>gi|26553583|ref|NP_757517.1| ribosomal protein-alanine-acetyltransferase [Mycoplasma penetrans HF-2] >gi|26453589|dbj|BAC43921.1| ribosomal protein-alanine-acetyltransferase [Mycoplasma penetrans HF-2] (145 aa)
Score = 587, Expect = 2.1e-59, Identities = 145/145 (100%), Positives = 145/145 (100%)
  Q:     1 MITLKNKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWIKQGI 145
           MITLKNKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWIKQGI
  S:     1 MITLKNKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWIKQGI 145
>gi|13357871|ref|NP_078145.1| N-acetyltransferase complex, ribosomal protein-alanine-acetyltransferase subunit [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762074|ref|YP_001752393.1| N-acetyltransferase complex, ribosomal protein-alanine-acetyltransferase subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920410|ref|ZP_02691347.2| N-acetyltransferase complex, probable ribosomal protein-alanine-acetyltransferase subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508789|ref|ZP_02690185.2| N-acetyltransferase complex, probable ribosomal protein-alanine-acetyltransferase subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701732|ref|ZP_02554138.2| N-acetyltransferase complex, probable ribosomal protein-alanine-acetyltransferase subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|11356990|pir||F82907 N-acetyltransferase complex, probable ribosomal protein-alanine-acetyltransferase subunit UU311 [imported] - Ureaplasma urealyticum >gi|6899287|gb|AAF30720.1|AE002128_8 N-acetyltransferase complex, probable ribosomal protein-alanine-acetyltransferase subunit [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827651|gb|ACA32913.1| N-acetyltransferase complex, probable ribosomal protein-alanine-acetyltransferase subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902852|gb|EDT49141.1| N-acetyltransferase complex, probable ribosomal protein-alanine-acetyltransferase subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675735|gb|EDT87640.1| N-acetyltransferase complex, probable ribosomal protein-alanine-acetyltransferase subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701000|gb|EDU19282.1| N-acetyltransferase complex, probable ribosomal protein-alanine-acetyltransferase subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] (146 aa)
Score = 186, Expect = 6.8e-13, Identities = 50/129 (38%), Positives = 79/129 (61%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           + +LN+I   E   FL++ Y++ NL     + N+  +I +  ++ + Y ++ ++    EI KIGV  +YRN KIGS L+  LK+  ++I LEVSD + N +NFYLK+ F   + R  YY++ SDA LM W
  S:    12 QKDLNDIAIFENRFFLNDCYSMRNLEEIFHNSNYQIIIVEYEQKNIAYLIYMKSVDFNEILKIGVDENYRNLKIGSLLIDLLKQKKQNILLEVSDLNTNALNFYLKHGFIKQNIRKRYYANGSDAILMIW 141
>gi|171920971|ref|ZP_02696368.2| ribosomal protein-alanine-acetyltransferase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185179175|ref|ZP_02555821.2| ribosomal protein-alanine-acetyltransferase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024315|ref|ZP_02570292.2| ribosomal protein-alanine-acetyltransferase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039441|ref|ZP_02528400.2| N-acetyltransferase complex, probable ribosomal protein-alanine-acetyltransferase subunit [Ureaplasma urealyticum serovar 8] >gi|188524488|ref|ZP_02558399.2| ribosomal protein-alanine-acetyltransferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530876|ref|ZP_02546660.2| N-acetyltransferase complex, probable ribosomal protein-alanine-acetyltransferase subunit [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568602|ref|ZP_02828477.2| N-acetyltransferase complex, probable ribosomal protein-alanine-acetyltransferase subunit [Ureaplasma urealyticum serovar 2] >gi|188592413|ref|ZP_02693823.2| N-acetyltransferase complex, probable ribosomal protein-alanine-acetyltransferase subunit [Ureaplasma urealyticum serovar 10] >gi|195867639|ref|ZP_03079641.1| ribosomal protein-alanine-acetyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171902996|gb|EDT49285.1| ribosomal protein-alanine-acetyltransferase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184208910|gb|EDU05953.1| ribosomal protein-alanine-acetyltransferase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018991|gb|EDU57031.1| ribosomal protein-alanine-acetyltransferase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|195659680|gb|EDX53060.1| ribosomal protein-alanine-acetyltransferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660696|gb|EDX53951.1| ribosomal protein-alanine-acetyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (146 aa)
Score = 182, Expect = 1.7e-12, Identities = 50/130 (38%), Positives = 79/130 (60%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSD-RDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           ++++LN+I   E + FL++ Y++ +L       N+  +I +  ++ +GY ++ +     EI KIGV  +YRN K+GS L+  LK+  ++I LEVS   +N +NFYLK  F     R  YY+DNSDA LM W
  S:    11 NQNDLNDIAIFENKFFLNDAYSIASLYQMFNDANYEIVIVEYEQKNIGYLIYMKTIDFNEILKIGVDENYRNLKVGSVLIDLLKQKKQNILLEVSSINENALNFYLKRGFIKQSIRKKYYADNSDAILMIW 141
>gi|34763845|ref|ZP_00144753.1| Ribosomal-protein-alanine acetyltransferase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886382|gb|EAA23649.1| Ribosomal-protein-alanine acetyltransferase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (143 aa)
Score = 154, Expect = 3.7e-09, Identities = 48/125 (38%), Positives = 74/125 (59%)
  Q:    15 LNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYSD-NSDAFLMK 139
           + +I +LE+EIF ++ ++   LN+ ++  N +  IY  + ++ GY +  ++    EI  I  V  YRNK I   LL+ ++   K+IFLEV + + T INFY KN FK I  R NYYS    +A +MK
  S:    13 MEQIFNLEKEIFKNSAFSKSYLNTLIKGDNSFIYIYLIDDKVCGYLIILDSIDVYEILAIATVEEYRNKGIAQELLAKIR--IKNIFLEVRESNQTAINFYKKNKFKEISIRKNYYSKPTENAIIMK 137
>gi|157150491|ref|YP_001449541.1| ribosomal-protein-alanine N-acetyltransferase [Streptococcus gordonii str. Challis substr. CH1] >gi|157075285|gb|ABV09968.1| ribosomal-protein-alanine N-acetyltransferase [Streptococcus gordonii str. Challis substr. CH1] (166 aa)
Score = 144, Expect = 4.5e-08, Identities = 37/109 (33%), Positives = 62/109 (56%)
  Q:    31 YTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYY-SDNSDAFLMK 139
           +T   +   L S    C + +D  Q++G+ ++ E + EAE+ +I V+ SY+ +KI + L  +L  + K IFLEV + +   + FY K  F+ I +R  YY +   DA +MK
  S:    51 WTANQVAEVLRSDVNSCALAEDESQLVGFLVWQETDFEAEVLQIAVLPSYQGQKIATALFDFLPAD-KEIFLEVRESNKPALLFYKKEKFEEIARRKAYYHAPVEDAIVMK 160
>gi|149011005|ref|ZP_01832310.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae SP19-BS75] >gi|149017809|ref|ZP_01834268.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae SP23-BS72] >gi|169832924|ref|YP_001693663.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae Hungary19A-6] >gi|147764641|gb|EDK71571.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae SP19-BS75] >gi|147931373|gb|EDK82351.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae SP23-BS72] >gi|168995426|gb|ACA36038.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae Hungary19A-6] (145 aa)
Score = 142, Expect = 7.4e-08, Identities = 43/122 (35%), Positives = 67/122 (54%)
  Q:    18 IVSLEQEIFLHNGYTLENLNSFL-ESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDN-SDAFLMK 139
           I ++   ++L + +TLE + + L + Q +Y L Y D  +++G+    EN  EAE+ +I V  +Y+ + I S L + L  + K IFLEV   +     FY K    VI +R  YY D   DA +MK
  S:    17 IYAVMAAVYLVSPWTLEQIQADLSQDQTWYALAY-DGAEVIGFLAVQENLFEAEVLQIAVKGAYQGQGIASALFAQLPTD-KEIFLEVRQSNQRAQAFYKKEKMAVIAERKAYYHDPVEDAIIMK 139
>gi|19703711|ref|NP_603273.1| ribosomal-protein-alanine acetyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713837|gb|AAL94572.1| Ribosomal-protein-alanine acetyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (143 aa)
Score = 142, Expect = 8.0e-08, Identities = 45/125 (36%), Positives = 72/125 (57%)
  Q:    15 LNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSD-NSDAFLMK 139
           +++I +LE+EIF ++ +    L++ ++  N +  +Y  + ++ GY +  ++    EI  I  +   RNK I   LL+ +K   K IFLEV + +   INFY KN FK I  R NYYS  N +A +MK
  S:    13 IDQIFNLEKEIFKNSAFNRTYLDTLIKGDNSFIYVYLIDSKVCGYLIVLDSIDIYEILAIATIEECRNKDIAQELLNKIKT--KDIFLEVRESNQPAINFYKKNKFKEISIRKNYYSKPNENAIIMK 137
>gi|15900070|ref|NP_344674.1| ribosomal-protein-alanine acetyltransferase, putative [Streptococcus pneumoniae TIGR4] >gi|111658066|ref|ZP_01408767.1| hypothetical protein SpneT_02000755 [Streptococcus pneumoniae TIGR4] >gi|14971596|gb|AAK74314.1| putative ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae TIGR4] (145 aa)
Score = 142, Expect = 8.5e-08, Identities = 43/122 (35%), Positives = 67/122 (54%)
  Q:    18 IVSLEQEIFLHNGYTLENLNSFL-ESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDN-SDAFLMK 139
           I ++   ++L + +TLE + + L + Q +Y L Y D  +++G+    EN  EAE+ +I V  +Y+ + I S L + L  + K IFLEV   +     FY K    VI +R  YY D   DA +MK
  S:    17 IYAVMAAVYLVSPWTLEQIQADLSQDQTWYALAY-DGAEVIGFLAVQENLFEAEVLQIAVKGAYQGQGIASALFAQLPTD-KEIFLEVRQSNQRAQAFYKKEKMTVIAERKAYYHDPVEDAIIMK 139
>gi|149001766|ref|ZP_01826739.1| ribosomal-protein-alanine acetyltransferase, putative [Streptococcus pneumoniae SP14-BS69] >gi|147760224|gb|EDK67213.1| ribosomal-protein-alanine acetyltransferase, putative [Streptococcus pneumoniae SP14-BS69] (145 aa)
Score = 142, Expect = 9.3e-08, Identities = 43/122 (35%), Positives = 67/122 (54%)
  Q:    18 IVSLEQEIFLHNGYTLENLNSFL-ESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDN-SDAFLMK 139
           I ++   ++L + +TLE + + L + Q +Y L Y D  +++G+    EN  EAE+ +I V  +Y+ + I S L + L  + K IFLEV   +     FY K    VI +R  YY D   DA +MK
  S:    17 IYAVMAAVYLVSPWTLEQIQADLSQDQTWYALAY-DGAEVIGFLAVQENLFEAEVLQIAVKGAYQGQGIASALFAQLPTD-KEIFLEVRKSNQRAQAFYKKEKMAVIAERKAYYHDPVEDAIIMK 139
>gi|167748529|ref|ZP_02420656.1| hypothetical protein ANACAC_03273 [Anaerostipes caccae DSM 14662] >gi|167652521|gb|EDR96650.1| hypothetical protein ANACAC_03273 [Anaerostipes caccae DSM 14662] (216 aa)
Score = 141, Expect = 1.0e-07, Identities = 38/131 (29%), Positives = 71/131 (54%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY-----KSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDN-SDAFLMKW 140
           + E +L  I  LE++ F  + ++L  +      ++++  +++D K++ GY +      E E+ ++GV+   RN  IG+ L+  L+E        +++LEV + +   I  Y K  F V  +R  YY +   DA LM+W
  S:     8 VREKDLAMIAELEKQCF-SDPWSLRTIEDAFRQKDYFIYVWRDMKRVSGYVIGRLAADEGELLRVGVLPFIRNFGIGARLVRVLQEELAKRFVSAVYLEVRESNKPAIRMYKKQGFIVQGRRPKYYRNPMEDAVLMRW 144
>gi|148322984|gb|EDK88234.1| ribosomal-protein-alanine N-acetyltransferase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (144 aa)
Score = 141, Expect = 1.1e-07, Identities = 44/125 (35%), Positives = 71/125 (56%)
  Q:    15 LNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSD-NSDAFLMK 139
           + +I +LE+EIF+++ +    + + +++ N +   Y  + ++ GY +  ++    EI  I  +  YRNK I   LL  +K   K IFLEV + +   INFY KN F  I  R NYYS+ N +A +MK
  S:    13 IEQIFNLEKEIFINSAFNKSYMETLIKADNSFIYTYIIDDKVCGYLMVLDSIDVYEILAIATIEKYRNKGIAQELLDKIKT--KDIFLEVRESNQVAINFYKKNKFNQISIRKNYYSEPNENAIIMK 137
>gi|149005884|ref|ZP_01829613.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae SP18-BS74] >gi|147762240|gb|EDK69201.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae SP18-BS74] (145 aa)
Score = 141, Expect = 1.1e-07, Identities = 43/122 (35%), Positives = 66/122 (54%)
  Q:    18 IVSLEQEIFLHNGYTLENLNSFL-ESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDN-SDAFLMK 139
           I ++   ++L + +TLE + + L + Q +Y L Y D  +++G+    EN  EAE+ +I V  +Y+ + I S L + L  + K IFLEV   +     FY K    VI  R  YY D   DA +MK
  S:    17 IYAVMAAVYLVSPWTLEQIQADLSQDQTWYALAY-DGAEVIGFLAVQENLFEAEVLQIAVKGAYQGQGIASALFAQLPTD-KEIFLEVRKSNQRAQAFYKKEKMAVIADRKAYYHDPVEDAIIMK 139
>gi|148992719|ref|ZP_01822362.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae SP9-BS68] >gi|168483779|ref|ZP_02708731.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae CDC1873-00] >gi|168489380|ref|ZP_02713579.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae SP195] >gi|147928445|gb|EDK79460.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae SP9-BS68] >gi|172042860|gb|EDT50906.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae CDC1873-00] >gi|183572055|gb|EDT92583.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae SP195] (145 aa)
Score = 140, Expect = 1.3e-07, Identities = 42/115 (36%), Positives = 64/115 (55%)
  Q:    25 IFLHNGYTLENLNSFL-ESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDN-SDAFLMK 139
           ++L + +TLE + + L + Q +Y L Y D  +++G+    EN  EAE+ +I V  +Y+ + I S L + L  + K IFLEV   +     FY K    VI +R  YY D   DA +MK
  S:    24 VYLVSPWTLEQIQADLSQDQTWYALAY-DGAEVIGFLAVQENLFEAEVLQIAVKGAYQGQGIASALFAQLPTD-KEIFLEVRKSNQRAQAFYKKEKMAVIAERKAYYHDPVEDAIIMK 139
>gi|182683101|ref|YP_001834848.1| ribosomal-protein-alanine acetyltransferase, putative [Streptococcus pneumoniae CGSP14] >gi|182628435|gb|ACB89383.1| ribosomal-protein-alanine acetyltransferase, putative [Streptococcus pneumoniae CGSP14] (145 aa)
Score = 139, Expect = 1.7e-07, Identities = 42/111 (37%), Positives = 61/111 (54%)
  Q:    29 NGYTLENLNSFL-ESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDN-SDAFLMK 139
           N +TLE + + L + Q +Y L Y D  +++G+    EN  EAE+ +I V  +Y+ + I S L + L  + K IFLEV   +     FY K    VI +R  YY D   DA +MK
  S:    28 NPWTLEQIQADLSQDQTWYALAY-DGAEVIGFLAVQENLFEAEVLQIAVKGAYQGQGIASALFAQLPTD-KEIFLEVRQSNQRAQAFYKKEKMAVIAERKAYYHDPVEDAIIMK 139
>gi|27365137|ref|NP_760665.1| acetyltransferase [Vibrio vulnificus CMCP6] >gi|27361283|gb|AAO10192.1|AE016802_235 Acetyltransferase [Vibrio vulnificus CMCP6] (366 aa)
Score = 139, Expect = 2.0e-07, Identities = 36/127 (28%), Positives = 70/127 (55%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYC--LFFENEQEAEIYKIGVVYSYRNKKIGSNLL-----SYLKENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           ++L+ +  LE+E+F+ +      +  F++S++   L+    +Q+ GY   LF +  Q + +Y I V   +R +KI  +L+     S +++ + ++ LEV  D    IN Y K  ++ +    +YY D SD   M+
  S:     9 ADLDALNRLERELFVGDRIAPRQMKRFIQSEHAVLLVADSGQQLAGYALLLFHQGTQLSRLYSIAVRPEFRGQKIAQSLIELCEQSAIEQGFTTLRLEVREDNSAAINLYKKLGYQKLKILIHYYDDLSDGIRMQ 143
>gi|37680812|ref|NP_935421.1| acetyltransferase [Vibrio vulnificus YJ016] >gi|37199561|dbj|BAC95392.1| acetyltransferase [Vibrio vulnificus YJ016] (366 aa)
Score = 139, Expect = 2.0e-07, Identities = 36/127 (28%), Positives = 70/127 (55%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYC--LFFENEQEAEIYKIGVVYSYRNKKIGSNLL-----SYLKENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           ++L+ +  LE+E+F+ +      +  F++S++   L+    +Q+ GY   LF +  Q + +Y I V   +R +KI  +L+     S +++ + ++ LEV  D    IN Y K  ++ +    +YY D SD   M+
  S:     9 ADLDALNRLERELFVGDRIAPRQMKRFIQSEHAVLLVADSGQQLAGYALLLFHQGTQLSRLYSIAVRPEFRGQKIAQSLIELCEQSAIEQGFTTLRLEVREDNSAAINLYKKLGYQKLKILIHYYDDLSDGIRMQ 143
>gi|183220100|ref|YP_001838096.1| ribosomal-protein-alanine acetyltransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189910220|ref|YP_001961775.1| Acetyltransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167774896|gb|ABZ93197.1| Acetyltransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167778522|gb|ABZ96820.1| Ribosomal-protein-alanine acetyltransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (142 aa)
Score = 138, Expect = 2.1e-07, Identities = 42/131 (32%), Positives = 63/131 (48%)
  Q:     9 NISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--KSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           ++ E  L EI++LE   F    +T + + + LE   F+      N +I  Y L  E   E EI++I  +  +R   +   LL  L + +  K  FLEV + +   I  YL   F  + +R  YY D S A LMK
  S:     7 SLGEDHLKEILTLESLCFPGEEWTEKMIQTHLE---FHVAFGMGNPEIQCYALVCETPWEIEIFRIATLPKFRKLGLAKQLLEQLFQKFPKKEFFLEVKESNEPAIKLYLSAGFFELERRKKYYPDGSTAVLMK 137
>gi|148996552|ref|ZP_01824270.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae SP11-BS70] >gi|168576435|ref|ZP_02722318.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae MLV-016] >gi|147757127|gb|EDK64166.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae SP11-BS70] >gi|183577844|gb|EDT98372.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae MLV-016] (145 aa)
Score = 137, Expect = 2.8e-07, Identities = 42/122 (34%), Positives = 66/122 (54%)
  Q:    18 IVSLEQEIFLHNGYTLENLNSFL-ESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDN-SDAFLMK 139
           I ++   ++L + +TLE + + L + Q +Y L Y D  +++G+    EN  E E+ +I V  +Y+ + I S L + L  + K IFLEV   +     FY K    VI +R  YY D   DA +MK
  S:    17 IYAVMAAVYLVSPWTLEQIQADLSQDQTWYALAY-DGAEVIGFLAVQENLFEVEVLQIAVKGAYQGQGIASALFAQLPTD-KEIFLEVRQSNQRAQAFYKKEKMAVIAERKAYYHDPVEDAIIMK 139
>gi|125717191|ref|YP_001034324.1| ribosomal protein alanine acetyl transferase, putative [Streptococcus sanguinis SK36] >gi|125497108|gb|ABN43774.1| Ribosomal protein alanine acetyl transferase, putative [Streptococcus sanguinis SK36] (150 aa)
Score = 137, Expect = 3.0e-07, Identities = 41/139 (29%), Positives = 78/139 (56%)
  Q:     1 MITLKNKNNISESEL----NEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYY-SDNSDAFLMK 139
           MIT++  ++ S+ +      E+  L   ++  + +T   +   L S    C + +D  +++ + ++ E + EAE+ +I V+ SY+ +KI + L ++L  + K IFLEV + +   + FY K  F+ I +R  YY +   DA +MK
  S:     1 MITMRKWSDSSDMDAATLAKELEQLLLAVYEVSPWTAGQVEEVLRSDVNSCALAEDENRLVAFLVWQETDFEAEVLQIAVLPSYQGQKIATALFAFLPAD-KEIFLEVRESNKPALLFYKKEKFEEIARRKAYYHAPVEDAIVMK 144
>gi|194397720|ref|YP_002036846.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae G54] >gi|194357387|gb|ACF55835.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae G54] (145 aa)
Score = 136, Expect = 3.7e-07, Identities = 41/109 (37%), Positives = 60/109 (55%)
  Q:    31 YTLENLNSFL-ESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDN-SDAFLMK 139
           +TLE + + L + Q +Y L Y D  +++G+    EN  EAE+ +I V  +Y+ + I S L + L  + K IFLEV   ++    FY K    VI  R  YY D   DA +MK
  S:    30 WTLEQIQADLSQDQTWYVLAY-DGAEVIGFLAVQENLFEAEVLQIAVKEAYQGQGIASALFAQLPTD-KEIFLEVRQSNHRAQAFYKKEKMAVIADRKAYYHDPVEDAIIMK 139
>gi|148983532|ref|ZP_01816851.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae SP3-BS71] >gi|147923679|gb|EDK74791.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae SP3-BS71] (145 aa)
Score = 136, Expect = 4.1e-07, Identities = 40/109 (36%), Positives = 58/109 (53%)
  Q:    31 YTLENLNS-FLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDN-SDAFLMK 139
           +TLE + +   + Q +Y L Y D  +++G+    E   EAE+ +I V  +Y+ K I S L + L  + K IFLEV   +     FY K    VI +R  YY D   DA +MK
  S:    30 WTLEQIQADLFQDQTWYALAY-DGAEVIGFLAVQETLFEAEVLQIAVKGAYQGKGIASALFAQLPTD-KEIFLEVRQSNQRAQAFYKKEKMAVIAERKAYYHDPVEDAIIMK 139
>gi|168487087|ref|ZP_02711595.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae CDC1087-00] >gi|168492397|ref|ZP_02716540.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae CDC0288-04] >gi|168493839|ref|ZP_02717982.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae CDC3059-06] >gi|183570014|gb|EDT90542.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae CDC1087-00] >gi|183573432|gb|EDT93960.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae CDC0288-04] >gi|183576022|gb|EDT96550.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae CDC3059-06] (145 aa)
Score = 134, Expect = 6.7e-07, Identities = 40/109 (36%), Positives = 57/109 (52%)
  Q:    31 YTLENLNS-FLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDN-SDAFLMK 139
           +TLE + +   + Q +Y L Y D  +++G+    E   EAE+ +I V  +Y+ K I S L + L  + K IFLEV   +     FY K    VI  R  YY D   DA +MK
  S:    30 WTLEQIQADLFQDQTWYALAY-DGAEVIGFLAVQETLFEAEVLQIAVKGAYQGKGIASALFAQLPTD-KEIFLEVRKSNQRAQAFYKKEKMAVIADRKAYYHDPVEDAIIMK 139
>gi|93005256|ref|YP_579693.1| ribosomal-protein-alanine acetyltransferase [Psychrobacter cryohalolentis K5] >gi|92392934|gb|ABE74209.1| ribosomal-protein-alanine acetyltransferase [Psychrobacter cryohalolentis K5] (155 aa)
Score = 134, Expect = 6.9e-07, Identities = 42/141 (29%), Positives = 72/141 (51%)
  Q:     1 MITLKNKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDN--KQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK-----SIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNS----DAFLMKWI 141
           M  +K   +   + +  + ++E  I   + +T + +   LE  +   ++  DN   +++GYCL+    ++AEI +IG    Y+ + I S +   L E  K     S+ LEV +D    I  Y +  F VIH R +YY        DA +M+ I
  S:     1 MFDIKILEDKQVTTIQAVATIEAMIQRQDPWTSQTIGDLLEQDSISLMVVTDNSANELIGYCLYQLLFEQAEILRIGTHPDYQRQGIASRVFIRLDETLKANQVESLLLEVRADNTAAIALYEQQGFTVIHTRKSYYQAAHQPAVDALIMQRI 153
>gi|15902174|ref|NP_357724.1| ribosomal protein alanine acetyltransferase [Streptococcus pneumoniae R6] >gi|116516175|ref|YP_815655.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae D39] >gi|15457669|gb|AAK98934.1| Ribosomal protein alanine acetyltransferase [Streptococcus pneumoniae R6] >gi|116076751|gb|ABJ54471.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pneumoniae D39] (145 aa)
Score = 133, Expect = 8.6e-07, Identities = 41/123 (33%), Positives = 66/123 (53%)
  Q:    17 EIVSLEQEIFLHNGYTLENLNSFL-ESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDN-SDAFLMK 139
           +I ++   ++  + +TLE + + L + Q +Y L Y D  +++G+    E   EAE+ +I V  +Y+ + I S L + L  + K IFLEV   +     FY K    VI +R  YY D   DA +MK
  S:    16 DIYAVMAAVYPVSPWTLEQIQADLSQDQTWYALAY-DGAEVIGFLTVQETLFEAEVLQIAVKGAYQGQGIASALFAQLPTD-KEIFLEVRQSNQRAQAFYKKEKMAVIAERKAYYHDPVEDAIIMK 139
>gi|15606021|ref|NP_213398.1| ribosomal-protein-alanine acetyltransferase [Aquifex aeolicus VF5] >gi|2983204|gb|AAC06803.1| ribosomal-protein-alanine acetyltransferase [Aquifex aeolicus VF5] (154 aa)
Score = 130, Expect = 1.8e-06, Identities = 35/130 (26%), Positives = 67/130 (51%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL----SYLKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           +   ++  +  + +E F  + ++  +     E++     + +++ +++GY +F+  ++EA I    +   YR K  G  LL    S L +  K + L+V   +   IN Y K  FKV+ +R  YYSD  +A LM+
  S:     7 MEREDVERVYEINRESFTTDAWSRFSFEKDFENKFSRRFVLEEDGKVVGYVIFWVVKEEATIMTFAIAPGYRGKGYGEKLLREAISRLGDKVKRVVLDVRKSNLRAINLYKKLGFKVVTERKGYYSDGENALLME 141
>gi|84489994|ref|YP_448226.1| acetyltransferase [Methanosphaera stadtmanae DSM 3091] >gi|84373313|gb|ABC57583.1| predicted acetyltransferase [Methanosphaera stadtmanae DSM 3091] (147 aa)
Score = 130, Expect = 2.1e-06, Identities = 41/128 (32%), Positives = 74/128 (57%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           S+L+++V +E E F  + Y +  L     +   + L+ +  + I+GY +F+  E +  I  I V  +Y++ K+GS LL      + + N  ++FLEV   +   INFY +N F  I++ D+YY+D   A +M++
  S:     9 SDLDDVVRIEYEAF-DDPYPVGILLQLYNAGAGF-LVAQVAQTIVGYVIFWIKEGQGHIIVIAVDSNYQDMKVGSLLLEKTCFIFKRNNINTVFLEVRKSNIRAINFYKRNGFVKINEEDDYYNDGESAIIMQY 140
>gi|56461261|ref|YP_156542.1| acetyltransferase [Idiomarina loihiensis L2TR] >gi|56180271|gb|AAV82993.1| Acetyltransferase, GNAT family [Idiomarina loihiensis L2TR] (155 aa)
Score = 130, Expect = 2.1e-06, Identities = 38/129 (29%), Positives = 70/129 (54%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFF--ENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           +++L ++VSLE+  F ++  +  +    +ES + YC + +    + GY + F   N +   +Y I V  S+R   +G+ L++ +  + K+     + LEV SD    I++Y    F+ I     YY D SD F M++
  S:    12 KNDLEQLVSLERATFNYSCISRRSFKRVIESSHNYCWVARSGNDLAGYAIAFTRRNSKVWRLYSIAVAQSFRGLGVGNLLMNEVLNSAKTAGANAMSLEVKSDNKAAIHWYQSCGFETIDILPEYYDDGSDGFKMRF 148
>gi|169176854|ref|ZP_02838558.1| ribosomal-protein-alanine acetyltransferase [Arthrobacter chlorophenolicus A6] >gi|169015045|gb|EDS61569.1| ribosomal-protein-alanine acetyltransferase [Arthrobacter chlorophenolicus A6] (179 aa)
Score = 130, Expect = 2.1e-06, Identities = 38/131 (29%), Positives = 68/131 (51%)
  Q:     9 NISESELNEIVSLEQEIFLHNGYTLENL-NSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK-----SIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           +++E+++  + +LEQE+F  + + ++   +   + +    L+ +    I+GY      E  A++  I VV     + IGS LL+ L E  +      + LEV +D       YL+  F+ IH R  YY D  DA +M+
  S:    24 DMTEADVPAVSALEQELFPVDAWPVQMFFDELAQPETRRYLVAEGPDGIVGYAGLMCIEPIADVQTIAVVPHREGRGIGSTLLTELIEEARRRSAADVLLEVRADNPRAQRLYLRFGFQQIHVRPRYYRDGVDALIMR 161
>gi|78777399|ref|YP_393714.1| GCN5-related N-acetyltransferase [Sulfurimonas denitrificans DSM 1251] >gi|78497939|gb|ABB44479.1| SSU ribosomal protein S18P alanine acetyltransferase [Sulfurimonas denitrificans DSM 1251] (142 aa)
Score = 128, Expect = 3.6e-06, Identities = 40/127 (31%), Positives = 66/127 (51%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKEN-----YKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           S+ +E+ +LEQ++FL   Y L   +     +N    + + +  I GY L     + A++Y IGV   +R +KI   LL +  +      + S+ LEV  D +  IN Y K  F +    + +Y D  DA+LM+
  S:     9 SDSSELFALEQKLFLSKNYPLSRGSFCYHIKNNMLFVAEIDNIIAGYILVLIKRKNAKLYSIGVKEEFRGRKIAQKLLEFSIKKLSSIGFDSLLLEVRVDNEVAINLYKKIGFSIKKNLNEFYLDGCDAYLME 141
>gi|154174299|ref|YP_001408914.1| ribosomal-protein-alanine acetyltransferase [Campylobacter curvus 525.92] >gi|112802575|gb|EAT99919.1| ribosomal-protein-alanine acetyltransferase [Campylobacter curvus 525.92] (153 aa)
Score = 127, Expect = 4.1e-06, Identities = 43/129 (33%), Positives = 63/129 (48%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNF-------YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWIK 142
           + +E+  LE E+F       +  NS L  ++F         LI++ N +ILGY L F   +   IY + V    R K IG  LL+ +   + ++ LEV +D    IN Y    FK      +YY D  D   MK+ K
  S:     9 DASELSRLENEVF-------DKFNSPLSKRSFAYHIRKNLLLIFRQNGEILGYVLVFIYLKTPRIYSLAVSPKARGKGIGKALLAAITAKFDTLRLEVRTDNQKAINLYESFGFKKGKILPHYYDDGCDGIEMKFSK 138
>gi|89100194|ref|ZP_01173061.1| Ribosomal-protein-alanine acetyltransferase [Bacillus sp. NRRL B-14911] >gi|89085044|gb|EAR64178.1| Ribosomal-protein-alanine acetyltransferase [Bacillus sp. NRRL B-14911] (142 aa)
Score = 126, Expect = 5.6e-06, Identities = 35/133 (26%), Positives = 70/133 (52%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK---SIFLEVSDRDNTI---NFYLKNNFKVIHKRDNYYSDNSDAFLMKWIK 142
           ++E ++++++ +E + F         +N   ++Q    L+ +D+  ++GYC  +    EA +  I V+  YR KK+G  L+  + E  K   ++ + +  R   I   + Y K  F+    R NYY+DN +  ++ W+K
  S:     1 MAEEDIDQVLVIEHKSFTLPWSRDAFINELTKNQFAVYLVLEDDDAVIGYCGAWIVVDEAHVTNIAVLPEYRGKKLGEALMKKMMEAAKELGAVTMTLEARVTNIAAQSLYRKLGFQNGGIRKNYYTDNQEDAIVMWVK 139
>gi|24216286|ref|NP_713767.1| acetyltransferase [Leptospira interrogans serovar Lai str. 56601] >gi|45656510|ref|YP_000596.1| ribosomal protein S18 acetyltransferase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|24197553|gb|AAN50785.1|AE011514_6 Acetyltransferases [Leptospira interrogans serovar Lai str. 56601] >gi|45599745|gb|AAS69233.1| ribosomal protein S18 acetyltransferase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (149 aa)
Score = 124, Expect = 8.9e-06, Identities = 45/130 (34%), Positives = 68/130 (52%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL--KENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           +++++L+ + +LE+  F    +T E L S LE   F  +   D    L Y L+    +E EI++I V Y  R + IG  +L +L   E  K+ FLEV   +   I  Y    F+ IH R +YY D SDA + K
  S:     6 LNKTDLDWLFNLEENCFGSRAWTKEMLYSHLEE--FSGIGSTD----LCYILYKMIGEEIEIFRIAVSYRKRRQGIGKEILEFLLNSEKEKTFFLEVDSTNYPAIALYDSCGFQRIHIRKHYYEDGSDALIYK 132
>gi|26989676|ref|NP_745101.1| acetyltransferase [Pseudomonas putida KT2440] >gi|24984564|gb|AAN68565.1|AE016488_9 acetyltransferase, GNAT family [Pseudomonas putida KT2440] (364 aa)
Score = 124, Expect = 8.9e-06, Identities = 37/126 (29%), Positives = 63/126 (50%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYC--LFFENEQEAEIYKIGVVYSYRNKKIGSNLL-----SYLKENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAF 136
           S ++++ +V+LEQ+ F  +  +  N N  +   N   ++ +    + GY   LF      A +Y I V  ++R   +G  LL     S L+ N   + LEV +D    I+ Y  N ++     +NYY D+S A 
  S:     9 SVADIDALVALEQDCFTLDRLSPRNFNWMVRRANASLIVAEQQGHLAGYALLLFHRGTSLARLYSIAVSPAWRGHGLGQQLLEQAQASALERNCAWLRLEVRADNPAAISLYESNGYQRFAVVENYYEDHSQAL 142
>gi|148547931|ref|YP_001268033.1| GCN5-related N-acetyltransferase [Pseudomonas putida F1] >gi|148511989|gb|ABQ78849.1| GCN5-related N-acetyltransferase [Pseudomonas putida F1] (364 aa)
Score = 124, Expect = 1.1e-05, Identities = 37/126 (29%), Positives = 63/126 (50%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYC--LFFENEQEAEIYKIGVVYSYRNKKIGSNLL-----SYLKENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAF 136
           S ++++ +V+LEQ+ F  +  +  N N  +   N   ++ +    + GY   LF      A +Y I V  ++R   +G  LL     S L+ N   + LEV +D    I+ Y  N ++     +NYY D+S A 
  S:     9 SVADIDALVALEQDCFTLDRLSPRNFNWMVRRANACLIVAEQQGHLAGYALLLFHRGTSLARLYSIAVSPAWRGHGLGQQLLGQAQASALERNCAWLRLEVRADNPAAISLYESNGYQRFAVVENYYEDHSQAL 142
>gi|195977432|ref|YP_002122676.1| ribosomal-protein-alanine acetyltransferase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974137|gb|ACG61663.1| ribosomal-protein-alanine acetyltransferase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (141 aa)
Score = 122, Expect = 1.8e-05, Identities = 34/116 (29%), Positives = 63/116 (54%)
  Q:    23 QEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           +E++  + +TL+ + S ++ ++     +   + +LG+    +   E EI  + V+ SY+ + I S L+  L      IFLEV   ++     YLK+ F+VI +R+NYY D  +A L+
  S:    16 KEVYGQSPWTLKQIVSDMQQEHVDYFTFYHQETLLGFLAIQQLPGEMEITNLAVLPSYQGQGIASWLMRQLDGFEGRIFLEVRASNHRAQQLYLKHGFEVIGQRNNYYHDPIEAALI 132
>gi|57642149|ref|YP_184627.1| ribosomal protein-alanine acetyltransferase RimI-like protein [Thermococcus kodakarensis KOD1] >gi|57160473|dbj|BAD86403.1| ribosomal protein-alanine acetyltransferase RimI homolog [Thermococcus kodakarensis KOD1] (166 aa)
Score = 121, Expect = 2.0e-05, Identities = 40/125 (32%), Positives = 63/125 (50%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCL-FFENEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           ++ E++ +E+E F    Y       FLE+     L+ + N +++GY + +   + E  I  I V   YR   IGS LLS      +K   + I LEV    +N I  Y +  F+ + +   YYSD  DA+ M
  S:    26 DIPEVMRIERESF-REAYPRGIFLMFLENNPETFLVAEYNGKVVGYVMGYLRPDLEGHIMSIAVDKEYRGNGIGSALLSEAIERLIKRGARYIGLEVRVSNENAIRLYERFGFRKVKRIIGYYSDGEDAYYM 156
>gi|146304902|ref|YP_001192218.1| SSU ribosomal protein S18P alanine acetyltransferase [Metallosphaera sedula DSM 5348] >gi|145703152|gb|ABP96294.1| SSU ribosomal protein S18P alanine acetyltransferase [Metallosphaera sedula DSM 5348] (154 aa)
Score = 120, Expect = 2.7e-05, Identities = 36/127 (28%), Positives = 65/127 (51%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCL-FFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSI-----FLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           E +L +I  +E+E F  N Y    L ++L+      L+ +D  +++GYC+   + +    +  I     +R   +GS LL  L+  +  +     +LEV+ +    I FY   +++V+  R NYY  N   F+M
  S:    11 EEDLEQIEKIERESF-DNPYPFSLLRAYLQLAEGLFLVARDGNRVIGYCIGIVQYKVRGHLISIASSKEFRRNGVGSLLLQELERRFLKLGCTYSYLEVNVNNAEAIRFYYNRSYRVVRTRKNYYGRNKHGFVM 143
>gi|20807038|ref|NP_622209.1| acetyltransferase [Thermoanaerobacter tengcongensis MB4] >gi|20515525|gb|AAM23813.1| Acetyltransferases [Thermoanaerobacter tengcongensis MB4] (149 aa)
Score = 120, Expect = 3.2e-05, Identities = 37/131 (28%), Positives = 68/131 (51%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           ++E +++E++ +E+  F         +    ++     ++ + +K+++GY  F+    E  I  I V   YR K IGS L+  L     K    S+ LEV + +    N Y K  FKV+ +R+ YY DN++  ++ W
  S:     9 MTEDDIDEVMEIEKLSFTTPWSREAFVGEVTKNSCARYIVAEVDKKVVGYAGFWVVLDEGHITNIAVHPEYRGKGIGSRLMEGLIDLAKKNGITSMTLEVRESNLVAQNLYKKFGFKVLGRREGYYQDNNEDAIVMW 145
>gi|189425365|ref|YP_001952542.1| ribosomal-protein-alanine acetyltransferase [Geobacter lovleyi SZ] >gi|189421624|gb|ACD96022.1| ribosomal-protein-alanine acetyltransferase [Geobacter lovleyi SZ] (152 aa)
Score = 119, Expect = 3.5e-05, Identities = 34/127 (26%), Positives = 66/127 (51%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSY-----LKENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           E++L++++++EQ  F   G+   +  + L S+   C++ + + ++ GY        EAEI  + V  + + + IG+ L+ +     ++   + + LEV +     I  Y +  F+    R  YY DN DA LM
  S:     9 EADLDQVLAIEQACF-PRGWNRSHFQAELASERASCVVTEQDGRVAGYLCLTVLLDEAEILDVAVDPALQGRGIGAQLVQWACEEAIQRGARLLLLEVRATSQPAIALYERFGFQRSGLRKAYYEDNIDAILM 140
>gi|30249370|ref|NP_841440.1| GCN5-related N-acetyltransferase [Nitrosomonas europaea ATCC 19718] >gi|30180689|emb|CAD85310.1| GCN5-related N-acetyltransferase [Nitrosomonas europaea ATCC 19718] (157 aa)
Score = 118, Expect = 4.5e-05, Identities = 34/126 (26%), Positives = 71/126 (56%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYC--LIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYS---DNSDAFLMK 139
           +L +++ +E EIFL   +++ N +  +++  ++C  L+  ++  ++GY +      EA +  +GV  +++++ +G  +L YL     K   + + L+V + +   IN Y +  F+ I  R  YY       DA +MK
  S:    20 DLEQVIRIEHEIFLFP-WSIVNFSDSIKA-GYHCRVLVQPNSDLVMGYGILMTGPGEAHVLTLGVGAAWQSQGLGRKMLRYLIELSRKHQAEFVLLDVRESNTGAINLYQRLGFQQIAVRKGYYPAMCGREDALVMK 154
>gi|153213938|ref|ZP_01949134.1| acetyltransferase, GNAT family [Vibrio cholerae 1587] >gi|153828235|ref|ZP_01980902.1| acetyltransferase, GNAT family [Vibrio cholerae 623-39] >gi|124115591|gb|EAY34411.1| acetyltransferase, GNAT family [Vibrio cholerae 1587] >gi|148876324|gb|EDL74459.1| acetyltransferase, GNAT family [Vibrio cholerae 623-39] (363 aa)
Score = 118, Expect = 4.7e-05, Identities = 36/129 (27%), Positives = 67/129 (51%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYC--LFFENEQEAEIYKIGVVYSYRNKKIGSNLL-----SYLKENYKSIFLEVSDRDNT--INFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           + ++LN + +LEQ++F  +  +   +  FL S +    +     Q+ GY   LF +  Q + +Y I V   +R ++I  +L+     + L +   ++ LEV + DNT  +  Y K  +K +    +YY D  D   M+
  S:     7 NSADLNALNALEQQLFDGDRISPRQMKRFLHSDHAALFVADAGDQLAGYALLLFHQGTQLSRLYSIAVKLEFRGRRIAQSLVEQCERAALDQGSTTLRLEVRE-DNTAALKLYEKMGYKTLKLLIHYYDDLCDGRRMQ 143
>gi|118475190|ref|YP_891392.1| acetyltransferase [Campylobacter fetus subsp. fetus 82-40] >gi|118414416|gb|ABK82836.1| acetyltransferase [Campylobacter fetus subsp. fetus 82-40] (138 aa)
Score = 118, Expect = 4.9e-05, Identities = 42/137 (30%), Positives = 63/137 (45%)
  Q:     2 ITLKNKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           +T++  NN    ++NE+ +LE  IF    + +   +     +    L Y D  +ILGY L   + +   IY +GV    R K +G+ LL  +   +K++ LEV  D    I  Y K  FK       YY D  DA  M
  S:     1 MTIQPANN---KDINELANLETSIFDKLNFPISKASFRYHIKRNLILKYVDEGEILGYILVLTSFKIPRIYSLGVSLQARGKGVGAALLGDICSKFKNLRLEVRKDNIGAIKLYEKFEFKNKKLIRAYYDDGMDAIEM 135
>gi|71064960|ref|YP_263687.1| ribosomal-protein-alanine acetyltransferase [Psychrobacter arcticus 273-4] >gi|71037945|gb|AAZ18253.1| possible ribosomal-protein-alanine acetyltransferase [Psychrobacter arcticus 273-4] (156 aa)
Score = 118, Expect = 5.4e-05, Identities = 32/115 (27%), Positives = 59/115 (51%)
  Q:    15 LNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLK-----ENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYY 129
           +  + ++E  I   + +  + +   L       L    +K+++GYCL+    ++AEI +IG    Y+ + + S + + L+     +  +S+ LEV +D    I  Y +  F VIHKR  YY
  S:    18 IQAVANIETVIQPQDAWGYQTIVELLAQDIIDLLAVYQSKKVVGYCLYQVVFEQAEILRIGTHPDYQRQGVASRIFARLEAELQAKQVESLLLEVRADNVPAIALYEQQAFAVIHKRKGYY 138
>gi|90022556|ref|YP_528383.1| pectic acid lyase [Saccharophagus degradans 2-40] >gi|89952156|gb|ABD82171.1| GCN5-related N-acetyltransferase [Saccharophagus degradans 2-40] (373 aa)
Score = 118, Expect = 5.6e-05, Identities = 36/138 (26%), Positives = 68/138 (49%)
  Q:     2 ITLKNKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGY--CLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSI-----FLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           ITL+      + +L  +V LEQ  F  +  +      +LE+ N   ++ +DN  +LGY   L  +  + A +Y I +    R + +   +L+ L+     +      LEV++ +   I  Y    +++  +  +YY D+SDA  M+
  S:     4 ITLRTAQ---KDDLAALVQLEQACFSGDRLSKRRFKHWLEADNGIFIVARDNHMLLGYGLVLLHQGTRLARLYSIAIDDRARGQGVAKKILAELEVRAAQVGRLFMRLEVAENNAGAIALYQSAGYRIFGEYSDYYEDHSDALRMQ 146
>gi|194535797|ref|YP_002070964.1| acetyltransferase, GNAT family [Vibrio cholerae RC385] >gi|150420591|gb|EDN12882.1| acetyltransferase, GNAT family [Vibrio cholerae RC385] (363 aa)
Score = 117, Expect = 6.3e-05, Identities = 35/129 (27%), Positives = 69/129 (53%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYC--LFFENEQEAEIYKIGVVYSYRNKKIGSNLL-----SYLKENYKSIFLEVSDRDNT--INFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           + ++LN + +LEQ++F  +  +   +  F+ S +    + + + Q+ GY   LF +  Q + +Y I V   +R ++I  +L+     + L +   ++ LEV + DNT  +  Y K  +K +    +YY D  D   M+
  S:     7 NSADLNALNALEQQLFDGDRISPRQMKRFIHSDHAALFVAEADDQLAGYALLLFHQGTQLSRLYSIAVKPEFRGRRIAQSLVEQCERAALDQGSTTLRLEVRE-DNTAALKLYEKMGYKTLKLLIHYYDDLCDGRRMQ 143
>gi|94989227|ref|YP_597328.1| ribosomal-protein-S18-alanine acetyltransferase [Streptococcus pyogenes MGAS9429] >gi|94993115|ref|YP_601214.1| ribosomal-protein-S18-alanine acetyltransferase [Streptococcus pyogenes MGAS2096] >gi|94542735|gb|ABF32784.1| ribosomal-protein-S18-alanine acetyltransferase [Streptococcus pyogenes MGAS9429] >gi|94546623|gb|ABF36670.1| Ribosomal-protein-S18-alanine acetyltransferase [Streptococcus pyogenes MGAS2096] (151 aa)
Score = 116, Expect = 7.8e-05, Identities = 41/139 (29%), Positives = 77/139 (55%)
  Q:     1 MITLKNKNNIS--ESELNEIVSLEQEIFLHNGYTLEN-LNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSD-AFLMK 139
           ++T  +++N+   E +  +I  L + ++  + +TLE  L      Q  Y L+Y D+ ++LG+    +   E E+ +I ++ S++   + S L+++L      IFLEV + ++     Y K  FK+I KR +YY +  + A LMK
  S:     2 IVTTLSESNMKTVEEQAKKIYQLLEMVYGTSPWTLEQVLIDIRRDQTDYFLLY-DHDKLLGFLAIQDLAGEVEMTQIAILPSHQGLGLASQLMTHLDSIESDIFLEVRESNHRAQGLYQKFGFKLIGKRPDYYRNPIETALLMK 144
>gi|153825992|ref|ZP_01978659.1| acetyltransferase, GNAT family [Vibrio cholerae MZO-2] >gi|149740309|gb|EDM54450.1| acetyltransferase, GNAT family [Vibrio cholerae MZO-2] (363 aa)
Score = 115, Expect = 1.0e-04, Identities = 36/129 (27%), Positives = 67/129 (51%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYC--LFFENEQEAEIYKIGVVYSYRNKKIGSNLL-----SYLKENYKSIFLEVSDRDNT--INFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           + ++LN + +LEQ++F  +  +   +  FL S +    +     Q+ GY   LF +  Q + +Y I V   +R ++I  +L+     + L +   ++ LEV + DNT  +  Y K  +K +    +YY D  D   M+
  S:     7 NSADLNALNALEQQLFDGDRISPRQMKRFLHSDHAALFVADAGDQLAGYALLLFHQGTQLSRLYSIAVKPEFRGQRIAQSLVEQCERAALDQGSTTLRLEVRE-DNTAALKLYEKMGYKTLKLLIHYYDDLCDGRRMQ 143
>gi|153801038|ref|ZP_01955624.1| acetyltransferase, GNAT family [Vibrio cholerae MZO-3] >gi|124123392|gb|EAY42135.1| acetyltransferase, GNAT family [Vibrio cholerae MZO-3] (363 aa)
Score = 115, Expect = 1.0e-04, Identities = 36/129 (27%), Positives = 67/129 (51%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYC--LFFENEQEAEIYKIGVVYSYRNKKIGSNLL-----SYLKENYKSIFLEVSDRDNT--INFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           + ++LN + +LEQ++F  +  +   +  FL S +    +     Q+ GY   LF +  Q + +Y I V   +R ++I  +L+     + L +   ++ LEV + DNT  +  Y K  +K +    +YY D  D   M+
  S:     7 NSADLNALNALEQQLFDGDRISPRQMKRFLHSDHAALFVADAGDQLAGYALLLFHQGTQLSRLYSIAVKPEFRGQRIAQSLVEQCERAALDQGSTTLRLEVRE-DNTAALKLYEKMGYKTLKLLIHYYDDLCDGRRMQ 143
>gi|85711215|ref|ZP_01042275.1| Acetyltransferase, GNAT family protein [Idiomarina baltica OS145] >gi|85695128|gb|EAQ33066.1| Acetyltransferase, GNAT family protein [Idiomarina baltica OS145] (158 aa)
Score = 115, Expect = 1.0e-04, Identities = 36/127 (28%), Positives = 64/127 (50%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDN-KQILGYCLFF--ENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           S++  +V LE E+F ++  +  N    L+S     L+ KD+ +Q+ GY +     N + A IY I V  ++R + +   L++ + E  +      + LEV  D    I  Y    F+ +    +YY D +D   M+
  S:    15 SDITALVELENEVFDYSRISRRNFIRLLQSPAASILLAKDSAEQLAGYAVILTRRNSRYARIYSIAVAPAFRGRGVAKRLVNEVIEAQRQQGRHGLSLEVKLDNKQAIQLYQSLGFETVDILVDYYDDGTDGLKMR 150
>gi|147675158|ref|YP_001217835.1| acetyltransferase [Vibrio cholerae O395] >gi|146317041|gb|ABQ21580.1| acetyltransferase, GNAT family [Vibrio cholerae O395] >gi|150423918|gb|EDN15858.1| acetyltransferase, GNAT family [Vibrio cholerae AM-19226] (363 aa)
Score = 115, Expect = 1.0e-04, Identities = 36/129 (27%), Positives = 67/129 (51%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYC--LFFENEQEAEIYKIGVVYSYRNKKIGSNLL-----SYLKENYKSIFLEVSDRDNT--INFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           + ++LN + +LEQ++F  +  +   +  FL S +    +     Q+ GY   LF +  Q + +Y I V   +R ++I  +L+     + L +   ++ LEV + DNT  +  Y K  +K +    +YY D  D   M+
  S:     7 NSADLNALNALEQQLFDGDRISPRQMKRFLHSDHAALFVADAGDQLAGYALLLFHQGTQLSRLYSIAVKPEFRGQRIAQSLVEQCERAALDQGSTTLRLEVRE-DNTAALKLYEKMGYKTLKLLIHYYDDLCDGRRMQ 143
>gi|194537028|ref|YP_002072177.1| acetyltransferase, GNAT family [Vibrio cholerae V51] >gi|125621641|gb|EAZ49971.1| acetyltransferase, GNAT family [Vibrio cholerae V51] (363 aa)
Score = 115, Expect = 1.0e-04, Identities = 36/129 (27%), Positives = 67/129 (51%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYC--LFFENEQEAEIYKIGVVYSYRNKKIGSNLL-----SYLKENYKSIFLEVSDRDNT--INFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           + ++LN + +LEQ++F  +  +   +  FL S +    +     Q+ GY   LF +  Q + +Y I V   +R ++I  +L+     + L +   ++ LEV + DNT  +  Y K  +K +    +YY D  D   M+
  S:     7 NSADLNALNALEQQLFDGDRISPRQMKRFLHSDHAALFVADAGDQLAGYALLLFHQGTQLSRLYSIAVKPEFRGQRIAQSLVEQCERAALDQGSTTLRLEVRE-DNTAALKLYEKMGYKTLKLLIHYYDDLCDGRRMQ 143
>gi|121726779|ref|ZP_01679997.1| acetyltransferase, GNAT family [Vibrio cholerae V52] >gi|121630813|gb|EAX63197.1| acetyltransferase, GNAT family [Vibrio cholerae V52] (363 aa)
Score = 115, Expect = 1.0e-04, Identities = 36/129 (27%), Positives = 67/129 (51%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYC--LFFENEQEAEIYKIGVVYSYRNKKIGSNLL-----SYLKENYKSIFLEVSDRDNT--INFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           + ++LN + +LEQ++F  +  +   +  FL S +    +     Q+ GY   LF +  Q + +Y I V   +R ++I  +L+     + L +   ++ LEV + DNT  +  Y K  +K +    +YY D  D   M+
  S:     7 NSADLNALNALEQQLFDGDRISPRQMKRFLHSDHAALFVADAGDQLAGYALLLFHQGTQLSRLYSIAVKPEFRGQRIAQSLVEQCERAALDQGSTTLRLEVRE-DNTAALKLYEKMGYKTLKLLIHYYDDLCDGRRMQ 143
>gi|15642330|ref|NP_231963.1| acetyltransferase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121586160|ref|ZP_01675951.1| acetyltransferase, GNAT family [Vibrio cholerae 2740-80] >gi|153221408|ref|ZP_01952386.1| acetyltransferase, GNAT family [Vibrio cholerae MAK 757] >gi|153817872|ref|ZP_01970539.1| acetyltransferase, GNAT family [Vibrio cholerae NCTC 8457] >gi|153821515|ref|ZP_01974182.1| acetyltransferase, GNAT family [Vibrio cholerae B33] >gi|194532320|ref|YP_002067749.1| acetyltransferase, GNAT family [Vibrio cholerae MO10] >gi|9656899|gb|AAF95476.1| acetyltransferase, GNAT family [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121549572|gb|EAX59596.1| acetyltransferase, GNAT family [Vibrio cholerae 2740-80] >gi|124119755|gb|EAY38498.1| acetyltransferase, GNAT family [Vibrio cholerae MAK 757] >gi|125618372|gb|EAZ46912.1| acetyltransferase, GNAT family [Vibrio cholerae MO10] >gi|126511580|gb|EAZ74174.1| acetyltransferase, GNAT family [Vibrio cholerae NCTC 8457] >gi|126521008|gb|EAZ78231.1| acetyltransferase, GNAT family [Vibrio cholerae B33] (363 aa)
Score = 115, Expect = 1.0e-04, Identities = 36/129 (27%), Positives = 67/129 (51%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYC--LFFENEQEAEIYKIGVVYSYRNKKIGSNLL-----SYLKENYKSIFLEVSDRDNT--INFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           + ++LN + +LEQ++F  +  +   +  FL S +    +     Q+ GY   LF +  Q + +Y I V   +R ++I  +L+     + L +   ++ LEV + DNT  +  Y K  +K +    +YY D  D   M+
  S:     7 NSADLNALNALEQQLFDGDRISPRQMKRFLHSDHAALFVADAGDQLAGYALLLFHQGTQLSRLYSIAVKPEFRGQRIAQSLVEQCERAALDQGSTTLRLEVRE-DNTAALKLYEKMGYKTLKLLIHYYDDLCDGRRMQ 143
>gi|119963453|ref|YP_948593.1| ribosomal-protein-alanine acetyltransferase [Arthrobacter aurescens TC1] >gi|119950312|gb|ABM09223.1| ribosomal-protein-alanine acetyltransferase [Arthrobacter aurescens TC1] (167 aa)
Score = 115, Expect = 1.1e-04, Identities = 34/131 (25%), Positives = 67/131 (51%)
  Q:     9 NISESELNEIVSLEQEIFLHNGYTLENL-NSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           +++E+++  + +LE+ +F  + + L+   +   + +    ++ +   +I+ Y      E  A++  I VV     K IGS +L+ L     +     + LEV +D       YL+  F+ IH R  YY D +DA +M+
  S:    16 DMTEADIPAVEALERRLFPVDAWPLQMFFDELAQPETRRYVVAEVAGEIVAYAGLMCIEPIADVQTIAVVPELEGKGIGSAILTELIDEARRRRAADVLLEVRADNPRAQQLYLRFGFEQIHVRPRYYRDGTDALIMR 153
>gi|19746800|ref|NP_607936.1| putative ribosomal-protein-alanine acetyltransferase [Streptococcus pyogenes MGAS8232] >gi|19749035|gb|AAL98435.1| putative ribosomal-protein-alanine acetyltransferase [Streptococcus pyogenes MGAS8232] (151 aa)
Score = 114, Expect = 1.3e-04, Identities = 41/139 (29%), Positives = 76/139 (54%)
  Q:     1 MITLKNKNNIS--ESELNEIVSLEQEIFLHNGYTLEN-LNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSD-AFLMK 139
           ++T  +++N+   E +   I  L + ++  + +TLE  L    + Q  Y L+Y D+ ++LG+    +   E E+ +I ++ S++   + S L+++L      IFLEV + ++     Y K  FK I KR +YY +  + A LMK
  S:     2 IVTTLSESNMKTVEEQAKNIYQLLEMVYGTSPWTLEQVLIDIWQDQTDYFLLY-DHDKLLGFLAIQDLAGEVEMTQIAILPSHQGLGLASQLMTHLGSIESDIFLEVRESNHRAQGLYQKFGFKFIGKRPDYYRNPIETALLMK 144
>gi|21911153|ref|NP_665421.1| putative ribosomal-protein-alanine acetyltransferase [Streptococcus pyogenes MGAS315] >gi|21905364|gb|AAM80224.1| putative ribosomal-protein-alanine acetyltransferase [Streptococcus pyogenes MGAS315] (151 aa)
Score = 114, Expect = 1.4e-04, Identities = 41/139 (29%), Positives = 76/139 (54%)
  Q:     1 MITLKNKNNIS--ESELNEIVSLEQEIFLHNGYTLEN-LNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSD-AFLMK 139
           ++T  +++N+   E +   I  L + ++  + +TLE  L      Q  Y L+Y D+ ++LG+    +   E E+ +I ++ S++   + S L+++L      IFLEV + ++     Y K  FK+I KR +YY +  + A LMK
  S:     2 IVTTLSESNMKTVEEQAKNIYQLLEMVYGTSPWTLEQVLIDIRRDQTDYFLLY-DHDKLLGFLAIQDLAGEVEMTQIAILPSHQGLGLASQLMTHLDSIESDIFLEVRESNHRAQGLYQKFGFKLIGKRPDYYRNPIETALLMK 144
>gi|84386720|ref|ZP_00989746.1| putative acetyltransferase [Vibrio splendidus 12B01] >gi|84378526|gb|EAP95383.1| putative acetyltransferase [Vibrio splendidus 12B01] (144 aa)
Score = 114, Expect = 1.4e-04, Identities = 38/130 (29%), Positives = 62/130 (47%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYC-----LIYKDNKQILGYCLFF--ENEQEAEIYKIGVVYSYRNKKIGSNLLSY----LKENYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           + EL +I  LE  +F  + Y       F   Q F C     L+ K + Q+LGY L    + +QE  +  + V  +YR   IG +L+      L ++ K +     +  +    YL   F  I +  NY+ D+   F+M+ I
  S:     8 KQELADIYQLEHALFGDHAYP-----QFFFRQAFDCWGKGLLVAKQDSQVLGYVLMTPTDKQQEYWVLSLAVDTAYRGMGIGRSLMQQAIETLPQDSKLLLTVDPNNSSACELYLSMGFVTIKEEINYFGDDEPRFVMQLI 143
>gi|28895162|ref|NP_801512.1| putative ribosomal-protein-alanine acetyltransferase [Streptococcus pyogenes SSI-1] >gi|28810407|dbj|BAC63345.1| putative ribosomal-protein-alanine acetyltransferase [Streptococcus pyogenes SSI-1] (141 aa)
Score = 114, Expect = 1.5e-04, Identities = 39/128 (30%), Positives = 68/128 (53%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLEN-LNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSD-AFLMK 139
           E +   I  L + ++  + +TLE  L      Q  Y L+Y D+ ++LG+    +   E E+ +I ++ S++   + S L+++L      IFLEV + ++     Y K  FK+I KR +YY +  + A LMK
  S:     5 EEQAKNIYQLLEMVYGTSPWTLEQVLIDIRRDQTDYFLLY-DHDKLLGFLAIQDLAGEVEMTQIAILPSHQGLGLASQLMTHLDSIESDIFLEVRESNHRAQGLYQKFGFKLIGKRPDYYRNPIETALLMK 134
>gi|114331291|ref|YP_747513.1| ribosomal-protein-alanine acetyltransferase [Nitrosomonas eutropha C91] >gi|114308305|gb|ABI59548.1| SSU ribosomal protein S18P alanine acetyltransferase [Nitrosomonas eutropha C91] (162 aa)
Score = 114, Expect = 1.5e-04, Identities = 35/127 (27%), Positives = 70/127 (55%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIY-------KDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYS---DNSDAFLMK 139
           S+L +++ +E EIFL   +++ N +  +++ + +C +         D   ++GY +      EA +  +GV Y+++N+ +G  +L YL     K   + I L+V + +    N Y +  F+ I    +YY       DA +M+
  S:    19 SDLEQVICIEHEIFLFP-WSIGNFSDSIKAGH-HCQVMVQQQGAEPDTDLVMGYSILMIGPGEAHVLTLGVGYAWQNQGLGGAMLRYLIELSRKHRAEFILLDVRESNTGAANLYRRLGFQQIAVHKDYYPAMCGREDALIMR 159
>gi|94995046|ref|YP_603144.1| Ribosomal-protein-S18-alanine acetyltransferase [Streptococcus pyogenes MGAS10750] >gi|94548554|gb|ABF38600.1| Ribosomal-protein-S18-alanine acetyltransferase [Streptococcus pyogenes MGAS10750] (151 aa)
Score = 114, Expect = 1.5e-04, Identities = 41/139 (29%), Positives = 76/139 (54%)
  Q:     1 MITLKNKNNIS--ESELNEIVSLEQEIFLHNGYTLEN-LNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSD-AFLMK 139
           ++T  +++N+   E +   I  L + ++  + +TLE  L      Q  Y L+Y D+ ++LG+    +   E E+ +I ++ S++   + S L+++L      IFLEV + ++     Y K  FK+I KR +YY +  + A LMK
  S:     2 IVTTLSESNMKTVEEQAKNIYQLLEMVYGTSPWTLEQVLIDIRRDQTDYFLLY-DHDKLLGFLAVQDLAGEVEMTQIAILPSHQGLGLASQLMTHLDSIESDIFLEVRESNHRAQGLYQKFGFKLIGKRPDYYRNPIETALLMK 144
>gi|14521872|ref|NP_127348.1| N-terminal acetyltransferase [Pyrococcus abyssi GE5] >gi|5459092|emb|CAB50578.1| N-terminal acetyltransferase [Pyrococcus abyssi GE5] (172 aa)
Score = 114, Expect = 1.5e-04, Identities = 37/101 (36%), Positives = 53/101 (52%)
  Q:    38 SFLESQNFYCLIYKDNKQILGYCL-FFENEQEAEIYKIGVVYSYRNKKIGSNLL-----SYLKENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           +FLES     L+ + N +++GY + +   + E  I  I V  SYR   IG  L+        K+  + I LEV   +   IN Y K  FK+  +  +YYSD  DAF M
  S:    52 TFLESNPDTFLVAEYNGKVVGYVMGYLRPDMEGHIMSIAVDPSYRGNGIGKALMIAVINKLFKKGARWIGLEVRVSNTIAINLYKKLGFKITKRIYSYYSDGEDAFYM 159
>gi|15897047|ref|NP_341652.1| N-terminal acetyltransferase complex ard1 subunit [Sulfolobus solfataricus P2] >gi|1707812|emb|CAA69569.1| orf c04040 [Sulfolobus solfataricus] >gi|13813214|gb|AAK40442.1| N-terminal acetyltransferase complex ard1 subunit [Sulfolobus solfataricus P2] (151 aa)
Score = 114, Expect = 1.5e-04, Identities = 39/128 (30%), Positives = 72/128 (56%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCL-FFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK-----SIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           +E++L++I  +E E F  + Y    L ++L   N   L+ K  ++++GY +   +      I  I V   YR + IG+ LL+ ++E +K       +LEV+  + + I+FY  N + +++ R NYY  +  AF+M
  S:     8 TEADLDQIFQIETESF-EDPYPYSLLRAYLFLANKLYLVAKQREKVVGYIIGIIQYGYRGHIVSIAVEPIYRKQGIGAKLLNEIEERFKLNGARYSYLEVNTNNLSAISFYRANGYLIMYVRKNYYGRDKHAFVM 141
>gi|167765646|ref|ZP_02437699.1| hypothetical protein CLOSS21_00130 [Clostridium sp. SS2/1] >gi|167712692|gb|EDS23271.1| hypothetical protein CLOSS21_00130 [Clostridium sp. SS2/1] (244 aa)
Score = 113, Expect = 1.8e-04, Identities = 33/116 (28%), Positives = 62/116 (53%)
  Q:    23 QEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK-----SIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDN-SDAFLM 138
           +++  H  ++ +++ SF   +     +++D  +I GY +      +AE+++I ++   R   IG+ L    +  Y+     +I+LEV + +     FYLKN F+   +R  YY D   DA LM
  S:    28 EKLSFHRPWSFDSIESFYYRKTSDIYVWRDRNRISGYIIAEHVLDQAELHRIAMIPFIRKMGIGTLLFHEFRRRYQEIGVDTIYLEVRESNEAAYQFYLKNGFEEYGRRAKYYKDPIEDAILM 150
>gi|189465912|ref|ZP_03014697.1| hypothetical protein BACINT_02275 [Bacteroides intestinalis DSM 17393] >gi|189434176|gb|EDV03161.1| hypothetical protein BACINT_02275 [Bacteroides intestinalis DSM 17393] (152 aa)
Score = 113, Expect = 2.0e-04, Identities = 36/127 (28%), Positives = 64/127 (50%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEA--EIYKIGVVYSYRNKKIGSNLLSY-----LKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           +++  I+ +EQ  F  + ++       +     Y  + +  +++ GY     N++     IY I +   +R +++G  L+       LKE+ K I LEV+  +   I  Y KN FK    +DNYY D S A+ M+
  S:    13 NDIPSIMEIEQICFDLDSFSKRQFAYLISQAKGYFYVAEYQQRVGGYFSALINQRACSLRIYSIAIHPDFRGRRVGQLLIDQIIVIALKESLKKIILEVNVSNFPAIYLYEKNGFKCTSVKDNYYHDGSSAYCMQ 147
>gi|29346883|ref|NP_810386.1| hypothetical protein BT_1473 [Bacteroides thetaiotaomicron VPI-5482] >gi|29338781|gb|AAO76580.1| putative acetyltransferase, GNAT family [Bacteroides thetaiotaomicron VPI-5482] (151 aa)
Score = 113, Expect = 2.1e-04, Identities = 38/126 (30%), Positives = 62/126 (49%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFL--ESQNFYCLIYKDNKQILGYC--LFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY-----KSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           ++  I+ +EQE F  + ++ E     +      FY ++  + ++I+ Y   LF    +   IY I V    R +K+G  L+    E         I LEV + +   I  Y+KN F  +  + NYY D SDA  M+
  S:    15 DIPAILEIEQECFQEDSFSREQFVYLICRSKGTFYVVV--EQERIIAYVSLLFHAGTRYLRIYSIAVHPDCRGRKLGQLLMERTIETALDCRAVKITLEVKESNTPAIKLYMKNGFIPVGVKPNYYHDGSDAIYMQ 148
>gi|77360321|ref|YP_339896.1| hypothetical protein PSHAa1378 [Pseudoalteromonas haloplanktis TAC125] >gi|76875232|emb|CAI86453.1| conserved protein of unknown function [Pseudoalteromonas haloplanktis TAC125] (385 aa)
Score = 112, Expect = 2.4e-04, Identities = 34/127 (26%), Positives = 68/127 (53%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFF--ENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           S+L  + +LE   F ++  +  +L  +L +++   L+ + N  + GY L +  +  + A +Y + V+ + + K I   LL  L++         + LEV+ + D+ I  Y    ++V  +  +YY D+SDA  M+
  S:    25 SDLTALTALENACFSNDKLSPRSLKRWLSAKHGILLVAEQNNALCGYGLIWCHKGTRLARLYSLAVLPTMQGKGIAKMLLIALEKATAERGRIYLRLEVAVNNDSAIGLYKSLGYRVFGQYSDYYDDHSDALRMQ 159
>gi|162447274|ref|YP_001620406.1| GNAT family acetyltransferase [Acholeplasma laidlawii PG-8A] >gi|161985381|gb|ABX81030.1| predicted acetyltransferase, GNAT family [Acholeplasma laidlawii PG-8A] (137 aa)
Score = 112, Expect = 2.4e-04, Identities = 34/125 (27%), Positives = 65/125 (52%)
  Q:     1 MITLKNKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYC--LIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTINFYLKNNFKVIHKR 125
           M+  K+   +++ EL EI  L Q +F+      E +   ++  +  C  L  K + +I+ Y    E ++E  I ++  +  YR +   + ++ YL+E +    L VS +D  I+FY K +FKV+ ++
  S:     1 MVFHKSFKELTKEELVEIFKLRQTVFM---VEQEIIEVDIDDHDLVCEHLFIKKDGKIVSYARLIEEKEELYIGRVATLKEYRKRGFTTEIIKYLQERHD--VLAVSSQDIRIDFYKKLDFKVVGRK 122
>gi|71904246|ref|YP_281049.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pyogenes MGAS6180] >gi|71803341|gb|AAX72694.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pyogenes MGAS6180] (151 aa)
Score = 112, Expect = 2.4e-04, Identities = 41/139 (29%), Positives = 75/139 (53%)
  Q:     1 MITLKNKNNIS--ESELNEIVSLEQEIFLHNGYTLEN-LNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSD-AFLMK 139
           ++T  +++N+   E +   I  L + ++  + +TLE  L      Q  Y L+Y D+ ++LG+    +   E E+ +I ++ S++   + S L+++L      IFLEV + ++     Y K  FK I KR +YY +  + A LMK
  S:     2 IVTTLSESNMKTVEEQAKNIYQLLEMVYGTSPWTLEQVLIDIRRDQTDYFLLY-DHDKLLGFLAIQDLAGEVEMTQIAILPSHQGLGLASQLMTHLDSIESDIFLEVRESNHRAQGLYQKFGFKFIGKRPDYYRNPIETALLMK 144
>gi|37676619|ref|NP_937015.1| acetyltransferase [Vibrio vulnificus YJ016] >gi|37201162|dbj|BAC96985.1| acetyltransferase [Vibrio vulnificus YJ016] (156 aa)
Score = 112, Expect = 2.6e-04, Identities = 35/131 (26%), Positives = 67/131 (51%)
  Q:     8 NNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYC-----LIYKDNKQILGYCLFFENE---QEAEIYKIGVVYSYRNKKIGSNLLSYL---KENYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           +NI  S+L +I ++E+++F  +GY      +F   Q + C     ++ +   QI GY L         EA +  + V  +Y+ + I   L+ Y    + +Y+ I+L V+ D       Y    F+++ + +NY+ D     +M
  S:     6 SNIQRSQLPDIEAMEKQLFAQHGYP-----AFFLRQAYDCWRSGFIVAECEHQIAGYVLIVPKAGKCNEAWMLSLAVSPAYQGRGIAKKLVKYALARQSHYQKIYLTVAPDNLPARAIYQSCGFEILIEEENYFDDGESRLVM 143
>gi|119472675|ref|ZP_01614645.1| hypothetical protein ATW7_07299 [Alteromonadales bacterium TW-7] >gi|119444800|gb|EAW26102.1| hypothetical protein ATW7_07299 [Alteromonadales bacterium TW-7] (369 aa)
Score = 111, Expect = 3.0e-04, Identities = 33/127 (25%), Positives = 70/127 (55%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFF--ENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           S+LN ++ +E   F ++  +  +L  +L +++   L+  +++Q+ GY L +  +  + A +Y + V    + K I   LL+ L++         + LEV+ + ++ I  Y    ++V  +  +YY D+SDA  M+
  S:    12 SDLNALIDVENACFNNDKLSPRSLKRWLSAKHGILLVADNDEQVCGYGLVWCHKGTRLARLYSLAVKPIMQGKGIAKILLAALEKQTSERGRLYLRLEVAVNNESAIGLYKSLGYRVFGQYSDYYDDHSDALRMQ 146
>gi|15675692|ref|NP_269866.1| putative ribosomal-protein-alanine acetyltransferase [Streptococcus pyogenes M1 GAS] >gi|13622907|gb|AAK34587.1| putative ribosomal-protein-alanine acetyltransferase [Streptococcus pyogenes M1 GAS] (141 aa)
Score = 111, Expect = 3.1e-04, Identities = 39/128 (30%), Positives = 67/128 (52%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLEN-LNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSD-AFLMK 139
           E +   I  L + ++  + +TLE  L      Q  Y L+Y D+ ++LG+    +   E E+ +I ++ S++   + S L+++L      IFLEV + ++     Y K  FK I KR +YY +  + A LMK
  S:     5 EEQAKNIYQLLEMVYGTSPWTLEQVLIDIRRDQTDYFLLY-DHDKLLGFLAIQDLAGEVEMTQIAILPSHQELGLASQLMTHLDSIESDIFLEVRESNHRAQGLYQKFGFKFIGKRPDYYRNPIETALLMK 134
>gi|56808612|ref|ZP_00366340.1| COG0456: Acetyltransferases [Streptococcus pyogenes M49 591] (141 aa)
Score = 111, Expect = 3.2e-04, Identities = 39/128 (30%), Positives = 67/128 (52%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLEN-LNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSD-AFLMK 139
           E +   I  L + ++  + +TLE  L      Q  Y L+Y D+ ++LG+    +   E E+ +I ++ S++   + S L+++L      IFLEV + ++     Y K  FK I KR +YY +  + A LMK
  S:     5 EEQAKNIYQLLEMVYGTSPWTLEQVLIDIRRDQTDYFLLY-DHDKLLGFLAIQDLAGEVEMTQIAILPSHQGLGLASQLMTHLDSIESDIFLEVRESNHRAQGLYQKFGFKFIGKRPDYYRNPIETALLMK 134
>gi|71911405|ref|YP_282955.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pyogenes MGAS5005] >gi|71854187|gb|AAZ52210.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pyogenes MGAS5005] (151 aa)
Score = 111, Expect = 3.3e-04, Identities = 41/139 (29%), Positives = 75/139 (53%)
  Q:     1 MITLKNKNNIS--ESELNEIVSLEQEIFLHNGYTLEN-LNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSD-AFLMK 139
           ++T  +++N+   E +   I  L + ++  + +TLE  L      Q  Y L+Y D+ ++LG+    +   E E+ +I ++ S++   + S L+++L      IFLEV + ++     Y K  FK I KR +YY +  + A LMK
  S:     2 IVTTLSESNMKTVEEQAKNIYQLLEMVYGTSPWTLEQVLIDIRRDQTDYFLLY-DHDKLLGFLAIQDLAGEVEMTQIAILPSHQELGLASQLMTHLDSIESDIFLEVRESNHRAQGLYQKFGFKFIGKRPDYYRNPIETALLMK 144
>gi|116329303|ref|YP_799023.1| acetyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116330090|ref|YP_799808.1| acetyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116122047|gb|ABJ80090.1| Acetyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116123779|gb|ABJ75050.1| Acetyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (149 aa)
Score = 111, Expect = 3.5e-04, Identities = 43/130 (33%), Positives = 66/130 (50%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLK--ENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           + +++L+ + +LE+  F  + +T E L S L  + F  +   D    L Y L+     E EIY+I V    R +  G  LL +L   E  K+ FLEV   ++  I  Y    F+ IH R +YY + SDA + K
  S:     6 LDKTDLDWLFALEENCFGSHAWTKEMLYSHL--REFSGIGSTD----LCYILYKLAGDEIEIYRIAVYSRQRKQGKGKKLLEHLLNFEKDKTFFLEVDSTNSPAIALYESCGFQRIHIRKHYYENGSDALIYK 132
>gi|139473135|ref|YP_001127850.1| acetyltransferase (GNAT) family protein [Streptococcus pyogenes str. Manfredo] >gi|134271381|emb|CAM29601.1| acetyltransferase (GNAT) family protein [Streptococcus pyogenes str. Manfredo] (141 aa)
Score = 110, Expect = 4.0e-04, Identities = 39/128 (30%), Positives = 67/128 (52%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLEN-LNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSD-AFLMK 139
           E +  +I  L + ++  + +TLE  L      Q  Y L+Y D  ++LG+    +   E E+ +I ++ S++   + S L+++L      IFLEV + ++     Y K  FK I KR +YY +  + A LMK
  S:     5 EEQAKKIYQLLEMVYGTSPWTLEQVLIDIRRDQTDYFLLY-DYDKLLGFLAIQDLAGEVEMTQIAILPSHQGLGLASQLMTHLGSIESDIFLEVRESNHRAQGLYQKFGFKFIGKRPDYYRNPIETALLMK 134
>gi|94991172|ref|YP_599272.1| ribosomal-protein-S18-alanine acetyltransferase [Streptococcus pyogenes MGAS10270] >gi|94544680|gb|ABF34728.1| Ribosomal-protein-S18-alanine acetyltransferase [Streptococcus pyogenes MGAS10270] (151 aa)
Score = 110, Expect = 4.1e-04, Identities = 41/139 (29%), Positives = 75/139 (53%)
  Q:     1 MITLKNKNNIS--ESELNEIVSLEQEIFLHNGYTLEN-LNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSD-AFLMK 139
           ++T  +++N+   E +  +I  L + ++  + +TLE  L      Q  Y L+Y D  ++LG+    +   E E+ +I ++ S++   + S L+++L      IFLEV + ++     Y K  FK I KR +YY +  + A LMK
  S:     2 IVTTLSESNMKTVEEQAKKIYQLLEMVYGTSPWTLEQVLIDIRRDQTDYFLLY-DYDKLLGFLAIQDLAGEVEMTQIAILPSHQGLGLASQLMTHLGSIESDIFLEVRESNHRAQGLYQKFGFKFIGKRPDYYRNPIETALLMK 144
>gi|50914949|ref|YP_060921.1| ribosomal-protein-alanine acetyltransferase [Streptococcus pyogenes MGAS10394] >gi|50904023|gb|AAT87738.1| Ribosomal-protein-alanine acetyltransferase [Streptococcus pyogenes MGAS10394] (151 aa)
Score = 110, Expect = 4.2e-04, Identities = 41/139 (29%), Positives = 75/139 (53%)
  Q:     1 MITLKNKNNIS--ESELNEIVSLEQEIFLHNGYTLEN-LNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSD-AFLMK 139
           ++T  +++N+   E +  +I  L + ++  + +TLE  L      Q  Y L+Y D  ++LG+    +   E E+ +I ++ S++   + S L+++L      IFLEV + ++     Y K  FK I KR +YY +  + A LMK
  S:     2 IVTTLSESNMKTVEEQAKKIYQLLEMVYGTSPWTLEQVLIDIRRDQTDYFLLY-DYDKLLGFLAIQDLSGEVEMTQIAILPSHQGLGLASQLMTHLGSIESDIFLEVRESNHRAQGLYQKFGFKFIGKRPDYYRNPIETALLMK 144
>gi|116671439|ref|YP_832372.1| SSU ribosomal protein S18P alanine acetyltransferase [Arthrobacter sp. FB24] >gi|116611548|gb|ABK04272.1| SSU ribosomal protein S18P alanine acetyltransferase [Arthrobacter sp. FB24] (181 aa)
Score = 109, Expect = 4.9e-04, Identities = 38/138 (27%), Positives = 70/138 (50%)
  Q:     2 ITLKNKNNISESELNEIVSLEQEIFLHNGYTLENLNSFL-ESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           +TL++ N    +++  + +LE  +F  + + L+  +  L ++   + ++ +   +I+GY      E  A++  I VV     K IGS LL+ L     +     + LEV +D     + Y +  F+ IH R  YY D  DA +M+
  S:    10 VTLRSMNG---TDIPAVHTLECRLFPVDAWPLQMFHEELAQTGTRHYVVAEAAGEIVGYAGLMCIEPIADVQTIAVVPECEGKGIGSALLTELIAESRRRRAADVLLEVRADNPRAQDLYRRFGFEQIHVRPRYYRDGVDALIMR 151
>gi|14590218|ref|NP_142283.1| acetyltransferase [Pyrococcus horikoshii OT3] >gi|3256685|dbj|BAA29368.1| 172aa long hypothetical acetyltransferase [Pyrococcus horikoshii OT3] (172 aa)
Score = 109, Expect = 4.9e-04, Identities = 36/101 (35%), Positives = 53/101 (52%)
  Q:    38 SFLESQNFYCLIYKDNKQILGYCL-FFENEQEAEIYKIGVVYSYRNKKIGSNLL-----SYLKENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           +FLES     L+ + N +++GY + +   + E  I  I V  +YR   IG  L+        K+  + I LEV   +   IN Y K  FK+  +  +YYSD  DAF M
  S:    52 TFLESNPDTFLVAEYNGKVIGYVMGYLRPDMEGHIMSIAVDPNYRGNGIGKALMIAVINKLFKKGARWIGLEVRVSNVIAINLYKKLGFKITKRIYSYYSDGEDAFYM 159
>gi|110833902|ref|YP_692760.1| acetyltransferase [Alcanivorax borkumensis SK2] >gi|110647013|emb|CAL16489.1| acetyltransferase, GNAT family, putative [Alcanivorax borkumensis SK2] (425 aa)
Score = 109, Expect = 5.0e-04, Identities = 36/123 (29%), Positives = 68/123 (55%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYK-DNKQILGYCLFF--ENEQEAEIYKIGVVYSYRNKKIGSNLL----SYLKENYKSIFLEVSDR-DNT--INFYLKNNFKVIHKRDNYYSDNSDAF 136
           +L+ + +LEQ  F  +  T  +   +L+ Q+   ++ + +++Q++GY L       + A +Y I V    R KK+G  LL     Y  + ++ +FL +  R DNT  I  Y +  +++  +  +YY D+ DA 
  S:    59 DLDALTALEQRCFSSDRLTRRSFRQWLKRQHAGLIVAQNEHQQLVGYVLVLLQPGTRLARLYSIAVDPQQRGKKLGEQLLGAAEGYAHQQHR-LFLRLEVRKDNTVAIALYERLGYRLFAQTVDYYEDHEDAL 190
>gi|153816290|ref|ZP_01968958.1| hypothetical protein RUMTOR_02541 [Ruminococcus torques ATCC 27756] >gi|145846343|gb|EDK23261.1| hypothetical protein RUMTOR_02541 [Ruminococcus torques ATCC 27756] (394 aa)
Score = 109, Expect = 5.1e-04, Identities = 37/121 (30%), Positives = 60/121 (49%)
  Q:    18 IVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSD-NSDAFLM 138
           I  LE  +F  + ++ +++   L+  N  CLI +   +  GY L +   +E EI +IGVV   R + +   LL  L++       + I L+V S  +     Y    F     R ++YSD + DA LM
  S:   263 IAELEYSLF-RDAWSEKSILETLKQPNAICLIAEKADRTAGYLLAYTAAEEMEIARIGVVKEMRRQGVARELLGALEKIGKQSGIEKILLDVRSGNEAAHKLYTSEGFTEDGIRKHFYSDPDEDAVLM 389
>gi|18976639|ref|NP_577996.1| ribosomal protein s18 alanine acetyltransferase [Pyrococcus furiosus DSM 3638] >gi|18892210|gb|AAL80391.1| ribosomal protein s18 alanine acetyltransferase [Pyrococcus furiosus DSM 3638] (170 aa)
Score = 109, Expect = 5.7e-04, Identities = 34/101 (33%), Positives = 53/101 (52%)
  Q:    38 SFLESQNFYCLIYKDNKQILGYCL-FFENEQEAEIYKIGVVYSYRNKKIGSNLL-----SYLKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           +FLE+     L+ + N +I+GY + +   + E  I  I V   YR   IG  L+        ++  + I LEV   +   IN Y K  FK++ +  +YYSD  DA+ M
  S:    50 TFLEANPDTFLVAEYNGKIVGYVMGYLRPDMEGHIMSIAVHPDYRGNGIGKALMIAVIKKLFEKGARWIGLEVRVSNYRAINLYKKLGFKIVKRIISYYSDGEDAYYM 157
>gi|167759777|ref|ZP_02431904.1| hypothetical protein CLOSCI_02140 [Clostridium scindens ATCC 35704] >gi|167662396|gb|EDS06526.1| hypothetical protein CLOSCI_02140 [Clostridium scindens ATCC 35704] (147 aa)
Score = 109, Expect = 5.8e-04, Identities = 38/127 (29%), Positives = 62/127 (48%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLK-----ENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDN-SDAFLM 138
           E E+ EI  LEQEIF  + ++L  L      +    L    + Q+ GY + +    E+EI +I V   +R + +   LL  ++     +    + L+V   +   + FYL   FK    R N+Y++   DA LM
  S:     9 EQEIEEIARLEQEIF-PDPWSLTALRDTWNQKQAQILGAWLDGQMAGYVIVYFAADESEIARIAVDEKFRRQGVAGALLDEMERVLAGKGIARLMLDVRKSNAAALRFYLSRGFKEDGVRKNFYTNPIEDAILM 141
>gi|82703241|ref|YP_412807.1| ribosomal-protein-alanine acetyltransferase [Nitrosospira multiformis ATCC 25196] >gi|82411306|gb|ABB75415.1| SSU ribosomal protein S18P alanine acetyltransferase [Nitrosospira multiformis ATCC 25196] (153 aa)
Score = 109, Expect = 6.2e-04, Identities = 34/129 (26%), Positives = 70/129 (54%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK-----SIFLEVSDRDN-TINFYLKNNFKVIHKRDNYY---SDNSDAFLMKWI 141
           S+L+ +V++E+E+FL   +T  N +  L++  ++CL+ + +  I GY +     +EA +  + +    + K  G  LL +  E  +     ++FL+V   ++     Y +  F+ I KR +YY       D+ +M+ +
  S:    17 SDLDAVVTIEREVFLFP-WTPGNFSDSLDA-GYHCLVLEQDGYIFGYGVMTIGAEEAHLLTLSIAPESQGKGWGEKLLRHFIEIAREQLALTMFLDVRVSNHVAARLYERLGFRQIGKRKDYYPAMGGREDSLVMELV 152
>gi|191162466|ref|ZP_03024346.1| ribosomal-protein-alanine acetyltransferase [Geobacter sp. M21] >gi|190996576|gb|EDV72024.1| ribosomal-protein-alanine acetyltransferase [Geobacter sp. M21] (149 aa)
Score = 108, Expect = 6.6e-04, Identities = 41/126 (32%), Positives = 63/126 (50%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLI-YKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNL----LSYLKENYKS-IFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           EL  ++ +E   F    +T E+    ++S   + ++   D+  + GY        EAEI  + V YS+R K IG  L    L + +E+  S +FLEV +     I  Y    FK   +R NYY +  DA LM+
  S:     5 ELKAVLEIESASF-SRPWTEEHFQYEIDSPFGHPMVALADDGTLAGYLCLKLVLDEAEILDVAVKYSHRGKGIGRLLVQWALDFSREHGASLLFLEVRAGNAEAIALYRSLGFKESGRRKNYYDNGEDAILME 136
>gi|119719727|ref|YP_920222.1| ribosomal-protein-alanine acetyltransferase [Thermofilum pendens Hrk 5] >gi|119524847|gb|ABL78219.1| Acetyltransferase, GNAT family [Thermofilum pendens Hrk 5] (156 aa)
Score = 108, Expect = 7.1e-04, Identities = 36/128 (28%), Positives = 63/128 (49%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS----YLKEN-YKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDNSDAFL 137
           +   +L  IV LE++ F  + ++L+ L         Y  +      ++GY +      +  ++ + VV   R + IG  LL       +EN  K+++LEV   +   +  Y K  FK I  ++ YY+D SDA+L
  S:     8 VEPGDLYYIVELEEKAFGPDAFSLDYLFYLYNRCRDYFFVADYKGLVVGYIVSCREGSQLHVHSVAVVEELRGRGIGRKLLEETIRIARENGLKAVYLEVKTTNTPALRLYEKLGFKRIGVKEKYYNDGSDAYL 141
>gi|167756622|ref|ZP_02428749.1| hypothetical protein CLORAM_02159 [Clostridium ramosum DSM 1402] >gi|167702797|gb|EDS17376.1| hypothetical protein CLORAM_02159 [Clostridium ramosum DSM 1402] (147 aa)
Score = 108, Expect = 7.8e-04, Identities = 43/125 (34%), Positives = 63/125 (50%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYC-LIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDN-SDAFLM 138
           ++ E+V LE ++F  + +  E     LE   F   LI +DN  I+GY   +    + +I  IGV   ++ K     L++   E      Y +I LEV       I+ Y K  FK+   R NYY DN  DA+LM
  S:    10 DIEEVVKLEHDLF-SSPWNEEAFKYELEKNAFSSILILEDNNIIVGYIGMWTLGDQTQITTIGVRKEFQGKGYAKILMTKCDEITKHLGYSNINLEVRVSNTKAISLYQKCGFKIAATRKNYYQDNHEDAYLM 141
>gi|15613110|ref|NP_241413.1| ribosomal-protein (S18)-alanine acetyltransferase [Bacillus halodurans C-125] >gi|10173160|dbj|BAB04266.1| ribosomal-protein (S18)-alanine acetyltransferase [Bacillus halodurans C-125] (151 aa)
Score = 108, Expect = 8.1e-04, Identities = 34/106 (32%), Positives = 53/106 (50%)
  Q:    36 LNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           +N    +Q    ++Y+  +QI+GYC  +    E+ I  I +   YR +K G  LL Y+ E       K + LEV   +      Y K  F+    R NYY+DN +  L+ W+
  S:    37 INEVTNNQFARYVVYEVGEQIVGYCGVWVVYDESHITNIAIHPDYRGEKRGEALLRYILEFARLLGAKKLSLEVRISNEIAQRLYRKFGFQAGGIRKNYYTDNQEDALVMWV 148
>gi|114571569|ref|YP_758249.1| GCN5-related N-acetyltransferase [Maricaulis maris MCS10] >gi|114342031|gb|ABI67311.1| GCN5-related N-acetyltransferase [Maricaulis maris MCS10] (153 aa)
Score = 107, Expect = 8.8e-04, Identities = 35/134 (26%), Positives = 62/134 (46%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDA-FLMKWIKQ 143
           +  S    + +L    F H G+T   + S L       L  + + Q +   LF +   EAE+  +     +R + +   +L+        +    IFLEVS+++      Y +  +  I +R +YY D SDA  L KW+++
  S:     8 VGPSSAEALAALHARCFPH-GWTAREIGSLLNLPGCIGLACRVDGQFVALALFRQALDEAELLTLATEPDFRRRGLADIILTSGETRLCDQGVARIFLEVSEKNPAAAALYKRAGYGEIARRKDYYRDGSDARVLEKWLRK 147
>gi|73959055|ref|XP_864502.1| PREDICTED: similar to CG18177-PB, isoform B isoform 2 [Canis familiaris] (261 aa)
Score = 107, Expect = 8.9e-04, Identities = 35/82 (42%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           I+K++  IL    F  + Q A I  +GVV  +R   IGS LL  LK++         K+I+L V   +NT INFY   +FK  H    YYS
  S:    77 IHKEDGDILA-STFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFKQHHYLPYYYS 166
>gi|160893544|ref|ZP_02074328.1| hypothetical protein CLOL250_01098 [Clostridium sp. L2-50] >gi|156864529|gb|EDO57960.1| hypothetical protein CLOL250_01098 [Clostridium sp. L2-50] (167 aa)
Score = 107, Expect = 8.9e-04, Identities = 40/128 (31%), Positives = 70/128 (54%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCL---------IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSD-RDNTINFYLKNNFKVIHKRDNYYSD-NSDAFLMK 139
           E +L +IVSL +++F+       + N  + + + Y             KD+K ++GYC+F    ++ E+ +I V   YR   IG  L+  +     +++ + IFLEV +  D  I+ Y    F  I +R +YY     DA +M+
  S:    25 EEQLLDIVSLGEKVFM------SSWNEQMVATSMYGTYDTVLTAVDTTKDDK-VVGYCIFTAPCEDCELLRIAVDKDYRKCGIGHRLMKEMIRMCVEDDGEKIFLEVRESNDAAISMYESLGFDEISRRKDYYKKPTEDAVIME 161
>gi|196193254|gb|EDX88213.1| acetyltransferase, GNAT family [Alcanivorax sp. DG881] (374 aa)
Score = 107, Expect = 9.5e-04, Identities = 37/123 (30%), Positives = 65/123 (52%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQIL-GYCLFF--ENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY----KSIFLEVS-DRDN--TINFYLKNNFKVIHKRDNYYSDNSDAF 136
           +L+ + +LEQ  F  +  +  +   +L+ Q+   ++  D +Q L GY L       + A +Y I V    R KK+G +LL    E+Y    + +FL +   RDN   I  Y +  +++  +  +YY D+ DA 
  S:    13 DLDALTALEQRCFSSDRLSRRSFRKWLKRQHTGLIVALDEQQQLAGYALVLLQPGTRLARLYSIAVDPQQRGKKLGEHLLE-AAEDYAHQQRRLFLRLEVRRDNAAAIALYERMGYRLFAQTADYYEDHEDAL 144
>gi|51243954|ref|YP_063838.1| N-terminal acetyltransferase [Desulfotalea psychrophila LSv54] >gi|50874991|emb|CAG34831.1| related to N-terminal acetyltransferase [Desulfotalea psychrophila LSv54] (146 aa)
Score = 107, Expect = 9.6e-04, Identities = 32/87 (36%), Positives = 49/87 (56%)
  Q:    52 DNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNL----LSYLK-ENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           D   I+G+C     + EAE+ KI +  S+R + +G  L    L++L+ +N   IFLEV   +      Y KN FK +  R NYY + +D  L+
  S:    46 DGNLIVGWCALTLLDFEAELLKIAIDKSHRGQGLGQLLLKEALAHLEAQNVCEIFLEVRSHNTPACRLYAKNGFKQVGTRKNYYQNPADDALV 138
>gi|110633310|ref|YP_673518.1| GCN5-related N-acetyltransferase [Mesorhizobium sp. BNC1] >gi|110284294|gb|ABG62353.1| GCN5-related N-acetyltransferase [Mesorhizobium sp. BNC1] (154 aa)
Score = 107, Expect = 9.7e-04, Identities = 32/124 (25%), Positives = 63/124 (50%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENE--QEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAF 136
           ++++ +VS+E  +F  +  +     S L S     L+ + +  I GY L    +  + A +Y I V   + +  +G  LL+  ++   +     + LEV  D    ++ Y ++ F+ I +R+NYY D + A 
  S:    11 TDIDTLVSIENSVFDTDRISRRAFRSHLASGTASLLVSEKDGAIAGYALLLYRKGGKTARLYSIAVANGHASAGVGRGLLAAAEKAAAARGRPILRLEVREDNARAVDLYRRSGFRPIGRRENYYEDGAPAL 142
>gi|134103154|ref|YP_001108815.1| ribosomal-protein-alanine N-acetyltransferase [Saccharopolyspora erythraea NRRL 2338] >gi|133915777|emb|CAM05890.1| ribosomal-protein-alanine N-acetyltransferase [Saccharopolyspora erythraea NRRL 2338] (162 aa)
Score = 107, Expect = 1.0e-03, Identities = 37/130 (28%), Positives = 68/130 (52%)
  Q:    10 ISESELNEIVSLEQEIF-LHNGYTLENLNSFLESQNFYCLIYKDNKQILGYC----LFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL----KENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYS-DNSDAFLMK 139
           +  S+L     LEQ +F   + ++     + L+  ++Y   Y   + +LGY     +    + +AE++ IGV  +++ + IG  LL  L     +    +FLEV +D D  I  Y ++ F+++  R  YY    +DA  M+
  S:     6 LRRSDLRRCAELEQVLFPADDPWSRAAFAAELDMGHYYIGAYDAGENLLGYAGLALVGRPPDAQAEVHTIGVDPAHQRRGIGRMLLKALLTRADQLRAEVFLEVRTDNDAAIELYRRHGFEIVGLRRRYYQPSGADAHTMR 146
>gi|157691317|ref|YP_001485779.1| ribosomal-protein-alanine N-acetyltransferase [Bacillus pumilus SAFR-032] >gi|157680075|gb|ABV61219.1| ribosomal-protein-alanine N-acetyltransferase [Bacillus pumilus SAFR-032] (156 aa)
Score = 106, Expect = 1.1e-03, Identities = 38/138 (27%), Positives = 74/138 (53%)
  Q:     4 LKNKNNISESELN--------EIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-------KENYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           +K+KNN++ +E+         E+ ++E   F         +   L +Q  +  + ++++Q +GYC  +    +A+I  I ++  +R K  G  LL Y+       K ++ S+ + VS+     + Y K  F+    R NYY+DN +  L+ W+
  S:     1 MKDKNNLNITEIRKMTVADIPEVYTIEVHSFTAPWKKESFVYEILHNQYSHYFLIEEDEQPVGYCGVWIVMDDAQITNIAILPEHRGKGYGEALLRYVMEFCKEKKTDHLSLEVRVSNTPAQ-SLYEKLGFRPASIRKNYYTDNGEDALVMWV 152
>gi|169350980|ref|ZP_02867918.1| hypothetical protein CLOSPI_01757 [Clostridium spiroforme DSM 1552] >gi|169292042|gb|EDS74175.1| hypothetical protein CLOSPI_01757 [Clostridium spiroforme DSM 1552] (148 aa)
Score = 106, Expect = 1.2e-03, Identities = 40/125 (32%), Positives = 70/125 (56%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYC-LIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDN-SDAFLM 138
           ++++IV +E+E+F  + +  + L   +E   F   LI ++N +I+GY   +    + +I  +G+   Y+ +  G  L+   +E      Y +I LEV    +  I+ Y K  FK++  R NYY DN  DA+LM
  S:    10 DIDKIVEIEKELFT-SPWDKDALYYEVERNAFSTILILENNDEIVGYIGMWLLGDQTQITTLGIREMYQGRGYGKLLMDKCEEITKMQGYPNINLEVRVSNEKAISLYKKCGFKIVATRKNYYQDNHEDAYLM 141
>gi|40063235|gb|AAR38062.1| ribosomal-protein-alanine acetyltransferase [uncultured marine bacterium 577] (153 aa)
Score = 106, Expect = 1.2e-03, Identities = 40/128 (31%), Positives = 62/128 (48%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL----KENYK-SIFLEVSDRD-NTINFYLKNNFKVIHKRDNYY---SDNSDAFLMKWI 141
           +L+ +V +E+E+FL   +T  N    + S  +YC + +    I GY +      EA I  + V   ++ +  G  LL Y     KEN   SIFLEV   +      Y +  F+ +  R  YY       DA +M+ I
  S:    18 DLDAVVLIEREVFLFP-WTKGNFGDSI-SSGYYCYVLEMGNHIFGYGVMTIGADEAHILTLSVASEWQREGWGEKLLHYFISLSKENNACSIFLEVRKSNLGAAKLYKQIGFRQVGARIGYYPAMGGREDAIVMELI 152
>gi|196157601|ref|YP_002127090.1| ribosomal-protein-alanine N-acetyltransferase [Alteromonas macleodii 'Deep ecotype'] >gi|88773673|gb|EAR04935.1| ribosomal-protein-alanine N-acetyltransferase [Alteromonas macleodii 'Deep ecotype'] >gi|196113380|gb|ACG67096.1| ribosomal-protein-alanine N-acetyltransferase [Alteromonas macleodii 'Deep ecotype'] (162 aa)
Score = 106, Expect = 1.3e-03, Identities = 31/101 (30%), Positives = 57/101 (56%)
  Q:    42 SQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNS-----------DAFLMKWIK 142
           ++ +Y +   +N+Q++GY +  E   EA +  I V  ++R + +G  L+ Y+     +     ++LEV + +   I  Y  + F+ I  R NYY+  S           +A +MKW K
  S:    42 TKPYYGVFAYENEQVIGYAIVLEVADEATLMDIAVDDAFRGQGVGRALVDYVLTASEQNGMIEMWLEVRESNLAAIKLYESSGFEHIETRKNYYTTKSYEANSSRTGKENAKIMKWSK 159
>gi|48477815|ref|YP_023521.1| ribosomal protein s18 alanine acetyltransferase [Picrophilus torridus DSM 9790] >gi|48430463|gb|AAT43328.1| ribosomal protein s18 alanine acetyltransferase [Picrophilus torridus DSM 9790] (150 aa)
Score = 106, Expect = 1.3e-03, Identities = 34/91 (37%), Positives = 51/91 (56%)
  Q:    48 LIYKDNKQILGYCLFFE-NEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           L+Y +   +LG+ +    +  E  I    V   YR+  IG+ LL+      L +   ++ LEV +D ++ I FY KN F +     NYYSD SDA+LM
  S:    49 LVYDNFTTVLGFIIGSRYSGTEGRILLFAVDERYRSSGIGTYLLNEITKVMLSDGLSTMRLEVRTDNESAIRFYKKNGFSITSTLKNYYSDLSDAYLM 146
>gi|169334905|ref|ZP_02862098.1| hypothetical protein ANASTE_01311 [Anaerofustis stercorihominis DSM 17244] >gi|169257643|gb|EDS71609.1| hypothetical protein ANASTE_01311 [Anaerofustis stercorihominis DSM 17244] (147 aa)
Score = 105, Expect = 1.5e-03, Identities = 35/126 (27%), Positives = 67/126 (53%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYSDN-SDAFLM 138
           +++ +I+  E++ F H           + +++FY + Y + + ++ +  + +   +  I  +GV    R    G  LLS +     +++ K + LEV + + T IN Y    FK+  KR NYY+DN  DA++M
  S:    11 TDVEDIIEFEKDCFEHPWGEQSIFGELINNKSFYIVFY-EGEDVIAFGGYQDIVGQGHITTMGVREDKRGLGYGKKLLSLIVEHAFRKDIKEMTLEVRESNITAINLYESMGFKIYGKRKNYYADNHEDAYIM 142
>gi|151572996|gb|EDN38650.1| acetyltransferase [Francisella tularensis subsp. novicida GA99-3548] (141 aa)
Score = 105, Expect = 1.5e-03, Identities = 36/132 (27%), Positives = 69/132 (52%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY-KSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWIKQ 143
           +++L  ++ LE   FL +  + +     +  Q ++  + K    + GY L FE ++   +Y + V  +Y+ + IG  LL Y+  N  K+I LEV+  +   I+ Y K  F++  + +NYY +   A+ M  I++
  S:     8 QTDLQALIDLENTTFLSDKISKKQFAYNINKQKYF-FVAKRQDSLAGYILCFEYKKTIRVYSLAVSKNYQGQGIGKKLLEYILNNTDKNISLEVNTNNLIAISLYQKLGFEINKQINNYYENGDAAYKMTIIRK 140
>gi|151569863|gb|EDN35517.1| hypothetical protein FTCG_01274 [Francisella tularensis subsp. novicida GA99-3549] (141 aa)
Score = 105, Expect = 1.6e-03, Identities = 36/132 (27%), Positives = 69/132 (52%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSY-LKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWIKQ 143
           +++L  ++ LE   FL +  + +     +  Q ++  + K    + GY L FE ++   +Y + V  +Y+ + IG  LL Y L +  K+I LEV+  +   I+ Y K  F++  + +NYY +   A+ M  I++
  S:     8 QTDLQALIDLENTTFLSDKISKKQFAYNINKQKYF-FVAKRQDSLAGYILCFEYKKTIRVYSLAVSKNYQGQGIGKKLLEYILNKTDKNISLEVNTNNLIAISLYQKLGFEINKQINNYYENGDAAYKMTIIRK 140
>gi|15672581|ref|NP_266755.1| hypothetical protein L189315 [Lactococcus lactis subsp. lactis Il1403] >gi|12723494|gb|AAK04697.1|AE006293_3 HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis Il1403] (154 aa)
Score = 105, Expect = 1.6e-03, Identities = 31/100 (31%), Positives = 52/100 (52%)
  Q:    35 NLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSN----LLSYLKENYKS--IFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSD 134
           +L ++LE+ + + L  K+ K +    +  + +   EI    V  S++ +  G      L++YLKEN  +  + L   D  N + FY K  F + HK  NY+ DN D
  S:    28 HLENYLENGDLFTLSLKNGKTVACAVVIKKQKNTFEIENFAVETSFQGQGFGQQMMKQLITYLKENLAADELILGTDDVSNNVAFYEKCGFTITHKISNYFLDNCD 133
>gi|104779974|ref|YP_606472.1| acetyltransferase [Pseudomonas entomophila L48] >gi|95108961|emb|CAK13657.1| putative acetyltransferase, GNAT family [Pseudomonas entomophila L48] (365 aa)
Score = 105, Expect = 1.6e-03, Identities = 32/123 (26%), Positives = 59/123 (47%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCL--FFENEQEAEIYKIGVVYSYRNKKIGSNLLSY-----LKENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAF 136
           +L  +++LE + F  +  T  +    L   N   L+ + + Q++GY L  F      A +Y I +    R + +G+ LL       L      + LEV +D    I  Y ++ ++   + D+YY D++ A 
  S:    12 DLPALLALENQCFALDRLTPRSFRWMLSHANASLLVAQRDGQLMGYALLLFHRGTSLARLYSIAIAEQARGQGLGARLLEQAERCALDHERAYLRLEVRTDNPTAIALYERHGYRRFAQVDDYYEDHASAL 142
>gi|73959057|ref|XP_851842.1| PREDICTED: similar to CG18177-PB, isoform B isoform 1 [Canis familiaris] (242 aa)
Score = 105, Expect = 1.7e-03, Identities = 35/82 (42%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           I+K++  IL    F  + Q A I  +GVV  +R   IGS LL  LK++         K+I+L V   +NT INFY   +FK  H    YYS
  S:    77 IHKEDGDILA-STFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFKQHHYLPYYYS 166
>gi|163782342|ref|ZP_02177340.1| ribosomal-protein-alanine acetyltransferase [Hydrogenivirga sp. 128-5-R1-1] >gi|159882375|gb|EDP75881.1| ribosomal-protein-alanine acetyltransferase [Hydrogenivirga sp. 128-5-R1-1] (150 aa)
Score = 105, Expect = 1.8e-03, Identities = 28/130 (21%), Positives = 62/130 (47%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGS----NLLSYLKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           + E +L  +  + +  F  + ++++           +  + ++  +++GY + +  ++EA +    +   +RN+  G      LL  LK   +S+ L+V   +   I  Y    FKV+ +R  +YSD   A +M+
  S:     8 MREEDLPRVYEINRLSFTTDAWSMDAFRREFNLPYSHRFVLENEGELIGYAVLWVIKEEAFVMTFAITPEFRNRGAGKWFLKELLKELKGEVRSVQLDVRKSNLPAIKLYRSAGFKVVRERPKFYSDGETALVME 142
>gi|168335438|ref|ZP_02693527.1| ribosomal-protein-alanine acetyltransferase [Epulopiscium sp. 'N.t. morphotype B'] (144 aa)
Score = 105, Expect = 1.8e-03, Identities = 42/138 (30%), Positives = 68/138 (49%)
  Q:     2 ITLKNKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK-----SIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYS-DNSDAFLMK 139
           +T++   NI  +E++ I +    +   +   L +LN+ + +      +  D   I+GY  ++    EA I  + V  ++RN  I +NLL+ L  + K     S FLEV   + T  + Y K  F  I  R NYY     DA +MK
  S:     1 MTIRKALNIDATEISAIEAQTFSLPWSHLEILTDLNNPIATY----FVATDAGTIVGYAGYWLVVGEANITNVAVATTHRNLGIATNLLTTLIASLKXSAAVSAFLEVRASNATAKHLYAKFGFVPISVRKNYYKCPPEDAIIMK 141
>gi|56707343|ref|YP_169239.1| acetyltransferase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110669813|ref|YP_666370.1| acetyltransferase [Francisella tularensis subsp. tularensis FSC198] >gi|134302715|ref|YP_001122683.1| acetyltransferase GNAT family protein [Francisella tularensis subsp. tularensis WY96-3418] >gi|56603835|emb|CAG44810.1| Acetyltransferase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320146|emb|CAL08193.1| Acetyltransferase [Francisella tularensis subsp. tularensis FSC 198] >gi|134050492|gb|ABO47563.1| Acetyltransferase GNAT family protein [Francisella tularensis subsp. tularensis WY96-3418] >gi|151568266|gb|EDN33920.1| acetyltransferase [Francisella tularensis subsp. tularensis FSC033] (141 aa)
Score = 104, Expect = 1.9e-03, Identities = 36/131 (27%), Positives = 68/131 (51%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY-KSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWIKQ 143
           ++L  ++ LE   FL +  + +     +  Q ++  + K    + GY L FE ++   +Y + V  +Y+ + IG  LL Y+  N  K+I LEV+  +   I+ Y K  F++  + +NYY +   A+ M  I++
  S:     9 TDLQALIDLENSTFLSDKISKKQFAYNINKQKYF-FVAKRQDSLAGYILCFEYKKTIRVYSLAVSKNYQGQGIGKKLLEYILNNTDKNISLEVNTNNLIAISLYQKLGFEINKQINNYYENGDAAYKMTIIRK 140
>gi|70730467|ref|YP_260208.1| acetyltransferase [Pseudomonas fluorescens Pf-5] >gi|68344766|gb|AAY92372.1| acetyltransferase, GNAT family [Pseudomonas fluorescens Pf-5] (368 aa)
Score = 104, Expect = 2.1e-03, Identities = 33/126 (26%), Positives = 60/126 (47%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYC--LFFENEQEAEIYKIGVVYSYRNKKIGSNLLSY-----LKENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           +L  +V+LE++ F  +  T  +    +   +   L+ +   Q+LGY   LF      A +Y + +  S R   +G  LL       L  +   + LEV +D    I  Y +N ++      +YY D++DA  ++
  S:    12 DLPALVALEEQCFTSDRLTPRSFQWMISRAHGQLLVAEQQAQVLGYALVLFHRGTSLARLYSLAIAESARGLGLGKRLLQRMEACALAHDCAYLRLEVRTDNPAAIALYERNGYRRFALVPDYYQDHADALRLE 145
>gi|149183971|ref|ZP_01862346.1| ribosomal-protein (S18)-alanine acetyltransferase [Bacillus sp. SG-1] >gi|148848319|gb|EDL62594.1| ribosomal-protein (S18)-alanine acetyltransferase [Bacillus sp. SG-1] (152 aa)
Score = 104, Expect = 2.4e-03, Identities = 30/95 (31%), Positives = 52/95 (54%)
  Q:    48 LIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWIK 142
           ++ ++  +++GYC  +    EA I  I V+ SYR + +G  L+  + E       +++ LEV   +    + Y K  F+    R NYYSDN +  L+ W+K
  S:    49 IVIEEGGKVIGYCGVWIIVDEAHITNIAVLPSYRGQGLGDKLMRSMIEIAKEMGARTMTLEVRVSNTPAQSLYRKFGFQEGGIRKNYYSDNQEDALVMWVK 149
>gi|167626894|ref|YP_001677394.1| acetyltransferase GNAT family protein [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167596895|gb|ABZ86893.1| acetyltransferase GNAT family protein [Francisella philomiragia subsp. philomiragia ATCC 25017] (143 aa)
Score = 103, Expect = 2.4e-03, Identities = 37/131 (28%), Positives = 69/131 (52%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY-KSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWIKQ 143
           ++L  +V LE   FL +  + +     ++ Q ++  + K N ++ GY L FE ++   +Y + V  +Y+ + IG  LL Y+  N  K+I LEV+  +   I+ Y K  F +  + +NYY +    + M  I++
  S:     9 TDLQTLVELESSTFLSDKISKKQFVYNIDKQKYF-FVAKINNELAGYILCFEYKKTIRVYSLAVSKNYQGQGIGKKLLEYILNNSDKNIALEVNTNNLIAISLYQKLGFVINKQINNYYENGDATYKMILIRK 140
>gi|148652428|ref|YP_001279521.1| GCN5-related N-acetyltransferase [Psychrobacter sp. PRwf-1] >gi|148571512|gb|ABQ93571.1| GCN5-related N-acetyltransferase [Psychrobacter sp. PRwf-1] (183 aa)
Score = 103, Expect = 2.4e-03, Identities = 29/86 (33%), Positives = 47/86 (54%)
  Q:    57 LGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYY--------SDNSDAFLMKWIK 142
           + YCL     + AEI +IG    ++ +    +L+  L      +   SI LEV +D +  I  Y K  F+VIH R  YY        ++  DA +M++ +
  S:    83 VAYCLVSTVFETAEILRIGTHPDFQRRGYAQSLIEQLIAQMPDKGLDSILLEVRADNEGAIRLYQKMGFEVIHTRKGYYTSSKPSGETERCDALIMQYTR 182
>gi|91773896|ref|YP_566588.1| SSU ribosomal protein S18P alanine acetyltransferase [Methanococcoides burtonii DSM 6242] >gi|91712911|gb|ABE52838.1| SSU ribosomal protein S18P alanine acetyltransferase [Methanococcoides burtonii DSM 6242] (139 aa)
Score = 103, Expect = 2.4e-03, Identities = 34/129 (26%), Positives = 65/129 (50%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           + S+L  +V LE   F    + L    S++    F  +++ ++  I GY +      +A +  I +   +R + IGS LL          ++  + LEV +++ T  +FYL N F+ +    +YY D+ +A +M+
  S:     6 TRSDLPAVVDLENLSFAEP-WDLRTFRSYVHHPGF--IVFDEDGSICGYVILVVIADDAHLASIAIHPKHRRRNIGSCLLDSCMLLAKTNSFPLVRLEVREKNKTAQDFYLANGFEAVAIIPDYYPDD-NAIVME 136
>gi|192811366|ref|ZP_03040037.1| ribosomal-protein-alanine acetyltransferase [Geobacillus sp. Y412MC10] >gi|192799929|gb|EDV76438.1| ribosomal-protein-alanine acetyltransferase [Geobacillus sp. Y412MC10] (174 aa)
Score = 103, Expect = 2.5e-03, Identities = 37/127 (29%), Positives = 65/127 (51%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNF-YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKEN-----YKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           ++ E++ +E+E F    +T E  ++ L+  +F   +I +   + +GY   +    EA +  I ++  YR +K G  LLS L +       + + LEV   ++     Y+K  FK    R  YYSDN +  L+ W
  S:    23 DIPEVLEVEREAFT-VPWTEEAFHNELKLNHFARYMIMEYEGRTVGYAGMWTIVDEAHVTNIALLEQYRGRKWGDRLLSELMKTAAYMGMEKMTLEVRVSNHVAQRLYIKKGFKPAGVRKGYYSDNQEDALIMW 155
>gi|119512927|ref|ZP_01631990.1| Ribosomal-protein-alanine acetyltransferase [Nodularia spumigena CCY9414] >gi|119462423|gb|EAW43397.1| Ribosomal-protein-alanine acetyltransferase [Nodularia spumigena CCY9414] (170 aa)
Score = 103, Expect = 2.6e-03, Identities = 43/140 (30%), Positives = 70/140 (50%)
  Q:     2 ITLKNKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQN-----FYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRD------NTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           + LK K+  SE +L+ I+ L+Q  F    +TLE     L+S N      +C ++    ++LG   F+    EA I  + +   Y  + +G  LL +L +      LE S  +        I+ Y K  FK+  +R  YY DN +  L+ W+
  S:     4 LDLKLKSLTSE-DLSAILELDQACF-GGLWTLEGYQRELDSPNSELLGLFCPLFP--AKLLGMGCFWAILDEAHITILAIHPQYHRQGLGQVLLYFLLKAACDRGLERSTLEVRASNLAAISLYQKFGFKIAGRRKGYYQDNGEDALVLWL 150
>gi|194386276|dbj|BAG59702.1| unnamed protein product [Homo sapiens] (249 aa)
Score = 103, Expect = 2.8e-03, Identities = 35/82 (42%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           I+K++  IL    F  + Q A I  +GVV  +R   IGS LL  LK++         K+I+L V   +NT INFY   +FK  H    YYS
  S:    84 IHKEDGDILA-SNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFKQHHYLPYYYS 173
>gi|78779483|ref|YP_397595.1| SSU ribosomal protein S18P alanine acetyltransferase [Prochlorococcus marinus str. MIT 9312] >gi|78712982|gb|ABB50159.1| SSU ribosomal protein S18P alanine acetyltransferase [Prochlorococcus marinus str. MIT 9312] (146 aa)
Score = 103, Expect = 3.0e-03, Identities = 34/82 (41%), Positives = 45/82 (54%)
  Q:    56 ILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFL 137
           ++G C+F     EA+I    V   YR +  GS L+SYL     K N   +FLEVS  +     FY + +F  +  R NYY D SDA L
  S:    51 VIGICVFHVVLDEAQINFFVVNQKYRERGFGSYLMSYLIKQCEKLNINKLFLEVSQTNVVAEKFYSRFDFCTVGIRRNYYKDGSDALL 138
>gi|187601227|ref|ZP_02987456.1| ribosomal-protein-alanine acetyltransferase [Chloroflexus sp. Y-400-fl] >gi|187486454|gb|EDU24426.1| ribosomal-protein-alanine acetyltransferase [Chloroflexus sp. Y-400-fl] (213 aa)
Score = 103, Expect = 3.1e-03, Identities = 29/85 (34%), Positives = 46/85 (54%)
  Q:    56 ILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           I+GY   + NE    I  I V  ++R + +G  +L+ L +     N + + LEV   + T    YLK  F+ + +R NYY DN +  L+ W
  S:    80 IVGYGGIWLNETSGHITTIAVAPAHRRRGVGELILNALIDGAYELNAQYLSLEVRVSNLTAQRLYLKYGFRPVGQRANYYVDNHEDALVMW 170
>gi|33861645|ref|NP_893206.1| putative ribosomal-protein-alanine acetyltransferase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|33634222|emb|CAE19548.1| putative ribosomal-protein-alanine acetyltransferase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (144 aa)
Score = 103, Expect = 3.1e-03, Identities = 32/84 (38%), Positives = 47/84 (55%)
  Q:    54 KQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSDAFL 137
           K+I+G  +      EA+I    +   +R K  GS L++YL     K N K + LEVS+ ++    FY K NF  + +R NYY   +DA L
  S:    49 KKIIGIYVVQTIIDEAQISYFSIKQKFRRKGYGSQLMTYLIKDCEKLNIKKLLLEVSETNSIAEIFYCKFNFLTVGRRKNYYKSGADAVL 138
>gi|163848268|ref|YP_001636312.1| ribosomal-protein-alanine acetyltransferase [Chloroflexus aurantiacus J-10-fl] >gi|163669557|gb|ABY35923.1| ribosomal-protein-alanine acetyltransferase [Chloroflexus aurantiacus J-10-fl] (220 aa)
Score = 103, Expect = 3.1e-03, Identities = 29/85 (34%), Positives = 46/85 (54%)
  Q:    56 ILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           I+GY   + NE    I  I V  ++R + +G  +L+ L +     N + + LEV   + T    YLK  F+ + +R NYY DN +  L+ W
  S:    87 IVGYGGIWLNETSGHITTIAVAPAHRRRGVGELILNALIDGAYELNAQYLSLEVRVSNLTAQRLYLKYGFRPVGQRANYYVDNHEDALVMW 177
>gi|37182209|gb|AAQ88907.1| TEVV2771 [Homo sapiens] (242 aa)
Score = 102, Expect = 3.7e-03, Identities = 35/82 (42%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           I+K++  IL    F  + Q A I  +GVV  +R   IGS LL  LK++         K+I+L V   +NT INFY   +FK  H    YYS
  S:    77 IHKEDGDILA-TNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFKQHHYLPYYYS 166
>gi|90421989|ref|YP_530359.1| ribosomal-protein-alanine acetyltransferase [Rhodopseudomonas palustris BisB18] >gi|90104003|gb|ABD86040.1| ribosomal-protein-alanine acetyltransferase [Rhodopseudomonas palustris BisB18] (161 aa)
Score = 102, Expect = 4.1e-03, Identities = 30/113 (26%), Positives = 54/113 (47%)
  Q:    27 LHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYY----SDNSDAFLMK 139
            H G++ +     L  +N      +  ++I+G+ +      EAEI  I +   YR +++   LL            K++FLEV + +      Y   NF V+ +R+ YY     +  +A LM+
  S:    35 FHRGWSEQEFEDMLSQRNTLVHRLRLGRRIIGFVVSRMAADEAEILSIAIDPGYRGRRLSRELLQTHLGHLAGRGVKTLFLEVEENNQPARRLYDHFNFAVVGRRERYYRQPDGEQLNALLMR 157
>gi|169630814|ref|YP_001704463.1| ribosomal-protein-alanine acetyltransferase RimI [Mycobacterium abscessus] >gi|169242781|emb|CAM63809.1| Probable ribosomal-protein-alanine acetyltransferase RimI [Mycobacterium abscessus] (155 aa)
Score = 101, Expect = 4.1e-03, Identities = 34/100 (34%), Positives = 51/100 (51%)
  Q:    40 LESQNFYCLIYKDNKQILGY---CLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL----KENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYY-SDNSDAFLMK 139
           L S + Y L  +D   ++GY        +  E EI+ IGV  +Y+ + +G  LL  L     ++   +FLEV +D    I  Y    F+ +  R  YY    +DAF MK
  S:    39 LASSHIYYLAARDGHTLVGYGGISRLGRHAPEYEIHTIGVDPAYQKQGLGRRLLDALLAHADQDPGPVFLEVRTDNAAAIALYQGAGFETVGLRKRYYPGSGADAFTMK 147
>gi|149750946|ref|XP_001502141.1| PREDICTED: similar to CG18177 CG18177-PB [Equus caballus] (242 aa)
Score = 101, Expect = 4.2e-03, Identities = 35/82 (42%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           I+K++  IL    F  + Q A I  +GVV  +R   IGS LL  LK++         K+I+L V   +NT INFY   +FK  H    YYS
  S:    77 IHKEDGDILA-SNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFKQHHYLPYYYS 166
>gi|21312874|ref|NP_083366.1| hypothetical protein LOC74763 [Mus musculus] >gi|81906110|sp|Q9DBU2|NATU_MOUSE N-acetyltransferase UNQ2771/PRO7155 homolog >gi|12836161|dbj|BAB23531.1| unnamed protein product [Mus musculus] >gi|13436011|gb|AAH04837.1| RIKEN cDNA 1200013P24 gene [Mus musculus] >gi|26353816|dbj|BAC40538.1| unnamed protein product [Mus musculus] >gi|32478176|gb|AAP83441.1| GNAT acetytransferase [Rattus norvegicus] (242 aa)
Score = 101, Expect = 4.2e-03, Identities = 34/82 (41%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           I+K++  IL    F  + Q A I  +GVV  +R   IGS LL  LK++         K+I+L V   +NT INFY   +F+  H    YYS
  S:    77 IHKEDGDILASS-FSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFRQHHYLPYYYS 166
>gi|48146765|emb|CAG33605.1| FLJ14154 [Homo sapiens] (242 aa)
Score = 101, Expect = 4.3e-03, Identities = 35/82 (42%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           I+K++  IL    F  + Q A I  +GVV  +R   IGS LL  LK++         K+I+L V   +NT INFY   +FK  H    YYS
  S:    77 IHKEDGDILA-SNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFKQHHYLPYYYS 166
>gi|13376261|ref|NP_079121.1| hypothetical protein LOC79903 [Homo sapiens] >gi|134254440|ref|NP_001077069.1| hypothetical protein LOC79903 [Homo sapiens] >gi|134254455|ref|NP_001077070.1| hypothetical protein LOC79903 [Homo sapiens] >gi|74733721|sp|Q9H7X0|NATU_HUMAN N-acetyltransferase UNQ2771/PRO7155 >gi|10436540|dbj|BAB14853.1| unnamed protein product [Homo sapiens] >gi|15030045|gb|AAH11267.1| FLJ14154 protein [Homo sapiens] >gi|119605764|gb|EAW85358.1| hCG1984390, isoform CRA_a [Homo sapiens] >gi|119605765|gb|EAW85359.1| hCG1984390, isoform CRA_a [Homo sapiens] >gi|119605766|gb|EAW85360.1| hCG1984390, isoform CRA_a [Homo sapiens] >gi|119605767|gb|EAW85361.1| hCG2040097, isoform CRA_a [Homo sapiens] >gi|119605768|gb|EAW85362.1| hCG2040097, isoform CRA_a [Homo sapiens] >gi|119605769|gb|EAW85363.1| hCG2040097, isoform CRA_a [Homo sapiens] >gi|119605770|gb|EAW85364.1| hCG2040097, isoform CRA_a [Homo sapiens] (242 aa)
Score = 101, Expect = 4.3e-03, Identities = 35/82 (42%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           I+K++  IL    F  + Q A I  +GVV  +R   IGS LL  LK++         K+I+L V   +NT INFY   +FK  H    YYS
  S:    77 IHKEDGDILA-SNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFKQHHYLPYYYS 166
>gi|154483098|ref|ZP_02025546.1| hypothetical protein EUBVEN_00799 [Eubacterium ventriosum ATCC 27560] >gi|149735906|gb|EDM51792.1| hypothetical protein EUBVEN_00799 [Eubacterium ventriosum ATCC 27560] (147 aa)
Score = 101, Expect = 4.5e-03, Identities = 36/131 (27%), Positives = 71/131 (54%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           +SE ++ ++ ++E+EIF         L+S L+++N   ++ +   +I+ YC  + + +EA+I  + V  ++R K +  N+L+ L     K+    I LEV + +   I+ Y K  F+    R N+Y    +  L+ W
  S:     9 MSEGDIKQVAAIEKEIFSLPWSEKSFLDS-LKNENTVYIVAEIKDEIVAYCGAYISFEEADISNVAVKENFRRKNVAENMLNKLFYECGKKGVSDITLEVRETNVPAISLYEKLGFEEAGIRKNFYEKPVENALIMW 144
>gi|116628464|ref|YP_821083.1| ribosomal-protein-alanine acetyltransferase [Streptococcus thermophilus LMD-9] >gi|116101741|gb|ABJ66887.1| Acetyltransferase [Streptococcus thermophilus LMD-9] (146 aa)
Score = 101, Expect = 4.5e-03, Identities = 34/139 (24%), Positives = 68/139 (48%)
  Q:     1 MITLKNKNNISESELNEIV-SLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSD-NSDAFLMK 139
           M T  + + +S  E  +++  +  +++  + +TLE + + L           + ++++G+        E E+  I V+ +Y+ +   S L+ YL+E  + IFLEV   +      Y K  F+ +  R NYY +   DA +M+
  S:     1 MTTTSSASRLSSQEQAQLIYQILSDVYDKSPWTLEQVVADLALDTTEYFYVYNQEEVVGFLALQNLVGEIEVTNIAVLKAYQGRGYASQLMKYLEERSEPIFLEVRASNQVAQALYRKFGFESLGIRKNYYHEPQEDAVIMR 142
>gi|118496767|ref|YP_897817.1| RimI-like acetyltransferase [Francisella tularensis subsp. novicida U112] >gi|194324075|ref|ZP_03057850.1| acetyltransferase, gnat family [Francisella tularensis subsp. novicida FTE] >gi|118422673|gb|ABK89063.1| RimI-like acetyltransferase [Francisella tularensis subsp. novicida U112] >gi|194321972|gb|EDX19455.1| acetyltransferase, gnat family [Francisella tularensis subsp. novicida FTE] (141 aa)
Score = 101, Expect = 4.6e-03, Identities = 36/131 (27%), Positives = 68/131 (51%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY-KSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWIKQ 143
           ++L  ++ LE   FL +    +     +  Q ++  + K    + GY L FE ++   +Y + V  +Y+ + IG  LL Y+  N  K+I LEV+  +   I+ Y K  F++  + +NYY ++  A+ M  I++
  S:     9 TDLQALIDLENTTFLSDKILKKQFAYNINKQKYF-FVAKIQGSLAGYILCFEYKKTIRVYSLAVSKNYQGQGIGKKLLEYILNNTDKNISLEVNTNNLIAISLYQKLGFEINKQINNYYENSDAAYKMTLIRK 140
>gi|171779199|ref|ZP_02920170.1| hypothetical protein STRINF_01047 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282255|gb|EDT47682.1| hypothetical protein STRINF_01047 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (102 aa)
Score = 101, Expect = 4.6e-03, Identities = 30/92 (32%), Positives = 47/92 (51%)
  Q:    48 LIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDN-SDAFLMK 139
            ++K +++I+G+    +   E EI  I +  +Y+   +GS LL+ L      IFLEV   +      Y K  F +I KR  YY +   DA +MK
  S:     5 FLFKKDEKIVGFLAISQLAGELEITNIAIKKAYQGHCLGSQLLANLDHVDFPIFLEVRASNTPAQALYKKCGFGIIGKRKQYYHEPVEDAIIMK 98
>gi|160886197|ref|ZP_02067200.1| hypothetical protein BACOVA_04204 [Bacteroides ovatus ATCC 8483] >gi|156108082|gb|EDO09827.1| hypothetical protein BACOVA_04204 [Bacteroides ovatus ATCC 8483] (149 aa)
Score = 101, Expect = 4.8e-03, Identities = 37/128 (28%), Positives = 67/128 (52%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQN---FYCLIYKDNKQILGYC--LFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY-----KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           ++++  I+ +E E F  + ++ E   ++L S++   FY ++  D  +++ Y   LF    +   IY I V   YR +++G  L+    +         I LEV   + + I  Y+KN F  +  +  YY D SDA  M+
  S:    11 QADIPAILEIEWECFREDSFSKEQF-AYLISRSKGIFYVMMEAD--RVIAYVSLLFHGGTRYLRIYSIAVHPDYRGRELGQVLMDQTIQTAGECKAAKITLEVKVTNTSAIGLYMKNGFIPVGIKPCYYHDGSDAIYMQ 146
>gi|194016017|ref|ZP_03054632.1| ribosomal-protein-alanine acetyltransferase [Bacillus pumilus ATCC 7061] >gi|194012372|gb|EDW21939.1| ribosomal-protein-alanine acetyltransferase [Bacillus pumilus ATCC 7061] (142 aa)
Score = 101, Expect = 4.9e-03, Identities = 33/132 (25%), Positives = 68/132 (51%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-------KENYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           ++ +++ E+ ++E   F         +   L +Q  +  + ++++Q +GYC  +    +A+I  I ++  +R K  G  LL Y+       K ++ S+ + VS+     + Y K  F+    R NYY+DN +  L+ W+
  S:     1 MTVADIPEVYTIEVHSFTAPWKKESFVYEILHNQYSHYFLIEEDEQPVGYCGVWIVMDDAQITNIAILPEHRGKGYGEALLRYVMEFCKEKKTDHLSLEVRVSNTPAQ-SLYEKLGFRPASIRKNYYTDNGEDALVMWV 138
>gi|76253847|ref|NP_001014248.2| hypothetical protein LOC363545 [Rattus norvegicus] >gi|109489628|ref|XP_001077604.1| PREDICTED: similar to CG18177-PB, isoform B [Rattus norvegicus] >gi|123780717|sp|Q3MHC1|NATU_RAT N-acetyltransferase UNQ2771/PRO7155 homolog (GNAT acetytransferase) >gi|75867812|gb|AAI05305.1| Similar to RIKEN cDNA 1200013P24 [Rattus norvegicus] (242 aa)
Score = 101, Expect = 4.9e-03, Identities = 34/82 (41%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           I+K++  IL    F  + Q A I  +GVV  +R   IGS LL  LK++         K+I+L V   +NT INFY   +F+  H    YYS
  S:    77 IHKEDGDILASS-FSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFRQHHYLPYYYS 166
>gi|119774293|ref|YP_927033.1| acetyltransferase [Shewanella amazonensis SB2B] >gi|119766793|gb|ABL99363.1| acetyltransferase [Shewanella amazonensis SB2B] (369 aa)
Score = 101, Expect = 5.0e-03, Identities = 33/128 (25%), Positives = 62/128 (48%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCL--FFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           S ++L+ + +LE   F  +  +   +  F++S +   ++  D   +  Y L  F      A +Y + V   YR + +   LL+ +++      Y ++ LEV +D     N Y K  +KV+    +YY D +D   M
  S:    11 SLAQLDALNALENSAFEGDRISPRQMRRFIQSPHACLMLALDGSTLAAYALVLFHRGTHLARLYSLAVSPDYRGRGVSRELLTRVEQVTVEKGYITLRLEVRNDNLAARNLYQKMGYKVLKSLVHYYDDLADGVRM 146
>gi|130492705|ref|NP_001076341.1| hypothetical protein LOC570640 [Danio rerio] >gi|182701371|sp|A3KPA3|NATU_DANRE N-acetyltransferase UNQ2771/PRO7155 homolog >gi|126632165|gb|AAI34237.1| Zgc:163109 protein [Danio rerio] (242 aa)
Score = 101, Expect = 5.2e-03, Identities = 34/82 (41%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           ++K++  IL    F  + Q A I  +GVV  +R   IGS LL  LKE+         K+I+L V   +NT I+FY   +FK  H    YYS
  S:    77 VHKEDGDILASS-FPVDTQVAYILSLGVVKEFRKHGIGSLLLDSLKEHISTTAQDHCKAIYLHVLTTNNTAIHFYENRDFKQHHYLPYYYS 166
>gi|167038138|ref|YP_001665716.1| ribosomal-protein-alanine acetyltransferase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167039151|ref|YP_001662136.1| ribosomal-protein-alanine acetyltransferase [Thermoanaerobacter sp. X514] >gi|166853391|gb|ABY91800.1| ribosomal-protein-alanine acetyltransferase [Thermoanaerobacter sp. X514] >gi|166856972|gb|ABY95380.1| ribosomal-protein-alanine acetyltransferase [Thermoanaerobacter pseudethanolicus ATCC 33223] (148 aa)
Score = 100, Expect = 5.6e-03, Identities = 33/95 (34%), Positives = 51/95 (53%)
  Q:    46 YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           Y +   DNK I+GY  F+    E  I  I V   YR+K IGS ++  L     K    ++ LEV + + T  + Y K  F+ + +R  YY DN++  ++ W
  S:    45 YIVAEVDNK-IVGYGGFWVVVDEGHITNIAVHPEYRSKGIGSKIMEGLIDLAKKNGITAMTLEVRESNITAQHLYAKYGFRQLGRRKGYYQDNNEDAIIMW 144
>gi|145618879|ref|ZP_01774934.1| ribosomal-protein-alanine acetyltransferase [Geobacter bemidjiensis Bem] >gi|144944805|gb|EDJ79875.1| ribosomal-protein-alanine acetyltransferase [Geobacter bemidjiensis Bem] >gi|197088140|gb|ACH39411.1| ribosomal-protein-alanine acetyltransferase [Geobacter bemidjiensis Bem] (149 aa)
Score = 100, Expect = 5.7e-03, Identities = 33/88 (37%), Positives = 45/88 (51%)
  Q:    52 DNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNL----LSYLKENYKSI-FLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           DN  + GY        EAEI  + V  S+R K IG  L    L + +E+  S+ FLEV +     I  Y    F+   +R NYY +  DA LM+
  S:    43 DNGTLTGYLCLKLVLDEAEILDVAVGNSHRGKGIGRLLVQWALDFSREHGASVLFLEVRAGNAEAIALYRSFGFRESGRRKNYYDNGEDAILME 136
>gi|118595270|ref|ZP_01552617.1| ribosomal-protein-alanine acetyltransferase [Methylophilales bacterium HTCC2181] >gi|118441048|gb|EAV47675.1| ribosomal-protein-alanine acetyltransferase [Methylophilales bacterium HTCC2181] (149 aa)
Score = 100, Expect = 5.8e-03, Identities = 35/116 (30%), Positives = 65/116 (56%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK-----SIFLEVSDRD-NTINFYLKNNFKVIHKRDNYY 129
           +L  +V +E+++   + +T++N    L ++N + + + D+  I+GY +      E +I  I +    +NK +G  L++++K+  K     SIFLEV   +   I  Y KN F  +  R+NYY
  S:    14 DLAIVVLIEKDVHF-SPWTIQNFQDALAAKNIFKVFFLDD-MIVGYYIALLASDECQILNIAIKKCQQNKGLGHYLINHVKDLSKSLYVASIFLEVRVSNIKAIKLYEKNGFNELGVRNNYY 133
>gi|148664796|gb|EDK97212.1| mCG126176 [Mus musculus] (662 aa)
Score = 100, Expect = 6.0e-03, Identities = 34/82 (41%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           I+K++  IL    F  + Q A I  +GVV  +R   IGS LL  LK++         K+I+L V   +NT INFY   +F+  H    YYS
  S:    77 IHKEDGDILASS-FSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFRQHHYLPYYYS 166
>gi|55821743|ref|YP_140185.1| ribosomal-protein-alanine acetyltransferase [Streptococcus thermophilus LMG 18311] >gi|55823663|ref|YP_142104.1| ribosomal-protein-alanine acetyltransferase [Streptococcus thermophilus CNRZ1066] >gi|55737728|gb|AAV61370.1| ribosomal-protein-alanine acetyltransferase [Streptococcus thermophilus LMG 18311] >gi|55739648|gb|AAV63289.1| ribosomal-protein-alanine acetyltransferase [Streptococcus thermophilus CNRZ1066] (151 aa)
Score = 100, Expect = 6.0e-03, Identities = 32/129 (24%), Positives = 62/129 (48%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSD-NSDAFLMK 139
           S+ +   I  +  +++  + +TLE + + L           + ++++G+        E E+  I V+ +Y+ +   S L+ YL+E  + IFLEV   +      Y K  F+ +  R NYY +   DA +M+
  S:    17 SQEQAQLIYQILSDVYDKSPWTLEQVVADLALDTTEYFYVYNQEEVVGFLALQNLVGEIEVTNIAVLKAYQGRGYASQLMKYLEERSEPIFLEVRASNQVAQALYRKFGFESLGIRKNYYHEPQEDAVIMR 147
>gi|15922398|ref|NP_378067.1| hypothetical protein ST2077 [Sulfolobus tokodaii str. 7] >gi|15623187|dbj|BAB67176.1| 152aa long conserved hypothetical protein [Sulfolobus tokodaii str. 7] (152 aa)
Score = 100, Expect = 6.4e-03, Identities = 40/130 (30%), Positives = 65/130 (50%)
  Q:     9 NISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCL-FFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSI-----FLEVSDRDNT-INFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           N+ E++L ++  +E E F  + Y    L ++        L+ K    I+GY L   +      +  I V   YR K IGS LL  L++ +K       +LEV+ ++ T I FY K  + ++  + NYY     AF+M
  S:     6 NVDENDLPKVYEVEVESF-EDPYPYSLLKAYYYLSRELFLVAKQGDDIVGYSLGIIQFGYRGHVVSIAVKKDYREKGIGSLLLKELEKRFKEYKCTHSYLEVNFKNKTAIEFYHKLGYIIVKLQKNYYGRGKHAFIM 141
>gi|169189331|ref|ZP_02849332.1| ribosomal-protein-alanine acetyltransferase [Paenibacillus sp. JDR-2] >gi|169003912|gb|EDS50775.1| ribosomal-protein-alanine acetyltransferase [Paenibacillus sp. JDR-2] (161 aa)
Score = 100, Expect = 6.4e-03, Identities = 39/132 (29%), Positives = 68/132 (51%)
  Q:     9 NISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNF-YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-------NYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           +++ +++  IV +E E F    +T E   + L S  F   ++ + N QI+GY   +    EA +  I V   +R + +G  LL+ L+        N  ++ + VS+ +   + Y K  FK    R  YYSDN++  L+ W
  S:     9 SMTMADIPFIVDIEHEAFA-TPWTPEAFKNELTSNMFARYMVMEHNGQIIGYGGMWVIVDEAHVTNIAVRADHRGQGLGERLLTELQRTAAFFGANKMTLEVRVSN-EIAQSLYRKLGFKPSGIRPAYYSDNNEDALIMW 146
>gi|109127395|ref|XP_001094891.1| PREDICTED: similar to CG18177-PB, isoform B [Macaca mulatta] >gi|90078466|dbj|BAE88913.1| unnamed protein product [Macaca fascicularis] (242 aa)
Score = 99, Expect = 7.3e-03, Identities = 34/82 (41%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           I+K++  IL    F  + Q A I  +GVV  +R   IGS LL  LK++         K+I+L V   +NT I+FY   +FK  H    YYS
  S:    77 IHKEDGDILASS-FSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAISFYENRDFKQHHYLPYYYS 166
>gi|85711410|ref|ZP_01042469.1| Acetyltransferase domain (GNAT family) fused peptidase domain (C39 family) protein [Idiomarina baltica OS145] >gi|85694911|gb|EAQ32850.1| Acetyltransferase domain (GNAT family) fused peptidase domain (C39 family) protein [Idiomarina baltica OS145] (377 aa)
Score = 99, Expect = 7.6e-03, Identities = 31/127 (24%), Positives = 65/127 (51%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGY--CLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKEN---YKSIFL--EVSDRDNTI-NFYLKNNFKVIHKRDNYY----SDNSDAFLMK 139
           + L+ +V LE+  F  +  +  +   F+ES      +  ++K+++GY   LF  N   A +Y + +   +R    G  LL + ++      S+FL  EV+  +      ++   F+ +  R+ Y+    S + DA +++
  S:    10 THLDSVVQLEKATFPDDAISKRSFRRFIESNTADFFVMLNDKRVVGYYVVLFRNNTNLARLYALVLSPQFRGSGFGKQLLQHAEDRADLRHSLFLRTEVATSNQLAQQLFINAGFRAVELREAYFPPSASQSQDALILQ 148
>gi|124523183|ref|ZP_01697416.1| ribosomal-protein-alanine acetyltransferase [Bacillus coagulans 36D1] >gi|124495681|gb|EAY43348.1| ribosomal-protein-alanine acetyltransferase [Bacillus coagulans 36D1] (114 aa)
Score = 99, Expect = 8.1e-03, Identities = 30/94 (31%), Positives = 55/94 (58%)
  Q:    48 LIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGS----NLLSYLKENY-KSIFLEVSDRDNTI--NFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           L+  +N++++GYC  +    EA +  + V+  YR +K+G     N+++Y   N+ K++ LEV    N I  + Y K  F+    R  YY+DN +  ++ W+
  S:    13 LVLVENEKVIGYCGVWVIVDEAHVTNLAVLPEYRGRKLGETLLKNVMAYAALNHAKTLSLEVR-VSNMIARSLYRKLGFREGGIRKGYYTDNYEDAIVMWV 112
>gi|145956070|ref|ZP_01805067.1| hypothetical protein CdifQ_04000169 [Clostridium difficile QCD-32g58] >gi|168696111|ref|ZP_02728388.1| putative ribosomal-protein-alanine acetyltransferase [Clostridium difficile QCD-37x79] >gi|168725484|ref|ZP_02757761.1| putative ribosomal-protein-alanine acetyltransferase [Clostridium difficile QCD-76w55] >gi|168733399|ref|ZP_02765676.1| putative ribosomal-protein-alanine acetyltransferase [Clostridium difficile QCD-97b34] >gi|196159405|ref|ZP_03119966.1| putative ribosomal-protein-alanine acetyltransferase [Clostridium difficile CIP 107932] (158 aa)
Score = 99, Expect = 8.2e-03, Identities = 37/131 (28%), Positives = 66/131 (50%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           ++  +++E+  +E+  F  + ++ E+    L ++    ++ K N +I+GY   +    E  I  + V   YR KKIG  L+  + +     N  S+ LEV   +    N Y K  FK+   R  YYSDN +  ++ W
  S:    17 MTTEDIDEVFEVEKNCF-EDYWSKESFRKELSNEVARYIVAKLNGKIVGYVGIWLILDEGHINNVAVHSDYRGKKIGDKLIKCIVDLCKDNNIASMTLEVRASNKIAQNLYRKYGFKMGGIRKEYYSDNKEDAIIMW 152
>gi|50755966|ref|XP_414956.1| PREDICTED: hypothetical protein [Gallus gallus] (242 aa)
Score = 99, Expect = 8.2e-03, Identities = 34/82 (41%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           ++K++  IL    F  + Q A I  +GVV  +R   IGS LL  LK++         K+I+L V   +NT INFY   +FK  H    YYS
  S:    77 VHKEDGDILA-SNFPLDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFKQHHYLPYYYS 166
>gi|126335271|ref|XP_001370249.1| PREDICTED: hypothetical protein [Monodelphis domestica] (242 aa)
Score = 99, Expect = 8.5e-03, Identities = 34/82 (41%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           ++K++  IL    F  + Q A I  +GVV  +R   IGS LL  LK++         K+I+L V   +NT INFY   +FK  H    YYS
  S:    77 VHKEDGDILA-SNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFKQHHYLPYYYS 166
>gi|115497156|ref|NP_001069117.1| hypothetical protein LOC514154 [Bos taurus] >gi|122145747|sp|Q17QK9|NATU_BOVIN N-acetyltransferase UNQ2771/PRO7155 homolog >gi|109658456|gb|AAI18299.1| Hypothetical protein LOC514154 [Bos taurus] (242 aa)
Score = 99, Expect = 8.8e-03, Identities = 34/82 (41%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           I+K++  IL    F  + Q A I  +GVV  +R   IGS LL  LK++         K+I+L V   +NT I+FY   +FK  H    YYS
  S:    77 IHKEDGDILASS-FSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAISFYENRDFKQHHYLPYYYS 166
>gi|193787256|dbj|BAG52462.1| unnamed protein product [Homo sapiens] (177 aa)
Score = 99, Expect = 8.9e-03, Identities = 35/82 (42%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           I+K++  IL    F  + Q A I  +GVV  +R   IGS LL  LK++         K+I+L V   +NT INFY   +FK  H    YYS
  S:    12 IHKEDGDILA-SNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFKQHHYLPYYYS 101
>gi|83645391|ref|YP_433826.1| acetyltransferase [Hahella chejuensis KCTC 2396] >gi|83633434|gb|ABC29401.1| Acetyltransferase [Hahella chejuensis KCTC 2396] (388 aa)
Score = 99, Expect = 8.9e-03, Identities = 28/123 (22%), Positives = 62/123 (50%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYC--LFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE---NYKSIFLEV---SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAF 136
           +L+E+V LE+  F  +  +  +    ++S++   ++ + ++++ GY   LF      A +Y I +    R K +   L+   ++   + + IF+ +   +D    I  Y K  ++      +YY D+ DA+
  S:    24 DLDELVELEESCFTTDRLSRRSFRHMIKSESASVVLCEMDEKLCGYAITLFHRGTSLARLYSIAIAPESRGKGVARALMDMAEQSAISRRCIFMRLEVRTDNQEAIGLYKKLGYRQFGVYHDYYEDHRDAY 154
>gi|47216900|emb|CAG02072.1| unnamed protein product [Tetraodon nigroviridis] (260 aa)
Score = 99, Expect = 9.1e-03, Identities = 33/82 (40%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           ++K++  IL    F  + Q A I  +GVV  +R   IGS LL  LKE+         K+I+L V   +NT I+FY   +F+  H    YYS
  S:    77 VHKEDGDILASS-FPVDTQVAYILSLGVVKEFRKHGIGSLLLDSLKEHISTTAQDHCKAIYLHVLTTNNTAIHFYESRDFRQHHYLPYYYS 166
>gi|76802628|ref|YP_327636.1| hypothetical protein NP3988A [Natronomonas pharaonis DSM 2160] >gi|76558493|emb|CAI50085.1| conserved hypothetical protein [Natronomonas pharaonis DSM 2160] (165 aa)
Score = 98, Expect = 9.4e-03, Identities = 21/88 (23%), Positives = 50/88 (56%)
  Q:    52 DNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           D++Q++G   F    ++  I  + V  +YR++  GS L++ + +++ S+     +  +  ++FY    F++  + D+YY D+ DA+ ++
  S:    62 DDEQLVG---FAATRRDGYILFLAVDPNYRDRGFGSQLVAAVADDHSSVTCHARTTNEPALDFYRSLGFEIERRIDDYYEDHGDAYYLR 147
>gi|126697723|ref|YP_001086620.1| putative ribosomal-protein-alanine acetyltransferase [Clostridium difficile 630] >gi|168711626|ref|ZP_02743903.1| putative ribosomal-protein-alanine acetyltransferase [Clostridium difficile QCD-63q42] >gi|196127066|ref|ZP_03118815.1| putative ribosomal-protein-alanine acetyltransferase [Clostridium difficile ATCC 43255] >gi|115249160|emb|CAJ66971.1| putative ribosomal-protein-alanine acetyltransferase [Clostridium difficile 630] (158 aa)
Score = 98, Expect = 9.5e-03, Identities = 37/131 (28%), Positives = 66/131 (50%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           ++  +++E+  +E+  F  + ++ E+    L ++    ++ K N +I+GY   +    E  I  + V   YR KKIG  L+  + +     N  S+ LEV   +    N Y K  FK+   R  YYSDN +  ++ W
  S:    17 MTTEDIDEVFEVEKNCF-EDYWSKESFRKELSNEVARYIVAKLNGKIVGYVGIWLILDEGHINNVAVHSDYRGKKIGDKLIKGIVDLCKDNNIASMTLEVRASNKIAQNLYRKYGFKMGGIRKEYYSDNKEDAIIMW 152
>gi|167751304|ref|ZP_02423431.1| hypothetical protein EUBSIR_02290 [Eubacterium siraeum DSM 15702] >gi|167655811|gb|EDR99940.1| hypothetical protein EUBSIR_02290 [Eubacterium siraeum DSM 15702] (162 aa)
Score = 98, Expect = 9.7e-03, Identities = 28/72 (38%), Positives = 42/72 (58%)
  Q:    68 EAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDN-SDAFLMK 139
           E E+Y+I V+  YR++ I + L+ Y          KSIFLEV  D +     Y K+ F  + +R NYY++   DA + K
  S:    81 ECELYRIAVLPEYRHQCIATQLMEYFINKCKNNGIKSIFLEVRCDNEPAKKLYEKHGFSEVGRRRNYYTEPICDALIYK 159
>gi|169824914|ref|YP_001692525.1| putative o-sialoglycoprotein endopeptidase [Finegoldia magna ATCC 29328] >gi|167831719|dbj|BAG08635.1| putative o-sialoglycoprotein endopeptidase [Finegoldia magna ATCC 29328] (483 aa)
Score = 98, Expect = 1.0e-02, Identities = 33/116 (28%), Positives = 65/116 (56%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYY 129
           +L+++V +E+E F  + ++     + L+++  +  + ++  +I+G   F     EAE++ I V  S RN+ I +  + ++     KEN  +IFLEV + +   IN Y K  F+   + + YY
  S:    10 DLDDVVEIEKESF-SDAWSKIGYEACLKNEFNHYFVGENKGEIVGAFGFSVVVDEAELHTISVKKSCRNQGIATEFIKFMLDFCKKENVNNIFLEVRESNFEAINLYTKFGFQKNGRINGYY 130
>gi|154502858|ref|ZP_02039918.1| hypothetical protein RUMGNA_00678 [Ruminococcus gnavus ATCC 29149] >gi|153796397|gb|EDN78817.1| hypothetical protein RUMGNA_00678 [Ruminococcus gnavus ATCC 29149] (396 aa)
Score = 98, Expect = 1.1e-02, Identities = 34/121 (28%), Positives = 61/121 (50%)
  Q:    18 IVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLK---ENYK--SIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNS-DAFLM 138
           +  +EQ+IF  + ++ +++   ++ +   C   +    +LGY L +    EAEI +I V    R +     L+  L+   E +K   + L+V + +    +FY KN F     R  +Y + S DA LM
  S:   262 VAEMEQQIF-SDSWSEKSVLETVQQKQSVCFAAEKAGHLLGYLLAYHAADEAEIARIAVQKEARRQGAAGKLMQALEHYCEEHKMEKLLLDVRESNEAARSFYTKNGFVEDGIRQGFYVNPSEDAVLM 388
>gi|70605923|ref|YP_254793.1| acetyltransferase [Sulfolobus acidocaldarius DSM 639] >gi|68566571|gb|AAY79500.1| acetyltransferase [Sulfolobus acidocaldarius DSM 639] (154 aa)
Score = 98, Expect = 1.1e-02, Identities = 38/127 (29%), Positives = 62/127 (48%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCL-FFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK------SIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           E +L EI  +E E F  N Y    L ++        ++ K   +++GY L   +      I  I V    R   IG+ L+S L+  +K        +LEV  ++ + INFY+KN +K +  + +YY     A +M
  S:     9 EEDLPEIYDVELESF-DNPYPFSLLRAYYYISGDLFIVAKSGDKVIGYILGIIQFGYRGHIVSIAVKKDKRGSGIGTKLISELENRFKLAYHCIHSYLEVYYKNISAINFYIKNGYKAVRIQKDYYGREKHAIIM 142
>gi|24378881|ref|NP_720836.1| putative ribosomal-protein-alanine acetyltransferase [Streptococcus mutans UA159] >gi|24376762|gb|AAN58142.1|AE014886_3 putative ribosomal-protein-alanine acetyltransferase [Streptococcus mutans UA159] (144 aa)
Score = 98, Expect = 1.1e-02, Identities = 29/88 (32%), Positives = 47/88 (53%)
  Q:    52 DNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSD-NSDAFLMK 139
           D+K+I+G+        E E+  I +  +Y+ + +GS LL+ L ++   IFLEV   +      Y K  F+ +  R +YY +   DA LMK
  S:    48 DDKEIVGFLSIQHLVGELELTNIAIKKAYQGQGLGSQLLAMLTKDELPIFLEVRASNQAAQALYQKFGFRSLTTRKDYYHNPKEDAILMK 137
>gi|118048847|ref|ZP_01517419.1| ribosomal-protein-alanine acetyltransferase [Chloroflexus aggregans DSM 9485] >gi|117994645|gb|EAV08914.1| ribosomal-protein-alanine acetyltransferase [Chloroflexus aggregans DSM 9485] (220 aa)
Score = 97, Expect = 1.2e-02, Identities = 28/85 (32%), Positives = 44/85 (51%)
  Q:    56 ILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-------KENYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           I GY   + NE+   I  I V   +R + +G  LL+ L          Y S+ + VS+       YLK  F+ + +R +YY+DN +  L+ W
  S:    87 IAGYGGIWLNERSGHITTIAVAPDHRRRGVGELLLNALIDGAYELNAEYLSLEVRVSNLAAQ-RLYLKYGFRPVGQRPHYYTDNQEDALVMW 177
>gi|13540845|ref|NP_110533.1| N-terminal acetyltransferase complex, Ard1 subunit [Thermoplasma volcanium GSS1] (151 aa)
Score = 97, Expect = 1.3e-02, Identities = 28/71 (39%), Positives = 39/71 (54%)
  Q:    68 EAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           EA I    V   +R   +GS L+        ++N  S+ LEV +D D  I FY K  F +     NYYSD+S+A+ M
  S:    71 EARILLFAVDERFRRMGVGSALMDAFLSLCREQNMLSVRLEVRTDNDEAIRFYKKYGFVITAMLPNYYSDSSNAYTM 147
>gi|114562468|ref|YP_749981.1| GCN5-related N-acetyltransferase [Shewanella frigidimarina NCIMB 400] >gi|114333761|gb|ABI71143.1| GCN5-related N-acetyltransferase [Shewanella frigidimarina NCIMB 400] (364 aa)
Score = 97, Expect = 1.3e-02, Identities = 33/128 (25%), Positives = 62/128 (48%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCL--FFENEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           + S+L ++  +E   F  +  +   +  F+ S     L+ + +  + GY L  F    + A +Y I V   +R + I   L++      ++  + ++ LEV +D     N YLK  +KV+    +YY D +D   M
  S:     7 TPSDLPQLNHIENNAFSGDKISSRQMKRFINSPLDSLLVAEIDGTLAGYALVLFHRGTRLARLYSIAVASEFRGRNIAFELVTQCEHTVVERGFITLRLEVRNDNIAAKNLYLKMGYKVLKTLVHYYDDLADGVRM 142
>gi|162147190|ref|YP_001601651.1| putative acetyltransferase protein [Gluconacetobacter diazotrophicus PAl 5] >gi|187598683|ref|ZP_02984933.1| GCN5-related N-acetyltransferase [Gluconacetobacter diazotrophicus PAl 5] >gi|161785767|emb|CAP55338.1| putative acetyltransferase protein [Gluconacetobacter diazotrophicus PAl 5] >gi|187489199|gb|EDU27150.1| GCN5-related N-acetyltransferase [Gluconacetobacter diazotrophicus PAl 5] (166 aa)
Score = 97, Expect = 1.4e-02, Identities = 26/71 (36%), Positives = 39/71 (54%)
  Q:    68 EAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSDAFLM 138
           EAEI  + V  + R + +G  LL +L         + + LEVSDR+      Y    F  I +R  YY+D +DAF++
  S:    78 EAEILTLAVSGAARRQGLGRALLDWLGAQAVTRGARRLVLEVSDRNQAARALYGAAGFAEIGRRRAYYADGADAFVL 154
>gi|163816080|ref|ZP_02207450.1| hypothetical protein COPEUT_02260 [Coprococcus eutactus ATCC 27759] >gi|158448890|gb|EDP25885.1| hypothetical protein COPEUT_02260 [Coprococcus eutactus ATCC 27759] (142 aa)
Score = 97, Expect = 1.4e-02, Identities = 32/117 (27%), Positives = 60/117 (51%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYS 130
           ++  I +LE E F  N +TLE + S + S   +  + + +    GY ++      A++ ++     YR + IG++L+  +     K   ++IFLEV   +   I  Y +  F+ I +R  YY+
  S:     6 KIKNIAALECEAF-SNPWTLEMIQSSMASDFDHVEVMEKDGIFQGYIIYSVVCDSADLLRVAAKSEYRRQGIGTSLMEMMIKDCEKSGVQNIFLEVRQSNAPAIGMYGRFGFQEISRRKRYYT 127
>gi|39933528|ref|NP_945804.1| ribosomal-protein-alanine acetyltransferase [Rhodopseudomonas palustris CGA009] >gi|192288886|ref|YP_001989491.1| ribosomal-protein-alanine acetyltransferase [Rhodopseudomonas palustris TIE-1] >gi|39647374|emb|CAE25895.1| putative RimI protein, peptide N-acetyltransferase [Rhodopseudomonas palustris CGA009] >gi|192282635|gb|ACE99015.1| ribosomal-protein-alanine acetyltransferase [Rhodopseudomonas palustris TIE-1] (161 aa)
Score = 97, Expect = 1.4e-02, Identities = 28/103 (27%), Positives = 49/103 (47%)
  Q:    27 LHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSN-LLSYL----KENYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYY 129
            H G+  +     L  +N      +  ++I+G+        EAEI  I V  SYR + +    LL++L         ++FLEV + +      Y +  F+V+ +R+ YY
  S:    35 FHRGWDEQEFADLLSERNTLVHRLRVGRRIIGFVASRIGADEAEILSIAVAASYRGRGLSREMLLTHLGHLAGRGVATVFLEVEENNQPARRLYNRTGFQVVGRRERYY 143
>gi|14324228|dbj|BAB59156.1| N-terminal acetyltransferase complex subunit [ARD1] [Thermoplasma volcanium GSS1] (154 aa)
Score = 97, Expect = 1.4e-02, Identities = 28/71 (39%), Positives = 39/71 (54%)
  Q:    68 EAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           EA I    V   +R   +GS L+        ++N  S+ LEV +D D  I FY K  F +     NYYSD+S+A+ M
  S:    74 EARILLFAVDERFRRMGVGSALMDAFLSLCREQNMLSVRLEVRTDNDEAIRFYKKYGFVITAMLPNYYSDSSNAYTM 150
>gi|124026197|ref|YP_001015313.1| putative ribosomal-protein-alanine acetyltransferase [Prochlorococcus marinus str. NATL1A] >gi|123961265|gb|ABM76048.1| putative ribosomal-protein-alanine acetyltransferase [Prochlorococcus marinus str. NATL1A] (151 aa)
Score = 97, Expect = 1.5e-02, Identities = 46/129 (35%), Positives = 63/129 (48%)
  Q:    10 ISESELNEIVSLEQEIFLHNG-YTLENLNSFLESQNFYCLIYKD--NKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSDAFLM 138
           + E  LN+ V L+Q+    NG ++       L      CL  K+   K++LG C  +    E  I  I V    + K IG  LLS L +  KS     IFLEV   + +    Y    FK + KR N+Y D SDA L+
  S:     8 LREMHLNDCVDLDQKS--SNGLWSKSQWKKELTDPKRICLGVKELQTKKLLGLCSAWLVIDELHITFIAVDPMNQRKGIGKFLLSDLIKRSKSLQINHIFLEVKQNNESAKALYNSMGFKTVGKRSNFYQDGSDALLL 143
>gi|160941598|ref|ZP_02088929.1| hypothetical protein CLOBOL_06498 [Clostridium bolteae ATCC BAA-613] >gi|158435492|gb|EDP13259.1| hypothetical protein CLOBOL_06498 [Clostridium bolteae ATCC BAA-613] (149 aa)
Score = 97, Expect = 1.5e-02, Identities = 36/131 (27%), Positives = 62/131 (47%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSF-LESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           ++  ++ ++  LEQ  F  +    ENL    L+S+     +Y D+  ILGY +      E EI +IGV   YR + I   L+  +         ++I LEV + +    N Y    F+    R  YY + ++  ++ W
  S:    10 MTGQDIEQVADLEQVCFSESWS--ENLIRMGLDSRLDTYFVYADHGTILGYAVLRILADEGEIQRIGVYPHYRRQGIARKLMDAMVTFARARGVRAIALEVRESNLGARNLYDSYGFRQEAVRKGYYHNPAEDAIIMW 145
>gi|115522238|ref|YP_779149.1| ribosomal-protein-alanine acetyltransferase [Rhodopseudomonas palustris BisA53] >gi|115516185|gb|ABJ04169.1| ribosomal-protein-alanine acetyltransferase [Rhodopseudomonas palustris BisA53] (161 aa)
Score = 97, Expect = 1.5e-02, Identities = 30/110 (27%), Positives = 58/110 (52%)
  Q:    30 GYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNL----LSYLK-ENYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYY----SDNSDAFLMK 139
           G++ E     L  +N      +  ++I+G+ +      EAEI  I +  +YR +++  +L    LS+L     +++FLEV + +      Y  + F+V+ +R+ YY        +A LM+
  S:    38 GWSEEEFEDMLSQRNTLVHRLRLGRRIIGFIVSRIGADEAEILSIAIDPAYRGRRLSRDLLRTHLSHLAGRGVRTLFLEVEENNQPARRLYDHSGFEVVGRRERYYRQPDGQQLNALLMR 157
>gi|149587412|ref|XP_001520254.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus] (213 aa)
Score = 96, Expect = 1.6e-02, Identities = 34/82 (41%), Positives = 47/82 (57%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY--------KSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYS 130
           ++K++  IL    F  + Q A I  +GVV  +R   IGS LL  LK++         K+I+L V   +NT INFY   +FK  H    YYS
  S:    48 VHKEDGDILA-SNFPVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFKQHHYLPYYYS 137
>gi|15679017|ref|NP_276134.1| N-terminal acetyltransferase complex, subunit ARD1 [Methanothermobacter thermautotrophicus str. Delta H] >gi|2622100|gb|AAB85496.1| N-terminal acetyltransferase complex, subunit ARD1 [Methanothermobacter thermautotrophicus str. Delta H] (156 aa)
Score = 96, Expect = 1.6e-02, Identities = 29/92 (31%), Positives = 51/92 (55%)
  Q:    48 LIYKDNKQILGYCLFF-ENEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           L+ +++ +++G+ +F+   E E  I  + V   YR + +G+ L+      + K + K+I LEV  R+   I FY    F      +NYY D  DA +M+
  S:    42 LVAQEDGKVVGFIIFWIRFEDEGHIISLAVDKDYRRRGVGAALVMTAISIFEKFHIKNIKLEVRARNKGAIKFYRALGFSEEKILENYYEDGEDAVVMR 140
>gi|75907134|ref|YP_321430.1| ribosomal-protein-alanine acetyltransferase [Anabaena variabilis ATCC 29413] >gi|75700859|gb|ABA20535.1| Ribosomal-protein-alanine acetyltransferase [Anabaena variabilis ATCC 29413] (184 aa)
Score = 96, Expect = 1.7e-02, Identities = 41/141 (29%), Positives = 72/141 (51%)
  Q:     1 MITLKNK-NNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCL-IYKDNK--QILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           MI+ K K  +++  +L+ I+ L+Q  F    +T+E     L+S N   L ++  +   ++LG   F+    EA I  + V   Y ++ +G  LL +L         +   LEV +  +  I+ Y K  F+   +R  YY DN +  L+ W+
  S:     1 MISSKLKLQSLTSKDLSAILELDQACF-GGLWTMEGYQRELDSPNSDLLGLFSPSSPIKLLGMGCFWSIVGEAHITILAVHPQYHHQGLGQALLYFLLRTASDRGLERATLEVRASNEAAISLYQKFGFQTAGRRRAYYQDNGEDALILWL 150
>gi|73668494|ref|YP_304509.1| SSU ribosomal protein S18P alanine acetyltransferase [Methanosarcina barkeri str. Fusaro] >gi|72395656|gb|AAZ69929.1| SSU ribosomal protein S18P alanine acetyltransferase [Methanosarcina barkeri str. Fusaro] (176 aa)
Score = 96, Expect = 1.7e-02, Identities = 35/126 (27%), Positives = 60/126 (47%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFEN-EQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           +  E++ +E E F  +   L    SF E+     LI + + +++GY + + + E E  I+ IGV   YR + IG++L+      ++    +   LEV + +      Y    F        YYSD  D  +MK
  S:     9 DFQEVIEIESEAFSEHNSLL--YMSFYETVGDGFLIAEQDGKVMGYVVGYRSGENEGHIFSIGVKEEYRGRGIGTSLIHAICDIFVANGLRYARLEVRNSNKGAQKLYRSIGFVPCWTEKKYYSDGEDGMVMK 139
>gi|91974727|ref|YP_567386.1| ribosomal-protein-alanine acetyltransferase [Rhodopseudomonas palustris BisB5] >gi|91681183|gb|ABE37485.1| ribosomal-protein-alanine acetyltransferase [Rhodopseudomonas palustris BisB5] (161 aa)
Score = 96, Expect = 1.7e-02, Identities = 26/103 (25%), Positives = 50/103 (48%)
  Q:    27 LHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSN-LLSYL----KENYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYY 129
            H+G++ E     L  +N      +  ++I+G+        EAEI  + V   YR + +    LL++L          +FLEV + +      Y ++ F+++ +R+ YY
  S:    35 FHSGWSEEEFADLLSQRNTLVHRLRMGRRIIGFIASRFGADEAEILSVAVASGYRGRGLSRELLLTHLGHLAGRGVAKVFLEVEENNQPARRLYQRSGFEIVGRRERYY 143
>gi|15896095|ref|NP_349444.1| acetyltransferase [Clostridium acetobutylicum ATCC 824] >gi|15025884|gb|AAK80784.1|AE007781_7 Predicted acetyltransferase [Clostridium acetobutylicum ATCC 824] (146 aa)
Score = 96, Expect = 1.7e-02, Identities = 40/133 (30%), Positives = 65/133 (48%)
  Q:     8 NNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDNTI--NFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           + + + +++ I+ +E   F    +T E++   L ++    ++ K+N  ++GY   +    E  I  I V   +R   IG+ +L  L     K N  S+ LEV    NTI  N Y K  FK    R  YY DN +  L+ W
  S:     7 HTLEKDDIDSIIEIENLCF-PTPWTKESMEGELRNKFAKYVVIKNNNLVVGYGGLWLIIDEGHITNIAVHPEFRGMGIGNKILEELIKLCEKRNIPSMTLEVR-ISNTIAQNLYKKFGFKEAGVRKKYYGDNDEDALIMW 144
>gi|171324891|ref|ZP_02913402.1| ribosomal-protein-alanine acetyltransferase [Geobacillus sp. WCH70] >gi|171089166|gb|EDT35500.1| ribosomal-protein-alanine acetyltransferase [Geobacillus sp. WCH70] (150 aa)
Score = 96, Expect = 1.7e-02, Identities = 31/95 (32%), Positives = 50/95 (52%)
  Q:    48 LIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK-----SIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWIK 142
           ++ + N +I+GY   +    EA I  + V+  YR KK+G  L+  L E  K     ++ LEV   ++   + Y K  F     R +YY DN +  L+ W+K
  S:    48 IVMEHNGRIIGYAGMWVVIDEAHITNVAVLPEYRGKKLGEALMRKLMETAKQLGAVTMTLEVRVSNHVAQSLYRKLGFLNGGIRRHYYPDNLEDALVMWVK 148
>gi|152995866|ref|YP_001340701.1| GCN5-related N-acetyltransferase [Marinomonas sp. MWYL1] >gi|150836790|gb|ABR70766.1| GCN5-related N-acetyltransferase [Marinomonas sp. MWYL1] (381 aa)
Score = 96, Expect = 1.8e-02, Identities = 37/129 (28%), Positives = 57/129 (44%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFF--ENEQEAEIYKIGVVYSYRNKKIGSNLLSY-----LKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           S  +L E++ LE + F  +  +  +    + S      +      +LGY L    +    A +Y + V    R   IG  L+       LK+    + LEVSD + N I  Y K  +K     D YY D +DA  M+
  S:    19 SIDDLKELLVLEGKAFTGDRLSRRSFRHAITSSGSALFVAMQEGGLLGYALLHLRQGTHLARLYSLAVSPEARGLGIGKLLIQACEKKALKKGKMLLRLEVSDVNHNAIALYQKMGYKEFGHYDAYYEDQTDAIRMQ 155
>gi|167939696|ref|ZP_02526771.1| ribosomal-protein-alanine N-acetyltransferase [Bacillus cereus AH1134] (147 aa)
Score = 96, Expect = 1.8e-02, Identities = 36/128 (28%), Positives = 69/128 (53%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLE-SQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL----SYLKE-NYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           ++ +IV++E+  F    +T +  +  L  +++ + L+ + + +++GYC  +    E+ I  I ++  YR +K+G  LL    S  KE   K++ LEV   +      Y K  F+    R  YY+DN +  L+ W+
  S:    12 DIAQIVAIEEASF-STPWTADAFHRELTMNEHAHYLVLEKDGRVVGYCGLWIIIDESHITNIAILPEYRGQKLGDALLKAVISEAKELGVKTMTLEVRVSNEVAKQLYRKYGFQNGGIRKRYYADNQEDGLVMWV 145
>gi|84702266|ref|ZP_01016841.1| Ribosomal-protein-alanine acetyltransferase [Parvularcula bermudensis HTCC2503] >gi|84691512|gb|EAQ17352.1| Ribosomal-protein-alanine acetyltransferase [Parvularcula bermudensis HTCC2503] (152 aa)
Score = 96, Expect = 1.9e-02, Identities = 27/73 (36%), Positives = 39/73 (53%)
  Q:    67 QEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           +EAEI   GV  S+R    G  LL YL     K     IFLEV++ ++  +  Y    F  + +R  YYSD   A +++
  S:    64 EEAEILTFGVAESHRRHGGGRALLHYLVAETEKAGVCRIFLEVAEENHAALKLYTGAAFHEVGRRHGYYSDGRHARILQ 142
>gi|170061259|ref|XP_001866158.1| N-acetyl transferase separation anxiety [Culex quinquefasciatus] >gi|167879559|gb|EDS42942.1| N-acetyl transferase separation anxiety [Culex quinquefasciatus] (212 aa)
Score = 96, Expect = 1.9e-02, Identities = 27/76 (35%), Positives = 50/76 (65%)
  Q:    64 ENEQEAEIYKIGVVYSYRNKKIGS----NLLSYLKE--NYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYS--DNSDAFLMK 139
           EN +   I  +G +Y YR   IGS    ++L+Y+++  N+ SIFL V  D +  I+FY +  F+++  + +YY   + +DA +++
  S:    67 ENMRRLYIMTLGCLYPYRRLGIGSVMVKHILNYVEKDGNFDSIFLHVKVDNEGAIDFYKQFGFEIVETKQHYYKRIEPADAHVLQ 151
>gi|123966413|ref|YP_001011494.1| putative ribosomal-protein-alanine acetyltransferase [Prochlorococcus marinus str. MIT 9515] >gi|123200779|gb|ABM72387.1| putative ribosomal-protein-alanine acetyltransferase [Prochlorococcus marinus str. MIT 9515] (145 aa)
Score = 96, Expect = 2.0e-02, Identities = 31/74 (41%), Positives = 43/74 (58%)
  Q:    68 EAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           EA+I    +   +R K  GS L++YL     K N + + LEVS+ +     FY K NF  + +R NYY D SDA L + I
  S:    63 EAQINYFSIKKGFRRKGYGSYLMNYLLKQCEKLNIQKLLLEVSETNLIAEVFYSKFNFLTVGRRKNYYKDGSDAVLKEKI 142
>gi|86747713|ref|YP_484209.1| ribosomal-protein-alanine acetyltransferase [Rhodopseudomonas palustris HaA2] >gi|86570741|gb|ABD05298.1| ribosomal-protein-alanine acetyltransferase [Rhodopseudomonas palustris HaA2] (161 aa)
Score = 95, Expect = 2.1e-02, Identities = 27/103 (26%), Positives = 49/103 (47%)
  Q:    27 LHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSN-LLSYL----KENYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYY 129
            H+G++ E     L  +N      +  ++I+G+        EAEI  I V   YR + +    LL++L          +FLEV + +      Y +  F+++ +R+ YY
  S:    35 FHSGWSEEEFADLLSQRNTLVHRLRMGRRIIGFIASRFGADEAEILSIAVASGYRGRGLSRELLLTHLGHLAGHGVAKVFLEVEENNQPARRLYQRAGFEIVGRRERYY 143
>gi|111023147|ref|YP_706119.1| acetyltransferase [Rhodococcus sp. RHA1] >gi|110822677|gb|ABG97961.1| acetyltransferase [Rhodococcus sp. RHA1] (159 aa)
Score = 95, Expect = 2.2e-02, Identities = 31/94 (32%), Positives = 49/94 (52%)
  Q:    46 YCLIYKDNKQILGYC----LFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS----IFLEV-SDRDNTINFYLKNNFKVIHKRDNYYS-DNSDAFLMK 139
           Y +   D   ++GY     L   +  E+EI+ IG   + + + IG  LL  L     +    +FLEV +D D  I  Y +  F+++  R  YY    +DAF M+
  S:    46 YTVARDDTGHVVGYAGIALLGDGSHPESEIHTIGTDPACQRRGIGGALLDELLRVADTRGGPVFLEVRTDNDAAIALYRREGFEIVGTRKKYYQPSGADAFTMR 149
>gi|94501175|ref|ZP_01307698.1| acetyltransferase, GNAT family protein [Oceanobacter sp. RED65] >gi|94426751|gb|EAT11736.1| acetyltransferase, GNAT family protein [Oceanobacter sp. RED65] (146 aa)
Score = 95, Expect = 2.2e-02, Identities = 41/138 (29%), Positives = 68/138 (49%)
  Q:     1 MITLKNKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLES---QNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK-----SIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDN---SDAFLM 138
           MIT+++   +  ++++ ++++E     H GY+     S  E     N Y  + +   +I GY +      EAE+  I V    R + +   LL +L +  K      +FLEV    D  I+ Y K+ F  I +R +YY       DA LM
  S:     1 MITIRS---MEINDIDVVINIE-----HQGYSFPWSRSLFEQAIHSNKYAAVIEYKNKICGYAVLSYVVGEAELLNICVDPKERGQGLAQTLLKHLMDEAKKAENHEMFLEVRPSNDAAIHIYQKHGFNEIGRRKDYYPTKGGREDALLM 142
>gi|163867523|ref|YP_001608722.1| ribosomal-protein-alanine acetyltransferase [Bartonella tribocorum CIP 105476] >gi|161017169|emb|CAK00727.1| ribosomal-protein-alanine acetyltransferase [Bartonella tribocorum CIP 105476] (163 aa)
Score = 95, Expect = 2.3e-02, Identities = 35/106 (33%), Positives = 58/106 (54%)
  Q:    34 ENLNSFLESQNFY---CLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS----YLKENYK-SIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNS---DAFLMK 139
           +  ++FL   + +     +   + QILG+CL      EAEI  I V   YR + IG+ L+     YL++     +FLEV   + + +N Y +  F+ I +R  YY   +   DA +M+
  S:    39 QAFDTFLTDHSIFGYKVFLIDHSDQILGFCLCRLILDEAEIITIAVHPHYRQQGIGTLLIDHTIHYLQDKRAIKLFLEVESTNLSALNLYQRFEFQKISERLAYYPSKNGRGDAIIMQ 156
>gi|91200468|emb|CAJ73516.1| conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] (383 aa)
Score = 95, Expect = 2.3e-02, Identities = 36/96 (37%), Positives = 51/96 (53%)
  Q:    40 LESQNFYCLIYKDN---------KQILGYCLFFENEQE--AEIYKIGVVYSYRNKKIGSNLLSYLKE---NYKSIFLEVSDRD---NTINFYLKNNFKVIHKRDNYYSDNSDA 135
           L  +NF  L+ K N           I GY +   N     A +Y   V   +RN+ IG  LL   ++   +Y  I + +  R+   N I FY KN +K I   D+YY D+ DA
  S:    40 LSRRNFRYLLTKANAITLAEIVDNAIRGYSIILYNTGTSLARLYSFAVDPDFRNQGIGKQLLEASEKAAIDYDCISMRLEVREDNYNAIQFYKKNGYKQIGVIDDYYEDHMDA 152
>gi|188997661|ref|YP_001931912.1| ribosomal-protein-alanine acetyltransferase [Sulfurihydrogenibium sp. YO3AOP1] >gi|188932728|gb|ACD67358.1| ribosomal-protein-alanine acetyltransferase [Sulfurihydrogenibium sp. YO3AOP1] (138 aa)
Score = 95, Expect = 2.4e-02, Identities = 37/98 (37%), Positives = 53/98 (54%)
  Q:    42 SQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           S+N    + + N QI+G+  +F    EAE++ I V   ++    G  LL YL     + N K  +LEVS +++  IN Y K  F     R+ YYS   DA LMK
  S:    32 SENNNPTVLEINGQIIGFLSYFYILDEAELFLIAVKKEFQGLGYGKILLEYLLNKLKENNVKVCYLEVSLKNSRAINLYKKLGFYEYGYREKYYSSLDDAILMK 135
>gi|121602482|ref|YP_989491.1| ribosomal-protein-alanine acetyltransferase [Bartonella bacilliformis KC583] >gi|120614659|gb|ABM45260.1| ribosomal-protein-alanine acetyltransferase [Bartonella bacilliformis KC583] (163 aa)
Score = 95, Expect = 2.5e-02, Identities = 32/85 (37%), Positives = 45/85 (52%)
  Q:    55 QILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSY-----LKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNS---DAFLMK 139
           QI G+CL      EAEI  I V   +R + IG  L+ +       E  K +FLEV + + + +  Y +  FK I KR  YY       DA +M+
  S:    63 QIFGFCLCRLILDEAEIITIAVHPHHRQQGIGYFLIDHTLRHLYHERAKKLFLEVEETNLSALALYQRFKFKKISKRLAYYPSKDGFVDAIIMQ 156
>gi|20093412|ref|NP_619487.1| acetyltransferase (GNAT) family protein [Methanosarcina acetivorans C2A] >gi|19918784|gb|AAM07967.1| acetyltransferase (GNAT) family protein [Methanosarcina acetivorans C2A] (177 aa)
Score = 95, Expect = 2.6e-02, Identities = 37/126 (29%), Positives = 59/126 (46%)
  Q:    14 ELNEIVSLEQEIFL-HNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFEN-EQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           +  EIV +E+E F  HN     N   F E      L+ +   +++GY + + + E E  I+ +GV   YR + IG+ L+      ++    K   LEV + + +    Y    F        YYSD  D  +MK
  S:    10 DFQEIVEIEEEAFSEHNSLVYMN---FYEMVGDGFLVAEKEGKVVGYVVGYRSAENEGHIFSVGVKKEYRGRGIGTELIYAICDIFVANGLKYARLEVRNSNTSAQKLYRSIGFVQCWTEKKYYSDGEDGMVMK 140
>gi|72382498|ref|YP_291853.1| putative ribosomal-protein-alanine acetyltransferase [Prochlorococcus marinus str. NATL2A] >gi|72002348|gb|AAZ58150.1| putative ribosomal-protein-alanine acetyltransferase [Prochlorococcus marinus str. NATL2A] (151 aa)
Score = 94, Expect = 2.8e-02, Identities = 46/129 (35%), Positives = 61/129 (47%)
  Q:    10 ISESELNEIVSLEQEIFLHNG-YTLENLNSFLESQNFYCL--IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSDAFLM 138
           + E  LN+ V L+Q+    NG ++       L      CL  I    K++LG C  +    E  I  I V    + K IG  LLS L +  KS     IFLEV   +      Y    FK + KR N+Y D SDA L+
  S:     8 LGEMHLNDCVDLDQKS--SNGLWSKSQWEKELTDPKRICLGIIELQTKKLLGLCSAWLVIDELHITFIAVDPRNQRKGIGKFLLSDLIKRSKSLQINHIFLEVKQNNEPAKALYNSMGFKTVGKRSNFYQDGSDALLL 143
>gi|169333994|ref|ZP_02861187.1| hypothetical protein ANASTE_00386 [Anaerofustis stercorihominis DSM 17244] >gi|169258711|gb|EDS72677.1| hypothetical protein ANASTE_00386 [Anaerofustis stercorihominis DSM 17244] (143 aa)
Score = 94, Expect = 2.9e-02, Identities = 33/94 (35%), Positives = 55/94 (58%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWIK 142
           I K+NK ++G    F       I  + V   Y+ K IGSNL+ + K+ Y+ + L V  + +N +NFYLK+ FK+I K  N  +++ + +LM++ K
  S:    51 ICKENKNVIG----FIGIDNGYIAGLFVSDKYKRKGIGSNLIGFAKDKYEKLSLHVFKENNNALNFYLKHGFKIISKEINEDTNHYE-YLMEYKK 140
>gi|120553962|ref|YP_958313.1| ribosomal-protein-alanine acetyltransferase [Marinobacter aquaeolei VT8] >gi|120323811|gb|ABM18126.1| Acetyltransferase, GNAT family [Marinobacter aquaeolei VT8] (371 aa)
Score = 94, Expect = 2.9e-02, Identities = 37/124 (29%), Positives = 60/124 (48%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQE--AEIYKIGVVYSYRNKKIGSNLLSYL-KENYKS----IFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAF 136
           S+L+ +V LE   F  +  +  +   FLE      +I + N +++GYCL   N     A IY I V    R + +G  L+    KE  ++    + LEV  D    I+ Y +  ++      +YY D+ DA 
  S:    12 SDLDALVQLENRCFTEDRISRRSFRRFLEMPRDRLVIAELNGELVGYCLVLMNAATRLARIYSIAVSPVARGRGVGERLVREAEKEAVEADRIIMRLEVREDNIGAISLYRRLGYRQFGTYRDYYEDHGDAL 143
>gi|169796947|ref|YP_001714740.1| ribosomal-protein-alanine acetyltransferase (acetylating enzyme for N-terminal of ribosomal protein S18) [Acinetobacter baumannii AYE] >gi|184157141|ref|YP_001845480.1| acetyltransferase [Acinetobacter baumannii ACICU] >gi|169149874|emb|CAM87765.1| ribosomal-protein-alanine acetyltransferase (Acetylating enzyme for N-terminal of ribosomal protein S18) [Acinetobacter baumannii] >gi|183208735|gb|ACC56133.1| Acetyltransferase [Acinetobacter baumannii ACICU] (151 aa)
Score = 94, Expect = 3.1e-02, Identities = 33/120 (27%), Positives = 59/120 (49%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFY-CLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL----SYLKENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYY 129
           +  S+++ +  +E+ +  H      +   F+ES N Y C + + N +++G+C+      EA +  + +    + K +G  LL      L+ +   IFLEV + +   I  Y K  F  I  R NYY
  S:     5 MQASDIDSVAQIEKLVQTHPW----SRQQFVESLNSYQCTVIELNNKVVGFCILQPVLDEANLLLMAIDPQMQGKGLGYQLLDASIERLENHPVQIFLEVRESNKAAIGLYEKTGFHQIDVRRNYY 126
>gi|168138600|ref|ZP_02581829.1| ribosomal-protein-alanine N-acetyltransferase [Bacillus cereus B4264] (147 aa)
Score = 94, Expect = 3.1e-02, Identities = 35/128 (27%), Positives = 69/128 (53%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLE-SQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL----SYLKE-NYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           ++ +IV++E+  F    +T +  +  L  +++ + ++ + + +++GYC  +    E+ I  I ++  YR +K+G  LL    S  KE   K++ LEV   +      Y K  F+    R  YY+DN +  L+ W+
  S:    12 DIAQIVAIEEASF-STPWTADAFHRELTMNEHAHYIVLEKDGRVVGYCGLWIIIDESHITNIAILPEYRGQKLGDALLKAVISEAKELGVKTMTLEVRVSNEVAKQLYRKYGFQNGGIRKRYYADNQEDGLVMWV 145
>gi|110004538|emb|CAK98875.1| hypothetical ribosomal-protein-alanine acetyltransferase [Spiroplasma citri] (142 aa)
Score = 94, Expect = 3.2e-02, Identities = 41/129 (31%), Positives = 68/129 (52%)
  Q:     1 MITLKNKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNF--YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE--NYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYY 129
           M+ LK  NN   S+   +  LEQE +  + Y   NL   + + N+  Y LI K+N  + GY +   +  + E+ ++ V   Y ++  G  +L Y+    +Y+ IFLEV++ +      YLK+ FK+I     YY
  S:     1 MVVLKPVNN---SDALLLFLLEQENYSRHCYKYRNLIQMINNTNYLVYKLIVKNN--LYGYFILMHSGDDFELIRLKVKKRYHHQGYGRQMLKYILTHFSYQQIFLEVNEHNLAAQQLYLKHGFKIIRTISQYY 129
>gi|52079049|ref|YP_077840.1| ribosomal-protein-alanine acetyltransferase YdiD [Bacillus licheniformis ATCC 14580] >gi|52784420|ref|YP_090249.1| YdiD [Bacillus licheniformis ATCC 14580] >gi|52002260|gb|AAU22202.1| Ribosomal-protein-alanine acetyltransferase YdiD [Bacillus licheniformis ATCC 14580] >gi|52346922|gb|AAU39556.1| YdiD [Bacillus licheniformis DSM 13] (152 aa)
Score = 94, Expect = 3.2e-02, Identities = 33/134 (24%), Positives = 67/134 (50%)
  Q:     9 NISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSY---LKENYKSIFLEVSDR-DNTI--NFYLKNNFKVIHKRDNYYSDNSDAFLMKWIK 142
           +++  +L+++  +E+  F          +    +   + L+ +  +Q++GYC  +    +A+I  I V  +YR ++ G  LL     L    +++ L +  R  N I  + Y K  F+    R NYY+DN +  L+ W++
  S:     9 DMNPKDLDQVFEIEKSSFSSPWKKESFHHELFHNMYAHYLVLEVEEQVVGYCGIWIVMDDAQITNIAVSPAYRGRRFGEALLKAAMKLCRMKRAVQLSLEVRVSNHIAQSLYKKLGFEPGGIRKNYYTDNGEDALLMWVR 148
>gi|168144361|ref|ZP_02587590.1| ribosomal-protein-alanine N-acetyltransferase [Bacillus cereus G9842] (147 aa)
Score = 94, Expect = 3.3e-02, Identities = 35/128 (27%), Positives = 69/128 (53%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLE-SQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL----SYLKE-NYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           ++ +IV++E E+     +T +  +  L  +++ + ++ + + +++GYC  +    E+ I  I ++  YR +K+G  LL    S  KE   K++ LEV   +      Y K  F+    R  YY+DN +  L+ W+
  S:    12 DIAQIVAIE-EVSFSTPWTADAFHRELTMNEHAHYIVLEKDGRVIGYCGLWIIIDESHITNIAILPEYRGQKLGDALLKAVISEAKELGVKTMTLEVRVSNEVAKQLYKKYGFQNGGIRKRYYADNQEDGLVMWV 145
>gi|56460758|ref|YP_156039.1| acetyltransferase domain-containing protein [Idiomarina loihiensis L2TR] >gi|56179768|gb|AAV82490.1| Acetyltransferase domain (GNAT family) fused peptidase domain (C39 family) [Idiomarina loihiensis L2TR] (380 aa)
Score = 94, Expect = 3.3e-02, Identities = 35/125 (28%), Positives = 65/125 (52%)
  Q:    15 LNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGY--CLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSY---LKENYKSIFLEVS-DRDNTINFYLKNN--FKVIHKRDNYY----SDNSDAFLMK 139
           L+ + +LE   F  +  +  +   F+ES +    +   N++++GY   L+  N   A +Y + V   +R+K  G  LL     L +   S+FL       NT+   L N+  F+ I  R+ Y+    S ++DA +++
  S:    12 LDAVAALEAVTFPEDAISKRSFRRFIESPSADFQVLLLNEKVIGYTVVLYRNNTNLARLYALVVEKEHRSKGYGRRLLQAAEDLADERHSLFLRTEVATSNTVGQQLMNSEGFRAIELREAYFPPSASQSTDALVLQ 148
>gi|49473882|ref|YP_031924.1| peptide N-acetyltransferase [Bartonella quintana str. Toulouse] >gi|49239385|emb|CAF25718.1| Peptide N-acetyltransferase [Bartonella quintana str. Toulouse] (163 aa)
Score = 94, Expect = 3.3e-02, Identities = 36/85 (42%), Positives = 48/85 (56%)
  Q:    55 QILGYCLFFENEQEAEIYKIGVVYSYRNKKIG-----SNLLSYLKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYY-SDNS--DAFLMK 139
           QILG+CL      EAEI  I V   YR + IG     S L    +E    +FLEV + + + +  Y +  F+ I KR  YY S NS  DA +M+
  S:    63 QILGFCLCRLILDEAEIITIAVHPHYRRQGIGILLIDSTLHHLYQERAIKLFLEVEETNLSALKLYQRFEFQKISKRLAYYQSKNSRIDAIIMQ 156
>gi|30018508|ref|NP_830139.1| ribosomal-protein-alanine acetyltransferase [Bacillus cereus ATCC 14579] >gi|29894048|gb|AAP07340.1| Ribosomal-protein-alanine acetyltransferase [Bacillus cereus ATCC 14579] (140 aa)
Score = 94, Expect = 3.3e-02, Identities = 35/128 (27%), Positives = 69/128 (53%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLE-SQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL----SYLKE-NYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           ++ +IV++E+  F    +T +  +  L  +++ + ++ + + +++GYC  +    E+ I  I ++  YR +K+G  LL    S  KE   K++ LEV   +      Y K  F+    R  YY+DN +  L+ W+
  S:     5 DIAQIVAIEEASF-STPWTADAFHRELTMNEHAHYIVLEKDGRVVGYCGLWIIIDESHITNIAILPEYRGQKLGDALLKAVISEAKELGVKTMTLEVRVSNEVAKQLYRKYGFQNGGIRKRYYADNQEDGLVMWV 138
>gi|77918898|ref|YP_356713.1| ribosomal-protein-alanine acetyltransferase [Pelobacter carbinolicus DSM 2380] >gi|77544981|gb|ABA88543.1| SSU ribosomal protein S18P alanine acetyltransferase [Pelobacter carbinolicus DSM 2380] (154 aa)
Score = 93, Expect = 3.7e-02, Identities = 25/85 (29%), Positives = 47/85 (55%)
  Q:    55 QILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           +++GY  F++   E  I  + V  ++R + +G  L+ ++ ++ ++      FLEV +     I  Y    F+VI +R  YY D  DA +M+
  S:    58 RLVGYICFWQVCDELHILNVAVDRAFRRRGLGRVLVEHVLQHGRAGGCDRAFLEVRTGNRGAIALYDSLGFEVIGRRVKYYPDGEDALVME 148
>gi|57234579|ref|YP_181350.1| ribosomal-protein-alanine acetyltransferase [Dehalococcoides ethenogenes 195] >gi|57225027|gb|AAW40084.1| ribosomal-protein-alanine acetyltransferase [Dehalococcoides ethenogenes 195] (213 aa)
Score = 93, Expect = 4.0e-02, Identities = 32/87 (36%), Positives = 45/87 (51%)
  Q:    52 DNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL-SYLKE--NYKSIFLEVSDRDNTI---NFYLKNNFKVIHKRDNYYSDN-SDAFLM 138
           DN +++GY   +     A +  + V  ++R K  G  LL S LKE   YK   + +  R + I   N YLK  F +   R  YY DN  DA +M
  S:    84 DNPKVIGYSAIWVMAGSAHLVSVAVRDAFRRKGFGELLLISSLKEAIKYKCFEMTLEVRVSNIVAQNLYLKYGFAIKGIRKKYYLDNHEDALIM 177
>gi|16081233|ref|NP_393537.1| N-terminal acetyltransferase complex ard1 subunit related protein [Thermoplasma acidophilum DSM 1728] >gi|10639204|emb|CAC11206.1| N-terminal acetyltransferase complex ard1 subunit related protein [Thermoplasma acidophilum] (154 aa)
Score = 93, Expect = 4.2e-02, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:    48 LIYKDNKQILGYCLFFE-NEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           ++Y     ++G+ +  + +  EA I    V   +R   +GS L+        +EN  S+ LEV +D D  I FY K  F +      YYSD+S+A+ M
  S:    53 MVYTITDTVVGFIVGSKYSRTEARILLFAVDERFRKMGVGSALMDRFLQLCREENMLSVRLEVRTDNDEAIRFYKKYGFVITALLPGYYSDSSNAYTM 150
>gi|164516918|emb|CAP48547.1| putative integron gene cassette protein [uncultured bacterium] (168 aa)
Score = 93, Expect = 4.4e-02, Identities = 29/128 (22%), Positives = 66/128 (51%)
  Q:    11 SESELNEIVSLEQEIFLHN---GYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           + S++ EI  L ++   ++    YT + +   L+      ++ + +K++ G+ +    +Q A +  + V   YR + +G  L+++L++  ++     I+++V   +   I FY K  F+VI +   YY       +M
  S:    21 ASSDVVEIAELSRKYIEYDLGWHYTPKTVKELLKDSEKNVVVARMDKKLAGFGIMTYADQNANLDLLAVKTRYRRRGVGKRLVTWLEDVARTAGIANIYVQVRKVNRGAITFYTKCGFQVIDQLSGYYRATETGVIM 157
>gi|124027856|ref|YP_001013176.1| acetyltransferase [Hyperthermus butylicus DSM 5456] >gi|123978550|gb|ABM80831.1| predicted Acetyltransferase [Hyperthermus butylicus DSM 5456] (170 aa)
Score = 92, Expect = 4.6e-02, Identities = 28/72 (38%), Positives = 38/72 (52%)
  Q:    67 QEAEIYKIGVVYSYRNKKIGSNLLSY----LKENY--KSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           ++  I  I V+  YR + IG  L+      LK  Y  K ++LEV   +N  I  Y K  FK +     YY D  DA+LM
  S:    88 KKGHIVSIAVLEGYRRRGIGRALMEAAMEALKTRYGCKEVYLEVRVSNNPAIRLYEKLGFKKVKVLHMYYLDGEDAYLM 166
>gi|193076625|gb|ABO11304.2| ribosomal-protein-alanine acetyltransferase [Acinetobacter baumannii ATCC 17978] (151 aa)
Score = 92, Expect = 4.6e-02, Identities = 33/120 (27%), Positives = 59/120 (49%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFY-CLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL----SYLKENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYY 129
           +  S+++ +  +E+ +  H      +   F+ES N Y C + + N +++G+C+      EA +  + +    + K +G  LL      L+ +   IFLEV + +   I  Y K  F  I  R NYY
  S:     5 MQASDIDSVAQIEKLVQTHPW----SRQQFVESLNSYQCTVIELNNKVVGFCILQPVLDEANLLLMAIDPQMQGKGLGYQLLDASIERLENHPVQIFLEVRESNKAAIGLYEKAGFHQIDVRRNYY 126
>gi|169634053|ref|YP_001707789.1| ribosomal-protein-alanine acetyltransferase (acetylating enzyme for N-terminal of ribosomal protein S18) [Acinetobacter baumannii SDF] >gi|169152845|emb|CAP01874.1| ribosomal-protein-alanine acetyltransferase (Acetylating enzyme for N-terminal of ribosomal protein S18) [Acinetobacter baumannii] (151 aa)
Score = 92, Expect = 4.7e-02, Identities = 33/120 (27%), Positives = 59/120 (49%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFY-CLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL----SYLKENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYY 129
           +  S+++ +  +E+ +  H      +   F+ES N Y C + + N +++G+C+      EA +  + +    + K +G  LL      L+ +   IFLEV + +   I  Y K  F  I  R NYY
  S:     5 MQASDIDSVAQIEKLVQTHPW----SRQQFVESLNSYQCTVIELNNKVVGFCILQPVLDEANLLLMAIDPQMQGKGLGYQLLDASIERLENHPVQIFLEVRESNKAAIGLYEKAGFHQIDVRRNYY 126
>gi|17230490|ref|NP_487038.1| ribosomal-protein-alanine acetyltransferase [Nostoc sp. PCC 7120] >gi|17132092|dbj|BAB74697.1| ribosomal-protein-alanine acetyltransferase [Nostoc sp. PCC 7120] (182 aa)
Score = 92, Expect = 4.7e-02, Identities = 41/141 (29%), Positives = 67/141 (47%)
  Q:     1 MITLKNK-NNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCL-IYKDNKQI--LGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRD------NTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           MI+ K K  +++  +L+ I+ L+Q  F    +T+E     L+S N   L ++     I  LG   F+    EA I  + V   Y  + +G  LL +L        LE +  +        I+ Y K  F+   +R  YY DN +  L+ W+
  S:     1 MISSKLKLQSLTSKDLSAILELDQACF-GGLWTMEGYQRELDSPNSDLLGLFSPTSSIKLLGMGCFWSIVGEAHITILAVHPQYHRQALGQALLYFLLRTASDRGLERATLEVRASNLAAISLYQKFGFQTAGRRRAYYQDNGEDALILWL 150
>gi|196036854|ref|ZP_03104242.1| ribosomal-protein-alanine acetyltransferase [Bacillus cereus W] >gi|195990536|gb|EDX54516.1| ribosomal-protein-alanine acetyltransferase [Bacillus cereus W] (147 aa)
Score = 92, Expect = 4.8e-02, Identities = 29/96 (30%), Positives = 49/96 (51%)
  Q:    46 YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKEN-----YKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           Y ++ KD + ++GYC  +    E+ I  I ++  YR +K+G  LL  +         K++ LEV   +      Y K  F+    R  YY+DN +  L+ W+
  S:    45 YVVLEKDGR-VIGYCGLWIIIDESHITNIAILPEYRGQKLGDALLKEVISEAKTLGVKTMTLEVRASNEVAKQLYRKYGFQNGGIRKRYYADNQEDGLVMWV 145
>gi|21227395|ref|NP_633317.1| acetyltransferase [Methanosarcina mazei Go1] >gi|20905758|gb|AAM30989.1| Acetyltransferase [Methanosarcina mazei Go1] (176 aa)
Score = 92, Expect = 4.8e-02, Identities = 36/126 (28%), Positives = 57/126 (45%)
  Q:    14 ELNEIVSLEQEIFL-HNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFEN-EQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           +  EIV +E+E F  HN     N   F E      L+ +   +++GY + + + E E  I+ +GV   YR + IG+ L+      ++    +   LEV +        Y    F        YYSD  D  +MK
  S:     9 DFQEIVEIEEEAFSEHNSLVYMN---FYEMVGDGFLVAEQEGKVVGYVVGYRSAENEGHIFSVGVKKEYRGRGIGTELIHAICDIFVANGLRYARLEVRTSNTGAQKLYRSIGFTQCWTEKKYYSDGEDGMVMK 139
>gi|50084097|ref|YP_045607.1| ribosomal-protein-alanine acetyltransferase (acetylating enzyme for N-terminal of ribosomal protein S18) [Acinetobacter sp. ADP1] >gi|49530073|emb|CAG67785.1| ribosomal-protein-alanine acetyltransferase (Acetylating enzyme for N-terminal of ribosomal protein S18) [Acinetobacter sp. ADP1] (152 aa)
Score = 92, Expect = 5.2e-02, Identities = 30/93 (32%), Positives = 51/93 (54%)
  Q:    39 FLESQNFY-CLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL----SYLKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSD 131
           F ES N Y   + + NKQ++G+C+      EA +  + +  + + + +G  LL    + LK N   IFLEV + + + +  Y K+ F  I  R +YY +
  S:    30 FAESLNSYQATVIELNKQVVGFCILQPVLDEANLLLMAIHPNMQGRGLGFKLLEESINQLKNNPVQIFLEVRESNLSAVGLYEKSGFHQIDLRRHYYPN 128
>gi|167462251|ref|ZP_02327340.1| ribosomal protein (S18)-alanine acetyltransferase [Paenibacillus larvae subsp. larvae BRL-230010] (172 aa)
Score = 92, Expect = 5.5e-02, Identities = 33/127 (25%), Positives = 58/127 (45%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKEN-----YKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           +++ I  +EQE F         +N    +     ++ + +  I GY   +    EA I  I V  +YR +K+G  LL  +++       K + LEV   ++     Y K  F     R  YY+DN++  ++ W
  S:    27 DISRICEIEQEAFTTPWSAGAFINELTSNHFARYMVMEVHGDIAGYGGMWLIMDEAHITNIAVSETYRGRKLGERLLREMQKTAGFLGAKRMTLEVRASNHIAQRLYNKMGFVYSGIRKGYYTDNNEDAIIMW 159
>gi|71737183|ref|YP_274874.1| acetyltransferase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557736|gb|AAZ36947.1| acetyltransferase, GNAT family [Pseudomonas syringae pv. phaseolicola 1448A] (386 aa)
Score = 92, Expect = 5.5e-02, Identities = 28/125 (22%), Positives = 61/125 (48%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCL--FFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAF 136
           E+++++++ LE + F  +  T  + +  +   N   ++ +   ++ GY L  F        +Y + +  + R K +G  LL   ++     +   + LEV  D    I  Y +N ++   + D+YY D++ A 
  S:    10 ETDVDDLLLLENQCFDGDRLTARSFHWMIRRANASLIVAEQVGKLTGYALVLFHRGTSLGRLYSLAIADAARGKGLGGQLLQRAEQQAVGRDCAYLRLEVRPDNHAAIGLYERNGYRRFAQVDDYYQDHAPAL 142
>gi|196164322|ref|ZP_03124853.1| putative ribosomal-protein-alanine acetyltransferase [Clostridium difficile QCD-23m63] (158 aa)
Score = 92, Expect = 5.5e-02, Identities = 36/127 (28%), Positives = 64/127 (50%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           +++E+  +E+  F  + ++ E+    L ++    ++ K + +I+GY   +    E  I  + V   YR KKIG  L+  + +     N  S+ LEV   +    N Y K  FK+   R  YYSDN +  ++ W
  S:    21 DIDEVFEVEKNCF-EDYWSKESFRKELSNEVARYIVAKLDGKIVGYVGIWLILDEGHINNVAVHSDYRGKKIGDKLIKGIVDLCKDNNIASMTLEVRASNKIAQNLYRKYGFKMGGIRKEYYSDNKEDAIIMW 152
>gi|163938250|ref|YP_001643134.1| ribosomal-protein-alanine acetyltransferase [Bacillus weihenstephanensis KBAB4] >gi|163860447|gb|ABY41506.1| ribosomal-protein-alanine acetyltransferase [Bacillus weihenstephanensis KBAB4] (147 aa)
Score = 92, Expect = 5.7e-02, Identities = 32/128 (25%), Positives = 67/128 (52%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLE-SQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKEN-----YKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           ++ +IV++E+  F    +T +  +  LE +++ + ++ + +  ++GYC  +    E+ +  I ++  YR +K+G  LL  +         K++ LEV   +      Y K  F+    R  YY+DN +  L+ W+
  S:    12 DIAQIVAIEEASF-STPWTADAFHRELEVNEHAHYVVLEKDGLVIGYCGLWIIIDESHVTNIAILPEYRGQKLGDALLKEVISEAKGLGVKTMTLEVRMSNEVAKQLYRKYGFQNGGIRKRYYADNQEDGLVMWV 145
>gi|56962644|ref|YP_174370.1| ribosomal-protein-alanine acetyltransferase [Bacillus clausii KSM-K16] >gi|56908882|dbj|BAD63409.1| ribosomal-protein-alanine acetyltransferase [Bacillus clausii KSM-K16] (160 aa)
Score = 91, Expect = 6.0e-02, Identities = 34/129 (26%), Positives = 60/129 (46%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGY-CLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK-----SIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWIK 142
           +++E++ +E++ F    +  E   + L    F C         +   C  ++   EA+I  + V   YR    G +L+ Y+ E  K     S+ LEV   +    + Y K  F+    R NYY+DN +   + W+K
  S:    18 DIDEVLLIERDAFT-TPWEREAFETELTKNQFACYYVVVVDGKVVGYCGLWKVVDEAQITNVAVASEYRGHSYGESLMRYVMEWLKALGVVSLSLEVRVSNTPAQSLYQKLGFRKAGIRKNYYADNQEDAWVMWVK 152
>gi|158317748|ref|YP_001510256.1| ribosomal-protein-alanine acetyltransferase [Frankia sp. EAN1pec] >gi|158113153|gb|ABW15350.1| ribosomal-protein-alanine acetyltransferase [Frankia sp. EAN1pec] (185 aa)
Score = 91, Expect = 6.0e-02, Identities = 39/125 (31%), Positives = 64/125 (51%)
  Q:    15 LNEIVSLEQEIFLHNGYTLENLNSFL-ESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL-SYLKE----NYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYS-DNSDAFLMK 139
           L EI +LE+++F  + ++ E   S L +  N + L+      I+GY        E+ I  IGVV + R + +GS L+ + L+E      +S  LEV +D       Y +  F  +  R  YY     DA++M+
  S:    25 LGEIATLERQVFDLDPWSAELFWSELAQGDNRHYLVAVAGGSIVGYAGLALQGDESYIQTIGVVPAMRGRHLGSRLMIAQLREARRRGARSCGLEVRTDNRPARALYTRLGFVDLGVRRGYYQPSGGDAYVMR 157
>gi|66045763|ref|YP_235604.1| GCN5-related N-acetyltransferase [Pseudomonas syringae pv. syringae B728a] >gi|63256470|gb|AAY37566.1| GCN5-related N-acetyltransferase [Pseudomonas syringae pv. syringae B728a] (382 aa)
Score = 91, Expect = 6.0e-02, Identities = 28/125 (22%), Positives = 61/125 (48%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCL--FFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAF 136
           E+++++++ LE + F  +  T  + +  +   N   ++ +   Q+ GY L  F        +Y + +  + R K +G  LL   ++     +   + LEV  D    I  Y ++ ++   + D+YY D++ A 
  S:    10 ETDVDDLLLLENQCFDGDRLTARSFHWMIRRANASLIVAEQAGQLTGYALVLFHRGTSLGRLYSLAIADAARGKGLGRQLLQRAEQQAVGRDCAYLRLEVRPDNGAAIGLYERSGYRRFAQVDDYYQDHAPAL 142
>gi|126640922|ref|YP_001083906.1| ribosomal-protein-alanine acetyltransferase [Acinetobacter baumannii ATCC 17978] (147 aa)
Score = 91, Expect = 6.1e-02, Identities = 33/120 (27%), Positives = 59/120 (49%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFY-CLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL----SYLKENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYY 129
           +  S+++ +  +E+ +  H      +   F+ES N Y C + + N +++G+C+      EA +  + +    + K +G  LL      L+ +   IFLEV + +   I  Y K  F  I  R NYY
  S:     1 MQASDIDSVAQIEKLVQTHPW----SRQQFVESLNSYQCTVIELNNKVVGFCILQPVLDEANLLLMAIDPQMQGKGLGYQLLDASIERLENHPVQIFLEVRESNKAAIGLYEKAGFHQIDVRRNYY 122
>gi|168266462|ref|ZP_02688427.1| hypothetical protein LmonFSL_13446 [Listeria monocytogenes FSL J2-071] (153 aa)
Score = 91, Expect = 6.3e-02, Identities = 31/107 (28%), Positives = 59/107 (55%)
  Q:    24 EIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGY-CLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYS 130
           E+ L    + + +  +LE+ + + L+  D  +I+G  CL   N+Q+ EI  I V  S RN+ IG  LL       +K  + ++ ++  +   + + FY KN+F++     NY++
  S:    15 ELLLEADPSEKQIAKYLEASHVFQLV--DANEIIGVICLLPLNKQQLEIMNIAVQPSKRNQGIGKMLLEKAFDYAMKNGFSALIVKTGNSSIDQLAFYQKNHFRMQQIVPNYFT 126
>gi|147921115|ref|YP_685074.1| GNAT family acetyltransferase [uncultured methanogenic archaeon RC-I] >gi|110620470|emb|CAJ35748.1| predicted acetyltransferase (GNAT family) [uncultured methanogenic archaeon RC-I] (152 aa)
Score = 91, Expect = 6.3e-02, Identities = 36/121 (29%), Positives = 62/121 (51%)
  Q:    18 IVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS----IFLEVSDRDNTI---NFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           I+ +E+EIF      L ++     ++ F  L+ + +  + GY +      EA +  + V   YR KK+G++L+ Y  +  +S    I LEV  R N +    FY K  FK +     YY +  +A++M
  S:    18 ILEMEEEIFHEPNPVLYSVIENYPTEGF--LVAEYDGVVCGYLVGALIMDEARVLLLAVKEGYRKKKVGTSLMEYYIDTVRSRANLIRLEV--RVNNLGAQTFYFKLGFKFLGVVSKYYRNGDNAYIM 141
>gi|192360128|ref|YP_001981402.1| ribosomal-protein-alanine acetyltransferase [Cellvibrio japonicus Ueda107] >gi|190686293|gb|ACE83971.1| ribosomal-protein-alanine acetyltransferase [Cellvibrio japonicus Ueda107] (160 aa)
Score = 91, Expect = 6.5e-02, Identities = 34/129 (26%), Positives = 62/129 (48%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSY----LKENYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYY---SDNSDAFLM 138
           ++E ++  ++ LE+    H        +     Q  +   YK+N  ++G  +      +AE+  I V  +++ K IG  LL +    +++    +FLEV       I+ Y K  F  + +R NYY   + + DA LM
  S:    22 LTEVDIPAVMQLERSAHSHPWRQSSFEDCLTGRQKCWLAEYKEN--LVGLVVITHGGGDAELLNISVSPAFQRKGIGRCLLHHALDCVRDKADMLFLEVRVSNHKAIDLYAKEGFFEVGQRKNYYPTLNGHEDALLM 156
>gi|170787859|gb|EDT28903.1| ribosomal-protein-alanine acetyltransferase [Oligotropha carboxidovorans OM5] (165 aa)
Score = 91, Expect = 6.6e-02, Identities = 25/107 (23%), Positives = 49/107 (45%)
  Q:    27 LHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL----SYLKE-NYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNS 133
            H G+        L  ++      +  + ++G+ L      EAEI  + +    R + +   LL     YL     +++FLEV + +      Y +  F+++ +R+ YY D+S
  S:    39 FHRGWDSGEFEQLLADRSVLAHRLRQGRTVVGFILSRMAADEAEILSVAIAPDQRGRGLSRGLLHTHLGYLAGLGIRTVFLEVEENNAPARALYARAGFQIVGRRERYYKDDS 151
>gi|148642953|ref|YP_001273466.1| acetyltransferase [Methanobrevibacter smithii ATCC 35061] >gi|148551970|gb|ABQ87098.1| acetyltransferase [Methanobrevibacter smithii ATCC 35061] (145 aa)
Score = 91, Expect = 6.7e-02, Identities = 34/91 (37%), Positives = 54/91 (59%)
  Q:    48 LIYKDNKQILGYCLFF-ENEQEAEIYKIGVVYSYRNKKIGS-------NLLSYLKENYKSIFLEVSDR-DNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           L+ +D+  ++GY LF+ + E E  I  + V   Y+ K+ G+       N+LS  K N   I LEV++  +  I FY K NF+V  K  +YY++   A +M
  S:    42 LVAEDDGYVVGYVLFWIKYENEGHIISLAVDKDYQRKQAGTKLLLKAINVLSLFKIN--KILLEVNENNEGAIEFYKKFNFEVDRKVPHYYNNGDGAIVM 139
>gi|169825734|ref|YP_001695892.1| ribosomal protein (S18)-alanine acetyltransferase [Lysinibacillus sphaericus C3-41] >gi|168990222|gb|ACA37762.1| ribosomal protein (S18)-alanine acetyltransferase [Lysinibacillus sphaericus C3-41] (141 aa)
Score = 91, Expect = 6.8e-02, Identities = 28/96 (29%), Positives = 47/96 (48%)
  Q:    46 YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRD----NTI--NFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           Y L   +N  I+G+C  +     A+I  + V+   R + IG  L+       +   +EV   +    NT+  N Y K +F+    R  YY+DN +  L+ W+
  S:    38 YVLALDENGSIIGFCGMWMVIDAAQITNVAVIEQARGRGIGEGLMREAMHIARLHGMEVMTLEVRVTNTVAQNLYRKLHFQDGGIRKGYYTDNGEDALVMWV 139
>gi|47567499|ref|ZP_00238211.1| ribosomal-protein-alanine acetyltransferase [Bacillus cereus G9241] >gi|49479116|ref|YP_034586.1| ribosomal-protein-alanine N-acetyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|166985465|ref|ZP_02256748.1| ribosomal-protein-alanine N-acetyltransferase [Bacillus cereus AH187] >gi|166995266|ref|ZP_02261726.1| ribosomal-protein-alanine N-acetyltransferase [Bacillus cereus AH820] >gi|168164060|ref|ZP_02599293.1| ribosomal-protein-alanine N-acetyltransferase [Bacillus cereus H3081.97] >gi|47555901|gb|EAL14240.1| ribosomal-protein-alanine acetyltransferase [Bacillus cereus G9241] >gi|49330672|gb|AAT61318.1| ribosomal-protein-alanine N-acetyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] (147 aa)
Score = 91, Expect = 7.3e-02, Identities = 29/96 (30%), Positives = 49/96 (51%)
  Q:    46 YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKEN-----YKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           Y ++ KD + ++GYC  +    E+ I  I ++  YR +K+G  LL  +         K++ LEV   +      Y K  F+    R  YY+DN +  L+ W+
  S:    45 YVVLEKDGR-VIGYCGLWIIIDESHITNIAILPEYRGQKLGDALLKEVISEAKTLGVKTMTLEVRVSNEVAKQLYRKYGFQNGGIRKRYYADNQEDGLVMWV 145
>gi|78184963|ref|YP_377398.1| putative ribosomal-protein-alanine acetyltransferase [Synechococcus sp. CC9902] >gi|78169257|gb|ABB26354.1| putative ribosomal-protein-alanine acetyltransferase [Synechococcus sp. CC9902] (147 aa)
Score = 91, Expect = 7.4e-02, Identities = 32/103 (31%), Positives = 49/103 (47%)
  Q:    40 LESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEVSDRDNT-INFYLKNNFKVIHKRDNYYSDNSDAFLMKWIK 142
           LE     CL + ++  +LG    +    E  I  + V  S R +  G  LLS L +  +        LEV++ ++  I  Y    F+    R  YYSD SDA L++W +
  S:    35 LEEPRRLCLGWTEDMSLLGVACGWLVADELHITVVAVDPSVRRRGHGKRLLSALLQRARQQGAIHATLEVANHNSAAIALYASGGFQSAGTRTKYYSDGSDA-LIQWCR 142
>gi|58337301|ref|YP_193886.1| putative acetyltransferase [Lactobacillus acidophilus NCFM] >gi|58254618|gb|AAV42855.1| putative acetyltransferase [Lactobacillus acidophilus NCFM] (129 aa)
Score = 91, Expect = 7.6e-02, Identities = 30/93 (32%), Positives = 49/93 (52%)
  Q:    36 LNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS--IFLEVSDRDN--TINFYLKNNFKVIHKRDNY 128
           ++ +LE    Y LI  D  +++  C+    ++  EI  I  V  Y+ +     L+++L E YK+   FL+V   D+  TI FY K  FK  H+  N+
  S:    27 IDKYLERGTMYILI--DRNEVISECVVTNEDKILEIKNIATVPDYQGQGYAKKLINFLCERYKTQYKFLQVGTGDSPLTIPFYEKCGFKRSHRVHNF 121
>gi|121997484|ref|YP_001002271.1| ribosomal-protein-alanine acetyltransferase [Halorhodospira halophila SL1] >gi|121588889|gb|ABM61469.1| SSU ribosomal protein S18P alanine acetyltransferase [Halorhodospira halophila SL1] (157 aa)
Score = 90, Expect = 7.9e-02, Identities = 29/97 (29%), Positives = 49/97 (50%)
  Q:    42 SQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYY---SDNSDAFLM 138
           S  + C + +  ++ILGY +      E  I  I V   +R   I S+L++   E       +++FLEV   +   I  Y ++ F  + +R +YY   S   DA +M
  S:    41 SAGYGCFVQQQGREILGYLVVSCAAGEGTILNICVDPDWRRHGIASHLIAVAVERAEVMQAENLFLEVRPSNTAAIALYERHGFHEVGRRPDYYPAASGREDALIM 146
>gi|153833169|ref|ZP_01985836.1| acetyltransferase [Vibrio harveyi HY01] >gi|148870599|gb|EDL69507.1| acetyltransferase [Vibrio harveyi HY01] (144 aa)
Score = 90, Expect = 8.1e-02, Identities = 36/127 (28%), Positives = 59/127 (46%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYC-----LIYKDNKQILGYCLFFENEQEA--EIYKIGVVYSYRNKKIGSNLL--SYLKENYKSIFLEVSDRDNT--INFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           + +L  + +LE  +F H+ Y       F   Q F C     LI K+  QI GY L   ++++    I  + V   +R K I   L+  +  K +  S+     D +N      Y    FKV+ K ++Y+ D     +M
  S:     8 KQDLASVHALEHVLFGHHAYP-----QFFFRQAFDCWPQGLLIAKEEDQITGYVLMATSDEQNIHWILSLAVDSQHRGKGIARLLVEEALTKASAGSVVKLTVDPNNVPACKLYTSLGFKVLEKEEDYFGDGEPRLVM 140
>gi|118591257|ref|ZP_01548656.1| hypothetical protein SIAM614_16562 [Stappia aggregata IAM 12614] >gi|118436333|gb|EAV42975.1| hypothetical protein SIAM614_16562 [Stappia aggregata IAM 12614] (376 aa)
Score = 90, Expect = 8.1e-02, Identities = 31/131 (23%), Positives = 61/131 (46%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFF--ENEQEAEIYKIGVVYSYRNKKIGSNLL-----SYLKENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWIKQG 144
           +L E+  +E   F  +  +  +   FLES     L+      ++GY L    +    A +Y + V  + R + +G+ LL     +        + LEV +D +  I  Y ++ ++++ + + YY D   A  M+ +  G
  S:    22 DLAELFRIENAAFAGDRISRRSFKRFLESTRARLLVATGPNGLVGYALLLLRQGTALARLYSLAVDPACRGQGLGAKLLEASEVAAFDSERIVLRLEVRADNEAAIALYRRSGYRLLGRVEAYYEDGCAALRMEKLLHG 160
>gi|171742873|ref|ZP_02918680.1| hypothetical protein BIFDEN_01989 [Bifidobacterium dentium ATCC 27678] >gi|171278487|gb|EDT46148.1| hypothetical protein BIFDEN_01989 [Bifidobacterium dentium ATCC 27678] (165 aa)
Score = 90, Expect = 8.3e-02, Identities = 36/127 (28%), Positives = 66/127 (51%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLES-QNFYCLIYKDNKQ-----ILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYS-DNSDAFLM 138
           ++ + +IV+LE ++F H  ++  ++   L +    Y L  + +       + GY  F+ +  +AEI  IGV  S++ + I + LL  L     ++  K + LEV  D    +  Y +  F  +  R  YY  +  DA+ M
  S:    11 DAAIRQIVALEADLFGHGAWSEHSVRQELNAPARTYLLDIEPSDDDGIPIVRGYAGFWYDGDDAEIMTIGVGRSFQRRGIAAMLLQSLIESAKRQGAKRMLLEVRVDNVPALGLYERFGFIRMGLRKRYYQPEGIDAYTM 150
>gi|163790864|ref|ZP_02185288.1| ribosomal-protein-alanine acetyltransferase, putative [Carnobacterium sp. AT7] >gi|159873817|gb|EDP67897.1| ribosomal-protein-alanine acetyltransferase, putative [Carnobacterium sp. AT7] (158 aa)
Score = 90, Expect = 8.3e-02, Identities = 35/95 (36%), Positives = 53/95 (55%)
  Q:    44 NFYCLIYKDNKQI--LGYCLFFENEQEAEIYKIGVVYSYRNKKIGS----NLLSYLK-ENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           N Y +    NK+I  +GY   F+   EAEI   G++  ++N+ IG     + + YLK +  K +FLEV +++   I  Y K  F+ I  R NYY    D  L+
  S:    54 NEYGIALHKNKKIGFIGYTQLFD---EAEITTFGILTPFKNQGIGQLFLRSFIEYLKAKEIKKLFLEVREQNKAAITVYKKLGFETIAVRKNYYHGPVDHALI 153
>gi|94498006|ref|ZP_01304570.1| acetyltransferase [Sphingomonas sp. SKA58] >gi|94422589|gb|EAT07626.1| acetyltransferase [Sphingomonas sp. SKA58] (159 aa)
Score = 90, Expect = 8.5e-02, Identities = 27/100 (27%), Positives = 45/100 (45%)
  Q:    30 GYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL-----SYLKENYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYY 129
            +TL  L   +     +  + + +   LG+ L      E E+  + V   +R + IG  LL     +  +    S+ LEV   +N I  Y K  F+ +H+R  YY
  S:    36 AWTLPQLAGVMIMPGTWLTVARLDASPLGFALVRSVLDECELLLLAVAPLWRGRGIGETLLRDSLRTARRRGITSMNLEVRATNNAIQLYEKIGFEYVHRRPGYY 140
>gi|34556524|ref|NP_906339.1| hypothetical protein WS0070 [Wolinella succinogenes DSM 1740] >gi|34482238|emb|CAE09239.1| hypothetical protein [Wolinella succinogenes] (136 aa)
Score = 90, Expect = 8.5e-02, Identities = 33/111 (29%), Positives = 54/111 (48%)
  Q:    21 LEQEIFLHNGYTLENLNSF--LESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY-----KSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSD 131
           LEQE F  + Y L   N    ++ +N   L Y++   +LGY L     +   +Y + V   YR++ +G  LL  + E       K + LEV + +      Y K  F++  + + YY D
  S:     7 LEQESFSASDYPLSRANFLYHIKRENPLFLAYEEG-WVLGYALGLLRPKSLRLYSLAVGIEYRHQGVGKRLLEGVMEEAMRLGKKEVTLEVRESNQRARILYEKAGFELWKRLEGYYPD 124
>gi|107101372|ref|ZP_01365290.1| hypothetical protein PaerPA_01002409 [Pseudomonas aeruginosa PACS2] (365 aa)
Score = 90, Expect = 8.6e-02, Identities = 32/123 (26%), Positives = 56/123 (45%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCL--FFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAF 136
           +L+ +V LE   F ++  +  N    L   +    + + +  +LGY L  F E    A +Y I +    R   +G  LL   ++  +      + LEV  D    I  Y +N ++      +YY D+S+A 
  S:    12 DLSALVELENRCFDYDRLSRRNFQWMLTRAHASLTVAEGDGGVLGYALVLFHEGTSLARLYSIAIDPRARGIGLGQKLLEAAEQAARDNDRAYMRLEVRPDNRGAIALYERNGYRPFATVRDYYEDHSEAL 142
>gi|152987859|ref|YP_001348708.1| hypothetical protein PSPA7_3348 [Pseudomonas aeruginosa PA7] >gi|150963017|gb|ABR85042.1| hypothetical protein PSPA7_3348 [Pseudomonas aeruginosa PA7] (365 aa)
Score = 90, Expect = 8.6e-02, Identities = 32/123 (26%), Positives = 56/123 (45%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCL--FFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAF 136
           +L+ +V LE   F ++  +  N    L   +    + + +  +LGY L  F E    A +Y I +    R   +G  LL   ++  +      + LEV  D    I  Y +N ++      +YY D+S+A 
  S:    12 DLSALVELENRCFDYDRLSRRNFQWMLTRAHASLTVAEGDGGVLGYALVLFHEGTSLARLYSIAIDPRARGIGLGQKLLEAAEQAARDNDRAYMRLEVRPDNRGAIALYERNGYRPFATVRDYYEDHSEAL 142
>gi|116049894|ref|YP_791297.1| hypothetical protein PA14_39410 [Pseudomonas aeruginosa UCBPP-PA14] >gi|115585115|gb|ABJ11130.1| putative acetyltransferase [Pseudomonas aeruginosa UCBPP-PA14] (365 aa)
Score = 90, Expect = 8.6e-02, Identities = 32/123 (26%), Positives = 56/123 (45%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCL--FFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAF 136
           +L+ +V LE   F ++  +  N    L   +    + + +  +LGY L  F E    A +Y I +    R   +G  LL   ++  +      + LEV  D    I  Y +N ++      +YY D+S+A 
  S:    12 DLSALVELENRCFDYDRLSRRNFQWMLTRAHASLTVAEGDGGVLGYALVLFHEGTSLARLYSIAIDPRARGIGLGQKLLEAAEQAARDNDRAYMRLEVRPDNRGAIALYERNGYRPFATVRDYYEDHSEAL 142
>gi|15597139|ref|NP_250633.1| hypothetical protein PA1943 [Pseudomonas aeruginosa PAO1] >gi|194551312|ref|YP_002086339.1| hypothetical protein PA2G_00974 [Pseudomonas aeruginosa 2192] >gi|9947940|gb|AAG05331.1|AE004621_2 hypothetical protein PA1943 [Pseudomonas aeruginosa PAO1] >gi|126193705|gb|EAZ57768.1| hypothetical protein PA2G_00974 [Pseudomonas aeruginosa 2192] (365 aa)
Score = 90, Expect = 8.6e-02, Identities = 32/123 (26%), Positives = 56/123 (45%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCL--FFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAF 136
           +L+ +V LE   F ++  +  N    L   +    + + +  +LGY L  F E    A +Y I +    R   +G  LL   ++  +      + LEV  D    I  Y +N ++      +YY D+S+A 
  S:    12 DLSALVELENRCFDYDRLSRRNFQWMLTRAHASLTVAEGDGGVLGYALVLFHEGTSLARLYSIAIDPRARGIGLGQKLLEAAEQAARDNDRAYMRLEVRPDNRGAIALYERNGYRPFATVRDYYEDHSEAL 142
>gi|75674211|ref|YP_316632.1| ribosomal-protein-alanine acetyltransferase [Nitrobacter winogradskyi Nb-255] >gi|74419081|gb|ABA03280.1| Ribosomal-protein-alanine acetyltransferase [Nitrobacter winogradskyi Nb-255] (160 aa)
Score = 90, Expect = 8.9e-02, Identities = 26/108 (24%), Positives = 49/108 (45%)
  Q:    27 LHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSN-LLSYL----KENYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSD 134
            H G+      + +  +N      +    ++G+ +      EAEI  I +   YR +    N LL++L        +++FLEV + +      Y +  F V+ +R+ YY +  D
  S:    34 FHRGWGESEFETMIAERNTLVQRLRLRSNVIGFAVSRIAADEAEILSIAIDAGYRGQGFSRNLLLTHLGHLAGRGVRTVFLEVEENNQPARRLYERAGFAVVGRRERYYREAGD 147
>gi|156976805|ref|YP_001447711.1| ribosomal-protein-alanine acetyltransferase [Vibrio harveyi ATCC BAA-1116] >gi|156528399|gb|ABU73484.1| hypothetical protein VIBHAR_05581 [Vibrio harveyi ATCC BAA-1116] (144 aa)
Score = 90, Expect = 9.2e-02, Identities = 36/127 (28%), Positives = 59/127 (46%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYC-----LIYKDNKQILGYCLFFENEQEA--EIYKIGVVYSYRNKKIGSNLL--SYLKENYKSIFLEVSDRDNT--INFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           + +L  + +LE  +F H+ Y       F   Q F C     LI K+  QI GY L   ++++    I  + V   +R K I   L+  +  K +  S+     D +N      Y    FKV+ K ++Y+ D     +M
  S:     8 KQDLASVHALEHVLFGHHAYP-----QFFFRQAFDCWPQGLLIAKEEDQITGYVLIATSDEQNIHWILSLAVDSQHRGKGIARLLVEEALTKASAGSVVKLTVDPNNVPACKLYTSLGFKVLEKEEDYFGDGEARLVM 140
>gi|134045272|ref|YP_001096758.1| SSU ribosomal protein S18P alanine acetyltransferase [Methanococcus maripaludis C5] >gi|132662897|gb|ABO34543.1| SSU ribosomal protein S18P alanine acetyltransferase [Methanococcus maripaludis C5] (161 aa)
Score = 90, Expect = 9.5e-02, Identities = 38/133 (28%), Positives = 61/133 (45%)
  Q:     6 NKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY-------KSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           N     E +L  ++ +E+E F  N      ++ +    + + +   ++ +I+GY +         +  I V  +Y+N  IG+ LLS   EN+       K   LEV  D      FY K N+       NYY D +DA LM
  S:     4 NIRKFREHDLKRVMEIEKESFDKNYPEFLMMHIYTSFPDGFLVAETEDGKIVGYIIALMEWGNGHVVSIAVDSAYQNYGIGNALLS-ATENFLFNECHAKHCVLEVRFDNKKAREFYYKRNYVDRKVLYNYYDDGADAILM 143
>gi|116072468|ref|ZP_01469735.1| putative ribosomal-protein-alanine acetyltransferase [Synechococcus sp. BL107] >gi|116064990|gb|EAU70749.1| putative ribosomal-protein-alanine acetyltransferase [Synechococcus sp. BL107] (148 aa)
Score = 90, Expect = 1.0e-01, Identities = 37/116 (31%), Positives = 50/116 (43%)
  Q:    27 LHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWIK 142
           L   +T E     LE     CL + + K +LG    +    E  I  I V  S R +  G  LLS L +  +        LEV   +   I  Y    F+    R  YYSD SDA L++W +
  S:    22 LQGLWTKEQWRRELEDPRRLCLGWTEAKTLLGVACGWLVADELHITLIAVDPSVRRRGHGKRLLSALLQQARQQGAIHATLEVGTNNLAAIALYANGGFQSAGTRLKYYSDGSDA-LIQWCR 142
>gi|182418023|ref|ZP_02949328.1| acetyltransferase, gnat family [Clostridium butyricum 5521] >gi|182378078|gb|EDT75614.1| acetyltransferase, gnat family [Clostridium butyricum 5521] (141 aa)
Score = 89, Expect = 1.0e-01, Identities = 29/79 (36%), Positives = 46/79 (58%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDN 127
           IYK+   I G+    +    A ++   V   Y+ + IGS+LL+Y K  Y+ I L+V  R+   +NFY KNNF+++ K+ N
  S:    51 IYKEENVIKGFIGVIDKSYIAGLF---VKKEYQREGIGSSLLNYCKIKYEHIKLDVFVRNKKAVNFYCKNNFRILEKKVN 127
>gi|27468569|ref|NP_765206.1| ribosomal-protein-alanine N-acetyltransfer [Staphylococcus epidermidis ATCC 12228] >gi|27316116|gb|AAO05250.1|AE016749_196 ribosomal-protein-alanine N-acetyltransfer [Staphylococcus epidermidis ATCC 12228] (153 aa)
Score = 89, Expect = 1.0e-01, Identities = 34/136 (25%), Positives = 66/136 (48%)
  Q:     6 NKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYC-LIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVS------DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           N   +S  ++ ++  +E+  F H+ ++++     +E+  F    + + + +I+GY   +    +A+I  I +  ++R   +G  LL Y   NY     +V       D D   + Y    F+   KR NYY +  DA +M W+
  S:    10 NIRKMSVEDVPKVFDIERNSFSHSSWSIDAFYHEIENNEFATYFVIEFSDKIIGYVGLWLVVDQAQITTIAISKAFRGYGLGQLLLKY-AMNYARFSCDVMSLEVRIDNDVAQHVYRNLGFQNGGKRKNYYGEGEDALVM-WV 150
>gi|186686025|ref|YP_001869221.1| ribosomal-protein-alanine acetyltransferase [Nostoc punctiforme PCC 73102] >gi|186468477|gb|ACC84278.1| ribosomal-protein-alanine acetyltransferase [Nostoc punctiforme PCC 73102] (183 aa)
Score = 89, Expect = 1.1e-01, Identities = 41/132 (31%), Positives = 65/132 (49%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCL-IYK--DNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL-SYLK----ENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           ++   L+ I+ L+Q  F    +TLE     L+S N   L ++    +  +LG   F+   +EA I  + V   Y  + +G+ LL S LK       +   LEV   +   I+ Y K  FK   +R  YY DN +  L+ W+
  S:    11 LTPDNLSAILELDQACF-GGLWTLEGYKRELDSPNSDLLGLFSPFSSVSLLGMGCFWSILEEAHITILAVHPQYHRQGLGAALLYSLLKTACDRGMERATLEVRASNLAAISLYQKFGFKTAGRRRGYYQDNGEDALILWL 150
>gi|159905705|ref|YP_001549367.1| ribosomal-protein-alanine acetyltransferase [Methanococcus maripaludis C6] >gi|159887198|gb|ABX02135.1| ribosomal-protein-alanine acetyltransferase [Methanococcus maripaludis C6] (161 aa)
Score = 89, Expect = 1.1e-01, Identities = 38/133 (28%), Positives = 62/133 (46%)
  Q:     6 NKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY-------KSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           N     E++L  ++ +E+E F  N      ++ +    + + +   ++ +I+GY +         +  I V  +Y+N  IG+ LLS   EN+       K   LEV  D      FY K N+       NYY D +DA LM
  S:     4 NIRKFRENDLKRVMEIEKESFDKNYPEFLMMHIYTSFPDGFLVAENEDGKIVGYIIALMEWGNGHVVSIAVDSAYQNYGIGNALLS-ATENFLFNECHAKHCVLEVRFDNKKAREFYYKRNYVDRKVLYNYYDDGADAILM 143
>gi|153877605|ref|ZP_02004300.1| ribosomal-protein-alanine acetyltransferase [Beggiatoa sp. PS] >gi|152065931|gb|EDN65700.1| ribosomal-protein-alanine acetyltransferase [Beggiatoa sp. PS] (141 aa)
Score = 89, Expect = 1.1e-01, Identities = 28/81 (34%), Positives = 45/81 (55%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYY 129
           I + + +I+GY L     +EA+I  + +  +++    G  +L +L E     N +SIFLEV   + T +N Y K  F  +  R NYY
  S:    38 ILELDSRIIGYGLMSIAAREAQILNLCIHPNWQGHGYGQQILKHLIELAKQKNAQSIFLEVRTSNQTAMNLYHKMGFNQVGLRKNYY 124
>gi|48478563|ref|YP_024269.1| acetyltransferase [Picrophilus torridus DSM 9790] >gi|48431211|gb|AAT44076.1| acetyltransferase [Picrophilus torridus DSM 9790] (151 aa)
Score = 89, Expect = 1.2e-01, Identities = 35/122 (28%), Positives = 60/122 (49%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFE-NEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSI-----FLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDN 132
           +++++N I  +E   F    Y+ E ++  L  +N   L+  DN  I+GY    + N    ++  I V+  Y+    G  LLS L++  + +      LEV   +   I+ Y KN ++ I    NYY  N
  S:     9 NDNDINGIYKVEMLSFGRGAYSYEMIDEMLHDKNSITLVL-DNNNIIGYATAVKLNSSSMDVESIAVIPEYQGHGYGKLLLSSLEDKMRGLGYLYSILEVRSMNYRAISMYKKNGYREIEYIKNYYEVN 136
>gi|150018749|ref|YP_001311003.1| GCN5-related N-acetyltransferase [Clostridium beijerinckii NCIMB 8052] >gi|149905214|gb|ABR36047.1| GCN5-related N-acetyltransferase [Clostridium beijerinckii NCIMB 8052] (142 aa)
Score = 89, Expect = 1.2e-01, Identities = 31/95 (32%), Positives = 50/95 (52%)
  Q:    33 LENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNT-INFYLKNNFKVIHKRDN 127
            E +   L S + Y  I+++N  I G+    E    A ++   V   Y+ + +G  L+ Y K  Y ++ L V  ++ T +NFY+KNNFKVI +  N
  S:    37 FELVKQMLPSADIY--IFEENNIIKGFIGIVEQNYIAGLF---VKKEYQREGVGKKLIEYCKSEYDNLTLHVFTKNVTAVNFYMKNNFKVIDEHIN 127
>gi|13476450|ref|NP_108020.1| hypothetical protein mlr7776 [Mesorhizobium loti MAFF303099] >gi|14027211|dbj|BAB54165.1| mlr7776 [Mesorhizobium loti MAFF303099] (396 aa)
Score = 89, Expect = 1.2e-01, Identities = 30/124 (24%), Positives = 61/124 (49%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYC--LFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAF 136
           S+++++ ++E+ +F  +  +  +   F+E +    L+ + + ++ GY   LF +    A +Y I V   +    IG  LL+  +E     +   + LEV  D    I  Y +  ++ I +   YY D + A 
  S:    39 SDVDDLAAIEKAVFSSDRISRRSFRLFIERETAETLVAEVDGRVAGYAIVLFRKGSGVARLYSIAVGPFFGALGIGRQLLTAAEEAAFEHDRMMLRLEVREDNSRAIRIYEQAGYRKIGREPGYYEDGATAL 170
>gi|59713836|ref|YP_206611.1| IAA acetyltransferase [Vibrio fischeri ES114] >gi|59482084|gb|AAW87723.1| IAA acetyltransferase [Vibrio fischeri ES114] (150 aa)
Score = 89, Expect = 1.2e-01, Identities = 30/101 (29%), Positives = 52/101 (51%)
  Q:    34 ENLNSFLESQNFYCLIYKDNKQILGYCLFFE-NEQEAEIYKIGVVYSYRNKKIGSNLLSYLKEN-----YKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSD 134
           E +N +L   +  C     N +I+G C+  + +   AEIY I +   Y+ K IGSNLL ++        Y ++ L        ++FY ++ F+V     +++ DN D
  S:    25 ECINKYLNGSD--CFGAFKNHEIVGICISKQLSSSVAEIYNIAIAPEYQQKGIGSNLLKFVLNELALNGYSNVELGTGTFGYQLSFYQRHGFRVDSIVKDFFLDNYD 129
>gi|52144979|ref|YP_081848.1| ribosomal-protein-alanine N-acetyltransferase [Bacillus cereus E33L] >gi|51978448|gb|AAU19998.1| ribosomal-protein-alanine N-acetyltransferase [Bacillus cereus E33L] (147 aa)
Score = 89, Expect = 1.2e-01, Identities = 32/128 (25%), Positives = 66/128 (51%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLE-SQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKEN-----YKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           ++ +IV++E+  F    +T +  +  L  +++ + ++ + +  ++GYC  +    E+ I  I ++  YR +K+G  LL  +         K++ LEV   +      Y K  F+    R  YY+DN +  L+ W+
  S:    12 DIAQIVAIEEASF-STPWTADAFHRELTMNEHAHYVVLEKDGHVIGYCGLWIIIDESHITNIAILPEYRGQKLGDALLKEVISEAKTLGVKTMTLEVRVSNEVAKQLYRKYGFQNGGIRKRYYADNQEDGLVMWV 145
>gi|162448191|ref|YP_001621323.1| ribosomal-protein-alanine N-acetyltransferase [Acholeplasma laidlawii PG-8A] >gi|161986298|gb|ABX81947.1| ribosomal-protein-alanine N-acetyltransferase [Acholeplasma laidlawii PG-8A] (143 aa)
Score = 89, Expect = 1.3e-01, Identities = 38/125 (30%), Positives = 64/125 (51%)
  Q:    14 ELNEIVSLEQEIFLHN-GYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK-----SIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           +L +IV LE+++F  + GY+    +  LE++  +  +Y  N +++GY  F + +  A+I    V   Y+ + IGS L  +     K     S+ LEV       I FY K    ++    NYY D  D ++M
  S:     9 DLEKIVQLEEKVFGASLGYSFLK-SELLENEFSHIYVYTLNNEVIGYLSFRQIDTNADILNFLVDIPYQGQGIGSQLFEHALLEMKSSGVNSLVLEVRVSNQKAIAFYEKYGAVIVTVIPNYY-DKEDGYMM 138
>gi|74002728|ref|XP_535745.2| PREDICTED: similar to Mak3 homolog [Canis familiaris] (465 aa)
Score = 89, Expect = 1.3e-01, Identities = 22/76 (28%), Positives = 46/76 (60%)
  Q:    64 ENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE------NYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYS--DNSDAFLMK 139
           +N++   I  +G +  YR   IG+ +L+++         + +I+L V    ++ I+FY K  F++I  + NYY   + +DA +++
  S:   363 QNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQ 447
>gi|18313208|ref|NP_559875.1| N-acetyltransferase [Pyrobaculum aerophilum str. IM2] >gi|18160724|gb|AAL64057.1| N-acetyltransferase [Pyrobaculum aerophilum str. IM2] (166 aa)
Score = 89, Expect = 1.3e-01, Identities = 34/126 (26%), Positives = 55/126 (43%)
  Q:    11 SESELNEIVSLEQEIFLHNGYTLENLNSFLESQ-NFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDNSDAF 136
           + S++  I+ +E++ F       + L  FL +  N Y  +Y  N  + GY +       A +  I V   YR + IG  LL              +FLEV   +   ++ Y    F+V     +YYSD  D +
  S:     6 TASDVPYILEIERKSFKPEDIYSDELLKFLCAYCNDYSYVYVLNGTVAGYIITCHEGNAAHVISIAVAPEYRRRGIGKRLLCTALRLMATGKVSEVFLEVRVSNAPALHLYKSAGFEVAEFLKSYYSDGEDGY 138
>gi|14601741|ref|NP_148282.1| N-terminal acetyltransferase [Aeropyrum pernix K1] >gi|5105650|dbj|BAA80963.1| N-terminal acetyltransferase [Aeropyrum pernix K1] (191 aa)
Score = 89, Expect = 1.3e-01, Identities = 28/75 (37%), Positives = 39/75 (52%)
  Q:    64 ENEQEAEIYKIGVVYSYRNKKIGSNLLS----YLKENYK--SIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           E      +  I V   +R + IGS LLS     +K  Y+  +IFLEV   +   I  Y K  F+ + +   YY D  DAF+M
  S:   105 EERPVGHLVSIAVRPGFRGRGIGSKLLSATVRVMKNVYRVDAIFLEVRVSNMPAIRLYEKFGFRKVRRIKGYYRDGEDAFVM 186
>gi|153196627|ref|ZP_01940997.1| hypothetical protein LMRG_01271 [Listeria monocytogenes 10403S] >gi|127634088|gb|EBA23480.1| hypothetical protein LMRG_01271 [Listeria monocytogenes 10403S] (153 aa)
Score = 88, Expect = 1.4e-01, Identities = 29/99 (29%), Positives = 54/99 (54%)
  Q:    34 ENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDN 132
           + +  +L+  + + L++ D+  I   CLF  N  + EI  I V   YRN+ IG  LL       + +++  I ++  +   + + FY KN F++ H   NY+++N
  S:    25 KQIAKYLDKSHVFQLMH-DDIVIGIICLFPLNNDQLEIMNIAVSSDYRNQGIGKKLLEKAFDYAIHKHFLKIIVKTGNSSIDQLAFYQKNGFRMQHIIPNYFTEN 128
>gi|88810469|ref|ZP_01125726.1| ribosomal-protein-alanine acetyltransferase [Nitrococcus mobilis Nb-231] >gi|88792099|gb|EAR23209.1| ribosomal-protein-alanine acetyltransferase [Nitrococcus mobilis Nb-231] (160 aa)
Score = 88, Expect = 1.4e-01, Identities = 26/83 (31%), Positives = 45/83 (54%)
  Q:    47 CLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS-YLKENYK----SIFLEVSDRD-NTINFYLKNNFKVIHKRDNYY 129
           C ++    QI+GY +      EA I  I V   ++N+  G NLL   L+++ +    ++FLEV   +   ++ Y    F V+ +R +YY
  S:    50 CCVHMFANQIVGYVVLRYGAGEAHILNIAVGPQWQNRGFGRNLLQRTLRQSARFGAQTLFLEVRPSNAAALHLYRSVGFCVVGRRRDYY 138
>gi|163798433|ref|ZP_02192340.1| ribosomal-protein-alanine acetyltransferase [Methanococcus voltae A3] >gi|158972440|gb|EDP39908.1| ribosomal-protein-alanine acetyltransferase [Methanococcus voltae A3] (161 aa)
Score = 88, Expect = 1.4e-01, Identities = 39/140 (27%), Positives = 76/140 (54%)
  Q:     6 NKNNISESELNEIVSLEQEIFLHN--GYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY------KSIFLEVSDRDNTIN-FYLKNNF---KVIHKRDNYYSDNSDAFLMKWIKQGI 145
           N     ES+LN ++ +E++ F +    + +++L+S  +  + + +   ++  +LGY +       A +  I V   YR++ IG+ LL  ++ ++      K + LEV   +     FY K  +   K+++K   YY D SDA LM   ++G+
  S:     4 NLRTFKESDLNRVLEIEKQSFDYEYPEFLIKSLHS--KCPDGFLVAVDESGYVLGYIITVLEWGNAHVVSIAVDKDYRHQGIGNLLLDAIENHFFTVYAVKHVVLEVRFTNTVARMFYYKRGYSDRKILYK---YYDDGSDAILMIKKRKGL 150
>gi|147776900|emb|CAN65722.1| hypothetical protein [Vitis vinifera] >gi|157339613|emb|CAO44154.1| unnamed protein product [Vitis vinifera] (164 aa)
Score = 88, Expect = 1.5e-01, Identities = 22/61 (36%), Positives = 39/61 (63%)
  Q:    71 IYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSD 131
           I  +GV+  YR   IG+ LL+++     K+N   ++L V ++ ++ INFY K  F++     NYY++
  S:    78 IMTLGVLAPYRGLGIGTKLLNHVLDLCSKQNIPEVYLHVQTNNEDAINFYKKFGFEITDTIQNYYTN 144
>gi|76178814|gb|ABA40997.1| acetyltransferase [Vibrio fischeri] (150 aa)
Score = 88, Expect = 1.5e-01, Identities = 30/101 (29%), Positives = 52/101 (51%)
  Q:    34 ENLNSFLESQNFYCLIYKDNKQILGYCLFFE-NEQEAEIYKIGVVYSYRNKKIGSNLLSYLKEN-----YKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSD 134
           E +N +L   +  C     N +I+G C+  + +   AEIY I +   Y+ K IGSNLL ++        Y ++ L        ++FY ++ F+V     +++ DN D
  S:    25 ECINKYLNGSD--CFGAFKNHEIVGICISKQLSSSVAEIYNIAIAPEYQQKGIGSNLLKFVLNELALNGYSNVELGTGAFGYQLSFYQRHGFRVDSIVKDFFLDNYD 129
>gi|78484958|ref|YP_390883.1| ribosomal-protein-alanine acetyltransferase [Thiomicrospira crunogena XCL-2] >gi|78363244|gb|ABB41209.1| SSU ribosomal protein S18P alanine acetyltransferase [Thiomicrospira crunogena XCL-2] (151 aa)
Score = 88, Expect = 1.5e-01, Identities = 32/120 (26%), Positives = 61/120 (50%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIG----SNLLSYLKE-NYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYY 129
           ++ S+L+ ++S+EQ+ + +  ++ +     L+    Y L   D++  LGY  F     EA +    +   Y  + +G      L+ Y K  +Y+ + LEV + ++ ++ Y K  FK    R NYY
  S:     1 MTSSDLSWVLSVEQQAYDYP-WSEQGFEKALDDGLAYLLCDVDHRP-LGYACFLTVLDEAHLLNFCIASKYVRQGVGFAAMQALIEYFKSADYQIMLLEVRESNSAVHLYKKLGFKENGIRPNYY 123
>gi|182704834|ref|ZP_02957234.1| GCN5-related N-acetyltransferase [Methylocella silvestris BL2] >gi|172066158|gb|EDT52292.1| GCN5-related N-acetyltransferase [Methylocella silvestris BL2] (154 aa)
Score = 88, Expect = 1.5e-01, Identities = 30/126 (23%), Positives = 58/126 (46%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCL--FFENEQEAEIYKIGVVYSYRNKKIGSNLL---SYLKENYKSIFLEV---SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           +L  I  +E  +F  +  T  +L  FL ++    L      +++GY L    +    A +Y I +      + +G  LL       E + + FL +   +D  + I  Y KN +++  +  +YY D  +A  ++
  S:    10 DLPAIERIENAVFDGDRLTRRSLRYFLTAKRSLMLTLVSQDEVVGYSLVGLRKGSLRARLYSIALDPKQHGRGLGRMLLRASERAAEAHGARFLRLEVRTDNQSAIALYEKNGYRIFGRYQDYYEDGGEAIRLE 143
>gi|114778413|ref|ZP_01453258.1| hypothetical protein SPV1_12612 [Mariprofundus ferrooxydans PV-1] >gi|114551257|gb|EAU53815.1| hypothetical protein SPV1_12612 [Mariprofundus ferrooxydans PV-1] (365 aa)
Score = 88, Expect = 1.5e-01, Identities = 31/127 (24%), Positives = 60/127 (47%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGY--CLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           +++  +VSLEQ  F  +  +  +    L   +    ++    ++ GY   LF +N   A +Y + V    R K  G+ L++      L+    S+ LEV  +    I+ Y +  ++      +YY D++ A  M+
  S:     8 ADIPALVSLEQRCFATDRLSARSFRHLLTRGHASLFVFDMQAELQGYVLVLFHQNTSMARLYSLAVAPEGRGKGTGAALIAACEQDALEHGVVSMRLEVHINNAGAIDLYHRLGYRDFDVFPDYYEDHAAALRME 142
>gi|47095829|ref|ZP_00233434.1| acetyltransferase, GNAT family [Listeria monocytogenes str. 1/2a F6854] >gi|153175382|ref|ZP_01930740.1| hypothetical protein LMIG_00767 [Listeria monocytogenes FSL N3-165] >gi|153180144|ref|ZP_01933283.1| hypothetical protein LMMG_00909 [Listeria monocytogenes F6900] >gi|153183599|ref|ZP_01934459.1| hypotehtical protein [Listeria monocytogenes J0161] >gi|153191640|ref|ZP_01938830.1| hypothetical protein LMPG_02130 [Listeria monocytogenes J2818] >gi|47015833|gb|EAL06761.1| acetyltransferase, GNAT family [Listeria monocytogenes str. 1/2a F6854] >gi|126943890|gb|EBA21607.1| hypotehtical protein [Listeria monocytogenes J0161] >gi|127765074|gb|EBA25426.1| hypothetical protein LMPG_02130 [Listeria monocytogenes J2818] >gi|133729301|gb|EBA30999.1| hypothetical protein LMIG_00767 [Listeria monocytogenes FSL N3-165] >gi|133732319|gb|EBA34017.1| hypothetical protein LMMG_00909 [Listeria monocytogenes F6900] (153 aa)
Score = 88, Expect = 1.5e-01, Identities = 25/73 (34%), Positives = 41/73 (56%)
  Q:    60 CLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDN 132
           CLF  N  + EI  I V   YRN+ IG  LL       + +++  I ++  +   + + FY KN F++ H   NY+++N
  S:    50 CLFPLNNDQLEIMNIAVSSDYRNQGIGKKLLEKAFDYAIHKHFLKIIVKTGNSSIDQLAFYQKNGFRMQHIIPNYFTEN 128
>gi|57867554|ref|YP_189227.1| ribosomal-protein-alanine acetyltransferase, putative [Staphylococcus epidermidis RP62A] >gi|57638212|gb|AAW55000.1| ribosomal-protein-alanine acetyltransferase, putative [Staphylococcus epidermidis RP62A] (145 aa)
Score = 88, Expect = 1.6e-01, Identities = 34/136 (25%), Positives = 66/136 (48%)
  Q:     6 NKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYC-LIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVS------DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           N   +S  ++ ++  +E+  F H+ ++++     +E+  F    + + + +I+GY   +    +A+I  I +  ++R   +G  LL Y   NY     +V       D D   + Y    F+   KR NYY +  DA +M W+
  S:     2 NIRKMSVEDVPKVFDIERNSFSHSSWSIDAFYHEIENNEFATYFVIEFSDKIIGYVGLWLVVDQAQITTIAISKAFRGYGLGQLLLKY-AMNYARFSCDVMSLEVRIDNDVAQHVYRNLGFQNGGKRKNYYGEGEDALVM-WV 142
>gi|126459571|ref|YP_001055849.1| ribosomal-protein-alanine acetyltransferase [Pyrobaculum calidifontis JCM 11548] >gi|126249292|gb|ABO08383.1| ribosomal-protein-alanine acetyltransferase [Pyrobaculum calidifontis JCM 11548] (173 aa)
Score = 88, Expect = 1.6e-01, Identities = 34/126 (26%), Positives = 59/126 (46%)
  Q:    11 SESELNEIVSLEQEIFLHNG-YTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL----SYLKENYKS-IFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAF 136
           S  ++ EI  +E+  F  +  Y++E L       + +  +Y  N  ++GY +    +  A +  I V   +R + +G+ LL      L E   S +FLEV    +  +  Y    F+V  +   YYSD  D +
  S:    19 SPPDVEEIYGIEKLSFKPDDIYSVELLKFLCSFCSDHSYVYVSNGDVVGYIITCIEDNAAHVISIAVHPEHRQRGVGAALLCTALKLLTEGQVSEVFLEVRVTNEPALRLYKSAGFEVKERLPAYYSDGEDGY 151
>gi|19551428|ref|NP_599430.1| hypothetical protein NCgl0175 [Corynebacterium glutamicum ATCC 13032] >gi|62389073|ref|YP_224475.1| acetyltransferase [Corynebacterium glutamicum ATCC 13032] >gi|21322942|dbj|BAB97571.1| Hypothetical protein [Corynebacterium glutamicum ATCC 13032] >gi|41324406|emb|CAF18746.1| Acetyltransferase, GNAT family [Corynebacterium glutamicum ATCC 13032] (142 aa)
Score = 88, Expect = 1.6e-01, Identities = 30/107 (28%), Positives = 55/107 (51%)
  Q:    25 IFLHNGYTLENLNSFLE---SQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTINFYLKNNFKVIHK-RDNYYSD 131
           ++L +GY+   L+  +    SQ     I++D   I  +  +F     A I  I V+ S++   +GS LL+ +  ++  ++LE    D+ ++FY K  F +  K RD  + D
  S:    20 LWLASGYSAAQLDHTITHEISQMTTIGIFEDASPI-AFASYFNEPTRAVIEYIAVLESHQGMGLGSQLLNVVATSFPEVYLETD--DDAVDFYRKLGFVISPKERDPRWPD 127
>gi|125623426|ref|YP_001031909.1| putative acetyltransferase [Lactococcus lactis subsp. cremoris MG1363] >gi|124492234|emb|CAL97163.1| putative acetyltransferase [Lactococcus lactis subsp. cremoris MG1363] (154 aa)
Score = 88, Expect = 1.6e-01, Identities = 28/100 (28%), Positives = 50/100 (50%)
  Q:    35 NLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSN----LLSYLKENYKS--IFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSD 134
           +L ++LE+ + + L  K+ K +    +  + +   EI    V  S+  +  G      L++YLKEN  +  + L   D    + FY K  F++ H   NY+ +N D
  S:    28 HLENYLENGDLFTLSLKNGKTVACAVVIKKQKNTFEIENFAVETSFEGQGFGQQMMKQLITYLKENLAADELILGTDDVSGNVEFYEKCGFEITHIISNYFVENYD 133
>gi|16804156|ref|NP_465641.1| hypothetical protein lmo2117 [Listeria monocytogenes EGD-e] >gi|16411587|emb|CAD00195.1| lmo2117 [Listeria monocytogenes] (153 aa)
Score = 88, Expect = 1.6e-01, Identities = 25/73 (34%), Positives = 41/73 (56%)
  Q:    60 CLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDN 132
           CLF  N  + EI  I V   YRN+ IG  LL       + +++  I ++  +   + + FY KN F++ H   NY+++N
  S:    50 CLFPLNNDQLEIMNIAVSSDYRNQGIGKKLLEKAFDYAIHKHFIKIIVKTGNSSIDQLAFYQKNGFRMQHIIPNYFTEN 128
>gi|116511389|ref|YP_808605.1| acetyltransferase [Lactococcus lactis subsp. cremoris SK11] >gi|116107043|gb|ABJ72183.1| Acetyltransferase, GNAT family [Lactococcus lactis subsp. cremoris SK11] (154 aa)
Score = 88, Expect = 1.6e-01, Identities = 28/100 (28%), Positives = 51/100 (51%)
  Q:    35 NLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSN----LLSYLKENYKS--IFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSD 134
           +L ++LE+ + + L  K+ K +    +  + +   EI    V  S++ +  G      L++YLKEN  +  + L   D    + FY K  F++ H   NY+ +N D
  S:    28 HLENYLENGDLFTLSLKNGKTVACAVVIKKQKNTFEIENFAVETSFQGQGFGQQMMKQLITYLKENLAADELILGTDDISGNVEFYEKCGFEITHIISNYFVENYD 133
>gi|160946136|ref|ZP_02093347.1| hypothetical protein PEPMIC_00098 [Peptostreptococcus micros ATCC 33270] >gi|158447659|gb|EDP24654.1| hypothetical protein PEPMIC_00098 [Peptostreptococcus micros ATCC 33270] (144 aa)
Score = 88, Expect = 1.7e-01, Identities = 33/96 (34%), Positives = 54/96 (56%)
  Q:    43 QNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           +N   ++ +  + ++GY +F +   EAEIYKI V+   R K+I   ++ +L     K N K IFLEV   +   IN Y K  F  I +  +YY++  +  +M
  S:    37 KNQRVIVAEKEENVIGYVIFNQILDEAEIYKIVVLKELRKKQIAFKIIEFLLNELKKNNVKKIFLEVRKNNIPAINLYKKCGFINIREIVDYYNNPKENGIM 138
>gi|57969412|ref|XP_563593.1| AGAP002568-PA [Anopheles gambiae str. PEST] >gi|55242198|gb|EAL40895.1| AGAP002568-PA [Anopheles gambiae str. PEST] (236 aa)
Score = 88, Expect = 1.7e-01, Identities = 24/76 (31%), Positives = 44/76 (57%)
  Q:    64 ENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE------NYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYS--DNSDAFLMK 139
           EN +   I  +G +Y YR   IG+ ++ ++        N+ SIFL V  D    I FY +  F+++  + +YY   + +DA +++
  S:    75 ENMRRLYIMTLGCLYPYRRLGIGTVMVQHILNCVERDGNFDSIFLHVKVDNKGAIEFYKRFGFEIVETKQHYYKRIEPADAHVLQ 159
>gi|110760049|ref|XP_001119998.1| PREDICTED: similar to separation anxiety CG12352-PA [Apis mellifera] (168 aa)
Score = 88, Expect = 1.7e-01, Identities = 23/66 (34%), Positives = 38/66 (57%)
  Q:    64 ENEQEAEIYKIGVVYSYRNKKIGSNLLS------YLKENYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYY 129
           EN +   I  +G +Y YR   IG+ ++       Y   N+ SIFL V    +  I+FY K  F+++  +++YY
  S:    67 ENSRRLYIMTLGCLYPYRRLGIGTVMVQHVLNYVYKDGNFDSIFLHVQISNEGAIDFYKKFGFEIVETKEHYY 139
>gi|13542047|ref|NP_111735.1| acetyltransferase [Thermoplasma volcanium GSS1] >gi|14325478|dbj|BAB60382.1| N-terminal acetyltransferase complex subunit [ARD1] [Thermoplasma volcanium GSS1] (150 aa)
Score = 88, Expect = 1.7e-01, Identities = 36/127 (28%), Positives = 65/127 (51%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFE-NEQEAEIYKIGVVYSYRNKKIGSNLLSYLKEN-----YKSIFLEVSDRD-NTINFYLKNNFK----VIHKRDNYYSDNSDAFLM 138
           + +L  +  LE   F    Y  E L   LE+ +    I + + +I+GY +    N QE +I  I     +R + IG+ L++ ++       Y++I LEV   +   I+FY +  F     +++  + YY  + DA+ M
  S:     8 KQDLCAVARLEVRSFEIGPYDKEYLREVLENASSISYIAQISDKIVGYIVAMPLNSQEIDIESIATDPDFRKRSIGTRLIARIENESKSLGYRNIILEVRKENIEAISFYSRLGFNIKEFIVNYYEEYYRGSRDAYRM 145
>gi|46908353|ref|YP_014742.1| acetyltransferase [Listeria monocytogenes str. 4b F2365] >gi|47091870|ref|ZP_00229665.1| acetyltransferase, GNAT family [Listeria monocytogenes str. 4b H7858] >gi|153167994|ref|ZP_01928046.1| hypothetical protein LMHG_02424 [Listeria monocytogenes FSL N1-017] >gi|153203220|ref|ZP_01944543.1| hypotehtical protein [Listeria monocytogenes HPB2262] >gi|167015246|ref|ZP_02277779.1| acetyltransferase, GNAT family protein [Listeria monocytogenes FSL J1-194] >gi|46881624|gb|AAT04919.1| acetyltransferase, GNAT family [Listeria monocytogenes str. 4b F2365] >gi|47019881|gb|EAL10619.1| acetyltransferase, GNAT family [Listeria monocytogenes str. 4b H7858] >gi|133726583|gb|EBA28281.1| hypothetical protein LMHG_02424 [Listeria monocytogenes FSL N1-017] >gi|133734715|gb|EBA36413.1| hypotehtical protein [Listeria monocytogenes HPB2262] (153 aa)
Score = 88, Expect = 1.7e-01, Identities = 25/73 (34%), Positives = 41/73 (56%)
  Q:    60 CLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDN 132
           CLF  N+ + EI  I V   YRN+ IG  LL         +++  I ++  +   + + FY KN F++ H   NY+++N
  S:    50 CLFPLNKNQLEIMNIVVSSEYRNQGIGKKLLEKAFDYATHKHFSKIIVKTGNSSIDQLAFYQKNGFRMQHIIPNYFTEN 128
>gi|89896721|ref|YP_520208.1| hypothetical protein DSY3975 [Desulfitobacterium hafniense Y51] >gi|89336169|dbj|BAE85764.1| hypothetical protein [Desulfitobacterium hafniense Y51] (148 aa)
Score = 87, Expect = 1.8e-01, Identities = 37/135 (27%), Positives = 64/135 (47%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFL---ESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSDAFLMKWIKQG 144
           + ES+L+ I+ +E   F    +  ++  S L   E   ++CL ++ N  I+GY   +   +E  I  + V   Y+    G  L+       +KE  + + LEV   + +    Y +  F     R  YYSDN +  L+ W+  G
  S:     6 MQESDLSTILEIEHACF-PAPWAPQSFVSELRDNEYARYFCLEHEGN--IIGYMGLWFILEEGHITNVAVAPGYQGMGGGEFLMRSVIDLMVKEGMERMTLEVRASNTSAQRLYERLGFVTAGVRKGYYSDNREDALIMWLDIG 146
>gi|23466012|ref|NP_696615.1| ribosomal-protein-alanine N-acetyltransferase [Bifidobacterium longum NCC2705] >gi|23326731|gb|AAN25251.1| probable ribosomal-protein-alanine N-acetyltransferase [Bifidobacterium longum NCC2705] (197 aa)
Score = 87, Expect = 1.8e-01, Identities = 34/124 (27%), Positives = 63/124 (50%)
  Q:    15 LNEIVSLEQEIFLHNGYTLENLNSFLES--QNFYCLIYKDNKQ--ILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK-----SIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYS-DNSDAFLM 138
           +  I  LE E+F    +    +   L++  + +   +  + +Q  + GY  F+ + ++AE+  IGV  +Y+ + I + LL  L +  K      + LEV  D D  +  Y +  F+ +  R  YY  +  DA+ M
  S:    27 VRSIAQLEGELFGRGAWNANMVREELDAPARTYLLDVLGEAEQAVVRGYAGFWYDGEDAELMTIGVGKAYQRQGIAAALLQVLVDEAKRQGASRMLLEVRVDNDPALALYQRFGFERMGLRKRYYQPEGIDAYTM 161
>gi|163914895|ref|NP_001106444.1| hypothetical protein LOC100127619 [Xenopus tropicalis] >gi|172045602|sp|A8E5V7|NATU_XENTR N-acetyltransferase UNQ2771/PRO7155 homolog >gi|157423451|gb|AAI53735.1| Unknown (protein for MGC:181259) [Xenopus tropicalis] (242 aa)
Score = 87, Expect = 1.8e-01, Identities = 30/82 (36%), Positives = 45/82 (54%)
  Q:    49 IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLK--------ENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYS 130
           ++K++  IL    F  + Q A I  +GVV  +R + IGS LL  LK        ++ K+++L V +   N I FY   +F   H    YYS
  S:    77 VHKEDGDILASS-FSGDTQVAYILSLGVVKEFRKQGIGSLLLESLKSHISSTAQDHCKALYLHVLTTNSNAIRFYENRHFHQHHYLPYYYS 166
>gi|18149309|dbj|BAB83619.1| Orf132 [Staphylococcus aureus] (104 aa)
Score = 87, Expect = 1.9e-01, Identities = 22/70 (31%), Positives = 43/70 (61%)
  Q:    31 YTLENLNSFLESQNFYCLIYKDNKQILGYCLFF-----ENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSI 100
           + ++NL  FL   + +  I K+N +I+G+   +     + +    ++ IG++ +Y++K  GS LLS++KE  K I
  S:    12 FDIDNLKGFLNDTSSFGFIAKENNKIIGFAYCYTLLRPDGKTMFYLHSIGMLPNYQDKGYGSKLLSFIKEYSKEI 86
>gi|109647348|ref|ZP_01371252.1| ribosomal-protein-alanine acetyltransferase [Desulfitobacterium hafniense DCB-2] >gi|109642594|gb|EAT52148.1| ribosomal-protein-alanine acetyltransferase [Desulfitobacterium hafniense DCB-2] (147 aa)
Score = 87, Expect = 1.9e-01, Identities = 37/135 (27%), Positives = 64/135 (47%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFL---ESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSDAFLMKWIKQG 144
           + ES+L+ I+ +E   F    +  ++  S L   E   ++CL ++ N  I+GY   +   +E  I  + V   Y+    G  L+       +KE  + + LEV   + +    Y +  F     R  YYSDN +  L+ W+  G
  S:     5 MQESDLSTILEIEHACF-PAPWAPQSFVSELRDNEYARYFCLEHEGN--IIGYMGLWFILEEGHITNVAVAPGYQGMGGGEFLMRSVIDLMVKEGMERMTLEVRASNTSAQRLYERLGFVTAGVRKGYYSDNREDALIMWLDIG 145
>gi|42779362|ref|NP_976609.1| ribosomal-protein-alanine acetyltransferase [Bacillus cereus ATCC 10987] >gi|42735277|gb|AAS39217.1| ribosomal-protein-alanine acetyltransferase [Bacillus cereus ATCC 10987] (147 aa)
Score = 87, Expect = 1.9e-01, Identities = 29/96 (30%), Positives = 48/96 (50%)
  Q:    46 YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKEN-----YKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           Y ++ KD + ++GYC  +    E+ I  I ++  YR +K+G  LL  +         K++ LEV   +      Y K  F+    R  YY DN +  L+ W+
  S:    45 YVVLEKDGR-VIGYCGLWIIIDESHITNIAILPEYRGQKLGDALLKEVISEAKTLGVKTMTLEVRVSNEVAKQLYRKYGFQNGGIRKRYYVDNQEDGLVMWV 145
>gi|152974089|ref|YP_001373606.1| ribosomal-protein-alanine acetyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152022841|gb|ABS20611.1| ribosomal-protein-alanine acetyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98] (159 aa)
Score = 87, Expect = 1.9e-01, Identities = 29/96 (30%), Positives = 49/96 (51%)
  Q:    46 YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKEN-----YKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           Y ++ KD   ++GYC  +    E+ I  I ++  YR +K+G  LL  + +       K++ LEV   +      Y K  F+    R  YY+DN +  L+ W+
  S:    57 YIVVEKDG-LVVGYCGLWIIIDESHITNIAILPEYRGQKLGDALLQEVMKQAKEMGAKTMTLEVRVSNEVAKQLYRKYGFQNGGIRKRYYTDNYEDGLVMWV 157
>gi|15925040|ref|NP_372574.1| ribosomal-protein-alanine N-acetyltransfer [Staphylococcus aureus subsp. aureus Mu50] >gi|15927625|ref|NP_375158.1| hypothetical protein SA1855 [Staphylococcus aureus subsp. aureus N315] >gi|57650722|ref|YP_186856.1| ribosomal-protein-alanine acetyltransferase, putative [Staphylococcus aureus subsp. aureus COL] >gi|87159974|ref|YP_494654.1| ribosomal-protein-alanine acetyltransferase [Staphylococcus aureus subsp. aureus USA300] >gi|148268502|ref|YP_001247445.1| ribosomal-protein-alanine acetyltransferase [Staphylococcus aureus subsp. aureus JH9] >gi|150394565|ref|YP_001317240.1| ribosomal-protein-alanine acetyltransferase [Staphylococcus aureus subsp. aureus JH1] >gi|151222169|ref|YP_001332991.1| ribosomal-protein-alanine N-acetyltransferase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156980366|ref|YP_001442625.1| hypothetical protein SAHV_2035 [Staphylococcus aureus subsp. aureus Mu3] >gi|161510262|ref|YP_001575921.1| ribosomal-protein-alanine acetyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727584|ref|ZP_02759861.1| ribosomal-protein-alanine acetyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|13701845|dbj|BAB43137.1| SA1855 [Staphylococcus aureus subsp. aureus N315] >gi|14247823|dbj|BAB58212.1| similar to ribosomal-protein-alanine N-acetyltransfer [Staphylococcus aureus subsp. aureus Mu50] >gi|57284908|gb|AAW37002.1| ribosomal-protein-alanine acetyltransferase, putative [Staphylococcus aureus subsp. aureus COL] >gi|87125948|gb|ABD20462.1| ribosomal-protein-alanine acetyltransferase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|147741571|gb|ABQ49869.1| ribosomal-protein-alanine acetyltransferase [Staphylococcus aureus subsp. aureus JH9] >gi|149947017|gb|ABR52953.1| ribosomal-protein-alanine acetyltransferase [Staphylococcus aureus subsp. aureus JH1] >gi|150374969|dbj|BAF68229.1| ribosomal-protein-alanine N-acetyltransferase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156722501|dbj|BAF78918.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] >gi|160369071|gb|ABX30042.1| ribosomal-protein-alanine acetyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (154 aa)
Score = 87, Expect = 1.9e-01, Identities = 36/136 (26%), Positives = 67/136 (49%)
  Q:     6 NKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFY-CLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN------FYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           N   +++ ++ ++  LE+  F  + +T++     +E  NF    + +  +QI+GY   +    +A+I  + +  +YR   +G  LL Y   NY S   +V   +  +N       Y    F+   KR NYY +  DA +M W+
  S:    10 NIREMTKEDVPQVFDLERRSFNDSSWTIDAFYHEIEQNNFAKYFVLEFEQQIIGYLGLWIVIDQAQITTVAIDDNYRGYGLGQMLLKY-GINYASHTCDVMSLEVRVNNKVAQHVYENLGFQYGGKRKNYYGEGEDAMVM-WV 150
>gi|165873317|ref|ZP_02217921.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. A0488] >gi|167634086|ref|ZP_02392408.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. A0442] >gi|167640113|ref|ZP_02398380.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. A0193] >gi|170687729|ref|ZP_02878944.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. A0465] >gi|170709443|ref|ZP_02899849.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. A0389] >gi|177655755|ref|ZP_02937030.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. A0174] >gi|190567319|ref|ZP_03020233.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis Tsiankovskii-I] >gi|196041139|ref|ZP_03108435.1| ribosomal-protein-alanine acetyltransferase [Bacillus cereus NVH0597-99] >gi|196046270|ref|ZP_03113497.1| ribosomal-protein-alanine acetyltransferase [Bacillus cereus 03BB108] >gi|164710937|gb|EDR16510.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. A0488] >gi|167511924|gb|EDR87303.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. A0193] >gi|167530400|gb|EDR93115.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. A0442] >gi|170125647|gb|EDS94568.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. A0389] >gi|170668256|gb|EDT19004.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. A0465] >gi|172079984|gb|EDT65086.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. A0174] >gi|190561446|gb|EDV15417.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis Tsiankovskii-I] >gi|196023015|gb|EDX61695.1| ribosomal-protein-alanine acetyltransferase [Bacillus cereus 03BB108] >gi|196028074|gb|EDX66685.1| ribosomal-protein-alanine acetyltransferase [Bacillus cereus NVH0597-99] (147 aa)
Score = 87, Expect = 2.0e-01, Identities = 29/96 (30%), Positives = 48/96 (50%)
  Q:    46 YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKEN-----YKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           Y ++ KD + ++GYC  +    E+ I  I ++  YR  K+G  LL  +         K++ LEV   +      Y K  F+    R  YY+DN +  L+ W+
  S:    45 YVVLEKDGR-VIGYCGLWIIIDESHITNIAILPEYRGLKLGDALLKEVISEAKTLGVKTMTLEVRVSNEVAKQLYRKYGFQNGGIRKRYYADNQEDGLVMWV 145
>gi|118476007|ref|YP_893158.1| SSU ribosomal protein S18P alanine acetyltransferase [Bacillus thuringiensis str. Al Hakam] >gi|118415232|gb|ABK83651.1| SSU ribosomal protein S18P alanine acetyltransferase [Bacillus thuringiensis str. Al Hakam] (150 aa)
Score = 87, Expect = 2.0e-01, Identities = 29/96 (30%), Positives = 48/96 (50%)
  Q:    46 YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKEN-----YKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           Y ++ KD + ++GYC  +    E+ I  I ++  YR  K+G  LL  +         K++ LEV   +      Y K  F+    R  YY+DN +  L+ W+
  S:    48 YVVLEKDGR-VIGYCGLWIIIDESHITNIAILPEYRGLKLGDALLKEVISEAKTLGVKTMTLEVRVSNEVAKQLYRKYGFQNGGIRKRYYADNQEDGLVMWV 148
>gi|65317687|ref|ZP_00390646.1| COG0456: Acetyltransferases [Bacillus anthracis str. A2012] (140 aa)
Score = 87, Expect = 2.0e-01, Identities = 29/96 (30%), Positives = 48/96 (50%)
  Q:    46 YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKEN-----YKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           Y ++ KD + ++GYC  +    E+ I  I ++  YR  K+G  LL  +         K++ LEV   +      Y K  F+    R  YY+DN +  L+ W+
  S:    38 YVVLEKDGR-VIGYCGLWIIIDESHITNIAILPEYRGLKLGDALLKEVISEAKTLGVKTMTLEVRVSNEVAKQLYRKYGFQNGGIRKRYYADNQEDGLVMWV 138
>gi|116493211|ref|YP_804946.1| acetyltransferase [Pediococcus pentosaceus ATCC 25745] >gi|116103361|gb|ABJ68504.1| Acetyltransferase [Pediococcus pentosaceus ATCC 25745] (204 aa)
Score = 87, Expect = 2.0e-01, Identities = 41/128 (32%), Positives = 72/128 (56%)
  Q:    11 SESELNEIVSLEQEIFLHNGYT----LENLNSFLESQNFYCLIYKDNKQILGY--CLFFENEQEAEIYKIGVVYSYRNKKIGSNLL-SYLKE----NYKSIFLEVSDRDNTIN-FYLKNNF-KVIHKRDNYYSDNSDAFLM 138
           + +++ EI+++E+ ++  +G T    +   N      +   L+ + N Q+LG+    F +  + A I  + ++  Y+N+ IGS L+ S +K+     YKSI LEV   + T    YLK  F K   K+  Y+ D+ DA  M
  S:    51 TNTDIPEILTVERAVY--DGQTPWDRMAFANELRRKLDRLYLVIRHNDQLLGFIGASFDDRSKMAHITNVAILPEYQNRGIGSFLIESIIKKAQFIEYKSITLEVRKSNITAQALYLKIGFEKTGIKKRYYFGDHEDAIDM 189
>gi|164687090|ref|ZP_02211118.1| hypothetical protein CLOBAR_00716 [Clostridium bartlettii DSM 16795] >gi|164603975|gb|EDQ97440.1| hypothetical protein CLOBAR_00716 [Clostridium bartlettii DSM 16795] (179 aa)
Score = 87, Expect = 2.0e-01, Identities = 32/91 (35%), Positives = 47/91 (51%)
  Q:    48 LIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDNTI--NFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           L+ + +  I+GY   +    E  I  + V  +YR ++IG  L+  +      E   S+ LEV    NT+  N Y K  FK+   R  YYSD  DA +M
  S:    76 LVAELDSVIVGYVGVWFVVDEGHITNVAVHSNYRGQRIGDRLVEEMVKLCKSEGLVSMTLEVRS-SNTVAQNLYRKYGFKMAGVRKEYYSDREDAIIM 172
>gi|145294303|ref|YP_001137124.1| hypothetical protein cgR_0259 [Corynebacterium glutamicum R] >gi|140844223|dbj|BAF53222.1| hypothetical protein [Corynebacterium glutamicum R] (142 aa)
Score = 87, Expect = 2.0e-01, Identities = 30/107 (28%), Positives = 54/107 (50%)
  Q:    25 IFLHNGYTLENLNSFLE---SQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTINFYLKNNFKVIHK-RDNYYSD 131
           ++L +GY+   L+  +    SQ     I++D   I  +  +F     A +  I V+ S++   +GS LL  +  ++  I+LE    D+ ++FY K  F +  K RD  + D
  S:    20 LWLASGYSAAQLDHTITHEISQMTTIGIFEDASPI-AFASYFNEPTRAVVEYIAVLESHQGMGLGSQLLKVVATSFPEIYLETD--DDAVDFYRKLGFVISPKERDPRWPD 127
>gi|30260436|ref|NP_842813.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. Ames] >gi|47777794|ref|YP_016868.2| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183278|ref|YP_026530.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. Sterne] >gi|30253757|gb|AAP24299.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. Ames] >gi|47551499|gb|AAT29343.2| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49177205|gb|AAT52581.1| ribosomal-protein-alanine acetyltransferase [Bacillus anthracis str. Sterne] (145 aa)
Score = 87, Expect = 2.1e-01, Identities = 29/96 (30%), Positives = 48/96 (50%)
  Q:    46 YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKEN-----YKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           Y ++ KD + ++GYC  +    E+ I  I ++  YR  K+G  LL  +         K++ LEV   +      Y K  F+    R  YY+DN +  L+ W+
  S:    43 YVVLEKDGR-VIGYCGLWIIIDESHITNIAILPEYRGLKLGDALLKEVISEAKTLGVKTMTLEVRVSNEVAKQLYRKYGFQNGGIRKRYYADNQEDGLVMWV 143
>gi|189439198|ref|YP_001954279.1| Acetyltransferase [Bifidobacterium longum DJO10A] >gi|189427633|gb|ACD97781.1| Acetyltransferase [Bifidobacterium longum DJO10A] (184 aa)
Score = 87, Expect = 2.1e-01, Identities = 34/124 (27%), Positives = 63/124 (50%)
  Q:    15 LNEIVSLEQEIFLHNGYTLENLNSFLES--QNFYCLIYKDNKQ--ILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK-----SIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYS-DNSDAFLM 138
           +  I  LE E+F    +    +   L++  + +   +  + +Q  + GY  F+ + ++AE+  IGV  +Y+ + I + LL  L +  K      + LEV  D D  +  Y +  F+ +  R  YY  +  DA+ M
  S:    14 VRSIAQLEGELFGRGAWNANMVREELDAPARTYLLDVLGEAEQAVVRGYAGFWYDGEDAELMTIGVGKAYQRQGIAAALLQALVDEAKRQGASRMLLEVRVDNDPALALYQRFGFERMGLRKRYYQPEGIDAYTM 148
>gi|56460984|ref|YP_156265.1| acyltransferase [Idiomarina loihiensis L2TR] >gi|56179994|gb|AAV82716.1| Acyltransferase for 30S ribosomal subunit protein S18, GNAT family [Idiomarina loihiensis L2TR] (145 aa)
Score = 87, Expect = 2.1e-01, Identities = 28/102 (27%), Positives = 51/102 (50%)
  Q:    39 FLES--QNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIG----SNLLSYLKENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYY---SDNSDAFLMKW 140
           F ES  + + C     + +++G+ +      E  ++ I V   ++ +  G     +LL Y ++ +  +FLEV +     I  Y  N F  + +R NYY       DA +M+W
  S:    32 FSESHGEQYRCRRLLSDSRVIGFTISQLVADELTLHNIAVDPDFQGQGFGYKLMQDLLDYAEKKHCVVFLEVRASNAAAIRLYEGNGFDTVGRRVNYYPAADGREDALVMRW 143
>gi|91773718|ref|YP_566410.1| SSU ribosomal protein S18P alanine acetyltransferase [Methanococcoides burtonii DSM 6242] >gi|91712733|gb|ABE52660.1| SSU ribosomal protein S18P alanine acetyltransferase [Methanococcoides burtonii DSM 6242] (173 aa)
Score = 87, Expect = 2.2e-01, Identities = 34/126 (26%), Positives = 61/126 (48%)
  Q:    14 ELNEIVSLEQEIFL-HNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENE-QEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           +  +++++E E F  HN +   N   F E ++   L+   +  I+G+ + + +E  E  I+ + V   ++N  +G  LL+     +  +  KS  LEV    D  I  Y   +F       +YYSD     +MK
  S:    10 DFEQVLAIEMEAFTEHNPFVYMN---FYEMKDEGFLVATMDSNIIGFVMGYRSETNEGRIFSLAVKKEWQNIGVGKKLLNSILDLFKDKGIKSATLEVRISNDKAIQMYRNMDFIACWIEQDYYSDGESGIIMK 140
>gi|153813335|ref|ZP_01966003.1| hypothetical protein RUMOBE_03752 [Ruminococcus obeum ATCC 29174] >gi|149830625|gb|EDM85716.1| hypothetical protein RUMOBE_03752 [Ruminococcus obeum ATCC 29174] (145 aa)
Score = 87, Expect = 2.2e-01, Identities = 35/130 (26%), Positives = 65/130 (50%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSI-----FLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSD-NSDAFLMKWIKQ 143
           +L ++V +E  +F  + +T E   +FL  +N    + ++ ++IL YC       E +I  + V    + + IG  L+  + +  + I      LEV + + T    Y +  FK    R NYY+D   +A LM  +++
  S:    10 DLEQVVEIENRLF-SDPWTKEGFFTFLTKENTMFFVIEEKEKILAYCSMQTVLDEGDILNVAVSPDRQREGIGYFLVDSMLKMAEMIGIHIVHLEVREGNGTARRLYERLGFKEDGLRKNYYTDPTENAVLMTKMQE 145
>gi|54022850|ref|YP_117092.1| putative acetyltransferase [Nocardia farcinica IFM 10152] >gi|54014358|dbj|BAD55728.1| putative acetyltransferase [Nocardia farcinica IFM 10152] (178 aa)
Score = 86, Expect = 2.4e-01, Identities = 32/82 (39%), Positives = 44/82 (53%)
  Q:    58 GYCLFFENEQ-EAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS----IFLEV-SDRDNTINFYLKNNFKVIHKRDNYY-SDNSDAFLMK 139
           G  L  ++E  EAE++ IGV   Y    IG+ LL  L          +FLEV +D    I  Y K+ F +I  R NYY    +DA+ M+
  S:    69 GIALLGDDEHPEAEVHTIGVDPDYHRAGIGTLLLEALLAEAGKRGGPVFLEVRTDNAPAIALYAKHGFHIIGLRKNYYHPSGADAYTMR 157
>gi|29654129|ref|NP_819821.1| ribosomal-protein-alanine acetyltransferase [Coxiella burnetii RSA 493] >gi|154707659|ref|YP_001424252.1| ribosomal-protein-alanine acetyltransferase [Coxiella burnetii Dugway 5J108-111] >gi|161830175|ref|YP_001596898.1| ribosomal-protein-alanine acetyltransferase [Coxiella burnetii RSA 331] >gi|164685751|ref|ZP_01947483.2| ribosomal-protein-alanine acetyltransferase [Coxiella burnetii 'MSU Goat Q177'] >gi|165919053|ref|ZP_02219139.1| ribosomal-protein-alanine acetyltransferase [Coxiella burnetii RSA 334] >gi|29541395|gb|AAO90335.1| ribosomal-protein-alanine acetyltransferase [Coxiella burnetii RSA 493] >gi|154356945|gb|ABS78407.1| ribosomal-protein-alanine acetyltransferase [Coxiella burnetii Dugway 5J108-111] >gi|161762042|gb|ABX77684.1| ribosomal-protein-alanine acetyltransferase [Coxiella burnetii RSA 331] >gi|164601261|gb|EAX31890.2| ribosomal-protein-alanine acetyltransferase [Coxiella burnetii 'MSU Goat Q177'] >gi|165917248|gb|EDR35852.1| ribosomal-protein-alanine acetyltransferase [Coxiella burnetii RSA 334] (145 aa)
Score = 86, Expect = 2.4e-01, Identities = 26/86 (30%), Positives = 45/86 (52%)
  Q:    44 NFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS----YLKENYKS-IFLEVSDRDNT-INFYLKNNFKVIHKRDNYY 129
           N+Y  + + +  ++G+ +    E+E ++  I V   Y+ K + S LL     Y K ++ + + LEV   + + I FY K     I  R NYY
  S:    38 NYYGWVMESDHHLVGFIVILMQEKECQLMNIAVAPRYQRKGVASQLLQHALHYAKTHHATRLLLEVRKSNRSAIEFYKKAGGVEIGVRKNYY 129
>gi|15678804|ref|NP_275921.1| hypothetical protein MTH779 [Methanothermobacter thermautotrophicus str. Delta H] >gi|2621870|gb|AAB85282.1| conserved protein [Methanothermobacter thermautotrophicus str. Delta H] (170 aa)
Score = 86, Expect = 2.4e-01, Identities = 29/86 (33%), Positives = 41/86 (47%)
  Q:    39 FLESQNFYCLIYKDNKQILGYCLFF---ENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSI------FLEVSDRDNTINFYLKNNFKVIHK 124
           F  + +F   I +D  +I+G+ L F   +N  EA I+ + V  S R   I   LL       K +       +     D  I FYLKN FK + K
  S:    42 FFSTTSF---IAEDGDEIVGFLLGFISQDNPSEAYIHLLCVSPSLRGTGIAGRLLERFAGTVKGMGAREIYLITKPSNDRAIRFYLKNGFKPVEK 133
>gi|170756707|ref|YP_001782946.1| ribosomal-protein-alanine acetyltransferase [Clostridium botulinum B1 str. Okra] >gi|169121919|gb|ACA45755.1| ribosomal-protein-alanine acetyltransferase [Clostridium botulinum B1 str. Okra] (152 aa)
Score = 86, Expect = 2.5e-01, Identities = 34/112 (30%), Positives = 56/112 (50%)
  Q:    29 NGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           N Y  E  N F +   +  ++ K+  ++LG+   +    E  I  I V  ++R   IG+ L++ +     + N  SI LEV + +    N Y K  FK    R  YY+DN++  L+ W
  S:    34 NSYETELKNKFAK---YIVVLNKETNKVLGFAGMWLIIDECHITNIAVHPNHRGLGIGNILMNEIIDICKEHNLTSITLEVRESNTAAKNLYYKYGFKDSGIRKGYYADNNENALLMW 148
>gi|160878506|ref|YP_001557474.1| ribosomal-protein-alanine acetyltransferase [Clostridium phytofermentans ISDg] >gi|160427172|gb|ABX40735.1| ribosomal-protein-alanine acetyltransferase [Clostridium phytofermentans ISDg] (144 aa)
Score = 86, Expect = 2.5e-01, Identities = 31/121 (25%), Positives = 60/121 (49%)
  Q:    21 LEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEVSDRDNT-INFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           +EQE F         L    E  + Y L+ +D+  ++ YC  +    E  I  + V    R + IG  +L  L E     N +++ LEV + + + I+ Y +  F+ + KR ++Y+  ++  ++ W+
  S:    17 IEQETFSDPWSEESFLKEATEKDHIY-LVVEDSGNLIAYCGMWNITGEGYITNVCVKKEKRKQGIGKLMLVSLLEQAKLCNIEAVTLEVRESNQSAIHLYEQLGFQSVGKRKDFYAHPTEDAIIMWL 142
>gi|157111000|ref|XP_001651349.1| n-acetyltransferase separation anxiety [Aedes aegypti] >gi|108878596|gb|EAT42821.1| n-acetyltransferase separation anxiety [Aedes aegypti] (208 aa)
Score = 86, Expect = 2.5e-01, Identities = 25/66 (37%), Positives = 41/66 (62%)
  Q:    64 ENEQEAEIYKIGVVYSYRNKKIGS----NLLSYLKE--NYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYY 129
           +N +   I  +G +Y YR   IGS    ++L+Y++   N+ SIFL V  D +  I FY K  F+++  + +YY
  S:    67 DNLRRLYIMTLGCLYPYRRLGIGSVMVKHILNYVENDGNFDSIFLHVKVDNEGAIEFYKKFGFEIVETKQHYY 139
>gi|2052350|gb|AAB53088.1| N-terminal acetyl transferase [Sulfolobus shibatae] (87 aa)
Score = 86, Expect = 2.5e-01, Identities = 27/70 (38%), Positives = 42/70 (60%)
  Q:    69 AEIYKIGVVYSYRNKKIGSNLLSYLKENYK-----SIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
             I  I V  +YR K IG+ LLS ++E +K       +LEV+  +   I+FY +N + +++ R NYY     AF+M
  S:     2 GHIVSIAVEPAYRKKGIGTKLLSEIEERFKLNGAKYSYLEVNINNLPAISFYRENGYLIMYMRRNYYGRGKHAFVM 77
>gi|170757654|ref|YP_001780606.1| acetyltransferase [Clostridium botulinum B1 str. Okra] >gi|169122866|gb|ACA46702.1| acetyltransferase, GNAT family [Clostridium botulinum B1 str. Okra] (147 aa)
Score = 86, Expect = 2.6e-01, Identities = 26/70 (37%), Positives = 39/70 (55%)
  Q:    65 NEQEA--EIYKIGVVYSYRNKKIGSNLL----SYLKENYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSD 134
           NE+E   EI  +     Y+ +  GS L+     Y K+N K++ +   D   TI FY    FKV H+  N+++DN D
  S:    52 NEEEGIYEIKNLATYEKYQGQGYGSRLIKFIFEYYKDNCKTMLVGTGDSPLTIPFYKHCGFKVSHRIKNFFTDNYD 127
>gi|126669088|ref|ZP_01740019.1| Acetyltransferase [Marinobacter sp. ELB17] >gi|126626443|gb|EAZ97109.1| Acetyltransferase [Marinobacter sp. ELB17] (372 aa)
Score = 86, Expect = 2.6e-01, Identities = 34/123 (27%), Positives = 54/123 (43%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQE--AEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSDNSDAF 136
           +L+ +++LE   F  +  +  +   FLE      L+  D   +LGYCL   +     A IY I V    R K IG  L+   +          + LEV  D    I  Y +  ++      +YY D+ +A 
  S:    13 DLDALLALEHRCFSEDRISRRSFRRFLEMPRDRLLLASDGDTLLGYCLVLMSAATRLARIYSIAVNPGSRGKGIGEKLVQMAETEAADAGRIVMRLEVREDNPGAIALYKRLGYRQFGSYRDYYEDHGNAL 143
>gi|187251562|ref|YP_001876044.1| ribosomal-protein-alanine acetyltransferase [Elusimicrobium minutum Pei191] >gi|186971722|gb|ACC98707.1| ribosomal-protein-alanine acetyltransferase [Elusimicrobium minutum Pei191] (145 aa)
Score = 86, Expect = 2.7e-01, Identities = 37/130 (28%), Positives = 64/130 (49%)
  Q:    10 ISESELN---EIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           ISE++L+   EI  +E        + ++   S  E++  + L    + +++G+         AE+  + V+     K   S LL  +         K++ LEV++ +   +N Y K  FKVI KR  +Y+   DA LMK
  S:     4 ISEAKLSLVKEIAGVEFSQPYGALWGVKGFKSEFENKFAHILTALKDGKVIGFISVRAVADTAELLNLAVLPVQTKKGAASKLLDAMFNRLKNLGVKTVTLEVNETNLPAVNLYKKFGFKVIGKRGKFYNGVQDALLMK 142
>gi|186900573|ref|ZP_02973530.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 7424] >gi|186692363|gb|EDU16982.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 7424] (143 aa)
Score = 86, Expect = 2.8e-01, Identities = 40/134 (29%), Positives = 65/134 (48%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKD---NKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY----KSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWIKQGI 145
           + ELN + +L  E    +   +   N  L  QNF    Y+     K I+G+      E+E  + +I V   Y+N+ IG+ L++ LKE      K+I L V  +++  N Y K  F+V+ +   +        +MKWI   I
  S:    10 DDELNFLDALYTENMKESVERVYPWNPNLFRQNFVAADYQVIEIEKVIIGFIKVVREEKEIYLGEIQVRRVYQNQGIGTQLINSLKEEAQDSGKNIRLRVLQKNSAYNLYKKLGFEVVEESQTHK-------IMKWIPPSI 143
>gi|46191296|ref|ZP_00120470.2| COG0456: Acetyltransferases [Bifidobacterium longum DJO10A] (165 aa)
Score = 86, Expect = 2.8e-01, Identities = 27/83 (32%), Positives = 45/83 (54%)
  Q:    56 ILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK-----SIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYS-DNSDAFLM 138
           + GY  F+ + ++AE+  IGV  +Y+ + I + LL  L +  K      + LEV  D D  +  Y +  F+ +  R  YY  +  DA+ M
  S:    40 VRGYAGFWYDGEDAELMTIGVGKAYQRQGIAAALLQALVDEAKRQGASRMLLEVRVDNDPALALYQRFGFERMGLRKRYYQPEGIDAYTM 129
>gi|121535447|ref|ZP_01667257.1| ribosomal-protein-alanine acetyltransferase [Thermosinus carboxydivorans Nor1] >gi|121305956|gb|EAX46888.1| ribosomal-protein-alanine acetyltransferase [Thermosinus carboxydivorans Nor1] (151 aa)
Score = 86, Expect = 2.9e-01, Identities = 30/100 (30%), Positives = 49/100 (49%)
  Q:    46 YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWIKQGI 145
           Y L+ + +  ++GY   +    EA +  I V+ +YR + +G  LL+ L     K    S+ LEV    +     Y +  F     R  YYSD  +  L+ W K+G+
  S:    47 YYLVGEADGAVVGYAGVWIILDEAHVTNIAVLPAYRGQGLGEQLLTALMAYAKKRGALSMTLEVRVSNEGAQRLYRRLGFMPRGIRKQYYSDTKEDALIMW-KEGL 151
>gi|50593432|gb|AAT79463.1| putative acetyl-transferase [Agrobacterium luteum] (167 aa)
Score = 86, Expect = 2.9e-01, Identities = 26/101 (25%), Positives = 47/101 (46%)
  Q:    30 GYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYS 130
           G+      S L   +   LI +   +I G+ +  +   E E+  I V    +++ IG +LL ++     ++   ++FLE+   +     Y K  FK I  R  YY+
  S:    44 GWNHHQSRSMLSMPSAKLLIARRQDKICGFVISRQAADEEELLMIAVAPECQSQGIGYHLLEHMLLIAREDQVSAVFLEMRADNPAAKLYAKFGFKEIGMRKAYYT 149
>gi|81429173|ref|YP_396174.1| GNAT family N-acetyltransferase [Lactobacillus sakei subsp. sakei 23K] >gi|78610816|emb|CAI55867.1| Putative N-acetyltransferase, GNAT family [Lactobacillus sakei subsp. sakei 23K] (153 aa)
Score = 86, Expect = 2.9e-01, Identities = 24/94 (25%), Positives = 47/94 (50%)
  Q:    36 LNSFLESQNFYCLIYKDNKQILGYC-LFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYY 129
           +  +L     Y L       ++G   + F ++ + E+  I ++ +YRN+  G   L+ LK+      Y+++ +   D     I FYL+  F+  H R N++
  S:    29 IRRYLNDGQLYSLPLAGQSTVIGVMHVTFVDQTQVELKNIALLPAYRNQGYGQQALNDLKQMMVDLGYQTLLVGTGDGSLAAIGFYLRQGFRFDHIRKNFF 129
>gi|56418773|ref|YP_146091.1| ribosomal protein (S18)-alanine acetyltransferase [Geobacillus kaustophilus HTA426] >gi|56378615|dbj|BAD74523.1| ribosomal protein (S18)-alanine acetyltransferase [Geobacillus kaustophilus HTA426] (150 aa)
Score = 86, Expect = 2.9e-01, Identities = 31/129 (24%), Positives = 63/129 (48%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK-----SIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWIK 142
           +++E+V +E+  F          N  + ++    ++   N +I+GY   +    EA +  + V+  +R +K+G  L+  L +  +     ++ LEV   ++   + Y K  F+    R  YY DN +  L+ W+K
  S:    14 DIDEVVQVERASFTSPWSRESFYNELMYNRYAKYIVMVYNGRIIGYGGMWLVIDEAHVTNVAVLPQFRGQKLGEALMRRLMDMARQHGAATMTLEVRVSNHVAQSLYRKLGFRNGGIRKRYYPDNFEDALVMWVK 148
>gi|168028099|ref|XP_001766566.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162682211|gb|EDQ68631.1| predicted protein [Physcomitrella patens subsp. patens] (234 aa)
Score = 86, Expect = 2.9e-01, Identities = 29/82 (35%), Positives = 45/82 (54%)
  Q:    56 ILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE------NYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYS---DNSDAFL 137
           +LGY +         I  +GV+  YRN  I S LL  + E      + ++++L V   +   I FY KN F+ + +  N+Y+    N DAFL
  S:   106 MLGYEISKTERSLIYILTLGVIQPYRNSGIASALLWEVIEYANQMSSCRALYLHVIAYNRPAIMFYQKNMFQCLRRLHNFYTIEGQNHDAFL 197
>gi|15920446|ref|NP_376115.1| N-terminal acetyltransferase [Sulfolobus tokodaii str. 7] >gi|74574871|sp|Q976C3|Y258_SULTO Uncharacterized acetyltransferase ST0258 >gi|15621229|dbj|BAB65224.1| 167aa long hypothetical N-terminal acetyltransferase [Sulfolobus tokodaii str. 7] (167 aa)
Score = 85, Expect = 3.0e-01, Identities = 27/72 (37%), Positives = 42/72 (58%)
  Q:    67 QEAEIYKIGVVYSYRNKKIGSNLLSY----LKENYKS--IFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           ++  +  I V+  YR   IG+ LL      +KE Y +  ++LEV   ++  IN Y K  FK +    +YY+D  DA+LM
  S:    85 KKGHVVSIAVLEQYRRLGIGTALLQASMKAMKEVYNAEEVYLEVRVSNSPAINLYKKLGFKEVKVLRHYYADGEDAYLM 163
>gi|126174650|ref|YP_001050799.1| GCN5-related N-acetyltransferase [Shewanella baltica OS155] >gi|160875662|ref|YP_001554978.1| GCN5-related N-acetyltransferase [Shewanella baltica OS195] >gi|125997855|gb|ABN61930.1| GCN5-related N-acetyltransferase [Shewanella baltica OS155] >gi|160861184|gb|ABX49718.1| GCN5-related N-acetyltransferase [Shewanella baltica OS195] (148 aa)
Score = 85, Expect = 3.1e-01, Identities = 33/116 (28%), Positives = 56/116 (48%)
  Q:    14 ELNEIVSLEQ--EIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYC-LFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY-----KSIFLEVSDRDNTINFYLKNNFKVIHKRDNYY 129
           E NE+ S E   ++ L    +  ++ ++L     +C    D  QILG C + F+N   AEIY + V   ++ + IGS LL +   N      K + L        + +Y +  F+V     +Y+
  S:     2 EYNEVKSSEIPIDLLLEADPSEASITTYLSDS--WCFTASDKGQILGVCAVKFQNSTLAEIYNVSVYPEHQGRGIGSELLKFALANLPMKGIKRVELGTGTFGYQLTYYQRLGFRVESVVKDYF 123
>gi|192812725|ref|ZP_03041392.1| GCN5-related N-acetyltransferase [Geobacillus sp. Y412MC10] >gi|192798533|gb|EDV75046.1| GCN5-related N-acetyltransferase [Geobacillus sp. Y412MC10] (312 aa)
Score = 85, Expect = 3.1e-01, Identities = 24/72 (33%), Positives = 41/72 (56%)
  Q:    48 LIY-KDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNL----LSYLKENYKSIFLEVSDRDNTINFYLKNNF 119
           LIY KD  Q++  C     + +A +Y IGV+ +YR + + + +    LS LK+ Y  + L V + ++  + YL   F
  S:   220 LIYDKDTSQLIANCRLCLQDNQAAVYSIGVMPTYRGRGLATGMLKRALSVLKDKYPVLRLYVMEGNDAESVYLNLGF 296
>gi|148655033|ref|YP_001275238.1| ribosomal-protein-alanine acetyltransferase [Roseiflexus sp. RS-1] >gi|148567143|gb|ABQ89288.1| ribosomal-protein-alanine acetyltransferase [Roseiflexus sp. RS-1] (221 aa)
Score = 85, Expect = 3.1e-01, Identities = 26/85 (30%), Positives = 41/85 (48%)
  Q:    56 ILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN------FYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           I+GY   + +  E  I  I V   YR + IG  LL+ L +    +  +V   +  ++       YLK  F+    R  YY+DN +  L+ W
  S:    88 IVGYGGVWLSVDEGHITTIAVAPEYRGRGIGELLLNGLIDQALDLHADVLTLEVRVSNVVAQQLYLKYGFRPAGTRPRYYTDNGEDALIMW 178
>gi|70725984|ref|YP_252898.1| hypothetical protein SH0983 [Staphylococcus haemolyticus JCSC1435] >gi|68446708|dbj|BAE04292.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (154 aa)
Score = 85, Expect = 3.1e-01, Identities = 38/128 (29%), Positives = 66/128 (51%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNF--YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDR----DNTINFYLKNN--FKVIHKRDNYYSDNSDAFLMKWI 141
           ++  +  +E++ F  + +T++     L   NF  Y +I  +N +I+GY   +    +A+I  I +   +R   +G  LL Y+ + Y S   EV       DN I  ++  N  F+   KR NYY +  DA +M W+
  S:    18 DVPSVFDIERDSFNDSSWTIDAFYHELNENNFAKYFVIVFEN-EIIGYLGLWMVIDQAQITTIAIRKDFRGYGLGQLLLKYVMD-YASHSCEVMSLEVRIDNVIAQHVYTNLGFQFGGKRKNYYGEGEDAMVM-WV 150
>gi|153938375|ref|YP_001392668.1| ribosomal-protein-alanine acetyltransferase [Clostridium botulinum F str. Langeland] >gi|152934271|gb|ABS39769.1| ribosomal-protein-alanine acetyltransferase [Clostridium botulinum F str. Langeland] (152 aa)
Score = 85, Expect = 3.1e-01, Identities = 34/112 (30%), Positives = 55/112 (49%)
  Q:    29 NGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           N Y  E  N F +   +  ++ K+  ++LG+   +    E  I  I V  +YR   IG+ L++ +     + N   I LEV + +    N Y K  FK    R  YY+DN++  L+ W
  S:    34 NSYETELKNKFAK---YIVVLNKETNKVLGFSGMWLIIDECHITNIAVHPNYRGLGIGNILMNEIIDICKEHNLTGITLEVRESNTAAKNLYYKYGFKDSGIRKGYYADNNENALLMW 148
>gi|146302930|ref|YP_001190246.1| SSU ribosomal protein S18P alanine acetyltransferase [Metallosphaera sedula DSM 5348] >gi|145701180|gb|ABP94322.1| SSU ribosomal protein S18P alanine acetyltransferase [Metallosphaera sedula DSM 5348] (166 aa)
Score = 85, Expect = 3.1e-01, Identities = 25/72 (34%), Positives = 39/72 (54%)
  Q:    67 QEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIF------LEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           ++  +  I V+  YR K IG  LL+   E  K ++      LEV   +   I+ Y K  +K +    +YY+D  DA+LM
  S:    84 RKGHVVSIAVLEGYRRKGIGKQLLTSSMEKMKQVYGAEEVYLEVRVSNYPAISLYEKLGYKKVKLLKHYYADGEDAYLM 162
>gi|119720547|ref|YP_921042.1| GCN5-related N-acetyltransferase [Thermofilum pendens Hrk 5] >gi|119525667|gb|ABL79039.1| GCN5-related N-acetyltransferase [Thermofilum pendens Hrk 5] (247 aa)
Score = 85, Expect = 3.1e-01, Identities = 22/75 (29%), Positives = 44/75 (58%)
  Q:    48 LIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEVSDRD-NTINFYLKNNFKVI 122
           L+ +   ++LG+ + +++ + A +  + V  +YR+  IG  LLS L+E       + I L V D +   ++FYL+  + V+
  S:    12 LVAERGSEVLGFVIAYKHRERAYVDSLAVDPAYRDLGIGGRLLSGLEELLAKRGVERIALSVKDSNLRALDFYLRRGYGVV 92
>gi|150399413|ref|YP_001323180.1| ribosomal-protein-alanine acetyltransferase [Methanococcus vannielii SB] >gi|150012116|gb|ABR54568.1| ribosomal-protein-alanine acetyltransferase [Methanococcus vannielii SB] (161 aa)
Score = 85, Expect = 3.2e-01, Identities = 37/133 (27%), Positives = 59/133 (44%)
  Q:     6 NKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY-------KSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           N     E++L  +  +E++ F  N      ++ +    + + +   +N  I+GY +         I  I V  S+R   +G+ LLS + EN+       K   LEV  D      FY   N+       NYY D +DA LM
  S:     4 NIRKFRETDLKRVTDIEKQAFDKNYPEFLIMHIYTTFPDGFLVAEDENSMIIGYVIALVEWGNGHIVAIAVDESHRQIGVGTILLSSI-ENFLFNECHVKHTVLEVRFDNKFAREFYYSKNYSDRKVLYNYYDDGADAILM 143
>gi|56295553|emb|CAH04796.1| predicted acetyltransferase [uncultured archaeon] (132 aa)
Score = 85, Expect = 3.3e-01, Identities = 35/118 (29%), Positives = 60/118 (50%)
  Q:    21 LEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS----IFLEVSDRDNTI---NFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           +E+EIF      L ++     ++ F  L+ + +  + GY +      EA +  + V   YR KK+G++L+ Y  +  +S    I LEV  R N +    FY K  FK +     YY +  +A++M
  S:     1 MEEEIFHEPNPVLYSVIENYPTEGF--LVAEYDGVVCGYLVGALIMDEARVLLLAVKEGYRKKKVGTSLMEYYIDTVRSRANLIRLEV--RVNNLGAQTFYFKLGFKFLGVVSKYYRNGDNAYIM 121
>gi|115402121|ref|XP_001217137.1| conserved hypothetical protein [Aspergillus terreus NIH2624] >gi|114188983|gb|EAU30683.1| conserved hypothetical protein [Aspergillus terreus NIH2624] (163 aa)
Score = 85, Expect = 3.3e-01, Identities = 22/75 (29%), Positives = 44/75 (58%)
  Q:    56 ILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSD-RDNTINFYLKNNFKVIHKRDNYYS 130
           ++ Y ++   +  A ++K+ VV +YR + +G  L++Y+     KE  + I L V   RD   + Y++N F+   +  +YY+
  S:    71 VIAYAVYVRQKGAALLHKVCVVEAYRRRGVGMELMNYIRQRLQKEGCQYIQLWVDKARDAARSLYVRNGFEEREEIADYYA 151
>gi|22537897|ref|NP_688748.1| ribosomal-protein-alanine acetyltransferase, putative [Streptococcus agalactiae 2603V/R] >gi|76798239|ref|ZP_00780488.1| ribosomal-protein-alanine acetyltransferase [Streptococcus agalactiae 18RS21] >gi|77409382|ref|ZP_00786082.1| ribosomal-protein-alanine acetyltransferase [Streptococcus agalactiae COH1] >gi|22534794|gb|AAN00621.1|AE014271_16 ribosomal-protein-alanine acetyltransferase, putative [Streptococcus agalactiae 2603V/R] >gi|76586392|gb|EAO62901.1| ribosomal-protein-alanine acetyltransferase [Streptococcus agalactiae 18RS21] >gi|77172023|gb|EAO75192.1| ribosomal-protein-alanine acetyltransferase [Streptococcus agalactiae COH1] (135 aa)
Score = 85, Expect = 3.3e-01, Identities = 33/122 (27%), Positives = 61/122 (50%)
  Q:    18 IVSLEQEIFLHNGYTLENLNSFLESQNF-YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDN-SDAFLMK 139
           I S+  +++  + ++L  ++  L+  +  Y  +Y D  +++G+    +   E EI  I V  +Y+ K     L+S + +    +FLEV   +      Y +  F V+ KR NYY D   DA +M+
  S:    10 IWSVLSDVYDKSPWSLSQISEDLKKDSTDYFFVYNDG-EVIGFLALQQLVGEVEITNIAVKKNYQGKGYAYQLMSMIADIEVPVFLEVRYSNIVAQKLYERCGFVVLRKRKNYYHDPIEDAIVMR 133
>gi|73662137|ref|YP_300918.1| putative acetyltransferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72494652|dbj|BAE17973.1| putative acetyltransferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (154 aa)
Score = 85, Expect = 3.4e-01, Identities = 33/129 (25%), Positives = 67/129 (51%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNF-YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL----SYLKENYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           +++ ++  +E+  F  + ++++     +E   F +  + + N++I+GY   +    +A+I  I +  +YR   +G  LL    +Y++     + LEV  D D   + Y    F+   KR NYY +  DA +M W+
  S:    17 NDVPQVFDIERNSFNDSSWSIDAFYHEVEQNEFAHYFVIEFNEKIIGYIGIWLVIDQAQITTIAIDETYRGYGLGQLLLKYAMNYVQTKCDVMSLEVRVDNDVAQHVYTNLGFQYGGKRKNYYGEGEDAIVM-WV 150
>gi|147669227|ref|YP_001214045.1| ribosomal-protein-alanine acetyltransferase [Dehalococcoides sp. BAV1] >gi|146270175|gb|ABQ17167.1| ribosomal-protein-alanine acetyltransferase [Dehalococcoides sp. BAV1] (213 aa)
Score = 85, Expect = 3.4e-01, Identities = 31/87 (35%), Positives = 45/87 (51%)
  Q:    52 DNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL-SYLKE--NYKSIFLEVSDRDNTI---NFYLKNNFKVIHKRDNYYSDN-SDAFLM 138
           D+ +++GY   +     A +  + V  +YR K  G  LL S LKE   +K   + +  R + I   N YLK  F +   R  YY DN  DA +M
  S:    84 DHPKVIGYGAIWVMAGSAHLVSVAVREAYRRKGFGELLLISSLKEAIKHKCFEMTLEVRVSNIVAQNLYLKYGFAIKGIRKKYYLDNHEDALIM 177
>gi|73748447|ref|YP_307686.1| ribosomal-protein-alanine acetyltransferase [Dehalococcoides sp. CBDB1] >gi|73660163|emb|CAI82770.1| ribosomal-protein-alanine acetyltransferase [Dehalococcoides sp. CBDB1] (213 aa)
Score = 85, Expect = 3.5e-01, Identities = 31/87 (35%), Positives = 45/87 (51%)
  Q:    52 DNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL-SYLKE--NYKSIFLEVSDRDNTI---NFYLKNNFKVIHKRDNYYSDN-SDAFLM 138
           D+ +++GY   +     A +  + V  +YR K  G  LL S LKE   +K   + +  R + I   N YLK  F +   R  YY DN  DA +M
  S:    84 DHPKVIGYGAIWVMAGSAHLVSVAVREAYRRKGFGELLLISSLKEAIKHKCFEMTLEVRVSNIVAQNLYLKYGFAIKGIRKKYYLDNHEDALIM 177
>gi|148987871|ref|ZP_01819334.1| ribosomal-protein-alanine acetyltransferase, putative [Streptococcus pneumoniae SP6-BS73] >gi|147926335|gb|EDK77408.1| ribosomal-protein-alanine acetyltransferase, putative [Streptococcus pneumoniae SP6-BS73] (122 aa)
Score = 85, Expect = 3.5e-01, Identities = 23/76 (30%), Positives = 43/76 (56%)
  Q:    18 IVSLEQEIFLHNGYTLENLNSFL-ESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL 93
           I ++   ++L + +TLE + + L + Q +Y L Y D  +++G+    E   EAE+ +I V  +Y+ + I S L + L
  S:    17 IYAVMAAVYLVSPWTLEQIQADLSQDQTWYALAY-DGAEVIGFLAVQETLFEAEVLQIAVKGAYQGQGIASALFAQL 92
>gi|21283703|ref|NP_646791.1| hypothetical protein MW1974 [Staphylococcus aureus subsp. aureus MW2] >gi|49484276|ref|YP_041500.1| putative acetyltransferase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49486845|ref|YP_044066.1| putative acetyltransferase [Staphylococcus aureus subsp. aureus MSSA476] >gi|82751653|ref|YP_417394.1| ribosomal-protein-alanine acetyltransferase [Staphylococcus aureus RF122] >gi|21205145|dbj|BAB95839.1| MW1974 [Staphylococcus aureus subsp. aureus MW2] >gi|49242405|emb|CAG41118.1| putative acetyltransferase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49245288|emb|CAG43762.1| putative acetyltransferase [Staphylococcus aureus subsp. aureus MSSA476] >gi|82657184|emb|CAI81624.1| ribosomal-protein-alanine acetyltransferase [Staphylococcus aureus RF122] (154 aa)
Score = 85, Expect = 3.5e-01, Identities = 35/136 (25%), Positives = 67/136 (49%)
  Q:     6 NKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFY-CLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN------FYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           N   +++ ++ ++  +E+  F  + +T++     +E  NF    + +  +QI+GY   +    +A+I  + +  +YR   +G  LL Y   NY S   +V   +  +N       Y    F+   KR NYY +  DA +M W+
  S:    10 NIREMTKEDVPQVFDIERRSFNDSSWTIDAFYHEIEQNNFAKYFVLEFEQQIIGYLGLWIVIDQAQITTVAIDDNYRGYGLGQMLLKY-GINYASHTCDVMSLEVRVNNKVAQHVYENLGFQYGGKRKNYYGEGEDAMVM-WV 150
>gi|45358914|ref|NP_988471.1| hypothetical protein MMP1351 [Methanococcus maripaludis S2] >gi|45047780|emb|CAF30907.1| unnamed protein product [Methanococcus maripaludis S2] (161 aa)
Score = 85, Expect = 3.5e-01, Identities = 36/133 (27%), Positives = 62/133 (46%)
  Q:     6 NKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY-------KSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           N     E +L  ++ +E+E F  N      ++ +    + + +   +N++++GY +         I  I V  +Y+N  IG+ L+  + EN+       K   LEV  D      FY K ++       NYY D +DA LM
  S:     4 NIRKFREKDLKRVMEIEKESFDKNYPEFLMMHIYSSFPDGFLVAEDENEKVVGYIIALMEWGNGHIVSIAVDLAYQNYGIGNALIKSV-ENFLFNECHAKHCVLEVRFDNKKAREFYYKRDYVDRKVLYNYYDDGADAILM 143
>gi|33416261|ref|NP_878007.1| acetyltransferase GNAT family protein [Staphylococcus aureus] >gi|170780443|ref|YP_001715987.1| acetyltransferase [Staphylococcus aureus] >gi|33390945|gb|AAQ17151.1| acetyltransferase, GNAT family [Staphylococcus aureus] >gi|84993526|dbj|BAE75928.1| putative acetyltransferase [Staphylococcus aureus] >gi|113927250|emb|CAL22894.1| putative aminoglycoside acetyltransferase [Staphylococcus aureus] >gi|169264784|dbj|BAG12277.1| acetyltransferase [Staphylococcus aureus] (148 aa)
Score = 85, Expect = 3.6e-01, Identities = 22/70 (31%), Positives = 43/70 (61%)
  Q:    31 YTLENLNSFLESQNFYCLIYKDNKQILGYCLFF-----ENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSI 100
           + ++NL  FL   + +  I K+N +I+G+   +     + +    ++ IG++ +Y++K  GS LLS++KE  K I
  S:    30 FDIDNLKGFLNDTSSFGFIAKENNKIIGFAYCYTLLRPDGKTMFYLHSIGMLPNYQDKGYGSKLLSFIKEYSKEI 104
>gi|156546685|ref|XP_001604181.1| PREDICTED: similar to N-acetyltransferase [Nasonia vitripennis] (187 aa)
Score = 85, Expect = 3.7e-01, Identities = 24/66 (36%), Positives = 41/66 (62%)
  Q:    64 ENEQEAEIYKIGVVYSYRNKKIGS----NLLSYLKE--NYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYY 129
           EN +   I  +G +Y YR   IG+    ++L+Y++   N+ SIFL V  + +  I+FY K  F+++  +  YY
  S:    91 ENSRRLYIMTLGCLYPYRRLGIGTVMVQHVLNYVERDGNFDSIFLHVQVNNEGAIDFYKKFGFEIVETKKYYY 163
>gi|146295284|ref|YP_001179055.1| ribosomal-protein-alanine acetyltransferase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145408860|gb|ABP65864.1| SSU ribosomal protein S18P alanine acetyltransferase [Caldicellulosiruptor saccharolyticus DSM 8903] (153 aa)
Score = 85, Expect = 3.8e-01, Identities = 35/104 (33%), Positives = 55/104 (52%)
  Q:    38 SFL-ESQNFYCL--IYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIG----SNLLSYLKEN-YKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           SFL E +N Y +  +Y+++ ++ G+        E  I  I V    R + IG    S L+SY KEN    + LEV  ++   I+ Y    FK    R NYY++  D  ++ W+
  S:    34 SFLAEIENDYAIYFVYEEDSKVWGFAGMHHIVDEGHITNIAVHPQKRRQGIGKALLSALISYAKENGLIGLTLEVRSKNIPAISLYKSFGFKEAGLRKNYYTNPPDDAIIMWL 146
>gi|114050739|ref|NP_001040401.1| N-acetyltransferase [Bombyx mori] >gi|95102756|gb|ABF51319.1| N-acetyltransferase [Bombyx mori] (187 aa)
Score = 85, Expect = 3.8e-01, Identities = 24/66 (36%), Positives = 42/66 (63%)
  Q:    64 ENEQEAEIYKIGVVYSYRNKKIGS----NLLSYLKE--NYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYY 129
           EN +   I  +G +Y YR   +GS    ++L+Y+K+  N+ SIFL V  + +  I+ Y K  F+++  ++ YY
  S:    67 ENSRRLYIMTLGCLYPYRRLGMGSMMVKHVLNYVKQDGNFDSIFLHVQVNNEGAIDSYKKFGFEMVETKERYY 139
>gi|153807927|ref|ZP_01960595.1| hypothetical protein BACCAC_02213 [Bacteroides caccae ATCC 43185] >gi|149129536|gb|EDM20750.1| hypothetical protein BACCAC_02213 [Bacteroides caccae ATCC 43185] (147 aa)
Score = 85, Expect = 3.8e-01, Identities = 22/71 (30%), Positives = 38/71 (53%)
  Q:    64 ENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY----KSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSD 134
           E E   EI  I  V  ++ +  G  L+ +L E+Y      + +   D  +TI+FY    F + H+ +N+++DN D
  S:    53 EGEGIYEIKNIATVPFFQRQGYGKRLIEFLFEHYLDKCTEMLVGTGDVSSTISFYEHCGFTISHRVENFFTDNYD 127
>gi|149622942|ref|XP_001516859.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus] (202 aa)
Score = 85, Expect = 3.8e-01, Identities = 33/131 (25%), Positives = 66/131 (50%)
  Q:     9 NISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAE---IYKIGVVYSYRNKKIGSNLLSYLKE------NYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYS--DNSDAFLMK 139
           +++   + ++  L Q IF    Y  +     LE      L Y ++  +   C   ++ Q  +   I  +G +  YR   IG+ +L+++         + +I+L V    ++ I+FY K  F+VI  + NYY   + +DA +++
  S:    41 DVTPHNIKQLKRLNQVIF-PVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQSQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEVIETKKNYYKRIEPADAHVLQ 182
>gi|29377855|ref|NP_816983.1| acetyltransferase [Enterococcus faecalis V583] >gi|32470426|ref|NP_863642.1| hypothetical protein pSK41_p43 [Staphylococcus aureus] >gi|57867488|ref|YP_189151.1| acetyltransferase [Staphylococcus epidermidis RP62A] >gi|70726613|ref|YP_253527.1| acetyltransferase [Staphylococcus haemolyticus JCSC1435] >gi|3676453|gb|AAC61971.1| unknown [Staphylococcus aureus] >gi|29345307|gb|AAO83054.1| acetyltransferase, GNAT family [Enterococcus faecalis V583] >gi|57638146|gb|AAW54934.1| acetyltransferase, GNAT family [Staphylococcus epidermidis RP62A] >gi|68447337|dbj|BAE04921.1| acetyltransferase, GNAT family [Staphylococcus haemolyticus JCSC1435] (130 aa)
Score = 85, Expect = 3.8e-01, Identities = 22/70 (31%), Positives = 43/70 (61%)
  Q:    31 YTLENLNSFLESQNFYCLIYKDNKQILGYCLFF-----ENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSI 100
           + ++NL  FL   + +  I K+N +I+G+   +     + +    ++ IG++ +Y++K  GS LLS++KE  K I
  S:    12 FDIDNLKGFLNDTSSFGFIAKENNKIIGFAYCYTLLRPDGKTMFYLHSIGMLPNYQDKGYGSKLLSFIKEYSKEI 86
>gi|14141850|ref|NP_115316.1| hypothetical protein SAVP027 [Staphylococcus aureus subsp. aureus Mu50] >gi|148244162|ref|YP_001220638.1| GCN5-related N-acetyltransferase [Staphylococcus aureus subsp. aureus JH9] >gi|150375702|ref|YP_001312299.1| GCN5-related N-acetyltransferase [Staphylococcus aureus subsp. aureus JH1] >gi|14020911|dbj|BAB47535.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] >gi|147742291|gb|ABQ50534.1| GCN5-related N-acetyltransferase [Staphylococcus aureus subsp. aureus JH9] >gi|149947690|gb|ABR53625.1| GCN5-related N-acetyltransferase [Staphylococcus aureus subsp. aureus JH1] (134 aa)
Score = 84, Expect = 3.9e-01, Identities = 22/70 (31%), Positives = 43/70 (61%)
  Q:    31 YTLENLNSFLESQNFYCLIYKDNKQILGYCLFF-----ENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSI 100
           + ++NL  FL   + +  I K+N +I+G+   +     + +    ++ IG++ +Y++K  GS LLS++KE  K I
  S:    16 FDIDNLKGFLNDTSSFGFIAKENNKIIGFAYCYTLLRPDGKTMFYLHSIGMLPNYQDKGYGSKLLSFIKEYSKEI 90
>gi|150402521|ref|YP_001329815.1| ribosomal-protein-alanine acetyltransferase [Methanococcus maripaludis C7] >gi|150033551|gb|ABR65664.1| ribosomal-protein-alanine acetyltransferase [Methanococcus maripaludis C7] (161 aa)
Score = 84, Expect = 4.1e-01, Identities = 37/133 (27%), Positives = 61/133 (45%)
  Q:     6 NKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY-------KSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           N     E +L  ++ +E+E F  N      ++ +    + + +   +  +I+GY +         +  I V  +Y+N  IG+ LL+ + EN+       K   LEV  D      FY K N+       NYY D +DA LM
  S:     4 NIRKFREKDLKRVMEIEKESFDKNYPEFLMMHIYTSFPDGFLVAENEEGKIVGYIIALMEWGNGHVVSIAVDSAYQNYGIGNALLNAV-ENFLFNECHAKHCVLEVRFDNKKAREFYYKRNYVDRKVLYNYYDDGADAILM 143
>gi|90416580|ref|ZP_01224511.1| peptide n-acetyltransferase RimI [marine gamma proteobacterium HTCC2207] >gi|90331779|gb|EAS47007.1| peptide n-acetyltransferase RimI [marine gamma proteobacterium HTCC2207] (180 aa)
Score = 84, Expect = 4.1e-01, Identities = 35/125 (28%), Positives = 60/125 (48%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIY----KDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSY----LKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDN---SDAFLM 138
           +L ++ ++E E+   + ++ +     LE     CL+      D    +GY +      +AEI  I +   Y+  + GS LL+Y    L E  + + LEV   +   I+ Y    F  + +R +YY       DA LM
  S:    33 DLAQVAAIEVEV-TPDPWSAKQFQQSLEDHQ--CLVICRQNADPTAPIGYMVMCTVLDQAEILNIAIDPKYQGHRFGSQLLNYGLRSLPEVIQEVLLEVRVSNFPAISLYFNYGFIEVGRRRDYYRTEFGREDAILM 166
>gi|159041945|ref|YP_001541197.1| GCN5-related N-acetyltransferase [Caldivirga maquilingensis IC-167] >gi|157920780|gb|ABW02207.1| GCN5-related N-acetyltransferase [Caldivirga maquilingensis IC-167] (166 aa)
Score = 84, Expect = 4.1e-01, Identities = 24/71 (33%), Positives = 34/71 (47%)
  Q:    68 EAEIYKIGVVYSYRNKKIGSNLLSY----LKENYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           +  +  +GV+  YR   +G  L+      L+    SI LEV    D  IN Y    F++ H    YYSD   A+ M
  S:    70 QGHVVSLGVLAEYRRMGVGRLLMCSSICRLRGIVDSIVLEVRVSNDAAINLYRSLGFRIHHTIPGYYSDGESAYFM 145
>gi|182678068|ref|YP_001832214.1| GCN5-related N-acetyltransferase [Beijerinckia indica subsp. indica ATCC 9039] >gi|182633951|gb|ACB94725.1| GCN5-related N-acetyltransferase [Beijerinckia indica subsp. indica ATCC 9039] (146 aa)
Score = 84, Expect = 4.3e-01, Identities = 28/124 (22%), Positives = 56/124 (45%)
  Q:    13 SELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCL--FFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVS------DRDNTINFYLKNNFKVIHKRDNYYSDNSDAF 136
           ++L ++ +LE   F H+  +  +L +++ S     L+    + + GY L  F +N   A +Y + +      + +G  LL+  ++  +             D    I  Y K  ++   K D+YY D + A 
  S:     9 ADLAKLEALECAAFAHDRLSRRSLRAYILSPRVIMLVAIHERVLAGYSLVAFRKNSSVARLYSLAIAPEKSGRGLGGALLAASEKAARRRGAARLRLEVRVDNQPAIALYNKAGYRPFDKIDDYYEDGTSAL 140
>gi|167218058|ref|ZP_02287694.1| acetyltransferase, GNAT family protein [Listeria monocytogenes FSL J1-175] (141 aa)
Score = 84, Expect = 4.4e-01, Identities = 24/72 (33%), Positives = 40/72 (55%)
  Q:    60 CLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSD 131
           CLF  N+ + EI  I V   YRN+ IG  LL         +++  I ++  +   + + FY KN F++ H   NY+++
  S:    50 CLFPLNKNQLEIMNIVVSSEYRNQGIGKKLLEKAFDYATHKHFSKIIVKTGNSSIDQLAFYQKNGFRMQHIIPNYFTE 127
>gi|15239024|ref|NP_196695.1| GCN5-related N-acetyltransferase (GNAT) family protein [Arabidopsis thaliana] >gi|8953396|emb|CAB96669.1| separation anxiety protein-like [Arabidopsis thaliana] >gi|28416617|gb|AAO42839.1| At5g11340 [Arabidopsis thaliana] >gi|110743265|dbj|BAE99523.1| separation anxiety protein - like [Arabidopsis thaliana] (164 aa)
Score = 84, Expect = 4.5e-01, Identities = 24/59 (40%), Positives = 37/59 (62%)
  Q:    71 IYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYY 129
           I  +GV+  YR   IGSNLL+++     K+N   I+L V ++ ++ I FY K  F++     NYY
  S:    78 IMTLGVLAPYRGIGIGSNLLNHVLDMCSKQNMCEIYLHVQTNNEDAIKFYKKFGFEITDTIQNYY 142
>gi|151570623|gb|EDN36277.1| ribosomal-protein-alanine acetyltransferase [Francisella tularensis subsp. novicida GA99-3549] (146 aa)
Score = 84, Expect = 4.6e-01, Identities = 34/78 (43%), Positives = 43/78 (55%)
  Q:    52 DNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS----YL-KENYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYY 129
           +NKQ+L   +F +    AE+  I V  S  NK  G  LL     YL ++  K IFLEV  +  + I  Y K NFK I  R NYY
  S:    46 ENKQLLAVAIFSKIFDTAELLYICVDISKHNKGFGFKLLKDSIYYLAQQQIKEIFLEVDINNHSAIKLYQKLNFKKISLRKNYY 129
>gi|138893889|ref|YP_001124342.1| ribosomal-protein-alanine acetyltransferase [Geobacillus thermodenitrificans NG80-2] >gi|196251109|ref|ZP_03149789.1| ribosomal-protein-alanine acetyltransferase [Geobacillus sp. G11MC16] >gi|134265402|gb|ABO65597.1| Ribosomal-protein-alanine acetyltransferase [Geobacillus thermodenitrificans NG80-2] >gi|196209403|gb|EDY04182.1| ribosomal-protein-alanine acetyltransferase [Geobacillus sp. G11MC16] (150 aa)
Score = 84, Expect = 4.6e-01, Identities = 31/129 (24%), Positives = 62/129 (48%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK-----SIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKWIK 142
           +++E+V +E+  F          N  + ++    ++     +I+GY   +    EA +  + V+  +R +K+G  L+  L +  K     ++ LEV   ++   + Y K  F+    R  YY DN +  L+ W+K
  S:    14 DIDEVVQVERASFTAPWSRESFYNELMYNRYAKYIVMVHRGRIIGYGGMWLVIDEAHVTNVAVLPQFRGQKLGEALMRRLMDLAKQHGAVTMTLEVRVSNHVAQSLYRKLGFRNGGIRKRYYPDNFEDALVMWVK 148
>gi|151572070|gb|EDN37724.1| hypothetical protein FTDG_00517 [Francisella tularensis subsp. novicida GA99-3548] (148 aa)
Score = 84, Expect = 4.6e-01, Identities = 34/78 (43%), Positives = 43/78 (55%)
  Q:    52 DNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS----YL-KENYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYY 129
           +NKQ+L   +F +    AE+  I V  S  NK  G  LL     YL ++  K IFLEV  +  + I  Y K NFK I  R NYY
  S:    48 ENKQLLAVAIFSKIFDTAELLYICVDISKHNKGFGFKLLKDSIYYLAQQQIKEIFLEVDINNHSAIKLYQKLNFKKISLRKNYY 131
>gi|194546014|ref|YP_002081042.1| hypothetical protein PACG_00909 [Pseudomonas aeruginosa C3719] >gi|126166960|gb|EAZ52471.1| hypothetical protein PACG_00909 [Pseudomonas aeruginosa C3719] (365 aa)
Score = 84, Expect = 4.7e-01, Identities = 31/123 (25%), Positives = 55/123 (44%)
  Q:    14 ELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCL--FFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAF 136
           +L+ +V LE   F ++  +  N    L   +    + + +  +LGY L  F E    A +Y I +    R   +G  LL   ++  +      + LEV  D    I  Y +  ++      +YY D+S+A 
  S:    12 DLSALVELENRCFDYDRLSRRNFQWMLTRAHASLTVAEGDGGVLGYALVLFHEGTSLARLYSIAIDPRARGIGLGQKLLEAAEQAARDNDRAYMRLEVRPDNRGAIALYERKGYRPFATVRDYYEDHSEAL 142
>gi|195551783|ref|XP_002076294.1| GD15393 [Drosophila simulans] >gi|194201943|gb|EDX15519.1| GD15393 [Drosophila simulans] (184 aa)
Score = 84, Expect = 4.7e-01, Identities = 22/66 (33%), Positives = 38/66 (57%)
  Q:    64 ENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE------NYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYY 129
           EN++   I  +G ++ YR   IG+ +  ++        N+ SIFL V   +N  I FY K  F+++  ++ YY
  S:    67 ENQRRLYIMTLGCLFPYRRLGIGTVMFEHIMNFAEKDGNFDSIFLHVQINNNGAIEFYKKFGFEIVDTKEQYY 139
>gi|188589780|ref|YP_001921366.1| acetyltransferase [Clostridium botulinum E3 str. Alaska E43] >gi|188500061|gb|ACD53197.1| acetyltransferase [Clostridium botulinum E3 str. Alaska E43] (146 aa)
Score = 84, Expect = 4.7e-01, Identities = 37/115 (32%), Positives = 58/115 (50%)
  Q:    20 SLEQEIFLHNGYTLEN---LNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSD 134
           ++E   F+   Y  EN   +   L S + Y  +Y +N  I G+    E    A ++   V   Y+   IG  L+ Y K  Y S+ L+V  ++ N +NFY KNNFKV+ +  N  +  S+
  S:    21 NIEAHDFIQKEYWTENYDLVKQMLPSADVY--VYDENNVIKGFIGIVEENYIAGLF---VKKEYQRDGIGQMLIEYCKSKYLSLKLDVFIKNKNALNFYYKNNFKVLDEHINEDTKESE 134
>gi|76788625|ref|YP_330377.1| ribosomal-protein-alanine acetyltransferase [Streptococcus agalactiae A909] >gi|77406206|ref|ZP_00783276.1| ribosomal-protein-alanine acetyltransferase [Streptococcus agalactiae H36B] >gi|77412340|ref|ZP_00788652.1| ribosomal-protein-alanine acetyltransferase [Streptococcus agalactiae CJB111] >gi|76563682|gb|ABA46266.1| ribosomal-protein-alanine acetyltransferase [Streptococcus agalactiae A909] >gi|77161596|gb|EAO72595.1| ribosomal-protein-alanine acetyltransferase [Streptococcus agalactiae CJB111] >gi|77175200|gb|EAO77999.1| ribosomal-protein-alanine acetyltransferase [Streptococcus agalactiae H36B] (135 aa)
Score = 84, Expect = 4.7e-01, Identities = 33/122 (27%), Positives = 61/122 (50%)
  Q:    18 IVSLEQEIFLHNGYTLENLNSFLESQNF-YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDN-SDAFLMK 139
           I S+  +++  + ++L  ++  L+  +  Y  +Y D  +++G+    +   E EI  I V  +Y+ K     L+S + +    +FLEV   +      Y +  F V+ KR NYY D   DA +M+
  S:    10 IWSVLSDVYDKSPWSLSQISEDLKKDSTDYFFVYNDG-EVIGFLALQQLVGEVEITNIAVKKNYQGKGYAYQLMSMIADIEVPVFLEVRYSNIVAQKLYERCGFVVLGKRKNYYHDPIEDAIVMR 133
>gi|29376966|ref|NP_816120.1| ribosomal-protein-alanine acetyltransferase, putative [Enterococcus faecalis V583] >gi|29344431|gb|AAO82190.1| ribosomal-protein-alanine acetyltransferase, putative [Enterococcus faecalis V583] (154 aa)
Score = 84, Expect = 4.8e-01, Identities = 36/96 (37%), Positives = 51/96 (53%)
  Q:    43 QNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEVSDRDNTI---NFYLKNNFKVIHKRDNYYSD-NSDAFLM 138
           +N   L   +N Q LGY  +     EAEI  + V    +++ IG  L+   KE  KS     IFLEV  R++ I     Y K  F+ +  R NYY +   +AF+M
  S:    43 ENSEYLFLVENGQWLGYIAYHFILDEAEISHVVVNGQKQHQGIGCQLMKAFKEYVKSRDITQIFLEV--RESNILAQKLYEKTGFRKVAVRKNYYKEPQENAFVM 145
>gi|148381265|ref|YP_001255806.1| ribosomal-protein-alanine acetyltransferase [Clostridium botulinum A str. ATCC 3502] >gi|153931748|ref|YP_001385641.1| ribosomal-protein-alanine acetyltransferase [Clostridium botulinum A str. ATCC 19397] >gi|153935744|ref|YP_001389047.1| ribosomal-protein-alanine acetyltransferase [Clostridium botulinum A str. Hall] >gi|148290749|emb|CAL84880.1| putative acetyltransferase [Clostridium botulinum A str. ATCC 3502] >gi|152927792|gb|ABS33292.1| ribosomal-protein-alanine acetyltransferase [Clostridium botulinum A str. ATCC 19397] >gi|152931658|gb|ABS37157.1| ribosomal-protein-alanine acetyltransferase [Clostridium botulinum A str. Hall] (152 aa)
Score = 84, Expect = 4.8e-01, Identities = 34/112 (30%), Positives = 55/112 (49%)
  Q:    29 NGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           N Y  E  N F +   +  ++ K+  ++LG+   +    E  I  I V  +YR   IG+ L++ +     + N   I LEV + +    N Y K  FK    R  YY+DN++  L+ W
  S:    34 NSYETELKNKFAK---YIVVLNKETNKVLGFAGMWLIIDECHITNIAVHPNYRVLGIGNILMNEIIDICKEHNLTGITLEVRESNTAAKNLYYKYGFKDSGIRKGYYADNNENALLMW 148
>gi|118497535|ref|YP_898585.1| ribosomal-protein-alanine acetyltransferase [Francisella tularensis subsp. novicida U112] >gi|195536231|ref|ZP_03079238.1| acetyltransferase, gnat family [Francisella tularensis subsp. novicida FTE] >gi|118423441|gb|ABK89831.1| ribosomal-protein-alanine acetyltransferase [Francisella tularensis subsp. novicida U112] >gi|194372708|gb|EDX27419.1| acetyltransferase, gnat family [Francisella tularensis subsp. novicida FTE] (146 aa)
Score = 84, Expect = 5.0e-01, Identities = 34/78 (43%), Positives = 43/78 (55%)
  Q:    52 DNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS----YL-KENYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYY 129
           +NKQ+L   +F +    AE+  I V  S  NK  G  LL     YL ++  K IFLEV  +  + I  Y K NFK I  R NYY
  S:    46 ENKQLLAVAIFSKIFDTAELLYICVDISKHNKGFGFKLLKDSIYYLAQQQIKEIFLEVDINNHSAIKLYQKLNFKKISLRKNYY 129
>gi|126180308|ref|YP_001048273.1| ribosomal-protein-alanine acetyltransferase [Methanoculleus marisnigri JR1] >gi|125863102|gb|ABN58291.1| Acetyltransferase, GNAT family [Methanoculleus marisnigri JR1] (153 aa)
Score = 83, Expect = 5.1e-01, Identities = 31/130 (23%), Positives = 67/130 (51%)
  Q:    13 SELNEIVSLEQEIFLH--NGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIY----KIGVVYSYRNKKIGSNLLSYLKENY-----KSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAF-LMKWIK 142
           ++++++V++E+  F    +  TL+   ++     F   + ++N  + G+      +   E+Y     + V   YR + IG NL+  L+  Y      ++ LEV        +FY +  ++ + +   YY++  DA  +MKW +
  S:    13 ADISQVVAVERMAFADPWDEKTLQESLAYYPETFF---VARNNGDVAGFVAGGVEDTGEEVYGHIMNLAVAPGYRRRGIGRNLVRRLEREYVVLGASAVQLEVRVTNTGAQDFYRRLGYREVFQVAAYYANEEDALVMMKWFR 152
>gi|187778097|ref|ZP_02994570.1| hypothetical protein CLOSPO_01689 [Clostridium sporogenes ATCC 15579] >gi|187775025|gb|EDU38827.1| hypothetical protein CLOSPO_01689 [Clostridium sporogenes ATCC 15579] (147 aa)
Score = 83, Expect = 5.3e-01, Identities = 25/71 (35%), Positives = 36/71 (50%)
  Q:    64 ENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK----SIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSD 134
           E E   EI  I     Y+ +  GS L+ Y+ E YK    ++ +   D   TI FY    FK+ H+  N++ DN D
  S:    53 EKEGVYEIKNIATYEKYQGQGYGSQLIKYVFEYYKDKCKTMLVGTGDSPLTIPFYKHCGFKISHRVKNFFIDNYD 127
>gi|189461135|ref|ZP_03009920.1| hypothetical protein BACCOP_01782 [Bacteroides coprocola DSM 17136] >gi|189432225|gb|EDV01210.1| hypothetical protein BACCOP_01782 [Bacteroides coprocola DSM 17136] (148 aa)
Score = 83, Expect = 5.5e-01, Identities = 23/71 (32%), Positives = 37/71 (52%)
  Q:    64 ENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS----IFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSD 134
           E E   EI  I V  S + K  G  L+ YL   Y+     + +   D  +T++FY    F++ H+  N+++DN D
  S:    53 EGEGIYEIKNIAVCPSSQRKGYGKRLVDYLFGYYQGRCSVMLVGTGDTPSTLSFYEHCGFRISHRLKNFFTDNYD 127
>gi|113476063|ref|YP_722124.1| ribosomal-protein-alanine acetyltransferase [Trichodesmium erythraeum IMS101] >gi|110167111|gb|ABG51651.1| ribosomal-protein-alanine acetyltransferase [Trichodesmium erythraeum IMS101] (201 aa)
Score = 83, Expect = 5.5e-01, Identities = 28/109 (25%), Positives = 51/109 (46%)
  Q:    35 NLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLMKWIKQ 143
           N     +S NF   I   ++ I+G C  +   +EA I  +G+   Y++   G  LL  L     +   +   LEV+  + + ++ Y K  F+ + +R  YY    +  L+ W+  
  S:    58 NEEVMFKSSNFQLQINYSHQSIIGVCCLWAILEEAHITILGIHPQYQSLGFGQLLLYTLMRSAWERGLERATLEVAASNVSALSLYYKFGFQYVGRRRGYYQHTGEDALILWLSH 172
>gi|116619612|ref|YP_821768.1| GCN5-related N-acetyltransferase [Solibacter usitatus Ellin6076] >gi|116222774|gb|ABJ81483.1| GCN5-related N-acetyltransferase [Solibacter usitatus Ellin6076] (124 aa)
Score = 83, Expect = 5.6e-01, Identities = 25/75 (33%), Positives = 38/75 (50%)
  Q:    66 EQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYK-SIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSD-NSDAFLMKW 140
           + E EI  + V+   R K I   LL      +  S+FLEV    +    FY  +NF  + +R NYY + +  A +MK+
  S:    44 DDEREILNLAVMPELRRKGIAKALLQRCLSGFTGSLFLEVRVSNEAATQFYKHHNFHEVSRRANYYQNPDESAIVMKF 121
>gi|163811833|ref|ZP_02203515.1| ribosomal-protein-alanine acetyltransferase [Dehalococcoides sp. VS] >gi|157404489|gb|EDO70527.1| ribosomal-protein-alanine acetyltransferase [Dehalococcoides sp. VS] (211 aa)
Score = 83, Expect = 5.7e-01, Identities = 31/87 (35%), Positives = 44/87 (50%)
  Q:    52 DNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLL-SYLKE--NYKSIFLEVSDRDNTI---NFYLKNNFKVIHKRDNYYSDN-SDAFLM 138
           D  +++GY   +     A +  + V  +YR K  G  LL S LKE   +K   + +  R + I   N YLK  F +   R  YY DN  DA +M
  S:    82 DCPKVIGYGAIWVMAGSAHLVSVAVREAYRRKGFGELLLISSLKEAIKHKCFEMTLEVRVSNIVAQNLYLKYGFAIKGIRKKYYLDNHEDALIM 175
>gi|53711467|ref|YP_097459.1| hypothetical protein BF0176 [Bacteroides fragilis YCH46] >gi|60679737|ref|YP_209881.1| acetyltransferase protein [Bacteroides fragilis NCTC 9343] >gi|52214332|dbj|BAD46925.1| conserved hypothetical protein [Bacteroides fragilis YCH46] >gi|60491171|emb|CAH05919.1| possible acetyltransferase protein [Bacteroides fragilis NCTC 9343] (176 aa)
Score = 83, Expect = 5.7e-01, Identities = 32/124 (25%), Positives = 64/124 (51%)
  Q:     1 MITLKNKNNISESELNEIVSLEQEIFLHNGY-TLENLNSFLESQN-FYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSI-FLEVSDRDNT-----INFYLKNNFKVIHK 124
           M+TL    +  +S LN ++ L +E F  +    +  L   +E+    Y    + + ++ G  ++++      +  + V    RNKKIG  +L Y+ E+ K +  LEV   ++      +N+Y +N ++V+ K
  S:     1 MMTLIRITSADDSRLNRLIPLYEESFPESERRKIGQLKRMIENHAPMYFNAIECDGELSGMFVYWDMGDFYYLEHLAVFPEMRNKKIGQQVLDYVAEHLKGVRLLEVEPTEDEMTTRRVNYYRRNGYEVLDK 132
>gi|194097628|ref|YP_002000664.1| putative acetyltransferase [Neisseria gonorrhoeae NCCP11945] >gi|193932918|gb|ACF28742.1| putative acetyltransferase [Neisseria gonorrhoeae NCCP11945] (146 aa)
Score = 83, Expect = 5.8e-01, Identities = 30/113 (26%), Positives = 52/113 (46%)
  Q:    29 NGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSY----LKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYY----SDNSDAFLMKWI 141
           + +T     S L S +    + + + +I  + ++     E+E++ I      R + + S LL Y    L E  + + LEV   +      Y K+ F +  +R NYY        DA LM+ I
  S:    24 SAWTQRQFESALVSPSEQVFLAEKDGRIAAFIVWQNLPDESELHLIATAPECRRRGVASALLEYWYAHLPEGTQRLLLEVRAGNAAAQALYTKHGFSIAGRRKNYYCAADGQTEDAVLMEKI 145
>gi|59800500|ref|YP_207212.1| putative acetyltransferase [Neisseria gonorrhoeae FA 1090] >gi|59717395|gb|AAW88800.1| putative acetyltransferase [Neisseria gonorrhoeae FA 1090] (146 aa)
Score = 83, Expect = 5.8e-01, Identities = 30/113 (26%), Positives = 52/113 (46%)
  Q:    29 NGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSY----LKENYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYY----SDNSDAFLMKWI 141
           + +T     S L S +    + + + +I  + ++     E+E++ I      R + + S LL Y    L E  + + LEV   +      Y K+ F +  +R NYY        DA LM+ I
  S:    24 SAWTQRQFESALVSPSEQVFLAEKDGRIAAFIVWQNLPDESELHLIATAPECRRRGVASALLEYWYAHLPEGTQRLLLEVRAGNAAAQALYTKHGFSIAGRRKNYYCAADGQTEDAVLMEKI 145
>gi|168178389|ref|ZP_02613053.1| acetyltransferase, GNAT family [Clostridium botulinum NCTC 2916] >gi|182670367|gb|EDT82341.1| acetyltransferase, GNAT family [Clostridium botulinum NCTC 2916] (147 aa)
Score = 83, Expect = 6.0e-01, Identities = 25/70 (35%), Positives = 39/70 (55%)
  Q:    65 NEQEA--EIYKIGVVYSYRNKKIGSNLL----SYLKENYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSD 134
           NE+E   EI  +     Y+ +  GS L+     Y K+N K++ +   D   TI FY    FK+ H+  N+++DN D
  S:    52 NEEEGIYEIKNLATYEKYQGQGYGSRLIKFIFEYYKDNCKTMLVGTGDSLLTIPFYKHCGFKISHRIKNFFTDNYD 127
>gi|91224547|ref|ZP_01259808.1| putative acetyltransferase [Vibrio alginolyticus 12G01] >gi|91190435|gb|EAS76703.1| putative acetyltransferase [Vibrio alginolyticus 12G01] (144 aa)
Score = 83, Expect = 6.3e-01, Identities = 35/131 (26%), Positives = 60/131 (45%)
  Q:    12 ESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYC-----LIYKDNKQILGYCLFFE--NEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENY---KSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDNSDAFLMKWIK 142
           + +L  I  LE  +F  + Y       F   Q F C     L+ K+ +Q+ GY L     N  +  I  + V   +R K I  +LL  +        S+ L V  ++   ++ YL   FK + +  +Y+ D     +M+ +K
  S:     8 KEDLFAIYKLENTLFGEHAYP-----QFFFRQAFDCWGESLLVAKEGEQVAGYILLTTSTNAHQYWIMSLAVDIQHRGKGIARSLLENVIAPLTLGSSVKLTVDPKNQPALSLYLSLGFKTLEEEAHYFGDEESRLVMELVK 144
>gi|16077660|ref|NP_388474.1| hypothetical protein BSU05930 [Bacillus subtilis subsp. subtilis str. 168] >gi|1945109|dbj|BAA19717.1| ydiD [Bacillus subtilis] >gi|2632906|emb|CAB12412.1| ydiD [Bacillus subtilis subsp. subtilis str. 168] (151 aa)
Score = 83, Expect = 6.3e-01, Identities = 30/133 (22%), Positives = 59/133 (44%)
  Q:     9 NISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE-----NYKSIFLEVSDRDNTIN-FYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           N+   +++ +  +E   F          +  LE+   + L+ + +  + GYC  +    +A+I  I +   YR + +G  L     E     + + + LEV   ++     Y K   +    R NYY+DN +  L+ W+
  S:     9 NMRLEDIDHVYEIEASSFTSPWTKDSFYHELLENPYAHYLVIEKDGHLAGYCGIWIVMDDAQITNIAIKPEYRGQSLGETLFRSAVELCKEKDARRLSLEVRVSNHPAQGLYKKFGMQPGGIRKNYYTDNGEDALIMWV 147
>gi|88195948|ref|YP_500759.1| ribosomal-protein-alanine acetyltransferase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|87203506|gb|ABD31316.1| ribosomal-protein-alanine acetyltransferase [Staphylococcus aureus subsp. aureus NCTC 8325] (136 aa)
Score = 83, Expect = 6.3e-01, Identities = 35/125 (28%), Positives = 61/125 (48%)
  Q:    17 EIVSLEQEIFLHNGYTLENLNSFLESQNFY-CLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTIN------FYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           ++  LE+  F  + +T++     +E  NF    + +  +QI+GY   +    +A+I  + +  +YR   +G  LL Y   NY S   +V   +  +N       Y    F+   KR NYY +  DA +M W+
  S:     3 QVFDLERRSFNDSSWTIDAFYHEIEQNNFAKYFVLEFEQQIIGYLGLWIVIDQAQITTVAIDDNYRGYGLGQMLLKY-GINYASHTCDVMSLEVRVNNKVAQHVYENLGFQYGGKRKNYYGEGEDAMVM-WV 132
>gi|195151389|ref|XP_002016630.1| GL11686 [Drosophila persimilis] >gi|194110477|gb|EDW32520.1| GL11686 [Drosophila persimilis] (186 aa)
Score = 83, Expect = 6.5e-01, Identities = 24/66 (36%), Positives = 41/66 (62%)
  Q:    64 ENEQEAEIYKIGVVYSYRNKKIGS----NLLSYLKE--NYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYY 129
           EN++   I  +G +  YR   IG+    ++L+Y ++  N+ SIFL V  + D  I FY K  F+++  ++ YY
  S:    67 ENQRRLYIMTLGCLSPYRRLGIGTVMFEHILNYAEKDGNFDSIFLHVQINNDGAIEFYKKFGFEIVDTKEQYY 139
>gi|168179029|ref|ZP_02613693.1| ribosomal-protein-alanine acetyltransferase [Clostridium botulinum NCTC 2916] >gi|182669998|gb|EDT81974.1| ribosomal-protein-alanine acetyltransferase [Clostridium botulinum NCTC 2916] (152 aa)
Score = 83, Expect = 6.5e-01, Identities = 33/112 (29%), Positives = 55/112 (49%)
  Q:    29 NGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           N Y  E  N F +   +  ++ ++  ++LG+   +    E  I  I V  +YR   IG+ L++ +     + N   I LEV + +    N Y K  FK    R  YY+DN++  L+ W
  S:    34 NSYETELKNKFAK---YIVVLNEETNKVLGFAGMWLIIDECHITNIAVHPNYRGLGIGNILMNEIIDICKEHNLTGITLEVRESNTAAKNLYYKYGFKDSGIRKGYYADNNENALLMW 148
>gi|187776758|ref|ZP_02993231.1| hypothetical protein CLOSPO_00273 [Clostridium sporogenes ATCC 15579] >gi|187775417|gb|EDU39219.1| hypothetical protein CLOSPO_00273 [Clostridium sporogenes ATCC 15579] (152 aa)
Score = 83, Expect = 6.6e-01, Identities = 35/112 (31%), Positives = 53/112 (47%)
  Q:    29 NGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           N Y  E  N F +   +  ++ K   ++LG+   +    E  I  I V   YR   IG+ L++ +     K N   I LEV + +    N Y K  FK    R  YY+DN++  L+ W
  S:    34 NSYETELKNKFAK---YIVVVDKKTDKVLGFAGMWLIIDECHITNIAVHPYYRRLGIGNILMNEIIEICKKYNITGITLEVRESNAAAKNLYYKYGFKDSGIRKGYYADNNENALLMW 148
>gi|126651456|ref|ZP_01723660.1| ribosomal protein (S18)-alanine acetyltransferase [Bacillus sp. B14905] >gi|126591709|gb|EAZ85805.1| ribosomal protein (S18)-alanine acetyltransferase [Bacillus sp. B14905] (141 aa)
Score = 83, Expect = 6.6e-01, Identities = 25/96 (26%), Positives = 45/96 (46%)
  Q:    46 YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSIFLEVSDRDNTI------NFYLKNNFKVIHKRDNYYSDNSDAFLMKWI 141
           Y L   ++  I+G+C  +     A+I  + V+   R + IG  L+       +   +EV   +  +      N Y K +F+    R  YY+DN +  L+ W+
  S:    38 YVLAIDEDGSIIGFCGMWMVIDAAQITNVAVIEQARGRGIGEGLMREAMHIARLHGMEVMTLEVRVTNVVAQNLYRKLHFQDGGIRKGYYTDNGEDALVMWV 139
>gi|170759428|ref|YP_001788638.1| ribosomal-protein-alanine acetyltransferase [Clostridium botulinum A3 str. Loch Maree] >gi|169406417|gb|ACA54828.1| ribosomal-protein-alanine acetyltransferase [Clostridium botulinum A3 str. Loch Maree] (152 aa)
Score = 82, Expect = 6.6e-01, Identities = 34/112 (30%), Positives = 54/112 (48%)
  Q:    29 NGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDNTI-NFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           N Y  E  N F +   +  ++ K+  ++LG+   +    E  I  I V  +YR   IG+ L+  +     + N   I LEV + +    N Y K  FK    R  YY+DN++  L+ W
  S:    34 NSYETELKNKFAK---YIVVLNKETNKVLGFAGMWLIIDECHITNIAVHPNYRRLGIGNILMDEIINIGKEHNIIGITLEVRESNTAAKNLYYKYGFKDSGIRKGYYADNNENALLMW 148
>gi|168182827|ref|ZP_02617491.1| acetyltransferase, GNAT family [Clostridium botulinum Bf] >gi|182674031|gb|EDT85992.1| acetyltransferase, GNAT family [Clostridium botulinum Bf] (147 aa)
Score = 82, Expect = 6.6e-01, Identities = 25/70 (35%), Positives = 39/70 (55%)
  Q:    65 NEQEA--EIYKIGVVYSYRNKKIGSNLL----SYLKENYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSD 134
           NE+E   EI  +     Y+ +  GS L+     Y K+N K++ +   D   TI FY    FK+ H+  N+++DN D
  S:    52 NEEEGIYEIKNLATYEKYQGQGYGSRLIKFIFEYYKDNCKTMLVGTGDSLLTIPFYKHCGFKISHRIKNFFTDNYD 127
>gi|150401228|ref|YP_001324994.1| ribosomal-protein-alanine acetyltransferase [Methanococcus aeolicus Nankai-3] >gi|150013931|gb|ABR56382.1| ribosomal-protein-alanine acetyltransferase [Methanococcus aeolicus Nankai-3] (164 aa)
Score = 82, Expect = 6.7e-01, Identities = 36/102 (35%), Positives = 47/102 (46%)
  Q:    37 NSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS------YLKENYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           N F+ ++N      K N  I+GY +         I  I     YRN+ +G  LL       + K N K+I LEV  D  N   FY K  +       +YY D SDA LM
  S:    44 NGFMVAEN------KKNSYIVGYIIATIEWGNGHIVSIATDSKYRNRGVGGILLGSIENYLFKKYNVKNIILEVRFDNTNARKFYYKRGYFDKRLVKDYYDDGSDAILM 146
>gi|124485579|ref|YP_001030195.1| hypothetical protein Mlab_0757 [Methanocorpusculum labreanum Z] >gi|124363120|gb|ABN06928.1| GCN5-related N-acetyltransferase [Methanocorpusculum labreanum Z] (151 aa)
Score = 82, Expect = 6.8e-01, Identities = 24/85 (28%), Positives = 50/85 (58%)
  Q:    55 QILGYCL---FFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS-----IFLEVSDRDNT-INFYLKNNFKVIHKRDNYYSDNSDAFLMK 139
           +I+GY L    F + +  ++ +IGV    +   +GS+L++ L    K+     + L V+D +   I+FYLK  F++  + + Y+  N+   +++
  S:    55 EIMGYILGGIHFNDPKTGKLIRIGVKSDCQRMDVGSHLVAALFTEMKNQGVNKVHLTVADTNTAAISFYLKKGFQIRKREEKYFYPNASRLILE 148
>gi|40643008|emb|CAD91430.1| Mak3p-like protein [Crassostrea gigas] (194 aa)
Score = 82, Expect = 6.8e-01, Identities = 23/80 (28%), Positives = 50/80 (62%)
  Q:    60 CLFFENEQEAEIY--KIGVVYSYRNKKIGSNLLSYL------KENYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYYS--DNSDAFLMK 139
           C    ++Q+  +Y   +G +  YR   IG++++ ++        N+ ++FL V  + D  I FY K  F+++ ++ NYY   + +DA++++
  S:    66 CRVDTSDQQRRLYIMTLGCLAPYRRLGIGTSMVEHVLKICEEDNNFDNVFLHVQINNDGAIRFYEKFGFEIVEEKKNYYKRIEPADAYVLQ 156
>gi|15897159|ref|NP_341764.1| acetyltransferase [Sulfolobus solfataricus P2] >gi|13813346|gb|AAK40554.1| Acetyltransferase, putative [Sulfolobus solfataricus P2] (216 aa)
Score = 82, Expect = 6.9e-01, Identities = 27/72 (37%), Positives = 40/72 (55%)
  Q:    67 QEAEIYKIGVVYSYRNKKIGSNLLS----YLKENYKS--IFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           ++  +  I V+  YR K I + LL      +K +Y +  I+LEV   +   I  Y K NFK +     YY+D  DA+LM
  S:   134 RKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLM 212
>gi|24371792|ref|NP_715834.1| acetyltransferase [Shewanella oneidensis MR-1] >gi|24345591|gb|AAN53279.1|AE015469_3 acetyltransferase, GNAT family [Shewanella oneidensis MR-1] (147 aa)
Score = 82, Expect = 7.0e-01, Identities = 37/131 (28%), Positives = 59/131 (45%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYC-----LIYKD-NKQILGYCLFFENEQEAEIYKIGVVYS--YRNKKIGSNL----LSYLKENYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           + +SEL  +  LEQ IF  + Y       F   Q F C     L+  D N  +LGY L  ++     ++ + V  S   R + +G  L    L+ L    K + L V   +   + Y +  F   H   NY+   +D  +M +
  S:     7 VLKSELAAVFQLEQAIFGEHSYP-----DFFFRQGFDCWPEYFLVAADANGVLLGYLLGAQSSDPECMWILSVAVSEQARGQGLGKQLLQRCLALLPAKVKRVDLTVDPHNPARSLYQRLGFVDAHVEANYFGAGADRVVMSY 144
>gi|115438456|ref|NP_001043544.1| Os01g0610400 [Oryza sativa (japonica cultivar-group)] >gi|113533075|dbj|BAF05458.1| Os01g0610400 [Oryza sativa (japonica cultivar-group)] >gi|125526813|gb|EAY74927.1| hypothetical protein OsI_002774 [Oryza sativa (indica cultivar-group)] >gi|125571140|gb|EAZ12655.1| hypothetical protein OsJ_002480 [Oryza sativa (japonica cultivar-group)] (179 aa)
Score = 82, Expect = 7.2e-01, Identities = 23/61 (37%), Positives = 38/61 (62%)
  Q:    71 IYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSD 131
           I  +GV+  YR+  IGS LL+++     K+N   I+L V ++ D+ I FY K  F++    + YY +
  S:    93 IMTLGVLAPYRSLGIGSKLLNHVIDLCEKQNIPEIYLHVQTNNDDAIAFYKKFGFEITKTIEKYYKN 159
>gi|154505018|ref|ZP_02041756.1| hypothetical protein RUMGNA_02528 [Ruminococcus gnavus ATCC 29149] >gi|153794497|gb|EDN76917.1| hypothetical protein RUMGNA_02528 [Ruminococcus gnavus ATCC 29149] (145 aa)
Score = 82, Expect = 7.3e-01, Identities = 31/130 (23%), Positives = 64/130 (49%)
  Q:     2 ITLKNKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRN-----KKIGSNLLSYLKENYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSD 131
           +T+K    ++  EL EI+    EIF+            ++ ++ +C  + ++K+++ Y   F  E + +I +IG V + ++     + +    L  +KEN K   + +  +   + FY K  FK I   D++Y +
  S:     3 LTVKKFQELTTIELYEILKARAEIFIMEQEINYQDMDDIDYKSLHCF-FTEDKKVIAYLRAFYQENDGDIVRIGRVLTLQHGNGTGRDLLEQSLKAIKENMKCKKIVMDAQKYAVGFYEKFGFKTI--SDDFYEE 134
>gi|125810438|ref|XP_001361493.1| GA11576-PA [Drosophila pseudoobscura] >gi|54636668|gb|EAL26071.1| GA11576-PA [Drosophila pseudoobscura] (184 aa)
Score = 82, Expect = 7.4e-01, Identities = 24/66 (36%), Positives = 41/66 (62%)
  Q:    64 ENEQEAEIYKIGVVYSYRNKKIGS----NLLSYLKE--NYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYY 129
           EN++   I  +G +  YR   IG+    ++L+Y ++  N+ SIFL V  + D  I FY K  F+++  ++ YY
  S:    65 ENQRRLYIMTLGCLSPYRRLGIGTVMFEHILNYAEKDGNFDSIFLHVQINNDGAIEFYKKFGFEIVDTKEQYY 137
>gi|116873552|ref|YP_850333.1| acetyltransferase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742430|emb|CAK21554.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (153 aa)
Score = 82, Expect = 7.5e-01, Identities = 32/113 (28%), Positives = 58/113 (51%)
  Q:    20 SLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGY-CLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS-----YLKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDN 132
           S+  E+ L    + E +  +L     Y L   +N +++G  CL   N+ + EI  I V  ++ N+ IG  +L+      ++EN+  I ++  +   N + FY KN F++     NY+  N
  S:    11 SVPLELLLEADPSEEQITKYLTKS--YVLQLINNHKVIGIICLLPLNKYQLEIMNIAVSSTHHNQGIGKKILNKAFEYAIQENFSEIIVKTGNSSINQLAFYQKNGFRMQQIIPNYFPTN 128
>gi|154498263|ref|ZP_02036641.1| hypothetical protein BACCAP_02251 [Bacteroides capillosus ATCC 29799] >gi|150272810|gb|EDM99978.1| hypothetical protein BACCAP_02251 [Bacteroides capillosus ATCC 29799] (151 aa)
Score = 82, Expect = 7.6e-01, Identities = 35/129 (27%), Positives = 61/129 (47%)
  Q:    10 ISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNF-YCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLS----YLKENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYY-SDNSDAFLM 138
           +  S + ++ ++E+E F    ++ + L   L + N  + +   D+  +LGY        E  I  I V   YR   +   LL     + +E+   + LEV +  D  I+ Y KN F    +R +YY +   DA +M
  S:     8 MDRSTVPDVAAIERECF-SQPWSEDMLAEELYNDNASFIVAVADDGTVLGYAGLTVVLDEGYINNIAVRSQYRRMGVADALLGTFIHFAEEHLAFLTLEVRASNDKAISLYTKNGFVQEGRRKDYYKAPKEDAIIM 142
>gi|148378971|ref|YP_001253512.1| GNAT family acetyltransferase [Clostridium botulinum A str. ATCC 3502] >gi|153932436|ref|YP_001383354.1| acetyltransferase [Clostridium botulinum A str. ATCC 19397] >gi|153937256|ref|YP_001386902.1| acetyltransferase [Clostridium botulinum A str. Hall] >gi|153939085|ref|YP_001390331.1| acetyltransferase [Clostridium botulinum F str. Langeland] >gi|148288455|emb|CAL82533.1| putative acetyltransferase [Clostridium botulinum A str. ATCC 3502] >gi|152928480|gb|ABS33980.1| acetyltransferase, GNAT family [Clostridium botulinum A str. ATCC 19397] >gi|152933170|gb|ABS38669.1| acetyltransferase, GNAT family [Clostridium botulinum A str. Hall] >gi|152934981|gb|ABS40479.1| acetyltransferase, GNAT family [Clostridium botulinum F str. Langeland] (147 aa)
Score = 82, Expect = 7.8e-01, Identities = 25/70 (35%), Positives = 38/70 (54%)
  Q:    65 NEQEA--EIYKIGVVYSYRNKKIGSNLL----SYLKENYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSD 134
           NE+E   EI  +     Y+ +  GS L+     Y K+N K++ +   D   TI FY    FK+ H+  N++ DN D
  S:    52 NEEEGIYEIKNLATYEKYQGQGYGSRLIKFIFEYYKDNCKTMLVGTGDSPLTIPFYKHCGFKISHRIKNFFIDNYD 127
>gi|149907515|ref|ZP_01896262.1| ribosomal-protein-alanine acetyltransferase [Moritella sp. PE36] >gi|149809185|gb|EDM69114.1| ribosomal-protein-alanine acetyltransferase [Moritella sp. PE36] (146 aa)
Score = 82, Expect = 7.9e-01, Identities = 33/106 (31%), Positives = 55/106 (51%)
  Q:    36 LNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYY---SDNSDAFLMKWI 141
           L S   ++ F  L+ KD +QILGY    +   EA +  I V   ++ K  G  L+++L     ++    ++LEV + ++     YL   F  + +R NYY       DA +M +I
  S:    32 LASNFGARYFNFLLVKD-EQILGYYFANQVAGEASLLNIAVAPEHQGKGYGKLLINHLIKECQQQELFQLWLEVRESNHGAYQLYLNTGFNEVDRRINYYPAAKGREDAIMMCYI 145
>gi|146085555|ref|XP_001465310.1| acetyltransferase [Leishmania infantum JPCM5] >gi|134069407|emb|CAM67560.1| acetyltransferase, putative [Leishmania infantum] (310 aa)
Score = 82, Expect = 7.9e-01, Identities = 21/61 (34%), Positives = 35/61 (57%)
  Q:    71 IYKIGVVYSYRNKKIGSNLLSYL--------KENYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYYSD 131
           I  IGV+ +YR+ +IGS LL  +        +    ++ L V      + FY + NF+ +   +NYY+D
  S:   217 IMTIGVLEAYRHLRIGSRLLQTVLSAVHNDTRNRIVAVTLHVQVGSPALKFYRQFNFEEVQLVENYYTD 285
>gi|167045401|gb|ABZ10056.1| putative acetyltransferase (GNAT) family protein [uncultured marine crenarchaeote HF4000_APKG10F15] (159 aa)
Score = 82, Expect = 7.9e-01, Identities = 23/72 (31%), Positives = 38/72 (52%)
  Q:    67 QEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKSI-----FLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           ++  +  I V+  +R K  GS L+    +  K+I     +LEV   +N  +  Y K  F +I +   YY D  DA++M
  S:    76 KKGHVVSIAVIDEHRRKGFGSVLVDEAVKGMKTIQGSELYLEVRCSNNDAVKLYEKLGFSIIQRLKTYYRDGEDAYVM 153
>gi|78044332|ref|YP_359578.1| ribosomal-protein-alanine acetyltransferase [Carboxydothermus hydrogenoformans Z-2901] >gi|77996447|gb|ABB15346.1| ribosomal-protein-alanine acetyltransferase [Carboxydothermus hydrogenoformans Z-2901] (144 aa)
Score = 82, Expect = 8.2e-01, Identities = 31/91 (34%), Positives = 46/91 (50%)
  Q:    48 LIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRDNYYS-DNSDAFLM 138
           L+ ++  +++GY   +    EA I  + V  +YR   +G +LL+ L         +SI LEV   +    N Y K  FK I  R  YYS    DA +M
  S:    39 LVAREGDKVIGYGGIWIVLDEAHITTLAVHPAYRRNGVGKSLLNALLDVAKNRKVRSIILEVRASNFPAQNLYQKFGFKPIGIRKKYYSRPEEDAIVM 136
>gi|134035360|sp|Q980R9|Y209_SULSO Uncharacterized acetyltransferase SSO0209 (167 aa)
Score = 82, Expect = 8.3e-01, Identities = 27/72 (37%), Positives = 40/72 (55%)
  Q:    67 QEAEIYKIGVVYSYRNKKIGSNLLS----YLKENYKS--IFLEVSDRD-NTINFYLKNNFKVIHKRDNYYSDNSDAFLM 138
           ++  +  I V+  YR K I + LL      +K +Y +  I+LEV   +   I  Y K NFK +     YY+D  DA+LM
  S:    85 RKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLM 163
>gi|86132108|ref|ZP_01050704.1| hypothetical protein MED134_12016 [Cellulophaga sp. MED134] >gi|85817442|gb|EAQ38622.1| hypothetical protein MED134_12016 [Dokdonia donghaensis MED134] (169 aa)
Score = 82, Expect = 8.4e-01, Identities = 32/103 (31%), Positives = 56/103 (54%)
  Q:    24 EIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLF--------FENEQEAEIYKIGVVYSYRNKKIGSNLLSY-------LKENYKSIFLEVSDRD-NTINFYLKNNFKVIHKRD 126
           E +  + +   NLN  L +++ Y   YK+  +ILGY           F+ +   E+ +I +   Y  K  GS L+ +       L++NY  I+L V + +   I FY ++ FK++   D
  S:    36 ERYYEDAFAKANLNKQLSNRDSYWYFYKEKDEILGYLKLNTGNAQTEFQEKNGLEVERIYIDIPYLGKGYGSELIEFSISKAKELEKNY--IWLGVWEENPEAIKFYKRHGFKIVGTHD 152
>gi|71896813|ref|NP_001025949.1| N-acetyltransferase 13 [Gallus gallus] >gi|53126547|emb|CAG30965.1| hypothetical protein [Gallus gallus] (153 aa)
Score = 81, Expect = 8.7e-01, Identities = 21/66 (31%), Positives = 40/66 (60%)
  Q:    64 ENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKE------NYKSIFLEVS-DRDNTINFYLKNNFKVIHKRDNYY 129
           +N++   I  +G +  YR  KIG+ +L+++         + +I+L V    ++ I+FY K  F++I  + NYY
  S:    67 QNQKRLYIMTLGCLAPYRRLKIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYY 139
>gi|196254408|ref|ZP_03152947.1| ribosomal-protein-alanine acetyltransferase [Cyanothece sp. PCC 7822] >gi|196203605|gb|EDX98421.1| ribosomal-protein-alanine acetyltransferase [Cyanothece sp. PCC 7822] (196 aa)
Score = 81, Expect = 9.4e-01, Identities = 39/139 (28%), Positives = 71/139 (51%)
  Q:     2 ITLKNKNNISESELNEIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYK-------DNKQILGYCLFFENEQEAEIYKIGVVYSYRNK-----KIGSNLLSYLKENYKSIFLEVSDRDN-TINFYLKNNFKVIHKRDNYYSDNSDAFLMKW 140
           + LK ++ I+ ++L ++V L+Q + L   +TLE     LES N   L+         D +QI+G   F+   +EA I  + +   Y+ +      + + L + +K   +   LEV + +   ++ Y K  FK   +R  YY    +  L+ W
  S:     4 VKLKLQSAIA-TQLPQVVELDQ-LTLGGLWTLEGYRRELESPNSELLVLSVVDPSTTDPEQIIGCGCFWAILEEAHITLLAIHPEYQGRGLGKLLLYALLKNAVKRKLERATLEVREANQVALSVYKKFGFKTAGRRKGYYQQTGEDALVLW 153
>gi|124010179|ref|ZP_01694836.1| acetyltransferase, gnat family [Microscilla marina ATCC 23134] >gi|123983770|gb|EAY24192.1| acetyltransferase, gnat family [Microscilla marina ATCC 23134] (147 aa)
Score = 81, Expect = 9.5e-01, Identities = 25/94 (26%), Positives = 48/94 (51%)
  Q:    43 QNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIG----SNLLSYLKENYKSIFLEVSDRDNTINFYLKNNFKVIHKRD-NYYSDNSDAF 136
           +N Y + ++  K   G   + ++E + E+ +I +   Y+ K IG     N+LS  +EN   + L V   +  +  Y +  F++I   D +YY   + +F
  S:    48 ENAYIICWQGTKA--GLLKYTQDETQIEVIQIQIAPEYQGKGIGKTVLENVLSKARENKLKVVLSVLKHNPALRLYQRVGFEIIRHDDVSYYLQYTPSF 144
>gi|53791479|dbj|BAD52531.1| Mak3 protein-like protein [Oryza sativa Japonica Group] (201 aa)
Score = 81, Expect = 9.5e-01, Identities = 23/61 (37%), Positives = 38/61 (62%)
  Q:    71 IYKIGVVYSYRNKKIGSNLLSYL-----KENYKSIFLEV-SDRDNTINFYLKNNFKVIHKRDNYYSD 131
           I  +GV+  YR+  IGS LL+++     K+N   I+L V ++ D+ I FY K  F++    + YY +
  S:    93 IMTLGVLAPYRSLGIGSKLLNHVIDLCEKQNIPEIYLHVQTNNDDAIAFYKKFGFEITKTIEKYYKN 159
>gi|169335112|ref|ZP_02862305.1| hypothetical protein ANASTE_01519 [Anaerofustis stercorihominis DSM 17244] >gi|169257850|gb|EDS71816.1| hypothetical protein ANASTE_01519 [Anaerofustis stercorihominis DSM 17244] (148 aa)
Score = 81, Expect = 9.6e-01, Identities = 28/99 (28%), Positives = 52/99 (52%)
  Q:    36 LNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLKENYKS----IFLEVSDRDNTINFYLKNNFKVIHKRDNYYSDNSD 134
           ++ +L+  N + L Y+ N+ +    +     +  EI  + +  SY+ K  GS L+ ++ E+YK+    I L   + D TI+FY    F    ++ N++ DN D
  S:    27 ISKYLKKSNMF-LCYEGNELVGQITVLRLANKIYEIKNLSIYESYQGKGYGSKLVKFIFEHYKNKASVIILGTGECDKTISFYKNLGFTYFMRKKNFFIDNYD 128
>gi|56552309|ref|YP_163148.1| acetyltransferase [Zymomonas mobilis subsp. mobilis ZM4] >gi|56543883|gb|AAV90037.1| acetyltransferase [Zymomonas mobilis subsp. mobilis ZM4] (158 aa)
Score = 81, Expect = 9.7e-01, Identities = 30/120 (25%), Positives = 55/120 (45%)
  Q:    17 EIVSLEQEIFLHNGYTLENLNSFLESQNFYCLIYKDNKQILGYCLFFENEQEAEIYKIGVVYSYRNKKIGSNLLSYLK-----ENYKSIFLEVSDRDNTINFYLKNNFKVIHKRDNYY-SDNSDAF 136
           EI++   + F    +     NS +     Y L+     +  G+ L      E E+  + V   +R + + + L   L      E+ K + LEV +++  +N Y +  F+ + +R NYY S N D +
  S:    23 EIMTDAFDPFYGEAWNRHQCNSIMGLPGVYTLVVTIEGKPAGFLLSRTVFDECELLLLAVKPEFRREGVATALFKKLIAKAKIEDTKYLHLEVREKNPALNLYYQIGFREVGRRINYYKSLNGDLY 148