E
  S:   420 IDTTYCVLDLETTGFSAATEKITEIGIMKIQGGKIIDQFGCFVNPEKPIPARVVEVTNITDDMVRDAETIDQV--FPKILNFIEGSVLVAHNAD-FDMGFLKHNAKVLGYDFDYTYLDTLSLAKELFPDYKTYKLGRIAKNLGIKVE 563
>gi|42560899|ref|NP_975350.1| DNA polymerase III alpha chain [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492396|emb|CAE76992.1| DNA polymerase III alpha chain [Mycoplasma mycoides subsp. mycoides SC str. PG1] (1482 aa)
Score = 89, Expect = 1.8e-01, Identities = 50/167 (29%), Positives = 79/167 (47%)
  Q:     6 FKDRKIVIFDIKTTEEGLD---SEILYFAARTY-INNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMS---ALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN-LQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRL 172
            KD ++V FD++TT  GL     EI+ F A  Y +      K +  I    K+     +   IT K +E    DK S   A + +  I +DAIL  +N  NF F  L    ++ GY+ L+ + ID L +++ I        L  LA ++ + Y+        Y   +L  I+ R+
  S:   430 LKDARMVFFDLETT--GLSPELDEIIEFGAIEYNLKTGERKKIDILIKPKTKLKAFTQKLTNITEKMLE----DKPSIEQAFKQINEIIKDAILVAHNA-NFDFTFLSYWSEKLGYSKLENTIIDTLTISRIIYPDLKSHRLGSLAKRVNISYDPSIAHRGDYDADILADIYERM 597
>gi|147808050|emb|CAN73010.1| hypothetical protein [Vitis vinifera] (369 aa)
Score = 88, Expect = 2.1e-01, Identities = 24/69 (34%), Positives = 40/69 (57%)
  Q:     1 MLKDLFKDRKIVIFDIKTTEEGLDSEILYFAARTYINN--EMVSKHNFFIATDKKIPGNIIRKYRITNKKI 69
           ML++ F+ RK  + D   T+EGL +   +FAA++Y     ++ S   F  ++ + I GN  RKY +  KK+
  S:   261 MLQEPFRKRKWCLRDFADTQEGLRN---HFAAKSYSRRAAKLASTWMFSASSLRHISGNFRRKYTLLYKKV 328
>gi|148377333|ref|YP_001256209.1| DNA polymerase III PolC [Mycoplasma agalactiae PG2] >gi|148291379|emb|CAL58763.1| DNA polymerase III alpha subunit [Mycoplasma agalactiae PG2] (1459 aa)
Score = 88, Expect = 2.3e-01, Identities = 49/169 (28%), Positives = 77/169 (45%)
  Q:     6 FKDRKIVIFDIKTTEEGLDS---EILYFAARTYINNEMVSKH--NFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNL-QISEIDALKLAKQIIGFDD--DISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRLKS 174
           FKD   V FDI+TT  GL     EI+ F A   IN ++       FFI    KI         IT + ++SEG+     L+ +       +   +N   F F  L++ ++        ++ ID L  ++  IGF +     LE++ ++LGV Y+        Y   VL  +W  + S
  S:   420 FKDYSYVSFDIETT--GLSPKFHEIIEFGA-VDINQDLKVGEVTQFFIKPQAKIGAFTTELTGITQQMLDSEGLSIKDGLQRIYDCLDGKVAIAHNA-KFDFNFLKEQFRLNNVPFPNVTVIDTLIASR--IGFPNYKRHKLEDVTSRLGVVYDPNVAHRGDYDAKVLANVWVNIIS 590
>gi|188159598|ref|ZP_02512644.2| DNA polymerase III alpha chain [Mycoplasma mycoides subsp. mycoides LC str. GM12] (1482 aa)
Score = 88, Expect = 2.4e-01, Identities = 50/167 (29%), Positives = 78/167 (46%)
  Q:     6 FKDRKIVIFDIKTTEEGLD---SEILYFAARTY-INNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMS---ALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGY-NLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIWFRL 172
            KD ++V FD++TT  GL     EI+ F A  Y +      K +  I    K+     +   IT K +E    DK S   A + +  I +DAIL  +N  NF F  L    ++ GY  L+ + ID L +++ I        L  LA ++ + Y+        Y   +L  I+ R+
  S:   430 LKDARMVFFDLETT--GLSPELDEIIEFGAIEYNLKTGERKKIDILIKPKAKLKAFTQKLTNITEKMLE----DKPSIEQAFKQINEIIKDAILVAHNA-NFDFTFLSYWSEKLGYGKLENTIIDTLTISRIIYPDLKSHRLGSLAKRVNISYDPSIAHRGDYDADILADIYERM 597
>gi|58337449|ref|YP_194034.1| ATP-dependent DNA helicase [Lactobacillus acidophilus NCFM] >gi|58254766|gb|AAV43003.1| ATP-dependent DNA helicase [Lactobacillus acidophilus NCFM] (927 aa)
Score = 88, Expect = 2.4e-01, Identities = 34/149 (22%), Positives = 69/149 (46%)
  Q:     2 LKDLFKDRKIVIFDIKTTEEGLDS--EILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN-LQISEIDALKLAKQIIGFDDDISLEELATKLGVRY 150
           +  +F      + D++TT    ++   I+ F      N ++V  ++F I   ++IP +++    I+N+ ++ +  D       +  I QD +   +N D F  P L     + GY+ L    ID ++LAK          L +L ++L +++
  S:     1 MAKIFNKDTFAVVDLETTGTQRENGHHIIQFGCAIIKNMKVVKTYSFLINPHREIPQSVVNLTGISNEDVQKQK-DFDYYAPKIVSILQDTVFVAHNVD-FDLPFLNYELTQHGYDALTNKAIDTVELAKIAFPTLPSYKLGDLTSQLKIKH 150
>gi|34762810|ref|ZP_00143796.1| DNA polymerase III alpha subunit [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887512|gb|EAA24596.1| DNA polymerase III alpha subunit [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (1216 aa)
Score = 87, Expect = 2.6e-01, Identities = 40/145 (27%), Positives = 72/145 (49%)
  Q:     8 DRKIVIFDIKTTEEGLDS---EILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESE-GIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEE 152
           D + V+FDI+TT  GL+S   EI+   A    +  ++ +++  I   + IP +I     IT++++ +E  IDK+  +        DA+L  +N    +  +   I K    + Q S ID L++A+ +        L +L   LG+  E+
  S:   419 DEEFVVFDIETT--GLNSHTNEIIEIGAVKIKSGRIMDRYSQLINPGRPIPYHITEITSITDEQVANEPKIDKV--IGKFVDFVGDAVLVAHNAPFDMGFIKRDIKKYLNIDYQCSVIDTLQMARDLFPDLKKYGLGDLNKTLGLALEK 563
>gi|147833440|emb|CAN77473.1| hypothetical protein [Vitis vinifera] (391 aa)
Score = 87, Expect = 2.8e-01, Identities = 24/68 (35%), Positives = 36/68 (52%)
  Q:     1 MLKDLFKDRKIVIFDIKTTEEGLDSEILYFAARTYINN--EMVSKHNFFIATDKKIPGNIIRKYRITNKK 68
           ML++ F+ RK  + D   T+EGL +   +FA   Y+    +M S   F  +  + I GN  RKY +  KK
  S:   124 MLQEPFRKRKWCLRDFADTQEGLRN---HFATTCYLRRVAKMASTLRFPASLSRHISGNFRRKYTLLYKK 190
>gi|29840147|ref|NP_829253.1| DNA polymerase III subunit epsilon [Chlamydophila caviae GPIC] >gi|29834495|gb|AAP05131.1| DNA polymerase III, epsilon chain [Chlamydophila caviae GPIC] (228 aa)
Score = 87, Expect = 2.9e-01, Identities = 37/119 (31%), Positives = 63/119 (52%)
  Q:    11 IVIFDIKTTEEGLDSE-ILYFAARTYINNEMVSKHNF--FIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN----LQISEIDALKLAKQ 129
           ++ +D +TT   +D + I+  AA    NN  V+K +F  ++  +  IP    + + IT   + S      +  +   +   +AIL  +N D+F FPLLE   KEC  +    L +  ID+LK A++
  S:     4 LIFYDTETTGTQIDKDRIIEIAA---YNN--VTKQSFVTYVNPEIPIPEEASKIHGITTSTVSSAPKFPEAYKQFCDFCGNEAILVAHNNDSFDFPLLE---KECRRHSLEPLSLRTIDSLKWAQK 121
>gi|19703626|ref|NP_603188.1| DNA polymerase III alpha subunit [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713736|gb|AAL94487.1| DNA polymerase III alpha subunit [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (1454 aa)
Score = 85, Expect = 4.4e-01, Identities = 40/145 (27%), Positives = 71/145 (48%)
  Q:     8 DRKIVIFDIKTTEEGLDS---EILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESE-GIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEE 152
           D + V+FDI+TT  GL+S   EI+   A       +V +++  I   + IP +I     IT++++ +E  ID++  +        DA+L  +N    +  +   I K    + Q S ID L++A+ +        L +L   LG+  E+
  S:   424 DEEFVVFDIETT--GLNSHTNEIIEIGAVKIKAGRIVDRYSQLINPGRPIPYHITEITSITDEQVANEPKIDEV--IGKFVDFIGDAVLVAHNAPFDMGFIKRDIKKYLNIDYQCSVIDTLQMARDLFPDLKKYGLGDLNKTLGLALEK 568
>gi|62185003|ref|YP_219788.1| DNA polymerase III subunit epsilon [Chlamydophila abortus S26/3] >gi|62148070|emb|CAH63824.1| DNA polymerase III, epsilon chain [Chlamydophila abortus S26/3] (228 aa)
Score = 85, Expect = 4.6e-01, Identities = 33/119 (27%), Positives = 58/119 (48%)
  Q:    11 IVIFDIKTTEEGLDSE-ILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN----LQISEIDALKLAKQ 129
           ++ +D +TT   +D + I+  AA  +I  E       ++  +  IP    + + IT   + S      +      +   DA+L  +N D+F FPL+E   KEC  +    L +  ID+LK A++
  S:     4 LIFYDTETTGTQIDKDRIIEIAAYNHITKESFVT---YVNPEIPIPEEASKIHGITTSTVISAPKFPEAYKHFCEFCGNDAVLVAHNNDSFDFPLME---KECRRHALEPLSLKTIDSLKWAQK 121
>gi|109644995|ref|ZP_01368915.1| DnaQ family exonuclease/DinG family helicase, putative [Desulfitobacterium hafniense DCB-2] >gi|109642944|gb|EAT52497.1| DnaQ family exonuclease/DinG family helicase, putative [Desulfitobacterium hafniense DCB-2] (929 aa)
Score = 85, Expect = 4.8e-01, Identities = 27/87 (31%), Positives = 47/87 (54%)
  Q:    10 KIVIFDIKTTEEGLD---SEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYN 96
           KIV+ DI+TT  G D    EI+ FAA      E     +  I+  +++P  I+R   I+ ++++  G    +  + +  +FQDAI+  +N
  S:     5 KIVVIDIETT--GFDIYNDEIIEFAALCIEEGEEAEAFSVLISPRRQVPERILRLTGISPEELKQAG-SLQAYRDKILDLFQDAIIVGHN 91
>gi|84514691|ref|ZP_01002055.1| exonuclease, DNA polymerase III, epsilon subunit family [Loktanella vestfoldensis SKA53] >gi|84511742|gb|EAQ08195.1| exonuclease, DNA polymerase III, epsilon subunit family [Loktanella vestfoldensis SKA53] (469 aa)
Score = 85, Expect = 4.9e-01, Identities = 32/143 (22%), Positives = 63/143 (44%)
  Q:     6 FKDRKIVIFDIKTTEEGL---DSEILYFAARTYINNEMVSKH--NFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGV 148
            +D   V+FD +TT  G      E++   A   +N +       +  +   + IP +    +RIT+  ++ +  D + A        +DA+L  +N   F      +   + G       +D + L+  + G  +  +L+ELA +LG+
  S:   271 LRDLTYVVFDTETT--GFLPNKDEVVQIGALRVVNGQQAPGEVLDLLVNPGRAIPASSTAVHRITDAMVK-DAPDMVHAGRKFHSFARDAVLVAHNAP-FDLSFFHRYAPKIGMKFDHPVLDTVLLSAVLFGITEGHTLDELAKRLGI 414
>gi|52080748|ref|YP_079539.1| bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon [Bacillus licheniformis ATCC 14580] >gi|52786119|ref|YP_091948.1| bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon [Bacillus licheniformis ATCC 14580] >gi|52003959|gb|AAU23901.1| ATP-dependent helicase [Bacillus licheniformis ATCC 14580] >gi|52348621|gb|AAU41255.1| DinG [Bacillus licheniformis DSM 13] (930 aa)
Score = 84, Expect = 6.0e-01, Identities = 32/144 (22%), Positives = 76/144 (52%)
  Q:     8 DRKIVIFDIKTTEEGLDS--EILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSAL-ENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGY-NLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYE 151
           +++ V+ D++TT         I+  AA    N ++  + + ++  ++ IP  I +   I+N+ +E+E  +  SA+ E++  +  D+    +N  +F    ++   +  G+  ++ S +D ++L++ +    D   L EL+ +L +R+E
  S:     3 NQRYVVIDVETTGNSPKKGDRIIQIAAVVIENGQITERFSKYVNPNQPIPAFIEQLTGISNEMVENE--EPFSAIAEDIFELLHDSCFIAHN-IHFDLAFVKHELQLAGFGEIECSVLDTVELSRIVFPGFDGYKLTELSEELQIRHE 147
>gi|167756906|ref|ZP_02429033.1| hypothetical protein CLORAM_02455 [Clostridium ramosum DSM 1402] >gi|167703081|gb|EDS17660.1| hypothetical protein CLORAM_02455 [Clostridium ramosum DSM 1402] (1445 aa)
Score = 84, Expect = 6.4e-01, Identities = 41/158 (25%), Positives = 68/158 (43%)
  Q:    12 VIFDIKTTEEGLDSE-ILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESE-GIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRYEEERLLGSPYTTMVLEKIW 169
           V FD++TT   +  + I  F A    N E++ +   F+   K I   I     ITN  + +E  ID +  L  +   F D IL  +N +  +  L E + +     +    ID+L LA+ I+       L  +     V Y++E    + Y   VL  ++
  S:   409 VSFDLETTGLSVIHDGITEFGAVKIKNGEVIDRLQMFVNPGKSISSRITNLTSITNDMVRNEPTIDAL--LPRIIEFFDDCILVAHNANFDIGFLNENLRRNNMPEITNPIIDSLALARAILKPMKSYRLGNVCRSYRVNYDDEVAHRADYDAEVLGDVF 566
>gi|89898431|ref|YP_515541.1| DNA polymerase III subunit epsilon [Chlamydophila felis Fe/C-56] >gi|89331803|dbj|BAE81396.1| DNA polymerase III epsilon chain [Chlamydophila felis Fe/C-56] (228 aa)
Score = 84, Expect = 6.6e-01, Identities = 37/119 (31%), Positives = 61/119 (51%)
  Q:    11 IVIFDIKTTEEGLDSE-ILYFAARTYINNEMVSKHNFFIATDKKIP--GNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYN----LQISEIDALKLAKQ 129
           ++ +D +TT   +D + I+  AA    NN  V+K +F    + KIP      + + IT   + S      +  +   +   +A+L  +N D F FPLLE   KEC  +    L +  ID+LK A++
  S:     4 LIFYDTETTGTQIDKDRIIEIAA---FNN--VTKESFVTYVNPKIPIPEEASKIHGITTSTVASAPDFPEAYKQFRDFCGNEAVLVAHNNDGFDFPLLE---KECRRHSLEPLTLRTIDSLKWAQK 121
>gi|89894618|ref|YP_518105.1| hypothetical protein DSY1872 [Desulfitobacterium hafniense Y51] >gi|89334066|dbj|BAE83661.1| hypothetical protein [Desulfitobacterium hafniense Y51] (929 aa)
Score = 84, Expect = 6.7e-01, Identities = 27/87 (31%), Positives = 47/87 (54%)
  Q:    10 KIVIFDIKTTEEGLD---SEILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYN 96
           KIV+ DI+TT  G D    EI+ FAA      E     +  I+  +++P  I+R   I+ ++++  G    +  + +  +FQDAI+  +N
  S:     5 KIVVIDIETT--GFDIYNDEIIEFAALCIEEGEEAEAFSVLISPRRQVPERILRLTGISPEELKQAG-SLHAYRDKILDLFQDAIIVGHN 91
>gi|168214684|ref|ZP_02640309.1| putative phage endopeptidase [Clostridium perfringens CPE str. F4969] >gi|170713871|gb|EDT26053.1| putative phage endopeptidase [Clostridium perfringens CPE str. F4969] (841 aa)
Score = 83, Expect = 7.3e-01, Identities = 40/126 (31%), Positives = 59/126 (46%)
  Q:    24 DSEILYFAARTYIN---NEMVSKHNFFIATDKKIPGNIIRKYRITNKKI-ESEGIDKMSALENMTYIFQDAILFTYNG----DNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVR 149
           D+ I+    R  IN   N  V  H F   +D     NII   RI +K + E+ G+D            ++  L  + G    DNF F + EKI  + GY +         L K +   + DIS+ E+ATKL ++
  S:   104 DTNIVEKDGRGAINQILNTTVDSHRFTATSDI----NIINNCRIVDKTVTEAIGVD------------ENCFLNRWGGEIDYDNFKFKINEKIGSDNGYRIS--------LRKNLKAINGDISITEVATKLKIK 213
>gi|16079297|ref|NP_390121.1| bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon [Bacillus subtilis subsp. subtilis str. 168] >gi|1706437|sp|P54394|DING_BACSU Probable ATP-dependent helicase dinG homolog >gi|1146243|gb|AAB38451.1| 22.4% identity with Escherichia coli DNA-damage inducible protein ...; putative [Bacillus subtilis] >gi|2634658|emb|CAB14156.1| ATP-dependent helicase [Bacillus subtilis subsp. subtilis str. 168] (931 aa)
Score = 83, Expect = 7.9e-01, Identities = 31/144 (21%), Positives = 70/144 (48%)
  Q:     9 RKIVIFDIKTTEEGLDS--EILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEI-DALKLAKQIIGFDDDISLEELATKLGVRYEE 152
           ++ V+ D++TT        +I+  AA    N ++  + + +I  +K IP  I +   I+N+ +E+E      A+    +   D   F  +  +F    ++    + G+ L   E+ D ++L++ +    +   L EL+ +L +R+++
  S:     4 QRFVVIDVETTGNSPKKGDKIIQIAAVVIENGQITERFSKYINPNKSIPAFIEQLTGISNQMVENE--QPFEAVAEEVFQLLDGAYFVAHNIHFDLGFVKYELHKAGFQLPDCEVLDTVELSRIVFPGFEGYKLTELSEELQLRHDQ 148
>gi|120436594|ref|YP_862280.1| DNA polymerase III subunit epsilon [Gramella forsetii KT0803] >gi|117578744|emb|CAL67213.1| DNA polymerase III subunit epsilon [Gramella forsetii KT0803] (258 aa)
Score = 82, Expect = 9.2e-01, Identities = 28/102 (27%), Positives = 49/102 (48%)
  Q:     4 DLFKDRKIVIFDIKTTEEGLDSE-ILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLL 105
           DL   + I  FD++TT   +  + I+  A      N     H + +  +++IP  +I  + ITN+K+ +E   K  A + +  + +   L  YN + F  PLL
  S:     2 DLKLTKPICFFDLETTGTNISKDRIVEIAVLKVFPNGNKESHTWLVNPEREIPAEVIAIHGITNEKVANEPTFKELA-QKIHDLIKGCDLGGYNSNRFDIPLL 103
>gi|89890830|ref|ZP_01202339.1| DNA polymerase III [Flavobacteria bacterium BBFL7] >gi|89516975|gb|EAS19633.1| DNA polymerase III [Flavobacteria bacterium BBFL7] (453 aa)
Score = 82, Expect = 9.8e-01, Identities = 36/156 (23%), Positives = 72/156 (46%)
  Q:    13 IFDIKTTEEGLDSE-ILYFAARTYINNEMVSKHNFFIATDKKIPGNIIRKYRITNKKIESEGIDKMSALENMTYIFQDAILFTYNGDNFVFPLLEKIYKECGYNLQISEIDALKLAKQIIGFDDDISLEELATKLGVRY-EEERLLGSPYTTMVLEKI 168
           I D++TT    + E I   A   +  +E+V +    +  +K+I   +++   I NK + +         + +  I Q  +L  +N  NF + +L   ++  GY      +  ++LA+Q++  ++  SL +L   LG+   +  R  G    T+ L K+
  S:     4 IVDVETTGGKFNEEGITEIAIYKFDGHEIVDQFASLVNPEKEIQPFVVKLTGINNKML-ARAPKFYEVAKRIIEIMQGTVLVAHNA-NFDYRMLRIEFERLGYEFHTQTLCTVELAQQLMPEEESYSLGKLTRSLGIPITDRHRATGDALATVKLFKM 159