>gi|26553582|ref|NP_757516.1| phosphoesterase [Mycoplasma penetrans HF-2] >gi|26453588|dbj|BAC43920.1| predicted phosphoesterase [Mycoplasma penetrans HF-2] (170 aa)
Score = 862, Expect = 3.5e-91, Identities = 170/170 (100%), Positives = 170/170 (100%)
  Q:     1 MKWVVDMKKILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDVVKYPA 170
           MKWVVDMKKILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDVVKYPA
  S:     1 MKWVVDMKKILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDVVKYPA 170
>gi|13507865|ref|NP_109814.1| hypothetical protein MPN126 [Mycoplasma pneumoniae M129] >gi|2501609|sp|P75349|Y126_MYCPN Putative metallophosphoesterase MG207 homolog >gi|1673676|gb|AAB95676.1| hypothetical protein MPN_126 [Mycoplasma pneumoniae M129] (159 aa)
Score = 252, Expect = 1.6e-20, Identities = 57/156 (36%), Positives = 87/156 (55%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERREL--KLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF 162
           M K+L++SDTHG    +  ++    PD+ IH GD  T    + +N  ++VAGN+D  GE I  F++E +   LMHG Q     P ++ ++    L + AK    D+L  GH+HIE     D I +INPGSL  PRN  ++ +Y  L++   +I  + F
  S:     1 MTKVLVLSDTHGYNDRWLAVMKLHNPDVVIHAGDHLTTKKFMDQNATFWVAGNHDVVGEEIQMFELEGIQFVLMHGHQ----APRHDLKQWYKMLVDQAKSYLCDVLIVGHSHIEHYETIDGIQVINPGSLEIPRNPRKLPTYCNLNLSQGRISDLTF 154
>gi|2507518|sp|P47449|Y207_MYCGE Putative metallophosphoesterase MG207 (163 aa)
Score = 223, Expect = 4.3e-17, Identities = 56/151 (37%), Positives = 80/151 (52%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELK-----LYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           M K+L+I+DTHG    + ++ N   PD+ IH GD  T    + +N  ++VAGNND  G  I  F++  +N  LMHG Q         R  LK     L   A++   D+L  GH+HIE     + I +INPGSL  PRN     SY    +  +++
  S:     1 MIKVLVIADTHGQNQRWIELKNYHNPDVIIHAGDHMTTKQFMDQNATFWVAGNNDSIGNEIEIFQLGQINFVLMHGHQ-------APRDNLKKWYQLLVLKAQQYPCDVLIFGHSHIEYTNKINMIQLINPGSLQLPRNQTNTPSYCTFIVNKDEL 149
>gi|15828773|ref|NP_326133.1| hypothetical protein MYPU_3020 [Mycoplasma pulmonis UAB CTIP] >gi|14089716|emb|CAC13475.1| conserved hypothetical protein [Mycoplasma pulmonis] (162 aa)
Score = 222, Expect = 4.7e-17, Identities = 60/156 (38%), Positives = 90/156 (57%)
  Q:    10 ILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERI-VDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           ILIISD HGD     KI+  +  D  I  GD     DL+ + FD+FVAGNND++  R  +DF+I      L HG   G        + ++  +  K ++ DIL  GH+H+  +   ++ + INPGS+  PR ++Q KS+A+L I  NK+ +VEF++V
  S:     5 ILIISDIHGDLKTLEKILKSQSYDYAISAGDHLLSYDLMQKYFDFFVAGNNDFDQARTSLDFEIMGKKIHLEHGHLIGSYNQLINSKFME--KVLKNSSFDILIYGHSHMNLLTKYEDKIAINPGSISLPRFSSQ-KSFAILTIANNKM-NVEFKNV 157
>gi|12045059|ref|NP_072869.1| Ser/Thr protein phosphatase family protein [Mycoplasma genitalium G37] >gi|11377624|pir||H64222 VPS29-like phosphoesterase-related protein MG207 [similarity] - Mycoplasma genitalium >gi|3844805|gb|AAC71425.1| Ser/Thr protein phosphatase family protein [Mycoplasma genitalium G37] >gi|166078656|gb|ABY79274.1| Ser/Thr protein phosphatase family protein [synthetic Mycoplasma genitalium JCVI-1.0] (167 aa)
Score = 220, Expect = 1.0e-16, Identities = 55/149 (36%), Positives = 79/149 (53%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELK-----LYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           K+L+I+DTHG    + ++ N   PD+ IH GD  T    + +N  ++VAGNND  G  I  F++  +N  LMHG Q         R  LK     L   A++   D+L  GH+HIE     + I +INPGSL  PRN     SY    +  +++
  S:     7 KVLVIADTHGQNQRWIELKNYHNPDVIIHAGDHMTTKQFMDQNATFWVAGNNDSIGNEIEIFQLGQINFVLMHGHQ-------APRDNLKKWYQLLVLKAQQYPCDVLIFGHSHIEYTNKINMIQLINPGSLQLPRNQTNTPSYCTFIVNKDEL 153
>gi|166031428|ref|ZP_02234257.1| hypothetical protein DORFOR_01118 [Dorea formicigenerans ATCC 27755] >gi|166028833|gb|EDR47590.1| hypothetical protein DORFOR_01118 [Dorea formicigenerans ATCC 27755] (159 aa)
Score = 202, Expect = 1.2e-14, Identities = 54/157 (34%), Positives = 81/157 (51%)
  Q:     9 KILIISDTHGDRSFFRKIIN-EEQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGE--RIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           KI+I+SDTHG R     +       D+ IH GD   D D I   F+   + V GNND+     R  +F++E  +  + HG  +  S+      E  L E A+    DI+  GHTH+  +    +++ +NPGSL YPR   +  +Y V+ +E  K   VE + V
  S:     2 KIVIVSDTHGSRKNIENVCECNPDADMLIHLGDVEDDADYIEAIFECPTHIVGGNNDFFSRLPREEEFELEGHHIFITHGHAYYVSMG-----EAHLQEEARRRGADIVMYGHTHVPALTIDADLVTLNPGSLTYPRQQGRQATYMVMKLEKGKQPEVELKTV 159
>gi|153852673|ref|ZP_01994110.1| hypothetical protein DORLON_00084 [Dorea longicatena DSM 13814] >gi|149754315|gb|EDM64246.1| hypothetical protein DORLON_00084 [Dorea longicatena DSM 13814] (160 aa)
Score = 197, Expect = 3.9e-14, Identities = 59/147 (40%), Positives = 81/147 (55%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQP-DIKIHCGDFCTDIDLISENFD---YFVAGNNDY----EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGN 155
           KILIISDTHG    F ++I +E+P D+ IH GD   D D I    D   + V GNND+     GE   +F +E  +    HG   GY V   E R   L + A+    DI+  GHTH      ++ ++ +NPGSL YPR   +  SY ++ I+ N
  S:     2 KILIISDTHGSHKNFDRVIEKERPLDMLIHLGDVEGDEDYIPAVADCPVHMVRGNNDFFSNLPGEE--EFMVEGYHIFTTHGH--GYYVSMGETR---LKQEARGRGADIVMYGHTHRPFYEKEEGLITLNPGSLCYPRQPGRKPSYMIMQIDSN 149
>gi|169350165|ref|ZP_02867103.1| hypothetical protein CLOSPI_00909 [Clostridium spiroforme DSM 1552] >gi|169292948|gb|EDS75081.1| hypothetical protein CLOSPI_00909 [Clostridium spiroforme DSM 1552] (154 aa)
Score = 188, Expect = 4.5e-13, Identities = 56/160 (35%), Positives = 88/160 (55%)
  Q:     7 MKKILIISDTHGDRSFFRKIIN-EEQPDIKIHCGDFCTDIDLISENFD------YFVAGNNDYEG--ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDVV 166
           MKKI+I+SD HG R+   +I   E   D  +HCGD        SE  +        V GNND+    +  + F+ E L   + HG ++GY       RE  + +  + +  D+L SGHTH+ Q    D   +INPGS   PR  +  KSY V++++  +++ VEF++++
  S:     1 MKKIVIMSDNHGYRNIIEEIKRLEPDGDFYVHCGD--------SEGMEKDLKGWISVRGNNDWMAKLDDEIMFETEGLAFLVTHGHRYGYL-----NRETMMVDDLQRHGCDVLLSGHTHVPQCDNIDGFYLINPGSTTLPRQGSN-KSYCVIYVDKGQLE-VEFKEII 154
>gi|153812642|ref|ZP_01965310.1| hypothetical protein RUMOBE_03042 [Ruminococcus obeum ATCC 29174] >gi|149831346|gb|EDM86434.1| hypothetical protein RUMOBE_03042 [Ruminococcus obeum ATCC 29174] (159 aa)
Score = 182, Expect = 2.0e-12, Identities = 54/155 (34%), Positives = 83/155 (53%)
  Q:     9 KILIISDTHG-DRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFDY---FVAGNNDYEGE--RIVDFKIEDLNCRLMHGDQFGYS--VPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           K+LI+SDTHG D +  R ++ E   D+ +HCGD       I    D     VAGNND+  +  R  + +++     + HG+ +G S  + G       + E AK  + D +F GHTH   +   D +L INPGSL YPR   +  SY +L  + ++  S + +
  S:     2 KVLIVSDTHGHDENLERAVMMETPFDMLVHCGDVEGREIFIEALVDCPCCIVAGNNDFFSDLPREEEIELDGNKVLVTHGNYYGVSMDISG-------VAEEAKSRDCDAVFFGHTHKPVIEEIDGVLAINPGSLSYPRQHGRKPSYVILETDKDRKMSAKIK 157
>gi|188586562|ref|YP_001918107.1| phosphodiesterase, MJ0936 family [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179351249|gb|ACB85519.1| phosphodiesterase, MJ0936 family [Natranaerobius thermophilus JW/NM-WN-LF] (178 aa)
Score = 177, Expect = 9.0e-12, Identities = 55/153 (35%), Positives = 82/153 (53%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQP-DIKIHCGDFCTDI-----------DLISEN-FDYF-VAGNND-YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVE 161
           K+ +ISDTHG      + I++ +P    +H GDF TD+           DL+ EN   Y+ V GN D Y+    +  ++  L   L+HG        G +   L+L   A+E   DI+  GHTHI     ++ +L  NPGS  YPR   +  SY ++ + GN + S E
  S:    10 KLAVISDTHGKIDDVVQSISKNEPVHYILHAGDFLTDLHNIKYEIEHNPDLLKENPLGYYGVVGNCDGYKSPSKLLIEVSGLRILLLHG-----HYEGVKNGLLQLNYLAEEERSDIVIFGHTHIPVNIQENGVLFFNPGSFNYPRGGVKEPSYGIIEVSGNTLNSAE 172
>gi|169829485|ref|YP_001699643.1| putative metallophosphoesterase ysnB [Lysinibacillus sphaericus C3-41] >gi|168993973|gb|ACA41513.1| Putative metallophosphoesterase ysnB [Lysinibacillus sphaericus C3-41] (167 aa)
Score = 174, Expect = 1.8e-11, Identities = 60/154 (38%), Positives = 82/154 (53%)
  Q:     9 KILIISDTHGDRSFFRKIIN-EEQPDIKIHCGDFCTDIDLISENFDYF--VAGNND--YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF 162
           +ILI+SDTHGD     K+ N   + D++IHCGD  +++  + +       V GN D          F IED+   + HG  F       +   L L   AKE N  I+  GH+HI      DNIL INPGSL+ PR   + KS+A+L IE +   +VEF
  S:     2 EILIMSDTHGDSHVIDKVRNFYPEIDVRIHCGD--SELPYVHDALKGMKKVRGNCDREEAFPEEEFFTIEDVKILVTHGHLFNV-----KSSMLSLAYRAKELNAQIVCFGHSHILGAEMLDNILFINPGSLLKPRGRKE-KSFAMLKIEDSTF-TVEF 151
>gi|15895922|ref|NP_349271.1| phosphoesterase [Clostridium acetobutylicum ATCC 824] >gi|15025694|gb|AAK80611.1|AE007764_3 Predicted phosphoesterase, YSNB B.subtilis ortholog [Clostridium acetobutylicum ATCC 824] (155 aa)
Score = 174, Expect = 1.9e-11, Identities = 55/138 (39%), Positives = 79/138 (57%)
  Q:    10 ILIISDTHGDRSFFRKII-NEEQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVDFKIEDLNCR---LMHGDQFG--YSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSY 147
           I ++SDTH  + + +K   N    D+ IH GD   DID I + ++    ++ GN D   E+I   K   L  +   + HGD++G  YS+       +KL   AKE   DI+  GHTHI Q+ + D I  INPGS+ YPRNA+   +Y
  S:     3 ISVMSDTHLSKHYIKKACSNLTNVDVLIHLGDNVQDIDEIKKYYNGELIYIRGNCD--DEKIPSEKTFLLGGKKFFITHGDRYGVKYSM-------MKLEYRAKELEADIVLFGHTHISQIDFNDGIWYINPGSVSYPRNASNSTAY 140
>gi|167759970|ref|ZP_02432097.1| hypothetical protein CLOSCI_02342 [Clostridium scindens ATCC 35704] >gi|167662589|gb|EDS06719.1| hypothetical protein CLOSCI_02342 [Clostridium scindens ATCC 35704] (159 aa)
Score = 172, Expect = 3.2e-11, Identities = 51/145 (35%), Positives = 78/145 (53%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQP-DIKIHCGDFCTDIDLISENFD---YFVAGNNDY----EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           KILI+SDTH       K++   +P D+ IH GD   + D I    D   + + GNND+     GE   +F IE  +  + HG  +  S+      E +L E A+    DI+  GHTH   +  +D+++ +NPGSL YPR   +  SY ++  +
  S:     2 KILIVSDTHKSHKNLDKVLEIVKPIDMLIHLGDVEGEDDYIQALADCPAHIIRGNNDFFCDLPGEE--EFFIEGFHVFITHGHYYYVSM-----SEERLKEEARGRGADIVMYGHTHKPSITREDDLITLNPGSLSYPRQEGRRPSYMLMETD 147
>gi|160914277|ref|ZP_02076498.1| hypothetical protein EUBDOL_00287 [Eubacterium dolichum DSM 3991] >gi|158433904|gb|EDP12193.1| hypothetical protein EUBDOL_00287 [Eubacterium dolichum DSM 3991] (161 aa)
Score = 171, Expect = 3.8e-11, Identities = 54/155 (34%), Positives = 86/155 (55%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFDYFVA--GNND----YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           K++++SD+HG  S  + ++ +  Q ++ +HCGD    I+   + +   V   GNND    Y  ER+V   +      ++H  QF YS     RR  +L + AK    DI+  GHTHI      D + ++NPGSL   R+  +  SYAV+ +EG+ +  VEF+
  S:     2 KVIVVSDSHGKDSAIQAVLEQYPQAELFLHCGD----IEAEPQQYPQLVTVRGNNDIFYDYPEERVV--TVGKHRIYVVHSHQFMYS-----RRVEQLAQKAKSLACDIVCYGHTHIAAYEVVDGVHVLNPGSLWRSRDG-RGPSYAVVELEGDNV-DVEFK 150
>gi|126652647|ref|ZP_01724808.1| phosphoesterase, putative [Bacillus sp. B14905] >gi|126590496|gb|EAZ84614.1| phosphoesterase, putative [Bacillus sp. B14905] (167 aa)
Score = 171, Expect = 4.5e-11, Identities = 60/154 (38%), Positives = 84/154 (54%)
  Q:     9 KILIISDTHGDRSFFRKIIN-EEQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDYEG----ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF 162
           KILI+SDTHGD     K+ N   + D++IHCGD  +++  + +       V GN D E     E I  F ++ +   + HG  F       +   L L   AKE N  I+  GH+HI      D+IL INPGSL+ PR   + KS+AVL I+ +   +VEF
  S:     2 KILIMSDTHGDCQVIDKVRNFYPEIDVRIHCGD--SELPYVHDALKGMKKVRGNCDREEAFPEEEI--FTVDGVRILVTHGHLFNV-----KSSILSLSYRAKELNAQIVCFGHSHILGAEMMDHILFINPGSLLKPRGRKE-KSFAVLEIKDSTF-TVEF 151
>gi|160878528|ref|YP_001557496.1| phosphodiesterase [Clostridium phytofermentans ISDg] >gi|160427194|gb|ABX40757.1| phosphodiesterase, MJ0936 family [Clostridium phytofermentans ISDg] (164 aa)
Score = 170, Expect = 6.2e-11, Identities = 54/144 (37%), Positives = 80/144 (55%)
  Q:    10 ILIISDTHGDRSFFRKIINEEQP-DIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGE--RIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNIL-IINPGSLMYPRNANQMKSYAVLHIE 153
           ILI+SD+HG  +   + I +  P D+ IH GD+  D   I E  D     V+GNNDY  +  R    +I      L HG ++G +   Y   +LK  E A  N  DI+  GHTH   +  KD+ L +INPGS+  PR A ++ ++ ++ I+
  S:     3 ILIVSDSHGRYTNLERAIKKVSPIDMLIHLGDYEGDASYIKEIADCPVEMVSGNNDYFTDIPREKFLEIGKYYVMLTHGHRYGVN---YGTEQLK--EAAVLNGADIVMFGHTHQPLIDLKDDSLAVINPGSITQPRQAGRIPTFILMEID 148
>gi|147677128|ref|YP_001211343.1| phosphoesterase [Pelotomaculum thermopropionicum SI] >gi|146273225|dbj|BAF58974.1| predicted phosphoesterase [Pelotomaculum thermopropionicum SI] (157 aa)
Score = 169, Expect = 6.6e-11, Identities = 50/144 (34%), Positives = 77/144 (53%)
  Q:     9 KILIISDTHGDRSFFRKIINEE-QPDIKIHCGDFCTD-IDLISENF--DYFVAGNNDYEGERIVDFKIEDLNCRLM--HGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI 152
           ++++ SD+HG   F R+ + E  + D+ +H GDFC D + L  E       V GN D  GE  ++  +E   CR++  HG      + G ER   +L   A E     +  GHTH  ++F +  IL  NPGS+  PR+ ++  SY +L I
  S:     2 RVIVFSDSHGVLRFARRALEEAGRVDLLLHAGDFCRDGLRLAGEAGLPVRTVRGNCDDPGEGPLEEVVEASGCRILLAHG-----HMGGPERWLERLLAKAAECGAGAVVFGHTHTAEIFKEKGILFFNPGSIARPRDYDR-PSYGILEI 145
>gi|138896229|ref|YP_001126682.1| hypothetical protein GTNG_2592 [Geobacillus thermodenitrificans NG80-2] >gi|134267742|gb|ABO67937.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] (181 aa)
Score = 169, Expect = 6.7e-11, Identities = 53/164 (32%), Positives = 91/164 (55%)
  Q:     6 DMKKILIISDTHGDRSFFRKIINEE--QPDIKIHCGDFCTDIDLISENFDYFVA--GNNDYEGERIVDFKIED---LNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDVVKYP 169
           D   ++I+SD+HG  +   +I++    + D+ IHCGD  +++   ++    FV   GN D++     D +IE+   +   + HG  +G          L+LY  AKE   +++  GH+H+  V   + +L INPGS+  PR   + K+YAVL I+ ++   V+F DV  +P
  S:    11 DGMNVVIVSDSHGLTAELAQIVSRHRHEADLFIHCGD--SELPAEADELAPFVVVRGNCDWKAA-FPDERIEEADGVRFFVTHGHLYGVKT-----SLLRLYYRAKETEANVVCFGHSHLAGVEQINGMLFINPGSIALPRGRKE-KTYAVLTIDKDQ-AFVQFYDVTGHP 171
>gi|160894133|ref|ZP_02074911.1| hypothetical protein CLOL250_01687 [Clostridium sp. L2-50] >gi|156864166|gb|EDO57597.1| hypothetical protein CLOL250_01687 [Clostridium sp. L2-50] (177 aa)
Score = 169, Expect = 7.2e-11, Identities = 49/133 (36%), Positives = 74/133 (55%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIV--DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA 141
           +ILIISDTHG  +  R +++     D+ IH GD C D + I +N     + VAGNND++ +  +  +F I      + HG ++     G +R    L E  K +  DI+  GHTH++ +       I+NPGSL YPR+ 
  S:     2 RILIISDTHGRTNTIRDVLDTVGDIDMFIHLGDVCGDEEYIYDNVTCPIHMVAGNNDWDSDLPMQEEFMIGRYKVFITHGHRYSVHY-GTDR----LQELIKYDGYDIVMYGHTHVQNLERYGGAYIVNPGSLAYPRDG 135
>gi|167755836|ref|ZP_02427963.1| hypothetical protein CLORAM_01352 [Clostridium ramosum DSM 1402] >gi|167704775|gb|EDS19354.1| hypothetical protein CLORAM_01352 [Clostridium ramosum DSM 1402] (155 aa)
Score = 169, Expect = 7.9e-11, Identities = 54/159 (33%), Positives = 90/159 (56%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEEQP-----DIKIHCGDFCTDIDLISENFDYF--VAGNNDYEG--ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           MKK++++SD+HG    + K+I+E Q      D  +HCGD     +   E    +  V GNND+    +  V F++E +   + HG ++GY    Y+R E  + +  + +  D+L SGHTH+ Q        +INPGS   PR  +  KSY ++ ++  KI+ V+F+ +
  S:     1 MKKVVVMSDSHG----YHKMIDEVQRLEPDGDYYVHCGD----SEAREEQLKGWICVRGNNDWMAPFDDEVVFEVEGVRFLVTHGHRYGY----YKREEAMVDDLLR-HGCDVLLSGHTHVPQCDEVTGFYLINPGSTTLPRRGSG-KSYCIILVDQGKIE-VKFKQI 153
>gi|167756979|ref|ZP_02429106.1| hypothetical protein CLORAM_02528 [Clostridium ramosum DSM 1402] >gi|167703154|gb|EDS17733.1| hypothetical protein CLORAM_02528 [Clostridium ramosum DSM 1402] (179 aa)
Score = 169, Expect = 8.1e-11, Identities = 56/150 (37%), Positives = 79/150 (52%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQP--DIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERI-VDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           ++L+ISDTH     F+KI N+  P  D  +HCGD     D    N  Y V GN+D E   + +  +I    C + HG+ +      Y   ++K Y  A  NNIDI F GHTH+       N  IINPGS+M  R +    ++A++ I G+ IK
  S:     2 QVLVISDTHLQNELFQKI-NQTYPKMDYYLHCGDSSLKKDDFLLNKYYTVKGNHDDEDFPVNIILEIGKYRCLITHGNAYDIY---YGNDKIKQYMIA--NNIDICFHGHTHVPAYTQIGNRYIINPGSVMINRGSYGFGTFAIVEI-GDTIK 147
>gi|196250187|ref|ZP_03148881.1| phosphodiesterase, MJ0936 family [Geobacillus sp. G11MC16] >gi|196210371|gb|EDY05136.1| phosphodiesterase, MJ0936 family [Geobacillus sp. G11MC16] (169 aa)
Score = 168, Expect = 1.0e-10, Identities = 52/160 (32%), Positives = 90/160 (56%)
  Q:    10 ILIISDTHGDRSFFRKIINEE--QPDIKIHCGDFCTDIDLISENFDYFVA--GNNDYEGERIVDFKIED---LNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDVVKYP 169
           ++I+SD+HG  +   +I++    + D+ IHCGD  +++   ++    FV   GN D++     D +IE+   +   + HG  +G          L+LY  AKE   +++  GH+H+  V   + +L INPGS+  PR   + K+YAVL I+ ++   V+F DV  +P
  S:     3 VVIVSDSHGLTAELAQIVSRHRHEADLFIHCGD--SELPAEADELAPFVVVRGNCDWKAA-FPDERIEEADGVRFFVTHGHLYGVKT-----SLLRLYYRAKETEANVVCFGHSHLAGVEQINGMLFINPGSIALPRGRKE-KTYAVLTIDKDQ-AFVQFYDVTGHP 159
>gi|29375699|ref|NP_814853.1| hypothetical protein EF1123 [Enterococcus faecalis V583] >gi|29343160|gb|AAO80923.1| conserved hypothetical protein [Enterococcus faecalis V583] (170 aa)
Score = 165, Expect = 2.0e-10, Identities = 51/142 (35%), Positives = 74/142 (52%)
  Q:     9 KILIISDTHGDRSFFRKIIN--EEQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDYEGE--RIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVL 150
           KIL++SD HGDR     ++N  E Q D   HCGD  ++++   E +  F  V GN D+  E  + V  K+ D    + HG      + G     L+    A+E    I   GHTH+      +NIL +NPGS+  PR   Q K+YA++
  S:     2 KILVVSDNHGDRDCLVDLVNHYEGQVDALFHCGD--SELEPTDELWQKFIVVQGNCDFYDEFPKTVTKKVGDQVIYMTHGHLANVRM-GLTTLALQ----AEEAGATIALFGHTHVLGAERHNNILFVNPGSIRLPRGPVQEKTYAII 142
>gi|167766441|ref|ZP_02438494.1| hypothetical protein CLOSS21_00947 [Clostridium sp. SS2/1] >gi|167711850|gb|EDS22429.1| hypothetical protein CLOSS21_00947 [Clostridium sp. SS2/1] (168 aa)
Score = 161, Expect = 5.8e-10, Identities = 51/145 (35%), Positives = 78/145 (53%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDY-------EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           +IL+ISD+HG       ++ +    D+ IHCGD       I E  D     VAGNNDY       E  RI D+K+      + HG  + Y   G +     L E+A E   D++  GHTH+  +   D++ I+NPGS+ YPR   +  ++ ++ I+
  S:     2 RILVISDSHGRNDDIEGVLKQVGDIDMMIHCGDVERGDSYIREIADCPVVMVAGNNDYYLDLPSEEEVRIGDYKV-----LVTHGHGY-YVNSGVDY----LREHALEYGYDVVMYGHTHVPYIEIGDDVTILNPGSISYPRQPGRKPTFLIMEID 147
>gi|187935646|ref|YP_001884654.1| phosphodiesterase, family [Clostridium botulinum B str. Eklund 17B] >gi|187723799|gb|ACD25020.1| phosphodiesterase, family [Clostridium botulinum B str. Eklund 17B] (159 aa)
Score = 160, Expect = 7.5e-10, Identities = 54/131 (41%), Positives = 74/131 (56%)
  Q:    10 ILIISDTHGDRSFFRKIINE--EQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEG----ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRN 140
           I +ISDTH   ++  K+ NE  ++ DI IH GD   D + IS+ F+   Y V+GN DY+     E I+D  IE       HGD +G    G       +Y   KE   DI   GHTHI  +   D+++++NPGSL  PRN
  S:     3 IAVISDTHRVSNYI-KMANEYIKEADIVIHLGDNVEDAEEISKEFNGEVYIVSGNCDYKDKYPKEGIID--IEGSRIFFTHGDLYGVKY-GLN----NIYYKTKELGADIALFGHTHISMIEKYDDVILMNPGSLSLPRN 134
>gi|134300517|ref|YP_001114013.1| phosphodiesterase [Desulfotomaculum reducens MI-1] >gi|134053217|gb|ABO51188.1| phosphodiesterase, MJ0936 family [Desulfotomaculum reducens MI-1] (162 aa)
Score = 160, Expect = 8.7e-10, Identities = 52/161 (32%), Positives = 78/161 (48%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGDF---CTDIDLISENFDYFVAGNNDYEGERIVD--FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDVVKYP 169
           +IL+++DTHG       I+    + D+ +H GD    C ++    E     V GN DY G+  ++   ++E     + HG + G            + E AKE    +   GHTHI      DNI+IINPGS + PR   +  S  ++ I+GNKI +  F     YP
  S:     2 RILVLADTHGRLGPIYHIMKHIGKVDLILHAGDHYRDCNELAFTLEVPAKGVMGNCDYPGDAPIEDLLEVEGFKIFITHGHRHGVKYGTNS-----ILERAKELGAQVAIYGHTHISDFRVIDNIMIINPGSPVQPR-GRKRPSVGLIEIQGNKINTEIFHIDYFYP 162
>gi|146296021|ref|YP_001179792.1| phosphodiesterase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409597|gb|ABP66601.1| phosphodiesterase, MJ0936 family [Caldicellulosiruptor saccharolyticus DSM 8903] (158 aa)
Score = 159, Expect = 1.0e-09, Identities = 49/144 (34%), Positives = 79/144 (54%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQPDIK--IHCGDFCTDIDLISENFDYF----VAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPG-YERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI 152
           KIL+ISDTHG      +I+ + + +I   +H GD   D   +   F       V GNND+  +   +  IE  N +++      YSV   Y+     +  +AK   +D +F GHTH ++ FY D+IL +NPGS+ + R+ +  +SYA+  +
  S:     2 KILVISDTHGITYEAERIVRKYEKNIVLCVHLGDLVKDAVYLQNKFPNLKFEIVRGNNDFTRDFPSEKIIEVGNKKILITHGHMYSVKSTYDL----IVNHAKSFRVDAVFFGHTHQQEEFYSDSILFLNPGSIAFSRDGS--RSYAIAEV 146
>gi|23099559|ref|NP_693025.1| hypothetical protein OB2104 [Oceanobacillus iheyensis HTE831] >gi|22777789|dbj|BAC14060.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] (169 aa)
Score = 159, Expect = 1.1e-09, Identities = 57/159 (35%), Positives = 77/159 (48%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFDYFVAGNND----YEGERIVDFKIEDLNCRLMHGD----QFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           M ++LI SD+HG      +I+N+ + D  IHCGD   D D    +  Y V GN D    Y  E I D  I+ +   + HG     + G +   Y          A+E    ++  GHTHI         L INPGS+  PRN  + K+YAVL    N   S+EF  V
  S:     1 MTRVLITSDSHGLTQELTEIMNQHEVDWYIHCGDSELDFDAEVLHPFYKVGGNCDFDPRYPTEEIKD--IDGIRFFITHGHLHQVKSGLTTLAYA---------AEEQEAKVVCFGHTHIAGAEKIGEQLFINPGSIRMPRNRVE-KTYAVLEWLDNYNVSIEFYTV 155
>gi|153815081|ref|ZP_01967749.1| hypothetical protein RUMTOR_01305 [Ruminococcus torques ATCC 27756] >gi|145847649|gb|EDK24567.1| hypothetical protein RUMTOR_01305 [Ruminococcus torques ATCC 27756] (160 aa)
Score = 158, Expect = 1.4e-09, Identities = 48/145 (33%), Positives = 75/145 (51%)
  Q:     9 KILIISDTHGDRSFFRKIINEE-QPDIKIHCGDFC---TDIDLISENFDYFVAGNNDYEGE--RIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           K+LI+SDTHG  +   +++ +E + D+ IH GD     + I+ + E   + V GNND+  +  R  +  I      + HG  +  S+     RE           +DI+  GHTH      KD I ++NPGSL YPR   +  SY ++ I+
  S:     2 KVLIVSDTHGRHTGLDRVLEKEGKIDLFIHLGDIEGGESYINSVVECEKHMVRGNNDFFSDLPREEEIDIGGYKAFITHGHPYYVSLDSEYIRE-----EGAARKVDIVMFGHTHKPYFEQKDGITVLNPGSLAYPRQEGRKGSYMIMEID 147
>gi|171324177|ref|ZP_02912693.1| phosphodiesterase, MJ0936 family [Geobacillus sp. WCH70] >gi|171089822|gb|EDT36140.1| phosphodiesterase, MJ0936 family [Geobacillus sp. WCH70] (169 aa)
Score = 157, Expect = 2.0e-09, Identities = 53/157 (33%), Positives = 80/157 (50%)
  Q:     9 KILIISDTHGDRSFFRKII--NEEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYE----GERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           K+LI+SD+HG  +   +I+  +  + +  IHCGD     D         V GN D+      ER  +  IE +   + HG  +           + LY  AKE    ++  GH+HI      D IL INPGS++ PR A + K+YA+L IE  K  +V+F ++
  S:     2 KVLIVSDSHGLTNELEEIVARHHHEANALIHCGDSELSFDQKEIARFLVVRGNCDFTTQFPNERTEE--IEGVRFFITHGHLYNVKT-----SLMNLYYRAKEVEAKVVCFGHSHIAGAEMIDGILFINPGSILLPR-ARKEKTYALLQIEDGK-ATVQFYEL 155
>gi|90962076|ref|YP_535992.1| phosphoesterase [Lactobacillus salivarius UCC118] >gi|90821270|gb|ABD99909.1| Phosphoesterase [Lactobacillus salivarius UCC118] (172 aa)
Score = 156, Expect = 2.1e-09, Identities = 50/150 (33%), Positives = 80/150 (53%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQPDIK--IHCGD--------FCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQM--KSYAVLHIEGNKIK 158
           KIL++SD+H  ++    + +    +I   IHCGD        + +   ++  N DY+     DY  + +V    E+ N  + HG  +G +  G +R  L     AK+ N   +F GHTH   V Y D  L +NPGS+ +PR   Q    +YA++ +  +KIK
  S:     2 KILVVSDSHSKKNILADLRDRYSNEIDYFIHCGDSELDPNSKWVSGYTIVEGNCDYY-----DYPEKEVV--ATEEGNILVTHGHLYGVNY-GLDRLAL----LAKQENAKFVFYGHTHRLAVEYVDGTLFLNPGSVWFPRGEYQKLGGTYAIVSVNESKIK 151
>gi|158319610|ref|YP_001512117.1| phosphodiesterase [Alkaliphilus oremlandii OhILAs] >gi|158139809|gb|ABW18121.1| phosphodiesterase, MJ0936 family [Alkaliphilus oremlandii OhILAs] (154 aa)
Score = 155, Expect = 3.0e-09, Identities = 49/142 (34%), Positives = 75/142 (52%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENF---DYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVL 150
           KI IISD+H  R +   ++ + ++ D+ IH GD   D   I   +      V GN D EG       IE+    + HGD++G  V   +R    ++  AKE   DI   GHTH+     ++ I+++NPGS+  PR  +Q +SY +L
  S:     2 KIGIISDSHEGRYYIDLVMAQLKEVDLIIHAGDGYQDTKYIEHRYGIKTLGVKGNCDLEGPEQRLETIENKRIFIAHGDRYGV-VSNMDR----IFYAAKEFEADIAIFGHTHVPFYMVEEGIVLMNPGSITLPRGDSQ-RSYCIL 141
>gi|188588911|ref|YP_001919838.1| phosphodiesterase, family [Clostridium botulinum E3 str. Alaska E43] >gi|188499192|gb|ACD52328.1| phosphodiesterase, family [Clostridium botulinum E3 str. Alaska E43] (159 aa)
Score = 155, Expect = 3.0e-09, Identities = 53/131 (40%), Positives = 75/131 (57%)
  Q:    10 ILIISDTHGDRSFFRKIINE--EQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEG----ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRN 140
           I +ISDTH   S + K+ +E  ++ DI IH GD   D + IS+ F+   Y V+GN DY+     E I+D  IE +     HGD +G    G       +Y   KE   DI   GHTHI  +   D+++++NPGSL  PR+
  S:     3 IAVISDTH-RMSNYIKMASEYIKEADIVIHLGDNVEDAEEISKEFNGEVYIVSGNCDYKDKYPKEGIID--IEGIRIFFTHGDLYGVKY-GLN----NIYYKTKELKADIALFGHTHISMIEKYDDVILMNPGSLSLPRS 134
>gi|167748615|ref|ZP_02420742.1| hypothetical protein ANACAC_03388 [Anaerostipes caccae DSM 14662] >gi|167651929|gb|EDR96058.1| hypothetical protein ANACAC_03388 [Anaerostipes caccae DSM 14662] (168 aa)
Score = 155, Expect = 3.1e-09, Identities = 47/145 (32%), Positives = 80/145 (55%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVDFKIEDLNCRL--MHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           +IL+ISD+HG     + ++ +  + D+ IHCGD       I +        VAGNNDY  +   +  IE    R+   HG  + Y   G +     L EY + +++D++  GHTH+  +   D++ I+NPGS+ YPR A +  ++ ++ I+
  S:     2 RILVISDSHGRNDDVKGVLEQVGEIDMLIHCGDVERGDQYIRDIAGCPVVMVAGNNDYYLDLPSEETIEVEGYRIWVTHGHPY-YVNSGVDY----LREYGEMHDVDVVMYGHTHVPFIEIGDDMTILNPGSISYPRQAGRKPTFLLMEID 147
>gi|194017172|ref|ZP_03055784.1| YsnB [Bacillus pumilus ATCC 7061] >gi|194011040|gb|EDW20610.1| YsnB [Bacillus pumilus ATCC 7061] (174 aa)
Score = 155, Expect = 3.5e-09, Identities = 54/156 (34%), Positives = 81/156 (51%)
  Q:     9 KILIISDTHGDRSFFRKIINEE--QPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYS---VPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFED 164
           KILIISD+HG     + I      + D+ IHCGD   D +  +      V GN D+ G    DF  E+L   L  G +   +   + G ++  L++Y  A+E   DI+  GH+HI         L+INPGS+  PR   + +SYA+L ++G++     F D
  S:     2 KILIISDSHGLTDELQTIAKRHAAEVDMMIHCGDSELDTNHPALEGYKVVKGNCDFMG----DFA-EELLLSLDGGGKLFLTHGHLHGIKQSLLQVYYRAEELGADIICFGHSHIPGSELLRGKLLINPGSVHLPR-VRKERSYAILTLDGSEANVQFFTD 156
>gi|154482815|ref|ZP_02025263.1| hypothetical protein EUBVEN_00499 [Eubacterium ventriosum ATCC 27560] >gi|149736410|gb|EDM52296.1| hypothetical protein EUBVEN_00499 [Eubacterium ventriosum ATCC 27560] (166 aa)
Score = 155, Expect = 3.5e-09, Identities = 51/155 (32%), Positives = 78/155 (50%)
  Q:     1 MKWVVDMKKILIISDTHGDRSFFRKIINEE-QPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVDFKIEDLNCRLM--HGDQFG--YSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGN 155
           MK   D  +IL+ISD+HG      +I+ E  + D  IH GD     + I E        V GN D+  +  +   +E+ N ++   HG +F   YSV         L   A+E    +   GHTH+  V Y  ++L++NPGS+  PR A+   +Y ++ I  N
  S:     1 MKERGDNMRILVISDSHGQLGNLNEILKEAGKVDRVIHLGDAVGQDEEIREMCGCPVTIVRGNCDFYSKNELVEIVEEENVKIFATHGHRFNVEYSVN-------DLCNAAREEGCSVALYGHTHVPDVSYCKDVLVMNPGSISRPRQASGRPTYGIVTIGSN 156
>gi|56421199|ref|YP_148517.1| hypothetical protein GK2664 [Geobacillus kaustophilus HTA426] >gi|56381041|dbj|BAD76949.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426] (168 aa)
Score = 153, Expect = 4.8e-09, Identities = 50/161 (31%), Positives = 85/161 (52%)
  Q:     9 KILIISDTHGDRSFFRKIINEE--QPDIKIHCGDFCTDIDLISENFDYF--VAGNNDYEG---ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDVVKYP 169
           K +I+SD+HG  +    I+N    + D+ IHCGD  +++++ ++    F  V GN D+     ERI +  +  +   + HG  +G          L+L   A+E    ++  GH+H+      D +L INPGS+  PR   + K+YAVL ++  +   V+F +V   P
  S:     2 KAVIVSDSHGLTAELAAIVNRHRHEADLFIHCGD--SELEVGADEIAPFAVVRGNCDFAAFPAERIEE--VGGVRLFVTHGHLYGVKT-----SLLRLSYRAQETGAHVVCFGHSHLAGAEQIDGLLFINPGSIALPRGRKE-KTYAVLTVDSGR-AHVQFYEVDGQP 158
>gi|163813944|ref|ZP_02205338.1| hypothetical protein COPEUT_00097 [Coprococcus eutactus ATCC 27759] >gi|158450814|gb|EDP27809.1| hypothetical protein COPEUT_00097 [Coprococcus eutactus ATCC 27759] (174 aa)
Score = 151, Expect = 9.4e-09, Identities = 53/145 (36%), Positives = 76/145 (52%)
  Q:     9 KILIISDTHGDRSFFRKIIN-EEQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIV--DFKIEDLNCRLMHGDQFGY-SVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           K+LIISDTHG  S   +I +     D+ IH GD   D +LI + F+   + V GN DY  E  +  +F I D    + HG ++G  S   Y    + L  Y      D +  GHTH   +    N  I+NPGSL  PR+ N++ +Y +L  +
  S:     2 KVLIISDTHGKSSCIEQIYDIVGDVDMLIHLGDVEGDEELIYDLFNCEIHMVRGNCDYNAELPIYDEFNIGDKRAFITHGHRYGVNSGTAYLEELIDLEGY------DFVMYGHTHRRDLTTYKNSYIVNPGSLALPRD-NRVGTYMLLDFD 146
>gi|170758417|ref|YP_001788577.1| phosphodiesterase [Clostridium botulinum A3 str. Loch Maree] >gi|169405406|gb|ACA53817.1| phosphodiesterase, MJ0936 family [Clostridium botulinum A3 str. Loch Maree] (156 aa)
Score = 151, Expect = 9.5e-09, Identities = 51/149 (34%), Positives = 80/149 (53%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVDFKIEDLNCR---LMHGDQFG--YSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           KI +ISDTH        ++N     ++ IH GD   D+ ++S  +      V GN D+  E   +  IE++  +   + HG+++   Y +     R L+L         DI   GHTH+ Q+ Y D I +INPGS   PRN   ++S A++ IEG+K+
  S:     2 KIGVISDTHRYIGDATSLVNSLGNVNLIIHLGDNVEDVKMLSSVYKGEIINVRGNCDFSKETPSEL-IENIGGKRFFITHGNRYDVKYDLAKLRYRALEL-------EADIALFGHTHVSQIEYIDGIWLINPGSPTLPRNG--VRSVAIIGIEGDKV 149
>gi|154505102|ref|ZP_02041840.1| hypothetical protein RUMGNA_02614 [Ruminococcus gnavus ATCC 29149] >gi|153794581|gb|EDN77001.1| hypothetical protein RUMGNA_02614 [Ruminococcus gnavus ATCC 29149] (159 aa)
Score = 150, Expect = 1.2e-08, Identities = 47/148 (31%), Positives = 72/148 (48%)
  Q:     9 KILIISDTHGDRSFFRKIINEE-QPDIKIHCGDFCTDIDLIS---ENFDYFVAGNNDYEGERIVD--FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNK 156
           ++LI+SDTHG  +   + + E  + D+ IH GD     D I    E   + + GNND+      +  F I      + HG  +  S+   + RE          N DI+  GHTH      +D I ++NPGSL +PR   +  SY +L  +G +
  S:     2 RVLIVSDTHGRHTSLDRALKEAGEIDMFIHLGDVEGGEDYIEAVVECEKHMIRGNNDFFSYLPAEEEFWIGKKKVFITHGHSYYVSMETEQIRE-----EGAARNADIIMFGHTHRPYFEERDGITVLNPGSLSFPRQEGRKSSYMILETDGEE 150
>gi|168183562|ref|ZP_02618226.1| phosphodiesterase, MJ0936 family [Clostridium botulinum Bf] >gi|182673293|gb|EDT85254.1| phosphodiesterase, MJ0936 family [Clostridium botulinum Bf] (156 aa)
Score = 150, Expect = 1.3e-08, Identities = 52/149 (34%), Positives = 81/149 (54%)
  Q:     9 KILIISDTH---GDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVDFKIEDLNCR---LMHGDQFG--YSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           KI +ISDTH   GD +     +     ++ IH GD   D+ ++S  +      V GN D+  E   +  IE++  +   + HG+++   Y +     R L+L         DI+  GHTH+ Q+ Y D I  INPGS   PRN   ++S A++ IEG+K+
  S:     2 KIGVISDTHRYIGDATSLVNSVG--NVNLIIHLGDNVEDVKMLSSVYKGEIINVRGNCDFSKETPSEL-IENIGGKRFFITHGNRYDVKYDLAKLRYRALEL-------EADIVLFGHTHVSQIEYIDGIWFINPGSPTLPRNG--VRSVAIIGIEGDKV 149
>gi|172058159|ref|YP_001814619.1| phosphodiesterase [Exiguobacterium sibiricum 255-15] >gi|171990680|gb|ACB61602.1| phosphodiesterase, MJ0936 family [Exiguobacterium sibiricum 255-15] (168 aa)
Score = 149, Expect = 1.4e-08, Identities = 53/157 (33%), Positives = 81/157 (51%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQ-PDIKIHCGDFCTDIDLISENFDYF--VAGNNDYEGERIVDFKIEDLN-----CRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           K LI+SD+HG       I N  Q  D   HCGD  + +   +E+   +  V GN DY G    D  IE+L      C   H     YS+        +L  +A +    I+  GH+H+ +   +D  L INPGS+  PR+  + K+YA+L +E ++  +V+F D+
  S:     2 KALIVSDSHGLDQELLTIFNRHQEADFAFHCGD--SQLTGTTESLYPYRVVKGNCDY-GNDFPDEVIEELGSFRVLCVHGHRQDVKYSLD-------QLVHHADQKAAAIVLYGHSHVAKAEQRDGKLFINPGSIRMPRHRPE-KTYALLTVENDQF-TVDFYDL 154
>gi|52081336|ref|YP_080127.1| hypothetical protein BL05298 [Bacillus licheniformis ATCC 14580] >gi|52786714|ref|YP_092543.1| YsnB [Bacillus licheniformis ATCC 14580] >gi|52004547|gb|AAU24489.1| hypothetical protein BL05298 [Bacillus licheniformis ATCC 14580] >gi|52349216|gb|AAU41850.1| YsnB [Bacillus licheniformis DSM 13] (173 aa)
Score = 149, Expect = 1.4e-08, Identities = 49/145 (33%), Positives = 76/145 (52%)
  Q:     9 KILIISDTHGDRSFFRKIINE--EQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLM--HGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           K+LI+SD+HG       I     ++ D+ IHCGD   D    + +    V GN D+ GE   +  +   + +L   HG  +G      ++  L +Y  A+E   DI+  GH+HI      D  L+INPGS+  PR   + K+YA+L+I+
  S:     2 KVLIVSDSHGLEDELEMIAERHGKETDLIIHCGDSELDPSHPALSSYLTVKGNCDFYGEFKDEIVVPAGSRKLFFTHGHLYGI-----KQSLLNVYYRAEELGADIICFGHSHIAGSELMDGKLLINPGSIRLPR-VRKEKTYAILNID 144
>gi|121534593|ref|ZP_01666415.1| phosphodiesterase, MJ0936 family [Thermosinus carboxydivorans Nor1] >gi|121306845|gb|EAX47765.1| phosphodiesterase, MJ0936 family [Thermosinus carboxydivorans Nor1] (161 aa)
Score = 149, Expect = 1.5e-08, Identities = 48/157 (30%), Positives = 79/157 (50%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQP-DIKIHCGDFCTDIDLISENFDYFV---AGNNDYEGERIVDFKIEDLNCR--LMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           +I +ISDTHGD +  R+ +    P D+ +H GD+  D ++++E     V   AGN D      +D  I+    +  L HG ++         R  +L  + ++  +DI+  GHTH+  +     +LI NPGS   PR  ++  S  +L I  +     EF D+
  S:     2 RIGVISDTHGDAAAIRRAVYASGPVDLWLHAGDYSQDANVLAELSGLEVIAAAGNCDGPTAAKIDEFIDAGGKKIWLTHGHRYQARA-----RIDELVWWGEKYEVDIVVFGHTHVPYLARHGRLLIFNPGSAARPRGGSR-PSIGILTITADGQVEAEFIDI 158
>gi|162447725|ref|YP_001620857.1| phosphoesterase [Acholeplasma laidlawii PG-8A] >gi|161985832|gb|ABX81481.1| predicted phosphoesterase [Acholeplasma laidlawii PG-8A] (148 aa)
Score = 149, Expect = 1.7e-08, Identities = 57/153 (37%), Positives = 75/153 (49%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQP-DIKIHCGDFCTDIDLISENFDYFVAGNNDY----EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYK--DNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVE 161
           K+LI  D HG      K++  E   D+ ++ GD   D+  I       V GN DY      ER+++FK   LN  L HG         Y   EL +   AKE   DI   GHTH    FY+  DNI+ INPG+L   +N    K+YAV   E   I +V+
  S:     2 KLLITGDIHGRNDVLEKVLKREPTFDLHLNTGDLGLDLQTIENAKMIAVKGNTDYYLDLPTERLIEFK--GLNILLTHGHLQNVK---YGLNELIMM--AKEMGADICIFGHTH--DAFYRSIDNIIFINPGALTGQKN----KTYAVYEKEKVSIINVD 148
>gi|153933668|ref|YP_001385580.1| phosphodiesterase [Clostridium botulinum A str. ATCC 19397] >gi|153937412|ref|YP_001388986.1| phosphodiesterase [Clostridium botulinum A str. Hall] >gi|153939904|ref|YP_001392606.1| phosphodiesterase [Clostridium botulinum F str. Langeland] >gi|168179092|ref|ZP_02613756.1| phosphodiesterase, MJ0936 family [Clostridium botulinum NCTC 2916] >gi|152929712|gb|ABS35212.1| phosphodiesterase, MJ0936 family [Clostridium botulinum A str. ATCC 19397] >gi|152933326|gb|ABS38825.1| phosphodiesterase, MJ0936 family [Clostridium botulinum A str. Hall] >gi|152935800|gb|ABS41298.1| phosphodiesterase, MJ0936 family [Clostridium botulinum F str. Langeland] >gi|182670249|gb|EDT82225.1| phosphodiesterase, MJ0936 family [Clostridium botulinum NCTC 2916] (156 aa)
Score = 149, Expect = 1.7e-08, Identities = 51/149 (34%), Positives = 79/149 (53%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVDFKIEDLNCR---LMHGDQFG--YSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           KI +ISDTH        ++N     ++ IH GD   D+ ++S  +      V GN D+  E   +  IE++  +   + HG+++   Y +     R L+L         DI   GHTH+ Q+ Y D I  INPGS   PRN   ++S A++ IEG+K+
  S:     2 KIGVISDTHRYIGDATSLVNSLGNVNLIIHLGDNVEDVKMLSSVYKGKIINVRGNCDFSKETPSEL-IENIGGKRFFITHGNRYDVKYDLAKLRYRALEL-------EADIALFGHTHVSQIEYIDGIWFINPGSPTLPRNG--VRSVAIIGIEGDKV 149
>gi|157693249|ref|YP_001487711.1| phosphoesterase [Bacillus pumilus SAFR-032] >gi|157682007|gb|ABV63151.1| possible phosphoesterase [Bacillus pumilus SAFR-032] (174 aa)
Score = 149, Expect = 1.7e-08, Identities = 54/156 (34%), Positives = 80/156 (51%)
  Q:     9 KILIISDTHGDRSFFRKIINEE--QPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDL-------NCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFED 164
           KILIISD+HG     + I      + D+ IHCGD   + +  +      V GN D+ G    DF+ E L          L HG      + G ++  L++Y  A+E   DI+  GH+HI         L+INPGS+  PR   + +SYA+L ++G++     F D
  S:     2 KILIISDSHGLTDELQMIAKRHAAEVDMMIHCGDSELETNHPALEGYKVVKGNCDFMG----DFEEELLLPLDGGGKLFLTHG-----HLHGIKQSLLQVYYRAEELGADIICFGHSHIPGSELLRGKLLINPGSVHLPR-VRKERSYAILTLDGSEANVQFFTD 156
>gi|154686970|ref|YP_001422131.1| YsnB [Bacillus amyloliquefaciens FZB42] >gi|154352821|gb|ABS74900.1| YsnB [Bacillus amyloliquefaciens FZB42] (169 aa)
Score = 148, Expect = 1.8e-08, Identities = 49/142 (34%), Positives = 78/142 (54%)
  Q:     9 KILIISDTHGDRSFFRKII--NEEQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDYEGERIVDFKIEDLNCRLM--HGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVL 150
           K+LIISD+HG       I   +EE+ D+ IHCGD  +++D        F  V GN D+ G    +  ++  + +++  HG      + G ++  L ++  A+E   D++  GH+HI         L+INPGS+  PR  N +KSYA+L
  S:     2 KVLIISDSHGLEDELETIAKRHEEEADLMIHCGD--SELDAAHPALTPFHTVKGNCDFGGGFQDELLLDAGSKKILAVHG-----HLHGIKQSLLTVFYRAEELGADVVCFGHSHIAGSEVLRGKLLINPGSIRLPRVRN-VKSYAIL 141
>gi|118580964|ref|YP_902214.1| phosphodiesterase [Pelobacter propionicus DSM 2379] >gi|118503674|gb|ABL00157.1| phosphodiesterase, MJ0936 family [Pelobacter propionicus DSM 2379] (156 aa)
Score = 148, Expect = 1.8e-08, Identities = 48/150 (32%), Positives = 76/150 (50%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQP-DIKIHCGDFCTDIDLISENFDYFV---AGNNDYEGE--RIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYE-YAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           KIL+ SD+HG+     +  +   P D  IH GD   D +L+++     V   AGN DY     R + ++   +   L HGD++G       +R+L L E  A +   +++  GH+H   +  +  IL +NPG+L+         SYA L I  N +K
  S:     2 KILVTSDSHGNYPLLFRASDAAAPLDAVIHLGDGGEDAELLNQATGIQVIAIAGNCDYHPSVPRELLWECAGIRFLLTHGDRYGV------KRDLNLLEKRALQLEANVVLYGHSHQAAISTRSEILFVNPGTLI---KGTSRTSYATLEIGPNGLK 149
>gi|16079887|ref|NP_390713.1| hypothetical protein BSU28350 [Bacillus subtilis subsp. subtilis str. 168] >gi|2501608|sp|P94559|YSNB_BACSU Putative metallophosphoesterase ysnB >gi|1770061|emb|CAA99556.1| hypothetical protein [Bacillus subtilis] >gi|2635300|emb|CAB14795.1| ysnB [Bacillus subtilis subsp. subtilis str. 168] (171 aa)
Score = 148, Expect = 1.9e-08, Identities = 54/155 (34%), Positives = 83/155 (53%)
  Q:    10 ILIISDTHGDRSFFRKII--NEEQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDYEGERIVDFKIEDL------NCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFED 164
           +LIISD+HG     + I   +E + D+ IHCGD  ++++      + +  V GN D+ G    DFK E L         + HG      + G ++  L +Y  A+E   D++  GH+HI         L+INPGS+  PR   + +SYA+L +E N   +V F D
  S:     5 VLIISDSHGLEEELQTIAKRHEAEVDLMIHCGD--SELETRHPALEPYAVVKGNCDFAG----DFKDELLLTAGSRKILVTHG-----HLHGIKQTLLNVYYRAEELGADVICFGHSHIAGSEVLRGKLMINPGSIRLPR-VRRTESYAILTLE-NDAATVRFYD 156
>gi|194468343|ref|ZP_03074329.1| phosphodiesterase, MJ0936 family [Lactobacillus reuteri 100-23] >gi|194453196|gb|EDX42094.1| phosphodiesterase, MJ0936 family [Lactobacillus reuteri 100-23] (174 aa)
Score = 148, Expect = 2.0e-08, Identities = 48/131 (36%), Positives = 68/131 (51%)
  Q:     9 KILIISDTHGDRSFFRKIINE--EQPDIKIHCGD--FCTDIDLISENFDYFVAGNNDY----EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPR 139
           KIL++SD H +     +I+ +  +Q D+ IHCGD     D DL+S NF   V  NNDY      E +++   E L     H  +  +S+         L    +E N  I+  GHTH     Y   +LIINPGS+ +PR
  S:     2 KILVVSDNHREEQILTEIVQKMRDQVDLMIHCGDSELAPDQDLMS-NFKA-VKENNDYGLLYPNELVINAGQEQLYITHGHLQRVNFSLT-------PLMLTGQEKNASIVCYGHTHQLGAAYDHQMLIINPGSISFPR 131
>gi|169824271|ref|YP_001691882.1| putative phosphoesterase [Finegoldia magna ATCC 29328] >gi|167831076|dbj|BAG07992.1| putative phosphoesterase [Finegoldia magna ATCC 29328] (154 aa)
Score = 147, Expect = 2.5e-08, Identities = 47/133 (35%), Positives = 69/133 (51%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYE---GERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA 141
           K+ IISDTH   +     + +++ DI +H GD C D  L+ +       +V GNND+    GE     +I D N  + HG ++  S  G +R    L E +K  N  +   GHTH       D + +INPGS+ YPR+ 
  S:     2 KVAIISDTHNKIAKVYDYLFDKEIDIIVHLGDVCDDAILLEDLLKKEVIYVKGNNDFYVVGGEYDKVIRISDKNIFITHGHKYNVS-SGVKR----LVEKSKSLNCQMCLYGHTHRYFNEKIDGVWVINPGSVTYPRDG 135
>gi|116333822|ref|YP_795349.1| phosphoesterase [Lactobacillus brevis ATCC 367] >gi|116099169|gb|ABJ64318.1| Predicted phosphoesterase [Lactobacillus brevis ATCC 367] (172 aa)
Score = 147, Expect = 2.8e-08, Identities = 45/133 (33%), Positives = 68/133 (51%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFD--YFVAGNNDYEGE-RIVDFKIEDLNCR--LMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPR 139
           M + L++SD HGDR     +    +PD   HCGD  ++++     F   Y V GN D++ E  +V+    D  C+  L HG    Y    ++  +LKL  +A E   D++F GHTH          + +NPGS+  PR
  S:     1 MARWLVVSDNHGDREILVSLRQALKPDAVFHCGD--SEMEAADPWFKGAYVVQGNMDFDSELPLVETPTVD-GCKVLLTHGH---YDAVHWDLTKLKL--HADEVQADLVFFGHTHELAAEVVGGHVFVNPGSISQPR 130
>gi|170754572|ref|YP_001782884.1| phosphodiesterase [Clostridium botulinum B1 str. Okra] >gi|169119784|gb|ACA43620.1| phosphodiesterase, MJ0936 family [Clostridium botulinum B1 str. Okra] (156 aa)
Score = 146, Expect = 3.0e-08, Identities = 51/149 (34%), Positives = 80/149 (53%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVDFKIEDLNCR---LMHGDQFG--YSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           KI +ISDTH        ++N     ++ IH GD   D+ ++S  +      V GN D+  E   +  IE++  +   + HG+++   Y++     R L+L         DI   GHTH+ Q+ Y D I  INPGS   PRN   ++S A++ IEG+K+
  S:     2 KIGVISDTHRYIGDAISLVNSLGNVNLIIHLGDNVEDVKMLSSVYKGKIINVRGNCDFSKETPSEL-IENIGGKRFFITHGNRYDVKYNLAKLRYRALEL-------EADIALFGHTHVSQIEYIDGIWFINPGSPTLPRNG--VRSVAIIGIEGDKV 149
>gi|167038076|ref|YP_001665654.1| phosphodiesterase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167039212|ref|YP_001662197.1| phosphodiesterase [Thermoanaerobacter sp. X514] >gi|166853452|gb|ABY91861.1| phosphodiesterase, MJ0936 family [Thermoanaerobacter sp. X514] >gi|166856910|gb|ABY95318.1| phosphodiesterase, MJ0936 family [Thermoanaerobacter pseudethanolicus ATCC 33223] (166 aa)
Score = 146, Expect = 3.0e-08, Identities = 51/156 (32%), Positives = 87/156 (55%)
  Q:    10 ILIISDTHGDRSFFRKIINEEQP-DIKIHCGDFCTDIDLISENFDY---FVAGNNDY----EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELK-LYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI--KSVEFEDV 165
           + +ISDTHG  +  RK + E +  D  IH GD  +D   +S+ F     +V GN D+    E E++++   E     L HG ++      Y + E + + +  +E  ++ +F GHTHI  +   ++IL++NPGS   PR   + K+ A++ I+   I  + V  E+V
  S:     3 LAVISDTHGIFALVRKKLRELKGIDYLIHLGDNASDAIQLSQEFGIPLEYVKGNCDFPTKDELEKVIE--TEGQKILLTHGHRY------YVKYEYQTILDRGRELGVNAVFFGHTHIPMISKHEDILLLNPGSPSLPREGAK-KTIALVTIDKTGIFPRLVNLEEV 160
>gi|110801633|ref|YP_699514.1| Ser/Thr protein phosphatase family protein [Clostridium perfringens SM101] >gi|110682134|gb|ABG85504.1| Ser/Thr protein phosphatase family protein [Clostridium perfringens SM101] (156 aa)
Score = 146, Expect = 3.2e-08, Identities = 50/150 (33%), Positives = 80/150 (53%)
  Q:     9 KILIISDTHGDR---SFFRKIINEEQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVD--FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           K+ I+SDTHG      + + ++N+   D+ IH GD   D+ L+SE+F    Y V GN DYE    V+   +IE     + HG ++     G +    K+Y    E  +D +  GHTH +    + N+ IINPGS   P++     S A ++++   I+
  S:     2 KVAIVSDTHGVTHVIEYIKTLLNDS--DVLIHLGDNINDVKLLSESFKGKVYSVVGNCDYERNGQVEQVIEIEGKKFLITHGHKYTVKY-GLD----KIYYRGLELGVDGVIFGHTHRKVALKEGNMWIINPGSPSIPKDGE--ASIAFMNVDSENIE 150
>gi|187776823|ref|ZP_02993296.1| hypothetical protein CLOSPO_00339 [Clostridium sporogenes ATCC 15579] >gi|187775482|gb|EDU39284.1| hypothetical protein CLOSPO_00339 [Clostridium sporogenes ATCC 15579] (156 aa)
Score = 146, Expect = 3.4e-08, Identities = 52/152 (34%), Positives = 81/152 (53%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVDFKIEDLNCR---LMHGDQFG--YSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSV 160
           KI +ISDTH        ++N     ++ IH GD   D+ ++S  +      V GN D+  +   +  IE++  +   + HG+++   Y +     R L+L         DI+  GHTHI Q+ Y D I  INPGS   PRN   ++S AV+ I+G+K+  V
  S:     2 KIGVISDTHRYIGDATSLVNSLGNVNLIIHLGDNVEDVKILSSVYKGKIINVRGNCDFSKQTPSEL-IENIGGKRFFITHGNRYDVKYDLAKLRYRALEL-------EADIVLFGHTHISQIEYIDGIWFINPGSPTLPRNG--VRSIAVIGIDGDKVVPV 152
>gi|168211258|ref|ZP_02636883.1| Ser/Thr protein phosphatase family protein [Clostridium perfringens B str. ATCC 3626] >gi|169347067|ref|ZP_02866009.1| Ser/Thr protein phosphatase family protein [Clostridium perfringens C str. JGS1495] >gi|182625538|ref|ZP_02953309.1| Ser/Thr protein phosphatase family protein [Clostridium perfringens D str. JGS1721] >gi|169296750|gb|EDS78879.1| Ser/Thr protein phosphatase family protein [Clostridium perfringens C str. JGS1495] >gi|170710686|gb|EDT22868.1| Ser/Thr protein phosphatase family protein [Clostridium perfringens B str. ATCC 3626] >gi|177909226|gb|EDT71691.1| Ser/Thr protein phosphatase family protein [Clostridium perfringens D str. JGS1721] (156 aa)
Score = 146, Expect = 3.8e-08, Identities = 50/150 (33%), Positives = 79/150 (52%)
  Q:     9 KILIISDTHGDR---SFFRKIINEEQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVD--FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           K+ I+SDTHG      + + ++N+   D+ IH GD   D+ L+SE F    Y V GN DYE    V+   +IE     + HG ++     G +    K+Y    E  +D +  GHTH +    + N+ IINPGS   P++     S A ++++   I+
  S:     2 KVAIVSDTHGVTHVIEYIKTLLNDS--DVLIHLGDNINDVKLLSEGFKGKVYSVVGNCDYERNGQVEQVIEIEGKKFLITHGHKYTVKY-GLD----KIYYRGLELGVDGVIFGHTHRKVALKEGNMWIINPGSPSIPKDGE--ASIAFMNVDSENIE 150
>gi|20807115|ref|NP_622286.1| phosphoesterase [Thermoanaerobacter tengcongensis MB4] >gi|20515608|gb|AAM23890.1| predicted phosphoesterase [Thermoanaerobacter tengcongensis MB4] (166 aa)
Score = 145, Expect = 4.4e-08, Identities = 50/148 (33%), Positives = 81/148 (54%)
  Q:    10 ILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFDY---FVAGNNDY----EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERREL-KLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           + +ISDTHG  +  R  + E +  D   H GD   D   +++ F+    +V GN D+    E E+IV+  IE     L HG ++      Y + E   + E  KE  +D +F GHTH+  +   ++IL++NPGS   PR  ++ K+ A++ I+   I
  S:     3 VAVISDTHGIFTLVRNKLKEFKGLDYIFHLGDHAGDGIQLAKEFNIPLEYVKGNCDFPTKDEIEKIVE--IEGKKILLTHGHRY------YVKYEYDTILERGKELGVDAVFFGHTHVPMISRHEDILLLNPGSPSLPREGSK-KTIALVTIDKTGI 150
>gi|114566007|ref|YP_753161.1| hypothetical protein Swol_0455 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114336942|gb|ABI67790.1| conserved hypothetical protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (157 aa)
Score = 144, Expect = 5.4e-08, Identities = 51/154 (33%), Positives = 79/154 (51%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFD----YFVAGNNDY----EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK-SVEF 162
           KI +I DTHG      + +   + D     GDF +D   I+ +      + VAGN D+      ERI+D  +E     ++HG Q+G  +         LY    E   D++  GHTHI      + I +INPGS   PR  ++  SY +L++E  KI+ ++E+
  S:     2 KIAVIGDTHGRIEKICRELKLVKADQIFFTGDFLSDAKRIAHHLGGVMLHAVAGNCDFYESGPAERILD--LEGKRFYMVHGHQYGVKISVNS-----LYYRGLELGADVVLFGHTHIPFCKQIEGIWLINPGSPSRPR-LDKKGSYVLLYLEKGKIEVAIEY 156
>gi|16800272|ref|NP_470540.1| hypothetical protein lin1203 [Listeria innocua Clip11262] >gi|16413662|emb|CAC96434.1| lin1203 [Listeria innocua] (174 aa)
Score = 143, Expect = 8.5e-08, Identities = 49/156 (31%), Positives = 81/156 (51%)
  Q:     9 KILIISDTHGDRS--FFRKIINEEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI--EGNKIKSVEFED 164
           K+L++SD+H +R      K   E   D  IHCGD   + D  +    + V GN D+ G    D+  E    R++      Y++   +   + L   A+E N D  F GH+H   V   D+ +I+NPGS+  PR   ++K+YA++    EG K++ ++ +D
  S:     2 KLLVVSDSHSERDCLIHLKEKYENTVDAMIHCGDSELEADDPAIQGFHTVRGNCDFGGGFPNDWVGEVDGYRILTTHGHLYNI---KMTLMNLRYRARELNADFAFFGHSHELGVDMLDDTIILNPGSISLPRGRIRIKTYALIDSTPEGIKVRFMDRDD 158
>gi|167404249|ref|ZP_02309053.1| hypothetical protein LmonocytFSL_09613 [Listeria monocytogenes FSL J2-003] (175 aa)
Score = 142, Expect = 8.9e-08, Identities = 47/156 (30%), Positives = 82/156 (52%)
  Q:     9 KILIISDTHGDRS---FFRKIINEEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI--EGNKIKSVEFED 164
           K+L++SD+H +R      ++ I +   D  IHCGD   + D  +    + V GN D+ G    D+  E    R+       Y++   +   + L   A+E N D  F GH+H   V   D+ +I+NPGS+  PR   ++K+YA++    EG +++ ++ +D
  S:     2 KLLVVSDSHSERDCLIHLKRKITKITVDAMIHCGDSELEADDPAIQGFHTVRGNCDFGGGFPNDWVGEVDGYRIFTTHGHLYNI---KMTLMNLRYRARELNADFAFFGHSHELGVDMLDDTIILNPGSISLPRGRIRVKTYALIDSTPEGIQVRFMDRDD 159
>gi|15668804|ref|NP_247607.1| hypothetical protein MJ0623 [Methanocaldococcus jannaschii DSM 2661] >gi|2501610|sp|Q58040|Y623_METJA Putative metallophosphoesterase MJ0623 >gi|1591334|gb|AAB98618.1| conserved hypothetical protein [Methanocaldococcus jannaschii DSM 2661] (192 aa)
Score = 142, Expect = 8.9e-08, Identities = 56/144 (38%), Positives = 79/144 (54%)
  Q:    10 ILIISDTH-GDRSF-FRKIINEE--QPDIKIHCGDFCTDIDLISENFDYF----VAGNNDYEG-ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           I +ISDTH  DR+F   K + +E    D+ IHCGD  TD +++    D      V GN DY    R    +I D+   ++HGD      P  +R +L+L    KE  +D+L SGHTH   +    +IL++NPGS   PR    +KS   L +E
  S:    36 IGVISDTHLYDRAFELPKAVFDEFSNVDLIIHCGD-VTDKEILDSLKDLAKVVAVKGNMDYLNLPRKEILEINDIKIGVIHGD---VVYPRGDRLKLRLL--GKEMGVDVLISGHTHTPFIDDCRDILLLNPGSPTVPRCP--LKSIMKLSVE 180
>gi|148264333|ref|YP_001231039.1| phosphodiesterase [Geobacter uraniireducens Rf4] >gi|146397833|gb|ABQ26466.1| phosphodiesterase, MJ0936 family [Geobacter uraniireducens Rf4] (156 aa)
Score = 142, Expect = 8.9e-08, Identities = 49/151 (32%), Positives = 73/151 (48%)
  Q:     9 KILIISDTHGDRSF-FRKIINEEQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGE--RIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           KILI SD+HG+     + + N  Q D  IH GD   D  +I +        VAGN D++    R +   I+ +   + HG ++   + G +    +LY  A      I+  GHTHI  +   +NI  INPG L     +    SYA+L I   K+ +
  S:     2 KILIFSDSHGNYPLAIKALDNAGQVDQVIHLGDGADDAQIIEDLLRQKVITVAGNCDFKTSIPRDIQITIDHMKLFITHGHKYNVKM-GLK----QLYNKAIAEQTSIVLYGHTHIAAIETINNITFINPGCL---SQSCTFTSYAILSIISGKVSA 150
>gi|15673262|ref|NP_267436.1| hypothetical protein L110933 [Lactococcus lactis subsp. lactis Il1403] >gi|12724256|gb|AAK05378.1|AE006360_7 HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis Il1403] (167 aa)
Score = 142, Expect = 9.3e-08, Identities = 51/148 (34%), Positives = 74/148 (50%)
  Q:    11 LIISDTHGDRSFFRKIINE--EQPDIKIHCGDF-CTDIDLISENFDYFVAGNNDYEG--ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEY-AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           +++SD+H DR   + I ++   +     HCGD      D I +     VAGN DY+      +  ++E     + HG  F Y   G +R     Y Y A+E N DI   GH H       +NIL +NPGS+  PR    +K YA++ IEG + K
  S:     3 VVMSDSHYDRDVVQSIKSKYLNEATAIFHCGDSELPSSDEIWQGIT-VVAGNCDYDSGYHDFLTQEVEGKKVLITHGHLF-YVGLGLDR-----YSYFAEEKNADIALFGHIHQPVAQKINNILYVNPGSVAQPRGKYDIKMYAIIEIEGEEFK 149
>gi|152976900|ref|YP_001376417.1| phosphodiesterase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152025652|gb|ABS23422.1| phosphodiesterase, MJ0936 family [Bacillus cereus subsp. cytotoxis NVH 391-98] (168 aa)
Score = 142, Expect = 9.8e-08, Identities = 51/155 (32%), Positives = 87/155 (56%)
  Q:     9 KILIISDTHGDRSFFRKI--INEEQPDIKIHCGDFCTDIDLISENFDY----FVAGN----NDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           K LI+SD+HG     +++  + E + D+ IHCGD     +L SE+ D      V GN    ND+E E ++D K   +   ++HG +    +         L  YA+E   +++  GH+H+       ++L INPGS++ PR   + K++A+L I   +I+ V+F+
  S:     2 KALIVSDSHGSVKELQQLKEMYEGKVDVMIHCGDS----ELTSEHQDIQGFQIVKGNCDFHNDFENEIVMDVK--GVRFLIVHGHRHNVKMT-----LQTLAYYAEEVAANVICFGHSHVLGAEIYKDMLFINPGSILLPRTRKE-KTFALLQINEQEIE-VQFK 153
>gi|184155009|ref|YP_001843349.1| hypothetical protein LAF_0533 [Lactobacillus fermentum IFO 3956] >gi|183226353|dbj|BAG26869.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956] (170 aa)
Score = 142, Expect = 1.0e-07, Identities = 44/131 (33%), Positives = 62/131 (47%)
  Q:     9 KILIISDTHGDRSFFRKIIN--EEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEG-ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPR 139
           K L ISD HGD +   ++     +Q D   HCGD     D  +      V GN D++   R+VD  + D +  + HG  +G +     +  L L   AKE    +   GHTH       D IL++NPGS+  PR
  S:     2 KALFISDNHGDAAILERVKEGLADQVDAMFHCGDSNLSPDDPALAGFQVVVGNTDWDPFPRVVDQVVGDEHVFVTHGHLYGVN-----QSLLNLKLAAKEAGATVAAYGHTHQLACQVVDGILLLNPGSISQPR 130
>gi|168216784|ref|ZP_02642409.1| Ser/Thr protein phosphatase family protein [Clostridium perfringens NCTC 8239] >gi|182381239|gb|EDT78718.1| Ser/Thr protein phosphatase family protein [Clostridium perfringens NCTC 8239] (156 aa)
Score = 141, Expect = 1.2e-07, Identities = 49/150 (32%), Positives = 79/150 (52%)
  Q:     9 KILIISDTHGDR---SFFRKIINEEQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVD--FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           K+ I+SDTHG      + + ++++   D+ IH GD   D+ L+SE F    Y V GN DYE    V+   +IE     + HG ++     G +    K+Y    E  +D +  GHTH +    + N+ IINPGS   P++     S A ++++   I+
  S:     2 KVAIVSDTHGVTHVIEYIKTLLSDS--DVLIHLGDNINDVKLLSEGFKGKVYSVVGNCDYERNGQVEQVIEIEGKKFLITHGHKYTVKY-GLD----KIYYRGLELGVDGVIFGHTHRKVALKEGNMWIINPGSPSIPKDGE--ASIAFMNVDSENIE 150
>gi|28378860|ref|NP_785752.1| phosphoesterase (putative) [Lactobacillus plantarum WCFS1] >gi|28271697|emb|CAD64603.1| phosphoesterase (putative) [Lactobacillus plantarum WCFS1] (172 aa)
Score = 141, Expect = 1.2e-07, Identities = 43/131 (32%), Positives = 71/131 (54%)
  Q:     9 KILIISDTHGDRSFFRKIINEE--QPDIKIHCGD--FCTDIDLISENFDYFVAGNNDYEG--ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPR 139
           K L++SD+HGDR    +++++   Q D   HCGD     D  +  E F   V GN D++      V+  I+++   + HG   G ++ G +     L   A+ +N  + F GHTH   V  +  ++++NPGS+ YPR
  S:     2 KCLVVSDSHGDRDVLVRLLDKYRGQVDAFFHCGDSELPHDDAVFQEMFT--VQGNMDFDAVIPNEVNPTIDEVTVYMTHGHLVGVNM-GLDH----LLANAEVHNAKLAFFGHTHQLGVERRGGVVVLNPGSITYPR 131
>gi|18311234|ref|NP_563168.1| Ser/Thr protein phosphatase family protein [Clostridium perfringens str. 13] >gi|18145917|dbj|BAB81958.1| conserved hypothetical protein [Clostridium perfringens str. 13] (156 aa)
Score = 141, Expect = 1.4e-07, Identities = 49/150 (32%), Positives = 79/150 (52%)
  Q:     9 KILIISDTHGDR---SFFRKIINEEQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVD--FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           K+ I+SDTHG      + + ++N+   D+ IH GD   D+ L+SE F    Y V GN DYE    V+   +IE     + HG ++     G +    K+Y    E  +D +  GHTH +    + ++ IINPGS   P++     S A ++++   I+
  S:     2 KVAIVSDTHGVTHVIEYIKTLLNDS--DVLIHLGDNINDVKLLSEGFKGKVYSVVGNCDYERNGQVEQVIEIEGKKFLITHGHKYTVKY-GLD----KIYYRGLELGVDGVIFGHTHRKVALKEGDMWIINPGSPSIPKDGE--ASIAFMNVDSENIE 150
>gi|148543778|ref|YP_001271148.1| phosphodiesterase [Lactobacillus reuteri F275] >gi|184153184|ref|YP_001841525.1| putative phosphoesterase [Lactobacillus reuteri F275] >gi|148530812|gb|ABQ82811.1| phosphodiesterase, MJ0936 family [Lactobacillus reuteri F275] >gi|183224528|dbj|BAG25045.1| putative phosphoesterase [Lactobacillus reuteri F275] (172 aa)
Score = 141, Expect = 1.4e-07, Identities = 46/131 (35%), Positives = 66/131 (50%)
  Q:     9 KILIISDTHGDRSFFRKIINE--EQPDIKIHCGD--FCTDIDLISENFDYFVAGNNDY----EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPR 139
           KIL++SD H +     +I+ +   Q D+ IHCGD     D + +S NF   V GNNDY      E +++   E L     H  +  +S+         L    +E    I+  GHTH     Y   +LIINPGS+ +PR
  S:     2 KILVVSDNHREEKILTEIVQKMGNQVDLMIHCGDSELAPDQEPMS-NFKA-VKGNNDYGLSYPNELVINAGQEQLYLTHGHLQRVNFSLT-------PLMLTGQEKGASIVCYGHTHQLGAVYDHQMLIINPGSISFPR 131
>gi|169349803|ref|ZP_02866741.1| hypothetical protein CLOSPI_00541 [Clostridium spiroforme DSM 1552] >gi|169293371|gb|EDS75504.1| hypothetical protein CLOSPI_00541 [Clostridium spiroforme DSM 1552] (160 aa)
Score = 140, Expect = 1.8e-07, Identities = 41/149 (27%), Positives = 73/149 (48%)
  Q:     9 KILIISDTHG-DRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLM---HGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           K++I+SD+H   ++    ++     D  IHCGD     D I+    Y V GNNDY   +I D  +  ++ +L    HG ++ ++         +L   AK+   + +  GH+H       D++++INPGS+  PR      +Y +   +  K+
  S:     2 KVMILSDSHHISKTDLLTLLKNNHVDYYIHCGDIYKSFDKITLPNFYLVKGNNDYN-TKIPDELLISIDNQLFFVTHGHRYTFN---------QLITIAKQKKANAVCFGHSHQPLSLVIDDMIVINPGSICLPRGHYHFPTYCIYDTKTKKV 144
>gi|157149968|ref|YP_001450951.1| phosphodiesterase [Streptococcus gordonii str. Challis substr. CH1] >gi|157074762|gb|ABV09445.1| phosphodiesterase, MJ0936 family [Streptococcus gordonii str. Challis substr. CH1] (173 aa)
Score = 139, Expect = 2.2e-07, Identities = 50/151 (33%), Positives = 78/151 (51%)
  Q:     8 KKILIISDTHGDRSFFRKIINEE--QPDIKIHCGDFCTDIDLISENFDYFVAGNND-YEGERIVDFKIEDLNCRLM---HGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           + I+++SD+HGDRS   +I N    + D   H GD     D       + VAGN D Y+G    D  + DLN   +   HG  F  +   +++ +L    +A+E N+DI   GH HI   + +   L +NPGS+  PR     + YA + IE ++ +
  S:     4 QTIIVMSDSHGDRSIVEEIKNYYLGKVDGIFHNGDSELPSDDPVWEGIHVVAGNMDFYDG--YPDRLVTDLNGTRIAQAHGHLFQINF-SFQKLDL----WAQEENVDICLYGHLHIPDAWMEGKTLFLNPGSISQPRGLITERLYAKVEIEEDRFR 153
>gi|167770007|ref|ZP_02442060.1| hypothetical protein ANACOL_01349 [Anaerotruncus colihominis DSM 17241] >gi|167667841|gb|EDS11971.1| hypothetical protein ANACOL_01349 [Anaerotruncus colihominis DSM 17241] (159 aa)
Score = 139, Expect = 2.3e-07, Identities = 45/151 (29%), Positives = 79/151 (52%)
  Q:     7 MKKILIISDTHGDRSFFRKII--NEEQPDIKIHCGDFCTDIDLISE---NFDYF-VAGNNDY-EGERIVDFKIEDLNCRLMHGDQFGYSVP-GYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           M +I+++SDTH D     +++  +++  D+ IH GD   ++  + +   N  +    GN DY  GE  V F    +  R+ +     Y V  G +     L    +E   +++  GHTHI  V Y++ + ++NPGSL  PR     ++Y VL +  ++I
  S:     1 MTRIIVVSDTHRDYKSLERLVLMHKKTADLFIHLGDGAQELAAVKKIYPNVKWLQTPGNCDYASGEASVGF-YGCMKARIFYTHGHIYCVKYGLD----ALLTAGQEVGANVILYGHTHIPHVKYENGVYLMNPGSLGQPRGGG--RTYGVLDVSDSEI 152
>gi|78222958|ref|YP_384705.1| hypothetical protein Gmet_1749 [Geobacter metallireducens GS-15] >gi|78194213|gb|ABB31980.1| protein of unknown function UPF0025 [Geobacter metallireducens GS-15] (160 aa)
Score = 139, Expect = 2.5e-07, Identities = 48/151 (31%), Positives = 71/151 (47%)
  Q:     9 KILIISDTHGDRSFFRKIIN-EEQPDIKIHCGDFCTD---IDLISENFDYFVAGNNDY--EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           KI I SDTHG+ +   +  +     D   H GD   D   ++L+       V GN D+  +  R     +E +   L HGD++G    G +    KL   A E   D +F GHTH+  V   D IL +NPG L   +      S+A+L +E   + +
  S:     2 KIAIFSDTHGNHTLLARAFDLAGDVDHIFHLGDDTDDAIFLELLCGKTVIKVLGNCDFSTDSPRESLLSLEGMKFLLTHGDRYGVK-GGLD----KLTTRAAEEKADAVFYGHTHVPTVTTIDGILYVNPGCL---KRGFSKPSFALLSLENGTLSA 150
>gi|116872611|ref|YP_849392.1| phosphoesterase family protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741489|emb|CAK20613.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (174 aa)
Score = 138, Expect = 2.6e-07, Identities = 48/156 (30%), Positives = 81/156 (51%)
  Q:     9 KILIISDTHGDRS--FFRKIINEEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI--EGNKIKSVEFED 164
           K+L++SD+H +R      K   E   D  IHCGD   + D  +    + V GN D+ G    D+  E    R++      Y++   +   + L   A+E N D  F GH+H   V   D+ +I+NPGS+  PR   ++K+YA++    EG +++ ++ +D
  S:     2 KLLVVSDSHSERDCLIHLKEKYENTVDAMIHCGDSELEADDPAIQGFHTVRGNCDFGGGFPNDWVGEVDGYRILTTHGHLYNI---KMTLMNLRYRARELNADFAFFGHSHELGVDMLDDTIILNPGSISLPRGRIRIKTYALIDSTPEGIQVRFMDRDD 158
>gi|118586559|ref|ZP_01544001.1| phosphoesterase [Oenococcus oeni ATCC BAA-1163] >gi|118433000|gb|EAV39724.1| phosphoesterase [Oenococcus oeni ATCC BAA-1163] (177 aa)
Score = 137, Expect = 3.6e-07, Identities = 55/144 (38%), Positives = 80/144 (55%)
  Q:     9 KILIISDTHGDRSFFRKIINE--EQPDIK--IHCGD--FCTDIDLISENFDYFVAGN-----NDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQM--KSYAVLHI 152
           K LI SDTHGDR+ F++I+N   + P+I    + GD  F +D D I EN  + V GN     +D+  E +   K +D+     HG    +   G+E    KL   A +++ DI+  GHTH+      +  L INPGS  YPR   +    +Y +L I
  S:     2 KYLIFSDTHGDRAEFQEILNHYRDNPEIAAIFYNGDSQFESD-DPIWENI-HVVLGNMDLFSSDFPIENVYKNKTDDITIYQTHG-HLAHVNNGFE----KLDRLANKHHADIVLFGHTHVILAEKYNGRLFINPGSTTYPRGPQRSIGGTYVILTI 151
>gi|110799383|ref|YP_696924.1| Ser/Thr protein phosphatase family protein [Clostridium perfringens ATCC 13124] >gi|110674030|gb|ABG83017.1| Ser/Thr protein phosphatase family protein [Clostridium perfringens ATCC 13124] (156 aa)
Score = 137, Expect = 3.7e-07, Identities = 48/150 (32%), Positives = 78/150 (52%)
  Q:     9 KILIISDTHGDR---SFFRKIINEEQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVD--FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           K+ I+SDTHG      + + ++N+    + IH GD   D+ L+SE F    Y V GN DYE    V+   +IE     + HG ++     G +    K+Y    E  +D +  GHTH +    + N+ IINPGS   P++     S A ++++   ++
  S:     2 KVAIVSDTHGVTHVIEYIKTLLNDSY--VLIHLGDNINDVKLLSEGFKGKVYSVVGNCDYERNGQVEQVIEIEGKKFLITHGHKYTVKY-GLD----KIYYRGLELGVDGVIFGHTHRKVALKEGNMWIINPGSPSIPKDGE--ASIAFMNVDSENVE 150
>gi|16803280|ref|NP_464765.1| hypothetical protein lmo1240 [Listeria monocytogenes EGD-e] >gi|16410656|emb|CAC99318.1| lmo1240 [Listeria monocytogenes] (174 aa)
Score = 137, Expect = 3.8e-07, Identities = 48/156 (30%), Positives = 80/156 (51%)
  Q:     9 KILIISDTHGDRS--FFRKIINEEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI--EGNKIKSVEFED 164
           K+L++SD+H +R      K   E   D  IHCGD   + D  +    + V GN D+ G    D+  E    R+       Y++   +   + L   A+E N D  F GH+H   V   D+ +I+NPGS+  PR   ++K+YA++    EG +++ ++ +D
  S:     2 KLLVVSDSHSERDCLIHLKEKYENTVDAMIHCGDSELEADDPAIQGFHTVRGNCDFGGGFPNDWVGEVDGYRIFTTHGHLYNI---KMTLMNLRYRARELNADFAFFGHSHELGVDMLDDTIILNPGSISLPRGRIRVKTYALIDSTPEGIQVRFMDRDD 158
>gi|46907459|ref|YP_013848.1| phosphoesterase family protein [Listeria monocytogenes str. 4b F2365] >gi|47093492|ref|ZP_00231254.1| phosphoesterase family protein [Listeria monocytogenes str. 4b H7858] >gi|153166595|ref|ZP_01927135.1| hypothetical protein LMHG_02264 [Listeria monocytogenes FSL N1-017] >gi|153201945|ref|ZP_01943702.1| hypothetical protein LMSG_01367 [Listeria monocytogenes HPB2262] >gi|167453861|ref|ZP_02320084.1| phosphoesterase family protein [Listeria monocytogenes FSL J2-064] >gi|46880727|gb|AAT04025.1| phosphoesterase family protein [Listeria monocytogenes str. 4b F2365] >gi|47018110|gb|EAL08881.1| phosphoesterase family protein [Listeria monocytogenes str. 4b H7858] >gi|133727522|gb|EBA29220.1| hypothetical protein LMHG_02264 [Listeria monocytogenes FSL N1-017] >gi|133735734|gb|EBA37432.1| hypothetical protein LMSG_01367 [Listeria monocytogenes HPB2262] (174 aa)
Score = 137, Expect = 4.0e-07, Identities = 48/156 (30%), Positives = 80/156 (51%)
  Q:     9 KILIISDTHGDRS--FFRKIINEEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI--EGNKIKSVEFED 164
           K+L++SD+H +R      K   E   D  IHCGD   + D  +    + V GN D+ G    D+  E    R+       Y++   +   + L   A+E N D  F GH+H   V   D+ +I+NPGS+  PR   ++K+YA++    EG +++ ++ +D
  S:     2 KLLVVSDSHSERDCLIHLKEKYENTVDAMIHCGDSELEADDPAIQGFHTVRGNCDFGGGFPNDWVGEVDGYRIFTTHGHLYNI---KMTLMNLRYRARELNADFAFFGHSHELGVDMLDDTIILNPGSISLPRGRIRVKTYALIDSTPEGIQVRFMDRDD 158
>gi|116490739|ref|YP_810283.1| phosphoesterase [Oenococcus oeni PSU-1] >gi|116091464|gb|ABJ56618.1| Predicted phosphoesterase [Oenococcus oeni PSU-1] (177 aa)
Score = 137, Expect = 4.1e-07, Identities = 55/144 (38%), Positives = 80/144 (55%)
  Q:     9 KILIISDTHGDRSFFRKIINE--EQPDIK--IHCGD--FCTDIDLISENFDYFVAGN-----NDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQM--KSYAVLHI 152
           K LI SDTHGDR+ F++I+N   + P+I    + GD  F +D D I EN  + V GN     +D+  E +   K +D+     HG    +   G+E    KL   A +++ DI+  GHTH+      +  L INPGS  YPR   +    +Y +L I
  S:     2 KYLIFSDTHGDRAEFQEILNHYRDNPEIAAIFYNGDSQFESD-DPIWENI-HVVLGNMDLFSSDFPIENVYKNKTDDITIYQTHG-HLAHVNNGFE----KLDHLANKHHADIVLFGHTHVILAEKYNGKLFINPGSTTYPRGPQRSIGGTYVILTI 151
>gi|139438732|ref|ZP_01772216.1| Hypothetical protein COLAER_01219 [Collinsella aerofaciens ATCC 25986] >gi|133775812|gb|EBA39632.1| Hypothetical protein COLAER_01219 [Collinsella aerofaciens ATCC 25986] (155 aa)
Score = 136, Expect = 4.4e-07, Identities = 51/158 (32%), Positives = 81/158 (51%)
  Q:     8 KKILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFCTDID---LISENFDYFVAGNNDY------EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           K+I IISDTHG  S    +++E E  D+ IH GD  +++D   L +      V GNNDY      + +R+  F  E L   + H            R +L +       ++D+  +GHTH+ +       L++NPGS  YPR   +  + A + ++  KI S +F D+
  S:     7 KRIDIISDTHGYLS--PALLDELEGADLIIHAGDLTSEMDYEHLCTIAPVRAVLGNNDYYRDYGPDVDRLALFTYEGLKFAVAH-----------YREDLPV------GSVDVAINGHTHVTKEAQVGRCLVLNPGSASYPR-GTRGPTMARMLVKDGKILSTKFIDL 154
>gi|15615628|ref|NP_243932.1| hypothetical protein BH3066 [Bacillus halodurans C-125] >gi|10175688|dbj|BAB06785.1| BH3066 [Bacillus halodurans C-125] (169 aa)
Score = 136, Expect = 4.9e-07, Identities = 42/150 (28%), Positives = 77/150 (51%)
  Q:     9 KILIISDTHGDRSFFRKIINE--EQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDF--KIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           K+LI+SD+HG     + + ++  ++ D  IHCGD     D  +      V GN D+  +   DF   + D N  + HG  +   +       + L   A+E    ++  GH+H+   F ++ I+ +NPGSL  PRN  + ++Y + ++  ++I+
  S:     2 KLLILSDSHGWSDELKAVADKHRQEVDAIIHCGDSELPRDDRALEGMNIVRGNCDFGVDFPEDFIKTVGDFNVYVTHGHLYNVKM-----SYVSLTYRAEEVGAQLVCFGHSHVATSFQENGIVFVNPGSLRLPRNRKE-QTYCLAYVRDDQIE 149
>gi|153179319|ref|ZP_01932538.1| hypothetical protein LMMG_00199 [Listeria monocytogenes F6900] >gi|153184599|ref|ZP_01935326.1| hypothetical protein LMOG_01233 [Listeria monocytogenes J0161] >gi|153190647|ref|ZP_01938010.1| hypothetical protein LMPG_00772 [Listeria monocytogenes J2818] >gi|126942570|gb|EBA20307.1| hypothetical protein LMOG_01233 [Listeria monocytogenes J0161] >gi|127765631|gb|EBA25976.1| hypothetical protein LMPG_00772 [Listeria monocytogenes J2818] >gi|133732804|gb|EBA34502.1| hypothetical protein LMMG_00199 [Listeria monocytogenes F6900] (174 aa)
Score = 136, Expect = 5.1e-07, Identities = 48/156 (30%), Positives = 80/156 (51%)
  Q:     9 KILIISDTHGDRS--FFRKIINEEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI--EGNKIKSVEFED 164
           K+L++SD+H +R      K   E   D  IHCGD   + D  +    + V GN D+ G    D+  E    R+       Y++   +   + L   A+E N D  F GH+H   V   D+ +I+NPGS+  PR   ++K+YA++    EG +++ ++ +D
  S:     2 KLLVVSDSHSERDCLIHLKEKYENTVDAMIHCGDSELEADDPAIQGFHTVRGNCDFGGGFPNDWVGEVDGYRIFTTHGHLYNI---KMTLMNLRYRARELNADFAFFGHSHELGVDMLDDTIILNPGSISLPRGRIRVKTYALIDSTPEGIQVRFMDRDD 158
>gi|69246344|ref|ZP_00603900.1| Protein of unknown function UPF0025 [Enterococcus faecium DO] >gi|68195297|gb|EAN09748.1| Protein of unknown function UPF0025 [Enterococcus faecium DO] (172 aa)
Score = 135, Expect = 6.1e-07, Identities = 48/154 (31%), Positives = 81/154 (52%)
  Q:     9 KILIISDTHGDRSFFRKIINE--EQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDY----EGERIVDFKIEDLNCRLMHGD----QFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF 162
           + L++SD HGDR     +++    + DI  HCGD  ++++     +D F  V GN DY    E ++++    + +   + HG     +FG +    E         A+    D++F GHTH         IL +NPGS+  PR   Q+ SYA++    ++I SV++
  S:     2 RYLVVSDNHGDRDILVDLVDRYRSEVDIFFHCGD--SELEASDPLWDTFQVVQGNCDYGPGFEQKKVIQTGQDTV--FMTHGHLSNVRFGLTQLAIE---------ARAATADMVFFGHTHQIGCEMDQKILFLNPGSISQPRGPIQIPSYALIESLDDQI-SVQY 153
>gi|150015247|ref|YP_001307501.1| phosphodiesterase [Clostridium beijerinckii NCIMB 8052] >gi|149901712|gb|ABR32545.1| phosphodiesterase, MJ0936 family [Clostridium beijerinckii NCIMB 8052] (159 aa)
Score = 135, Expect = 7.3e-07, Identities = 44/130 (33%), Positives = 71/130 (54%)
  Q:    10 ILIISDTHGDRSFF---RKIINEEQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVDFKIEDLNCRLM--HGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPR 139
           I ++SDTH    +    +++I +   DI IH GD   D +L+   F    Y VAGN DY  +   +  IE    ++   HGD +G      +     +Y   +E N DI+  GHTH + V  +D+++++NPGS+  P+
  S:     3 IAVVSDTHRITKYINLAKRLIKD--ADILIHLGDNIDDAELLENTFKGKVYAVAGNCDYSTKYPKESVIEVNGKKIFFTHGDLYGV-----KSSMNNIYYRGRELNADIVLFGHTHQQLVEKEDDMILMNPGSISLPK 133
>gi|75760747|ref|ZP_00740769.1| putative phosphoesterase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74491775|gb|EAO54969.1| putative phosphoesterase [Bacillus thuringiensis serovar israelensis ATCC 35646] (168 aa)
Score = 133, Expect = 1.0e-06, Identities = 50/157 (31%), Positives = 83/157 (52%)
  Q:     7 MKKILIISDTHGDRSFFRKIIN--EEQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDY---EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEY-AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           M K LI+SD+H      +++    E + DI IHCGD  +++    E    F  V GN DY   + E + D  +  +   ++HG +         +  L+   Y A+E    +   GH+H+      D +L INPGS++ PR   + K++AVL ++ N+++ V FE
  S:     1 MMKALIVSDSHSSVKELQQLKEKYEGKVDIMIHCGD--SELTPAHEEMQGFRVVKGNCDYANFQDEIVTD--VNGIRFLVVHGHRHNV------KMTLQTLAYHAEEVGAQVACFGHSHVLGAELIDGVLFINPGSILLPRQRVE-KTFAVLEMDENQME-VRFE 153
>gi|171780256|ref|ZP_02921160.1| hypothetical protein STRINF_02044 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281604|gb|EDT47039.1| hypothetical protein STRINF_02044 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (173 aa)
Score = 133, Expect = 1.1e-06, Identities = 53/166 (31%), Positives = 85/166 (51%)
  Q:     5 VDMKKILIISDTHGDRSFFRKIINEEQPDIK--IHCGDF-CTDIDLISENFDYFVAGNNDYEG---ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF--EDVVKYPA 170
           ++ + I+++SD+HGDR     I    Q ++    H GD      D I +     V GN DY+    ER+  + ++D+     HG  +  +   ++R +L    +A+E + DI   GH H    +     + INPGS++ PR   + K YA + I  +KIK V+F   D   YPA
  S:     1 MESRTIIVMSDSHGDREIISNIKQRYQGEVDAIFHNGDSELPSSDPIWDGIK-VVRGNCDYDNGYPERLTTY-LDDIVIAQTHGHLYNINFT-WDRLDL----FAQEEDADICLYGHLHRAAAWRNGKTIFINPGSVLQPRGDVKEKLYAKVIITKDKIK-VDFYTRDHKLYPA 166
>gi|66880192|ref|ZP_00405176.1| COG0622: Predicted phosphoesterase [Mycoplasma genitalium G-37] (114 aa)
Score = 133, Expect = 1.2e-06, Identities = 38/102 (37%), Positives = 52/102 (50%)
  Q:    56 VAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELK-----LYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           +AGNND  G  I  F++  +N  LMHG Q         R  LK     L   A++   D+L  GH+HIE     + I +INPGSL  PRN     SY    +  +++
  S:     1 MAGNNDSIGNEIEIFQLGQINFVLMHGHQ-------APRDNLKKWYQLLVLKAQQYPCDVLIFGHSHIEYTNKINMIQLINPGSLQLPRNQTNTPSYCTFIVNKDEL 100
>gi|189425555|ref|YP_001952732.1| phosphodiesterase, MJ0936 family [Geobacter lovleyi SZ] >gi|189421814|gb|ACD96212.1| phosphodiesterase, MJ0936 family [Geobacter lovleyi SZ] (157 aa)
Score = 133, Expect = 1.2e-06, Identities = 48/144 (33%), Positives = 73/144 (50%)
  Q:     9 KILIISDTHGDRS-FFRKIINEEQPDIKIHCGDFCTDIDLIS---ENFDYF-VAGNNDYEGERIVDFKIEDLNCRLM--HGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI 152
           +IL++SDTHG+++   R      + +  IH GD   D  L++   E      +AGN D       +   E    RL+  HGD++G  V G   R   L E  +   +D +  GHTH+ Q   ++ I +INPG+L  P       SYA+L +
  S:     2 RILVVSDTHGNQAALLRAHEAAGRCEAIIHLGDGEEDAALLAVLDEGCPVVRLAGNCDLGSTAPRELIREWAGVRLLLCHGDRYG--VKGGLAR---LLEQGRATGVDAVLYGHTHLAQAVRQEGIWLINPGTLTAPA---PFHSYAILEL 144
>gi|30264548|ref|NP_846925.1| phosphoesterase, putative [Bacillus anthracis str. Ames] >gi|47530013|ref|YP_021362.1| phosphoesterase, putative [Bacillus anthracis str. 'Ames Ancestor'] >gi|49187370|ref|YP_030622.1| phosphoesterase, putative [Bacillus anthracis str. Sterne] >gi|49481511|ref|YP_038532.1| phosphoesterase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|166996133|ref|ZP_02262593.1| hypothetical protein BcerA_22868 [Bacillus cereus AH820] >gi|170708337|ref|ZP_02898781.1| putative phosphoesterase [Bacillus anthracis str. A0389] >gi|190567055|ref|ZP_03019971.1| putative phosphoesterase [Bacillus anthracis Tsiankovskii-I] >gi|196034418|ref|ZP_03101827.1| putative phosphoesterase [Bacillus cereus W] >gi|30259206|gb|AAP28411.1| phosphoesterase, putative [Bacillus anthracis str. Ames] >gi|47505161|gb|AAT33837.1| phosphoesterase, putative [Bacillus anthracis str. 'Ames Ancestor'] >gi|49181297|gb|AAT56673.1| phosphoesterase, putative [Bacillus anthracis str. Sterne] >gi|49333067|gb|AAT63713.1| conserved hypothetical protein, possible phosphoesterase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|170126712|gb|EDS95595.1| putative phosphoesterase [Bacillus anthracis str. A0389] >gi|190562046|gb|EDV16015.1| putative phosphoesterase [Bacillus anthracis Tsiankovskii-I] >gi|195992960|gb|EDX56919.1| putative phosphoesterase [Bacillus cereus W] (167 aa)
Score = 132, Expect = 1.4e-06, Identities = 49/155 (31%), Positives = 83/155 (53%)
  Q:     9 KILIISDTHGDRSFFRKIIN--EEQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDY---EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEY-AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           K LI+SD+H      +++    E + DI IHCGD  +++    E    F  V GN DY   + E + D  ++ L   ++HG +         +  L+   Y A+E    +   GH+H+      D +L INPGS++ PR   + K++A+L ++ N+++ V FE
  S:     2 KALIVSDSHSSVKELQQLKEKYEGKVDIMIHCGD--SELTPAHEELQGFHVVKGNCDYANFQDEIVTD--VDGLRFVVVHGHRHNV------KMTLQTLAYRAEEVGAQVACFGHSHVLGAELIDGVLFINPGSILLPRQRVE-KTFAILEMDENQME-VRFE 152
>gi|154500350|ref|ZP_02038388.1| hypothetical protein BACCAP_04017 [Bacteroides capillosus ATCC 29799] >gi|150270855|gb|EDM98138.1| hypothetical protein BACCAP_04017 [Bacteroides capillosus ATCC 29799] (166 aa)
Score = 132, Expect = 1.6e-06, Identities = 39/129 (30%), Positives = 66/129 (51%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFD----YFVAGNNDYE----GERIVDFKIEDLNCRLMHGDQFGYSVP-GYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSL 135
           + K+L+ SD+HG+    R+ + +E+PD  +H GD   D   +S ++       V GN DY      ++I+ F  E     + HG  +   +  G   R       A E  +D+L  GHTH      +D + ++NPG++
  S:     9 LMKLLVFSDSHGNIEHMRRAVEQEKPDQILHLGDVMRDAVELSRDYPNIPLELVPGNCDYATDVPAQKILYF--EGRRILMTHGHIYHVKLGIGAAVRA------AVEAKVDVLLFGHTHEAFCCEQDGLWVMNPGTI 138
>gi|118479644|ref|YP_896795.1| phosphoesterase [Bacillus thuringiensis str. Al Hakam] >gi|118418869|gb|ABK87288.1| conserved hypothetical protein [Bacillus thuringiensis str. Al Hakam] (177 aa)
Score = 130, Expect = 2.3e-06, Identities = 48/157 (30%), Positives = 84/157 (53%)
  Q:     7 MKKILIISDTHGDRSFFRKIIN--EEQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDY---EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEY-AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           + K LI+SD+H      +++    E + DI IHCGD  +++    E    F  V GN DY   + E + D  ++ +   ++HG +         +  L+   Y A+E    +   GH+H+      D +L INPGS++ PR   + K++A+L ++ N+++ V FE
  S:    10 LMKALIVSDSHSSVKELQQLKEKYEGKVDIMIHCGD--SELTPAHEELQGFHVVKGNCDYANFQDEIVTD--VDGIRFVVVHGHRHNV------KMTLQTLAYRAEEVGAQVACFGHSHVLGAELIDGVLFINPGSILLPRQRVE-KTFAILEMDENQME-VRFE 162
>gi|77406895|ref|ZP_00783920.1| Unknown [Streptococcus agalactiae H36B] >gi|77412371|ref|ZP_00788682.1| Unknown [Streptococcus agalactiae CJB111] >gi|77161591|gb|EAO72591.1| Unknown [Streptococcus agalactiae CJB111] >gi|77174504|gb|EAO77348.1| Unknown [Streptococcus agalactiae H36B] (173 aa)
Score = 130, Expect = 2.3e-06, Identities = 46/151 (30%), Positives = 78/151 (51%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEE--QPDIKIHCGDF-CTDIDLISENFDYFVAGNNDYEG--ERIVDFKIEDLNCRLMHGD--QFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           ++K++++SD+HGDR   + I N    + D+  H GD      D I E   + V GN DY+     ++  KI++      HG   Q  ++   +++ +L     A++ + DI   GH H    +     + INPGS++ PR     K YAV+ I  +K+
  S:     3 IRKLVVMSDSHGDRDIVKDIKNHYLGKVDVIFHNGDSELPSSDPIWEGI-HVVTGNCDYDSGYPEVLVTKIDNTVIVQTHGHLHQINFT---WDKLDL----LAQQEDADICLYGHLHRADAWKNGKTIFINPGSVLQPRGPINEKLYAVVTITDSKV 152
>gi|188585279|ref|YP_001916824.1| phosphodiesterase, MJ0936 family [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349966|gb|ACB84236.1| phosphodiesterase, MJ0936 family [Natranaerobius thermophilus JW/NM-WN-LF] (185 aa)
Score = 130, Expect = 2.4e-06, Identities = 45/157 (28%), Positives = 86/157 (54%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQP-DIKIHCGD--FCTDIDLISENFD---------------YFVAGNNDYEGERIV----------DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           +I +ISDTHG    + + +   Q   + +H GD  +    + + E +D               + V GN D E + +V             +E LN  ++HG ++          + +L++  K    D++  GHTHI Q+ ++D++++INPGS   P+  +++ +  +L       K+VE +D+
  S:     2 RIGLISDTHGSLKAWNQAMELFQDCQVILHGGDILYHGPRNPLPEGYDPKELANELNNLGKSLFMVGGNCDAEVDNMVLNHPVLTPYFYTSLEGLNILVLHGHKYS---------QEELFQLGKRYQADMIMVGHTHIPQIKHQDDLILINPGSPSLPKGEDKVPAVGILDTTE---KTVEIKDL 174
>gi|65321846|ref|ZP_00394805.1| COG0622: Predicted phosphoesterase [Bacillus anthracis str. A2012] (150 aa)
Score = 130, Expect = 2.4e-06, Identities = 46/152 (30%), Positives = 81/152 (53%)
  Q:     9 KILIISDTHGDRSFFRKIIN--EEQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDY---EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEY-AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSV 160
           K LI+SD+H      +++    E + DI IHCGD  +++    E    F  V GN DY   + E + D  ++ L   ++HG +         +  L+   Y A+E    +   GH+H+      D +L INPGS++ PR   + K++A+L ++ N+++ +
  S:     2 KALIVSDSHSSVKELQQLKEKYEGKVDIMIHCGD--SELTPAHEELQGFHVVKGNCDYANFQDEIVTD--VDGLRFVVVHGHRHNV------KMTLQTLAYRAEEVGAQVACFGHSHVLGAELIDGVLFINPGSILLPRQRVE-KTFAILEMDENQMEGI 150
>gi|148322564|gb|EDK87814.1| hypothetical protein FNP_2428 [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (153 aa)
Score = 130, Expect = 2.5e-06, Identities = 44/128 (34%), Positives = 67/128 (52%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLIS----ENFDYFVAGNNDYEGERIVD---FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS 134
           MKKIL++SD+H       KI  +E+PDI I  GD   DID +S    E   Y V GN DY      +   F+I+ +   L HG  +       +R    + E  K+ N+ ++  GHTH   +   +++ + NPG+
  S:     1 MKKILVLSDSHSYFDGALKIFEKEKPDIVIGAGDGIKDIDDLSYVHLEAKYYMVKGNCDYFDRNHNEENLFEIDGIKIFLTHGHLY-----DVKRSLSSIKEIGKKLNVSLVVFGHTHKPYIEKDEDMTLFNPGA 130
>gi|34763290|ref|ZP_00144248.1| hypothetical protein with Metallo-phosphoesterase motif [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887038|gb|EAA24151.1| hypothetical protein with Metallo-phosphoesterase motif [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (153 aa)
Score = 130, Expect = 2.6e-06, Identities = 53/152 (34%), Positives = 79/152 (51%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLIS----ENFDYFVAGNNDYEGERIVD----FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           MKKIL++SD+H       KI  +E+PDI I  GD   DID +S    E   Y V GN D+  +R  D    F+I+ +   L HG    YSV   +R    + E  K+ N+ ++  GHTH   +    ++++ NPG       A +   Y V+ +E   I+
  S:     1 MKKILVLSDSHSYFDEALKIFEKEKPDIVIGAGDGIKDIDELSYVHPEAKYYMVKGNCDF-FDRNHDEENFFEIDGIKIFLTHGHL--YSV---KRSLSSIKEIGKKLNVSLVIFGHTHKPYMEKDGDMILFNPG-------ATEDGRYGVIILENGNIQ 147
>gi|56964415|ref|YP_176146.1| phosphoesterase [Bacillus clausii KSM-K16] >gi|56910658|dbj|BAD65185.1| phosphoesterase [Bacillus clausii KSM-K16] (169 aa)
Score = 129, Expect = 2.8e-06, Identities = 41/130 (31%), Positives = 66/130 (50%)
  Q:    10 ILIISDTHGDRSFFRKIIN--EEQPDIKIHCGDF--------CTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPR 139
           IL+ISD+HG     + II+  E + D  IH GD            +++++ N D F +  N+ E +       E     + HG   G      ++   KL + AKE    I   GH+HI +   +D +++INPGS+  P+
  S:     3 ILVISDSHGWTDQLKAIISRHEHEVDQVIHVGDSELPEHAPELAGVNVVAGNCDVFSSFPNELECQ------WEGTTAYIAHGHHHGV-----KQTLAKLIDRAKEKGARIAIYGHSHIARAEEQDGVILINPGSVRLPK 131
>gi|163942226|ref|YP_001647110.1| phosphodiesterase [Bacillus weihenstephanensis KBAB4] >gi|163864423|gb|ABY45482.1| phosphodiesterase, MJ0936 family [Bacillus weihenstephanensis KBAB4] (167 aa)
Score = 129, Expect = 2.9e-06, Identities = 50/155 (32%), Positives = 84/155 (54%)
  Q:     9 KILIISDTHGDRSFFRKIIN--EEQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDY---EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELK-----LYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           K LI+SD+H      +++    E + D+ IHCGD  +++    E    F  V GN DY   + E + D  ++ +   ++HG           R ++K     L  +A+E    +   GH+H+      D IL INPGS++ PR+  + K++A+L ++ N I+ V FE
  S:     2 KALIVSDSHSSVKELQQLKENYEGKVDVMIHCGD--SELTPAHEELQGFQVVKGNCDYANFQDEIVTD--VDGIRFLVVHG----------HRHDVKMTLQTLAYHAEEVGAQVACFGHSHVLGAELLDGILFINPGSILLPRSRVE-KTFALLEMDENHIE-VRFE 152
>gi|164686705|ref|ZP_02210733.1| hypothetical protein CLOBAR_00300 [Clostridium bartlettii DSM 16795] >gi|164604095|gb|EDQ97560.1| hypothetical protein CLOBAR_00300 [Clostridium bartlettii DSM 16795] (158 aa)
Score = 129, Expect = 3.2e-06, Identities = 56/149 (37%), Positives = 76/149 (51%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQP-----DIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVD---FKIEDLNCRLMHGDQFG--YSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKD--NILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           +I IISDTH     F K I+   P     D+ +H GD   D D I    D     V GN D+  +   D   F  ED    + HG  +G  YS+         L   A  +NIDI+  GH+HI   FY++   ++ INPGS+  PR  +  K   +L IE  +I
  S:     2 RIGIISDTHR----FTKAIDHAIPYLQDCDLIVHAGDNIDDADYIEAVTDIPVVAVKGNCDFYSDPGKDEEAFMAEDKRVFVCHGHNYGIKYSMS-------DLLNKALNSNIDIVIFGHSHIP--FYQEIRGVIFINPGSVSLPRGGSS-KGLGILDIENGEI 151
>gi|168140472|ref|ZP_02583701.1| possible phosphoesterase [Bacillus cereus G9842] (167 aa)
Score = 129, Expect = 3.2e-06, Identities = 49/155 (31%), Positives = 82/155 (52%)
  Q:     9 KILIISDTHGDRSFFRKIIN--EEQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDY---EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEY-AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           K LI+SD+H      +++    E + DI IHCGD  +++    E    F  V GN DY   + E + D  +  +   ++HG +         +  L+   Y A+E    +   GH+H+      D +L INPGS++ PR   + K++AVL ++ N+++ V FE
  S:     2 KALIVSDSHSSVKELQQLKEKYEGKVDIMIHCGD--SELTPAHEEMQGFRVVKGNCDYANFQDEIVTD--VNGIRFLVVHGHRHNV------KMTLQTLAYHAEEVGAQVACFGHSHVLGAELIDGVLFINPGSILLPRQRVE-KTFAVLEMDENQME-VRFE 152
>gi|196044936|ref|ZP_03112170.1| putative phosphoesterase [Bacillus cereus 03BB108] >gi|196024424|gb|EDX63097.1| putative phosphoesterase [Bacillus cereus 03BB108] (167 aa)
Score = 129, Expect = 3.3e-06, Identities = 48/155 (30%), Positives = 83/155 (53%)
  Q:     9 KILIISDTHGDRSFFRKIIN--EEQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDY---EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEY-AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           K LI+SD+H      +++    E + DI IHCGD  +++    E    F  V GN DY   + E + D  ++ +   ++HG +         +  L+   Y A+E    +   GH+H+      D +L INPGS++ PR   + K++A+L ++ N+++ V FE
  S:     2 KALIVSDSHSSVKELQQLKEKYEGKVDIMIHCGD--SELTPAHEELQGFHVVKGNCDYANFQDEIVTD--VDGIRFVVVHGHRHNV------KMTLQTLAYRAEEVGAQVACFGHSHVLGAELIDGVLFINPGSILLPRQRVE-KTFAILEMDENQME-VRFE 152
>gi|153956059|ref|YP_001396824.1| phosphoesterase [Clostridium kluyveri DSM 555] >gi|146348917|gb|EDK35453.1| Predicted phosphoesterase [Clostridium kluyveri DSM 555] (156 aa)
Score = 129, Expect = 3.5e-06, Identities = 43/132 (32%), Positives = 74/132 (56%)
  Q:    10 ILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVDFKIEDLNCR---LMHGDQFG--YSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA 141
           I ++SDTH  + F  K+++     ++ IH GD   D++ I + +      V+GN D+  +  V+ ++E ++ +   + HG ++   YS+   + R L       E   DI+  GHTHI Q+ Y++ I  INPGS   PR+ 
  S:     3 IGVVSDTHRYKKFINKVVDVLYNTELIIHLGDNVQDVNEIKKIYTGSIINVSGNCDFNVDAPVE-RLEIISGKRFFITHGHRYDVKYSLSRLKCRAL-------ERKADIVLFGHTHISQIVYEEGIWFINPGSPSVPRDG 135
>gi|153174319|ref|ZP_01929847.1| hypothetical protein LMIG_01347 [Listeria monocytogenes FSL N3-165] >gi|133730267|gb|EBA31965.1| hypothetical protein LMIG_01347 [Listeria monocytogenes FSL N3-165] (174 aa)
Score = 128, Expect = 3.7e-06, Identities = 45/155 (29%), Positives = 80/155 (51%)
  Q:    10 ILIISDTHGDRSFFRKIINEEQP--DIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI--EGNKIKSVEFED 164
           +L++SD+H +R     +  + +   D  IHCGD   + D  +    + V GN D+ G    D+  E    R+       Y++   +   + L   A+E N D  F GH+H   V   D+ +I+NPGS+  PR   ++K+YA++    EG +++ ++ +D
  S:     3 LLVVSDSHSERDCLIHLKEKYKNTVDAMIHCGDSELEADDPAIQGFHTVRGNCDFGGGFPNDWVGEVDGYRIFTTHGHLYNI---KMTLMNLRYRARELNADFAFFGHSHELGVDMLDDTIILNPGSISLPRGRIRVKTYALIDSTPEGIQVRFMDRDD 158
>gi|116512123|ref|YP_809339.1| hypothetical protein LACR_1401 [Lactococcus lactis subsp. cremoris SK11] >gi|125624019|ref|YP_001032502.1| hypothetical protein llmg_1189 [Lactococcus lactis subsp. cremoris MG1363] >gi|116107777|gb|ABJ72917.1| Predicted phosphoesterase [Lactococcus lactis subsp. cremoris SK11] >gi|124492827|emb|CAL97782.1| conserved hypothetical protein [Lactococcus lactis subsp. cremoris MG1363] (167 aa)
Score = 128, Expect = 3.9e-06, Identities = 50/146 (34%), Positives = 75/146 (51%)
  Q:    11 LIISDTHGDRSFFRKIINE--EQPDIKIHCGDFCTDIDLISE--NFDYFVAGNNDYEGERIVDF---KIEDLNCRLMHGDQFGYSVPGYERRELKLYEY-AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNK 156
           +++SD+H DR     I ++   +     HCGD  +++    E  N    VAGN DY+ +   DF    +E     + HG  + Y   G ER     Y Y A+E   DI   GH H       +NIL +NPGS+  PR    +K YA++ I+G++
  S:     3 VVMSDSHYDREVVESIKSKYLNEATAIFHCGD--SELPSSDEIWNGITVVAGNCDYD-DGYHDFLTQTVEGKKVLITHGHLY-YVGLGLER-----YSYFAEEQGADIALFGHIHQPVAQKINNILYVNPGSVAQPRGKYDIKMYAIIEIDGDE 147
>gi|160937346|ref|ZP_02084707.1| hypothetical protein CLOBOL_02237 [Clostridium bolteae ATCC BAA-613] >gi|158439415|gb|EDP17165.1| hypothetical protein CLOBOL_02237 [Clostridium bolteae ATCC BAA-613] (166 aa)
Score = 128, Expect = 4.3e-06, Identities = 48/145 (33%), Positives = 76/145 (52%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQP-DIKIHCGDFCTDIDLIS----ENFDY-FVAGNNDYEG--ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTH-----IEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           +ILI+SDTH      +++I    P D+ IH GD       I+    E+ D   + GNND+    ++  +  I      L HG  +  SV G E     L + A+    DI+  GHTH     +E+     +++++NPGSL YPR      S+ ++ I+
  S:     2 RILIVSDTHRRDENLKEVIRRTGPLDMLIHLGDAEGSEHAIATWVNEDCDLEIILGNNDFFSCLDKEKELMIGRYKTLLTHGHYYNVSV-GAEY----LKQEARARGFDIVMFGHTHRPFYEVEKKEGDKDLIVLNPGSLSYPRQDGHKPSFMLMEID 154
>gi|30022571|ref|NP_834202.1| putative phosphoesterase [Bacillus cereus ATCC 14579] >gi|29898129|gb|AAP11403.1| putative phosphoesterase [Bacillus cereus ATCC 14579] (168 aa)
Score = 128, Expect = 4.3e-06, Identities = 48/157 (30%), Positives = 84/157 (53%)
  Q:     7 MKKILIISDTHGDRSFFRKIIN--EEQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDY---EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEY-AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           M K LI+SD+H      +++    E + DI IHCGD  +++    E    F  V GN DY   + E + D  ++ +   ++HG +         +  L+   Y A+E    +   GH+H+      + +L INPGS++ PR   + K++A+L ++ N+++ V FE
  S:     1 MMKALIVSDSHSSVKELQQLKEKYEGKVDIMIHCGD--SELTPAHEELQGFHVVKGNCDYANFQDEIVTD--VDGIRFLVVHGHRHNV------KMTLQTLAYHAEEVGAQVACFGHSHVLGAELIEGVLFINPGSILLPRQRVE-KTFALLEMDENQME-VRFE 153
>gi|52141020|ref|YP_085811.1| phosphoesterase [Bacillus cereus E33L] >gi|196039246|ref|ZP_03106552.1| putative phosphoesterase [Bacillus cereus NVH0597-99] >gi|51974489|gb|AAU16039.1| conserved hypothetical protein; possible phosphoesterase [Bacillus cereus E33L] >gi|196029873|gb|EDX68474.1| putative phosphoesterase [Bacillus cereus NVH0597-99] (167 aa)
Score = 128, Expect = 4.4e-06, Identities = 48/155 (30%), Positives = 83/155 (53%)
  Q:     9 KILIISDTHGDRSFFRKIIN--EEQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDY---EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEY-AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           K LI+SD+H      +++    E + DI IHCGD  +++    E    F  V GN DY   + E + D  ++ +   ++HG +         +  L+   Y A+E    +   GH+H+      D +L INPGS++ PR   + K++A+L ++ N+++ V FE
  S:     2 KALIVSDSHSSVKELQQLKEKYEGKVDIMIHCGD--SELTPAHEELQGFHVVKGNCDYANFQDEIVTD--VDGIRFVVVHGHRHNV------KMTLQTLAYRAEEVGAQVACFGHSHVLGAELIDGVLFINPGSILLPRQRVE-KTFALLEMDENQME-VRFE 152
>gi|163799155|ref|ZP_02193062.1| phosphodiesterase, MJ0936 family [Methanococcus voltae A3] >gi|158973162|gb|EDP40630.1| phosphodiesterase, MJ0936 family [Methanococcus voltae A3] (209 aa)
Score = 127, Expect = 5.1e-06, Identities = 56/158 (35%), Positives = 89/158 (56%)
  Q:     9 KILIISDTH-GDRSFFRKI--INE--------------EQPDIKIHCGDFCTD---------------IDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERR--ELKLYEYAKENNIDILFSGHTHIEQV----FYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDVV 166
           +I IISDTH  DR   R+I  INE              ++ D+ IHCGD  +                + L+  N D +    +  +  +  +F +  L   ++HG+         E R  +LKL   A E   D+L SGHTHI  +     +   I+++NPGS   PR    +K++ +L  E NK+  +E ++V+
  S:    23 RIGIISDTHIPDRHTCREIDDINECIKEQFSEYVENELKKVDLIIHCGDLTSKEVIEKLNELKSTKYKLILVKGNIDRYDPILSKIDLPQEYEFIVNGLKIGVIHGNTI-------EPRGDKLKLKYMALEKGWDVLISGHTHIPMIESVEGFDKTIMLLNPGSFTCPRIP--LKTFIILDFENNKLNKIELKEVL 209
>gi|22537738|ref|NP_688589.1| hypothetical protein SAG1598 [Streptococcus agalactiae 2603V/R] >gi|76788676|ref|YP_330216.1| hypothetical protein SAK_1613 [Streptococcus agalactiae A909] >gi|76799028|ref|ZP_00781223.1| phosphoesterase [Streptococcus agalactiae 18RS21] >gi|22534628|gb|AAN00462.1|AE014264_17 conserved hypothetical protein [Streptococcus agalactiae 2603V/R] >gi|76563733|gb|ABA46317.1| phosphoesterase family protein [Streptococcus agalactiae A909] >gi|76585614|gb|EAO62177.1| phosphoesterase [Streptococcus agalactiae 18RS21] (173 aa)
Score = 127, Expect = 5.2e-06, Identities = 46/151 (30%), Positives = 77/151 (50%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEE--QPDIKIHCGDF-CTDIDLISENFDYFVAGNNDYEG--ERIVDFKIEDLNCRLMHGD--QFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           ++K++++SD+HGDR   + I N    + D   H GD      D I E   + V GN DY+     ++  KI++      HG   Q  ++   +++ +L     A++ + DI   GH H    +     + INPGS++ PR     K YAV+ I  +K+
  S:     3 IRKLVVMSDSHGDRDIVKDIKNHYLGKVDAIFHNGDSELPSSDPIWEGI-HVVTGNCDYDSGYPEVLVTKIDNAVIVQTHGHLHQINFT---WDKLDL----LAQQEDADICLYGHLHRADAWKNGKTIFINPGSVLQPRGPINEKLYAVVTITDSKV 152
>gi|45359064|ref|NP_988621.1| phosphodiesterase [Methanococcus maripaludis S2] >gi|45047939|emb|CAF31057.1| Protein of unknown function UPF0025:Metallo-phosphoesterase:Serine/threonine-specific protein phosphatase [Methanococcus maripaludis S2] (163 aa)
Score = 127, Expect = 5.3e-06, Identities = 57/150 (38%), Positives = 82/150 (54%)
  Q:    10 ILIISDTH-GDRSFFRKIINE-----EQPDIKIHCGDFCT-----DIDLISENFDYFVAGNNDYEG-ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRE-LKLYEYAKENNIDILFSGHTHIEQV----FYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           I IISDTH  +R+  +K+  E        D+ IHCGD  +     D++ ISE     V+GN DY    +  +  IE+    ++HG+Q       + R + LK+     E N DIL SGHTHI  +         IL++NPGS   PR    +K+   L IE  +I +
  S:     3 IGIISDTHIPERA--KKLPKEIFEHFSDVDLIIHCGDVTSESVLNDLEKISELL--VVSGNMDYMNYPKEYEITIENFKIGIIHGNQI------HPRGDTLKMKYLCLEKNWDILISGHTHIPMIKEISLENKKILLLNPGSPTVPRYP--LKTIMKLKIEEREIDA 157
>gi|19705414|ref|NP_602909.1| hypothetical protein FN2124 [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713407|gb|AAL94208.1| Hypothetical protein with Metallo-phosphoesterase motif [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (153 aa)
Score = 127, Expect = 5.6e-06, Identities = 42/128 (32%), Positives = 66/128 (51%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFD----YFVAGNNDYEGERIVD---FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS 134
           MKKIL++SD+H       KI  +E+PDI I  GD   DI+ +S  +     Y V GN D+      +   F+I+ +   L HG  +       +R    + E  K+ N+ ++  GHTH   +    N+ + NPG+
  S:     1 MKKILVLSDSHSYFDKVLKIFEKEKPDIVIGAGDGIKDIEELSYVYPKAKYYMVKGNCDFFDRSHNEENLFEIDGIKVFLTHGHLY-----DVKRTLNSIKEIGKKLNVSLIVFGHTHKPYIEKDGNMTLFNPGA 130
>gi|170017582|ref|YP_001728501.1| phosphoesterase [Leuconostoc citreum KM20] >gi|169804439|gb|ACA83057.1| Predicted phosphoesterase [Leuconostoc citreum KM20] (178 aa)
Score = 127, Expect = 5.7e-06, Identities = 48/146 (32%), Positives = 70/146 (47%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEEQPDIK--IHCGDFCTDIDLISENFD--YFVAGN----NDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQM--KSYAVLHI 152
           M K LI+SDTHGDR     I N  Q ++    + GD  +++      FD    V GN    +D+   R+    I        HG  +             + + AKE    I+  GHTHI+ V   D+ L INPGS+  P+ ++     +YAVL +
  S:     1 MTKFLIVSDTHGDRDILVDIFNHWQSNVAAVFYNGD--SELSANDSVFDGVSTVIGNMDTDDDFVAARVT--TIAGTTFFQTHGHLYNVRSLDSWANLTVMNQLAKEAKAQIVLFGHTHIDGVAMFDDKLFINPGSISLPKGSHIAIGGTYAVLTV 152
>gi|16082027|ref|NP_394449.1| hypothetical protein Ta0989 [Thermoplasma acidophilum DSM 1728] >gi|10640304|emb|CAC12118.1| conserved hypothetical protein [Thermoplasma acidophilum] (231 aa)
Score = 127, Expect = 5.8e-06, Identities = 53/154 (34%), Positives = 86/154 (55%)
  Q:    10 ILIISDTHGDRSFFRKIINEEQPDIKIHCGDFC-------TDIDLISENFDYFVAGNNDYEGERIVD------------FKIEDLNCRLMHGDQFGY--SVP----------------GYERRELK--LYEYAKENNIDILFS----------GHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           +LIISD H +    + +I  E+ D  + CGD           +DL+ EN D  V+GN+DY     VD            F  E++  + +  +   +  S+P                G  R EL   +Y ++ ++++  +            GHTH + +      L+INPGS+  PR+ N M SYAV     N ++   F+
  S:     1 MLIISDAHANIHPLKYVIQREKFDKIVFCGDAVDYGPNPGETLDLLKENADVMVSGNHDYAAAYSVDCRCGEENHELSVFTRENITLKKLGKNDISFLRSLPNRMDMEIDGMKFQVMHGSPRDELYGYMYPWSVQDHLRSMLGSPLDPANYVVGHTHYQFLIRYAGNLVINPGSIGQPRD-NPMPSYAVYDSSRNSVEFPRFD 202
>gi|42783630|ref|NP_980877.1| phosphoesterase, putative [Bacillus cereus ATCC 10987] >gi|42739559|gb|AAS43485.1| phosphoesterase, putative [Bacillus cereus ATCC 10987] (167 aa)
Score = 126, Expect = 6.3e-06, Identities = 48/155 (30%), Positives = 83/155 (53%)
  Q:     9 KILIISDTHGDRSFFRKIIN--EEQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDY---EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEY-AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           K LI+SD+H      +++    E + DI IHCGD  +++    E    F  V GN DY   + E + D  ++ +   ++HG +         +  L+   Y A+E    +   GH+H+      D +L INPGS++ PR   + K++A+L ++ N+++ V FE
  S:     2 KALIVSDSHSSVKELQQLKEKYEGKVDIMIHCGD--SELTPAHEELQGFHVVKGNCDYANFQDEIVTD--VDGVRFIVVHGHRHNV------KMTLQTLAYRAEEVGAQVACFGHSHVLGAELIDGVLFINPGSILLPRQRVE-KTFALLEMDENQME-VRFE 152
>gi|25011687|ref|NP_736082.1| hypothetical protein gbs1647 [Streptococcus agalactiae NEM316] >gi|77414392|ref|ZP_00790547.1| Unknown [Streptococcus agalactiae 515] >gi|24413227|emb|CAD47306.1| Unknown [Streptococcus agalactiae NEM316] >gi|77159582|gb|EAO70738.1| Unknown [Streptococcus agalactiae 515] (173 aa)
Score = 126, Expect = 6.5e-06, Identities = 46/151 (30%), Positives = 77/151 (50%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEE--QPDIKIHCGDF-CTDIDLISENFDYFVAGNNDYEG--ERIVDFKIEDLNCRLMHGD--QFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           ++K++++SD+HGDR   + I N    + D   H GD      D I E   + V GN DY+     ++  KI++      HG   Q  ++   +++ +L     A++ + DI   GH H    +     + INPGS++ PR     K YAV+ I  +K+
  S:     3 IRKLVVMSDSHGDRDIVKDIKNHYLGKVDAIFHNGDSELPSSDPIWEGI-HVVTGNCDYDSGYPEVLVTKIDNTVIVQTHGHLHQINFT---WDKLDL----LAQQEDADICLYGHLHRADAWKNGKTIFINPGSVLQPRGPINEKLYAVVTITDSKV 152
>gi|13542026|ref|NP_111714.1| serine/threonine protein phosphatase [Thermoplasma volcanium GSS1] >gi|14325457|dbj|BAB60361.1| hypothetical protein [Thermoplasma volcanium GSS1] (229 aa)
Score = 126, Expect = 6.6e-06, Identities = 53/149 (35%), Positives = 79/149 (53%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQPDIKIHCGDF-------CTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYS-----VPGYERRELK------------------LYEYAKENN----------------------IDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           K++I SD H +    +++I  E+ DI I  GD           +DL+ EN DY V GN+DY          ED NC     D   +S     +P     +LK                  L  +A  NN                       D++  GHTH  Q+ Y++   IINPGS   PR+ +    YA+   + +++
  S:     2 KVIIYSDIHANLEAMKEVIKREKFDIAIFLGDVVDYGPKPAETLDLVMENMDYGVMGNHDYAAA-----TGEDCNCAPDMHDLSEFSRKEVTLPSLSSEDLKRLSSLKEFVDTEIDGRKILMTHASPNNHLFGYLFATEAEMVWKDKRYSSYDLIMVGHTHF-QMLYRNK--IINPGSAGQPRDGDWRPMYAIWDTDADEV 194
>gi|55820354|ref|YP_138796.1| hypothetical protein stu0257 [Streptococcus thermophilus LMG 18311] >gi|55822244|ref|YP_140685.1| hypothetical protein str0257 [Streptococcus thermophilus CNRZ1066] >gi|116627190|ref|YP_819809.1| hypothetical protein STER_0304 [Streptococcus thermophilus LMD-9] >gi|55736339|gb|AAV59981.1| conserved hypothetical protein [Streptococcus thermophilus LMG 18311] >gi|55738229|gb|AAV61870.1| conserved hypothetical protein [Streptococcus thermophilus CNRZ1066] >gi|116100467|gb|ABJ65613.1| Predicted phosphoesterase [Streptococcus thermophilus LMD-9] (173 aa)
Score = 126, Expect = 6.7e-06, Identities = 48/151 (31%), Positives = 75/151 (49%)
  Q:     8 KKILIISDTHGDRSFFRKIINEEQP--DIKIHCGDF-CTDIDLISENFDYFVAGNNDYEG---ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           + I+++SD+HG+R     I    Q   D   H GD      D + E   + V GN DY+    ER+V  K+ D+     HG  FG +   +++ +L    +A++ + DI   GH H+   +     + INPGS+  PR     K YA + I   KI+
  S:     4 QTIIVMSDSHGERDIVVDIKKRYQGKVDAIFHNGDSELESSDSVWEGI-HVVRGNCDYDSGYPERLV-VKLGDVIIAQTHGHLFGINFT-WDKLDL----WAQQEDADICLYGHLHVAAAWRNGKTVYINPGSISQPRGPIHEKLYAKVIINDAKIR 153
>gi|168708071|ref|ZP_02740348.1| putative phosphoesterase [Clostridium difficile QCD-63q42] (156 aa)
Score = 126, Expect = 6.9e-06, Identities = 53/153 (34%), Positives = 74/153 (48%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFDY---FVAGNNDYEGERIVDFKI-EDLNCRLMHGDQFG--YSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVE 161
           KI I+SDTH       K I   ++ D+ IH GD  TD   I    +     V GN D++           +    L HGD++G  Y     E++       A E + DI+  GHTH      KD +L INPGS   PR  +  KS+ +++IE + IK  E
  S:     2 KIGIVSDTHMMIKNMEKTIPYLKECDLIIHAGDNFTDSRYIHSMTNVGIIAVKGNCDFDAVEEEVVFEVANKTIFLCHGDKYGVKYGTNMLEKK-------ATEVDADIVIFGHTHTPFREIKDGVLYINPGSTSLPRGVS-YKSFVIMNIEEDDIKIEE 153
>gi|77408457|ref|ZP_00785195.1| Unknown [Streptococcus agalactiae COH1] >gi|77172899|gb|EAO76030.1| Unknown [Streptococcus agalactiae COH1] (173 aa)
Score = 126, Expect = 6.9e-06, Identities = 46/151 (30%), Positives = 77/151 (50%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEE--QPDIKIHCGDF-CTDIDLISENFDYFVAGNNDYEG--ERIVDFKIEDLNCRLMHGD--QFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           ++K++++SD+HGDR   + I N    + D   H GD      D I E   + V GN DY+     ++  KI++      HG   Q  ++   +++ +L     A++ + DI   GH H    +     + INPGS++ PR     K YAV+ I  +K+
  S:     3 IRKLVVMSDSHGDRDIVKDIKNHYLGKVDAIFHNGDSELPSSDPIWEGI-HVVTGNCDYDSGYPEVLVTKIDNAVIVQTHGHLHQINFT---WDKLDL----LAQQEDADICLYGHLHRADAWKNGKTIFINPGSVLQPRGPINEKLYAVVTITDSKV 152
>gi|166982187|ref|ZP_02253629.1| phosphoesterase, putative [Bacillus cereus AH187] >gi|168161261|ref|ZP_02596494.1| phosphoesterase, putative [Bacillus cereus H3081.97] (167 aa)
Score = 126, Expect = 7.7e-06, Identities = 48/155 (30%), Positives = 83/155 (53%)
  Q:     9 KILIISDTHGDRSFFRKIIN--EEQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDY---EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEY-AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           K LI+SD+H      +++    E + DI IHCGD  +++    E    F  V GN DY   + E + D  ++ +   ++HG +         +  L+   Y A+E    +   GH+H+      D +L INPGS++ PR   + K++A+L ++ N+++ V FE
  S:     2 KALIVSDSHSSVKELQQLKEKYEGKVDIMIHCGD--SELTPAHEELQGFHVVKGNCDYANFQDEIVTD--VDGVRFIVVHGHRHNV------KMTLQTLAYHAEEVGAQVACFGHSHVLGAELIDGVLFINPGSILLPRQRVE-KTFALLEMDENQME-VRFE 152
>gi|169824902|ref|YP_001692513.1| putative phosphoesterase [Finegoldia magna ATCC 29328] >gi|167831707|dbj|BAG08623.1| putative phosphoesterase [Finegoldia magna ATCC 29328] (180 aa)
Score = 125, Expect = 8.9e-06, Identities = 48/158 (30%), Positives = 86/158 (54%)
  Q:     9 KILIISDTHGDRSFFRKIIN-EEQPDIKIHCGDFC--------------TDIDLISENFD--YFVAGNNDYEGER-IVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDVV 166
           KI +ISDTHG     +K +   +  D  +H GD                 D+ +I ++ D   +  GN D + ++ +++  +   +  L  G    +++ GYE  E      A  NN DI+ +GHTH++ +  KD ++++NPGS   P++   +KS A++  +  K+  V+   VV
  S:     2 KIGVISDTHGSLDNTKKALEILKDCDTILHLGDVLYHGPRNALPEDYNPKDLAVIFKSMDNVIYTRGNCDSDVDQMVIEHDLTQKHRILNLGKYRIFTIHGYEEDEDNRIRIANANNCDIVITGHTHVKVLEEKDGVILLNPGSPSIPKDG--VKSIAIIDEDEIKLIDVDSNKVV 175
>gi|81428021|ref|YP_395020.1| putative phosphoesterase [Lactobacillus sakei subsp. sakei 23K] >gi|78609662|emb|CAI54708.1| Putative phosphoesterase [Lactobacillus sakei subsp. sakei 23K] (173 aa)
Score = 125, Expect = 9.2e-06, Identities = 43/144 (29%), Positives = 74/144 (51%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQPDIK--IHCGDF-CTDIDLISENFDYFVAGNNDYEG---ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQM--KSYAVLHI 152
           +++++SD+HGDR    +++   + ++   +HCGD   T  D + +     V GN D+ G   E++V   +      L HG  +G +   ++   L L   A+     + F GHTH         +L++NPGS+  PR   Q    +YAV+ I
  S:     2 RLVVVSDSHGDRDILVQLVAHYKDEVVTFLHCGDSELTTTDSLFQQMT-VVQGNMDFNGHFPEQVV-VPVGAQKAFLTHGHLYGVN---FDLTRLMLA--AQAEGAQLAFYGHTHQLACEMHQGLLVLNPGSISQPRGQFQPLGGTYAVVDI 146
>gi|148381205|ref|YP_001255746.1| phosphodiesterase [Clostridium botulinum A str. ATCC 3502] >gi|148290689|emb|CAL84819.1| putative phosphoesterase [Clostridium botulinum A str. ATCC 3502] (116 aa)
Score = 124, Expect = 1.1e-05, Identities = 37/102 (36%), Positives = 56/102 (54%)
  Q:    56 VAGNNDYEGERIVDFKIEDLNCR---LMHGDQFG--YSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           V GN D+  E   +  IE++  +   + HG+++   Y +     R L+L         DI   GHTH+ Q+ Y D I  INPGS   PRN   ++S A++ IEG+K+
  S:    13 VRGNCDFSKETPSEL-IENIGGKRFFITHGNRYDVKYDLAKLRYRALEL-------EADIALFGHTHVSQIEYIDGIWFINPGSPTLPRNG--VRSVAIIGIEGDKV 109
>gi|126700926|ref|YP_001089823.1| putative phosphoesterase [Clostridium difficile 630] >gi|145953827|ref|ZP_01802835.1| hypothetical protein CdifQ_04003842 [Clostridium difficile QCD-32g58] >gi|168697576|ref|ZP_02729853.1| putative phosphoesterase [Clostridium difficile QCD-37x79] >gi|168724266|ref|ZP_02756543.1| putative phosphoesterase [Clostridium difficile QCD-76w55] >gi|168731606|ref|ZP_02763883.1| putative phosphoesterase [Clostridium difficile QCD-97b34] >gi|196124856|ref|ZP_03116605.1| putative phosphoesterase [Clostridium difficile ATCC 43255] >gi|196160497|ref|ZP_03121058.1| putative phosphoesterase [Clostridium difficile CIP 107932] >gi|115252363|emb|CAJ70204.1| putative phosphoesterase [Clostridium difficile 630] (156 aa)
Score = 124, Expect = 1.1e-05, Identities = 53/153 (34%), Positives = 73/153 (47%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFDY---FVAGNNDYEGERIVDFKI-EDLNCRLMHGDQFG--YSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVE 161
           KI I+SDTH       K I   ++ D+ IH GD  TD   I    +     V GN D++           +    L HGD++G  Y     E++       A E + DI+  GHTH      KD +L INPGS   PR  +  KS+ ++ IE + IK  E
  S:     2 KIGIVSDTHMMIKNMEKTIPYLKECDLIIHAGDNFTDSRYIHSMTNVGIIAVKGNCDFDAVEEEVVFEVANKTIFLCHGDKYGVKYGTNMLEKK-------ATEVDADIVIFGHTHTPFREIKDGVLYINPGSTSLPRGVS-YKSFVIMDIEEDDIKIEE 153
>gi|196165798|ref|ZP_03126329.1| phosphodiesterase [Clostridium difficile QCD-23m63] (189 aa)
Score = 124, Expect = 1.1e-05, Identities = 46/144 (31%), Positives = 80/144 (55%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGD--FCTDIDLISENFD--------------YFVAGNNDYEGER-IVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI 152
           KI I+SDTHG   +F K +N     D+ +H GD  +    + I E ++                V GN D + ++ +++  I+        G+       GY   E ++ + AK+   DIL  GHTH+++++  DN+++INPGS   P++ +   S A++ I
  S:     2 KIGIMSDTHGSLLYFEKALNVLSDCDVLLHGGDVLYHGPRNDIPEGYNPKKFIETLNKLENIVIVKGNCDADVDQMVIEHPIQSPYVMSQFGEIRIILNHGYTESEEEIIDKAKKMGGDILVLGHTHVKKLYMDDNLIVINPGSTSIPKDGSH--SVAIIDI 161
>gi|182419476|ref|ZP_02950728.1| Ser/Thr protein phosphatase family protein [Clostridium butyricum 5521] >gi|182376807|gb|EDT74379.1| Ser/Thr protein phosphatase family protein [Clostridium butyricum 5521] (161 aa)
Score = 124, Expect = 1.1e-05, Identities = 40/130 (30%), Positives = 68/130 (52%)
  Q:     9 KILIISDTHGDRSFF---RKIINEEQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVDFKIEDLNCRLM--HGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYP 138
           +I +ISDTH    +    + +I +   DI IH GD   D+D ++  F    Y VAGN D+  +   +  IE    ++   HGD +G      +     +Y   +E   +I+  GHTH + +   + ++++NPGS+  P
  S:     2 RIAVISDTHRADKYINLAKSLIKD--ADILIHLGDNIEDVDKLANGFKGKVYAVAGNCDFSSKYPKEGMIEVNGVKIFYTHGDLYGV-----KSSVTSIYYRGRELQANIVLFGHTHQQLIEKTEEVILMNPGSISLP 132
>gi|81177087|ref|ZP_00875981.1| Protein of unknown function UPF0025 [Streptococcus suis 89/1591] >gi|80976218|gb|EAP39851.1| Protein of unknown function UPF0025 [Streptococcus suis 89/1591] (175 aa)
Score = 124, Expect = 1.2e-05, Identities = 46/145 (31%), Positives = 76/145 (52%)
  Q:     8 KKILIISDTHGDRSFFRKIINEE--QPDIKIHCGDFCTDIDLISENFD--YFVAGNNDYEG---ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI 152
           K IL++SD+HGDR     I +    + D   H GD  +++D     +D    V GN DY G   ++++  ++ D+     HG  +G +  G++R    L  +A+E + DI   GH H+     +   L +NPGS+  PR   +   YA++ I
  S:     6 KTILVMSDSHGDRQIVEDIKHHYLGKVDAIFHNGD--SELDSQDSLWDGIQVVNGNCDYFGGYPDQLIT-QLGDVTIAQTHGHLYGINY-GWQR----LDYWAQEVDADICLYGHLHVPDAEVRGKTLFLNPGSVSQPRGLVRECLYALVTI 149
>gi|156089231|ref|XP_001612022.1| vacuolar protein sorting 29, putative [Babesia bovis] >gi|154799276|gb|EDO08454.1| vacuolar protein sorting 29, putative [Babesia bovis] (215 aa)
Score = 124, Expect = 1.3e-05, Identities = 26/79 (32%), Positives = 46/79 (58%)
  Q:    86 GYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS---LMYPRNANQMKSYAVLHIEGNKIKSVEFED 164
           GY +P +  +   +YEYAK  ++D+L  GHTHI  V      +++NPGS      P   N + ++ ++ ++G+KI    +E+
  S:    96 GYQLPSWGDKN-AVYEYAKNRDVDVLVYGHTHISDVSKISGKILVNPGSATGAFQPWAPNAIPTFMLMAVQGSKIVIYVYEE 176
>gi|116494344|ref|YP_806078.1| phosphoesterase [Lactobacillus casei ATCC 334] >gi|116104494|gb|ABJ69636.1| Predicted phosphoesterase [Lactobacillus casei ATCC 334] (174 aa)
Score = 124, Expect = 1.3e-05, Identities = 46/149 (30%), Positives = 78/149 (52%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISEN--FDYF--VAGNNDYEGE--RIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRN--ANQMKSYAVLHIEGNKI 157
           KIL +SDTHGDR     ++ ++QP +  +   +  D +L +++  F  +  V GN DY+      +   I+ +   + HG +FG +  G +    KL    +  + D++  GHTH   V     I+I+NPGS+  PR   AN   +YA +    + +
  S:     2 KILAVSDTHGDREILTALL-KQQPHLDGYF--YAGDSELAADDGLFQQYEAVEGNMDYDPNFPMQITTTIQGVTVFMAHGHRFGVNF-GLD----KLIAAGEGVHADLIIFGHTHQLGVEEHAGIVILNPGSISQPRGQFANLGGTYATVEFTADNV 150
>gi|168135578|ref|ZP_02578807.1| putative phosphoesterase [Bacillus cereus B4264] (167 aa)
Score = 124, Expect = 1.4e-05, Identities = 47/155 (30%), Positives = 83/155 (53%)
  Q:     9 KILIISDTHGDRSFFRKIIN--EEQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDY---EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEY-AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           K LI+SD+H      +++    E + DI IHCGD  +++    E    F  V GN DY   + E + D  ++ +   ++HG +         +  L+   Y A+E    +   GH+H+      + +L INPGS++ PR   + K++A+L ++ N+++ V FE
  S:     2 KALIVSDSHSSVKELQQLKEKYEGKVDIMIHCGD--SELTSAHEELQGFHVVKGNCDYANFQDEIVTD--VDGIRFLVVHGHRHNV------KMTLQTLAYHAEEVGAQVACFGHSHVLGAELIEGVLFINPGSILLPRQRVE-KTFALLEMDENQME-VRFE 152
>gi|125718582|ref|YP_001035715.1| hypothetical protein SSA_1782 [Streptococcus sanguinis SK36] >gi|125498499|gb|ABN45165.1| Conserved hypothetical protein [Streptococcus sanguinis SK36] (173 aa)
Score = 123, Expect = 1.6e-05, Identities = 50/151 (33%), Positives = 77/151 (50%)
  Q:     8 KKILIISDTHGDRSFFRKIINEE--QPDIKIHCGDFCTDIDLISENFDYFVAGNND-YEG--ERIVDFKIEDLNCRLM---HGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           + I+++SD+HGDR+   +I N    + D   H GD     D         VAGN D Y+G  ER+V     DL   ++   HG  F  +   +++ +L    +A+E N DI   GH HI     +   L +NPGS+  PR     + YA + I+ ++ K
  S:     4 QTIIVMSDSHGDRAIVEEIRNHYIGKIDAIFHNGDSELPSDDEVWQGIQVVAGNMDFYDGYPERLV----TDLAGTIIAQTHGHLFHINF-SFQKLDL----WAQEVNADICLYGHLHIPDARMEGKTLFLNPGSISQPRGLINERLYAKVEIDDDRFK 153
>gi|191637676|ref|YP_001986842.1| Predicted phosphoesterase [Lactobacillus casei] >gi|190711978|emb|CAQ65984.1| Predicted phosphoesterase [Lactobacillus casei BL23] (174 aa)
Score = 123, Expect = 1.7e-05, Identities = 45/149 (30%), Positives = 78/149 (52%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISEN--FDYF--VAGNNDYEGE--RIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRN--ANQMKSYAVLHIEGNKI 157
           K+L +SDTHGDR     ++ ++QP +  +   +  D +L +++  F  +  V GN DY+      +   I+ +   + HG +FG +  G +    KL    +  + D++  GHTH   V     I+I+NPGS+  PR   AN   +YA +    + +
  S:     2 KVLAVSDTHGDREILTALL-KQQPHLDGYF--YAGDSELAADDGLFQQYEAVEGNMDYDPNFPMQITTTIQGVTVFMAHGHRFGVNF-GLD----KLIAAGEGVHADLIIFGHTHQLGVEEHAGIVILNPGSISQPRGQFANLGGTYATVEFTADNV 150
>gi|9651776|gb|AAF91268.1|AF230199_10 conserved hypothetical protein [Methanococcus maripaludis] (163 aa)
Score = 122, Expect = 1.9e-05, Identities = 56/150 (37%), Positives = 84/150 (56%)
  Q:    10 ILIISDTH-GDRSFFRKIINE-----EQPDIKIHCGDFCTD-----IDLISENFDYFVAGNNDYEG-ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRE-LKLYEYAKENNIDILFSGHTHIEQV--FYKDN--ILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           I IISDTH  +R+  +K+  E        D+ IHCGD  ++     +  ISE     V+GN DY    +  +  IE+    ++HG+Q       + R + LK+     E N D+L SGHTH+  +   + +N  IL++NPGS   PR    +K+   L IE  KI +
  S:     3 IGIISDTHIPERA--KKLPKEIFEHFSDVDLIIHCGDVTSESVLNELKKISEIL--VVSGNMDYMNYPKEHELNIENFKIGIIHGNQI------HPRGDTLKMKYLCLEKNWDVLISGHTHVPMIKELHAENKKILLLNPGSPTVPRYP--LKTIMKLKIEERKIDA 157
>gi|126698632|ref|YP_001087529.1| phosphodiesterase [Clostridium difficile 630] >gi|145954756|ref|ZP_01803760.1| hypothetical protein CdifQ_04001151 [Clostridium difficile QCD-32g58] >gi|168693816|ref|ZP_02726093.1| phosphodiesterase [Clostridium difficile QCD-37x79] >gi|168715049|ref|ZP_02747326.1| phosphodiesterase [Clostridium difficile QCD-63q42] >gi|168724129|ref|ZP_02756406.1| phosphodiesterase [Clostridium difficile QCD-76w55] >gi|168732281|ref|ZP_02764558.1| phosphodiesterase [Clostridium difficile QCD-97b34] >gi|196162153|ref|ZP_03122714.1| phosphodiesterase [Clostridium difficile CIP 107932] >gi|115250069|emb|CAJ67889.1| putative phosphoesterase [Clostridium difficile 630] (189 aa)
Score = 122, Expect = 2.2e-05, Identities = 46/144 (31%), Positives = 80/144 (55%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGD--FCTDIDLISENFD--------------YFVAGNNDYEGER-IVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI 152
           KI I+SDTHG   +F K +N     D+ +H GD  +    + I E ++                V GN D + ++ +++  I+        G+       GY   E ++ + AK+   DIL  GHTH+++++  DN+++INPGS   P++ +   S A++ I
  S:     2 KIGIMSDTHGSLLYFEKALNVLSDCDVLLHGGDVLYHGPRNDIPEGYNPKKFIETLNKLENIVIVKGNCDADVDQMVIEHPIQSPYVMSQFGEIRIILNHGYIESEEEIIDKAKKMGGDILVLGHTHVKKLYMDDNLIVINPGSTSIPKDGSH--SVAIIDI 161
>gi|169335160|ref|ZP_02862353.1| hypothetical protein ANASTE_01567 [Anaerofustis stercorihominis DSM 17244] >gi|169257898|gb|EDS71864.1| hypothetical protein ANASTE_01567 [Anaerofustis stercorihominis DSM 17244] (159 aa)
Score = 121, Expect = 2.6e-05, Identities = 51/147 (34%), Positives = 75/147 (51%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEEQP-DIKIHCGDFCTDIDLISENFDYF----VAGNNDY--EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           M KILIISDTHGD     KII +E+     IH GD   D+D +  +++      V GN D+  E E +V F +      + HG  +     G +     ++  A E   DI+  GHTH        +I + NPGSL   R+  ++ SY ++ I+
  S:     1 MDKILIISDTHGDIKTLEKIIKKEKNYSYIIHLGDHHFDLDEVDIDYENVNVLRVRGNCDFMKEKEDLV-FTLHGKKIFMTHGHYY-----GVKNSFTNIFYKADEIGADIVLFGHTHEALNEKISDIHLFNPGSLSSMRSFGKI-SYGIMTID 147
>gi|159905556|ref|YP_001549218.1| phosphodiesterase [Methanococcus maripaludis C6] >gi|159887049|gb|ABX01986.1| phosphodiesterase, MJ0936 family [Methanococcus maripaludis C6] (163 aa)
Score = 121, Expect = 2.6e-05, Identities = 58/150 (38%), Positives = 80/150 (53%)
  Q:    10 ILIISDTHGDRSFFR--KIINEEQPDIK--IHCGDFCT-----DIDLISENFDYFVAGNND---YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRE-LKLYEYAKENNIDILFSGHTHIEQV----FYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           I +ISDTH      +  K I E   D+   IHCGD  +     D++ ISE     V+GN D   Y  E+  +  IE+    ++HG+Q       + R + LK+     E N DIL SGHTHI  +         IL++NPGS   PR    +K+   L IE  KI +
  S:     3 IGLISDTHIPERAKKLPKEIFEHFSDVNLIIHCGDVTSESVLNDLEKISEIL--VVSGNMDVMNYPKEQ--ELVIENFKIGIIHGNQI------HPRGDTLKMKYLCIEKNWDILISGHTHIPMIKEINVENKKILLLNPGSPTVPRYP--LKTIMKLKIEDKKIDA 157
>gi|167936672|ref|ZP_02523747.1| putative phosphoesterase [Bacillus cereus AH1134] (167 aa)
Score = 121, Expect = 2.9e-05, Identities = 46/155 (29%), Positives = 83/155 (53%)
  Q:     9 KILIISDTHGDRSFFRKIIN--EEQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDY---EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEY-AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           K LI+SD+H      +++    E + DI IHCGD  +++    E    F  V GN DY   + E + D  ++ +   ++HG +         +  L+   Y A+E    +   GH+H+      + +L INPGS++ PR   + K++++L ++ N+++ V FE
  S:     2 KALIVSDSHSSVKELQQLKEKYEGKVDIMIHCGD--SELTPAHEELQGFRVVKGNCDYANFQDEIVTD--VDGIRFLVVHGHRHNV------KMTLQTLAYHAEEVGAQVACFGHSHVLGAELIEGVLFINPGSILLPRQRVE-KTFSLLEMDENQME-VRFE 152
>gi|150402669|ref|YP_001329963.1| phosphodiesterase [Methanococcus maripaludis C7] >gi|150033699|gb|ABR65812.1| phosphodiesterase, MJ0936 family [Methanococcus maripaludis C7] (163 aa)
Score = 121, Expect = 3.0e-05, Identities = 57/150 (38%), Positives = 83/150 (55%)
  Q:    10 ILIISDTH-GDRSFFRKIINE-----EQPDIKIHCGDFCT-----DIDLISENFDYFVAGNND---YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRE-LKLYEYAKENNIDILFSGHTHI----EQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           I +ISDTH  +R+  +K+  E        D+ IHCGD  +     D++ IS+     V+GN D   Y  ER  +  IE+    ++HG+Q       + R + LK+     E N DIL SGHTH+    E       IL++NPGS   PR    +K+   L IE  K+ +
  S:     3 IGLISDTHIPERA--KKLPKEIFEHFSDVDLIIHCGDVTSESVLKDLEKISK--ISVVSGNMDSMNYPKER--ELIIENFKIGIIHGNQI------HPRGDTLKMKYLCLEKNWDILISGHTHVPMIKEITVENKKILLLNPGSPTVPRYP--LKTIMKLKIEDKKVDA 157
>gi|146319358|ref|YP_001199070.1| phosphoesterase [Streptococcus suis 05ZYH33] >gi|146321563|ref|YP_001201274.1| phosphoesterase [Streptococcus suis 98HAH33] >gi|145690164|gb|ABP90670.1| Predicted phosphoesterase [Streptococcus suis 05ZYH33] >gi|145692369|gb|ABP92874.1| Predicted phosphoesterase [Streptococcus suis 98HAH33] (175 aa)
Score = 120, Expect = 3.2e-05, Identities = 45/145 (31%), Positives = 76/145 (52%)
  Q:     8 KKILIISDTHGDRSFFRKIINEE--QPDIKIHCGDFCTDIDLISENFD--YFVAGNNDYEG---ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI 152
           K IL++SD+HGDR     I +    + D   H GD  +++D     +D    V GN DY G   ++++  +++ +     HG  +G +  G++R    L  +A+E + DI   GH H+     +   L +NPGS+  PR   +   YA++ I
  S:     6 KTILVMSDSHGDRQIVEDIKHHYLGKVDAIFHNGD--SELDSQDSLWDGIQVVNGNCDYFGGYPDQLIT-QLDGVTIAQTHGHLYGINY-GWQR----LDYWAQEVDADICLYGHLHVPDAEVRGKTLFLNPGSVSQPRGLVRECLYALVTI 149
>gi|50913677|ref|YP_059649.1| putative phosphoesterase [Streptococcus pyogenes MGAS10394] >gi|50902751|gb|AAT86466.1| putative phosphoesterase [Streptococcus pyogenes MGAS10394] (173 aa)
Score = 120, Expect = 3.2e-05, Identities = 52/163 (31%), Positives = 76/163 (46%)
  Q:     8 KKILIISDTHGDRSFFRKIINEE--QPDIKIHCGDF-CTDIDLISENFDYFVAGNNDYEG---ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF-EDVVKYPA 170
           K I+++SD+HGDR   + I ++   Q D   H GD      D I     Y V GN DY+    +R+V  ++  +     HG  +  +         KL  +A+E   DI   GH H    +    IL +NPGS+  PR     K YA + +   +IK   F  D   YP+
  S:     4 KTIIVMSDSHGDRDIVQAIKDKYLGQVDAIFHNGDSELNSSDPIWAGI-YVVGGNCDYDTGYPDRLVT-QLGTVTIAQTHGHLYHINFTWD-----KLDYFAQEVAADICLYGHLHRPAAWQVGQILFMNPGSVTQPRGEINEKLYARVELTDTQIKVDYFTRDHKLYPS 166
>gi|196165108|ref|ZP_03125639.1| putative phosphoesterase [Clostridium difficile QCD-23m63] (156 aa)
Score = 120, Expect = 3.7e-05, Identities = 50/149 (33%), Positives = 70/149 (46%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFDY---FVAGNNDYEGERIVDFKI-EDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           KI I+SDTH       K I   ++ D+ IH GD  TD   I    +     V GN D++           +    L HGD++G     +      L + A E + DI+  GHTH      KD +L INPGS   PR  +  KS+ ++ IE + I
  S:     2 KIGIVSDTHMMIKNMEKTIPYLKECDLIIHAGDNFTDSRYIHSMTNVGIIAVKGNCDFDAVEEEVVFEVANKTIFLCHGDKYGVKYGTH-----MLEKKATEIDADIVIFGHTHTPFREIKDGVLYINPGSTSLPRGVS-YKSFVIMDIEEDNI 149
>gi|116753507|ref|YP_842625.1| phosphodiesterase [Methanosaeta thermophila PT] >gi|116664958|gb|ABK13985.1| phosphodiesterase, MJ0936 family [Methanosaeta thermophila PT] (179 aa)
Score = 120, Expect = 3.7e-05, Identities = 49/148 (33%), Positives = 75/148 (50%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQPDIKIHCGDFC-----TDIDLISENFDYFVAGNNDYEGER-----IVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKD-NILIINPGSLMYPRNANQMKSYAVLHIEGNK 156
           KIL+ISDTH DR     +      D+ +H GD       TD+  + E   + VAGN+D+   R      +   IE L   ++H        PG       +   A+E ++D+L  GH H + VF +D + +++ PGS   PR +    S A L +EG +
  S:     2 KILLISDTHLDRISEELLKTLSGYDMILHAGDLVSMEVYTDLKTLGET--HAVAGNSDHPDVRRSLPERLKLDIEGLRVGIIHRPSHSPDSPG-------ISLMAREMDVDLLVFGHFH-KPVFERDGSRMMVCPGSPTCPRLSP--PSVAELLVEGGR 148
>gi|160943465|ref|ZP_02090698.1| hypothetical protein FAEPRAM212_00955 [Faecalibacterium prausnitzii M21/2] >gi|158445144|gb|EDP22147.1| hypothetical protein FAEPRAM212_00955 [Faecalibacterium prausnitzii M21/2] (163 aa)
Score = 120, Expect = 3.8e-05, Identities = 47/161 (29%), Positives = 77/161 (47%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEEQPDIK--IHCGDFCTDIDLISENFD----YFVAGNNDYEGERIVD--FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDVVK 167
           M K+L++SD+HG R   ++I+N+EQ ++   I  GD   D++     F     Y VAGN DY     +D     +       HG  +G     Y+   L     A+   + +   GH+HI     + N+ + NPGS    R      +Y +L +E   + + E ++V K
  S:     1 MTKLLVLSDSHGARDAIKRILNKEQNNVDAVIFLGDGLRDLEQALAFFPHLRVYSVAGNCDYGALEPLDGLAGFDQTVVFYTHGHMYGVK---YDLDTLADAAAARGAEVALF--GHSHIPHAEQRGNVFLFNPGSC--GRCYTGPDTYGLLTLENGAVTAYEHKEVPK 162
>gi|168702584|ref|ZP_02734861.1| phosphodiesterase, MJ0936 family protein [Gemmata obscuriglobus UQM 2246] (203 aa)
Score = 120, Expect = 4.0e-05, Identities = 46/152 (30%), Positives = 79/152 (51%)
  Q:     9 KILIISDTHGDRSFFR---KIINEEQPDIKIHCGDFCT--DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPG---------YERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSV 160
           +I ++SDTH  +       +++ E++ ++ +HCGD  +   + +      +FV GN D +  R+    I+D+     H D FG    G         +ER +L+  E A  +  D +F GHTH+ +       L+ NPG+L     AN  K+  VL +   +IK +
  S:     2 RIGVVSDTHDRQEAVAEAVRLLMEQEVELILHCGDIESPDTVRVFRPVPTHFVFGNWDKDKNRLAT-AIKDVGG--THYDSFGALTLGDKRIAWVHSHERHQLRQLENA--DFFDYVFYGHTHVREQHRTGRTLVANPGALF---RANP-KTCIVLDVATGEIKPI 158
>gi|145619454|ref|ZP_01775503.1| phosphodiesterase, MJ0936 family [Geobacter bemidjiensis Bem] >gi|144944191|gb|EDJ79267.1| phosphodiesterase, MJ0936 family [Geobacter bemidjiensis Bem] >gi|197088844|gb|ACH40115.1| phosphodiesterase, MJ0936 family [Geobacter bemidjiensis Bem] (154 aa)
Score = 119, Expect = 4.3e-05, Identities = 44/146 (30%), Positives = 71/146 (48%)
  Q:     9 KILIISDTHGDRSF-FRKIINEEQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVDFKIEDLNCRLM--HGDQFGYSVPGYERRELKLYEY---AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEG 154
           ++L+ISD+HG+ +  FR        D  IH GD   D  ++ E      + VAGN D++     +  +E   CR++  HG++        ER +  L E      E    ++  GHTH+  V     +L++NPG    P       S+A++ I G
  S:     2 RLLVISDSHGNYAHAFRAHQMAGDVDGIIHLGDGSEDARMLEEVLGVTVHKVAGNCDFDRGLPAELTLELGECRILATHGNR--------ERVKSGLKELIGKGIEAKASVVLYGHTHLPAVEAAQGMLLVNPG----PLKEGLAGSFAIVTIHG 144
>gi|20094241|ref|NP_614088.1| diadenosine tetraphosphatase [Methanopyrus kandleri AV19] >gi|19887272|gb|AAM02018.1| Diadenosine tetraphosphatase [Methanopyrus kandleri AV19] (232 aa)
Score = 119, Expect = 4.3e-05, Identities = 44/151 (29%), Positives = 81/151 (53%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFC-------TDIDLISENFDYFVAGNNDYE-------------------GERIVD---------------FKIEDLNCRLMHGDQ----FGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           +I +ISD H +    ++++ E    D+ + CGD           +D++ E  D  V GN+DY                      R +D               F++E ++  L+HG      + Y  P   R+ L+  +   +   D+L  GHTH+      +   ++NPGS+  PR+ +   ++ +L +   +I S
  S:     4 EIAVISDVHSNLEALKRVLREVRSADMLVCCGDIVGYGPRPVECVDIVREWCDRCVMGNHDYGVVTGDVAYFNIAARIAVEWTRRQLDEDRREFLAKLPKTERFEVEGVSIFLVHGSPRDPIWEYVFPHTPRQLLE--KLVDKAGTDVLIMGHTHVPMYDEVNGSYVLNPGSVGQPRDGDPRAAFGILEVSNGRIVS 198
>gi|24380090|ref|NP_722045.1| hypothetical protein SMU.1716c [Streptococcus mutans UA159] >gi|24378085|gb|AAN59351.1|AE015000_9 conserved hypothetical protein [Streptococcus mutans UA159] (172 aa)
Score = 118, Expect = 5.8e-05, Identities = 47/150 (31%), Positives = 73/150 (48%)
  Q:     8 KKILIISDTHGDRSFFRKIINEE--QPDIKIHCGDFCTDI-DLISENFDYFVAGN---NDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           + ++I+SD+HGD+   ++I N    + D   H GD    + D I E   + V GN    DY    + +F   +L     HG  F  +  G+ER +L    +A+E + DI   GH H   V+     + INPGS+  PR       YA + +  + I
  S:     4 RTLIIMSDSHGDQQIVQEIKNRYLGKVDAIFHNGDSELSVNDPIWEGI-HVVCGNCDFGDYPDCLVTNFP--ELLVAQTHGHLFNINF-GFERLDL----WAQEEDADICTYGHLHRPAVWKNGKTVFINPGSISQPRGEINECLYAKVRVNADTI 151
>gi|55379345|ref|YP_137195.1| phosphoesterase [Haloarcula marismortui ATCC 43049] >gi|55232070|gb|AAV47489.1| phosphoesterase [Haloarcula marismortui ATCC 43049] (185 aa)
Score = 118, Expect = 5.8e-05, Identities = 43/127 (33%), Positives = 60/127 (47%)
  Q:    13 ISDTHGD---RSFFRKIINEEQPDIKIHCGDFCTD--IDLISENFDYF--VAGNNDYEGER-----IVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPR 139
           ISDTHG    R   R +    + D  +H GDF T+  +D I    D    V GNND    R     +     E+L   ++HG         +E  E  L   A++ N DI+  GH+H   +       ++NPGS   PR
  S:    21 ISDTHGTDNHRLTGRTLDAVREADHVLHAGDFMTEQVLDAIDAESDELTGVVGNNDRPAVRARLSDVATVSWEELTIVVVHG---------HEHTETALGMLARQENADIVVVGHSHKPVLTDFGGWTLVNPGSYADPR 150
>gi|134045122|ref|YP_001096608.1| phosphodiesterase [Methanococcus maripaludis C5] >gi|132662747|gb|ABO34393.1| phosphodiesterase, MJ0936 family [Methanococcus maripaludis C5] (163 aa)
Score = 118, Expect = 6.1e-05, Identities = 56/150 (37%), Positives = 82/150 (54%)
  Q:    10 ILIISDTH-GDRSFFRKIINE-----EQPDIKIHCGDFCT-----DIDLISENFDYFVAGNND---YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRE-LKLYEYAKENNIDILFSGHTHIEQV----FYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           I +ISDTH  +R+  +K+  E        D+ IHCGD  +     D+  ISE     V+GN D   Y  E  ++  IE+    ++HG+Q       + R + LK+     E N DIL SGHTH  ++         IL++NPGS   PR    +K+   L IE  K+ +
  S:     3 IGLISDTHIPERA--KKLPKEIFEHFSDVDLIIHCGDVTSESVLNDLKKISELL--VVSGNMDCMNYPKE--LEVVIENFKIGIIHGNQI------HPRGDTLKMKYLCLEKNWDILISGHTHTPRIKEITVENKKILLLNPGSPTVPRYP--LKTIMKLKIEEKKVNA 157
>gi|89098917|ref|ZP_01171797.1| YsnB [Bacillus sp. NRRL B-14911] >gi|89086321|gb|EAR65442.1| YsnB [Bacillus sp. NRRL B-14911] (174 aa)
Score = 118, Expect = 6.2e-05, Identities = 45/152 (29%), Positives = 75/152 (49%)
  Q:     7 MKKILIISDTHGDRSFFRKIINE--EQPDIKIHCGDFCTDIDLISENFDYF--VAGNNDYEG---ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           M +ILI+SD+HG      ++     ++ D  IHCGD  +++     +   F  V GN DY+    +++V   +  L   + HG  +G      +   +KL    +E   DI+  GH+H       D  L +NPGSL  PR   + ++Y +L     +I+
  S:     1 MARILIVSDSHGLEEELAQLAERHGKEADFMIHCGD--SELPAGHPSMSGFAGVRGNCDYDDAYPDQLVK-NLGGLTILVTHGHLYGV-----KSSLMKLKYKGEEEGADIICFGHSHELGAEMIDGRLFLNPGSLRLPRGRYE-RTYLLLETAEREIR 150
>gi|84489179|ref|YP_447411.1| phosphoesterase [Methanosphaera stadtmanae DSM 3091] >gi|84372498|gb|ABC56768.1| predicted phosphoesterase [Methanosphaera stadtmanae DSM 3091] (173 aa)
Score = 118, Expect = 6.4e-05, Identities = 33/82 (40%), Positives = 44/82 (53%)
  Q:    58 GNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPR 139
           G N+YE        I++L   L HG  +       +  E +LY  AKE N+DIL SGHTH   +   D+IL++NPGS   PR
  S:    65 GLNEYE-----ILSIDNLTIGLTHGVVYP------KGDEQQLYYKAKELNVDILISGHTHQALIKQIDDILLLNPGSPTQPR 135
>gi|158320140|ref|YP_001512647.1| phosphodiesterase [Alkaliphilus oremlandii OhILAs] >gi|158140339|gb|ABW18651.1| phosphodiesterase, MJ0936 family [Alkaliphilus oremlandii OhILAs] (238 aa)
Score = 117, Expect = 7.4e-05, Identities = 35/106 (33%), Positives = 54/106 (50%)
  Q:    47 LISENFDYFVAGNNDYEGERIVDFKIEDLNCRL-------MHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI 152
           L S+N   +   N   E + I+    E L C          HG     +   Y+ ++ +L E  +E N DIL  GHTH+  + +  N LIINPGS+  P++ +   SY +L +
  S:    85 LQSQNSLRWTEENTKEENKIILRQLPEQLECNFNGKVISAYHGSPSSITEYIYDNQQDRLQEVIEELNTDILLLGHTHLPFIKWIGNKLIINPGSVGKPKDGDNRASYVLLEL 197
>gi|51891483|ref|YP_074174.1| putative phosphoesterase [Symbiobacterium thermophilum IAM 14863] >gi|51855172|dbj|BAD39330.1| putative phosphoesterase [Symbiobacterium thermophilum IAM 14863] (164 aa)
Score = 117, Expect = 8.0e-05, Identities = 48/153 (31%), Positives = 72/153 (47%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEEQP---DIKIHCGDFCTDIDLISENFDY------FVAGNNDYEGERIVDFKIEDLNCR--LMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           M ++ ++SD+H  R F +      Q    D  +H GD  TD   I+E           VAGN D+      +  +E    R  L+HG Q G    G +R    L   A+E    +   GH+HI  +     +L++NPGSL  PR      S AVL +    +++
  S:     1 MLRVGVVSDSH--RRFGKVASMRAQCGRLDWLLHAGDHLTDAPRIAEAVGVEPDRVRAVAGNCDFPETEPAELLLELAGVRILLVHGHQHGVKT-GPQR----LLYRAQEVGARVAVFGHSHIPFLEDVGGVLLLNPGSLSMPRRPQDPPSCAVLELVDGAVRA 157
>gi|150399561|ref|YP_001323328.1| phosphodiesterase [Methanococcus vannielii SB] >gi|150012264|gb|ABR54716.1| phosphodiesterase, MJ0936 family [Methanococcus vannielii SB] (164 aa)
Score = 117, Expect = 8.5e-05, Identities = 47/125 (37%), Positives = 68/125 (54%)
  Q:    33 DIKIHCGDFCTD-----------IDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRE-LKLYEYAKENNIDILFSGHTH---IEQVFYKDN--ILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           D+ IHCGD  +            I  +S N D     N D+  E   +  I++    ++HG+Q       + R + LK+     ENN DIL SGHTH   IE++   +N  IL++NPGS   PR    +K+   L IE  K+
  S:    30 DLIIHCGDLTSKKVLEDLKKISKIIAVSGNMD-----NTDFPTE--YELLIDNFRIGIIHGNQI------HPRGDSLKMKYLCLENNWDILISGHTHIPMIEEIDISENKKILLLNPGSPTVPRYP--LKTVMKLKIENKKV 156
>gi|148269830|ref|YP_001244290.1| phosphodiesterase [Thermotoga petrophila RKU-1] >gi|170288516|ref|YP_001738754.1| phosphodiesterase [Thermotoga sp. RQ2] >gi|147735374|gb|ABQ46714.1| phosphodiesterase, MJ0936 family [Thermotoga petrophila RKU-1] >gi|170176019|gb|ACB09071.1| phosphodiesterase, MJ0936 family [Thermotoga sp. RQ2] (158 aa)
Score = 117, Expect = 8.6e-05, Identities = 40/123 (32%), Positives = 62/123 (50%)
  Q:    11 LIISDTHGDRSFFRKI---INEEQPDIKIHCGDFCTDIDL---ISENFDYF-VAGNNDYE--------GERI----VDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPG 133
           LI+SDTH +    +K+   ++E+  +   HCGDF     L   I E  D++ V GNND E        G RI    +  +++ L   +MH               + L    +    D++  GHTH   V  +   L++NPG
  S:     3 LILSDTHDNMEVLKKVEELLSEKNIEKVFHCGDFVAPFTLGRLIKEGVDFYGVFGNNDGEVLLLDKRSGGRIKKPPISLEVDGLRIAMMH-------------EPILLDAIVRSQEFDLILYGHTHRVDVRKEGKTLVVNPG 131
>gi|15643002|ref|NP_228044.1| hypothetical protein TM0230 [Thermotoga maritima MSB8] >gi|4980728|gb|AAD35321.1|AE001707_8 conserved hypothetical protein [Thermotoga maritima MSB8] (158 aa)
Score = 116, Expect = 9.9e-05, Identities = 40/123 (32%), Positives = 62/123 (50%)
  Q:    11 LIISDTHGDRSFFRKI---INEEQPDIKIHCGDFCTDIDL---ISENFDYF-VAGNNDYE--------GERI----VDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPG 133
           LI+SDTH +    +K+   ++E+  +   HCGDF     L   I E  D++ V GNND E        G RI    +  +++ L   +MH               + L    +    D++  GHTH   V  +   L++NPG
  S:     3 LILSDTHDNMEVLKKVEELVSEKNIEKIFHCGDFVAPFTLGRLIKEGVDFYGVFGNNDGEVLLLDKRSGGRIKKPPISLEVDGLRIAMMH-------------EPVLLDAIVRSQEFDLVLYGHTHKVDVRKEGKTLVVNPG 131
>gi|163763625|ref|ZP_02170686.1| phosphodiesterase, MJ0936 family [Bacillus selenitireducens MLS10] >gi|160355945|gb|EDP82597.1| phosphodiesterase, MJ0936 family [Bacillus selenitireducens MLS10] (170 aa)
Score = 116, Expect = 1.0e-04, Identities = 44/142 (30%), Positives = 62/142 (43%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQPDIKI--HCGDFCTDIDLISENFDYFVAGN----NDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVL 150
           K LI+SD+HG +     + +  Q ++ +  HCGD     D         V GN    +DY  E +     E       HG  FG  +      EL L     EN+  I   GHTH         +L++NPGS+  PR      SYA++
  S:     2 KALILSDSHGWKKEVATVRDRHQDEVDVIFHCGDSELPYDAPELKGIEAVGGNCDLGSDYPDEIVTSIGEERFFAG--HGHLFGIKM-----SELNLVYKGMENDASICLFGHTHQPVAVMNKGLLLVNPGSMREPR-GYPTGSYAII 141
>gi|19745521|ref|NP_606657.1| putative phosphoesterase [Streptococcus pyogenes MGAS8232] >gi|21909800|ref|NP_664068.1| putative phosphoesterase [Streptococcus pyogenes MGAS315] >gi|28896507|ref|NP_802857.1| putative phosphoesterase [Streptococcus pyogenes SSI-1] >gi|71902960|ref|YP_279763.1| putative phosphoesterase [Streptococcus pyogenes MGAS6180] >gi|94987935|ref|YP_596036.1| putative phosphoesterase [Streptococcus pyogenes MGAS9429] >gi|94989809|ref|YP_597909.1| putative phosphoesterase [Streptococcus pyogenes MGAS10270] >gi|94991819|ref|YP_599918.1| putative phosphoesterase [Streptococcus pyogenes MGAS2096] >gi|94993695|ref|YP_601793.1| putative phosphoesterase [Streptococcus pyogenes MGAS10750] >gi|139474360|ref|YP_001129076.1| putative phosphoesterase [Streptococcus pyogenes str. Manfredo] >gi|19747640|gb|AAL97156.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232] >gi|21903985|gb|AAM78871.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315] >gi|28811761|dbj|BAC64690.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1] >gi|71802055|gb|AAX71408.1| putative phosphoesterase [Streptococcus pyogenes MGAS6180] >gi|94541443|gb|ABF31492.1| putative phosphoesterase [Streptococcus pyogenes MGAS9429] >gi|94543317|gb|ABF33365.1| putative phosphoesterase [Streptococcus pyogenes MGAS10270] >gi|94545327|gb|ABF35374.1| putative phosphoesterase [Streptococcus pyogenes MGAS2096] >gi|94547203|gb|ABF37249.1| putative phosphoesterase [Streptococcus pyogenes MGAS10750] >gi|134272607|emb|CAM30874.1| putative phosphoesterase [Streptococcus pyogenes str. Manfredo] (173 aa)
Score = 116, Expect = 1.1e-04, Identities = 51/163 (31%), Positives = 75/163 (46%)
  Q:     8 KKILIISDTHGDRSFFRKIINEE--QPDIKIHCGDF-CTDIDLISENFDYFVAGNNDYEG---ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF-EDVVKYPA 170
           K I+++SD+HGDR   + I ++   Q D   H GD      D I     Y V GN DY+    +R+V  ++  +     HG  +  +         KL  +A+E   DI   GH H    +     L +NPGS+  PR     K YA + +   +IK   F  D   YP+
  S:     4 KTIIVMSDSHGDRDIVQAIKDKYLGQVDAIFHNGDSELNSSDPIWAGI-YVVGGNCDYDTGYPDRLVT-QLGTVTIAQTHGHLYHINFTWD-----KLDYFAQEVAADICLYGHLHRPAAWQVGQTLFMNPGSVTQPRGEINEKLYARVELTDTQIKVDYFTRDHKLYPS 166
>gi|73662952|ref|YP_301733.1| hypothetical protein SSP1643 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72495467|dbj|BAE18788.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (169 aa)
Score = 116, Expect = 1.1e-04, Identities = 44/147 (29%), Positives = 69/147 (46%)
  Q:     7 MKKILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           M K +I+SD H ++     +IN  +  D+ IH GD     D    +  Y + GN D+  E   +  IE    +  +     Y+V    R  ++L E AK       F GHTH+ +      + +INPGS+   R +N  ++YA L I+
  S:     1 MTKWIIVSDNHTEQGVLFDVINHHDHIDVAIHLGDSEFAYDDSELSRFYRIKGNTDFYAEFPNEETIEIDGIKAFYTHGHLYNV---NRSRMQLAEQAKSLGCQFAFYGHTHVAKHENIAGVHVINPGSISQSR-SNIEETYAELVID 144
>gi|196124518|ref|ZP_03116267.1| phosphodiesterase [Clostridium difficile ATCC 43255] (189 aa)
Score = 116, Expect = 1.1e-04, Identities = 45/144 (31%), Positives = 79/144 (54%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGD--FCTDIDLISENFD--------------YFVAGNNDYEGER-IVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI 152
           KI I+SDTHG   +F K +N     D+ +H GD  +    + I E ++                V GN D + ++ +++  I+        G+       GY   E ++ + AK+    IL  GHTH+++++  DN+++INPGS   P++ +   S A++ I
  S:     2 KIGIMSDTHGSLLYFEKALNVLSDCDVLLHGGDVLYHGPRNDIPEGYNPKKFIETLNKLENIVIVKGNCDADVDQMVIEHPIQSPYVMSQFGEIRIILNHGYIESEEEIIDKAKKMGGGILVLGHTHVKKLYMDDNLIVINPGSTSIPKDGSH--SVAIIDI 161
>gi|126465070|ref|YP_001040179.1| phosphodiesterase [Staphylothermus marinus F1] >gi|126013893|gb|ABN69271.1| phosphodiesterase, MJ0936 family [Staphylothermus marinus F1] (193 aa)
Score = 116, Expect = 1.1e-04, Identities = 52/129 (40%), Positives = 68/129 (52%)
  Q:     7 MKKILIISDTH-GDRS-----FFRKIINEEQP-DIKIHCGDFCTDIDLISENF----------DYFVAGNNDY-EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELK-LYEYAKENNIDILFSGHTHIEQVFY--KDNILIINPGSL 135
           M  IL+I DTH  DR+         II   +P DI +  GDF      + EN            Y V GN DY    +   FKI D+   + HGD        Y R +++ L   A     D+LF+GHTH   + +    NIL+INPGSL
  S:     1 MAVILVIGDTHIPDRADKIPDKLLNIIEYGRPWDIVVFTGDF------VGENIYRWFLGLGKKSYPVRGNMDYLPLPKTQIFKINDITIGVHHGDGV------YPRGDIRGLTRIANRLGADMLFTGHTHSPFIKHGITKNILLINPGSL 138
>gi|110600976|ref|ZP_01389182.1| Protein of unknown function UPF0025 [Geobacter sp. FRC-32] >gi|110548334|gb|EAT61554.1| Protein of unknown function UPF0025 [Geobacter sp. FRC-32] (168 aa)
Score = 115, Expect = 1.4e-04, Identities = 48/156 (30%), Positives = 74/156 (47%)
  Q:     4 VVDMKKILIISDTHGDRSFFRKIINEEQP-DIKIHCGDFCTD---IDLISENFDYFVAGNNDYEGERIVD--FKIEDLNCRLMHGDQFGYSV-PGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           V  +  IL++SDTHG+     K ++   P D  +H GD   D   I+ IS      V GN D+    + D    +   +  + HG +  YSV  G +     LY  A +    ++  GHTH+  +     +L INPG L     + Q  +YA+L I   K+ +
  S:     9 VESVMNILVLSDTHGNYPLAIKALDAAGPVDHIVHLGDGLDDAVIIEDISGLPTTKVVGNCDFSSSAVKDAIISLAGQSIFITHGHR--YSVKSGLD----GLYRKALDGGASVVLFGHTHLPLIENVHEVLFINPGCL---SQSCQTTTYAMLSIICGKVTA 162
>gi|150388788|ref|YP_001318837.1| phosphodiesterase [Alkaliphilus metalliredigens QYMF] >gi|149948650|gb|ABR47178.1| phosphodiesterase, MJ0936 family [Alkaliphilus metalliredigens QYMF] (160 aa)
Score = 115, Expect = 1.5e-04, Identities = 47/155 (30%), Positives = 78/155 (50%)
  Q:     9 KILIISDTHGD-RSFFRKIINEEQPDIKIHCGDFCTDIDLISENF---DYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFG--YSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGN---KIKSVEFE 163
           KI ++ D+HG   +    + +    ++ IH GD   D   I EN+      V+GN D EG   V   I      + HG  +G  + + G       ++   KE   D++  GHTH+     ++ ++I+NPGS+  PR  +Q KS A++ I  +   K+  +E E
  S:     5 KIGVLGDSHGGFENIGLAMKHLGHVNLIIHTGDHYRDRSYIEENYHIKTIGVSGNCDQEGPDEVVQIIHGKKYFISHGHIYGVTHGING-------IFYRGKELGADVVIFGHTHVPLNVKEEGMIILNPGSVSSPRGDSQ-KSCALMEIGAHRHLKVSLIELE 160
>gi|15674513|ref|NP_268687.1| putative phosphoesterase [Streptococcus pyogenes M1 GAS] >gi|71910119|ref|YP_281669.1| putative phosphoesterase [Streptococcus pyogenes MGAS5005] >gi|13621616|gb|AAK33408.1| conserved hypothetical protein [Streptococcus pyogenes M1 GAS] >gi|71852901|gb|AAZ50924.1| putative phosphoesterase [Streptococcus pyogenes MGAS5005] (173 aa)
Score = 114, Expect = 1.6e-04, Identities = 51/163 (31%), Positives = 75/163 (46%)
  Q:     8 KKILIISDTHGDRSFFRKIINEE--QPDIKIHCGDF-CTDIDLISENFDYFVAGNNDYEG---ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF-EDVVKYPA 170
           K I+++SD+HGDR   + I ++   Q D   H GD      D I     Y V GN DY+    +R+V  ++  +     HG  +  +         KL  +A+E   DI   GH H    +     L +NPGS+  PR     K YA + +   +IK   F  D   YP+
  S:     4 KTIIVMSDSHGDRDIVQAIKDKYLGQVDAIFHNGDSELNSSDPIWAGI-YVVGGNCDYDTGYPDRLVT-QLGTVTIAQTHGHLYHINFTWD-----KLDYFAQEVVADICLYGHLHRPAAWQVGQTLFMNPGSVTQPRGEINEKLYARVELTDTQIKVDYFTRDHKLYPS 166
>gi|160946945|ref|ZP_02094148.1| hypothetical protein PEPMIC_00906 [Peptostreptococcus micros ATCC 33270] >gi|158447329|gb|EDP24324.1| hypothetical protein PEPMIC_00906 [Peptostreptococcus micros ATCC 33270] (156 aa)
Score = 114, Expect = 1.9e-04, Identities = 45/144 (31%), Positives = 65/144 (45%)
  Q:    10 ILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTD---IDLISENFDYFVAGNNDYEGERIVD---FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           + ++SDTHG        +   + D+ +H GD   D   I+ I+    Y VAGN D   +   +    +I      L HG ++     G +    K+ E AKE   D    GHTH+      D I ++NPGS   PR  +    Y V  IE
  S:     3 VAVVSDTHGIVLPVAYSLQRNKVDVVLHLGDNVEDARKIEQITGMEVYVVAGNCDENSKDTPEDLVLEIRRKKFFLTHGHKYDVD-NGID----KIVEKAKEVGADYALFGHTHVHLREKVDGITVLNPGSTTLPRQGDTKGYYIVNLIE 147
>gi|150401709|ref|YP_001325475.1| phosphodiesterase [Methanococcus aeolicus Nankai-3] >gi|150014412|gb|ABR56863.1| phosphodiesterase, MJ0936 family [Methanococcus aeolicus Nankai-3] (168 aa)
Score = 114, Expect = 2.0e-04, Identities = 51/128 (39%), Positives = 68/128 (53%)
  Q:    12 IISDTH-GDR------SFFRKIINEEQPDIKIHCGDFCTD--------IDLISENFDYFVAGNNDYEG-ERIVDFKIEDLNCRLMHGDQFGYSVPGYERREL-KLYEYAKENNIDILFSGHTHIEQVF------YKDNILIINPGSLMYPR 139
           IISDTH  DR        + K  N  +    IHCGD  ++        ID +SE     V GN D     + +  +I      + HGD+       Y R +L K+  Y  EN +D+L SGHTHI  +          NIL++NPGS   PR
  S:     5 IISDTHITDRVGELPDEIYDKFKNVNK---IIHCGDITSNGILDNLNSIDGVSEVIA--VKGNMDTMALPKEIFLEINGFKIGIFHGDKI------YPRGDLLKMKYYCLENELDVLISGHTHIPLIKKITIPELNKNILLLNPGSPTVPR 144
>gi|94265269|ref|ZP_01289028.1| Protein of unknown function UPF0025 [delta proteobacterium MLMS-1] >gi|93454250|gb|EAT04566.1| Protein of unknown function UPF0025 [delta proteobacterium MLMS-1] (164 aa)
Score = 113, Expect = 2.1e-04, Identities = 47/153 (30%), Positives = 72/153 (47%)
  Q:     9 KILIISDTHGDRSFFRKII---NEEQPDIKIHCGDFCTD--IDLISE--NFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFG--------YSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVE 161
           +I IISDTH   +  R  +   N  Q ++ IHCGD  +   +D ++      + V GNN  +   I  F          HGD FG        ++   Y +    L   A + N D++  GH H  QV      L+INPG L+     +    +A+L     +++ VE
  S:     2 RIAIISDTHDHIAHLRAAVTYCNSYQVEMIIHCGDLISPFMLDELARFGGAAHLVYGNNPGDKHLIAQFCGTKFPSLSHHGD-FGAVEAAGLKFAFTHYPQLARGL---AAQGNFDVVCCGHNHRYQVEEIAATLLINPGELL---GKDDQPGFAILDSTDRRVERVE 162
>gi|167750958|ref|ZP_02423085.1| hypothetical protein EUBSIR_01943 [Eubacterium siraeum DSM 15702] >gi|167656137|gb|EDS00267.1| hypothetical protein EUBSIR_01943 [Eubacterium siraeum DSM 15702] (165 aa)
Score = 113, Expect = 2.4e-04, Identities = 48/148 (32%), Positives = 74/148 (50%)
  Q:     9 KILIISDTHGDRSFFRKII-NEEQPDIKIHCGD----FCTDIDLISENFDYFVAGNNDYEGE---RIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNK 156
           KI+++SD+H +      ++ N    D  IH GD    F    +L  E    FV GN D+      RI + K   + C  +HG +  +   G +     L   AK+N   I   GHTH+ +    D I ++NPGS+  PR+  +  SY ++ I+ NK
  S:     2 KIVVVSDSHKEFHKLNSVVENNLDADAFIHLGDGEHEFNDVRNLHPEKSFLFVKGNCDFADNKTIRIANAKGIKILC--VHGHEH-HVHQGLD----TLIAVAKQNGCKIALYGHTHLYRTELIDGIYVMNPGSIDSPRD-KRPPSYGIITIDDNK 149
>gi|191164233|ref|ZP_03026101.1| phosphodiesterase, MJ0936 family [Geobacter sp. M21] >gi|190994704|gb|EDV70164.1| phosphodiesterase, MJ0936 family [Geobacter sp. M21] (154 aa)
Score = 112, Expect = 2.8e-04, Identities = 44/146 (30%), Positives = 69/146 (47%)
  Q:     9 KILIISDTHGDRSF-FRKIINEEQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVDFKIEDLNCRLM--HGDQFGYSVPGYERRELKLYEY---AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEG 154
           ++L+ISD+HG+ +  FR        D  IH GD   D  ++ E      + VAGN D++        +E   CR++  HG++        ER +  L E      E    ++  GHTH   V     +L++NPG    P       S+A++ I G
  S:     2 RLLVISDSHGNYAHAFRAHQMAGDVDGIIHLGDGSEDARMLEEVLGVTVHKVAGNCDFDRGLPAQLTLELGECRILATHGNR--------ERVKSGLKELIGKGIEAKASVVLYGHTHSPAVEAAHGMLLVNPG----PLKEGLAGSFAIVTIHG 144
>gi|168265742|ref|ZP_02687707.1| phosphoesterase family protein [Listeria monocytogenes FSL J2-071] (145 aa)
Score = 112, Expect = 2.9e-04, Identities = 39/129 (30%), Positives = 66/129 (51%)
  Q:    36 IHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI--EGNKIKSVEFED 164
           IHCGD   + D  +    + V GN D+ G    D+  E    R+       Y++   +   + L   A+E N D  F GH+H   V   D+ +I+NPGS+  PR   ++K+YA++    EG +++ ++ +D
  S:     2 IHCGDSELEADDPAIQGFHTVRGNCDFGGGFPNDWVGEVGGYRIFTTHGHLYNI---KMTLMNLRYRARELNADFAFFGHSHELGVDMLDDTIILNPGSISLPRGRIRVKTYALIDSTPEGIQVRFMDRDD 129
>gi|94268731|ref|ZP_01291269.1| Protein of unknown function UPF0025 [delta proteobacterium MLMS-1] >gi|93451487|gb|EAT02318.1| Protein of unknown function UPF0025 [delta proteobacterium MLMS-1] (164 aa)
Score = 112, Expect = 2.9e-04, Identities = 47/153 (30%), Positives = 72/153 (47%)
  Q:     9 KILIISDTHGDRSFFRKII---NEEQPDIKIHCGDFCTD--IDLISE--NFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFG--------YSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVE 161
           +I IISDTH   +  R  +   N  Q ++ IHCGD  +   +D ++      + V GNN  +   I  F          HGD FG        ++   Y +    L   A + N D++  GH H  QV      L+INPG L+     +    +A+L     +++ VE
  S:     2 RIAIISDTHDHIANLRAAVTYCNSYQVEMVIHCGDLISPFMLDELARFGGAAHLVYGNNPGDKHLIAQFCGTKFPSLSHHGD-FGAVEAAGLKFAFTHYPQLARGL---AAQGNFDVVCCGHNHRYQVEEIAATLLINPGELL---GKDDQPGFAILDSADRRVERVE 162
>gi|167212115|ref|ZP_02282422.1| hypothetical protein LmonL_10689 [Listeria monocytogenes LO28] (145 aa)
Score = 112, Expect = 3.1e-04, Identities = 39/129 (30%), Positives = 66/129 (51%)
  Q:    36 IHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI--EGNKIKSVEFED 164
           IHCGD   + D  +    + V GN D+ G    D+  E    R+       Y++   +   + L   A+E N D  F GH+H   V   D+ +I+NPGS+  PR   ++K+YA++    EG +++ ++ +D
  S:     2 IHCGDSELEADDPAIQGFHTVRGNCDFGGGFPNDWVGEVDGYRIFTTHGHLYNI---KMTLMNLRYRARELNADFAFFGHSHELGVDMLDDTIILNPGSISLPRGRIRVKTYALIDSTPEGIQVRFMDRDD 129
>gi|39996335|ref|NP_952286.1| phosphoesterase, putative [Geobacter sulfurreducens PCA] >gi|39983215|gb|AAR34609.1| phosphoesterase, putative [Geobacter sulfurreducens PCA] (161 aa)
Score = 111, Expect = 3.7e-04, Identities = 47/151 (31%), Positives = 72/151 (47%)
  Q:     9 KILIISDTHGDRSFFRKIIN-EEQPDIKIHCGDFCTDIDLISENFDYF---VAGNNDYEGE--RIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           KI+++SDTHG++     I++  E     +H GD   D D + +        V GN D      R V  ++      L HGD + +   G ER    L E A   +  ++  GHTH+  +   D IL +NPG L   R A  + +YAV+ +    I +
  S:     5 KIVVLSDTHGNQRLALSILDLHEDAGHVVHLGDELQDADFLEDATGKTIIKVQGNCDCSPAHPREVSLELAGRRFLLTHGDIY-HVKSGLER----LRERAAAVDAAVVLFGHTHVACIETTDGILYVNPGCL--KRGAGNL-TYAVVTLTDGSITA 153
>gi|84997421|ref|XP_953432.1| vacuolar protein sorting, VPS29 homologue, putative [Theileria annulata] >gi|65304428|emb|CAI76807.1| vacuolar protein sorting, VPS29 homologue, putative [Theileria annulata] (213 aa)
Score = 111, Expect = 4.2e-04, Identities = 23/79 (29%), Positives = 45/79 (56%)
  Q:    86 GYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLM---YPRNANQMKSYAVLHIEGNKIKSVEFED 164
           GY +P +  ++L L + A + N+DIL  GH+H+  +      + +NPGS      P   N + ++ ++ I+G+K+    +E+
  S:    96 GYQIPTWNNKDL-LLKVAVDMNVDILVYGHSHVSDISKHGGKIFVNPGSATGCYQPWQPNSIPTFMLMAIQGSKVVIYVYEE 176
>gi|150019937|ref|YP_001305291.1| phosphodiesterase [Thermosipho melanesiensis BI429] >gi|149792458|gb|ABR29906.1| phosphodiesterase, MJ0936 family [Thermosipho melanesiensis BI429] (158 aa)
Score = 111, Expect = 4.3e-04, Identities = 43/123 (34%), Positives = 66/123 (53%)
  Q:    11 LIISDTHGDRSFFR---KIINEEQPDIKIHCGDFCTDIDL---ISENFDYF-VAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNI-DILFSGHTHIEQVFYKDNILIINPG 133
           LI+SD+H + +  +   K+I   + D   HCGDF     L     +N +++ V GNND  GER++  K  +   R    +    +   +   E    + AKE+N+ D +F GHTH   V   +N +IINPG
  S:     3 LILSDSHDNLTKAKEIEKVIESYKIDTIFHCGDFVAPFILPYFFKDNIEFYGVFGNND--GERLLLSKKSNGKIRTGPYEILIQNFKIFLMHEPYALKAAKESNLYDFIFFGHTHELVVEKYNNSVIINPG 131
>gi|134298606|ref|YP_001112102.1| phosphodiesterase [Desulfotomaculum reducens MI-1] >gi|134051306|gb|ABO49277.1| phosphodiesterase, MJ0936 family [Desulfotomaculum reducens MI-1] (181 aa)
Score = 111, Expect = 4.3e-04, Identities = 45/159 (28%), Positives = 84/159 (52%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGD--FCTDIDLISENFD--------------YFVAGNNDYEGERIV-DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDVVK 167
           +I IISDTHG   +F+K +N     D  IH GD  +    + + E +                   GN D + +++V    I+     L  G        GY R + +  + A++   D+   GHTH++++   +N++++NPGS   P++   + S AV+     ++ ++E ++V+K
  S:     2 RIGIISDTHGSLFYFKKALNTLGGCDYIIHGGDVLYHGPRNPLPEGYSPKELAEKINGMKNIIIARGNCDADVDQMVLQHPIQSPYVFLQLGGLKILVSHGYTRDKKEYIKMARDYGADLFIYGHTHVKELNQDENLIVLNPGSTALPKDG--IHSVAVIDDGNIQLINMENQEVIK 176
>gi|89209716|ref|ZP_01188111.1| Protein of unknown function UPF0025 [Halothermothrix orenii H 168] >gi|89160785|gb|EAR80438.1| Protein of unknown function UPF0025 [Halothermothrix orenii H 168] (186 aa)
Score = 111, Expect = 4.4e-04, Identities = 47/158 (29%), Positives = 79/158 (50%)
  Q:     8 KKILIISDTHGDRSFFRKIIN-EEQPDIKIHCGDFC------------TDIDLISENFDY-----FVAGNND---------YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           + I+++SDTHG  + ++K      +  + IH GD                  LI E   +      V GN D         Y     V  +I  L   + HG Q           E    ++A+    DIL  GHTHI ++  +++I+++NPGS+  P+    + S AV  I+ N I+ ++ + +
  S:     3 ESIVVVSDTHGSLTAWKKAEGLMSRSKLVIHAGDVLYHGARNPLPDGYNTTGLIEEINKFKGSLMMVKGNVDSLVDEWVLPYPLPEYVLVEINGLRLVVYHGYQ--------HNNEKDRIKFARRFKADILIYGHTHIPEIKNREDIILLNPGSMSLPKQKPAIPSVAV--IKDNSIEIIDLDSL 177
>gi|15639922|ref|NP_219373.1| hypothetical protein TP0937 [Treponema pallidum subsp. pallidum str. Nichols] >gi|189026160|ref|YP_001933932.1| hypothetical protein TPASS_0937 [Treponema pallidum subsp. pallidum SS14] >gi|3323258|gb|AAC65894.1| conserved hypothetical protein [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018735|gb|ACD71353.1| hypothetical protein TPASS_0937 [Treponema pallidum subsp. pallidum SS14] (211 aa)
Score = 110, Expect = 4.5e-04, Identities = 41/144 (28%), Positives = 70/144 (48%)
  Q:     9 KILIISDTHGDRSFFRKIINE--EQPDIKIHCGDFCTDIDLISEN-------------FDYFVAGNNDYEGE-----RIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI 152
           ++L++SDTHG       ++++     D  +  GD   D+  + +                + VAGN D         RI   ++ D+   L HG     +V      +  L   A +    I   GHTH+++      +LIINPGSL + R ++    +A+LH+
  S:    28 RLLLVSDTHGSAEALTAVVDQFGSCADALLFAGDGIGDVLYLCQRGRRNRVLRERIPGVIFMVAGNCDRASHIPLCGRI---QVADVTLFLAHGHTHSVNV-----SDSVLVSQALQACCSIAVHGHTHVQRACVSSRVLIINPGSLEHARGSSH-AGFALLHV 182
>gi|167757058|ref|ZP_02429185.1| hypothetical protein CLORAM_02607 [Clostridium ramosum DSM 1402] >gi|167703233|gb|EDS17812.1| hypothetical protein CLORAM_02607 [Clostridium ramosum DSM 1402] (143 aa)
Score = 110, Expect = 4.7e-04, Identities = 41/120 (34%), Positives = 56/120 (46%)
  Q:    46 DLISENFDYFVAGNNDYEGERIVD---FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           D I+ N  Y V GNND+    I D     I+DL   ++HG ++       +     L   AKE   DI+  GHTH     + + I  INPGS+ YPR   +  +Y +      K K   F DV
  S:     4 DGINLNSFYLVRGNNDFGN--IPDELFITIDDLKFYIVHGHRYDV-----DYNLDYLTHIAKEKGADIVCFGHTHRPYYDFHEGITFINPGSVCYPRGQYRNPTYCIFD---TKTKKSTFYDV 116
>gi|11498405|ref|NP_069633.1| hypothetical protein AF0799 [Archaeoglobus fulgidus DSM 4304] >gi|2649807|gb|AAB90439.1| conserved hypothetical protein [Archaeoglobus fulgidus DSM 4304] (178 aa)
Score = 110, Expect = 4.9e-04, Identities = 43/127 (33%), Positives = 66/127 (51%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLI-------SENFDYF----------VAGN-NDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSL 135
           +ILI  DTH         I E   +I     D+  D D++       SE    F          V GN +D        F++E L+  ++HG Q     P   R +L+  + A E ++D+L SGHTH+  V Y+   +++NPGS+
  S:     5 RILIFGDTH---------IPERADEIPREFTDYLVDFDMVVITGDLTSERVLRFAERVAESVIAVRGNMDDLPLPHSAKFRVEGLSFGVVHGHQV---YPRGNREQLE--QIALEMDVDVLISGHTHLPDV-YRGAKILLNPGSM 134
>gi|89072714|ref|ZP_01159279.1| phosphodiesterase [Photobacterium sp. SKA34] >gi|89051534|gb|EAR56988.1| phosphodiesterase [Photobacterium sp. SKA34] (181 aa)
Score = 110, Expect = 5.0e-04, Identities = 37/108 (34%), Positives = 57/108 (52%)
  Q:    56 VAGNNDYEGER-IVDFKI-EDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNI---DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           V GN D E ++ +++F I  D N  L+   Q  +   G+      LY   K   +   D++ SGHTHI     KD + + NPGS+  PRN     SY +L  +GN++  + F+
  S:    69 VRGNCDSEVDQMLLEFPIMADYNLVLLPTGQRLFLTHGH------LYNANKHPRLRAGDVIVSGHTHIPVAAAKDELFVFNPGSVAIPRNG-LPASYGLL--DGNQLSVISFD 172
>gi|15679762|ref|NP_276880.1| hypothetical protein MTH1774 [Methanothermobacter thermautotrophicus str. Delta H] >gi|3183448|sp|O27802|Y1774_METTH Putative metallophosphoesterase MTH_1774 >gi|2622904|gb|AAB86240.1| conserved protein [Methanothermobacter thermautotrophicus str. Delta H] (172 aa)
Score = 110, Expect = 5.4e-04, Identities = 50/150 (33%), Positives = 80/150 (53%)
  Q:    10 ILIISDTH-GDR-SFFRKIINEEQPDIKI--HCGDFCTDIDLISENFDYF----VAGNND----YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           I +ISDTH  DR S   + + +   D+++  H GD  T  D+++E         V GN D     E  R   F+IE     L+HG+ +    P  + ++L+      E   D+L SGHTH   +   ++++++NPGS   PR  +   S  VL I+G K+ +
  S:     3 IGVISDTHIPDRASEIPEAVFDAFRDVELILHAGDL-TSPDILTELETLAPVECVQGNMDRHYGIETPRSRLFEIESFRVGLIHGEVY----PRGDTQQLRYL--GLELGADVLISGHTHQPFIRELEDMVLLNPGSPTVPRLTD--PSVMVLRIDGEKLDA 155
>gi|49483315|ref|YP_040539.1| hypothetical protein SAR1125 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49241444|emb|CAG40128.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MRSA252] (167 aa)
Score = 110, Expect = 5.5e-04, Identities = 46/158 (29%), Positives = 76/158 (48%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEEQPD--IKIHCGDFCTDIDLISENFDYFVAGNNDY--EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK-SVEFED 164
           M K +++SD H +     +I  E  PD  + +H GD   + D    +    V GN D+  E E     K  D+     HG  +  +     R    L E A+E      F GHTH+ +  Y + +  INPGS+   R++ + +SYA + I+   ++ +V F++
  S:     1 MSKWIVVSDNHTESGILYQIY-EAHPDADMYLHLGDSEFEYDDTELSLFRRVKGNCDFYPEFENEAVAKCNDVRAFYTHGHLYQVN-----RTRYLLAEQARELGCVFAFYGHTHVAKYEYINGVHAINPGSISQSRSSME-ESYAEVLIDDQTLQGTVNFKN 156
>gi|28211979|ref|NP_782923.1| putative phosphoesterase [Clostridium tetani E88] >gi|28204422|gb|AAO36860.1| putative phosphoesterase [Clostridium tetani E88] (157 aa)
Score = 109, Expect = 6.0e-04, Identities = 48/150 (32%), Positives = 71/150 (47%)
  Q:    10 ILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGE---RIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           I ++SDTH       K++      D+ IH GD   DI    + +      V GN DY       IVD  IE     + HG  +      Y    LK  + A E   +++  GHTHI Q+ Y++ +  INPGS +  R+   + S A++ I+   I S
  S:     3 IGVVSDTHRHIWIIDKVMEVLGDIDMLIHLGDNIQDIREFKKVYKGKILNVKGNCDYSNSIPSDIVD-DIEGYKFLITHGHNYDVK---YNLTRLK--DKAFEEKANVVLYGHTHISQIIYEEGVWFINPGSPVLSRDG--INSVALIEIKNGNINS 151
>gi|168703963|ref|ZP_02736240.1| phosphodiesterase, MJ0936 family protein [Gemmata obscuriglobus UQM 2246] (242 aa)
Score = 109, Expect = 6.6e-04, Identities = 21/55 (38%), Positives = 33/55 (60%)
  Q:   108 IDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF 162
           +D L +GHTHI         L++NPGS+   R+ N + SYAV+  +  ++K VE+
  S:   144 VDYLLAGHTHIPYTLRVGATLVVNPGSVGIGRDGNPLASYAVIDGDEVQLKRVEY 198
>gi|150403311|ref|YP_001330605.1| phosphodiesterase [Methanococcus maripaludis C7] >gi|150034341|gb|ABR66454.1| phosphodiesterase, MJ0936 family [Methanococcus maripaludis C7] (171 aa)
Score = 109, Expect = 6.7e-04, Identities = 46/125 (36%), Positives = 64/125 (51%)
  Q:     9 KILIISDTHGDRSFFRKII---NEEQPDIKIHCGDFCTDIDLISENFDYF------VAGNNDYEG----------------ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPG 133
           KI I+SDTH   +  RK I   N+E+ D+ IHCGDF +    + + F+        V GNND E                 E+ V F+ +     ++HG       P  E          K    D++  GHTH  Q    D +L+INPG
  S:     2 KIGIMSDTHDHLANIRKAIAVFNDEKVDMVIHCGDFVSL--FVVKEFENLNSKIVGVLGNNDGEKTLLKEWLKEIDSDNELEQYVSFETDGHKFFVLHGTH----APILE-------SVIKSKEYDVVIHGHTHERQFEEIDGVLVINPG 138
>gi|168183525|ref|ZP_02618189.1| phosphodiesterase, MJ0936 family [Clostridium botulinum Bf] >gi|182673330|gb|EDT85291.1| phosphodiesterase, MJ0936 family [Clostridium botulinum Bf] (154 aa)
Score = 109, Expect = 6.9e-04, Identities = 42/127 (33%), Positives = 70/127 (55%)
  Q:    33 DIKIHCGDFCTDIDLISENFDYFVAG---NNDYEGERIVDFKIEDLNCRLMHGDQFG-YSVPGYERREL-KLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMK--SYAVLHIEGNKIKS 159
           D+ IH GDF +   L        V G   NND  G R    ++++    +++G + G +   G E+  L ++Y   K++N+DI+  GH+H   +  K+  LIINPGS   P    + +  SY VL ++ +KI++
  S:    20 DLIIHLGDFTSPRVLEKIKKKKKVIGVWGNNDRNGLRQ---ELKEKEIVILNGYKVGLFHGHGTEKNTLDRIYNIFKDDNVDIILFGHSHQPMIKTKNKTLIINPGS---PSKKIRERWFSYVVLSLKKDKIEA 147
>gi|163727031|ref|ZP_02134532.1| phosphodiesterase, MJ0936 family [Desulfatibacillum alkenivorans AK-01] >gi|161399687|gb|EDQ23954.1| phosphodiesterase, MJ0936 family [Desulfatibacillum alkenivorans AK-01] (236 aa)
Score = 109, Expect = 6.9e-04, Identities = 35/122 (28%), Positives = 61/122 (50%)
  Q:    12 IISDTHGDRSFFRKIINEEQP-DIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVDFKI--EDLNCRLMHGDQFGYS----VPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPG 133
           + SDTHG+  + ++ +    P ++ IH GD   +   +++ +      V GN DY     +D  I        +MHG Q   +       ++R   ++ + A  N+ DI   GHTH   +  ++ +LI NPG
  S:    51 VFSDTHGNARYMQEALQNLGPFNMIIHLGDGVREGRELAKQWGLPFMGVRGNEDYGALAPMDDDISFHGFKVFMMHGHQMEINPYQDAETWDRHYKEMAQRAARNSADIFLFGHTHKPVLKNREGVLICNPG 182
>gi|75766005|pdb|2A22|A Chain A, Structure Of Vacuolar Protein Sorting 29 From Cryptosporidium Parvum >gi|75766006|pdb|2A22|B Chain B, Structure Of Vacuolar Protein Sorting 29 From Cryptosporidium Parvum (215 aa)
Score = 109, Expect = 7.2e-04, Identities = 42/137 (30%), Positives = 77/137 (56%)
  Q:    21 SFFRKIINEEQPDIKIHCGDFCTD-----IDLISENFDYFVAG-------NNDYEGERI----VDFKIEDLNCRLMHGDQ-FGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKI 157
           S FR+++  ++ +  +  G+ C+      +  I++N  Y V+G       N D E   +    V  +I +    LMHG+Q   +  PG       L ++ +  + DIL +GHTH  +VF K+  L +NPG+     +A   +   S+ ++ ++GNK+
  S:    45 SNFRELLATDKINYVLCTGNVCSQEYVEMLKNITKNV-YIVSGDLDSAIFNPDPESNGVFPEYVVVQIGEFKIGLMHGNQVLPWDDPG------SLEQWQRRLDCDILVTGHTHKLRVFEKNGKLFLNPGTATGAFSALTPDAPPSFMLMALQGNKV 194
>gi|164687179|ref|ZP_02211207.1| hypothetical protein CLOBAR_00820 [Clostridium bartlettii DSM 16795] >gi|164603603|gb|EDQ97068.1| hypothetical protein CLOBAR_00820 [Clostridium bartlettii DSM 16795] (199 aa)
Score = 108, Expect = 7.8e-04, Identities = 44/147 (29%), Positives = 82/147 (55%)
  Q:     9 KILIISDTHGDRSFFRKIINE-EQPDIKIHCGDFC-----TDI-------DLISE--NFD--YFVAGNNDYEGER-IVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRN-ANQMKSYAVLHIEGN 155
           KI ++SDTHG   +F K ++  +  D+  H GD        D+        +I E  N D    V GN D + ++ ++   IED       G+       GY   + +    AK+   ++L  GHTH+++++  ++++++NPGS   P++ ++ +    ++ IEGN
  S:    13 KIGVMSDTHGSLPYFEKALDLLKDCDVLFHMGDVLYHGPRNDLPEGYNPKGVIKEINNLDNIIIVRGNCDADVDQMVIKHPIEDGYILTEVGNVTFLLNHGYLESKEETIRQAKDKGANVLILGHTHVKELYMDEDLVVLNPGSTSIPKDGSHSVAIIEIMPIEGN 178
>gi|70726810|ref|YP_253724.1| hypothetical protein SH1809 [Staphylococcus haemolyticus JCSC1435] >gi|68447534|dbj|BAE05118.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (169 aa)
Score = 108, Expect = 7.9e-04, Identities = 36/135 (26%), Positives = 62/135 (45%)
  Q:     7 MKKILIISDTHGDRSFFRKIIN-EEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA 141
           M K LI+SD H +      +    +  D+ +H GD   + +    +    V GN D+  E   + ++E    + ++     YSV    +  + L + AK       F GHTH+ +  Y D + +INPGS+   R++
  S:     1 MTKWLIVSDNHTESGILYHLYEVHKDADVLLHLGDSEFEYNDTELSLYRRVKGNCDFYPEFPNEEEVEIKGIKAIYTHGHLYSV---NQTRMHLAQKAKSQGCQFAFYGHTHVAKYEYLDGVHVINPGSISQSRSS 133
>gi|76801152|ref|YP_326160.1| hypothetical protein NP1002A [Natronomonas pharaonis DSM 2160] >gi|76557017|emb|CAI48592.1| conserved hypothetical protein [Natronomonas pharaonis DSM 2160] (170 aa)
Score = 108, Expect = 8.0e-04, Identities = 46/146 (31%), Positives = 72/146 (49%)
  Q:    12 IISDTHGDRSFFRKIIN---EEQPDIKIHCGDFCT-------DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYE------YAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           +ISDTH +    R  ++   EE  D  +HCGDF         D D I+    + V GNND E E +VD   + L+    HG     ++ G E   L   E       A     D +  GH H+ +        ++NPG+  +P  A++ ++ AV+    ++I
  S:     5 VISDTHDNVPAARAAMDRFEEEGVDTVVHCGDFVAPPLIPFLDRDGIAV---HAVRGNNDGEREGLVD-AFDALDGGTFHGRFAELTLGGREFAVLHGEERPVIDALAASGEYDYVLHGHWHVREERTVGETTVLNPGA-HFPTVADEHRTVAVVDTGADEI 161
>gi|148381158|ref|YP_001255699.1| phosphodiesterase [Clostridium botulinum A str. ATCC 3502] >gi|153932319|ref|YP_001385533.1| phosphodiesterase [Clostridium botulinum A str. ATCC 19397] >gi|153937846|ref|YP_001388939.1| phosphodiesterase [Clostridium botulinum A str. Hall] >gi|168179142|ref|ZP_02613806.1| phosphodiesterase, MJ0936 family [Clostridium botulinum NCTC 2916] >gi|148290642|emb|CAL84771.1| putative phosphoesterase [Clostridium botulinum A str. ATCC 3502] >gi|152928363|gb|ABS33863.1| phosphodiesterase, MJ0936 family [Clostridium botulinum A str. ATCC 19397] >gi|152933760|gb|ABS39259.1| phosphodiesterase, MJ0936 family [Clostridium botulinum A str. Hall] >gi|182669970|gb|EDT81946.1| phosphodiesterase, MJ0936 family [Clostridium botulinum NCTC 2916] (154 aa)
Score = 108, Expect = 8.4e-04, Identities = 42/127 (33%), Positives = 69/127 (54%)
  Q:    33 DIKIHCGDFCTDIDLISENFDYFVAG---NNDYEGERIVDFKIEDLNCRLMHGDQFG-YSVPGYERREL-KLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMK--SYAVLHIEGNKIKS 159
           D+ IH GDF +   L        V G   NND  G R    ++++    +++G + G +   G E+  L ++Y   K++N+DI+  GH+H   +  K+  LIINPGS   P    + +  SY VL ++  KI++
  S:    20 DLIIHLGDFTSPRVLEKIKKKKKVIGVWGNNDRNGLRQ---ELKEKEIVILNGYKVGLFHGHGTEKNTLDRIYSIFKDDNVDIILFGHSHQPMIKTKNKTLIINPGS---PSKKIRERWFSYVVLSLKKEKIEA 147
>gi|153939181|ref|YP_001392560.1| phosphodiesterase [Clostridium botulinum F str. Langeland] >gi|170755114|ref|YP_001782848.1| phosphodiesterase [Clostridium botulinum B1 str. Okra] >gi|152935077|gb|ABS40575.1| phosphodiesterase, MJ0936 family [Clostridium botulinum F str. Langeland] >gi|169120326|gb|ACA44162.1| phosphodiesterase, MJ0936 family [Clostridium botulinum B1 str. Okra] (154 aa)
Score = 108, Expect = 8.8e-04, Identities = 42/127 (33%), Positives = 69/127 (54%)
  Q:    33 DIKIHCGDFCTDIDLISENFDYFVAG---NNDYEGERIVDFKIEDLNCRLMHGDQFG-YSVPGYERREL-KLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMK--SYAVLHIEGNKIKS 159
           D+ IH GDF +   L        V G   NND  G R    ++++    +++G + G +   G E+  L ++Y   K++N+DI+  GH+H   +  K+  LIINPGS   P    + +  SY VL ++  KI++
  S:    20 DLIIHLGDFTSPRVLEKIKKKKKVIGVWGNNDKNGLRQ---ELKEKEIVILNGYKVGLFHGHGTEKNTLDRIYSIFKDDNVDIILFGHSHQPMIKTKNKTLIINPGS---PSKKIRERWFSYVVLSLKKEKIEA 147
>gi|170761343|ref|YP_001788529.1| phosphodiesterase [Clostridium botulinum A3 str. Loch Maree] >gi|169408332|gb|ACA56743.1| phosphodiesterase, MJ0936 family [Clostridium botulinum A3 str. Loch Maree] (154 aa)
Score = 108, Expect = 9.5e-04, Identities = 42/127 (33%), Positives = 70/127 (55%)
  Q:    33 DIKIHCGDFCTDIDLISENFDYFVAG---NNDYEGERIVDFKIEDLNCRLMHGDQFG-YSVPGYERREL-KLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMK--SYAVLHIEGNKIKS 159
           D+ IH GDF +   L        V G   NND  G R    ++++    +++G + G +   G E+  L ++Y   K++N+DI+  GH+H   +  K+  LIINPGS   P    + +  SY VL ++ +KI++
  S:    20 DLIIHLGDFTSPRVLEKIKKKKKVIGVWGNNDRGGLRQ---ELKEKEIVILNGYKVGLFHGHGTEKNTLDRIYNIFKDDNVDIILFGHSHQPMIKTKNKTLIINPGS---PSKKIRERWFSYVVLSLKKDKIEA 147
>gi|18977922|ref|NP_579279.1| hypothetical protein PF1550 [Pyrococcus furiosus DSM 3638] >gi|18893690|gb|AAL81674.1| hypothetical protein [Pyrococcus furiosus DSM 3638] (170 aa)
Score = 108, Expect = 9.8e-04, Identities = 45/156 (28%), Positives = 73/156 (46%)
  Q:     9 KILIISDTHGDRSFFR---KIINEEQPDIKIHCGDFCTDIDLISENFDYFVA------GNNDYE----------GERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFED 164
           K+ I+SDTH +    +   +  NEE  D+ +H GD+      ++       A      GNND E           + I+   I+ L   L+HG             E  +  +A+    DI+  GHTH   +      LI+NPG +        +KS+A+L+    +IK +  E+
  S:     2 KVGIMSDTHDNLEAIKLAVEYFNEEGVDLVLHAGDYVAP--FVARELSKLSAPLKGVFGNNDGERKMLEEKLGIKDEILTLDIDGLKVVLLHGTD-----------ERVVEAFARSQMYDIVIRGHTHKYGIQEVGRTLIVNPGEVC--GYITGIKSFAILNTREREIKIINLEN 161
>gi|170585284|ref|XP_001897414.1| vacuolar protein sorting 29 [Brugia malayi] >gi|158595093|gb|EDP33666.1| vacuolar protein sorting 29, putative [Brugia malayi] (186 aa)
Score = 107, Expect = 1.0e-03, Identities = 40/144 (27%), Positives = 76/144 (52%)
  Q:    10 ILIISD------THGDRSFFRKIINEEQPDIKIHCGDFCT------------DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS---LMYPRNANQMKSYAVLHIE 153
           +L+I D      +H   + FRK++   +    +  G+ CT            D+ +   +FD  +    D +   +  F+I      L HG Q    VP  +++ L++   A++ ++D+L +GHTH  Q F  +    +NPGS      P  ++ + S+A+L ++
  S:     3 VLVIGDFHIPHRSHNIPARFRKLLVPNKMQHVLCTGNLCTRETFDYLKSLASDVHVARGDFDDVLTNYPDTKVITVGQFRIG-----LCHGHQI---VPWGDKKRLEML--ARQMDVDVLITGHTHECQTFQHEGRFYVNPGSATGAFSPIQSDVIPSFALLDVQ 157
>gi|163802565|ref|ZP_02196457.1| phosphodiesterase [Vibrio campbellii AND4] >gi|159173648|gb|EDP58467.1| phosphodiesterase [Vibrio campbellii AND4] (181 aa)
Score = 107, Expect = 1.0e-03, Identities = 22/50 (44%), Positives = 31/50 (62%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           DI+  GHTH+     +D ++I NPGS+ +PRN     SY V+  EGN +K
  S:   121 DIIAHGHTHVPVAEVQDGVIIFNPGSMTFPRNGLS-PSYGVM--EGNTLK 167
>gi|160932210|ref|ZP_02079601.1| hypothetical protein CLOLEP_01045 [Clostridium leptum DSM 753] >gi|156868812|gb|EDO62184.1| hypothetical protein CLOLEP_01045 [Clostridium leptum DSM 753] (157 aa)
Score = 107, Expect = 1.0e-03, Identities = 39/127 (30%), Positives = 65/127 (51%)
  Q:     9 KILIISDTHGDRSFFRKIINEE-QPDIKIHCGDFCTDI----DLISENFDYFVAGNNDYEGERIV---DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEY---AKENNIDILFSGHTHIEQVFYKDNILIINPGSL 135
           +IL++SDTH D S     +  + + +I +H GD   ++     +  E     V GN D+ G  +    +  +E       HG  + Y V      ++ LY     A++   DI   GHTH  ++ Y+D + ++NPGSL
  S:     2 RILVVSDTHRDFSALHHAVQTQPKAEIVLHLGDGEEELMQVKPMFPEKMIVGVRGNCDF-GSLLPWEEELSVEGKKIFFTHG--YTYQV------KMTLYNLECAARDRKADIALYGHTHQAEIEYRDGLYLMNPGSL 130
>gi|148642567|ref|YP_001273080.1| phosphoesterase, YfcE [Methanobrevibacter smithii ATCC 35061] >gi|148551584|gb|ABQ86712.1| predicted phosphoesterase, YfcE [Methanobrevibacter smithii ATCC 35061] (179 aa)
Score = 107, Expect = 1.2e-03, Identities = 46/134 (34%), Positives = 75/134 (55%)
  Q:    10 ILIISDTH---GDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISE----NFDYFVAGNNDYE-GERIVDFKI---EDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQ 143
           I +ISDTH     R   + +I+  E  D+ +H GD  T   +I E         + GN D   G  + + K+   E L   + HG+ +    P  + ++L LY  AK+ + DIL +GH+H  ++   D +L++NPGS + PR A++
  S:     6 IGLISDTHIPDRARELPKNVISSFENVDLILHAGDL-TSTKVIDELKKIAPTIAIQGNMDRAAGIMLPNAKVIEAEGLKIGIAHGEVY----PRADTQQL-LY-LAKQLDADILVTGHSHQPKIEQIDGVLLLNPGSPVVPRLADR 144
>gi|12052754|emb|CAB66549.1| hypothetical protein [Homo sapiens] >gi|49065362|emb|CAG38499.1| VPS29 [Homo sapiens] >gi|117644436|emb|CAL37713.1| hypothetical protein [synthetic construct] (182 aa)
Score = 107, Expect = 1.2e-03, Identities = 33/120 (27%), Positives = 62/120 (51%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:    55 DVHIVRGDFDE----NLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQFDVDILISGHTHKSEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQ 166
>gi|66362834|ref|XP_628383.1| vacuolar protein sorting 29 [Cryptosporidium parvum Iowa II] >gi|67624407|ref|XP_668486.1| vacuolar protein sorting 29 [Cryptosporidium hominis TU502] >gi|46229420|gb|EAK90238.1| vacuolar protein sorting 29 [Cryptosporidium parvum Iowa II] >gi|54659693|gb|EAL38259.1| vacuolar protein sorting 29 [Cryptosporidium hominis] (197 aa)
Score = 107, Expect = 1.3e-03, Identities = 42/137 (30%), Positives = 77/137 (56%)
  Q:    21 SFFRKIINEEQPDIKIHCGDFCTD-----IDLISENFDYFVAG-------NNDYEGERI----VDFKIEDLNCRLMHGDQ-FGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKI 157
           S FR+++  ++ +  +  G+ C+      +  I++N  Y V+G       N D E   +    V  +I +    LMHG+Q   +  PG       L ++ +  + DIL +GHTH  +VF K+  L +NPG+     +A   +   S+ ++ ++GNK+
  S:    27 SNFRELLATDKINYVLCTGNVCSQEYVEMLKNITKNV-YIVSGDLDSAIFNPDPESNGVFPEYVVVQIGEFKIGLMHGNQVLPWDDPG------SLEQWQRRLDCDILVTGHTHKLRVFEKNGKLFLNPGTATGAFSALTPDAPPSFMLMALQGNKV 176
>gi|114646922|ref|XP_509367.2| PREDICTED: hypothetical protein isoform 3 [Pan troglodytes] (214 aa)
Score = 106, Expect = 1.3e-03, Identities = 36/120 (30%), Positives = 64/120 (53%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIV---DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V    FKI      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:    87 DVHIVRGDFDE----NLNYPEQKVVTVGQFKIG-----LIHGHQV---IPWGDMASLALLQ--RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQ 198
>gi|21226854|ref|NP_632776.1| hypothetical protein MM_0752 [Methanosarcina mazei Go1] >gi|20905157|gb|AAM30448.1| conserved protein [Methanosarcina mazei Go1] (171 aa)
Score = 106, Expect = 1.4e-03, Identities = 42/124 (33%), Positives = 62/124 (50%)
  Q:    10 ILIISDTHGDRSFFRKII---NEEQPDIKIHCGDFCTDIDLISENFD------YFVAGNNDYEGERIV-----------------DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPG 133
           I IISD+H + +  RK +   N++Q    +H GD  +   +    F       YFV GNND  G+R+                  D  I+ L+  L+HG             E  +   AK  + D++  GHTH   V   D   ++NPG
  S:     7 IGIISDSHDNLAAIRKAVEFFNKKQVKAVLHAGDIISPFTV--REFKELNPKLYFVFGNND--GDRVTLTKKFEEIGAVSCGDFGDLTIDGLHIALLHGTD-----------ETLVRALAKSGDFDVVVRGHTHNAGVKMIDGTPVLNPG 141
>gi|147920036|ref|YP_686207.1| putative serine/threonine protein phosphatase [uncultured methanogenic archaeon RC-I] >gi|110621603|emb|CAJ36881.1| putative serine/threonine protein phosphatase [uncultured methanogenic archaeon RC-I] (230 aa)
Score = 106, Expect = 1.4e-03, Identities = 34/113 (30%), Positives = 52/113 (46%)
  Q:    38 CGDFCTDIDLISENFDYFVAGNNDYEGERIV----DFKIEDLNCRLMHGDQ---FGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVL 150
           CG     + + +  + + V  + D E  R +    D +I+ L  +++HG     F Y  P       KL EY      D L +GHTH   V       ++NPGS+  PR+ +   S  VL
  S:    72 CGYKYKHLSVATREYTWKVLSDADMEFLRGLPLSRDLEIDGLKLKMVHGSPESFFDYLYPDIAPE--KLAEYTAGITSDYLLTGHTHFPAVLKAPTTTVLNPGSVGQPRDKDWRASCMVL 189
>gi|150021124|ref|YP_001306478.1| phosphodiesterase [Thermosipho melanesiensis BI429] >gi|149793645|gb|ABR31093.1| phosphodiesterase, MJ0936 family [Thermosipho melanesiensis BI429] (184 aa)
Score = 106, Expect = 1.5e-03, Identities = 50/145 (34%), Positives = 78/145 (53%)
  Q:     9 KILIISDTHGDRSFFRKIIN-EEQPDIKIHCGDFCTD----------------IDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGY--SVPGY-------ERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           +IL+ISDTHG    + KI N  +  D   H GD                     +L   N +Y V GN D +    VD K+  LN + M      Y  ++P Y       E     L  +AK++++ I+  GHTHI ++   + +++ NPGSL  P+     K+Y ++ I+
  S:     2 RILVISDTHGSLKNWEKIKNIVDSVDEVFHLGDILYHGPRNPLPDGYDPKNLAEELKKTNVNY-VRGNCDAD----VDLKV--LNIQEMPKQIIEYFGNLPVYFFHGEVIEDDGFDLIAFAKKHDVKIVLHGHTHIPKIEEIEGVVVANPGSLSLPKRGFP-KTYMIIDID 164
>gi|126460040|ref|YP_001056318.1| phosphodiesterase [Pyrobaculum calidifontis JCM 11548] >gi|126249761|gb|ABO08852.1| phosphodiesterase, MJ0936 family [Pyrobaculum calidifontis JCM 11548] (166 aa)
Score = 106, Expect = 1.6e-03, Identities = 48/144 (33%), Positives = 68/144 (47%)
  Q:    10 ILIISDTHGDRSFFRK---IINEEQPDIKIHCGDFCTDIDL------ISENFDYFVAGNNDYEGERI------VDFKIEDLNCRLMHGDQFGYSVPGYER-------RELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS---LMYPRNANQMKSYAVLHIE 153
           + +ISDTH D    R+   ++    P   IH GD+ +   L      + +   Y V GNN  EG++I         K+E L      GD  G    G  R        EL L    +    DI+  GHTH   + + D  L+INPG      + R        + LH+E
  S:     3 VAVISDTHDDWVAIRRFGELVKRRGPAFIIHAGDWTSPFSLMKMRKAVGDMPIYTVLGNN--EGDKINFARQAAAHKVEIL------GDA-GLIEAGGRRIGVYHGTSELILEALIRSKMFDIVVYGHTHKVDIRHVDGTLVINPGEACGCAHERKTAAFLDLSTLHVE 162
>gi|169188488|ref|ZP_02848587.1| phosphodiesterase, MJ0936 family [Paenibacillus sp. JDR-2] >gi|169004780|gb|EDS51636.1| phosphodiesterase, MJ0936 family [Paenibacillus sp. JDR-2] (168 aa)
Score = 106, Expect = 1.7e-03, Identities = 49/151 (32%), Positives = 81/151 (53%)
  Q:     9 KILIISDTHGDR---SFFRKIINE-EQPDIKIHCGDFCTDIDLISENFDYF----VAGNNDYEGERIVDF----KIEDLNCR---LMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           KI+++SDTH  R   +   +++ E    D+ +H GD+ T  D+  E   +     VAGNND  GE IV      KI +   +   L+HG    YS    E+     +  A+   +D +  GH+H+  +  ++ IL+ NPGS    R   Q  S+ ++ I   ++K+
  S:     2 KIVVVSDTHMPRMAKALPPRLLAELANADLILHAGDW-TSSDVYRELAKFAPVKGVAGNND--GETIVKKLGFKKIVNAGGKRIGLVHG-HLPYSGKKAEQNAALSFTAAQ---VDAIVFGHSHVPYLKEQNGILLFNPGSATAKRKQPQY-SFGIMSIIEGELKA 159
>gi|42527086|ref|NP_972184.1| phosphoesterase, putative [Treponema denticola ATCC 35405] >gi|41817510|gb|AAS12095.1| phosphoesterase, putative [Treponema denticola ATCC 35405] (219 aa)
Score = 105, Expect = 1.7e-03, Identities = 28/87 (32%), Positives = 47/87 (54%)
  Q:    79 LMHGDQFGYSVPGYERRELK-LYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           L HG +F      Y   EL  L  +A++ +  +   GHTH+  +   + I +INPGS+  PR  +  KSY +L +  +   S+EF+++
  S:   139 LTHGHEF------YVDFELNTLLNFARQQDCSVAVFGHTHVPLIKEVNGIFLINPGSVSRPRMGSN-KSYGILTMSKDAKPSMEFKNL 219
>gi|187776871|ref|ZP_02993344.1| hypothetical protein CLOSPO_00410 [Clostridium sporogenes ATCC 15579] >gi|187775530|gb|EDU39332.1| hypothetical protein CLOSPO_00410 [Clostridium sporogenes ATCC 15579] (154 aa)
Score = 105, Expect = 1.7e-03, Identities = 42/127 (33%), Positives = 68/127 (53%)
  Q:    33 DIKIHCGDFCTDIDLISENFDYFVAG---NNDYEGERIVDFKIEDLNCRLMHGDQFG-YSVPGYERREL-KLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMK--SYAVLHIEGNKIKS 159
           D+ IH GDF +   L        V G   NND  G R    ++++     ++G + G +   G E+  L ++Y   K +N+DI+  GH+H   +  K+  LIINPGS   P    + +  SY VL ++ +KI++
  S:    20 DLIIHLGDFTSPRVLEKIKKKKKVIGVWGNNDRSGLRQ---ELKEKEIVTLNGYKIGLFHGHGTEKNTLDRVYNIFKNDNVDIILFGHSHQPMIKTKNKTLIINPGS---PSKKIRERWFSYVVLTLKKDKIEA 147
>gi|124028186|ref|YP_001013506.1| diadenosine tetraphosphatase-related serine/threonine protein phosphatase [Hyperthermus butylicus DSM 5456] >gi|123978880|gb|ABM81161.1| diadenosine tetraphosphatase-related serine/threonine protein phosphatase [Hyperthermus butylicus DSM 5456] (251 aa)
Score = 105, Expect = 1.7e-03, Identities = 30/98 (30%), Positives = 53/98 (54%)
  Q:    66 RIVDFKIEDLNCRLMHGDQ----FGYSVPGYERRELKLYEYA-------KENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGN--KIKSVEFE 163
           ++   ++ +L   + HG      +GY  P     EL+L           +    D++  GHTHI      D + I+NPGS+  PR+ +   SYA+L +E    +I+ V+++
  S:   107 KVYSGQVSNLKVYMAHGSPRNPLYGYLRPNLPADELRLALTPSMAALKPRPVKADLVVVGHTHIPVDMTIDWVRIVNPGSVGQPRDGDPRASYAILDVEKGSLEIRRVKYD 217
>gi|134046272|ref|YP_001097757.1| phosphodiesterase [Methanococcus maripaludis C5] >gi|132663897|gb|ABO35543.1| phosphodiesterase, MJ0936 family [Methanococcus maripaludis C5] (171 aa)
Score = 105, Expect = 1.8e-03, Identities = 48/125 (38%), Positives = 69/125 (55%)
  Q:     9 KILIISDTHGDRSFFRKII---NEEQPDIKIHCGDFCTDIDLIS-ENFD---YFVAGNNDYEGERIV----------DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPG 133
           KI I+SDTH      RK I   N+E+ D+ IHCGDF +   +   EN +     V GNND  GE+ +          D ++E+       G +F + + G     L+    +KE   D++  GHTH  Q    D +L+INPG
  S:     2 KIGIMSDTHDHLPNIRKAIAVFNDEKVDMVIHCGDFVSLFVIKEFENLNSKIVGVLGNND--GEKTLLKEWLKEIDPDNELENYVSFETDGHKF-FVLHGTHAPILEAVIKSKE--YDVVIHGHTHERQFEEIDGVLVINPG 138
>gi|159904904|ref|YP_001548566.1| phosphodiesterase [Methanococcus maripaludis C6] >gi|159886397|gb|ABX01334.1| phosphodiesterase, MJ0936 family [Methanococcus maripaludis C6] (171 aa)
Score = 105, Expect = 1.9e-03, Identities = 47/125 (37%), Positives = 69/125 (55%)
  Q:     9 KILIISDTHGDRSFFRKII---NEEQPDIKIHCGDFCTDIDLIS-ENFDYFVAG---NNDYEGERIV----------DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPG 133
           KI I+SDTH      RK I   N+E+ D+ IHCGDF +   +   EN +  + G   NND  GE+ +          D ++E+       G +F + + G     L+    +KE   D++  GHTH  Q    D +L+INPG
  S:     2 KIGIMSDTHDHLPNIRKAIAVFNDEKVDMVIHCGDFVSLFVIKEFENLNSKIVGVFGNND--GEKTLLKEWLKEIDSDNELENYVSFETDGHKF-FVLHGTHAPVLEAVIKSKE--YDVVIHGHTHERQFEEIDGVLVINPG 138
>gi|47459138|ref|YP_016000.1| phosphoesterase protein [Mycoplasma mobile 163K] >gi|47458467|gb|AAT27789.1| predicted phosphoesterase protein [Mycoplasma mobile 163K] (176 aa)
Score = 105, Expect = 1.9e-03, Identities = 38/154 (24%), Positives = 76/154 (49%)
  Q:     4 VVDMKKILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFDYFVAGNND-YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLY--EYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           +++ KKILI++ T+ +R    +II +E P+  IH G+   +I  + + F+ FV G ND ++ +    F + + +  L    +   ++    R  ++ Y  + A ++        ++    V  +  I I+NPGS++       + SY ++ I G  I
  S:    17 IMETKKILIVARTYSNRKLLEEIIKKESPNFLIHAGNHEEEIGYMEKYFNQFVNGENDNFDTDLSKIFNVFNFSFHL----ESNLNLIKITRSNIEKYTSDLAIKSGSKFFIFSNSDEPSVKNEGTIFILNPGSIVKSVWNKFIGSYILVFINGESI 169
>gi|157738435|ref|YP_001491119.1| hypothetical protein Abu_2236 [Arcobacter butzleri RM4018] >gi|157700289|gb|ABV68449.1| conserved hypothetical protein [Arcobacter butzleri RM4018] (170 aa)
Score = 105, Expect = 1.9e-03, Identities = 46/127 (36%), Positives = 67/127 (52%)
  Q:     9 KILIISDTHGDRSFFRKIIN---EEQPDIKIHCGDFCTD--IDLISE-NFDYFVA-GNNDYEGERIVD----------FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSL 135
           KI I+SD+H    + +++I+   E+  +  IH GDFC +  + L+ E N  Y V  GNND +   +            FKIEDL  +LMH       +P         Y    ++NI I   GHTH     Y +  L +NPG +
  S:     2 KIGILSDSHLKSGYAKEVIDLLKEKNCEYLIHAGDFCCEKNLQLLKESNLKYIVVFGNNDRDLFDLASKYNIKSEPYYFKIEDLKFKLMH-------LP---------YHLTPDSNIVIF--GHTHKFHCEYTNKTLFLNPGEV 127
>gi|14520848|ref|NP_126323.1| hypothetical protein PAB1944 [Pyrococcus abyssi GE5] >gi|5458064|emb|CAB49554.1| Phosphoesterase, putative [Pyrococcus abyssi GE5] (170 aa)
Score = 105, Expect = 1.9e-03, Identities = 43/155 (27%), Positives = 73/155 (47%)
  Q:     9 KILIISDTHGDRSFFR---KIINEEQPDIKIHCGDFCTDIDLISENFDYF------VAGNNDYEGE----------RIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           K+ I+SDTH +    R      N+E+ D+ IH GD+      ++            V GNND E E           I+   ++DL   ++HG             E  +   AK    DI+  GHTH  ++      +++NPG +        +KS A+L+ +  +++ +  E
  S:     2 KVGIMSDTHDNLPAIRLAVDFFNKEKVDLVIHAGDYVAP--FVARELSKLNAPLRGVFGNNDGEREGLKEKLGIKDEILTLNLDDLKVIVLHGTD-----------ERIVEALAKSQLYDIVIRGHTHRHRIQEVGRTIVVNPGEVC--GYLTGVKSVAILNTKEREVRIINLE 160
>gi|170289494|ref|YP_001739732.1| phosphodiesterase [Thermotoga sp. RQ2] >gi|170176997|gb|ACB10049.1| phosphodiesterase, MJ0936 family [Thermotoga sp. RQ2] (187 aa)
Score = 105, Expect = 2.0e-03, Identities = 47/154 (30%), Positives = 81/154 (52%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQPDIKI-HCGDFCTD---------------IDLISENFDYFVAGNNDYEGE-RIVDFK---------IEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---------NQMKSYAVLHIEGNKIKSVEF 162
           +IL+ISDTHG  S   K +       +I H GD                     L+ ++   ++ GN D + + R+++           + D+   L+HGDQF Y   G +   L     A+ +   ++  GHTH+      + +L++NPGS+  P++             K Y +  +EG+ +K V F
  S:     2 RILVISDTHGSLSCTEKALKSAGNFDEIWHLGDVLYHGPRNPLPEGYSPKELSSLLKKHRVKYIRGNCDADVDIRVLEIPEMPRIGMEFLGDVKILLVHGDQFEYE--GGDPVSL-----AQAHGCSVVLFGHTHVPLAERCEGVLLLNPGSVSLPKSEVGPTFGIIDTDEKKYYLCSLEGDVLKEVMF 183
>gi|84393788|ref|ZP_00992535.1| predicted phosphoesterase [Vibrio splendidus 12B01] >gi|84375585|gb|EAP92485.1| predicted phosphoesterase [Vibrio splendidus 12B01] (181 aa)
Score = 105, Expect = 2.0e-03, Identities = 22/54 (40%), Positives = 35/54 (64%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNAN-------QMKSYAVLHIEGNKIKSVEF 162
           DI+  GHTHI    Y+D+I I NP S+ +PR+ +       +  ++ V+ +EG+ I S E 
  S:   121 DIIAHGHTHIPVAEYQDDIFIFNPSSVTFPRDGHAASHGIYENNTFKVISLEGDVIVSGEL 181
>gi|156973619|ref|YP_001444526.1| phosphodiesterase [Vibrio harveyi ATCC BAA-1116] >gi|156525213|gb|ABU70299.1| hypothetical protein VIBHAR_01322 [Vibrio harveyi ATCC BAA-1116] (181 aa)
Score = 104, Expect = 2.3e-03, Identities = 25/60 (41%), Positives = 36/60 (60%)
  Q:    99 LYEYAKENNI---DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           LY  AK   +   DI+  GHTH+     +D  +I NPGS+ +PRN    +SY ++  EGN +K
  S:   108 LYNSAKRPPLREGDIIAHGHTHVPVAEMQDGAVIFNPGSMTFPRNGLS-RSYGLM--EGNTLK 167
>gi|73667688|ref|YP_303703.1| hypothetical protein Mbar_A0138 [Methanosarcina barkeri str. Fusaro] >gi|72394850|gb|AAZ69123.1| conserved hypothetical protein [Methanosarcina barkeri str. Fusaro] (166 aa)
Score = 104, Expect = 2.4e-03, Identities = 47/154 (30%), Positives = 77/154 (50%)
  Q:    10 ILIISDTHGDRSFFRKII---NEEQPDIKIHCGDFCTDI------DLISENFDYFVAGNNDYEGERIV-----------------DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           I IISD+H + +  RK +   NE++    +H GD  +        DL  E+  YFV GNND  G+++                  D  I+ L+  L+HG             E+ +   A+    D++  GHTH   V   + + +INPG      +  Q  + A+L I    ++ ++ E
  S:     2 IGIISDSHDNMNAIRKSVEFFNEKKVKAVLHAGDLISPFTAGAFKDL--ESKLYFVFGNND--GDKVTLTKRFEEIGAISCGNFGDLTIDGLHIGLLHGTN-----------EVLVKALARSGEFDVVVRGHTHDPGVKIIEGVPVINPGEASGVLSGKQ--TVAILEIANLNVEIMQLE 164
>gi|157164711|ref|YP_001467370.1| Ser/Thr protein phosphatase family protein [Campylobacter concisus 13826] >gi|112802036|gb|EAT99380.1| Ser/Thr protein phosphatase family protein [Campylobacter concisus 13826] (227 aa)
Score = 104, Expect = 2.4e-03, Identities = 18/44 (40%), Positives = 28/44 (63%)
  Q:   114 GHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           GHTHI  + YK+   +INPGS+  PR+  +  SYA++  + N +
  S:   148 GHTHIPSILYKNGTCVINPGSVGQPRDYTKQSSYAIIDFQKNNV 191
>gi|71029586|ref|XP_764436.1| hypothetical protein TP04_0799 [Theileria parva strain Muguga] >gi|68351390|gb|EAN32153.1| hypothetical protein, conserved [Theileria parva] (213 aa)
Score = 104, Expect = 2.5e-03, Identities = 30/140 (21%), Positives = 66/140 (47%)
  Q:    25 KIINEEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLM---YPRNANQMKSYAVLHIEGNKIKSVEFED 164
           +++N+  P + I  GD+                 ++D+     +   + DL   +++G    Y +P +  ++L L + A + N+DIL  GH+H+  +      + +NPGS      P     + ++ ++ I+G+K+    +E+
  S:    56 EVLNDISPSLHIVQGDY-----------------DDDFNHPETLTINVGDLKIGVING----YQIPTWNNKDL-LLKVAVDMNVDILVYGHSHVSDISKHGGKIFVNPGSATGCYQPWQPKSIPTFMLMAIQGSKVVIYVYEE 176
>gi|126324244|ref|XP_001372813.1| PREDICTED: hypothetical protein [Monodelphis domestica] (200 aa)
Score = 104, Expect = 2.5e-03, Identities = 33/120 (27%), Positives = 62/120 (51%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:    73 DVHIVRGDFDE----NLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQ 184
>gi|153894657|ref|ZP_02015241.1| phosphodiesterase, MJ0936 family [Halorubrum lacusprofundi ATCC 49239] >gi|151587255|gb|EDN50678.1| phosphodiesterase, MJ0936 family [Halorubrum lacusprofundi ATCC 49239] (184 aa)
Score = 104, Expect = 2.6e-03, Identities = 47/144 (32%), Positives = 69/144 (47%)
  Q:     9 KILIISDTHGDRSFFRKIIN---EEQPDIKIHCGDFC-----TDIDLISEN---FDYFVA-GNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNI-----------DILFSGHTHIEQVFYKDNILIINPGSLMYPRN-ANQMKSYAVLHI 152
           +I I+SDTH D +     +     E  D  +HCGDF      T  D+  ++   FD++ A GNND  GE  V   +E     L       +   G E   + +      + +           D +F GHTH      +D  + +NPG L  P + A+     AVL I
  S:     2 RIGIVSDTHDDLAAVEAAVTLFEREGVDAVVHCGDFVAPFSVTPFDVGGDSDAGFDFYAARGNND--GEWAVQSTVESFGTYLGEAGTLSF---GDEENAVDIAVTHGTSAVVVDALVDCGDYDYVFHGHTHAHDAEERDGTVRVNPGGLPIPVDGADDAFRVAVLDI 164
>gi|123471040|ref|XP_001318722.1| phosphodiesterase, MJ0936 family protein [Trichomonas vaginalis G3] >gi|121901488|gb|EAY06499.1| phosphodiesterase, MJ0936 family protein [Trichomonas vaginalis G3] (184 aa)
Score = 104, Expect = 2.6e-03, Identities = 37/130 (28%), Positives = 61/130 (46%)
  Q:    28 NEEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLM--YPRNA-NQMKSYAVLHIEGNKI 157
           N   PD        C D+ ++  ++D  +   ++        FKI      ++HG Q    +P  +    +L    +E N+DIL SG TH+  V   +NIL +NPGSL   Y   A     S+ VL ++ +++
  S:    39 NLTTPDQMAWIKSLCKDVTVVYGDYDEKMTDVSERATLSAGSFKIG-----VIHGHQV---LPWGDPE--RLGAVGREMNVDILVSGQTHVASVSTYENILFLNPGSLTGAYSNTATTSTPSFMVLDVKKDQM 161
>gi|167037978|ref|YP_001665556.1| phosphodiesterase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167040875|ref|YP_001663860.1| phosphodiesterase [Thermoanaerobacter sp. X514] >gi|166855115|gb|ABY93524.1| phosphodiesterase, MJ0936 family [Thermoanaerobacter sp. X514] >gi|166856812|gb|ABY95220.1| phosphodiesterase, MJ0936 family [Thermoanaerobacter pseudethanolicus ATCC 33223] (184 aa)
Score = 104, Expect = 2.6e-03, Identities = 42/155 (27%), Positives = 79/155 (50%)
  Q:     9 KILIISDTHGDRSFFRKIIN-EEQPDIKIHCGD--FCTDIDLISENFD---------------YFVAGNND-YEGERIVDFKIEDLNC-RLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           KI +ISDTHGD   + K  +  +  DI +H GD  +    + I E +D                   GN D Y  + +++  I+       + G +F  +  G+   +  +++  K+  +D   +GHTHI  +   +N ++INPGS    +  +++ S   + +E   +  ++ E
  S:     2 KIGVISDTHGDYKSWEKAWDFLKDSDIILHAGDVLYHGPRNPIPEGYDPKKLADAINACPVPLLIAEGNCDAYVDQMMLEVPIQTPYVFAFIEGKRFMIN-HGHSISDEDIHKLIKKYKLDYFITGHTHIPLIKKIENCVVINPGSTSLSKREDKINSVGFIEVESGSVHIIDLE 175
>gi|76801016|ref|YP_326024.1| serine/threonine protein phosphatase; bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Natronomonas pharaonis DSM 2160] >gi|76556881|emb|CAI48455.1| serine/threonine protein phosphatase; bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Natronomonas pharaonis DSM 2160] (219 aa)
Score = 104, Expect = 2.7e-03, Identities = 26/80 (32%), Positives = 44/80 (55%)
  Q:    74 DLNCRLMHG---DQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           D   +L+HG   D   Y+ PG    EL   E       D+L  GHTH++ +   D  +++NPGS+  PR+ +   +YA++ ++
  S:   107 DGRLKLVHGHPDDPDRYTYPGLFSPELLGDE-------DVLVMGHTHVQAIEQYDEGIVLNPGSVGQPRDGDPRAAYALVDLD 182
>gi|119618325|gb|EAW97919.1| vacuolar protein sorting 29 (yeast), isoform CRA_b [Homo sapiens] (186 aa)
Score = 104, Expect = 2.8e-03, Identities = 33/120 (27%), Positives = 62/120 (51%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:    59 DVHIVRGDFDE----NLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQ 170
>gi|71042152|pdb|1Z2W|A Chain A, Crystal Structure Of Mouse Vps29 Complexed With Mn2+ >gi|71042153|pdb|1Z2W|B Chain B, Crystal Structure Of Mouse Vps29 Complexed With Mn2+ >gi|71042154|pdb|1Z2X|A Chain A, Crystal Structure Of Mouse Vps29 >gi|71042155|pdb|1Z2X|B Chain B, Crystal Structure Of Mouse Vps29 (192 aa)
Score = 103, Expect = 2.9e-03, Identities = 33/120 (27%), Positives = 62/120 (51%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:    65 DVHIVRGDFDE----NLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQ 176
>gi|109098716|ref|XP_001107745.1| PREDICTED: similar to Vacuolar protein sorting 29 (Vesicle protein sorting 29) isoform 1 [Macaca mulatta] (197 aa)
Score = 103, Expect = 3.0e-03, Identities = 33/120 (27%), Positives = 62/120 (51%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:    70 DVHIVRGDFDE----NLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQ 181
>gi|17402912|ref|NP_476528.1| vacuolar protein sorting 29 isoform 2 [Homo sapiens] >gi|9437347|gb|AAF87318.1|AF168716_1 x 007 protein [Homo sapiens] >gi|12654131|gb|AAH00880.1| Vacuolar protein sorting 29 homolog (S. cerevisiae) [Homo sapiens] >gi|48146481|emb|CAG33463.1| VPS29 [Homo sapiens] (186 aa)
Score = 103, Expect = 3.0e-03, Identities = 33/120 (27%), Positives = 62/120 (51%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:    59 DVHIVRGDFDE----NLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQ 170
>gi|149408841|ref|XP_001505645.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus] (204 aa)
Score = 103, Expect = 3.0e-03, Identities = 33/120 (27%), Positives = 62/120 (51%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:    77 DVHIVRGDFDE----NLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQ 188
>gi|77735861|ref|NP_001029627.1| vacuolar protein sorting 29 [Bos taurus] >gi|57105600|ref|XP_534675.1| PREDICTED: similar to vacuolar protein sorting 29 isoform 2 isoform 1 [Canis familiaris] >gi|73994602|ref|XP_861614.1| PREDICTED: similar to vacuolar protein sorting 29 isoform 2 isoform 3 [Canis familiaris] >gi|109098714|ref|XP_001107808.1| PREDICTED: similar to vacuolar protein sorting 29 isoform 2 isoform 2 [Macaca mulatta] >gi|114646924|ref|XP_001143558.1| PREDICTED: hypothetical protein isoform 1 [Pan troglodytes] >gi|149720674|ref|XP_001495149.1| PREDICTED: similar to vacuolar sorting protein VPS29 isoform 2 [Equus caballus] >gi|122140384|sp|Q3T0M0|VPS29_BOVIN Vacuolar protein sorting-associated protein 29 (Vesicle protein sorting 29) >gi|12835154|dbj|BAB23170.1| unnamed protein product [Mus musculus] >gi|74267950|gb|AAI02342.1| Vacuolar protein sorting 29 homolog (S. cerevisiae) [Bos taurus] (186 aa)
Score = 103, Expect = 3.1e-03, Identities = 33/120 (27%), Positives = 62/120 (51%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:    59 DVHIVRGDFDE----NLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQ 170
>gi|27527039|emb|CAC81245.1| putative YsnB protein [Listeria ivanovii] (123 aa)
Score = 103, Expect = 3.2e-03, Identities = 25/68 (36%), Positives = 42/68 (61%)
  Q:    97 LKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLH--IEGNKIKSVEFED 164
           + L   A+E N D  F GH+H   V   D+ +I+NPGS+  PR   ++K+YA++    EG K++ ++ +D
  S:    38 MNLRYRARELNADFAFFGHSHELGVDMLDDTIILNPGSISLPRGRIRVKTYALIDSTSEGIKVRFMDRDD 107
>gi|157963870|ref|YP_001503904.1| phosphodiesterase [Shewanella pealeana ATCC 700345] >gi|157848870|gb|ABV89369.1| phosphodiesterase, MJ0936 family [Shewanella pealeana ATCC 700345] (185 aa)
Score = 103, Expect = 3.4e-03, Identities = 20/58 (34%), Positives = 36/58 (62%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDVV 166
           D L  GHTHI    Y+D+IL+ NPGS   PRN  +  SY ++     ++++++ ++++
  S:   120 DALVYGHTHIAVAEYRDDILLFNPGSTTIPRNGAR-ASYGLITDTECQVRAIDNDELL 176
>gi|7706441|ref|NP_057310.1| vacuolar protein sorting 29 isoform 1 [Homo sapiens] >gi|25453325|sp|Q9UBQ0|VPS29_HUMAN Vacuolar protein sorting-associated protein 29 (Vesicle protein sorting 29) (hVPS29) (PEP11) >gi|62738178|pdb|1W24|A Chain A, Crystal Structure Of Human Vps29 >gi|6164955|gb|AAF04596.1|AF193795_1 vacuolar sorting protein VPS29/PEP11 [Homo sapiens] >gi|6563290|gb|AAF17238.1|AF201946_1 DC7 protein [Homo sapiens] >gi|9622848|gb|AAF89952.1|AF175264_1 vacuolar sorting protein 29 [Homo sapiens] >gi|63102177|gb|AAH95446.1| Vacuolar protein sorting 29 homolog (S. cerevisiae) [Homo sapiens] >gi|119618324|gb|EAW97918.1| vacuolar protein sorting 29 (yeast), isoform CRA_a [Homo sapiens] (182 aa)
Score = 103, Expect = 3.4e-03, Identities = 33/120 (27%), Positives = 62/120 (51%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:    55 DVHIVRGDFDE----NLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQ 166
>gi|56808579|ref|ZP_00366310.1| COG0622: Predicted phosphoesterase [Streptococcus pyogenes M49 591] (165 aa)
Score = 103, Expect = 3.4e-03, Identities = 49/158 (31%), Positives = 71/158 (44%)
  Q:    13 ISDTHGDRSFFRKIINEE--QPDIKIHCGDF-CTDIDLISENFDYFVAGNNDYEG---ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF-EDVVKYPA 170
           +SD+HGDR   + I ++   Q D   H GD      D I     Y V GN DY+    +R+V  ++  +     HG  +  +         KL  +A+E   DI   GH H    +     L +NPGS+  PR     K YA + +   +IK   F  D   YP+
  S:     1 MSDSHGDRDIVQAIKDKYLGQVDAIFHNGDSELNSSDPIWAGI-YVVGGNCDYDTGYPDRLVT-QLGTVTIAQTHGHLYHINFTWD-----KLDYFAQEVAADICLYGHLHRPAAWQVGQTLFMNPGSVTQPRGEINEKLYARVELTDTQIKVDYFTRDHKLYPS 158
>gi|75041805|sp|Q5R9Z1|VPS29_PONAB Vacuolar protein sorting-associated protein 29 (Vesicle protein sorting 29) >gi|55729374|emb|CAH91419.1| hypothetical protein [Pongo abelii] (182 aa)
Score = 103, Expect = 3.5e-03, Identities = 33/120 (27%), Positives = 62/120 (51%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRN---ANQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     N   AN + S+ ++ I+ + + +  ++
  S:    55 DVHIVRGDFDE----NLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALEANIIPSFVLMDIQASTVVTYVYQ 166
>gi|59006672|emb|CAI46196.1| hypothetical protein [Homo sapiens] (181 aa)
Score = 103, Expect = 3.6e-03, Identities = 33/120 (27%), Positives = 62/120 (51%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:    54 DVHIVRGDFDE----NLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQ 165
>gi|9295176|gb|AAF86872.1|AF201936_1 DC15 [Homo sapiens] (188 aa)
Score = 103, Expect = 3.6e-03, Identities = 33/120 (27%), Positives = 62/120 (51%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:    61 DVHIVRGDFDE----NLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQ 172
>gi|9790285|ref|NP_062754.1| vacuolar protein sorting 29 [Mus musculus] >gi|73994600|ref|XP_861583.1| PREDICTED: similar to Vacuolar protein sorting 29 (Vesicle protein sorting 29) isoform 2 [Canis familiaris] >gi|109098718|ref|XP_001107873.1| PREDICTED: similar to Vacuolar protein sorting 29 (Vesicle protein sorting 29) isoform 3 [Macaca mulatta] >gi|114646926|ref|XP_001143634.1| PREDICTED: similar to vacuolar sorting protein VPS29 isoform 2 [Pan troglodytes] >gi|149720676|ref|XP_001495130.1| PREDICTED: similar to vacuolar sorting protein VPS29 isoform 1 [Equus caballus] >gi|25453324|sp|Q9QZ88|VPS29_MOUSE Vacuolar protein sorting-associated protein 29 (Vesicle protein sorting 29) >gi|6164953|gb|AAF04595.1|AF193794_1 vacuolar sorting protein VPS29 [Mus musculus] >gi|13542952|gb|AAH05663.1| Vacuolar protein sorting 29 (S. pombe) [Mus musculus] >gi|74219384|dbj|BAE29472.1| unnamed protein product [Mus musculus] >gi|148687739|gb|EDL19686.1| vacuolar protein sorting 29 (S. pombe) [Mus musculus] (182 aa)
Score = 103, Expect = 3.6e-03, Identities = 33/120 (27%), Positives = 62/120 (51%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:    55 DVHIVRGDFDE----NLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQ 166
>gi|71663476|ref|XP_818730.1| vacuolar sorting protein, putative [Trypanosoma cruzi strain CL Brener] >gi|70883998|gb|EAN96879.1| vacuolar sorting protein, putative [Trypanosoma cruzi] (192 aa)
Score = 103, Expect = 3.7e-03, Identities = 29/91 (31%), Positives = 49/91 (53%)
  Q:    72 IEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSL---MYPRNANQMKSYAVLHIEGNKIKSVEF 162
           +EDL   L+HG Q    VP  +R  L + +  ++ ++D+L SG TH  + F  D  L INPGS+     P + +   ++ +L I+   + S  +
  S:    80 VEDLKIGLVHGHQV---VPCGDRDSLAILQ--RKLDVDVLVSGATHHCKTFEFDGHLFINPGSITGAFTPAHLDVTPTFVLLDIKEKTVTSFSY 168
>gi|163799800|ref|ZP_02193707.1| phosphodiesterase, MJ0936 family [Methanococcus voltae A3] >gi|158973807|gb|EDP41275.1| phosphodiesterase, MJ0936 family [Methanococcus voltae A3] (176 aa)
Score = 103, Expect = 3.7e-03, Identities = 43/125 (34%), Positives = 65/125 (52%)
  Q:     9 KILIISDTHGDRSFFRK---IINEEQPDIKIHCGDFCTDIDLISE--NFD---YFVAGNNDYEGERI----------------VDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPG 133
           KI +ISDTH      RK   + N    D+ IHCGDF + + +++E  N +   Y   GNND E  R+                + F +E+L   ++HG                L    +    D++  GHTH ++    D +L+INPG
  S:     2 KIGLISDTHDYLPNIRKAVQVFNRFNVDLVIHCGDFVS-LFVVNEFKNLNAKLYATYGNNDGEKTRLKEWFLEANPENKVEDSLSFDVENLKFFVLHGQDGNI-----------LDSIIRSKKYDVVVHGHTHEQKFEEVDGVLVINPG 138
>gi|28211458|ref|NP_782402.1| phosphodiesterase [Clostridium tetani E88] >gi|28203899|gb|AAO36339.1| putative phosphoesterase [Clostridium tetani E88] (181 aa)
Score = 102, Expect = 4.0e-03, Identities = 54/155 (34%), Positives = 78/155 (50%)
  Q:     9 KILIISDTHGDRSFFRKIIN---EEQPDIKIHCGD-----------------FCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKL---YEYAKEN-----NIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           K+  ISD HG   +  K+IN   +E+ D  +  GD                    +I    +N    V GN D E +++V      LN  +M      YS+  Y  R L L   + Y K N     N D+   GHTH+      +NI IINPGS+ +P+  N    Y +L      IK+++ E
  S:     2 KLFFISDIHGSSYYLEKVINIYEKEKADYLVILGDELYHGARNPLPKEYNPKKVAEILNKYKNKIIAVRGNCDSEVDQMV------LNYPIMS----DYSIILYNNRRLFLTHGHIYNKNNLPTISNGDVFIYGHTHVPLAKRINNIFIINPGSITFPKE-NTPHCYGILENNTFIIKTLDGE 173
>gi|149179758|ref|ZP_01858263.1| putative phosphoesterase [Bacillus sp. SG-1] >gi|148851950|gb|EDL66095.1| putative phosphoesterase [Bacillus sp. SG-1] (188 aa)
Score = 102, Expect = 4.1e-03, Identities = 50/151 (33%), Positives = 78/151 (51%)
  Q:     9 KILIISDTH---GDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFDYF-----VAGNNDYEG-----ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           K+++ISDTH     + F   +I E +  D+ IH GD+ T ID + E    F     V GN D +       + +    E  +  ++HGD  G +    E+R L+ ++       DI+  GH+HI    Y    L+ NPGS    R      S+ ++ IE ++IKS
  S:    25 KMIVISDTHMPNRGQEFPPVLIKELKSADLIIHAGDWNT-ID-VYEKLKGFGRVEGVYGNTDQQEILETFPKKMVLNAEGYSIGVVHGDGKGKTT---EKRALEAFD----ERPDIIIFGHSHIPYARYSQGTLLFNPGSATDKRK-QPYYSFGIIEIE-SEIKS 178
>gi|193659814|ref|XP_001951880.1| PREDICTED: similar to CG4764 CG4764-PA [Acyrthosiphon pisum] (183 aa)
Score = 102, Expect = 4.2e-03, Identities = 42/153 (27%), Positives = 77/153 (50%)
  Q:     7 MKKILIISDTH------GDRSFFRKIINEEQPDIKIHCGDFCT------------DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS---LMYPRNANQMKSYAVLHIEGNKIKS 159
           M  +L+I D H      G  + F+K++   +    +  G+ CT            D+ ++  +FD     N +Y  +++V+  +      L HG Q    +P  +   L L +  ++ ++D+L  GHTH    F   N   +NPGS      P N + + S+ V+ I+ + + S
  S:     1 MCSVLVIGDMHVPFRSSGLPAQFKKLLTPGKIQHVLCTGNLCTKEMYEFLKSIANDVHIVRGDFDE----NLNYPDQKVVN--VGQFKVGLCHGHQV---IPWGDPESLALLQ--RQLDVDVLVFGHTHKFDAFELGNKFFLNPGSATGAFNPLNPDIIPSFVVMDIQSSTVVS 163
>gi|167038018|ref|YP_001665596.1| phosphodiesterase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856852|gb|ABY95260.1| phosphodiesterase, MJ0936 family [Thermoanaerobacter pseudethanolicus ATCC 33223] (180 aa)
Score = 102, Expect = 4.5e-03, Identities = 43/155 (27%), Positives = 77/155 (49%)
  Q:     9 KILIISDTHGDRSFFRKIIN-EEQPDIKIHCGD--FCTDIDLISENFD---------------YFVAGNND-YEGERIVDFKIEDLNC-RLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           KI +ISDTHGD   + K  N  +  DI +H GD  +    + I E +D                   GN D Y  + +++  I+       + G +F  +  G+   E  +++   +  +D   +GHTHI  +   +N ++INPGS    +  +++ S   + +E      ++ E
  S:     2 KIGVISDTHGDYKSWIKAWNFLKDSDIILHAGDVLYHGPRNPIPEGYDPKKLAVAINACPVPLLIAEGNCDAYVDQMMLEVPIQTPYVFAFIEGKRFMIN-HGHSISEEDIHKLIMKYKLDYFITGHTHIPLIKKIENCVVINPGSTSLSKREDKINSVGFIEVESGSAHIIDLE 175
>gi|168334969|ref|ZP_02693087.1| phosphodiesterase, MJ0936 family protein [Epulopiscium sp. 'N.t. morphotype B'] (182 aa)
Score = 102, Expect = 4.6e-03, Identities = 20/44 (45%), Positives = 30/44 (68%)
  Q:   106 NNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAV 149
           N IDI   GHTH+  +   +NIL++NPGS+  P+  N+ K+YA+
  S:   117 NKIDIFMYGHTHLYDLTLHNNILMLNPGSVALPKE-NRPKTYAI 159
>gi|167622140|ref|YP_001672434.1| phosphodiesterase [Shewanella halifaxensis HAW-EB4] >gi|167352162|gb|ABZ74775.1| phosphodiesterase, MJ0936 family [Shewanella halifaxensis HAW-EB4] (185 aa)
Score = 102, Expect = 4.9e-03, Identities = 21/58 (36%), Positives = 37/58 (63%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDVV 166
           D L  GHTHI    Y+D+IL+ NPGS   PRN ++  SY ++     +I++++ ++++
  S:   120 DGLLYGHTHIAVAEYRDDILLFNPGSTTIPRNDSR-ASYGLITDTECQIRALDNDELL 176
>gi|54309962|ref|YP_130982.1| phosphodiesterase [Photobacterium profundum SS9] >gi|46914401|emb|CAG21180.1| hypothetical phosphoesterase [Photobacterium profundum SS9] (182 aa)
Score = 101, Expect = 5.0e-03, Identities = 39/122 (31%), Positives = 69/122 (56%)
  Q:    46 DLISENFDYFVA--GNNDYEGER-IVDFK-IEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNI---DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE-DVVK 167
           DL+++  D  +A  GN D E ++ ++DF  + D N  L+   +  +   G+      LY   K   +   D++ SGHTHI     K ++++ NPGS+  PR  +Q  S+ +   E N +K++ F+ DV++
  S:    57 DLLNQFGDCIIAVRGNCDSEVDQMLLDFPMLADYNLVLLPNGRRLFLTHGH------LYNADKHPRLKVGDVIVSGHTHIPVAEQKGDLVLFNPGSVTMPRGDHQ-ASFGMF--EDNMLKAITFDGDVLR 177
>gi|15896006|ref|NP_349355.1| phosphodiesterase [Clostridium acetobutylicum ATCC 824] >gi|15025786|gb|AAK80695.1|AE007772_7 Predicted phosphoesterase [Clostridium acetobutylicum ATCC 824] (180 aa)
Score = 101, Expect = 5.1e-03, Identities = 46/152 (30%), Positives = 73/152 (48%)
  Q:     9 KILIISDTHGDRSFFRKII---NEEQPDIKIHCGD-----------FCTDIDLISENFDYF------VAGNNDYE-GERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSV 160
           KI  +SD HG   +  K +    EE  D  +  GD              +   +SE  + +      + GN D E  E ++ + I      +++ D+  +   G+   E  L    +    D+   GHTH+     KD+I IINPGS+  P+  N   SYAV   +  +IK +
  S:     2 KIFFMSDIHGSLHYLEKALARFKEENADFIVILGDELYHGARNPLPLGYNPKAVSELLNSYSEQIIAIRGNCDSEVDEMVLTYPIMSTYSTILYKDKRLFLTHGHVYGEENLPRLRRG---DVFLYGHTHVPVAKKKDDIYIINPGSISIPKE-NSPNSYAVFENDLFEIKDL 170
>gi|45357956|ref|NP_987513.1| phosphodiesterase [Methanococcus maripaludis S2] >gi|44920713|emb|CAF29949.1| phosphoesterase-like protein [Methanococcus maripaludis S2] (171 aa)
Score = 101, Expect = 6.1e-03, Identities = 46/125 (36%), Positives = 69/125 (55%)
  Q:     9 KILIISDTHGDRSFFRKII---NEEQPDIKIHCGDFCTDIDLIS-ENFDYFVAG---NNDYEGERIV----------DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPG 133
           KI I+SDTH      RK I   N+E+ D+ +HCGDF +   +   EN +  + G   NND  GE+ +          D ++E+       G +F + + G     L+    +KE   D++  GHTH  Q    D +L+INPG
  S:     2 KIGIMSDTHDYLPNIRKAIAVFNDEKVDMVVHCGDFVSLFVIKEFENLNSKIVGVFGNND--GEKTLLKEWLKEIDPDNELENYVSFETDGHKF-FILHGTHAPILEAVIQSKE--YDVVIHGHTHERQFEEIDGVLVINPG 138
>gi|153834088|ref|ZP_01986755.1| putative phosphoesterase [Vibrio harveyi HY01] >gi|148869553|gb|EDL68548.1| putative phosphoesterase [Vibrio harveyi HY01] (181 aa)
Score = 101, Expect = 6.4e-03, Identities = 25/59 (42%), Positives = 35/59 (59%)
  Q:    99 LYEYAKENNI---DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           LY  AK   +   DI+  GHTH+     +D  +I NPGS+ +PRN    +SY +L  EGN +
  S:   108 LYNSAKRPPLREGDIIAYGHTHVPVAEMQDGAVIFNPGSMTFPRNGLS-RSYGLL--EGNTL 166
>gi|90579353|ref|ZP_01235163.1| phosphodiesterase [Vibrio angustum S14] >gi|90440186|gb|EAS65367.1| phosphodiesterase [Vibrio angustum S14] (181 aa)
Score = 101, Expect = 6.4e-03, Identities = 36/107 (33%), Positives = 55/107 (51%)
  Q:    56 VAGNNDYEGER-IVDFKI-EDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNI---DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF 162
           V GN D E ++ +++F I  D N  L+   Q  +   G+      LY   K   +   D++ SGHTHI     KD + + NPGS+  PRN     SY +L +  N++  + F
  S:    69 VRGNCDSEVDQMLLEFPIMADYNLVLLPTGQRLFLTHGH------LYNANKHPRLRAGDVIVSGHTHIPVAEAKDELFVFNPGSVAIPRNG-LPASYGLLDV--NQLSVISF 171
>gi|74025838|ref|XP_829485.1| vacuolar sorting protein [Trypanosoma brucei TREU927] >gi|70834871|gb|EAN80373.1| vacuolar sorting protein, putative [Trypanosoma brucei] (226 aa)
Score = 100, Expect = 7.0e-03, Identities = 41/154 (26%), Positives = 79/154 (51%)
  Q:     9 KILIISDTHGDRS---FFRKIINEEQPDIKIHCGDF--CTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSL---MYPRNANQMKSYAVLHIEGNKIKSVEF 162
           ++++I+   G R    +FR I+    PD+    G+F  C   ++ S++     A + D   +      +E L   L+HG Q   ++P  +R  L + +  ++ ++D+L SG TH  +VF     L +NPGS+      R  + + ++ +L I+  K+ S  +
  S:    33 QLVLITGNVGCREMYDYFRSIV----PDVYCAKGEFDSCWWPNVNSKH-----ASDTDKLLQDTHVINVESLRIGLIHGHQ---AIPCGDRDMLAMLQ--RKLDVDVLVSGATHNNKVFEFGGHLFVNPGSITGAFTTRRLDVVPTFVLLDIQDKKVTSFSY 180
>gi|20092991|ref|NP_619066.1| hypothetical protein MA4200 [Methanosarcina acetivorans C2A] >gi|19918309|gb|AAM07546.1| conserved hypothetical protein [Methanosarcina acetivorans C2A] (166 aa)
Score = 100, Expect = 7.1e-03, Identities = 39/124 (31%), Positives = 64/124 (51%)
  Q:    10 ILIISDTHGDRSFFRKII---NEEQPDIKIHCGDFCTDIDLIS-ENFD---YFVAGNNDYEGERIV-----------------DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPG 133
           I IISD+H + +  RK +   N++Q    +H GD  +   + + +  +   YFV GNND  G+++                  D  I+ ++  L+HG             E  +   A+  + D++  GHTH   V   D   +INPG
  S:     2 IGIISDSHDNLTAIRKAVEFFNKKQVKAVLHAGDIISPFTVRAFKELNPKLYFVFGNND--GDKVTLTKWFEEIGAVSCGDFGDLAIQGMHIALLHGTN-----------EALVKALAESGDFDVVVRGHTHDPGVRMIDGTPVINPG 136
>gi|4760827|dbj|BAA77455.1| unnamed protein product [Clostridium histolyticum] (180 aa)
Score = 100, Expect = 7.1e-03, Identities = 21/52 (40%), Positives = 34/52 (65%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSV 160
           DI+ SGHTHI  + + D +  INPGS+  P+  ++  SY +L+ +G  IK++
  S:   120 DIMISGHTHIPSIEHIDGVTFINPGSISIPKGGSE-NSYGILNEDGFSIKNL 170
>gi|183232723|ref|XP_652937.2| vacuolar sorting protein 29 [Entamoeba histolytica HM-1:IMSS] >gi|13276202|emb|CAC34071.1| putative vacuolar sorting protein [Entamoeba histolytica] >gi|62821732|dbj|BAD95806.1| vacuolar protein sorting 29 [Entamoeba histolytica] >gi|169801904|gb|EAL47551.2| vacuolar sorting protein 29 [Entamoeba histolytica HM-1:IMSS] (185 aa)
Score = 100, Expect = 7.5e-03, Identities = 35/119 (29%), Positives = 62/119 (52%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLM---YPRNANQMKSYAVLHIEGNKIKSVEF 162
           ++ ++  +FD  + G N+ E  +I +FKI      LMHG Q    +P  +R  L +Y+  ++ ++DIL +GHTH  +         +NPGS      P   N + S+ +L I  +++   E+
  S:    55 EVHVVKGDFDE-MQGLNETEVIKIGNFKIG-----LMHGHQV---IPWGDREALAIYQ--RQLDVDILITGHTHKLETKEVGGKYFLNPGSATGAYSPLVDNPVPSFMLLEINDSELTIYEY 165
>gi|167390273|ref|XP_001739276.1| vacuolar protein sorting-associated protein, putative [Entamoeba dispar SAW760] >gi|165897050|gb|EDR24318.1| vacuolar protein sorting-associated protein, putative [Entamoeba dispar SAW760] (185 aa)
Score = 100, Expect = 7.7e-03, Identities = 35/119 (29%), Positives = 62/119 (52%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLM---YPRNANQMKSYAVLHIEGNKIKSVEF 162
           ++ ++  +FD  + G N+ E  +I +FKI      LMHG Q    +P  +R  L +Y+  ++ ++DIL +GHTH  +         +NPGS      P   N + S+ +L I  +++   E+
  S:    55 EVHVVKGDFDE-MQGLNETEVIKIGNFKIG-----LMHGHQV---IPWGDREALAIYQ--RQLDVDILITGHTHKLETKEIGGKYFLNPGSATGAYSPLVDNPIPSFMLLEINDSELTIYEY 165
>gi|91225913|ref|ZP_01260882.1| phosphodiesterase [Vibrio alginolyticus 12G01] >gi|91189563|gb|EAS75839.1| phosphodiesterase [Vibrio alginolyticus 12G01] (181 aa)
Score = 100, Expect = 7.7e-03, Identities = 21/49 (42%), Positives = 30/49 (61%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           DI+  GHTH+     +D  +I NPGS+ +PRN    +S+  L  EGNK+
  S:   121 DIIAHGHTHVPVAEMQDGAIIFNPGSMTFPRNG-LPRSFGTL--EGNKL 166
>gi|157786944|ref|NP_001099402.1| vacuolar protein sorting 29 [Rattus norvegicus] >gi|149063370|gb|EDM13693.1| vacuolar protein sorting 29 (S. pombe) (predicted) [Rattus norvegicus] (182 aa)
Score = 99, Expect = 8.5e-03, Identities = 38/125 (30%), Positives = 66/125 (52%)
  Q:    39 GDFCTDIDLISENFDYF---------VAGNND----YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           G+ CT      E++DY          V G+ D    Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:    38 GNLCT-----KESYDYLKTLAGDVHIVRGDFDESLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQ 166
>gi|90412825|ref|ZP_01220825.1| hypothetical phosphoesterase [Photobacterium profundum 3TCK] >gi|90326184|gb|EAS42611.1| hypothetical phosphoesterase [Photobacterium profundum 3TCK] (182 aa)
Score = 99, Expect = 8.5e-03, Identities = 38/117 (32%), Positives = 63/117 (53%)
  Q:    46 DLISENFDYFVA--GNNDYEGER-IVDFK-IEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNI---DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF 162
           DL+++  D  +A  GN D E ++ ++DF  + D N  L+   +  +   G+      LY   K   +   D++ SGHTHI     K ++++ NPGS+  PR  +Q  S+ V   E N +K + F
  S:    57 DLLNQFGDCIIAVRGNCDSEVDQMLLDFPMLADYNLVLLPNGRRLFLTHGH------LYNADKHPRLKVGDVIVSGHTHIPVAEQKGDLVLFNPGSVTMPRGDHQ-ASFGVF--EDNTLKVITF 171
>gi|187469635|gb|AAI67055.1| Vps29 protein [Rattus norvegicus] (186 aa)
Score = 99, Expect = 8.5e-03, Identities = 38/125 (30%), Positives = 66/125 (52%)
  Q:    39 GDFCTDIDLISENFDYF---------VAGNND----YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           G+ CT      E++DY          V G+ D    Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:    42 GNLCT-----KESYDYLKTLAGDVHIVRGDFDESLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQ 170
>gi|87306398|ref|ZP_01088545.1| hypothetical protein DSM3645_08702 [Blastopirellula marina DSM 3645] >gi|87290577|gb|EAQ82464.1| hypothetical protein DSM3645_08702 [Blastopirellula marina DSM 3645] (160 aa)
Score = 99, Expect = 9.0e-03, Identities = 40/127 (31%), Positives = 65/127 (51%)
  Q:     9 KILIISDTHGDRSFFR---KIINEEQPDIKIHCGDF--CTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLN---C----RLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSL 135
           +I I+SDTHG   F R   +++   +    IHCGD      ++L S+   ++V GN D + E I + KIE      C    +L   D+    + G++   LK       +  D++  GHTH    +      ++NPG+L
  S:     2 QIGIVSDTHGQVEFTRAAIRMLESFEVAQVIHCGDIGGAAIVELFSQWPTHYVLGNVDRDPEYIQE-KIESAGQTFCGMFGQLTIADRKIAFLHGHDENRLK--STIHSDAFDLVCHGHTHQAANYLVGKTRVLNPGAL 137
>gi|86148398|ref|ZP_01066690.1| phosphodiesterase [Vibrio sp. MED222] >gi|85833812|gb|EAQ51978.1| phosphodiesterase [Vibrio sp. MED222] (181 aa)
Score = 99, Expect = 9.5e-03, Identities = 22/55 (40%), Positives = 31/55 (56%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           DI+  GHTHI    Y+D+I I NP S+ +PR+ +   SY +   E N  K +  E
  S:   121 DIIAHGHTHIPVAEYQDDIFIFNPSSVTFPRDGHA-ASYGIY--ENNIFKVISLE 172
>gi|170757313|ref|YP_001780623.1| phosphodiesterase [Clostridium botulinum B1 str. Okra] >gi|169122525|gb|ACA46361.1| phosphodiesterase, MJ0936 family [Clostridium botulinum B1 str. Okra] (181 aa)
Score = 99, Expect = 9.9e-03, Identities = 55/153 (35%), Positives = 80/153 (52%)
  Q:     9 KILIISDTHGDRSFFRK---IINEEQPDIKIHCGDFCT-----------DIDLISENFDYF------VAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKL---YEYAKEN--NI---DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVE 161
           K+  ISD HG   +  K   I  EE+ D  I  GD              D   ++E  + +      V GN + E +++V      LN  +M      YS+  Y  + L L   + + K+N  NI   D L  GHTHI      +NI +INPGS+ +P+  N    Y +L     KIK++E
  S:     2 KLFFISDIHGSAYYLEKALHIFEEEKADYLIILGDELYHGARNPLPKGYDPKKVTEILNSYKDKIIAVRGNCESEVDQMV------LNYPIMSD----YSIVLYNGKRLFLTHGHIFNKDNMPNISDGDALIYGHTHIPLAERINNIFVINPGSITFPKE-NTPHCYGILSDNLFKIKTLE 171
>gi|159795414|pdb|2R17|A Chain A, Functional Architecture Of The Retromer Cargo-Recognition Complex >gi|159795415|pdb|2R17|B Chain B, Functional Architecture Of The Retromer Cargo-Recognition Complex (183 aa)
Score = 99, Expect = 1.0e-02, Identities = 33/120 (27%), Positives = 61/120 (50%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     NA   N + S+ +  I+ + + +  ++
  S:    56 DVHIVRGDFDE----NLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDXASLALLQ--RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLXDIQASTVVTYVYQ 167
>gi|47216776|emb|CAG03780.1| unnamed protein product [Tetraodon nigroviridis] (200 aa)
Score = 99, Expect = 1.0e-02, Identities = 32/120 (26%), Positives = 62/120 (51%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     +A   N + S+ ++ I+ + + +  ++
  S:    73 DVHIVRGDFDE----NLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQLDVDILISGHTHKFEAFENENKFYINPGSATGAYSALESNIIPSFVLMDIQASTVVTYVYQ 184
>gi|153826200|ref|ZP_01978867.1| conserved hypothetical protein [Vibrio cholerae MZO-2] >gi|149740060|gb|EDM54229.1| conserved hypothetical protein [Vibrio cholerae MZO-2] (189 aa)
Score = 99, Expect = 1.1e-02, Identities = 22/55 (40%), Positives = 32/55 (58%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           D+L  GHTHI       +I ++NPGS+ +PR+ +   SY VL  +  K+ SV  E
  S:   128 DVLVHGHTHIPMAEQVGSIYLVNPGSMTFPRD-DYAASYGVLEGDTMKVISVAGE 181
>gi|153829898|ref|ZP_01982565.1| conserved hypothetical protein [Vibrio cholerae 623-39] >gi|148874641|gb|EDL72776.1| conserved hypothetical protein [Vibrio cholerae 623-39] (189 aa)
Score = 99, Expect = 1.1e-02, Identities = 22/55 (40%), Positives = 32/55 (58%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           D+L  GHTHI       +I ++NPGS+ +PR+ +   SY VL  +  K+ SV  E
  S:   128 DVLVHGHTHIPMAEQVGSIYLVNPGSMTFPRD-DYAASYGVLEGDTMKVISVAGE 181
>gi|187778119|ref|ZP_02994592.1| hypothetical protein CLOSPO_01711 [Clostridium sporogenes ATCC 15579] >gi|187775047|gb|EDU38849.1| hypothetical protein CLOSPO_01711 [Clostridium sporogenes ATCC 15579] (181 aa)
Score = 99, Expect = 1.1e-02, Identities = 51/153 (33%), Positives = 79/153 (51%)
  Q:     9 KILIISDTHGDRSFFRKIIN---EEQPDIKIHCGDFCT-----------DIDLISENFDYF------VAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKL---YEYAKEN-----NIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVE 161
           K+  ISD HG   +  K+++   EE+ D  I  GD              D   ++E  + +      V GN + E +++V          L +     YS+  Y  + L L   + + K+N     N D L  GHTHI       NI +INPGS+ +P+  N    Y +L+    KIK++E
  S:     2 KLFFISDIHGSAYYLEKVLHIFEEEKADYLIILGDELYHGARNPLPKGYDPKKVAEILNSYKDKIIAVRGNCESEVDQMV----------LKYPIMSDYSIVLYNGKRLFLTHGHIFNKDNIPNISNGDALIYGHTHIPLAEKTSNIFMINPGSITFPKE-NTPHCYGILNDNLFKIKTLE 171
>gi|52695427|pdb|1S3L|A Chain A, Structural And Functional Characterization Of A Novel Archaeal Phosphodiesterase >gi|52695428|pdb|1S3L|B Chain B, Structural And Functional Characterization Of A Novel Archaeal Phosphodiesterase >gi|52695429|pdb|1S3M|A Chain A, Structural And Functional Characterization Of A Novel Archaeal Phosphodiesterase >gi|52695430|pdb|1S3M|B Chain B, Structural And Functional Characterization Of A Novel Archaeal Phosphodiesterase >gi|52695431|pdb|1S3N|A Chain A, Structural And Functional Characterization Of A Novel Archaeal Phosphodiesterase >gi|52695432|pdb|1S3N|B Chain B, Structural And Functional Characterization Of A Novel Archaeal Phosphodiesterase (190 aa)
Score = 98, Expect = 1.1e-02, Identities = 49/125 (39%), Positives = 68/125 (54%)
  Q:     9 KILIISDTHGDRSFFRK---IINEEQPDIKIHCGDFCTDIDLIS-ENFDYFVA---GNNDYE------------GERIVD----FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYK-DNILIINPG 133
           KI I+SDTH      RK   I N+E  +  IHCGDF +   +   EN +  +    GNND E             E I+D     +I+DL   + HG             +  L    K    D++  GHTH E+VF + D++L+INPG
  S:    27 KIGIMSDTHDHLPNIRKAIEIFNDENVETVIHCGDFVSLFVIKEFENLNANIIATYGNNDGERCKLKEWLKDINEENIIDDFISVEIDDLKFFITHG-----------HHQSVLEMAIKSGLYDVVIYGHTH-ERVFEEVDDVLVINPG 163
>gi|170117469|ref|XP_001889921.1| predicted protein [Laccaria bicolor S238N-H82] >gi|164635057|gb|EDQ99370.1| predicted protein [Laccaria bicolor S238N-H82] (213 aa)
Score = 98, Expect = 1.1e-02, Identities = 26/85 (30%), Positives = 45/85 (52%)
  Q:    79 LMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSL----MYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           +MHG Q    +P  +   L     A++ ++D+L SGHTH  Q    DN   +NPGS         N +   S+A++ I+G+ + +  ++
  S:    84 VMHGHQ---CIPTGDLDSLS--SLARQMDVDVLISGHTHTFQAIEFDNKFFVNPGSATGAWTGAYNGDPTPSFALMDIQGSVVVTYVYQ 167
>gi|91200208|emb|CAJ73252.1| conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] (232 aa)
Score = 98, Expect = 1.2e-02, Identities = 52/155 (33%), Positives = 80/155 (51%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTD-------IDLISENFDYFVAGNNDY--------------------------------EGERIVDFKIEDLNCR-------LMHG----DQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           KILIISD HG+ +  + ++ EE  D+    GD           I+ I +  D  V GN+D                                 E E + +  +  LN         L HG    D + Y  P     E++  +  K    +I+  GHTH+  V     I ++NPGS+  PR+   + SYA+      +IK V ++
  S:     2 KILIISDIHGNEAALKAVL-EETADMIFCLGDIVNYGPYPKECIEKIRKLTDKIVRGNHDNAIGKNMECGCSEKYKALSDQGKIFTKTILDAGEKEFLANLPLT-LNTEAGGVTFLLSHGSPGGDIYKYLRPEVSDSEME--DELKGVRANIVLLGHTHLPVVRKVGEITVVNPGSVGQPRDGIPLASYAIWKDGALEIKRVPYD 202
>gi|15643858|ref|NP_228907.1| phosphodiesterase [Thermotoga maritima MSB8] >gi|4981646|gb|AAD36177.1|AE001769_7 conserved hypothetical protein [Thermotoga maritima MSB8] (189 aa)
Score = 98, Expect = 1.3e-02, Identities = 45/152 (29%), Positives = 80/152 (52%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQPDIKI-HCGDFCTD---------------IDLISENFDYFVAGNNDYEGE-RIVDFK---------IEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNAN---------QMKSYAVLHIEGNKIKSV 160
           +IL+ISDTHG  S   K +       +I H GD                     L+ ++   ++ GN D + + R+++           + D+   L+HGDQF Y   G +   L     A+ +   ++  GHTH+      + +L++NPGS+  P++             K + +  +EG+ +K V
  S:     4 RILVISDTHGSLSCTEKALKSAGNFDEIWHLGDVLYHGPRNPLPEGYSPKELASLLKKHRVKYIRGNCDADVDIRVLEIPEMPRIGMEFLGDVKILLVHGDQFEYE--GGDPVSL-----AQAHGCSVVLFGHTHVPLAERCEGVLLLNPGSVSLPKSEAGPTFGIIDMDEKKFYLCSLEGDVLKEV 183
>gi|148378988|ref|YP_001253529.1| phosphodiesterase [Clostridium botulinum A str. ATCC 3502] >gi|153930976|ref|YP_001383371.1| phosphodiesterase [Clostridium botulinum A str. ATCC 19397] >gi|153935753|ref|YP_001386918.1| phosphodiesterase [Clostridium botulinum A str. Hall] >gi|148288472|emb|CAL82550.1| putative phosphoesterase [Clostridium botulinum A str. ATCC 3502] >gi|152927020|gb|ABS32520.1| phosphodiesterase, MJ0936 family [Clostridium botulinum A str. ATCC 19397] >gi|152931667|gb|ABS37166.1| phosphodiesterase, MJ0936 family [Clostridium botulinum A str. Hall] (181 aa)
Score = 98, Expect = 1.3e-02, Identities = 54/153 (35%), Positives = 80/153 (52%)
  Q:     9 KILIISDTHGDRSFFRK---IINEEQPDIKIHCGDFCT-----------DIDLISENFDYF------VAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKL---YEYAKEN--NI---DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVE 161
           K+  +SD HG   +  K   I  EE+ D  I  GD              D   ++E  + +      V GN + E +++V      LN  +M      YS+  Y  + L L   + + K+N  NI   D L  GHTHI      +NI +INPGS+ +P+  N    Y +L     KIK++E
  S:     2 KLFFMSDIHGSAYYLEKALHIFEEEKADYLIILGDELYHGARNPLPKGYDPKKVTEILNSYKDKIIAVRGNCESEVDQMV------LNYPIMSD----YSIVLYNGKRLFLTHGHIFNKDNMPNISDGDALIYGHTHIPLAEKTNNIFVINPGSITFPKE-NTPHCYGILSDNLFKIKTLE 171
>gi|55378949|ref|YP_136799.1| hypothetical protein rrnAC2263 [Haloarcula marismortui ATCC 43049] >gi|55231674|gb|AAV47093.1| unknown [Haloarcula marismortui ATCC 43049] (163 aa)
Score = 98, Expect = 1.3e-02, Identities = 42/150 (28%), Positives = 69/150 (46%)
  Q:     9 KILIISDTHGDRSFFRKIIN---EEQPDIKIHCGDFCTDIDLISENFD---YFVAGNNDYEGERIVDFKIEDLNCRLMHGDQF---GYSVPGYERRELKLYEYAKE-NNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           +I I+SDTH + S     +    +   +  +HCGDF     +   + D   Y V GNND  GE  V   +++         +    G+++  Y     ++ +   E  + D +F GHTH      +   + INPG +  P  A +  S A L  E  ++K
  S:     2 QIGIVSDTHDNASEVEAAVETFADTGCETVVHCGDFVAPFSVTPFDGDWSFYAVRGNND--GEWAVQSTVKEFGTYFGEMGELTIDGHTIAVYHGTSGEIVDALVECGSYDYVFHGHTHERGSKERGGTVRINPGGISIP-PAPEPFSVATLSTETGEVK 158
>gi|73536243|pdb|2AHD|A Chain A, The Apo Structure Of Methanococcus Jannaschii Phosphodiesterase Mj0936 >gi|73536244|pdb|2AHD|B Chain B, The Apo Structure Of Methanococcus Jannaschii Phosphodiesterase Mj0936 >gi|73536245|pdb|2AHD|C Chain C, The Apo Structure Of Methanococcus Jannaschii Phosphodiesterase Mj0936 >gi|73536246|pdb|2AHD|D Chain D, The Apo Structure Of Methanococcus Jannaschii Phosphodiesterase Mj0936 (165 aa)
Score = 98, Expect = 1.3e-02, Identities = 49/125 (39%), Positives = 68/125 (54%)
  Q:     9 KILIISDTHGDRSFFRK---IINEEQPDIKIHCGDFCTDIDLIS-ENFDYFVA---GNNDYE------------GERIVD----FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYK-DNILIINPG 133
           KI I+SDTH      RK   I N+E  +  IHCGDF +   +   EN +  +    GNND E             E I+D     +I+DL   + HG             +  L    K    D++  GHTH E+VF + D++L+INPG
  S:     2 KIGIMSDTHDHLPNIRKAIEIFNDENVETVIHCGDFVSLFVIKEFENLNANIIATYGNNDGERCKLKEWLKDINEENIIDDFISVEIDDLKFFITHG-----------HHQSVLEMAIKSGLYDVVIYGHTH-ERVFEEVDDVLVINPG 138
>gi|148927127|ref|ZP_01810756.1| phosphodiesterase, MJ0936 family [candidate division TM7 genomosp. GTL1] >gi|147887421|gb|EDK72866.1| phosphodiesterase, MJ0936 family [candidate division TM7 genomosp. GTL1] (173 aa)
Score = 98, Expect = 1.4e-02, Identities = 38/129 (29%), Positives = 71/129 (55%)
  Q:     9 KILIISDTHGDRSFFRK---IINEEQPDIKIHCGDFCT--DIDLISENFDYF----VAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERREL-------KLYEYAKEN-----------NIDILFSGHTHIEQVFYKDNILIINPGSLMY 137
           KI +ISDTH +    ++   ++ E + D+ +HCGD+     ++ +S+N        V GNN+ + + I           ++   +F   V   ER+ L       ++  Y  E+             D +F+GHTH  +    D++L++NPG+  +
  S:     2 KIGVISDTHDNLKPLKQALDVLMEHKVDLIVHCGDWVARFTVEFLSKNSGNIPVKGVFGNNEGDTKSI-----------MLRNAKFAKPVEFAERKVLDFVADGRRIAAYHGEDAPTLDALIRSKKYDAVFTGHTHRPRNEVIDDVLVLNPGTTCF 146
>gi|153217068|ref|ZP_01950832.1| conserved hypothetical protein [Vibrio cholerae 1587] >gi|124113898|gb|EAY32718.1| conserved hypothetical protein [Vibrio cholerae 1587] >gi|150422215|gb|EDN14179.1| conserved hypothetical protein [Vibrio cholerae AM-19226] (189 aa)
Score = 97, Expect = 1.4e-02, Identities = 22/55 (40%), Positives = 31/55 (56%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           D+L  GHTHI       +I ++NPGS+ +PR  +   SY VL  +  K+ SV  E
  S:   128 DVLVHGHTHIPMAEQVGSIYLVNPGSMTFPR-GDYAASYGVLEGDTMKVISVAGE 181
>gi|15669126|ref|NP_247931.1| hypothetical protein MJ0936 [Methanocaldococcus jannaschii DSM 2661] >gi|2501611|sp|Q58346|P936_METJA Phosphodiesterase MJ0936 >gi|1499771|gb|AAB98941.1| conserved hypothetical protein [Methanocaldococcus jannaschii DSM 2661] (166 aa)
Score = 97, Expect = 1.5e-02, Identities = 49/125 (39%), Positives = 68/125 (54%)
  Q:     9 KILIISDTHGDRSFFRK---IINEEQPDIKIHCGDFCTDIDLIS-ENFDYFVA---GNNDYE------------GERIVD----FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYK-DNILIINPG 133
           KI I+SDTH      RK   I N+E  +  IHCGDF +   +   EN +  +    GNND E             E I+D     +I+DL   + HG             +  L    K    D++  GHTH E+VF + D++L+INPG
  S:     2 KIGIMSDTHDHLPNIRKAIEIFNDENVETVIHCGDFVSLFVIKEFENLNANIIATYGNNDGERCKLKEWLKDINEENIIDDFISVEIDDLKFFITHG-----------HHQSVLEMAIKSGLYDVVIYGHTH-ERVFEEVDDVLVINPG 138
>gi|66805597|ref|XP_636520.1| metallophosphoesterase domain-containing protein [Dictyostelium discoideum AX4] >gi|74852473|sp|Q54IF7|VPS29_DICDI Vacuolar protein sorting-associated protein 29 >gi|60464900|gb|EAL63015.1| metallophosphoesterase domain-containing protein [Dictyostelium discoideum AX4] (183 aa)
Score = 97, Expect = 1.5e-02, Identities = 33/115 (28%), Positives = 58/115 (50%)
  Q:    43 TDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLM--YPRNANQ-MKSYAVLHIEGNKI 157
           +D+ ++  + D     N  Y   +IV   I      L HG Q    VP  +R  L   +  ++ ++D+L SGHTH+ +VF  +  L +NPGS    +   +N  + S+ ++ ++ N I
  S:    54 SDVHIVRGDLDE----NTSYPDTKIV--SIGQFKFGLCHGHQI---VPWGDRASLAALQ--RQLDVDVLISGHTHVLEVFESNGKLFVNPGSATGAFSNISNDVIPSFVLMDVQSNNI 160
>gi|154149295|ref|YP_001407081.1| phosphodiesterase [Campylobacter hominis ATCC BAA-381] >gi|153805304|gb|ABS52311.1| phosphodiesterase, family [Campylobacter hominis ATCC BAA-381] (180 aa)
Score = 97, Expect = 1.5e-02, Identities = 45/129 (34%), Positives = 61/129 (47%)
  Q:     7 MKKILIISDTHGDRSFFRKIIN---EEQPDIKIHCGDFC---TDIDLISENFDYF-VAGNND------------YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSL 135
           M KI +ISD+H         IN    ++ D+ IH GD     T   L +    Y  V GNND            ++  +I +FK   L  RLMH                  Y Y  +N+ DI+  GHTH       D+ LI+NPG +
  S:     1 MIKIGVISDSHHKSDVAGSAINYLLNKKADLIIHAGDIVEISTLKALKNSKIPYVAVFGNNDNALKDYAKSFKIFKEPKIFNFK--GLKIRLMH------------------YPYYIKNDADIVIYGHTHYFAALKSDSSLILNPGEI 128
>gi|146096392|ref|XP_001467791.1| vacuolar sorting-like protein [Leishmania infantum JPCM5] >gi|134072157|emb|CAM70858.1| vacuolar sorting-like protein [Leishmania infantum] (204 aa)
Score = 97, Expect = 1.5e-02, Identities = 31/97 (31%), Positives = 51/97 (52%)
  Q:    61 DYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLM---YPRNANQMKSYAVLHIEGNKI 157
           D+  E +V   +E L   L+HG Q    VP  ++  L   +  +E ++D+L SG TH  + F  D+ L +NPGSL       + N + S+ +L I+   +
  S:    70 DHMPESVV-LTVEGLKLGLIHGHQ----VPVGDKDSLAAVQ--RELDVDVLVSGSTHQSKYFEFDSHLFVNPGSLSGADTEYDVNVVPSFMLLDIQDKSV 162
>gi|157873841|ref|XP_001685421.1| vacuolar sorting-like protein [Leishmania major] >gi|68128493|emb|CAJ08625.1| vacuolar sorting-like protein [Leishmania major] (204 aa)
Score = 97, Expect = 1.5e-02, Identities = 31/97 (31%), Positives = 51/97 (52%)
  Q:    61 DYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLM---YPRNANQMKSYAVLHIEGNKI 157
           D+  E +V   +E L   L+HG Q    VP  ++  L   +  +E ++D+L SG TH  + F  D+ L +NPGSL       + N + S+ +L I+   +
  S:    70 DHMPESVV-LTVEGLKLGLIHGHQ----VPVGDKDSLAAVQ--RELDVDVLVSGSTHQSKYFEFDSHLFVNPGSLSGADTEYDVNVVPSFMLLDIQDKSV 162
>gi|17385448|emb|CAC85729.1| Gp0 [Listeria monocytogenes] (82 aa)
Score = 97, Expect = 1.6e-02, Identities = 23/62 (37%), Positives = 39/62 (62%)
  Q:   103 AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI--EGNKIKSVEFED 164
           A+E N D  F GH H   V   D+ +I+NPGS+  PR   ++K+YA++    EG +++ ++ +D
  S:     3 ARELNADFAFFGHPHELGVDMLDDTIILNPGSISLPRGRIRVKTYALIDSTPEGIQVRFMDRDD 66
>gi|41053315|ref|NP_956331.1| vacuolar protein sorting 29 [Danio rerio] >gi|82188598|sp|Q7ZV68|VPS29_DANRE Vacuolar protein sorting-associated protein 29 (Vesicle protein sorting 29) >gi|28279210|gb|AAH45981.1| Vacuolar protein sorting 29 (yeast) [Danio rerio] >gi|37606122|emb|CAE50610.1| novel protein similar to human and mouse vacuolar protein sorting 29 (yeast) (VPS29) [Danio rerio] >gi|48734906|gb|AAH71331.1| Vacuolar protein sorting 29 (yeast) [Danio rerio] (182 aa)
Score = 97, Expect = 1.7e-02, Identities = 32/120 (26%), Positives = 61/120 (50%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     +A   N   S+ ++ I+ + + +  ++
  S:    55 DVHIVRGDFDE----NLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQLDVDILISGHTHKFEAFENENKFYINPGSATGAYSALESNITPSFVLMDIQASTVVTYVYQ 166
>gi|57640602|ref|YP_183080.1| calcineurin superfamily metallophosphoesterase [Thermococcus kodakarensis KOD1] >gi|57158926|dbj|BAD84856.1| metallophosphoesterase, calcineurin superfamily [Thermococcus kodakarensis KOD1] (235 aa)
Score = 97, Expect = 1.7e-02, Identities = 22/57 (38%), Positives = 31/57 (54%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           D L  GHTHI  +   +   IINPGS+  PR+ +   SYA++       ++VEF  V
  S:   151 DDLLVGHTHIPMLKVIEGRRIINPGSVGQPRDGDWRASYAIIDTSEEPPENVEFHRV 207
>gi|154343053|ref|XP_001567472.1| vacuolar sorting-like protein [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134064804|emb|CAM42910.1| vacuolar sorting-like protein [Leishmania braziliensis] (204 aa)
Score = 97, Expect = 1.8e-02, Identities = 27/75 (36%), Positives = 41/75 (54%)
  Q:    61 DYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSL 135
           D+  E +V   +E L   L+ G+Q    VP  ++  L   +  +E ++D+L SG TH  Q F  D+ L +NPGSL
  S:    70 DHMSESVV-LTVESLKIGLVRGNQ----VPLGDKESLAAIQ--RELDVDVLVSGSTHQPQYFEFDSHLFVNPGSL 137
>gi|148270764|ref|YP_001245224.1| phosphodiesterase [Thermotoga petrophila RKU-1] >gi|147736308|gb|ABQ47648.1| phosphodiesterase, MJ0936 family [Thermotoga petrophila RKU-1] (187 aa)
Score = 97, Expect = 1.8e-02, Identities = 41/132 (31%), Positives = 69/132 (52%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQPDIKI-HCGDFCTD---------------IDLISENFDYFVAGNNDYEGE-RIVDFK---------IEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRN 140
           +IL+ISDTHG  S   K +       +I H GD                     L+  +   ++ GN D + + R+++           + D+   L+HGDQF Y   G +   L     A+ +  +++  GHTHI        +L++NPGS+  P++
  S:     2 RILVISDTHGSLSHTEKALESAGSFDEIWHLGDVLYHGPRNPLPEGYSPKELASLLKRHRVKYIRGNCDADVDVRVLEVPEMPRIGMEFLGDVKMLLVHGDQFEYG--GGDPVSL-----AQVHRCNVVLFGHTHIPMAERCGGVLLLNPGSVSLPKS 152
>gi|52346072|ref|NP_001005079.1| MGC89642 protein [Xenopus (Silurana) tropicalis] >gi|147899688|ref|NP_001085746.1| MGC80657 protein [Xenopus laevis] >gi|82182732|sp|Q6DEU3|VPS29_XENTR Vacuolar protein sorting-associated protein 29 (Vesicle protein sorting 29) >gi|82236531|sp|Q6GP62|VPS29_XENLA Vacuolar protein sorting-associated protein 29 (Vesicle protein sorting 29) >gi|49257321|gb|AAH73281.1| MGC80657 protein [Xenopus laevis] >gi|50370230|gb|AAH77001.1| MGC89642 protein [Xenopus tropicalis] >gi|66910684|gb|AAH97520.1| MGC80657 protein [Xenopus laevis] >gi|89266928|emb|CAJ82280.1| vacuolar protein sorting 29 [Xenopus tropicalis] (182 aa)
Score = 97, Expect = 1.8e-02, Identities = 38/125 (30%), Positives = 66/125 (52%)
  Q:    39 GDFCTDIDLISENFDYF--VAG-----------NNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           G+ CT      E+FDY   +AG           N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHT   + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:    38 GNLCT-----KESFDYLKTLAGDVHIVRGDFDENLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQLDVDILISGHTQKFEAFEHENKFYINPGSATGAYNALENNIIPSFVLMDIQASTVVTYVYQ 166
>gi|56119058|ref|NP_001007838.1| vacuolar protein sorting 29 [Gallus gallus] >gi|82081200|sp|Q5ZIL2|VPS29_CHICK Vacuolar protein sorting-associated protein 29 (Vesicle protein sorting 29) >gi|53135507|emb|CAG32431.1| hypothetical protein [Gallus gallus] (186 aa)
Score = 97, Expect = 1.8e-02, Identities = 32/120 (26%), Positives = 62/120 (51%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           D+ ++  +FD     N +Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS     +A   N + S+ ++ I+ + + +  ++
  S:    59 DVHVVRGDFDE----NLNYPEQKVV--TVGQFKIGLIHGHQV---IPWGDMASLALLQ--RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYHALENNIIPSFVLMDIQASTVVTYVYQ 170
>gi|29841378|gb|AAP06410.1| similar to NM_019780 vacuolar protein sorting 29 [Schistosoma japonicum] >gi|171474001|gb|AAX31012.3| SJCHGC09715 protein [Schistosoma japonicum] (185 aa)
Score = 96, Expect = 2.0e-02, Identities = 33/117 (28%), Positives = 58/117 (49%)
  Q:    42 CTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLM---YPRNANQMKSYAVLHIEGNKIK 158
           C D+ ++  +FD  +    D+   +++   + +    L+HG Q    VP  +++ L + +  +E N+DIL SGHTH  + +       INPGS      P   N   S+ +L I+   I+
  S:    53 CGDVHVVKGDFDEGL----DFPLTKVL--SVGNFKIGLIHGHQV---VPWGDQKSLAMLQ--RELNVDILISGHTHKFEAYEYAGHFYINPGSATGAYSPFEKNPQPSFVLLDIQETVIQ 161
>gi|168185566|ref|ZP_02620201.1| phosphodiesterase, family [Clostridium botulinum C str. Eklund] >gi|169296202|gb|EDS78335.1| phosphodiesterase, family [Clostridium botulinum C str. Eklund] (156 aa)
Score = 96, Expect = 2.1e-02, Identities = 52/155 (33%), Positives = 69/155 (44%)
  Q:     9 KILIISDTHGD-RSFFRKIINEEQPDIKIHCGDF---CTDIDLISENFDYFVAGNND-----YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           KI +ISDTHG  R    +I NE   D  IH GD    C   +L        V GN D     Y   +    ++ D+N  ++H              EL L    KE   D++ SGH+H       D++L  NPGS   PR      S  VL + G KI++   E
  S:     5 KIGVISDTHGLLRPEVLEIFNE--VDCIIHAGDVGDACIIQELRKIAPVTVVRGNCDNGELGYILRKTEVLEVGDINVYVLH-----------NLDELDLE--PKEAGFDVVISGHSHKACEKIVDDVLYFNPGS-AGPRRFTLPISLGVLKVHGKKIQAETIE 152
>gi|196012014|ref|XP_002115870.1| hypothetical protein TRIADDRAFT_59735 [Trichoplax adhaerens] >gi|190581646|gb|EDV21722.1| hypothetical protein TRIADDRAFT_59735 [Trichoplax adhaerens] (181 aa)
Score = 96, Expect = 2.1e-02, Identities = 31/124 (25%), Positives = 61/124 (49%)
  Q:    40 DFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLM---YPRNANQMKSYAVLHIEGNKIKSVEFE 163
           +  +D+ ++  +FD     N  Y  ++++   +      L HG Q    VP  +   L L +  ++ ++DIL +GHTH  + F  +N   INPGS      P  ++   S+A++ I+   + +  ++
  S:    51 NLASDVHVVKGDFDE----NASYPDQKVI--TVGQFRIGLCHGHQI---VPWGDIESLALVQ--RQLDVDILITGHTHKFEAFEHENKFYINPGSATGAYSPIESDAAPSFALMDIQSATVVTYVYQ 166
>gi|189502908|gb|ACE06835.1| unknown [Schistosoma japonicum] (185 aa)
Score = 96, Expect = 2.1e-02, Identities = 33/117 (28%), Positives = 58/117 (49%)
  Q:    42 CTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLM---YPRNANQMKSYAVLHIEGNKIK 158
           C D+ ++  +FD  +    D+   +++   + +    L+HG Q    VP  +++ L + +  +E N+DIL SGHTH  + +       INPGS      P   N   S+ +L I+   I+
  S:    53 CGDVHVVKGDFDEGL----DFPLTKVL--SVGNFKIGLIHGHQV---VPWGDQKSLAMLQ--RELNVDILISGHTHKFEAYEYAGHFYINPGSATGAYSPFEKNPQPSFVLLDIQETVIQ 161
>gi|148980737|ref|ZP_01816193.1| phosphodiesterase [Vibrionales bacterium SWAT-3] >gi|145961087|gb|EDK26406.1| phosphodiesterase [Vibrionales bacterium SWAT-3] (181 aa)
Score = 96, Expect = 2.2e-02, Identities = 21/55 (38%), Positives = 30/55 (54%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           DI+  GHTHI    Y+D+I I NP S+ +PR  +   SY +   E    K + F+
  S:   121 DIIAHGHTHIPVAEYQDDIFIFNPSSVTFPREGHA-ASYGIY--ENGTFKVISFD 172
>gi|168178408|ref|ZP_02613072.1| phosphodiesterase, MJ0936 family [Clostridium botulinum NCTC 2916] >gi|182671232|gb|EDT83206.1| phosphodiesterase, MJ0936 family [Clostridium botulinum NCTC 2916] (181 aa)
Score = 96, Expect = 2.2e-02, Identities = 54/153 (35%), Positives = 80/153 (52%)
  Q:     9 KILIISDTHGDRSFFRK---IINEEQPDIKIHCGDFCT-----------DIDLISENFDYF------VAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKL---YEYAKEN--NI---DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVE 161
           K+  +SD HG   +  K   I  EE+ D  I  GD              D   ++E  + +      V GN + E +++V      LN  +M      YS+  Y  + L L   + + K+N  NI   D L  GHTHI      +NI +INPGS+ +P+  N    Y +L     KIK++E
  S:     2 KLFFMSDIHGSAYYLEKALHIFEEEKADYLIILGDELYHGARNPLPKGYDPKKVTEILNSYKDKIIAVRGNCESEVDQMV------LNYPIMSD----YSIVLYNGKRLFLTHGHIFNKDNMPNISDGDALIYGHTHIPLAEKINNIFVINPGSITFPKE-NTPHCYGILSDNLFKIKTLE 171
>gi|121728138|ref|ZP_01681174.1| conserved hypothetical protein [Vibrio cholerae V52] >gi|121629606|gb|EAX62028.1| conserved hypothetical protein [Vibrio cholerae V52] (189 aa)
Score = 96, Expect = 2.3e-02, Identities = 22/52 (42%), Positives = 30/52 (57%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSV 160
           D+L  GHTHI       +I ++NPGS+ +PR      SY VL  EG+ IK +
  S:   128 DVLVHGHTHIPVAEQVGSIYLVNPGSMTFPR-GEYAASYGVL--EGDTIKVI 176
>gi|145591448|ref|YP_001153450.1| phosphodiesterase [Pyrobaculum arsenaticum DSM 13514] >gi|145283216|gb|ABP50798.1| phosphodiesterase, MJ0936 family [Pyrobaculum arsenaticum DSM 13514] (173 aa)
Score = 96, Expect = 2.4e-02, Identities = 44/150 (29%), Positives = 74/150 (49%)
  Q:    12 IISDTHGDRSFFRK---IINEEQPDIKIHCGDFCTDIDLIS------ENFDYFVAGNNDYE----GERIVDFKIEDLNCRLMHGDQFGYSVPG--YERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVE 161
           +ISDTH D +  R+   I      +  IH GD+ +   ++       E   Y V GNND +     +R  D K+E L    +   Q G    G  +   E+ +   A+    D++  GHTH   +   +  L++NPG       A + K+ A+L ++  +++ VE
  S:     5 VISDTHDDYTAVRRLAEIFKHRGVEAVIHAGDWTSPFMMLKMRRVFPEVSIYTVFGNNDGDRYMFAKRAADAKVEVLGEGALL--QIGGRRIGIYHGTAEVLVEAMARSGMFDVVIYGHTHKVDIRRVNGTLVLNPGEAC--GCATERKTAALLDLKTLEVELVE 165
>gi|153812639|ref|ZP_01965307.1| hypothetical protein RUMOBE_03039 [Ruminococcus obeum ATCC 29174] >gi|149831343|gb|EDM86431.1| hypothetical protein RUMOBE_03039 [Ruminococcus obeum ATCC 29174] (190 aa)
Score = 96, Expect = 2.4e-02, Identities = 47/154 (30%), Positives = 77/154 (50%)
  Q:     9 KILIISDTHGDRSFFRKII---NEEQPDIKIHCGDFC---TDIDLISE--------------NFDYFVAGNNDYEGERIV-DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNAN-------QMKSYAVLHIEGNKIKSVEF 162
           K +  SD HG   + R ++    EEQ +  +  GD        DL  E              N  Y V GN + E +++V +F +    C L       Y+  G+   E  L  + +    DIL  GHTH+ +   K+  +++NPGS+  P+  N       + K++ +   +GN IK +  
  S:    11 KYMFASDVHGSAYYCRLMLEKYKEEQAERLVLLGDLLYHGPRNDLPKEYAPKEVIKMLNGMKNDIYAVRGNCEAEVDQMVLEFPVMADYCILAINGLTFYATHGHVYNENNLPPFHEG---DILIHGHTHVLKAEQKEGYILLNPGSVSIPKEGNPPTYAVLEDKTFTIKDFDGNIIKEMRL 189
>gi|170759843|ref|YP_001786390.1| phosphodiesterase [Clostridium botulinum A3 str. Loch Maree] >gi|169406832|gb|ACA55243.1| phosphodiesterase, MJ0936 family [Clostridium botulinum A3 str. Loch Maree] (181 aa)
Score = 95, Expect = 2.6e-02, Identities = 54/153 (35%), Positives = 80/153 (52%)
  Q:     9 KILIISDTHGDRSFFRK---IINEEQPDIKIHCGDFCT-----------DIDLISENFDYF------VAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKL---YEYAKEN--NI---DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVE 161
           ++  ISD HG   +  K   I  EE+ D  I  GD              D   ++E  + +      V GN + E +++V      LN  +M      YS+  Y  + L L   + + K+N  NI   D L  GHTHI      +NI +INPGS+ +P+  N    Y +L     KIK++E
  S:     2 RLFFISDIHGSAYYLEKALHIFEEEKADYLIILGDELYHGARNPLPKGYDPKKVTEILNSYKDKIIAVRGNCESEVDQMV------LNYPIMSD----YSIILYNGKRLFLTHGHIFNKDNMPNISDGDALIYGHTHIPLAEKINNIFVINPGSITFPKE-NTPHCYGILSDNLFKIKTLE 171
>gi|11499762|ref|NP_071005.1| hypothetical protein AF2180 [Archaeoglobus fulgidus DSM 4304] >gi|2648343|gb|AAB89070.1| conserved hypothetical protein [Archaeoglobus fulgidus DSM 4304] (175 aa)
Score = 95, Expect = 2.6e-02, Identities = 51/151 (33%), Positives = 82/151 (54%)
  Q:     7 MKKILIISDTH-GDRSFFRKIIN-EEQPDIKIHCGDF--------CTDIDLISENFDYFVAGNND-----YEGERIVDFKIEDLNCRLMHGDQF--GYSVPGYERRELKLYEYAKENNIDILFSGHTH---IEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           MK+IL ++DTH  + +   K+I   E  D  +H GDF         +D +L      Y VAGN+D      E +  + F++E +   L+H   F   +   GY+  EL          +D+L  GH H   +E+V  K   L++ PGS   PR +  + S A + ++G+K+
  S:     1 MKRILAVADTHLKEWNLPEKLIELMEGADFVVHAGDFESYKVYKKFSDYEL------YAVAGNSDDDKIKEELDEELVFEVEGVRFGLVHKGNFINQFHDLGYKAMEL---------GVDVLVFGHLHRFVLEEVRGK---LLVCPGSPTQPRMS--VASCAEIAVDGSKV 151
>gi|154249863|ref|YP_001410688.1| phosphodiesterase [Fervidobacterium nodosum Rt17-B1] >gi|154153799|gb|ABS61031.1| phosphodiesterase, MJ0936 family [Fervidobacterium nodosum Rt17-B1] (196 aa)
Score = 95, Expect = 2.6e-02, Identities = 45/157 (28%), Positives = 80/157 (50%)
  Q:     9 KILIISDTHGDRSFFR---KIINEEQPDIKIHCGDFC---------------TDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMH--GDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           K L +SDTHG    +    K+   ++ D   H GD                 T ID++ +    ++ GN D + +  V  +++++   +M   GD     + G    E  + ++ K+ N+  L  GHTHI ++   D   I+NPGS   P+  +  +S  V+ ++ N   S EF ++
  S:     2 KFLFVSDTHGSAKAWEDIEKLFKLDEFDDIFHLGDVLYHGPRNKLPDAYDPKTLIDMLKKYDIKYIRGNCDADVDLKV-LEVQEMPKMVMEYFGDFSLLLIHGEILEENDVKDFLKDKNVHFLIHGHTHISKIEEIDGKYILNPGSTSLPK-GDTPRSVMVIEVKDNTF-SAEFYNL 175
>gi|76800883|ref|YP_325891.1| hypothetical protein NP0462A [Natronomonas pharaonis DSM 2160] >gi|76556748|emb|CAI48322.1| conserved hypothetical protein [Natronomonas pharaonis DSM 2160] (172 aa)
Score = 95, Expect = 2.6e-02, Identities = 41/130 (31%), Positives = 63/130 (48%)
  Q:    10 ILIISDTHG---DRSFFRKIINEEQPDIKIHCGDFCTD--IDLISENFDYF-VAGNN-------DYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPR 139
           + ++SDTHG    R   R      +    +H GDF T+  +D   E      V GNN           ERIV +  E L   ++HG         +E  E  L  + ++++ D++  GH+H E  F    + ++NPGS   PR
  S:     2 LAVLSDTHGRDSPRLSGRTADAVAEASRVVHAGDFMTEAVLDAFEERGPLAAVYGNNATAAVRERLPAERIVVW--EGLRIAVVHG---------HEHTETALAMFGRQSSADLVVFGHSH-EPTFEDGTVPMLNPGSHADPR 132
>gi|147919547|ref|YP_686713.1| putative metallophosphoesterase [uncultured methanogenic archaeon RC-I] >gi|110622109|emb|CAJ37387.1| putative metallophosphoesterase [uncultured methanogenic archaeon RC-I] (174 aa)
Score = 95, Expect = 2.9e-02, Identities = 45/153 (29%), Positives = 75/153 (49%)
  Q:     9 KILIISDTHGDRSFFRKIIN-EEQPDIKIHCGDFCT--DIDLISENFDYFVA--GNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEY-AKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK-SVE 161
           KIL +SDTH      R+++    + D+ +H GDF T    + +       VA  GN+D    + +  + E      + G +FG    G    +L    Y A E  +D+L  GH H   +  + ++L++ PGS  +PR ++   S   L ++  KI  S+E
  S:     2 KILALSDTHLSCPLPRELLELVGKADLVVHAGDFNTLEAYESLKGGSKRLVAVHGNSDTPALKDLLPESEKFE---VEGIRFGVVHTGKHTSDLTNMRYLALEMGVDVLIFGHIH-RPLIDQTDVLLVCPGSPTFPRMSD--PSVVELTVQNGKISGSIE 155
>gi|21226392|ref|NP_632314.1| hypothetical protein MM_0290 [Methanosarcina mazei Go1] >gi|20904648|gb|AAM29986.1| hypothetical protein MM_0290 [Methanosarcina mazei Go1] (182 aa)
Score = 95, Expect = 2.9e-02, Identities = 48/159 (30%), Positives = 82/159 (51%)
  Q:     9 KILIISDTHGDRSFFRKIINE--EQPDIKIHCGDFCTDIDLISENFDYF--------VAGNNDYEGERIV-----DFKIEDLNCRLMHGDQFGYSV-----PGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNAN--------QMKSYA--VLHIEGNKIKSVEFEDVVK 167
           K++I+SDTH         +    E  D+ +H GDF T      E +  F        V+GN+D    R +      F++E +   ++H  + G SV      GY          AKE  +D+L  GH H   +  + +++++ PGS   PR +N        +  S    ++ +EG+    ++F D +K
  S:     2 KLIILSDTHLKTGEIPGQLQTLLEDCDLIVHAGDFST-----VEAYRAFNASGKLKAVSGNDDSPELRKLLPERLKFEVEGVRIGVVH--EAGLSVMDTTAQGY---------LAKEMEVDVLIFGHLH-RPIIERKDVMLVCPGSPTKPRMSNPGVVELIIEKGSIEGRIITLEGDSCGYIKFRDALK 173
>gi|194398451|ref|YP_002038468.1| conserved hypothetical protein [Streptococcus pneumoniae G54] >gi|194358118|gb|ACF56566.1| conserved hypothetical protein [Streptococcus pneumoniae G54] (173 aa)
Score = 95, Expect = 3.0e-02, Identities = 41/151 (27%), Positives = 66/151 (43%)
  Q:     8 KKILIISDTHGDRSFFRKIINEE--QPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEG---ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           + I+++SD+HGD     ++ +    + D   H GD     D         V GN D+     ER+V  ++        HG  F  +         KL  +A+E    I   GH H+   + +  IL +NPGS+  PR   +   YA + I+ +  K
  S:     4 QTIIVMSDSHGDSLIVEEVRDRYVGKVDAVFHNGDSELRPDFPLWEGIRVVKGNMDFYAGYPERLVT-ELGSTKIIQTHGHLFDINF-----NFQKLDYWAQEEEAAICLYGHLHVPSAWMEGKILFLNPGSISQPRGTIRECLYARVEIDDSYFK 153
>gi|167767142|ref|ZP_02439195.1| hypothetical protein CLOSS21_01661 [Clostridium sp. SS2/1] >gi|167711117|gb|EDS21696.1| hypothetical protein CLOSS21_01661 [Clostridium sp. SS2/1] (178 aa)
Score = 95, Expect = 3.0e-02, Identities = 43/135 (31%), Positives = 71/135 (52%)
  Q:     9 KILIISDTHGDRSFFRKII---NEEQPDIKIHC---------GDFCTD------IDLISENFDYF--VAGNNDYEGERIV-DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQ 143
           K++I SD HG   + +++I    +EQPD  +            D   D      I++++   D    V GN + E +++V +F +   +C L    Q  Y+  G+        +  K    DIL +GHTHI      DN L +NPGS+  P+  ++
  S:     2 KLMIASDIHGSAFYCKQLIEAYKQEQPDKLLLLGDLLYHGPRNDLPKDYAPKQVIEMLNAISDQLICVRGNCEAEVDQMVLNFPVLSESCILYIDGQTIYATHGHINSPANPPKLHKG---DILLTGHTHIPAWEEYDNFLYLNPGSVSIPKEGSE 154
>gi|168182847|ref|ZP_02617511.1| phosphodiesterase, MJ0936 family [Clostridium botulinum Bf] >gi|182674054|gb|EDT86015.1| phosphodiesterase, MJ0936 family [Clostridium botulinum Bf] (181 aa)
Score = 95, Expect = 3.0e-02, Identities = 54/153 (35%), Positives = 80/153 (52%)
  Q:     9 KILIISDTHGDRSFFRK---IINEEQPDIKIHCGDFCT-----------DIDLISENFDYF------VAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKL---YEYAKEN--NI---DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVE 161
           K+  +SD HG   +  K   I  EE+ D  I  GD              D   ++E  + +      V GN + E +++V      LN  +M      YS+  Y  + L L   + + K+N  NI   D L  GHTHI      +NI +INPGS+ +P+  N    Y +L     KIK++E
  S:     2 KLFFMSDIHGSAYYLEKALHIFEEEKADYLIILGDELYHGARNPLPKGYDPKKVTEILNCYKDKIIAVRGNCESEVDQMV------LNYPIMSD----YSIILYNGKRLFLTHGHIFNKDNIPNISDGDALIYGHTHIPLAEKINNIFVINPGSITFPKE-NTPHCYGILSDNLFKIKTLE 171
>gi|114053067|ref|NP_001040505.1| vacuolar protein sorting 29 [Bombyx mori] >gi|95103166|gb|ABF51524.1| vacuolar protein sorting 29 isoform 2 [Bombyx mori] (179 aa)
Score = 95, Expect = 3.1e-02, Identities = 28/92 (30%), Positives = 47/92 (51%)
  Q:    43 TDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS 134
           +D+ ++  +FD     N  Y  +++V   +      L+HG Q    VP  +   L L +  ++ ++DIL SGHTH  + +  +N   INPGS
  S:    54 SDVHVVRGDFDE----NATYPEQKVV--TVGQFRIGLIHGHQV---VPWGDEESLALIQ--RQLDVDILISGHTHRFEAYEHENKFYINPGS 134
>gi|57866662|ref|YP_188318.1| phosphoesterase, putative [Staphylococcus epidermidis RP62A] >gi|57637320|gb|AAW54108.1| phosphoesterase, putative [Staphylococcus epidermidis RP62A] (169 aa)
Score = 95, Expect = 3.2e-02, Identities = 38/134 (28%), Positives = 58/134 (43%)
  Q:     7 MKKILIISDTHGDRSFFRKIIN-EEQPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRN 140
           M K +I+SD H +      I +  +  D  +H GD     +    +    V GN D+  E + +   E+   R  +     Y V    +  +KL E AKE      F GHTH+ +      I +INPGS+   R+
  S:     1 MSKWIILSDNHKETGILYHIYDLHKDADKFLHLGDSEFSYNDTELSLYQRVKGNCDFYPEFLEEAITEENGVRAFYTHGHLYQV---NQTRMKLAEKAKELGCLFAFYGHTHVAKYEQIGGIHVINPGSISQSRS 132
>gi|28211947|ref|NP_782891.1| putative phosphoesterase [Clostridium tetani E88] >gi|28204390|gb|AAO36828.1| putative phosphoesterase [Clostridium tetani E88] (167 aa)
Score = 95, Expect = 3.2e-02, Identities = 48/153 (31%), Positives = 80/153 (52%)
  Q:     7 MKKILIISDTHGDRSF--FRKIINEEQPDIK--IHCGDFCTDIDLIS--ENFDYFVA--GNNDYEGERIV-----DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           + KI IISDTH  +      K++ +   D+   +H GDF   +++I   +N   F+   GNND +  + V       KIE     L HG        G +    + Y+  K+  +DI+  GH+H   +  ++ IL+INPGS    +   +  SY +L ++  KI++
  S:     2 LMKIGIISDTHVTKKVENIDKLLKDYFYDVDTIVHVGDF-NSLEVIKRIKNKKKFIGVYGNNDSKDIKGVLPMKDIIKIEGYKIGLFHGHG------GSKNTLDRAYDEFKDEKVDIIIFGHSHQPIIKTRNKILMINPGSPTR-KLKERWYSYVLLELDKKKIEA 159
>gi|150400122|ref|YP_001323889.1| phosphodiesterase [Methanococcus vannielii SB] >gi|150012825|gb|ABR55277.1| phosphodiesterase, MJ0936 family [Methanococcus vannielii SB] (171 aa)
Score = 94, Expect = 3.3e-02, Identities = 47/125 (37%), Positives = 63/125 (50%)
  Q:     9 KILIISDTHGDRSFFRKII---NEEQPDIKIHCGDFCTDIDLISENFDYF------VAGNNDYEG----------------ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDN-ILIINPG 133
           K+ IISDTH      +K I   N E+ D+ IHCGDF +    + + F         V GNND E                 E  + F+I+ L   ++HG                L    K    D++  GHTH E  F + N IL+INPG
  S:     2 KLGIISDTHDHLKNIKKAIGVFNNEKVDLVIHCGDFVSL--FVIKEFKKLNSKIISVYGNNDGEKVLLKEWLKEIDQDNELENYLSFEIDSLRFFVLHGTHGPI-----------LESVIKSKEYDVVIHGHTH-ESFFDEVNGILVINPG 138
>gi|109645002|ref|ZP_01368922.1| phosphodiesterase, MJ0936 family [Desulfitobacterium hafniense DCB-2] >gi|109642951|gb|EAT52504.1| phosphodiesterase, MJ0936 family [Desulfitobacterium hafniense DCB-2] (164 aa)
Score = 94, Expect = 3.4e-02, Identities = 47/151 (31%), Positives = 75/151 (49%)
  Q:     9 KILIISDTH--GDRSFFRKIINE-EQPDIKIHCGD-----FCTDIDLISENFDYFVAGNND-YEGERIVDFKIEDLNC-RLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           +I ++SDTH  G ++  + +  + E  D+ IH GD       +D+  I+      V GN D +E   +   KI  + C  +  G   G   PG    E  L  +  ++ +D++  GH+HI     +  IL+ NPGS    R   Q  S  ++ IEG  IK+
  S:     2 RIAVLSDTHLRGGQTLPKWVWEQCEVADLIIHAGDVGYPSLLSDLGQIAPL--EAVQGNCDGWELAHLPHHKI--ITCGEIRIGVTHGAYGPGRSTPERALRTF-DQDKVDLIIFGHSHIPYQGKQGEILLFNPGSPTDKRRQAQY-SMGMIWIEGKIIKA 156
>gi|153838373|ref|ZP_01991040.1| phosphoesterase, putative subfamily [Vibrio parahaemolyticus AQ3810] >gi|149748232|gb|EDM59091.1| phosphoesterase, putative subfamily [Vibrio parahaemolyticus AQ3810] (181 aa)
Score = 94, Expect = 3.4e-02, Identities = 15/33 (45%), Positives = 22/33 (66%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNA 141
           DI+  GHTH+     K+ ++I NPGS+ +PRN 
  S:   121 DIIAHGHTHVPVAEMKEGVVIFNPGSMTFPRNG 153
>gi|28897590|ref|NP_797195.1| phosphodiesterase [Vibrio parahaemolyticus RIMD 2210633] >gi|28805802|dbj|BAC59079.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD 2210633] (181 aa)
Score = 94, Expect = 3.4e-02, Identities = 15/33 (45%), Positives = 22/33 (66%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNA 141
           DI+  GHTH+     K+ ++I NPGS+ +PRN 
  S:   121 DIIAHGHTHVPVAEMKEGVVIFNPGSMTFPRNG 153
>gi|14591312|ref|NP_143390.1| hypothetical protein PH1530 [Pyrococcus horikoshii OT3] >gi|3257957|dbj|BAA30640.1| 172aa long hypothetical protein [Pyrococcus horikoshii OT3] (172 aa)
Score = 94, Expect = 3.5e-02, Identities = 37/127 (29%), Positives = 60/127 (47%)
  Q:     9 KILIISDTHGDRSFFR---KIINEEQPDIKIHCGDFCTDIDLISENFDYFVA------GNNDYEGE----------RIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSL 135
           K+ I+SDTH + S  R   +  N E  ++ +H GDF      +++      A      GNND E E           I+   ++ L   ++HG             E  +  +AK    DI+  GHTH   +      +++NPG +
  S:     4 KVGIMSDTHDNLSAIRLAVEFFNREGVNLVLHAGDFVAP--FVAKELSNLKAPLKGVFGNNDGEREGLREKLGIKDDILTLNLDGLKVVMLHGTD-----------ERVVEAFAKSQLYDIVIRGHTHKYGIQEVGRTIVVNPGEV 136
>gi|55380100|ref|YP_137949.1| phosphoesterase [Haloarcula marismortui ATCC 43049] >gi|55232825|gb|AAV48243.1| phosphoesterase [Haloarcula marismortui ATCC 43049] (216 aa)
Score = 94, Expect = 3.6e-02, Identities = 18/42 (42%), Positives = 27/42 (64%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVL 150
           D+L  GHTHI+     D+ L+INPGS+  PR+ +   +Y V+
  S:   136 DVLVLGHTHIQHAETFDDGLVINPGSVGQPRDGDPDAAYGVV 177
>gi|15640996|ref|NP_230627.1| phosphodiesterase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121587332|ref|ZP_01677103.1| conserved hypothetical protein [Vibrio cholerae 2740-80] >gi|147674558|ref|YP_001216453.1| phosphodiesterase [Vibrio cholerae O395] >gi|153222758|ref|ZP_01953417.1| conserved hypothetical protein [Vibrio cholerae MAK 757] >gi|153818618|ref|ZP_01971285.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457] >gi|153822691|ref|ZP_01975358.1| conserved hypothetical protein [Vibrio cholerae B33] >gi|194531693|ref|YP_002067138.1| conserved hypothetical protein [Vibrio cholerae MO10] >gi|9655441|gb|AAF94142.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121548415|gb|EAX58475.1| conserved hypothetical protein [Vibrio cholerae 2740-80] >gi|124118632|gb|EAY37375.1| conserved hypothetical protein [Vibrio cholerae MAK 757] >gi|125617647|gb|EAZ46205.1| conserved hypothetical protein [Vibrio cholerae MO10] >gi|126510844|gb|EAZ73438.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457] >gi|126519772|gb|EAZ76995.1| conserved hypothetical protein [Vibrio cholerae B33] >gi|146316441|gb|ABQ20980.1| conserved hypothetical protein [Vibrio cholerae O395] (189 aa)
Score = 94, Expect = 3.8e-02, Identities = 22/55 (40%), Positives = 30/55 (54%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           D+L  GHTHI       +I ++NPGS+ +PR      SY VL  +  K+ SV  E
  S:   128 DVLVHGHTHIPVAEQVGSIYLVNPGSMTFPR-GEYAASYGVLEGDTMKVISVAGE 181
>gi|78044258|ref|YP_359186.1| putative phosphoesterase [Carboxydothermus hydrogenoformans Z-2901] >gi|77996373|gb|ABB15272.1| putative phosphoesterase [Carboxydothermus hydrogenoformans Z-2901] (156 aa)
Score = 94, Expect = 4.1e-02, Identities = 41/144 (28%), Positives = 64/144 (44%)
  Q:    11 LIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFD---YFVAGNND--YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELK-LYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEG 154
           L++SDTHG      K          IH GD+  D   +        + V GN D  + G      ++  +   L HG  +      Y + +LK + E A +  +D+   GH+H+      + + ++NPGS   PR   Q  S AVL +E 
  S:     4 LVVSDTHGRIEKVIKYARSRNFAGIIHAGDYYRDGIALGAELGIPVFAVHGNCDGVWNGIEEELLELNGIKIFLTHGHLY------YVKHDLKQIAEKAAQLKVDLAVFGHSHVPIFTELNGVRLLNPGSPERPRE-EQRGSLAVLKMEA 146
>gi|116617727|ref|YP_818098.1| phosphoesterase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096574|gb|ABJ61725.1| Predicted phosphoesterase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (178 aa)
Score = 93, Expect = 4.2e-02, Identities = 42/150 (28%), Positives = 67/150 (44%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFDYF-----VAGN--NDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRN--ANQMKSYAVLHIEGNK 156
           M K LI+SD H DR     I+ + +  +    G F      ++ + D F     V GN  +D +        I+ +     HG  +  +          + E A + +  ++  GHTH E     D+ L INPGS   P+   A+   +YAVL +  +K
  S:     1 MVKFLIVSDIHSDRKILVDILAQWRDKVD---GIFYNGDSELNADDDIFAGVSTVIGNMDDDPDFAEARSTVIDGITFFQTHGHLYNATAILKWANLDSMNEAANDAHAQVVLFGHTHKEGAVSYDHKLFINPGSTTLPKGSRADLGGTYAVLEVTDDK 156
>gi|89894624|ref|YP_518111.1| hypothetical protein DSY1878 [Desulfitobacterium hafniense Y51] >gi|89334072|dbj|BAE83667.1| hypothetical protein [Desulfitobacterium hafniense Y51] (167 aa)
Score = 93, Expect = 4.3e-02, Identities = 47/151 (31%), Positives = 75/151 (49%)
  Q:     9 KILIISDTH--GDRSFFRKIINE-EQPDIKIHCGD-----FCTDIDLISENFDYFVAGNND-YEGERIVDFKIEDLNC-RLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           +I ++SDTH  G ++  + +  + E  D+ IH GD       +D+  I+      V GN D +E   +   KI  + C  +  G   G   PG    E  L  +  ++ +D++  GH+HI     +  IL+ NPGS    R   Q  S  ++ IEG  IK+
  S:     5 RIAVLSDTHLRGGQALPKWVWEQCEVADLIIHAGDVGYPSLLSDLGQIAPL--EAVQGNCDGWELAHLPHHKI--ITCGEIRIGVTHGAYGPGRSTPERALRTF-DQDKVDLIIFGHSHIPYQEKQGEILLFNPGSPTDKRRQPQY-SMGMIWIEGKIIKA 159
>gi|57650262|ref|YP_186026.1| hypothetical protein SACOL1163 [Staphylococcus aureus subsp. aureus COL] >gi|151221277|ref|YP_001332099.1| hypothetical protein NWMN_1065 [Staphylococcus aureus subsp. aureus str. Newman] >gi|57284448|gb|AAW36542.1| conserved hypothetical protein TIGR00040 [Staphylococcus aureus subsp. aureus COL] >gi|150374077|dbj|BAF67337.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus str. Newman] (167 aa)
Score = 93, Expect = 4.3e-02, Identities = 44/147 (29%), Positives = 69/147 (46%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEEQPD--IKIHCGDFCTDIDLISENFDYFVAGNNDY--EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           M K +I+SD H +     +I  E  PD  + +H GD     D    +    V GN D+  E E     K  D+     HG  +  +      R+L L E   E      F GHTH+ +  Y + + +INPGS+   R++ + ++YA + I+
  S:     1 MSKWIIVSDNHTESGVLYQIY-EMHPDADVYLHLGDSELAYDDTELSLFNRVKGNCDFYPEFENEAVAKYNDVKAFYTHGHLYQVN----RTRDL-LAEKGLELGCLFAFYGHTHVAKYEYINGVHVINPGSISQSRSSME-ETYAEVIID 144
>gi|150008800|ref|YP_001303543.1| putative phosphoesterase [Parabacteroides distasonis ATCC 8503] >gi|149937224|gb|ABR43921.1| conserved hypothetical protein, putative phosphoesterase [Parabacteroides distasonis ATCC 8503] (166 aa)
Score = 93, Expect = 4.6e-02, Identities = 51/155 (32%), Positives = 81/155 (52%)
  Q:     7 MKKILIISDTHG---DR--SFFRKIINEEQPDIKIHCGDFCTDIDLISENFDYF-----VAGNNDYEGER-----IVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNI--LIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVE 161
           M K+ ++SDTH    D+   +F+        D   H GD  +D  L++  F+       V GN D +  R     +  FK+ED+N  + H    GY  PG    E++   Y    N+ I  SGH+HI +V +  ++  L +NPG+       +Q+++     IEG  IK +E
  S:     1 MIKVGLLSDTHAYWDDKYAEYFKDC------DEIWHAGDIGSD--LLAAKFEALKPFKAVYGNIDGQAIRLQYPKVAHFKVEDVNVMMTHIG--GY--PGRYNPEIRKELYDTRPNLFI--SGHSHILKVVFDRSLKCLHMNPGA-AGKSGFHQVRTLLRFVIEGKDIKDLE 157
>gi|170051140|ref|XP_001861630.1| vacuolar protein sorting-associated protein 29 [Culex quinquefasciatus] >gi|167872507|gb|EDS35890.1| vacuolar protein sorting-associated protein 29 [Culex quinquefasciatus] (182 aa)
Score = 93, Expect = 4.6e-02, Identities = 29/91 (31%), Positives = 46/91 (50%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS 134
           D+ ++  +FD     N +Y  ++IV   +      L HG Q    VP  +   L L +  ++ ++DIL SGHTH  + +  +N   INPGS
  S:    55 DVHIVRGDFDE----NMNYPDQKIV--TVGQFRVGLTHGHQV---VPWGDPEALALIQ--RQLDVDILISGHTHKFEAYEHENKFYINPGS 134
>gi|126465245|ref|YP_001040354.1| metallophosphoesterase [Staphylothermus marinus F1] >gi|126014068|gb|ABN69446.1| metallophosphoesterase [Staphylothermus marinus F1] (248 aa)
Score = 93, Expect = 4.8e-02, Identities = 32/101 (31%), Positives = 54/101 (53%)
  Q:    50 ENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQ----FGYSVP--GYER-----------RELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVL 150
           EN    +  +ND E    +   IE  N   +HG      + Y  P  GYE            R+    + + ++  + ++ GHTH++ +   D+I +INPGS+  PR+ +    YAV+
  S:    85 ENITNKLLSSNDKEYLAKLPLFIEKDNALYVHGSPSNPLYDYLYPWIGYEEIIEKILRAVIGRKYVFGKTSGKHRYERIYVGHTHVQFMLTIDSIQVINPGSIGQPRDGDPRAGYAVV 202
>gi|88801322|ref|ZP_01116850.1| hypothetical protein PI23P_01647 [Polaribacter irgensii 23-P] >gi|88781980|gb|EAR13157.1| hypothetical protein PI23P_01647 [Polaribacter irgensii 23-P] (165 aa)
Score = 93, Expect = 4.9e-02, Identities = 48/128 (37%), Positives = 68/128 (53%)
  Q:     7 MKKILIISDTHGDRSFFRKIINE--EQPDIKIHCGDF----CTD-------IDLISENFDYFVAGNNDYEGERIVD--FKIEDLNCRLMHGDQFGYSVPGYERR-ELKLYEYAKENNIDILFSGHTHIEQVFY--KDNILIINPGS 134
           MKKIL+ISDTH   SF    I +   Q D   H GD      TD       +  +  N D     ++D   E  +D  F++ED+   + H       + GY  R + ++ E  K N   I  SGH+HI +V Y  K  +L +NPG+
  S:     1 MKKILLISDTH---SFIDDQILKFVRQADEVWHAGDIGNLQVTDTIKSLKPLRAVFGNID-----DHDARAEFPLDQKFEVEDVTIWITH-------IGGYPNRYDQRVREELKINTPTIFISGHSHILKVQYDKKLKLLHLNPGA 131
>gi|50756577|ref|XP_415222.1| PREDICTED: similar to vacuolar sorting protein VPS29 [Gallus gallus] (181 aa)
Score = 93, Expect = 5.1e-02, Identities = 39/129 (30%), Positives = 68/129 (52%)
  Q:    39 GDFCTDIDLISENFDYF---------VAGNND---YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEF---EDVVK 167
           G+ CT      E++DY          V G+++   Y  +++V   +      L+HG Q    +P  +   L L +  ++ ++DIL SGHTH  + F  +N   INPGS          N + S+ ++ I+ + + +  +   ED VK
  S:    38 GNLCT-----KESYDYLRTLAGDVHVVKGDSESLNYPEQKVV--TVGQFRIGLIHGHQV---IPWGDVASLALLQ--RQLDVDILISGHTHRFEAFEHENKFYINPGSATGAYTGLQTNVIPSFVLMDIQASTVVTYVYQLIEDDVK 172
>gi|58383585|ref|XP_312630.2| AGAP002338-PA [Anopheles gambiae str. PEST] >gi|55242454|gb|EAA08218.2| AGAP002338-PA [Anopheles gambiae str. PEST] (182 aa)
Score = 93, Expect = 5.3e-02, Identities = 32/122 (26%), Positives = 60/122 (49%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLM---YPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           D+ ++  +FD     N +Y  +++V   +      L HG Q    VP  +   L L +  ++ ++DIL SGHTH  + +  +N   INPGS      P +   + S+ ++ I+   + +  ++ V
  S:    55 DVHIVRGDFDE----NTNYPEQKVV--TVGQFRIGLSHGHQV---VPWGDPEALALIQ--RQLDVDILISGHTHKFEAYEHENKFYINPGSATGSYNPLDTAVIPSFVLMDIQSTTVVTYVYQLV 168
>gi|145538383|ref|XP_001454897.1| hypothetical protein GSPATT00021143001 [Paramecium tetraurelia strain d4-2] >gi|124422674|emb|CAK87500.1| unnamed protein product [Paramecium tetraurelia] (191 aa)
Score = 93, Expect = 5.3e-02, Identities = 34/105 (32%), Positives = 56/105 (53%)
  Q:    54 YFVAGNNDYEGERIVDFKIEDLNC---RLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQ--MKSYAVLHIEGNKIK 158
           +FV G+ D E + I + KI  +      L+HG Q    +P  +  +  LY + KE   D+L +G+T + +V   +   IINPGS+    N  Q  + S+ +L  +  KI+
  S:    67 HFVKGDFD-EAKDIPETKIIQIGAWKLALVHGHQI---IPAGD--DESLYTFLKEMEADVLITGYTGVAKVSAVEKKYIINPGSVTGGFNGQQSSIPSFLILEFKKEKIQ 170
>gi|15903736|ref|NP_359286.1| hypothetical protein spr1694 [Streptococcus pneumoniae R6] >gi|116516789|ref|YP_817109.1| hypothetical protein SPD_1659 [Streptococcus pneumoniae D39] >gi|148998743|ref|ZP_01826181.1| phosphodiesterase, MJ0936 family protein [Streptococcus pneumoniae SP11-BS70] >gi|149011256|ref|ZP_01832503.1| phosphodiesterase, MJ0936 family protein [Streptococcus pneumoniae SP19-BS75] >gi|168491806|ref|ZP_02715949.1| phosphodiesterase, family [Streptococcus pneumoniae CDC0288-04] >gi|168574932|ref|ZP_02720895.1| phosphodiesterase, family [Streptococcus pneumoniae MLV-016] >gi|182684822|ref|YP_001836569.1| hypothetical protein SPCG_1852 [Streptococcus pneumoniae CGSP14] >gi|15459369|gb|AAL00497.1| Conserved hypothetical protein [Streptococcus pneumoniae R6] >gi|116077365|gb|ABJ55085.1| phosphodiesterase, MJ0936 family protein [Streptococcus pneumoniae D39] >gi|147755437|gb|EDK62486.1| phosphodiesterase, MJ0936 family protein [Streptococcus pneumoniae SP11-BS70] >gi|147764246|gb|EDK71177.1| phosphodiesterase, MJ0936 family protein [Streptococcus pneumoniae SP19-BS75] >gi|182630156|gb|ACB91104.1| hypothetical protein SPCG_1852 [Streptococcus pneumoniae CGSP14] >gi|183573861|gb|EDT94389.1| phosphodiesterase, family [Streptococcus pneumoniae CDC0288-04] >gi|183578815|gb|EDT99343.1| phosphodiesterase, family [Streptococcus pneumoniae MLV-016] (173 aa)
Score = 92, Expect = 5.5e-02, Identities = 41/151 (27%), Positives = 66/151 (43%)
  Q:     8 KKILIISDTHGDRSFFRKIINEE--QPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEG---ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           + I+++SD+HGD     ++ +    + D   H GD     D         V GN D+     ER+V  ++        HG  F  +         KL  +A+E    I   GH H+   + +  IL +NPGS+  PR   +   YA + I+ +  K
  S:     4 QTIIVMSDSHGDSLIVEEVRDRYVGKVDAVFHNGDSELRPDSPLWEGIRVVKGNMDFYAGYPERLVT-ELGSTKIIQTHGHLFDINF-----NFQKLDYWAQEEEAAICLYGHLHVPSAWMEGKILFLNPGSISQPRGTIRECLYARVEIDDSYFK 153
>gi|15901707|ref|NP_346311.1| hypothetical protein SP_1879 [Streptococcus pneumoniae TIGR4] >gi|111657287|ref|ZP_01408052.1| hypothetical protein SpneT_02001504 [Streptococcus pneumoniae TIGR4] >gi|148984331|ref|ZP_01817626.1| hypothetical protein CGSSp3BS71_03882 [Streptococcus pneumoniae SP3-BS71] >gi|148989672|ref|ZP_01821004.1| hypothetical protein CGSSp6BS73_00485 [Streptococcus pneumoniae SP6-BS73] >gi|148993337|ref|ZP_01822877.1| hypothetical protein CGSSp9BS68_07062 [Streptococcus pneumoniae SP9-BS68] >gi|149003920|ref|ZP_01828734.1| hypothetical protein CGSSp14BS69_09155 [Streptococcus pneumoniae SP14-BS69] >gi|149006466|ref|ZP_01830165.1| hypothetical protein CGSSp18BS74_01716 [Streptococcus pneumoniae SP18-BS74] >gi|149025003|ref|ZP_01836383.1| site-specific tyrosine recombinase XerD-like protein [Streptococcus pneumoniae SP23-BS72] >gi|168483411|ref|ZP_02708363.1| phosphodiesterase, family [Streptococcus pneumoniae CDC1873-00] >gi|168487313|ref|ZP_02711821.1| phosphodiesterase, family [Streptococcus pneumoniae CDC1087-00] >gi|168489843|ref|ZP_02714042.1| phosphodiesterase, family [Streptococcus pneumoniae SP195] >gi|168494205|ref|ZP_02718348.1| phosphodiesterase, family [Streptococcus pneumoniae CDC3059-06] >gi|169833464|ref|YP_001695245.1| phosphodiesterase [Streptococcus pneumoniae Hungary19A-6] >gi|14973382|gb|AAK75951.1| conserved hypothetical protein [Streptococcus pneumoniae TIGR4] >gi|147758060|gb|EDK65065.1| hypothetical protein CGSSp14BS69_09155 [Streptococcus pneumoniae SP14-BS69] >gi|147761764|gb|EDK68727.1| hypothetical protein CGSSp18BS74_01716 [Streptococcus pneumoniae SP18-BS74] >gi|147923620|gb|EDK74733.1| hypothetical protein CGSSp3BS71_03882 [Streptococcus pneumoniae SP3-BS71] >gi|147924989|gb|EDK76071.1| hypothetical protein CGSSp6BS73_00485 [Streptococcus pneumoniae SP6-BS73] >gi|147928104|gb|EDK79123.1| hypothetical protein CGSSp9BS68_07062 [Streptococcus pneumoniae SP9-BS68] >gi|147929496|gb|EDK80491.1| site-specific tyrosine recombinase XerD-like protein [Streptococcus pneumoniae SP23-BS72] >gi|168995966|gb|ACA36578.1| phosphodiesterase, family [Streptococcus pneumoniae Hungary19A-6] >gi|172043271|gb|EDT51317.1| phosphodiesterase, family [Streptococcus pneumoniae CDC1873-00] >gi|183569799|gb|EDT90327.1| phosphodiesterase, family [Streptococcus pneumoniae CDC1087-00] >gi|183571738|gb|EDT92266.1| phosphodiesterase, family [Streptococcus pneumoniae SP195] >gi|183575820|gb|EDT96348.1| phosphodiesterase, family [Streptococcus pneumoniae CDC3059-06] (173 aa)
Score = 92, Expect = 5.6e-02, Identities = 41/151 (27%), Positives = 66/151 (43%)
  Q:     8 KKILIISDTHGDRSFFRKIINEE--QPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEG---ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           + I+++SD+HGD     ++ +    + D   H GD     D         V GN D+     ER+V  ++        HG  F  +         KL  +A+E    I   GH H+   + +  IL +NPGS+  PR   +   YA + I+ +  K
  S:     4 QTIIVMSDSHGDSLIVEEVRDRYVGKVDAVFHNGDSELRPDSPLWEGIRVVKGNMDFYAGYPERLVT-ELGSTKIIQTHGHLFDINF-----NFQKLDYWAQEEEAAICLYGHLHVPSAWLEGKILFLNPGSISQPRGTIRECLYARVEIDDSYFK 153
>gi|163787683|ref|ZP_02182130.1| transcription termination factor Rho [Flavobacteriales bacterium ALC-1] >gi|159877571|gb|EDP71628.1| transcription termination factor Rho [Flavobacteriales bacterium ALC-1] (164 aa)
Score = 92, Expect = 5.6e-02, Identities = 50/155 (32%), Positives = 78/155 (50%)
  Q:     7 MKKILIISDTHG--DRSFFRKIINEEQPDIKIHCGDF----CTDIDLISENFDYFVAGNNDYEGERIV-----DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVF--YKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVE 161
           MKKIL++SDTH   D +  + +   +Q D   H GD      TD   + +     V GN D    R        F  ED++  + H    G   P Y  R   + E  + N  DI  +GH+HI +V    K N+L +NPG++      +++++     I+G +IK +E
  S:     1 MKKILLLSDTHSYIDDAILKYV---KQADEVWHAGDIGDLKVTDKITVLKPIKA-VYGNIDDAKARTEFPLHNRFMCEDVDVWITH---IGGYPPKYNNR---VREELQLNPPDIFITGHSHILKVMPDKKLNLLHMNPGAVG-KHGFHKIRTMLRFKIDGKQIKDLE 157
>gi|59711396|ref|YP_204172.1| phosphodiesterase [Vibrio fischeri ES114] >gi|59479497|gb|AAW85284.1| predicted phosphatase [Vibrio fischeri ES114] (183 aa)
Score = 92, Expect = 5.8e-02, Identities = 21/55 (38%), Positives = 31/55 (56%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVL--------HIEGNKIKSVEFE 163
           DI+  GHTHI    +    +I NPGS  +PR   +  SY +L          EGN + S++ +
  S:   121 DIIAHGHTHITVAEWVGEQIIFNPGSTTFPRIEGEKASYGLLDGQTLSVCDFEGNTLHSIDIQ 183
>gi|15924143|ref|NP_371677.1| hypothetical protein SAV1153 [Staphylococcus aureus subsp. aureus Mu50] >gi|15926736|ref|NP_374269.1| hypothetical protein SA0999 [Staphylococcus aureus subsp. aureus N315] >gi|21282764|ref|NP_645852.1| hypothetical protein MW1035 [Staphylococcus aureus subsp. aureus MW2] >gi|49485990|ref|YP_043211.1| hypothetical protein SAS1086 [Staphylococcus aureus subsp. aureus MSSA476] >gi|82750759|ref|YP_416500.1| hypothetical protein SAB1016 [Staphylococcus aureus RF122] >gi|87159931|ref|YP_493749.1| hypothetical protein SAUSA300_1051 [Staphylococcus aureus subsp. aureus USA300] >gi|88194854|ref|YP_499652.1| hypothetical protein SAOUHSC_01108 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148267644|ref|YP_001246587.1| phosphodiesterase [Staphylococcus aureus subsp. aureus JH9] >gi|150393699|ref|YP_001316374.1| phosphodiesterase [Staphylococcus aureus subsp. aureus JH1] >gi|156979474|ref|YP_001441733.1| hypothetical protein SAHV_1143 [Staphylococcus aureus subsp. aureus Mu3] >gi|161509327|ref|YP_001574986.1| hypothetical protein USA300HOU_1088 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727546|ref|ZP_02759823.1| hypothetical protein Sauraur_04197 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|13700952|dbj|BAB42248.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] >gi|14246923|dbj|BAB57315.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] >gi|21204202|dbj|BAB94900.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] >gi|49244433|emb|CAG42861.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|82656290|emb|CAI80704.1| conserved hypothetical protein [Staphylococcus aureus RF122] >gi|87125905|gb|ABD20419.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202412|gb|ABD30222.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740713|gb|ABQ49011.1| phosphodiesterase, MJ0936 family [Staphylococcus aureus subsp. aureus JH9] >gi|149946151|gb|ABR52087.1| phosphodiesterase, MJ0936 family [Staphylococcus aureus subsp. aureus JH1] >gi|156721609|dbj|BAF78026.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] >gi|160368136|gb|ABX29107.1| hypothetical protein USA300HOU_1088 [Staphylococcus aureus subsp. aureus USA300_TCH1516] (167 aa)
Score = 92, Expect = 5.8e-02, Identities = 44/147 (29%), Positives = 69/147 (46%)
  Q:     7 MKKILIISDTHGDRSFFRKIINEEQPD--IKIHCGDFCTDIDLISENFDYFVAGNNDY--EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           M K +I+SD H +     +I  E  PD  + +H GD     D    +    V GN D+  E E     K  D+     HG  +  +      R+L L E   E      F GHTH+ +  Y + + +INPGS+   R++ + ++YA + I+
  S:     1 MSKWIIVSDNHTESGVLYQIY-EMHPDADVYLHLGDSEFAYDDTELSLFNRVKGNCDFYPEFENEAVAKYNDVKAFYTHGHLYQVN----RTRDL-LAEKGLELGCLFAFYGHTHVAKYEYINGVHVINPGSISQSRSSME-ETYAEVIID 144
>gi|152965482|ref|YP_001361266.1| phosphodiesterase [Kineococcus radiotolerans SRS30216] >gi|151359999|gb|ABS03002.1| phosphodiesterase, MJ0936 family [Kineococcus radiotolerans SRS30216] (210 aa)
Score = 92, Expect = 6.4e-02, Identities = 39/136 (28%), Positives = 68/136 (50%)
  Q:    30 EQPDIKIHCGDFCTDIDLIS----ENFDYFVAGNNDYEGER-----IVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIE-QVFYKDNILIINPGSLMYPRNANQM--KSYAVLHIEGNKIKSVEFEDV 165
           E  D+ +H GD+C +  +++          VAGNND    R       +F +E L   ++H  + G    G ERR     + A+   +D+L  GH+H+         I ++NPGS   P +  +M  +++  L +   +++ VE   V
  S:    29 EAADLVVHAGDWCDEATVLALRDRARRLVGVAGNNDGPDVRAHLGEFAEFAVEGLRFGVVH--ETG-PRQGRERR----CDAARAGTLDVLLFGHSHVPWDSTTPSGIRLLNPGS---PTDRRRMPTRTWLELTVAEGRLEEVELRHV 166
>gi|183179434|ref|ZP_02957645.1| conserved hypothetical protein [Vibrio cholerae MZO-3] >gi|183012845|gb|EDT88145.1| conserved hypothetical protein [Vibrio cholerae MZO-3] (189 aa)
Score = 92, Expect = 6.5e-02, Identities = 21/55 (38%), Positives = 30/55 (54%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           D+L  GHTHI       +I ++NPGS+ +PR  +   SY VL  +   + SV  E
  S:   128 DVLVHGHTHIPMAEQVGSIYLVNPGSMTFPR-GDYAASYGVLEGDTMTVISVAGE 181
>gi|156545657|ref|XP_001604061.1| PREDICTED: similar to ENSANGP00000015419 [Nasonia vitripennis] (185 aa)
Score = 92, Expect = 6.8e-02, Identities = 31/123 (25%), Positives = 63/123 (51%)
  Q:    43 TDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLM---YPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           +D+ ++  +FD     N +Y  +++V   +      L HG Q    VP  +   L L +  ++ ++DIL +GHTH  + +  +N   INPGS      P + + + S+ ++ I+ + + +  ++ V
  S:    57 SDVHIVRGDFDE----NLNYPEQKVV--TVGQFRIGLSHGHQV---VPWGDPEALALIQ--RQLDVDILITGHTHKFEAYEHENKFYINPGSATGAYNPLDTSVIPSFVLMDIQSSTVVTYVYQLV 171
>gi|153940984|ref|YP_001390345.1| phosphodiesterase [Clostridium botulinum F str. Langeland] >gi|152936880|gb|ABS42378.1| phosphodiesterase, MJ0936 family [Clostridium botulinum F str. Langeland] (181 aa)
Score = 92, Expect = 7.0e-02, Identities = 53/153 (34%), Positives = 80/153 (52%)
  Q:     9 KILIISDTHGDRSFFRK---IINEEQPDIKIHCGDFCT-----------DIDLISENFDYF------VAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKL---YEYAKEN--NI---DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVE 161
           K+  +SD HG   +  K   I  +E+ D  I  GD              D   ++E  + +      V GN + E +++V      LN  +M      YS+  Y  + L L   + + K+N  NI   D L  GHTHI      +NI +INPGS+ +P+  N    Y +L     KIK++E
  S:     2 KLFFMSDIHGSAYYLEKALHIFEKEKADYLIILGDELYHGARNPLPKGYDPKKVTEILNSYKDKIIAVRGNCESEVDQMV------LNYPIMSD----YSIVLYNGKRLFLTHGHIFNKDNMPNISDGDALIYGHTHIPLAEKINNIFVINPGSITFPKE-NTPHCYGILSDNLFKIKTLE 171
>gi|189238482|ref|XP_969121.2| PREDICTED: similar to AGAP002338-PA [Tribolium castaneum] (182 aa)
Score = 91, Expect = 7.3e-02, Identities = 29/99 (29%), Positives = 50/99 (50%)
  Q:    43 TDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA 141
           +D+ ++  +FD     N +Y  +++V   +      L+HG Q    VP  +   L L +  ++ ++DIL SGHTH  + +  ++   INPGS     NA
  S:    54 SDVHVVRGDFD----DNLNYPEQKVV--TVGQFRIGLLHGHQV---VPWGDPESLALIQ--RQLDVDILISGHTHKFEAYEHESKFYINPGSATGAYNA 141
>gi|27363676|ref|NP_759204.1| phosphodiesterase [Vibrio vulnificus CMCP6] >gi|27359792|gb|AAO08731.1|AE016797_186 Predicted phosphoesterase [Vibrio vulnificus CMCP6] (185 aa)
Score = 91, Expect = 7.3e-02, Identities = 17/42 (40%), Positives = 26/42 (61%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVL 150
           DIL  GH+H+     +  I++ NPGS+ +PR  NQ+ SY + 
  S:   123 DILAHGHSHVALAEPQGEIVVFNPGSVTFPRE-NQLASYGLF 163
>gi|91773336|ref|YP_566028.1| hypothetical protein Mbur_1360 [Methanococcoides burtonii DSM 6242] >gi|91712351|gb|ABE52278.1| Protein of unknown function UPF0025 [Methanococcoides burtonii DSM 6242] (176 aa)
Score = 91, Expect = 7.5e-02, Identities = 50/155 (32%), Positives = 79/155 (50%)
  Q:     9 KILIISDTH---GD-RSFFRKIINEEQPDIKIHCGDFCTDIDLISENFDYFVA--------GNNDYEG------ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKI--KSVEFE 163
           +IL ISDTH   GD    FR ++++   D+  H GDF ++     E ++ F A        GN+D         ER+V F+ E +   ++H                 L   A E  +D+L  GH H   +  K ++++I PGS   PR ++   S  ++ I+  KI  + VE E
  S:     2 RILAISDTHLKGGDIPPTFRGLVDD--CDMIAHAGDFTSN-----ECYNAFAATGKLKAVHGNSDNSELKQLLPERLV-FETEGIKIGIVHEGSLSI------MDTTALRYLALEMGVDVLIFGHIH-RPLIEKSDVILICPGSPTEPRQSD--PSVVLIDIKDGKILPRIVEIE 159
>gi|73669534|ref|YP_305549.1| hypothetical protein Mbar_A2035 [Methanosarcina barkeri str. Fusaro] >gi|72396696|gb|AAZ70969.1| conserved hypothetical protein [Methanosarcina barkeri str. Fusaro] (186 aa)
Score = 91, Expect = 7.8e-02, Identities = 43/134 (32%), Positives = 74/134 (55%)
  Q:     9 KILIISDTHGDRSFFRKIINE--EQPDIKIHCGDFCTDIDLISENFDYF--------VAGNNDY-EGERIV----DFKIEDLNCRLMHGDQFGYSV-----PGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNAN 142
           K++++SDTH       + +    ++ DI +H GDF T      + ++ F        V GN+D  E +R++     F++E +   ++H  + G SV      GY          AKE ++DIL  GH H   +  K +++++ PGS   PR +N
  S:     2 KLIVLSDTHMKNGEIPQQLKTLLKECDIIVHAGDFST-----VKAYNAFNASGKLKAVFGNDDTSELKRLLPERLKFEVEGVKIGVVH--EGGLSVNDTTAQGY---------LAKEMDVDILIFGHLH-RPLIEKRDVVLVCPGSPTRPRMSN 138
>gi|171849117|pdb|3CK2|A Chain A, Crystal Structure Of Conserved Uncharacterized Protein (Predicted Phosphoesterase Cog0622) From Streptococcus Pneumoniae Tigr4 (176 aa)
Score = 91, Expect = 8.1e-02, Identities = 41/151 (27%), Positives = 65/151 (43%)
  Q:     8 KKILIISDTHGDRSFFRKIINEE--QPDIKIHCGDFCTDIDLISENFDYFVAGNNDYEG---ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           + I++ SD+HGD     ++ +    + D   H GD     D         V GN D+     ER+V  ++        HG  F  +         KL  +A+E    I   GH H+   + +  IL +NPGS+  PR   +   YA + I+ +  K
  S:     7 QTIIVXSDSHGDSLIVEEVRDRYVGKVDAVFHNGDSELRPDSPLWEGIRVVKGNXDFYAGYPERLVT-ELGSTKIIQTHGHLFDINF-----NFQKLDYWAQEEEAAICLYGHLHVPSAWLEGKILFLNPGSISQPRGTIRECLYARVEIDDSYFK 156
>gi|157128660|ref|XP_001661488.1| vacuolar sorting protein vps29 [Aedes aegypti] >gi|157167327|ref|XP_001660257.1| vacuolar sorting protein vps29 [Aedes aegypti] >gi|94468608|gb|ABF18153.1| membrane coat complex retromer subunit VPS29/PEP11 [Aedes aegypti] >gi|108872529|gb|EAT36754.1| vacuolar sorting protein vps29 [Aedes aegypti] >gi|108882902|gb|EAT47127.1| vacuolar sorting protein vps29 [Aedes aegypti] (182 aa)
Score = 91, Expect = 8.3e-02, Identities = 28/91 (30%), Positives = 46/91 (50%)
  Q:    44 DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS 134
           D+ ++  +FD     N +Y  +++V   +      L HG Q    VP  +   L L +  ++ ++DIL SGHTH  + +  +N   INPGS
  S:    55 DVHIVRGDFDE----NMNYPEQKVV--TVGQFRVGLTHGHQV---VPWGDPEALALIQ--RQLDVDILISGHTHKFEAYEHENKFYINPGS 134
>gi|163729687|ref|ZP_02137166.1| phosphodiesterase [Vibrio fischeri MJ11] >gi|161397144|gb|EDQ21434.1| phosphodiesterase [Vibrio fischeri MJ11] (182 aa)
Score = 91, Expect = 8.5e-02, Identities = 20/55 (36%), Positives = 29/55 (52%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           DI+  GHTHI    +    +I NPGS  +PR   +  SY +L  +G  +   +FE
  S:   121 DIIAHGHTHITVAEWVGEQIIFNPGSTTFPRIEGEKASYGLL--DGQTLSVCDFE 173
>gi|95929561|ref|ZP_01312303.1| Protein of unknown function UPF0025 [Desulfuromonas acetoxidans DSM 684] >gi|95134258|gb|EAT15915.1| Protein of unknown function UPF0025 [Desulfuromonas acetoxidans DSM 684] (165 aa)
Score = 91, Expect = 8.5e-02, Identities = 43/146 (29%), Positives = 72/146 (49%)
  Q:     7 MKKILIISDTHGDR-----SFFRKIINE--EQPDIKIHCGDFC-TDIDLISENFDYF-VAGNNDYEG-----ERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHI 152
           MKKI ++SDTH +      +    ++       D  IH GD    ++ L+ +   ++ V GN D        +RI+   IE     ++HG  +G      +  E ++ E+    ++D L  GH+H         IL++NPGS    R +    S A+LH+
  S:     1 MKKIAVLSDTHFNTLSEATALVEHLLTSCFSSVDAVIHAGDLVHPELGLLFDGLPFYSVQGNMDCSQPGVPLQRIL--TIESWRIGVVHG--WGPK----DDLEQRMLEHFAPAHLDCLIYGHSHHPICHRVGGILVVNPGSAA-DRRSEPWHSVALLHV 151
>gi|82705718|ref|XP_727083.1| phosphoesterase [Plasmodium yoelii yoelii str. 17XNL] >gi|23482764|gb|EAA18648.1| phosphoesterase, putative [Plasmodium yoelii yoelii] (191 aa)
Score = 91, Expect = 8.5e-02, Identities = 30/106 (28%), Positives = 52/106 (49%)
  Q:    59 NNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS---LMYPRNANQMKSYAVLHIEGNKIKSVEFED 164
           +N+++    ++ KI D    L+HG Q    +P  +     L ++ KE + DI+ SGHTH   +   +    INPGS      P  +N   S+ ++ I  + I    +E+
  S:    73 DNNFDFPEKINIKIGDFKISLVHGHQI---IPWGDLN--ALLQWQKEYDSDIIISGHTHKNSINNFEGKYFINPGSATGAFQPWISNPTPSFILMAISKSSIVVYVYEE 176
>gi|110755558|ref|XP_001121517.1| PREDICTED: similar to vacuolar protein sorting 29 isoform 2 [Apis mellifera] (191 aa)
Score = 90, Expect = 9.4e-02, Identities = 32/123 (26%), Positives = 61/123 (49%)
  Q:    43 TDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLM---YPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           +D+ ++  +FD     N +Y  +++V   +      L HG Q    VP  +   L L +  ++ ++DIL SGHTH  + +  +N   INPGS      P +     S+ ++ I+ + + +  ++ V
  S:    63 SDVHVVRGDFDE----NLNYPEQKVV--TVGQFRIGLSHGHQV---VPWGDPESLALIQ--RQLDVDILISGHTHKFEAYEHENKFYINPGSATGAYNPLDTQLSPSFVLMDIQSSTVVTYVYQLV 177
>gi|89097886|ref|ZP_01170773.1| putative phosphoesterase [Bacillus sp. NRRL B-14911] >gi|89087388|gb|EAR66502.1| putative phosphoesterase [Bacillus sp. NRRL B-14911] (165 aa)
Score = 90, Expect = 1.0e-01, Identities = 48/144 (33%), Positives = 75/144 (52%)
  Q:    10 ILIISDTH---GDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFDYF----VAGNNDYE--GERIVDFKIEDLN---CRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           I  ISDTH     R+    ++   E  DI +H GD+  D+ +  E   +     V GN D     E + D  I +LN     ++HG   G +    E+R L  +    ++ +D L  GH+HI  +  ++  LIINPGS +  R   +  S+AV+ +E
  S:     3 ITAISDTHMPKKGRNLPELLVEYLEISDIIVHAGDW-QDLSVYKELSSFGRLEGVFGNTDSGELKEMLKDKLILNLNGFKLGIVHGHGKGKTT---EKRALASF---ADDKVDCLIYGHSHIPVLKKENGTLIINPGSPVDKRRQPRF-SFAVIRVE 151
>gi|119719119|ref|YP_919614.1| phosphodiesterase [Thermofilum pendens Hrk 5] >gi|119524239|gb|ABL77611.1| phosphodiesterase, MJ0936 family [Thermofilum pendens Hrk 5] (168 aa)
Score = 90, Expect = 1.0e-01, Identities = 40/156 (25%), Positives = 73/156 (46%)
  Q:     7 MKKILIISDTHGDRSFFRKIINE---EQPDIKIHCGDFCTD--IDLISENFDYFVAGNNDYE---------------GERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF 162
           M ++ ++SD+H      R  +N    E  +  IH GD  +   + + S    Y V GNND E                E+ +  ++   +  ++HG      V G +         AK     ++  GHTH   V    + L++NPG+L       + +++A++ +E  + + VE 
  S:     1 MARVAVVSDSHDSLEAIRLFVNSLKNENVEAVIHAGDIISPFALRMFSGYRLYAVFGNNDGEKLLLKKTADEIGAVLSEQPMLVRVGSFDIAVLHG------VDGLDVSRRLARALAKSGEFRLVVYGHTHRVDVERIGDALVVNPGTL--SGYLAEKRTFAIVDLEKLEAEIVEL 168
>gi|170725325|ref|YP_001759351.1| phosphodiesterase [Shewanella woodyi ATCC 51908] >gi|169810672|gb|ACA85256.1| phosphodiesterase, MJ0936 family [Shewanella woodyi ATCC 51908] (183 aa)
Score = 90, Expect = 1.1e-01, Identities = 20/55 (36%), Positives = 32/55 (58%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           DI+ SGHTH+     +  I++ NPGS+  PR  N+  SY +   E N++  + F+
  S:   121 DIIASGHTHLPVAEKQGEIILFNPGSVTIPRGENK-PSYGLF--EDNRLSVMNFD 172
>gi|195032211|ref|XP_001988456.1| GH11176 [Drosophila grimshawi] >gi|193904456|gb|EDW03323.1| GH11176 [Drosophila grimshawi] (182 aa)
Score = 90, Expect = 1.1e-01, Identities = 31/121 (25%), Positives = 59/121 (48%)
  Q:    43 TDIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS---LMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           TD+ ++  +FD     N  Y  +++V   +      L HG Q    VP  +   L L +  ++ ++DIL +GHT+  + +   N   INPGS      P + N + S+ ++ I+   + +  ++
  S:    54 TDVHIVRGDFDE----NLSYPEQKVV--TVGQFRIGLCHGHQV---VPRGDPEALALIQ--RQLDVDILITGHTYKFEAYEHGNKFYINPGSATGAFNPLDTNVVPSFVLMDIQSTTVVTYVYQ 166
>gi|158320157|ref|YP_001512664.1| phosphodiesterase [Alkaliphilus oremlandii OhILAs] >gi|158140356|gb|ABW18668.1| phosphodiesterase, MJ0936 family [Alkaliphilus oremlandii OhILAs] (243 aa)
Score = 90, Expect = 1.2e-01, Identities = 33/100 (33%), Positives = 44/100 (44%)
  Q:    63 EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF 162
           E E  +  +IE     L HG     +   YE    K  E  +    DIL  GHTH       +N L INPGS+  P++ +    Y ++   G KI  VEF
  S:   112 ELEEQISLEIEGYQLLLTHGSPISINDYIYENDLEKQEEIVEVLEEDILVFGHTHYPYYKKVNNKLFINPGSVGRPKDGDNRACYCIVEF-GEKI-DVEF 209
>gi|77960834|ref|ZP_00824689.1| COG0622: Predicted phosphoesterase [Yersinia mollaretii ATCC 43969] (180 aa)
Score = 89, Expect = 1.2e-01, Identities = 15/33 (45%), Positives = 22/33 (66%)
  Q:   107 NIDILFSGHTHIEQVFYKDNILIINPGSLMYPR 139
           N DIL  GHTH+ Q  ++D ++  NPGS+  P+
  S:   115 NGDILVYGHTHLPQAEWQDEVICFNPGSVSIPK 147
>gi|18313435|ref|NP_560102.1| hypothetical protein PAE2565 [Pyrobaculum aerophilum str. IM2] >gi|18160970|gb|AAL64284.1| conserved hypothetical protein [Pyrobaculum aerophilum str. IM2] (167 aa)
Score = 89, Expect = 1.3e-01, Identities = 42/151 (27%), Positives = 74/151 (49%)
  Q:    12 IISDTHGDRSF---FRKIINEEQPDIKIHCGDFCTDIDLIS-------ENFDYFVAGNNDYE----GERIVDFKIEDLN---CRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF 162
           +ISDTH D      F +I         IH GD+ +   ++        E   Y V GNND +     +R  D +++ L       + G + G     +   E+ +   AK    D++  GHTH   +   D +L++NPG       A++ K+ A+L++E   ++ ++ 
  S:     5 VISDTHDDYKAIYKFGEIARRVGVSAVIHAGDWTSPFSMLKMRRALGREIPVYTVFGNNDGDRYNFAKRAADSQVDILGEAGVVELDGVKIGVY---HGTSEILVEAMAKSGLFDVVIYGHTHKIDIRRVDGVLVVNPGEAC--GCASERKTAALLNVEKMDVEIIDL 167
>gi|110669490|ref|YP_659301.1| phosphoesterase,metallo-phosphoesterase-calcineu rin-like [Haloquadratum walsbyi DSM 16790] >gi|109627237|emb|CAJ53727.1| phosphoesterase,metallo-phosphoesterase-calcineu rin-like [Haloquadratum walsbyi DSM 16790] (170 aa)
Score = 89, Expect = 1.4e-01, Identities = 40/130 (30%), Positives = 60/130 (46%)
  Q:    10 ILIISDTHGDRSF------FRKIINEEQPDIKIHCGDFCTD--IDLISENFDYFV--AGNNDYEGERIVDFKIEDLNCRLMHGDQFGYS----VPGYERR--ELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPR 139
           + +ISDTH   +       +  + N E   +  H GDF  +  +D +       V  AGNND  G R           RL    QF ++    V  + RR     L    +E + D++  GH+H   V   +   ++NPGS   PR
  S:     2 LTVISDTHSTDNHQLSGQTYEAVQNAE---MVAHAGDFMCESVLDALQREATQLVGVAGNNDDTGIRE----------RLPTTRQFTFAGVQFVMTHTRRGGPTALSLLGRERDADVVIFGHSHRPTVIESEECTLVNPGSHAQPR 134
>gi|72145926|ref|XP_796390.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus] >gi|115944829|ref|XP_001191147.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus] (182 aa)
Score = 89, Expect = 1.5e-01, Identities = 37/154 (24%), Positives = 79/154 (51%)
  Q:    10 ILIISDTH------GDRSFFRKIINEEQPDIKIHCGDFCT------------DIDLISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLM---YPRNANQMKSYAVLHIEGNKIKSVEFE 163
           +L++ D H      G  + F+K++   +    +  G+ CT            D+ ++  +FD  V+    Y  +++V   +      + HG Q    +P  +   L + +  ++ ++DIL SGHTH  + +  +    INPGS        +AN + S+ ++ I+ + + +  ++
  S:     3 VLVLGDLHVPHRQSGLPAKFKKLLVPGKIQHILCTGNLCTKESQDYLKTLASDVHIVRGDFDETVS----YPEQKVV--TVGQFRVGICHGHQV---IPWGDVESLSMVQ--RQLDVDILISGHTHKFEAYEHEGKFYINPGSATGAYSALDANTVPSFVLMDIQASTVVTYVYQ 166
>gi|15643834|ref|NP_228882.1| hypothetical protein TM1076 [Thermotoga maritima MSB8] >gi|148270789|ref|YP_001245249.1| phosphodiesterase [Thermotoga petrophila RKU-1] >gi|170289519|ref|YP_001739757.1| phosphodiesterase [Thermotoga sp. RQ2] >gi|4981621|gb|AAD36153.1|AE001768_2 conserved hypothetical protein [Thermotoga maritima MSB8] >gi|147736333|gb|ABQ47673.1| phosphodiesterase, MJ0936 family [Thermotoga petrophila RKU-1] >gi|170177022|gb|ACB10074.1| phosphodiesterase, MJ0936 family [Thermotoga sp. RQ2] (157 aa)
Score = 89, Expect = 1.5e-01, Identities = 52/152 (34%), Positives = 81/152 (53%)
  Q:     7 MKKILIISDTHGD---RSFFRKIINE-EQPDIKIHCGDFCTDID--LISENFD---YFVAGNNDY-EGERIVDFK----IEDLNCRLMHGDQFGYSVP-GYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           MK+ L+ISD+H      S   +I+N  ++ D  I  GD+  D+D  ++ E F    Y V GN DY + +  + F     +E +   + HG    +  P   + R LK++    E    ILF GHTH  +   K  +  +NPGSL          SYAVL ++G +++
  S:     1 MKRFLLISDSHVPVRMASLPDEILNSLKEYDGVIGLGDY-VDLDTVILLEKFSKEFYGVHGNMDYPDVKEHLPFSKVLLVEGVTIGMCHG----WGAPWDLKDRLLKVF---NEKPQVILF-GHTHEPEDTVKAGVRFLNPGSL-------AEGSYAVLELDGGEVR 151
>gi|121533686|ref|ZP_01665513.1| phosphodiesterase, MJ0936 family [Thermosinus carboxydivorans Nor1] >gi|121307677|gb|EAX48592.1| phosphodiesterase, MJ0936 family [Thermosinus carboxydivorans Nor1] (185 aa)
Score = 89, Expect = 1.5e-01, Identities = 42/155 (27%), Positives = 84/155 (54%)
  Q:     9 KILIISDTHGDRSFFRKIINEE--QPDIKIHCGD--FCTDIDLISENFD---------------YFVAGNNDYEGERIV----------DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           KI I+SDTHG  + +RKI N      D+ IH GD  +    ++I + +D                   GN D E + +V            ++E+++  + H    G+++    ++ L     A++  + +  SGHTH+  +  ++  + +NPGS    +  + + + A   I G+K++ ++ +
  S:     2 KIGIVSDTHGCAATWRKIYNRYFCDMDVIIHAGDVLYHGPRNVIPDEYDPKALAEELNNCPIPIVAACGNCDAEVDGMVLNIPIQSPYTYLRLENISVLVTH----GHNLSDDAKQVL-----AEKMKVSLFISGHTHVAVLAKQNGRIFLNPGSPAMSKRPDGIGTIA--RIIGSKLEVLDIQ 174
>gi|20094205|ref|NP_614052.1| phosphoesterase [Methanopyrus kandleri AV19] >gi|19887227|gb|AAM01982.1| Predicted phosphoesterase [Methanopyrus kandleri AV19] (165 aa)
Score = 88, Expect = 1.7e-01, Identities = 43/153 (28%), Positives = 75/153 (49%)
  Q:    10 ILIISDTHGDRSFFRKI---INEEQPDIKIHCGDFCTDIDL---ISENFDYFVA--GNNDYEGERIVDFKIEDLNCRLM----HGDQFGYSVPGYERRELKLYE-YAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF 162
           I I+SDTH +     ++   +NE   ++ +H GD+     L        D F+   GNND E + + + K E++   L+     G+  G  V      E  + E  A+    D++  GHTH  +     + L++NPG +         ++ A+L  +  K++ VEF
  S:     3 IGILSDTHDNLKAIERLASELNEADVEVVLHAGDYVAPFTLPVLAKVECDEFIGVFGNNDGERDYLRE-KAEEVGFELVGEIFTGEVLGLRVAMIHGTEEAVVEALARCGEYDLVVYGHTHEPEERVVGDTLVVNPGEVC--GYVTGRRTAALLDPDEKKVEFVEF 165
>gi|70950411|ref|XP_744531.1| vacuolar protein sorting 29 [Plasmodium chabaudi chabaudi] >gi|56524523|emb|CAH81675.1| vacuolar protein sorting 29, putative [Plasmodium chabaudi] (191 aa)
Score = 88, Expect = 1.7e-01, Identities = 29/106 (27%), Positives = 53/106 (50%)
  Q:    59 NNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS---LMYPRNANQMKSYAVLHIEGNKIKSVEFED 164
           +++++    ++ KI D    L+HG Q    +P  +     L ++ KE + DI+ SGHTH   +   +    INPGS      P  +N + S+ ++ I  + I    +E+
  S:    73 DSNFDFPEKINIKIGDFKISLVHGHQI---IPWGDLN--ALLQWQKEYDSDIIISGHTHKNSINNFEGKYFINPGSATGAFQPWVSNPIPSFILMAISKSSIVVYVYEE 176
>gi|194535166|ref|YP_002070350.1| conserved hypothetical protein [Vibrio cholerae RC385] >gi|125621252|gb|EAZ49592.1| conserved hypothetical protein [Vibrio cholerae V51] >gi|150419960|gb|EDN12268.1| conserved hypothetical protein [Vibrio cholerae RC385] (189 aa)
Score = 88, Expect = 1.7e-01, Identities = 21/55 (38%), Positives = 29/55 (52%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           D+L  GHTHI       +I ++NPGS+ +PR      SY VL  +   + SV  E
  S:   128 DVLVHGHTHIPVAEQVGSIYLVNPGSMTFPR-GEYAASYGVLEGDTMTVISVAGE 181
>gi|116749556|ref|YP_846243.1| phosphodiesterase [Syntrophobacter fumaroxidans MPOB] >gi|116698620|gb|ABK17808.1| phosphodiesterase, MJ0936 family [Syntrophobacter fumaroxidans MPOB] (158 aa)
Score = 88, Expect = 1.7e-01, Identities = 44/145 (30%), Positives = 70/145 (48%)
  Q:     9 KILIISDTHGDR--SFFRKIINE--EQPDIKIHCGDFC--TDIDLISENFDYFVAGNNDYEG--ERIVDFKIEDLNCRLMHGDQFGYSVP-GYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           KI+++SDTH +R    F  +     E  D+ IH GD+   + ++ +       VAGN D  G  ER+   K+  +    + G   G+  P G   R +  +E     N++ +  GHTH      +  I   NPGS+   R   +  S  +L+IE
  S:     2 KIVVMSDTHLERVTDRFESLCAAYCEGADLVIHLGDWARHSVLNFLERYPLEAVAGNMDDSGIHERLPVKKVIRVRGHRL-GIIHGWGSPVGLRHRLMDEFE-----NVEAILFGHTHQALQLVEHGIFWFNPGSVYLGR-GERANSLGILNIE 148
>gi|37679179|ref|NP_933788.1| phosphodiesterase [Vibrio vulnificus YJ016] >gi|37197921|dbj|BAC93759.1| predicted phosphoesterase [Vibrio vulnificus YJ016] (185 aa)
Score = 88, Expect = 1.7e-01, Identities = 17/42 (40%), Positives = 25/42 (59%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVL 150
           DIL  GH+H+     +  I++ NPGS+ +PR  NQ  SY + 
  S:   123 DILAHGHSHVALAEQQGEIVVFNPGSVTFPRE-NQPASYGLF 163
>gi|88604216|ref|YP_504394.1| metallophosphoesterase [Methanospirillum hungatei JF-1] >gi|88189678|gb|ABD42675.1| metallophosphoesterase [Methanospirillum hungatei JF-1] (636 aa)
Score = 88, Expect = 1.7e-01, Identities = 17/61 (27%), Positives = 34/61 (55%)
  Q:    93 ERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           E  E +  E A++   DI+ +GH+H+  +   DN++ +N GS+    + +    YA+L ++
  S:   527 ETPESRFREIAQKTKADIIVTGHSHLPSIREIDNVVFVNCGSVGRTEDGDPRACYALLTLD 587
>gi|118431348|ref|NP_147754.2| hypothetical protein APE_1169.1 [Aeropyrum pernix K1] >gi|116062671|dbj|BAA80154.2| conserved hypothetical protein [Aeropyrum pernix K1] (251 aa)
Score = 88, Expect = 1.8e-01, Identities = 18/56 (32%), Positives = 30/56 (53%)
  Q:   114 GHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDVVKYP 169
           GHTH++     D   ++NPGS   PR+ +    YA+L +E  +++       V+YP
  S:   163 GHTHVQFHLTLDGRRVVNPGSAGQPRDGDPRAGYAMLDLESGRVELAR----VEYP 214
>gi|149194968|ref|ZP_01872061.1| hypothetical protein CMTB2_08910 [Caminibacter mediatlanticus TB-2] >gi|149134889|gb|EDM23372.1| hypothetical protein CMTB2_08910 [Caminibacter mediatlanticus TB-2] (173 aa)
Score = 88, Expect = 1.8e-01, Identities = 39/127 (30%), Positives = 62/127 (48%)
  Q:     9 KILIISDTHGDRSFFRKIIN---EEQPDIKIHCGDFCT-----DIDLISENFDYFVAGNNDYEGERIVD----------FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSL 135
           ++ IISDTH      +K I+   E+  +  IH GD         ++ + +N    V GNNDY    +VD          FK+  L  +LMH  ++ + +                 + +I+  GHTH   + +    LIINPG +
  S:     2 RVGIISDTHKKVGRAKKAIDLLKEKGCEWIIHAGDIVKVEILDYLEEVYKNRYIAVLGNNDYHLYEVVDKYHLVTEPYYFKLASLTWKLMHYPKYIFPL-----------------DTEIIVYGHTHDVDISFNGKNLIINPGEV 129
>gi|195978745|ref|YP_002123989.1| putative metallophosphoesterase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975450|gb|ACG62976.1| putative metallophosphoesterase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (165 aa)
Score = 88, Expect = 1.9e-01, Identities = 43/136 (31%), Positives = 58/136 (42%)
  Q:    13 ISDTHGDRSFFRKIINEE--QPDIKIHCGDF-CTDIDLISENFDYFVAGNND----YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYA 148
           +SD+HGDR     I      + D   H GD      D I E   + VAGN D    Y+   I  F  +       HG  +  +   ++R    L  +A+E   DI   GH H    +     + INPGS+  PR     K YA
  S:     1 MSDSHGDREVVAAIKGRYLGKVDAIFHNGDSELESSDPIWEGI-HVVAGNCDHDSGYKDSLITSF--DGFTIAQTHGHLYHINFT-WDR----LDYFAQETGADICLYGHLHRPAAWQLGKTVFINPGSVTQPRGEVNEKLYA 135
>gi|111223383|ref|YP_714177.1| putative metallo-dependent phosphatase [Frankia alni ACN14a] >gi|111150915|emb|CAJ62621.1| putative metallo-dependent phosphatase [Frankia alni ACN14a] (237 aa)
Score = 88, Expect = 1.9e-01, Identities = 44/158 (27%), Positives = 87/158 (55%)
  Q:     3 WVVDMKKILIISDTHGDRSFF----RKIINEEQPDIKIHCGD------FCTDIDLISENFDY-FVAGNNDYE-----GER--------------------IVDFKIEDLNCRLMHGDQFGYSVPGYERR-ELKLYEYAK--ENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNAN--QMKSYAVLHIEGNKIKSV 160
           W     K+ I+SD H + +      R+++     +I +  GD      F  ++  +   FD  +++GN+++      G+R                     +D  ++  + R++HG  +    P Y+R       +YA+  +  +DIL  GHTH+  +      L+INPGSL + ++     + +YA+L    +++  V
  S:    37 WEGTAMKLGIVSDVHCEAALLETAAREMVEAGAEEILL-AGDAHFEYRFSNEVTEVIRAFDMRYISGNHEWRLMGPTGQRAREAPHVRAANRDFVEAIPTTIDTVVDGRSLRMIHGCPW----PPYDRYLNPADPDYARCGDLGVDILVLGHTHLPHLQRVGGTLVINPGSLAFSQDPGGFDLMTYALLDASTDEVTLV 230
>gi|167038005|ref|YP_001665583.1| hypothetical protein Teth39_1603 [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856839|gb|ABY95247.1| hypothetical protein Teth39_1603 [Thermoanaerobacter pseudethanolicus ATCC 33223] (111 aa)
Score = 88, Expect = 1.9e-01, Identities = 17/73 (23%), Positives = 36/73 (49%)
  Q:    91 GYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           G+   +  ++   K   +D   +GHTHI  +   +N ++INPGS    +  +++ S   + +E   +  ++ E
  S:    38 GHNISDEDIHRLIKRYKLDYFITGHTHIPLIKKIENCVVINPGSTSLSKREDKINSVGFIEVESGSVHVIDLE 110
>gi|160880390|ref|YP_001559358.1| phosphodiesterase [Clostridium phytofermentans ISDg] >gi|160429056|gb|ABX42619.1| phosphodiesterase, MJ0936 family [Clostridium phytofermentans ISDg] (153 aa)
Score = 88, Expect = 2.0e-01, Identities = 45/152 (29%), Positives = 76/152 (50%)
  Q:     7 MKKILIISDTHGDRSFFRKIINE--EQPDIKIHCGDFCTDIDLISENFDY----FVAGNNDYEGERIV----DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIK 158
           M  I IISDTHG     R  + E  +Q D  +H GD  T  ++  +  +Y     V GNND E    +       ++++   L+H            +R++K  +   E+NI +   GH+H   +  KD +L +NPGS    R  + + + A+L +E ++ +
  S:     1 MTTIAIISDTHG---LLRPEVCEHLKQVDYILHAGDIHTK-EIYEQLLNYAPLFVVRGNNDKEWAEFLPSSLTIAVDNITFYLIH-----------NKRDIK--QLPIESNIVVY--GHSHKYSLERKDEVLWLNPGSCGRKRFHHDV-TMAILTVEDDRYR 142
>gi|183213111|gb|ACC55218.1| vacuolar protein sorting-associated protein 29 alpha [Xenopus borealis] (108 aa)
Score = 88, Expect = 2.0e-01, Identities = 26/85 (30%), Positives = 46/85 (54%)
  Q:    79 LMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           L+HG Q    +P  +   L L +  ++ ++DIL SGHT   + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:    10 LIHGHQV---IPWGDMASLALLQ--RQLDVDILISGHTQKFEAFEHENKFYINPGSATGAYNALENNIIPSFVLMDIQASTVVTYVYQ 92
>gi|116283479|gb|AAH15095.1| VPS29 protein [Homo sapiens] (87 aa)
Score = 88, Expect = 2.0e-01, Identities = 20/60 (33%), Positives = 36/60 (60%)
  Q:   104 KENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNA---NQMKSYAVLHIEGNKIKSVEFE 163
           ++ ++DIL SGHTH  + F  +N   INPGS     NA   N + S+ ++ I+ + + +  ++
  S:     9 RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQ 71
>gi|157363290|ref|YP_001470057.1| phosphodiesterase [Thermotoga lettingae TMO] >gi|157313894|gb|ABV32993.1| phosphodiesterase, MJ0936 family [Thermotoga lettingae TMO] (158 aa)
Score = 88, Expect = 2.0e-01, Identities = 39/123 (31%), Positives = 66/123 (53%)
  Q:    11 LIISDTHGDRSFFRKIINE-EQPDIK--IHCGDFCTDIDL---ISENFDYF-VAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYE------YAKENNIDILFSGHTHIEQVFYKDNILIINPG 133
           LIISDTH +    R+ ++E ++ ++    HCGD  +   L   + ++ D++ V GNND  GE+I+   +   +   M        +  Y  R L ++E      + + N  D +F GHTH   V      +++NPG
  S:     3 LIISDTHDNIPKIRQFLDEAKRRNVTHIFHCGDVISPFALAEFLKQDCDFYGVFGNND--GEKIL---LNQKSSGRMKKGPAELIISKY--RILMMHEPISIDAFLEANFFDFVFYGHTHKVDVRKSSKTVVLNPG 131
>gi|170694701|ref|ZP_02885852.1| phosphodiesterase, MJ0936 family [Burkholderia graminis C4D1M] >gi|170140332|gb|EDT08509.1| phosphodiesterase, MJ0936 family [Burkholderia graminis C4D1M] (162 aa)
Score = 88, Expect = 2.1e-01, Identities = 43/151 (28%), Positives = 70/151 (46%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQ------PDIKIHCGDFCTD--IDLISENFDY-FVAGNNDYEGERIVDF------KIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           +I +ISDTH        ++  E        D  IH GD C +  +D +++      V GNND  GE            ++ +   ++H       VP   R+E           I ++ +GH+H   +  +D +L +NPGS   PR      S  +L IEG + ++
  S:    12 RIGLISDTH-------NLVRPEALAYLAGCDAIIHAGDICNEAVLDALAQIAPLTVVRGNNDV-GEWAASLPTHATLAVQQVTILVVHDIA---DVPADPRKEA----------IGVVVTGHSHKPSISERDGVLFVNPGS-AGPRRFKLPVSAGILTIEGARAEA 155
>gi|123441660|ref|YP_001005644.1| hypothetical protein YE1325 [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122088621|emb|CAL11416.1| conserved hypothetical protein [Yersinia enterocolitica subsp. enterocolitica 8081] (153 aa)
Score = 87, Expect = 2.1e-01, Identities = 13/31 (41%), Positives = 22/31 (70%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPR 139
           D+L  GHTH+ Q  ++D+++  NPGS+  P+
  S:    89 DVLVYGHTHLPQAEWQDDVICFNPGSVSIPK 119
>gi|153006492|ref|YP_001380817.1| phosphodiesterase [Anaeromyxobacter sp. Fw109-5] >gi|152030065|gb|ABS27833.1| phosphodiesterase, MJ0936 family [Anaeromyxobacter sp. Fw109-5] (238 aa)
Score = 87, Expect = 2.1e-01, Identities = 15/42 (35%), Positives = 26/42 (61%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVL 150
           D++  GHTH+  +    N L++NPGS+   R+ +   +YA+L
  S:   153 DLILVGHTHLPVILPLGNKLVVNPGSVGLQRDGDPRAAYAIL 194
>gi|77975495|ref|ZP_00831030.1| COG0622: Predicted phosphoesterase [Yersinia frederiksenii ATCC 33641] (181 aa)
Score = 87, Expect = 2.2e-01, Identities = 18/56 (32%), Positives = 32/56 (57%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFED 164
           D+L  GHTH+ Q  ++D ++  NPGS+  P+      SY +L  +G  ++ +  +D
  S:   117 DVLVYGHTHLPQAQWQDEVICFNPGSVSIPKGGYP-ASYGML--DGGVLQVLALQD 169
>gi|145543165|ref|XP_001457269.1| hypothetical protein GSPATT00023045001 [Paramecium tetraurelia strain d4-2] >gi|124425084|emb|CAK89872.1| unnamed protein product [Paramecium tetraurelia] (191 aa)
Score = 87, Expect = 2.2e-01, Identities = 34/105 (32%), Positives = 55/105 (52%)
  Q:    54 YFVAGNNDYEGERIVDFKIEDLNC---RLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQ--MKSYAVLHIEGNKIK 158
           +FV G+ D E + I + KI  +      L+HG Q    +P  +  +  LY + KE   D+L +G T + +V   +   IINPGS+    N  Q  + S+ +L  +  KI+
  S:    67 HFVKGDFD-ESKDIPETKIIQIGSWKLALVHGHQI---IPAGD--DESLYTFLKEMEADVLITGFTGVAKVSAVEKKYIINPGSVTGGFNGQQQSIPSFLILEFKKEKIQ 170
>gi|145533823|ref|XP_001452656.1| hypothetical protein GSPATT00002659001 [Paramecium tetraurelia strain d4-2] >gi|124420355|emb|CAK85259.1| unnamed protein product [Paramecium tetraurelia] (234 aa)
Score = 87, Expect = 2.4e-01, Identities = 26/49 (53%), Positives = 34/49 (69%)
  Q:    13 ISDTHG--DRSFFRKIINEEQPDIKIHCGDF--CTDID--------LISENFDY--FVAGNND 61
           ISDTHG  + S  +  IN  Q D+ IHCGDF  C ++D         I + F Y   +AGN+D
  S:    10 ISDTHGFLNPSSIKPTINLPQGDVLIHCGDFTNCGELDGIKKFKQWFIQQPFKYKIMIAGNHD 72
>gi|167762795|ref|ZP_02434922.1| hypothetical protein BACSTE_01153 [Bacteroides stercoris ATCC 43183] >gi|167699135|gb|EDS15714.1| hypothetical protein BACSTE_01153 [Bacteroides stercoris ATCC 43183] (247 aa)
Score = 87, Expect = 2.5e-01, Identities = 22/51 (43%), Positives = 28/51 (54%)
  Q:   107 NIDILFSGHTHIEQ---VFYKD---------NILIINPGSLMYPRNANQMKSYAVLHIEGNKI 157
           N D +FSGHTH+      FY D           + INPGS+  PRN N    Y    +   K+
  S:   153 NYDYVFSGHTHLPHNMSCFYPDECPRLRNKKKTVFINPGSVGQPRNQNPCAQYVYFELSTGKV 215
>gi|150020661|ref|YP_001306015.1| phosphodiesterase [Thermosipho melanesiensis BI429] >gi|149793182|gb|ABR30630.1| phosphodiesterase, MJ0936 family [Thermosipho melanesiensis BI429] (259 aa)
Score = 86, Expect = 2.7e-01, Identities = 28/92 (30%), Positives = 49/92 (53%)
  Q:    71 KIEDLNCRLMHGDQFGYSV----PGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGN----KIKSVEF 162
           +IED+   L+HG    Y +    P      LK+   AK  + DI+ +GHTH+    +     I+NPGS+   ++     +Y +L ++ +    + K VE+
  S:   117 EIEDVKILLVHGSPLNYLLEYVKPETNSERLKII--AKSIDEDIVINGHTHLMMAKHLLGKTILNPGSVGRTKDGKPGATYLILEVDKDVFSYRFKFVEY 214
>gi|14591391|ref|NP_143469.1| hypothetical protein PH1616 [Pyrococcus horikoshii OT3] >gi|3258045|dbj|BAA30728.1| 233aa long hypothetical protein [Pyrococcus horikoshii OT3] (233 aa)
Score = 86, Expect = 2.7e-01, Identities = 21/54 (38%), Positives = 30/54 (55%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF 162
           D L  GHTH+  +       +INPGS+  PR+ +   SYA+L+ +G     VEF
  S:   153 DDLIVGHTHVPMLKIIGKRRVINPGSVGQPRDGDWRASYAILYEDGK----VEF 202
>gi|20093532|ref|NP_613379.1| phosphoesterase [Methanopyrus kandleri AV19] >gi|19886373|gb|AAM01309.1| Predicted phosphoesterase [Methanopyrus kandleri AV19] (183 aa)
Score = 86, Expect = 2.8e-01, Identities = 16/38 (42%), Positives = 24/38 (63%)
  Q:    98 KLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSL 135
           +L   A+E   D++F+GHTH  +      +LI+NPGSL
  S:   100 QLAAIAEEEGADVIFTGHTHRPEFKEHRGVLIVNPGSL 137
>gi|57103746|ref|XP_542697.1| PREDICTED: similar to F40B5.2b [Canis familiaris] (447 aa)
Score = 86, Expect = 3.1e-01, Identities = 28/89 (31%), Positives = 46/89 (51%)
  Q:     5 VDMKKILIISDTH-------GDRSFFRKIINEEQPDIKIHCGDFCTDI------------DLISENFDYFVAGNNDYEGERIVDF--KIEDLNCRLMHGDQFGYSVPGYE 93
           +D  KI ++SD H            F +++N  +PD+ +  GD C                L S    YFV GN++Y    + ++   +E LN R +H +    S  G +
  S:   204 MDGLKITLLSDIHLGPTVGRTKMEMFVRMVNRLEPDVTVIVGDLCDSEASVLRTAVAPLGQLHSRLGTYFVTGNHEYYTSDVSNWFALLESLNVRPLHNENVKISATGAQ 313
>gi|73667690|ref|YP_303705.1| putative serine/threonine protein phosphatase [Methanosarcina barkeri str. Fusaro] >gi|72394852|gb|AAZ69125.1| putative serine/threonine protein phosphatase [Methanosarcina barkeri str. Fusaro] (233 aa)
Score = 86, Expect = 3.2e-01, Identities = 19/55 (34%), Positives = 29/55 (52%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           + L  GH+HI       N+ IINPGS+  PR+ +   S AV   E  K++ +  +
  S:   151 EFLVVGHSHIPMDRKLGNLTIINPGSVGQPRDGDPRASCAVFDTENGKVEHLHLD 205
>gi|194430726|ref|ZP_03063150.1| phosphodiesterase, MJ0936 family [Escherichia coli B171] >gi|194411230|gb|EDX27628.1| phosphodiesterase, MJ0936 family [Escherichia coli B171] (163 aa)
Score = 86, Expect = 3.3e-01, Identities = 37/125 (29%), Positives = 63/125 (50%)
  Q:    12 IISDTHGDRSFFRKIINEEQP---DIKIHCGDFCTD--IDLIS--ENFDYFVAGNNDYEGERIVDFK-IEDLNCRLMHGDQFGYSVPGYERRELKL----YEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLM 136
           +ISDTH +     K I   Q    +I  HCGD  +   I L++  +   + + GNN  +G+  + ++ ++       HG+Q    + G     +      Y  AK +  D +F GHTH  +V      L++NPG ++
  S:     5 VISDTHDNIFNTEKAIKVAQQKGCEILFHCGDLISPFMIPLLASFQKEVHLIVGNN--QGDIALMYEHLKKYPWVKFHGEQAFLEIKGVNVAMVHYPKLAYVLAKSHEFDYVFCGHTHKFEVKEIGKALVVNPGEVL 139
>gi|77957367|ref|ZP_00821425.1| COG0622: Predicted phosphoesterase [Yersinia bercovieri ATCC 43970] (183 aa)
Score = 86, Expect = 3.3e-01, Identities = 13/31 (41%), Positives = 21/31 (67%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPR 139
           D+L  GHTH+ Q  ++D ++  NPGS+  P+
  S:   117 DVLVYGHTHLPQAEWQDEVICFNPGSVSIPK 147
>gi|195437730|ref|XP_002066793.1| GK24671 [Drosophila willistoni] >gi|194162878|gb|EDW77779.1| GK24671 [Drosophila willistoni] (182 aa)
Score = 86, Expect = 3.4e-01, Identities = 34/125 (27%), Positives = 62/125 (49%)
  Q:    39 GDFCTDIDLISENFDYFVAGNND-------------YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS---LMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           G+ CT      E++DY  +  ND             Y  +++V   +      L HG Q    VP  +   L L +  ++ ++DIL +GHT+  + +   N   INPGS      P + N + S+ ++ I+   + +  ++
  S:    38 GNICT-----KESYDYLKSLANDVHIVRGDFDENLSYPEQKVV--TVGQFRIGLCHGHQV---VPRGDPEALSLIQ--RQLDVDILITGHTYKFEAYEHGNKFYINPGSATGAFNPLDTNVVPSFVLMDIQSTTVVTYVYQ 166
>gi|164449856|gb|ABY56376.1| CG4764 [Drosophila simulans] >gi|164449858|gb|ABY56377.1| CG4764 [Drosophila simulans] >gi|164449860|gb|ABY56378.1| CG4764 [Drosophila simulans] >gi|164449862|gb|ABY56379.1| CG4764 [Drosophila simulans] >gi|164449864|gb|ABY56380.1| CG4764 [Drosophila simulans] >gi|164449866|gb|ABY56381.1| CG4764 [Drosophila simulans] >gi|164449868|gb|ABY56382.1| CG4764 [Drosophila simulans] >gi|164449870|gb|ABY56383.1| CG4764 [Drosophila simulans] >gi|164449872|gb|ABY56384.1| CG4764 [Drosophila simulans] >gi|164449874|gb|ABY56385.1| CG4764 [Drosophila simulans] >gi|164449876|gb|ABY56386.1| CG4764 [Drosophila simulans] >gi|164449878|gb|ABY56387.1| CG4764 [Drosophila simulans] >gi|164449880|gb|ABY56388.1| CG4764 [Drosophila simulans] >gi|164449882|gb|ABY56389.1| CG4764 [Drosophila simulans] >gi|164449884|gb|ABY56390.1| CG4764 [Drosophila simulans] >gi|164449886|gb|ABY56391.1| CG4764 [Drosophila simulans] (170 aa)
Score = 86, Expect = 3.5e-01, Identities = 34/125 (27%), Positives = 62/125 (49%)
  Q:    39 GDFCTDIDLISENFDYFVAGNND-------------YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS---LMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           G+ CT      E++DY  +  ND             Y  +++V   +      L HG Q    VP  +   L L +  ++ ++DIL +GHT+  + +   N   INPGS      P + N + S+ ++ I+   + +  ++
  S:    32 GNICT-----KESYDYLKSLANDVHIVRGDFDENLTYPEQKVV--TVGQFRIGLCHGHQV---VPRGDPEALALIQ--RQLDVDILITGHTYKFEAYEHGNKFYINPGSATGAFNPLDTNVVPSFVLMDIQSTTVVTYVYQ 160
>gi|194759194|ref|XP_001961834.1| GF15167 [Drosophila ananassae] >gi|195388529|ref|XP_002052932.1| GJ19542 [Drosophila virilis] >gi|190615531|gb|EDV31055.1| GF15167 [Drosophila ananassae] >gi|194149389|gb|EDW65087.1| GJ19542 [Drosophila virilis] (182 aa)
Score = 85, Expect = 3.7e-01, Identities = 34/125 (27%), Positives = 62/125 (49%)
  Q:    39 GDFCTDIDLISENFDYFVAGNND-------------YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS---LMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           G+ CT      E++DY  +  ND             Y  +++V   +      L HG Q    VP  +   L L +  ++ ++DIL +GHT+  + +   N   INPGS      P + N + S+ ++ I+   + +  ++
  S:    38 GNICT-----KESYDYLKSLANDVHIVRGDFDENLSYPEQKVV--TVGQFRIGLCHGHQV---VPRGDPEALALIQ--RQLDVDILITGHTYKFEAYEHGNKFYINPGSATGAFNPLDTNVVPSFVLMDIQSTTVVTYVYQ 166
>gi|68071111|ref|XP_677469.1| vacuolar protein sorting 29 [Plasmodium berghei strain ANKA] >gi|56497602|emb|CAI04608.1| vacuolar protein sorting 29, putative [Plasmodium berghei] (190 aa)
Score = 85, Expect = 3.7e-01, Identities = 24/76 (31%), Positives = 38/76 (50%)
  Q:    59 NNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS 134
           +N+++    +  KI D    L+HG Q    +P  +     L ++ KE + DI+ SGHTH   +   +    INPGS
  S:    73 DNNFDFPEKISIKIGDFKISLVHGHQI---IPWGDLN--ALLQWQKEYDSDIIISGHTHKNSINNFEGKYFINPGS 143
>gi|82523926|emb|CAI78648.1| hypothetical protein [uncultured delta proteobacterium] (164 aa)
Score = 85, Expect = 3.7e-01, Identities = 45/126 (35%), Positives = 64/126 (50%)
  Q:     9 KILIISDTH--GDRSFFRKII--NEEQPDIKIHCGDFCTDI---DLISENFDYFVAGNND--YEGERIVD---FKIEDLNCRLMHGDQFGYSVP-GYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS 134
           KI +ISDTH  G     + I+  +    DI +H GD   DI   D+  +     V GN D     ER+ +   F+I+     L+HG    +  P G E + L+     +   +D +  GHTH      KDN+L  NPGS
  S:     8 KIGVISDTHLGGYDDKLKSIVVRHFNDADIILHAGDI-VDIGVLDIFEQKEVKAVCGNMDNYKTRERLPEQLIFEIKGFKIGLIHG----WGSPCGIEEKILE-----RIGKVDCVVYGHTHKPANHKKDNVLFFNPGS 136
>gi|77454954|gb|ABA86286.1| CG4764 [Drosophila melanogaster] >gi|77454956|gb|ABA86287.1| CG4764 [Drosophila simulans] >gi|77454958|gb|ABA86288.1| CG4764 [Drosophila simulans] >gi|77454960|gb|ABA86289.1| CG4764 [Drosophila yakuba] >gi|77454962|gb|ABA86290.1| CG4764 [Drosophila yakuba] >gi|77454964|gb|ABA86291.1| CG4764 [Drosophila erecta] (169 aa)
Score = 85, Expect = 3.8e-01, Identities = 34/125 (27%), Positives = 62/125 (49%)
  Q:    39 GDFCTDIDLISENFDYFVAGNND-------------YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS---LMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           G+ CT      E++DY  +  ND             Y  +++V   +      L HG Q    VP  +   L L +  ++ ++DIL +GHT+  + +   N   INPGS      P + N + S+ ++ I+   + +  ++
  S:    31 GNICT-----KESYDYLKSLANDVHIVRGDFDENLTYPEQKVV--TVGQFRIGLCHGHQV---VPRGDPEALALIQ--RQLDVDILITGHTYKFEAYEHGNKFYINPGSATGAFNPLDTNVVPSFVLMDIQSTTVVTYVYQ 159
>gi|19920498|ref|NP_608575.1| CG4764 CG4764-PA [Drosophila melanogaster] >gi|194853931|ref|XP_001968253.1| GG24770 [Drosophila erecta] >gi|195350285|ref|XP_002041671.1| GM16798 [Drosophila sechellia] >gi|195470429|ref|XP_002087509.1| GE17363 [Drosophila yakuba] >gi|195575705|ref|XP_002077717.1| GD23074 [Drosophila simulans] >gi|7296116|gb|AAF51410.1| CG4764-PA [Drosophila melanogaster] >gi|16768236|gb|AAL28337.1| GH25884p [Drosophila melanogaster] >gi|190660120|gb|EDV57312.1| GG24770 [Drosophila erecta] >gi|194123444|gb|EDW45487.1| GM16798 [Drosophila sechellia] >gi|194173610|gb|EDW87221.1| GE17363 [Drosophila yakuba] >gi|194189726|gb|EDX03302.1| GD23074 [Drosophila simulans] (182 aa)
Score = 85, Expect = 3.8e-01, Identities = 34/125 (27%), Positives = 62/125 (49%)
  Q:    39 GDFCTDIDLISENFDYFVAGNND-------------YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS---LMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           G+ CT      E++DY  +  ND             Y  +++V   +      L HG Q    VP  +   L L +  ++ ++DIL +GHT+  + +   N   INPGS      P + N + S+ ++ I+   + +  ++
  S:    38 GNICT-----KESYDYLKSLANDVHIVRGDFDENLTYPEQKVV--TVGQFRIGLCHGHQV---VPRGDPEALALIQ--RQLDVDILITGHTYKFEAYEHGNKFYINPGSATGAFNPLDTNVVPSFVLMDIQSTTVVTYVYQ 166
>gi|156102378|ref|XP_001616882.1| vacuolar protein sorting 29, putative [Plasmodium vivax SaI-1] >gi|148805756|gb|EDL47155.1| vacuolar protein sorting 29, putative [Plasmodium vivax] (169 aa)
Score = 85, Expect = 3.8e-01, Identities = 22/76 (28%), Positives = 38/76 (50%)
  Q:    59 NNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS 134
           +++Y+    +   I D    L+HG Q    +P  +     L ++ K+++ DI+ SGHTH   +   +    INPGS
  S:    52 DDEYDFPEDISLTIGDFKMSLIHGHQI---IPWGDTN--ALLQWQKKHDSDIVISGHTHKNSIVRYEGKYFINPGS 122
>gi|14520766|ref|NP_126241.1| hypothetical protein PAB1999 [Pyrococcus abyssi GE5] >gi|5457982|emb|CAB49472.1| Serine/threonine-specific protein phosphatase, putative [Pyrococcus abyssi GE5] (233 aa)
Score = 85, Expect = 3.8e-01, Identities = 24/59 (40%), Positives = 33/59 (55%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE-DVVK 167
           D L  GHTH+  +       +INPGS+  PR+ +   SYA+L+ E  KI+    E DV K
  S:   153 DDLIVGHTHVPMLKEIKGRRVINPGSVGQPRDGDWRASYAILY-ENGKIEFFRVEYDVEK 211
>gi|171914467|ref|ZP_02929937.1| phosphodiesterase, MJ0936 family protein [Verrucomicrobium spinosum DSM 4136] (165 aa)
Score = 85, Expect = 3.9e-01, Identities = 37/128 (28%), Positives = 64/128 (50%)
  Q:     9 KILIISDTHGDRSFFR---KIINEEQPDIKIHCGDFCTDIDL--ISENFD---YFVAGNNDYEGERIVDFKIEDLNCRL-MHGDQFGYSVPGYERRELKLYEY-------AKENNIDILFSGHTHIEQVFYKDNILIINPGSLM 136
           KI ++SD H          + + E + ++ +  GDFC    L  ++E+F    + V GNND  G++ +  ++   +  + +HG      + G   +++ L  Y       A+    + +FSGH H   V      L  NPG LM
  S:     2 KIAVLSDIHDHLHHLTAATRQVRELEAEVLVFLGDFCAPFTLAQLAESFSGPIHVVFGNND--GDQFLLSRVAGKHTHVTLHGLLAELELAG---KKIALNHYPDISRRLAESGAYEAVFSGHDHQRYVHQVGKTLWANPGELM 140
>gi|134298433|ref|YP_001111929.1| phosphodiesterase [Desulfotomaculum reducens MI-1] >gi|134051133|gb|ABO49104.1| phosphodiesterase, MJ0936 family [Desulfotomaculum reducens MI-1] (239 aa)
Score = 85, Expect = 3.9e-01, Identities = 23/70 (32%), Positives = 36/70 (51%)
  Q:    96 ELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           E  L ++  EN+ D+L  GHTH+      D   +IN GS   P++ N    YA++ +    ++ VEF  V
  S:   142 EETLKQFLTENHCDVLVCGHTHLPYHKQVDGGHVINVGSAGKPKHGNANVGYALVDVTEGSLQ-VEFIQV 210
>gi|146165300|ref|XP_001014758.2| Ser/Thr protein phosphatase family protein [Tetrahymena thermophila SB210] >gi|146145530|gb|EAR94626.2| Ser/Thr protein phosphatase family protein [Tetrahymena thermophila SB210] (194 aa)
Score = 85, Expect = 4.3e-01, Identities = 32/99 (32%), Positives = 48/99 (48%)
  Q:    59 NNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLM---YPRNANQMKSYAVLHIEGNKI 157
           N +Y   ++V   I      ++HG Q    VP  +  E  LY   +E + DIL SGHTH +     D   I+NPG++     P   N + S+ +L I+   I
  S:    79 NTEYPEFKVV--TIGSFKIAIIHGHQI---VPWGD--EEALYNQLRELDADILISGHTHDQIASKVDKKYILNPGTITGAYSPLKRNALPSFLLLEIKDKLI 173
>gi|146309220|ref|YP_001189685.1| phosphodiesterase [Pseudomonas mendocina ymp] >gi|145577421|gb|ABP86953.1| phosphodiesterase, MJ0936 family [Pseudomonas mendocina ymp] (152 aa)
Score = 85, Expect = 4.5e-01, Identities = 18/56 (32%), Positives = 30/56 (53%)
  Q:   104 KENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKS 159
           K   ID++ +GH+H      +D +L +NPGS   PR         +LHIE  ++++
  S:    91 KAEGIDVVIAGHSHKPLQEERDGVLYLNPGS-AGPRRFKLPIGVGILHIEDGRVRA 145
>gi|125986487|ref|XP_001357007.1| GA18414-PA [Drosophila pseudoobscura] >gi|195159600|ref|XP_002020666.1| GL15595 [Drosophila persimilis] >gi|54645333|gb|EAL34073.1| GA18414-PA [Drosophila pseudoobscura] >gi|194117616|gb|EDW39659.1| GL15595 [Drosophila persimilis] (182 aa)
Score = 84, Expect = 4.8e-01, Identities = 34/125 (27%), Positives = 62/125 (49%)
  Q:    39 GDFCTDIDLISENFDYFVAGNND-------------YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS---LMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           G+ CT      E++DY  +  ND             Y  +++V   +      L HG Q    VP  +   L L +  ++ ++DIL +GHT+  + +   N   INPGS      P + N + S+ ++ I+   + +  ++
  S:    38 GNICT-----KESYDYLKSLANDVHIVRGDFDENLSYPEQKVV--TVGQFRIGLCHGHQV---VPRGDPEALALIQ--RQLDVDILITGHTYKFEAYEHGNKFYINPGSATGAFNPLDTNVVPSFVLMDIQSTTVVTYVYQ 166
>gi|195118054|ref|XP_002003555.1| GI17980 [Drosophila mojavensis] >gi|193914130|gb|EDW12997.1| GI17980 [Drosophila mojavensis] (182 aa)
Score = 84, Expect = 5.0e-01, Identities = 34/125 (27%), Positives = 62/125 (49%)
  Q:    39 GDFCTDIDLISENFDYFVAGNND-------------YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS---LMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           G+ CT      E++DY  +  ND             Y  +++V   +      L HG Q    VP  +   L L +  ++ ++DIL +GHT+  + +   N   INPGS      P + N + S+ ++ I+   + +  ++
  S:    38 GNICT-----KESYDYLKSLANDVHIVRGDFDENLSYPEQKVV--TVGQFRIGLCHGHQV---VPRGDPEALALIQ--RQLDVDILITGHTYKFEAYEHGNKFYINPGSATGAFNPLDQNVVPSFVLMDIQSTTVVTYVYQ 166
>gi|66880191|ref|ZP_00405175.1| COG0622: Predicted phosphoesterase [Mycoplasma genitalium G-37] (53 aa)
Score = 84, Expect = 5.1e-01, Identities = 16/47 (34%), Positives = 27/47 (57%)
  Q:     9 KILIISDTHGDRSFFRKIINEEQPDIKIHCGDFCTDIDLISENFDYF 55
           K+L+I+DTHG    + ++ N   PD+ IH GD  T    + +N  ++
  S:     7 KVLVIADTHGQNQRWIELKNYHNPDVIIHAGDHMTTKQFMDQNATFW 53
>gi|160933987|ref|ZP_02081374.1| hypothetical protein CLOLEP_02849 [Clostridium leptum DSM 753] >gi|156866660|gb|EDO60032.1| hypothetical protein CLOLEP_02849 [Clostridium leptum DSM 753] (182 aa)
Score = 84, Expect = 5.2e-01, Identities = 45/150 (30%), Positives = 73/150 (48%)
  Q:     1 MKWVVDMKKILIISDTHGDRSFFRKIIN---EEQPDIKIHCGDFCTD---------------IDLIS--ENFDYFVAGNNDYEGERIV-DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVL 150
           MKW       +I SD HG   + RK++    +E+ D  +  GD                   I+L++  ++    V GN D E +++V DF I      L  G++  ++  G+   E  L    +    DIL  GHTH+ +       + +NPGS+  P+  N    Y +L
  S:     1 MKW-------MIASDIHGSEYYCRKMLEAFYDEKADRLLLLGDILYHGPRNDLPRDYNPKRVIELLNGIQSHILCVRGNCDTEVDQMVLDFPILADYAILTVGEKIIFATHGHHFNEENLPPLQEG---DILLHGHTHVPKRVKHKTYVYLNPGSVSIPKE-NSYHGYLLL 160
>gi|167461588|ref|ZP_02326677.1| phosphodiesterase, MJ0936 family protein [Paenibacillus larvae subsp. larvae BRL-230010] (165 aa)
Score = 84, Expect = 5.5e-01, Identities = 38/126 (30%), Positives = 70/126 (55%)
  Q:     9 KILIISDTH--GDRSFFRKIINE--EQPDIKIHCGDFCTDIDLISENFDYF-----VAGNNDYEGERIVD-------FKIEDLNCRLMHGDQFGYSVPGYE-RRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGS 134
           ++ I+SDTH  G R+     + E  +  ++ +H GD+ + ++++ E  +       VAGNND  G  I++        ++      L+HGD       GY    E + ++   ++  D +  GH+HI  +  ++ IL+ NPGS
  S:     2 RVGIVSDTHLYGKRTGLPGALIEGLQGVELILHAGDWIS-VEIV-EAMEKIAPVESVAGNND--GLDIIERFGRQKMLELAGYRIGLIHGD-------GYRGTTEQRAFQAFSQDKPDAVIFGHSHIPYMEKREGILLFNPGS 133
>gi|55379295|ref|YP_137145.1| DNA repair protein [Haloarcula marismortui ATCC 43049] >gi|55232020|gb|AAV47439.1| DNA repair protein [Haloarcula marismortui ATCC 43049] (232 aa)
Score = 84, Expect = 5.5e-01, Identities = 19/44 (43%), Positives = 28/44 (63%)
  Q:   109 DILFSGHTHIE-QVFYKDNILIINPGSLMYPRNANQMKSYAVLHI 152
           D+L  GHTH +    Y D I ++NPGS+  PR+ +   +YAVL +
  S:   151 DVLVMGHTHHQHHEVYGDGI-VMNPGSVGQPRDRDHRAAYAVLDL 194
>gi|192813003|ref|ZP_03041669.1| phosphodiesterase, MJ0936 family [Geobacillus sp. Y412MC10] >gi|192798331|gb|EDV74845.1| phosphodiesterase, MJ0936 family [Geobacillus sp. Y412MC10] (169 aa)
Score = 84, Expect = 5.6e-01, Identities = 42/147 (28%), Positives = 74/147 (50%)
  Q:     9 KILIISDTH---GDRSFFRKIINE-EQPDIKIHCGDFCTDIDLISENFDYF----VAGNNDYEGERIVD-------FKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKD--NILIINPGSLMYPRNANQMKSYAVLHIEGN 155
           +I ++SDTH     +     ++ +  Q ++ +H GD+ +D +L  +   Y     VAGN D    RIV+        +IE     ++HG   G + P   R+         +  +D +  GH+HI   F +D   +L+ NPGS    R  ++     +  ++GN
  S:     6 RITVLSDTHMPKKAKELPDPLLEDLRQSELILHAGDW-SDWELYEQLSQYAPVEGVAGNVD--DARIVERFGYKRLVEIEGKRIGIVHGHGQGGTTPSRARKAFA------DTEVDCILFGHSHIP--FKEDVQGVLLFNPGSATDKRRQSRYSHGRIEILDGN 158
>gi|15791164|ref|NP_280988.1| DNA repair protein [Halobacterium sp. NRC-1] >gi|169236920|ref|YP_001690120.1| putative phosphoesterase [Halobacterium salinarum R1] >gi|10581780|gb|AAG20468.1| DNA repair protein [Halobacterium sp. NRC-1] >gi|167727986|emb|CAP14774.1| putative phosphoesterase [Halobacterium salinarum R1] (227 aa)
Score = 84, Expect = 5.9e-01, Identities = 15/45 (33%), Positives = 28/45 (62%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIE 153
           D+L  GHTH++        +++NPGS+  PR+ +   +YAV+ ++
  S:   146 DVLILGHTHVQHHETYAAGIVMNPGSVGQPRDEDPRAAYAVVDVD 190
>gi|91204294|emb|CAJ71947.1| conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] (161 aa)
Score = 83, Expect = 6.1e-01, Identities = 39/125 (31%), Positives = 57/125 (45%)
  Q:     9 KILIISDTHGDRSFFRKII---NEEQPDIKIHCGDFCTDIDL-----ISENFDYFVAGNNDYEGERIVDFKIEDLNCRLMHGDQFGYSVPG----YERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPG 133
           KI II+DTH +    +K +   N +  +  IH GDF     L     +   F   V GNND E + ++        C  +H   +  ++ G           L       NIDI+ S HTH  ++  +   L INPG
  S:     2 KIGIIADTHDNIPAIKKAVRFFNTQDLEYIIHAGDFVAPFSLKELMHVKARF-IGVFGNNDGEQKGLLGV------CNDIHIPPYTITIDGKTILVSHMPEMLTGSVNIENIDIIISAHTHTPEI-SRGKPLYINPG 130
>gi|18978164|ref|NP_579521.1| 5'-cyclic-nucleotide phosphodiesterase [Pyrococcus furiosus DSM 3638] >gi|18893971|gb|AAL81916.1| 5'-cyclic-nucleotide phosphodiesterase cpda homolog [Pyrococcus furiosus DSM 3638] (164 aa)
Score = 83, Expect = 6.4e-01, Identities = 49/157 (31%), Positives = 80/157 (50%)
  Q:     9 KILIISDTHGDRSFFRKIINE--EQPDIK--IHCGDFCTD--IDLISENFDYF-VAGNNDY----EGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQV----FYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV 165
           K+ ++SDTH  +++F   I E  ++ +++  IH GD  +   ++ + E      V GN D     E E+I   +I + +  ++HG QF             L   A E  +DIL  GHTH         Y   I+++NPGS   PR +    ++A+L +    I  V F +V
  S:     2 KVGVLSDTHIPKAYFPPQIFEFLKKRNVQYIIHAGDITSKEFLEKLEEVAPVIAVKGNMDRIDLPEEEKI---EIGNFSILILHGHQF------LSLNLDNLTYKALEEEVDILVFGHTHRPYYNVVRSYGREIILLNPGSPTLPRMSE--PTFAILEVSNEDI-DVHFYNV 161
>gi|187924603|ref|YP_001896245.1| phosphodiesterase, MJ0936 family [Burkholderia phytofirmans PsJN] >gi|187715797|gb|ACD17021.1| phosphodiesterase, MJ0936 family [Burkholderia phytofirmans PsJN] (162 aa)
Score = 83, Expect = 6.6e-01, Identities = 20/63 (31%), Positives = 33/63 (52%)
  Q:   104 KENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDVV 166
           +   ID++ +GH+H   +  +D +L +NPGS   PR      S  +L +EG    S  F+ +V
  S:   101 RSQGIDVVVTGHSHKPMISERDGVLFVNPGS-AGPRRFKLPISAGILIVEGAH-ASASFDPLV 161
>gi|189461829|ref|ZP_03010614.1| hypothetical protein BACCOP_02495 [Bacteroides coprocola DSM 17136] >gi|189431423|gb|EDV00408.1| hypothetical protein BACCOP_02495 [Bacteroides coprocola DSM 17136] (179 aa)
Score = 83, Expect = 7.6e-01, Identities = 19/52 (36%), Positives = 34/52 (65%)
  Q:   109 DILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLH--------IEGNKIKSV 160
           D  F GHTH+ ++  K+N++I N GS+ +P+  N + ++A+          + G K+K V
  S:   119 DYFFYGHTHLWKLEKKENMVICNTGSVTFPKGGN-VPTFAIFEDGKVSIYDLNGTKLKEV 177
>gi|15644619|ref|NP_229672.1| hypothetical protein TM1876 [Thermotoga maritima MSB8] >gi|148270055|ref|YP_001244515.1| phosphodiesterase [Thermotoga petrophila RKU-1] >gi|4982462|gb|AAD36938.1|AE001824_7 conserved hypothetical protein [Thermotoga maritima MSB8] >gi|147735599|gb|ABQ46939.1| phosphodiesterase, MJ0936 family [Thermotoga petrophila RKU-1] (254 aa)
Score = 83, Expect = 7.6e-01, Identities = 20/55 (36%), Positives = 32/55 (58%)
  Q:   114 GHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV-VKY 168
           GHTH+  V +    L++NPGS   P++ +   SY ++ +E     +V FE V V+Y
  S:   161 GHTHLPMVKWVMGKLVLNPGSAGRPKDGDPRASYMIVDVENG---TVSFEIVRVRY 213
>gi|160902808|ref|YP_001568389.1| phosphodiesterase [Petrotoga mobilis SJ95] >gi|160360452|gb|ABX32066.1| phosphodiesterase, MJ0936 family [Petrotoga mobilis SJ95] (158 aa)
Score = 83, Expect = 7.7e-01, Identities = 40/125 (32%), Positives = 66/125 (52%)
  Q:    11 LIISDTHGDRSFFRKI---INEEQPDIKIHCGDFCTDID---LISENFDYF-VAGNNDYEGERIVDFKIEDLNCRLMHG----DQFGYSVPGYERRELKLYEYAKENNI-DILFSGHTHIEQVFYKDNILIINPGSL 135
           L++SD+H +    +KI   I     D   HCGDF        LI ++ D++ V GNND  GE+++ +  E  N ++ +G    ++ G  +  +   E    E A+ + I D +F GHTH          +++NPG  
  S:     3 LVLSDSHDNMDKLKKIPDIIQRYNVDTIFHCGDFVAPFTLPYLIYDDIDFYGVFGNND--GEKLLLY--ERSNKKIKNGPITVEKDGKKI--FLMHEPYSLEAAENSGIYDYVFFGHTHEIGNRKTGKTVVLNPGEF 133
>gi|170288739|ref|YP_001738977.1| phosphodiesterase [Thermotoga sp. RQ2] >gi|170176242|gb|ACB09294.1| phosphodiesterase, MJ0936 family [Thermotoga sp. RQ2] (254 aa)
Score = 82, Expect = 8.0e-01, Identities = 20/55 (36%), Positives = 32/55 (58%)
  Q:   114 GHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFEDV-VKY 168
           GHTH+  V +    L++NPGS   P++ +   SY ++ +E     +V FE V V+Y
  S:   161 GHTHLPMVKWVMGKLVLNPGSAGRPKDGDPRASYMIVDVENG---TVSFEIVRVRY 213
>gi|148244265|ref|YP_001218959.1| hypothetical protein COSY_0099 [Candidatus Vesicomyosocius okutanii HA] >gi|146326092|dbj|BAF61235.1| conserved hypothetical protein [Candidatus Vesicomyosocius okutanii HA] (160 aa)
Score = 82, Expect = 8.0e-01, Identities = 43/138 (31%), Positives = 58/138 (42%)
  Q:    10 ILIISDTHG-DRSFFRKIINEEQPDIKIHCGDFCTDIDL---ISENFDYFVAGNNDYEGER---IVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSY 147
           I I+SDTHG       K++N  Q DI IH GD   +  L   I +     + GNND        I        N  + HG + G+  P +          A   N  I+  GHTH + +       IINPG+    RN    K +
  S:     6 IGILSDTHGFIHPNIVKLMN--QCDIIIHAGDIIDEKTLQALIPKQKLIAIQGNNDTHITHLNLIEKLSFSSGNIIIEHGHKHGHHQPSHNSLR------AAYPNSKIIIYGHTHKQVIDKIKTPWIINPGAAGKIRNYGGSKCF 142
>gi|196243251|ref|ZP_03141981.1| metallophosphoesterase [Cyanothece sp. PCC 8802] >gi|196209150|gb|EDY03939.1| metallophosphoesterase [Cyanothece sp. PCC 8802] (366 aa)
Score = 82, Expect = 8.1e-01, Identities = 18/59 (30%), Positives = 33/59 (55%)
  Q:   104 KENNIDILFSGHTHIEQVFYKDNILIINPGSLM-YPRNANQMKSYAVLHIEGNKIKSVEF 162
           KE+   ++F+GH H++ + Y +NI  I  GSL+ YP        Y ++ +E  + K++  
  S:   206 KESGCQLIFTGHLHVQDIAYSNNIYEITTGSLVSYPH------PYRIIEVEHKQHKNIRL 259
>gi|91784292|ref|YP_559498.1| hypothetical protein Bxe_A1508 [Burkholderia xenovorans LB400] >gi|91688246|gb|ABE31446.1| Protein of unknown function UPF0025 [Burkholderia xenovorans LB400] (162 aa)
Score = 82, Expect = 8.3e-01, Identities = 17/51 (33%), Positives = 28/51 (54%)
  Q:   104 KENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEG 154
           +   I ++ +GH+H   +  +DN+L +NPGS   PR      S  +L +EG
  S:   101 RSEGIGVVVTGHSHKPSISERDNVLFVNPGS-AGPRRFKLPVSAGILIVEG 150
>gi|157363105|ref|YP_001469872.1| phosphodiesterase [Thermotoga lettingae TMO] >gi|157313709|gb|ABV32808.1| phosphodiesterase, MJ0936 family [Thermotoga lettingae TMO] (253 aa)
Score = 82, Expect = 8.5e-01, Identities = 25/84 (29%), Positives = 42/84 (50%)
  Q:    79 LMHG----DQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEF 162
           L+HG    +   Y  P  E   L+  +  +    D++ SGHTH+    +    LI+N GS+  P++ N    Y +++I    + S EF
  S:   122 LVHGSPLDELLEYVTPDTEPERLR--KIIENVEADVIISGHTHLPMAKFFKGKLILNAGSVGRPKDGNPKACYLLIYIH-EGVLSYEF 206
>gi|57641553|ref|YP_184031.1| calcineurin superfamily metallophosphoesterase [Thermococcus kodakarensis KOD1] >gi|57159877|dbj|BAD85807.1| metallophosphoesterase, calcineurin superfamily [Thermococcus kodakarensis KOD1] (170 aa)
Score = 82, Expect = 8.6e-01, Identities = 38/126 (30%), Positives = 58/126 (46%)
  Q:    10 ILIISDTHGDRSFFRKII---NEEQPDIKIHCGDFCTDIDLISENFDYFVA------GNND------YEGERIVDFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSL 135
           I I+SDTH +    RK +   NE   D+ IH GD+      ++       A      GNND      YE   I D  IE      +  D    +V  +   E+ +   A     D++  GHTH  ++      +++NPG +
  S:     3 IGIMSDTHDNLPAIRKAVEFFNERNVDLVIHAGDYVAP--FVARELKKLKAPLKGVFGNNDGERKGLYEALGIYDELIE------LEADGMKIAVT-HGTNEVLVKALAHSRLYDVVVVGHTHRYEIQEVGRTVLVNPGEV 134
>gi|177663460|ref|ZP_02939264.1| metallophosphoesterase [Cyanothece sp. PCC 8801] >gi|172077174|gb|EDT62584.1| metallophosphoesterase [Cyanothece sp. PCC 8801] (366 aa)
Score = 82, Expect = 8.7e-01, Identities = 18/59 (30%), Positives = 33/59 (55%)
  Q:   104 KENNIDILFSGHTHIEQVFYKDNILIINPGSLM-YPRNANQMKSYAVLHIEGNKIKSVEF 162
           KE+   ++F+GH H++ + Y +NI  I  GSL+ YP        Y ++ +E  + K++  
  S:   206 KESGCQLIFTGHLHVQDIAYSNNIYEITTGSLVSYPH------PYRIIEVEHKQHKNIRL 259
>gi|20091834|ref|NP_617909.1| phosphoesterase [Methanosarcina acetivorans C2A] >gi|19917023|gb|AAM06389.1| phosphoesterase [Methanosarcina acetivorans C2A] (182 aa)
Score = 82, Expect = 9.6e-01, Identities = 48/159 (30%), Positives = 79/159 (49%)
  Q:     9 KILIISDTHGDRSFFRKIINE--EQPDIKIHCGDFCTDIDLISENFDYF--------VAGNND-YEGERIV----DFKIEDLNCRLMHGDQFGYSV-----PGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMK----------SYAVLHIEGNKIKSVEFEDVVK 167
           K++ ISDTH         +    +  D+ +H GDF T      E +  F        V+GN D +E  +++     F++E +   ++H  + G SV      GY  RE+          +D+L  GH H   +  KD IL+  PGS   PR +                 +L +EG+  + + F D ++
  S:     2 KLIAISDTHLKTGEVPPQLQNILKDCDLIVHAGDFST-----VEAYQAFNASGKLKAVSGNADTFELRQLLPERLKFEVEGVKIGVVH--EGGLSVIDTTAQGYLAREM---------GVDVLIFGHLHRPLIEKKDVILVC-PGSPTKPRMSKPSAVELIIEKGSIKGRILTLEGDSCEYIRFRDALE 173
>gi|160881850|ref|YP_001560818.1| phosphodiesterase [Clostridium phytofermentans ISDg] >gi|160430516|gb|ABX44079.1| phosphodiesterase, MJ0936 family [Clostridium phytofermentans ISDg] (187 aa)
Score = 82, Expect = 9.7e-01, Identities = 44/155 (28%), Positives = 79/155 (50%)
  Q:     9 KILIISDTHGDRSFFRKIIN---EEQPDIKIHCGDFCTD---------------IDLISE--NFDYFVAGNNDYEGERIV-DFKIEDLNCRLMHGDQFGYSVPGYERRELKLYEYAKENNIDILFSGHTHIEQVFYKDNILIINPGSLMYPRNANQMKSYAVLHIEGNKIKSVEFE 163
           +++  SD HG   +  K++    +EQP+  I  GD                   I +++E  N    V GN + E +++V +F +   +  L       ++  G+   E KL   + +   DIL  GHTH++ +   +  + +NPGS+  P+  N+  SY +       IKS++ E
  S:     2 RLMFASDIHGSAYYCEKLMECYEKEQPEKLILLGDLLYHGPRNDLPKDYNPKEVIRMLNEKKNEILCVRGNCEAEVDQMVLEFSVMSDSLLLYVDGITIFATHGHLFNEEKLPPISDK---DILIHGHTHVQAIRKMEQGMYLNPGSVSIPKEGNK-NSYMIYENGTFLIKSLDGE 173