>gi|26553584|ref|NP_757518.1| hypothetical protein MYPE1300 [Mycoplasma penetrans HF-2] >gi|26453590|dbj|BAC43922.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (193 aa)
Score = 811, Expect = 3.9e-85, Identities = 193/193 (100%), Positives = 193/193 (100%)
  Q:     1 MENNKFSLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLIDAKTKLFYIGANGMEKPFLIQSDEINKLTNKYEKYFYSLETKKSIYEKWQFNKNKFLKTSFIRPLYIKEAIYDYSKKQK 193
           MENNKFSLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLIDAKTKLFYIGANGMEKPFLIQSDEINKLTNKYEKYFYSLETKKSIYEKWQFNKNKFLKTSFIRPLYIKEAIYDYSKKQK
  S:     1 MENNKFSLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLIDAKTKLFYIGANGMEKPFLIQSDEINKLTNKYEKYFYSLETKKSIYEKWQFNKNKFLKTSFIRPLYIKEAIYDYSKKQK 193
>gi|50365311|ref|YP_053736.1| putative glycoprotein endopeptidase [Mesoplasma florum L1] >gi|50363867|gb|AAT75852.1| putative glycoprotein endopeptidase [Mesoplasma florum L1] (188 aa)
Score = 158, Expect = 1.8e-09, Identities = 56/178 (31%), Positives = 89/178 (50%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLIDAKTKLFYIGANGMEKPFL----IQSDEINKLTNKYEKYFYSLETKKSIYEKWQFN---KNKFL--KTSFIRPLYIKEAI 185
           L ID C   L L + KD  I+DS      K ++ I   +I  ++ KN L+  +++  Y+ NGPGS+T V+  +    T K +   + +Y LNS  +    +  I ++DA+   +YIG    +KP +    +   E++ +   Y  +    E  KS+     FN   KN  L  +   I PLYIK  I
  S:     3 LFIDTCNWKLVLILKKDDQIIDSLILSDTKKVSDIALSTITKLLSKNNLKINDIQEFYLTNGPGSYTGVRVGLTIVKTLKTLNNRIKVYLLNSLAFQAANDQAISILDARGSKYYIGVYENQKPLIEETVVNLSELDDIKKTYSNFLIK-EDNKSLDYIQTFNLLEKNFRLVDEIEEILPLYIKNFI 188
>gi|42560860|ref|NP_975311.1| hypothetical protein MSC_0312 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492357|emb|CAE76953.1| conserved hypothetical protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] (187 aa)
Score = 139, Expect = 3.4e-07, Identities = 47/163 (28%), Positives = 81/163 (49%)
  Q:    23 KDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLIDAKTKLFYIGANGMEKPF----LIQSDEINKLTNKYEKYFYSLETKKSIYEKWQFNKNKFLKT---SFIRPLYIKEAI 185
           KD  I+DS   + +K L+ I    +   ++ N L   +L++ Y+  GPGS+T V+  +    T K +  N +++ +NS  +       I  IDA++  +Y+      K      LI  D+IN L N+Y+ Y    + +    + +   K  F+K    + + PLYIK  I
  S:    18 KDNQIIDSLIILNNKKLSDIAILKLEEFLKNNNLTLNDLKAFYLTIGPGSYTGVRVGLTIVKTLKVLNNNFDVFIINSLLYQAGSNKIISCIDARSNKYYVSVYNNAKQLLDISLIDQDQINNLINQYQDYKLVNDYQFDYLKHYLDLKKHFIKIDDDNKLNPLYIKSFI 187
>gi|188159620|ref|ZP_02512679.2| hypothetical protein Mmycm_03226 [Mycoplasma mycoides subsp. mycoides LC str. GM12] (187 aa)
Score = 135, Expect = 9.1e-07, Identities = 47/163 (28%), Positives = 81/163 (49%)
  Q:    23 KDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLIDAKTKLFYIGANGMEKPF----LIQSDEINKLTNKYEKYFYSLETKKSIYEKWQFNKNKFLKT---SFIRPLYIKEAI 185
           KD  I+DS   + +K L+ I    +   ++ N L   +L++ Y+  GPGS+T V+  +    T K +  N +++ +NS  +       I  IDA++  +Y+      K      LI  D+IN L N+Y+ Y    + +    + +   K  F+K    + + PLYIK  I
  S:    18 KDNQIIDSLIILNNKKLSDIAILKLEEFLKNNNLTLNDLKAFYLTIGPGSYTGVRVGLTIVKTLKVLNNNFDVFIINSLLYQAGLNKIISCIDARSNKYYVSVFNNAKQLLEISLIDQDQINNLINQYQDYKLINDYQFDYLKHYLDLKKHFIKIDDDNKLNPLYIKSFI 187
>gi|73662136|ref|YP_300917.1| putative glycoprotease [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72494651|dbj|BAE17972.1| putative glycoprotease [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (220 aa)
Score = 130, Expect = 3.0e-06, Identities = 42/128 (32%), Positives = 72/128 (56%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQ--WNTTKENEIVLI---DAKTKLFYIGANGMEKPFLIQ 135
           LLID     L +AI++D  ++      + KN +  L P+IA I+E+++L+K+ L++I +  GPGS+T ++  V  A T      N  LY ++S +    T KE  I+++   DA+ +  Y G    +   L+Q
  S:     4 LLIDTSNQPLSVAIMQDDKVLSEFNTNEKKNHSVQLMPAIANILEESQLDKKELDAIIVAEGPGSYTGLRIGVTVAKTLAYAL-NTKLYGVSSLKALAATVKEENILIVPVFDARREAVYSGVYQYQNGHLVQ 135
>gi|83319754|ref|YP_424253.1| metalloendopeptidase, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283640|gb|ABC01572.1| metalloendopeptidase, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (187 aa)
Score = 127, Expect = 6.8e-06, Identities = 51/163 (31%), Positives = 82/163 (50%)
  Q:    23 KDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLIDAKTKLFYIGANGMEKPF----LIQSDEINKLTNKYEKYFYSLETKKSIYEKWQFNKNKFL----KTSFIRPLYIKEAI 185
           KD  I+DS   + +K L+ I    +   + KNKL  ++L++ Y+  GPGS+T V+  +    T K +  N  ++ +NS  +     N I  IDA++  +YI      K      LI+ ++I+ L  KY K F  +   +  Y K   +  KF       + + PLYIK  I
  S:    18 KDDQIIDSLIILNNKKLSDIAILKLNEFLLKNKLTIKDLKAFYLTIGPGSYTGVRVGLTIVKTLKVLNNNFEVFIINSLLYQAGLNNVISCIDARSNKYYISVYNNAKQLLDISLIEQNQIDDLLFKY-KDFELVNDYEFDYIKHYLDLKKFFINIKDDNQLNPLYIKSFI 187
>gi|110004537|emb|CAK98874.1| conserved hypothetical protein [Spiroplasma citri] (190 aa)
Score = 122, Expect = 2.6e-05, Identities = 31/124 (25%), Positives = 65/124 (52%)
  Q:     6 FSLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLIDAK--TKLFYIGANGME 129
            +L ID   D+L L + + + I+    E   +  T+   P I  ++   +L+ +++ + Y+  GPGS+T V+  +    T K +   +N+Y +N+  +    +N + ++DA+   + F + +NG E
  S:     2 LNLFIDTSTDFLILILEQKQKIIGQVHENHTRRHTEATLPVIKQLLSAYQLKLKDINNFYLTTGPGSYTGVRIPMTIVKTIKIINSAINVYTINTLLYQAGLDNVVSMLDARGGKRYFAVISNGTE 127
>gi|70725983|ref|YP_252897.1| hypothetical protein SH0982 [Staphylococcus haemolyticus JCSC1435] >gi|68446707|dbj|BAE04291.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (221 aa)
Score = 121, Expect = 3.4e-05, Identities = 34/117 (29%), Positives = 64/117 (54%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTF-----KKVFQNVNLYFLNSTQWNTTKENEIVLIDAKTKLFYIG 124
           L+ID     + +AI++D T++  +     ++ +  L P I  + E+ K+EK +++ I +  GPGS+T V+  V  A T       K++   +L  L +T  N  ++  + +IDA+ +  Y G
  S:     4 LMIDTSNQPMSIAIMQDDTVLAETTSEDKRDHSSQLMPGIQHLFEEAKIEKNDIDGIVVAKGPGSYTGVRIGVTTAKTLAYALNTKLYGVSSLAALAATVKNDKQKLLVPIIDARREAVYTG 125
>gi|21911154|ref|NP_665422.1| putative glycoprotein endopeptidase [Streptococcus pyogenes MGAS315] >gi|28895161|ref|NP_801511.1| putative glycoprotein endopeptidase [Streptococcus pyogenes SSI-1] >gi|21905365|gb|AAM80225.1| putative glycoprotein endopeptidase [Streptococcus pyogenes MGAS315] >gi|28810406|dbj|BAC63344.1| putative glycoprotein endopeptidase [Streptococcus pyogenes SSI-1] (232 aa)
Score = 119, Expect = 6.8e-05, Identities = 41/118 (34%), Positives = 67/118 (56%)
  Q:     7 SLLIDGCLDYLELAIIKDKTIV-DSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQN--VNLYFLNSTQWNTTKE--NEIV--LIDAKTKLFYIG 124
           +L  D     L LAI+ D+T++ D +  IQ KN +  L P+I F++    L+ ++LE I +  GPGS+T ++  V  A T         V +  L++   +T K+  N +V  LIDA+ +  Y+G
  S:     3 TLAFDTSNKTLSLAILDDETLLADMTLNIQ-KNHSVSLMPAIDFLMTCTDLKPQDLERIVVAKGPGSYTGLRVAVATAKTLAYSLNIALVGISSLHALAASTCKQYPNTLVVPLIDARRQNAYVG 126
>gi|31544412|ref|NP_852990.1| hypothetical protein MGA_0995 [Mycoplasma gallisepticum R] >gi|31541256|gb|AAP56558.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (226 aa)
Score = 118, Expect = 7.6e-05, Identities = 38/119 (31%), Positives = 66/119 (55%)
  Q:     5 KFSLLIDGCLDYLELAII---KDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLIDAKTKLFYI 123
           K+SL ID CLD + LAI    K++    +S E+  KNL  I+   I   +  +K++ +++  +Y+  GPGSF+ V+     A T+K V  ++ +Y +++ +        I  IDAK+   Y+
  S:    39 KYSLFIDTCLDKINLAIFDSEKEEIYYYTSIELH-KNLVDIIINKIEEFLADHKIKMKSIRKLYLTLGPGSFSGVRVGTNIAKTWKTVDPSLEVYTISNLKIQVPYGEGISCIDAKSNKKYV 159
>gi|19746801|ref|NP_607937.1| putative glycoprotein endopeptidase [Streptococcus pyogenes MGAS8232] >gi|19749036|gb|AAL98436.1| putative glycoprotein endopeptidase [Streptococcus pyogenes MGAS8232] (232 aa)
Score = 117, Expect = 9.8e-05, Identities = 39/118 (33%), Positives = 63/118 (53%)
  Q:     7 SLLIDGCLDYLELAIIKDKTIV-DSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNV-----NLYFLNSTQWNTTKENEIV-LIDAKTKLFYIG 124
           +L  D     L LAI+ D+T++ D +  IQ KN +  L P+I F++    L+ ++LE I +  GPGS+T ++  V  A T             +LY L ++         +V LIDA+ +  Y+G
  S:     3 TLAFDTSNKTLSLAILDDETLLADMTLNIQ-KNHSVSLMPAIDFLMTCTDLKPQDLERIVVAKGPGSYTGLRVAVATAKTLAYSLNIALVGISSLYALAASTCKQYPNTLVVPLIDARRQNVYVG 126
>gi|50914950|ref|YP_060922.1| glycoprotease family protein [Streptococcus pyogenes MGAS10394] >gi|71904247|ref|YP_281050.1| glycoprotease family protein [Streptococcus pyogenes MGAS6180] >gi|94989228|ref|YP_597329.1| M22 family non-proteolytic peptidase [Streptococcus pyogenes MGAS9429] >gi|94993116|ref|YP_601215.1| M22 family non-proteolytic peptidase [Streptococcus pyogenes MGAS2096] >gi|50904024|gb|AAT87739.1| Glycoprotease protein family [Streptococcus pyogenes MGAS10394] >gi|71803342|gb|AAX72695.1| glycoprotease protein family [Streptococcus pyogenes MGAS6180] >gi|94542736|gb|ABF32785.1| non-proteolytic protein, peptidase family M22 [Streptococcus pyogenes MGAS9429] >gi|94546624|gb|ABF36671.1| Non-proteolytic protein, peptidase family M22 [Streptococcus pyogenes MGAS2096] (243 aa)
Score = 116, Expect = 1.4e-04, Identities = 39/118 (33%), Positives = 63/118 (53%)
  Q:     7 SLLIDGCLDYLELAIIKDKTIV-DSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNV-----NLYFLNSTQWNTTKENEIV-LIDAKTKLFYIG 124
           +L  D     L LAI+ D+T++ D +  IQ KN +  L P+I F++    L+ ++LE I +  GPGS+T ++  V  A T             +LY L ++         +V LIDA+ +  Y+G
  S:    14 TLAFDTSNKTLSLAILDDETLLADMTLNIQ-KNHSVSLMPAIDFLMTCTDLKPQDLERIVVAKGPGSYTGLRVAVATAKTLAYSLNIALVGISSLYALAASTCKQYPNTLVVPLIDARRQNAYVG 137
>gi|56808613|ref|ZP_00366341.1| COG1214: Inactive homolog of metal-dependent proteases, putative molecular chaperone [Streptococcus pyogenes M49 591] (232 aa)
Score = 116, Expect = 1.4e-04, Identities = 39/118 (33%), Positives = 63/118 (53%)
  Q:     7 SLLIDGCLDYLELAIIKDKTIV-DSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNV-----NLYFLNSTQWNTTKENEIV-LIDAKTKLFYIG 124
           +L  D     L LAI+ D+T++ D +  IQ KN +  L P+I F++    L+ ++LE I +  GPGS+T ++  V  A T             +LY L ++         +V LIDA+ +  Y+G
  S:     3 TLAFDTSNKTLSLAILDDETLLADMTLNIQ-KNHSVSLMPAIDFLMTCTDLKSQDLERIVVAKGPGSYTGLRVAVATAKTLAYSLNIALVGISSLYALAASTCKQYPNTLVVPLIDARRQNAYVG 126
>gi|94991173|ref|YP_599273.1| M22 family non-proteolytic peptidase [Streptococcus pyogenes MGAS10270] >gi|94544681|gb|ABF34729.1| Non-proteolytic protein, peptidase family M22 [Streptococcus pyogenes MGAS10270] (243 aa)
Score = 116, Expect = 1.5e-04, Identities = 39/118 (33%), Positives = 63/118 (53%)
  Q:     7 SLLIDGCLDYLELAIIKDKTIV-DSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNV-----NLYFLNSTQWNTTKENEIV-LIDAKTKLFYIG 124
           +L  D     L LAI+ D+T++ D +  IQ KN +  L P+I F++    L+ ++LE I +  GPGS+T ++  V  A T             +LY L ++         +V LIDA+ +  Y+G
  S:    14 TLAFDTSNKTLSLAILDDETLLADMTLNIQ-KNHSVSLMPAIDFLMTCTDLKPQDLERIVVAKGPGSYTGLRVAVATAKTLAYSLNIALVGISSLYALAASTCKQYPNTLVVPLIDARRQNAYVG 137
>gi|71911406|ref|YP_282956.1| glycoprotease family protein [Streptococcus pyogenes MGAS5005] >gi|71854188|gb|AAZ52211.1| glycoprotease protein family [Streptococcus pyogenes MGAS5005] (232 aa)
Score = 116, Expect = 1.6e-04, Identities = 39/118 (33%), Positives = 63/118 (53%)
  Q:     7 SLLIDGCLDYLELAIIKDKTIV-DSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNV-----NLYFLNSTQWNTTKENEIV-LIDAKTKLFYIG 124
           +L  D     L LAI+ D+T++ D +  IQ KN +  L P+I F++    L+ ++LE I +  GPGS+T ++  V  A T             +LY L ++         +V LIDA+ +  Y+G
  S:     3 TLAFDTSNKTLSLAILDDETLLADMTLNIQ-KNHSVSLMPAIDFLMTCTDLKPQDLERIVVAKGPGSYTGLRVAVATAKTLAYSLNIALVGISSLYALAASTCKQYPNTLVVPLIDARRQNAYVG 126
>gi|94995047|ref|YP_603145.1| Non-proteolytic protein, peptidase family M22 [Streptococcus pyogenes MGAS10750] >gi|94548555|gb|ABF38601.1| Non-proteolytic protein, peptidase family M22 [Streptococcus pyogenes MGAS10750] (243 aa)
Score = 115, Expect = 1.8e-04, Identities = 39/118 (33%), Positives = 63/118 (53%)
  Q:     7 SLLIDGCLDYLELAIIKDKTIV-DSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNV-----NLYFLNSTQWNTTKENEIV-LIDAKTKLFYIG 124
           +L  D     L LAI+ D+T++ D +  IQ KN +  L P+I F++    L+ ++LE I +  GPGS+T ++  V  A T             +LY L ++         +V LIDA+ +  Y+G
  S:    14 TLAFDTSNKTLSLAILDDETLLADMTLNIQ-KNHSVSLMPAIDFLMTCTDLKPQDLERIVVAKGPGSYTGLRVAVATAKTLAYSLNIALVGISSLYALAASTCKQYPNTLVVPLIDARRQNAYVG 137
>gi|15675693|ref|NP_269867.1| putative glycoprotein endopeptidase [Streptococcus pyogenes M1 GAS] >gi|13622908|gb|AAK34588.1| putative glycoprotein endopeptidase [Streptococcus pyogenes M1 GAS] (232 aa)
Score = 115, Expect = 2.0e-04, Identities = 37/118 (31%), Positives = 63/118 (53%)
  Q:     7 SLLIDGCLDYLELAIIKDKTIV-DSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNV-----NLYFLNSTQWNTTKENEIV-LIDAKTKLFYIG 124
           +L  D     L LAI+ D+T++ D +  IQ K+   ++ P+I F++    L+ ++LE I +  GPGS+T ++  V  A T             +LY L ++         +V LIDA+ +  Y+G
  S:     3 TLAFDTSNKTLSLAILDDETLLADMTLNIQKKHSVSLM-PAIDFLMTCTDLKPQDLERIVVAKGPGSYTGLRVAVATAKTLAYSLNIALVGISSLYALAASTCKQYPNTLVVPLIDARRQNAYVG 126
>gi|12045060|ref|NP_072870.1| glycoprotease family protein [Mycoplasma genitalium G37] >gi|66880193|ref|ZP_00405177.1| COG1214: Inactive homolog of metal-dependent proteases, putative molecular chaperone [Mycoplasma genitalium G-37] >gi|1351509|sp|P47450|Y208_MYCGE Uncharacterized protein MG208 >gi|3844806|gb|AAC71426.1| glycoprotease family protein [Mycoplasma genitalium G37] >gi|166078921|gb|ABY79539.1| glycoprotease family protein [synthetic Mycoplasma genitalium JCVI-1.0] (196 aa)
Score = 115, Expect = 2.1e-04, Identities = 35/121 (28%), Positives = 64/121 (52%)
  Q:     4 NKFSLLIDGCLDYLELAIIKDKT--IVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLIDAKTKLFYIG 124
           +K+ L +D     L + I++ KT  +VD      ++NLT++    +  ++ KNKL+K +++  Y+  GPGSFT  +   + A ++  ++ +  LY LNS ++    E+ I  I       Y G
  S:     5 SKYKLFLDCAYKTLNIIILEMKTNAVVDELSIGVEQNLTELAVYYLETMLTKNKLKKSSIKQFYVTIGPGSFTGQRIATIIAKSWCLLYPSCELYALNSLRFQIPYEHGISKISCGNDQNYCG 127
>gi|13508030|ref|NP_109979.1| hypothetical protein MPN291 [Mycoplasma pneumoniae M129] >gi|2496328|sp|P75486|Y291_MYCPN Uncharacterized protein MG208 homolog >gi|1674241|gb|AAB96192.1| conserved hypothetical protein [Mycoplasma pneumoniae M129] (196 aa)
Score = 112, Expect = 4.4e-04, Identities = 35/121 (28%), Positives = 58/121 (47%)
  Q:     4 NKFSLLIDGCLDYLELAII--KDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLIDAKTKLFYIG 124
           NK+ L +D    +L + ++  K  T+VD       +NLT++    +  +++KNK+    +   Y+  GPGSFT  +   + A T+  V  N  L+ LNS +        I  I A  +  Y G
  S:     5 NKYKLFLDCAYKHLNIVLLDFKTNTVVDQLTIPVQQNLTELAVYHLEKLLKKNKVRNNTVRQFYVTTGPGSFTGQRVGAIIAKTWCTVNPNCQLFALNSLRLQIPYGCGISKISAGNEKNYCG 127
>gi|27468570|ref|NP_765207.1| glycoprotein endopeptidase [Staphylococcus epidermidis ATCC 12228] >gi|57867555|ref|YP_189228.1| hypothetical protein SERP1663 [Staphylococcus epidermidis RP62A] >gi|27316117|gb|AAO05251.1|AE016749_197 glycoprotein endopeptidase [Staphylococcus epidermidis ATCC 12228] >gi|57638213|gb|AAW55001.1| conserved hypothetical protein [Staphylococcus epidermidis RP62A] (220 aa)
Score = 112, Expect = 4.5e-04, Identities = 39/117 (33%), Positives = 63/117 (53%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQ--WNTTKENEIVLI---DAKTKLFYIG 124
           LLID     L +AI+KD  ++        KN +  L P IA I+ ++K+ K  +  I +  GPGS+T ++  V  A T      N NLY ++S +   +T K++  +L+   DA+ +  Y G
  S:     4 LLIDTSNQPLSVAIMKDNEVIAEKTTDIKKNHSVQLMPEIAEILTESKINKTEITDIVVAEGPGSYTGLRIGVTVAKTLAYAL-NTNLYGVSSLKALASTVKDSTKLLVPIFDARREAVYAG 124
>gi|24378880|ref|NP_720835.1| putative glycoprotein endopeptidase [Streptococcus mutans UA159] >gi|24376761|gb|AAN58141.1|AE014886_2 putative glycoprotein endopeptidase [Streptococcus mutans UA159] (228 aa)
Score = 110, Expect = 8.0e-04, Identities = 36/117 (30%), Positives = 63/117 (53%)
  Q:     8 LLIDGCLDYLELAIIKD-KTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANT--FKKVFQNVNLYFLNSTQWNTTKENEIV-LIDAKTKLFYIG 124
           L  D     L +AI++D + + D+S  I+ KN +  L P+I F+++   L  ++L+ I +  GPGS+T ++  V  A T  +      V +  L +   N+  E  IV ++DA+    Y+G
  S:     4 LAFDTSSTALSVAILEDDRLLADASLTIK-KNHSISLMPTIDFLMKSVNLSPQDLDRIVVAEGPGSYTGLRVAVATAKTLAYTLTIDLVGVSSLAALALNSHHEGFIVPIMDARRNHVYVG 123
>gi|139473134|ref|YP_001127849.1| glycoprotease family protein [Streptococcus pyogenes str. Manfredo] >gi|134271380|emb|CAM29600.1| glycoprotease family protein [Streptococcus pyogenes str. Manfredo] (232 aa)
Score = 109, Expect = 8.4e-04, Identities = 38/118 (32%), Positives = 61/118 (51%)
  Q:     7 SLLIDGCLDYLELAIIKDKTIV-DSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNV-----NLYFLNSTQWNTTKENEIV-LIDAKTKLFYIG 124
           +L  D     L LAI+ D+ ++ D +  IQ KN +  L P+I F++    L+ + LE I +  GPGS+T ++  V  A T             +LY L ++         +V LIDA+ +  Y+G
  S:     3 TLAFDTSNKTLSLAILDDEILLADMTLNIQ-KNHSVSLMPAIDFLMTCTDLKPQGLERIVVAKGPGSYTGLRVAVATAKTLAYSLNIALVGISSLYALAASTCKQYPNTLVVPLIDARRQNAYVG 126
>gi|168487086|ref|ZP_02711594.1| glycoprotein endopeptidase [Streptococcus pneumoniae CDC1087-00] >gi|183570036|gb|EDT90564.1| glycoprotein endopeptidase [Streptococcus pneumoniae CDC1087-00] (227 aa)
Score = 109, Expect = 1.0e-03, Identities = 36/129 (27%), Positives = 63/129 (48%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENE---IVLIDAKTKLFYIGANGMEKPFLIQS 136
           L  D     L LAI++DK ++  +     KN +  L P+I F++    L  ++L+ I +  GPGS+T ++  V  A T      N+ L  ++S      ++ E   + ++DA+    Y G     KP L ++
  S:     4 LAFDTSSKALSLAILEDKQVLAETMINIKKNHSINLMPAIDFLMASLDLTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAHTL-NIELVGMSSLLALVPRQKEGLVVPIMDARRNNVYAGFYENAKPVLPEA 134
>gi|148992718|ref|ZP_01822361.1| hypothetical protein CGSSp9BS68_03218 [Streptococcus pneumoniae SP9-BS68] >gi|168489381|ref|ZP_02713580.1| glycoprotein endopeptidase [Streptococcus pneumoniae SP195] >gi|147928444|gb|EDK79459.1| hypothetical protein CGSSp9BS68_03218 [Streptococcus pneumoniae SP9-BS68] >gi|183572071|gb|EDT92599.1| glycoprotein endopeptidase [Streptococcus pneumoniae SP195] (227 aa)
Score = 109, Expect = 1.1e-03, Identities = 36/129 (27%), Positives = 62/129 (48%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENE---IVLIDAKTKLFYIGANGMEKPFLIQS 136
           L  D     L LAI++DK ++  +     KN +  L P+I F++       +NL+ I +  GPGS+T ++  V  A T      N+ L  ++S       + E   + L+DA+    Y+G     KP + ++
  S:     4 LAFDTSSKALSLAILEDKQVLAETTINIKKNHSITLMPAIDFLMASLDWTPKNLDRIVVAEGPGSYTGLRIAVATAKTLAHTL-NIELVGMSSLLALVPYQQEGLFVSLMDARRNNVYVGFYENAKPVMPEA 134
>gi|13357872|ref|NP_078146.1| hypothetical protein UU312 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168282519|ref|ZP_02690186.1| glycoprotease family [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308673|ref|ZP_02691348.1| glycoprotease family [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762294|ref|YP_001752394.1| glycoprotease family protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|11282619|pir||G82907 conserved hypothetical UU312 [imported] - Ureaplasma urealyticum >gi|6899288|gb|AAF30721.1|AE002128_9 conserved hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827871|gb|ACA33133.1| glycoprotease family [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902738|gb|EDT49027.1| glycoprotease family [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675676|gb|EDT87581.1| glycoprotease family [Ureaplasma parvum serovar 14 str. ATCC 33697] (191 aa)
Score = 108, Expect = 1.1e-03, Identities = 36/121 (29%), Positives = 62/121 (51%)
  Q:     3 NNKFSLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEI-VLIDAKTKLFYI 123
           N+ + L ID       LAI K+  I  S     + NLT I+   +  +++   L+ ++LE+IY+  GPGSFT ++   + A T   +F  + L+  +S       +N++ V +DAK    Y+
  S:     2 NSTYQLFIDVTSRKCILAIYKNFKIHTSIIVDTNNNLTDIIVEHLNNLLKITNLQYQDLEAIYLNTGPGSFTGIRVGAIVAKTICTIFNKIKLFINDSLNIIANGKNDVFVYLDAKGNKSYV 123
>gi|167971860|ref|ZP_02554137.1| glycoprotease family [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186700925|gb|EDU19207.1| glycoprotease family [Ureaplasma parvum serovar 6 str. ATCC 27818] (191 aa)
Score = 106, Expect = 1.9e-03, Identities = 35/121 (28%), Positives = 62/121 (51%)
  Q:     3 NNKFSLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEI-VLIDAKTKLFYI 123
           N+ + L ID       LAI K+  I  S     + N+T I+   +  +++   L+ ++LE+IY+  GPGSFT ++   + A T   +F  + L+  +S       +N++ V +DAK    Y+
  S:     2 NSTYQLFIDVTSRKCILAIYKNFKIHTSIIVDTNNNITDIIVEHLNDLLKITNLQYQDLEAIYLNTGPGSFTGIRVGAIVAKTICTIFNKIKLFINDSLNIIANGKNDVFVYLDAKGNKSYV 123
>gi|82751654|ref|YP_417395.1| hypothetical protein SAB1936c [Staphylococcus aureus RF122] >gi|82657185|emb|CAI81625.1| probable glycoprotein endopeptidase [Staphylococcus aureus RF122] (220 aa)
Score = 106, Expect = 2.0e-03, Identities = 33/118 (27%), Positives = 65/118 (55%)
  Q:     7 SLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQW-----NTTKENEIVLIDAKTKLFYIG 124
           SLLID     L +A++++  ++        +N +  L P+I+ + E++K+ K+ L++I +  GPGS+T ++  V  A T      +V LY ++S +      + T +  + + DA+ +  Y G
  S:     3 SLLIDTSNQPLSVALMQNDEVLAEITTDSKQNHSVQLMPAISQLFEQSKIAKQQLDAIIVAEGPGSYTGLRIGVTVAKTLAYAL-DVKLYGVSSLKALAATIDHTDKLLVPVFDARRQAVYTG 124
>gi|49484277|ref|YP_041501.1| hypothetical protein SAR2138 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49242406|emb|CAG41119.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MRSA252] (220 aa)
Score = 106, Expect = 2.0e-03, Identities = 33/118 (27%), Positives = 65/118 (55%)
  Q:     7 SLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQW-----NTTKENEIVLIDAKTKLFYIG 124
           SLLID     L +A++++  ++        +N +  L P+I+ + E++K+ K+ L++I +  GPGS+T ++  V  A T      +V LY ++S +      + T +  + + DA+ +  Y G
  S:     3 SLLIDTSNQPLSVALMQNDEVLAEITTDSKQNHSVQLMPAISQLFEQSKIAKQQLDAIIVAEGPGSYTGLRIGVTVAKTLAYAL-DVKLYGVSSLKALAATIDHTDKLLVPVFDARRQAVYTG 124
>gi|57650723|ref|YP_186857.1| hypothetical protein SACOL2040 [Staphylococcus aureus subsp. aureus COL] >gi|87160647|ref|YP_494655.1| hypothetical protein SAUSA300_2004 [Staphylococcus aureus subsp. aureus USA300] >gi|88195949|ref|YP_500760.1| hypothetical protein SAOUHSC_02279 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|161510263|ref|YP_001575922.1| hypothetical protein USA300HOU_2046 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727583|ref|ZP_02759860.1| M22 family O-sialoglycoprotein endopeptidase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|57284909|gb|AAW37003.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus COL] >gi|87126621|gb|ABD21135.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203507|gb|ABD31317.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|160369072|gb|ABX30043.1| M22 family O-sialoglycoprotein endopeptidase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (220 aa)
Score = 106, Expect = 2.2e-03, Identities = 33/118 (27%), Positives = 65/118 (55%)
  Q:     7 SLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQW-----NTTKENEIVLIDAKTKLFYIG 124
           SLLID     L +A++++  ++        +N +  L P+I+ + E++K+ K+ L++I +  GPGS+T ++  V  A T      +V LY ++S +      + T +  + + DA+ +  Y G
  S:     3 SLLIDTSNQPLSVALMQNDEVLAEITTDSKQNHSVQLMPAISQLFEQSKIAKQQLDAIIVAEGPGSYTGLRIGVTVAKTLAYAL-DVKLYGVSSLKALAATIDHTDKLLVPVFDARRQAVYTG 124
>gi|151222170|ref|YP_001332992.1| hypothetical protein NWMN_1958 [Staphylococcus aureus subsp. aureus str. Newman] >gi|150374970|dbj|BAF68230.1| peptidase M22, glycoprotease [Staphylococcus aureus subsp. aureus str. Newman] (229 aa)
Score = 106, Expect = 2.3e-03, Identities = 33/118 (27%), Positives = 65/118 (55%)
  Q:     7 SLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQW-----NTTKENEIVLIDAKTKLFYIG 124
           SLLID     L +A++++  ++        +N +  L P+I+ + E++K+ K+ L++I +  GPGS+T ++  V  A T      +V LY ++S +      + T +  + + DA+ +  Y G
  S:    12 SLLIDTSNQPLSVALMQNDEVLAEITTDSKQNHSVQLMPAISQLFEQSKIAKQQLDAIIVAEGPGSYTGLRIGVTVAKTLAYAL-DVKLYGVSSLKALAATIDHTDKLLVPVFDARRQAVYTG 133
>gi|148268503|ref|YP_001247446.1| hypothetical protein SaurJH9_2088 [Staphylococcus aureus subsp. aureus JH9] >gi|150394566|ref|YP_001317241.1| hypothetical protein SaurJH1_2125 [Staphylococcus aureus subsp. aureus JH1] >gi|147741572|gb|ABQ49870.1| peptidase M22, glycoprotease [Staphylococcus aureus subsp. aureus JH9] >gi|149947018|gb|ABR52954.1| peptidase M22 glycoprotease [Staphylococcus aureus subsp. aureus JH1] (220 aa)
Score = 105, Expect = 2.4e-03, Identities = 33/118 (27%), Positives = 65/118 (55%)
  Q:     7 SLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQW-----NTTKENEIVLIDAKTKLFYIG 124
           SLLID     L +A++++  ++        +N +  L P+I+ + E++K+ K+ L++I +  GPGS+T ++  V  A T      +V LY ++S +      + T +  + + DA+ +  Y G
  S:     3 SLLIDTSNQPLSVALMQNDEVLAEITTDSKQNHSVQLMPAISQLFEQSKIAKQQLDAIIVAEGPGSYTGLRIGVTVAKTLAYAL-DVKLYGVSSLKALAATIDHTDKLLVPVFDARRQAVYTG 124
>gi|15925041|ref|NP_372575.1| hypothetical protein SAV2051 [Staphylococcus aureus subsp. aureus Mu50] >gi|15927626|ref|NP_375159.1| hypothetical protein SA1856 [Staphylococcus aureus subsp. aureus N315] >gi|156980367|ref|YP_001442626.1| hypothetical protein SAHV_2036 [Staphylococcus aureus subsp. aureus Mu3] >gi|13701846|dbj|BAB43138.1| SA1856 [Staphylococcus aureus subsp. aureus N315] >gi|14247824|dbj|BAB58213.1| similar to glycoprotein endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >gi|156722502|dbj|BAF78919.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] (229 aa)
Score = 105, Expect = 2.7e-03, Identities = 33/118 (27%), Positives = 65/118 (55%)
  Q:     7 SLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQW-----NTTKENEIVLIDAKTKLFYIG 124
           SLLID     L +A++++  ++        +N +  L P+I+ + E++K+ K+ L++I +  GPGS+T ++  V  A T      +V LY ++S +      + T +  + + DA+ +  Y G
  S:    12 SLLIDTSNQPLSVALMQNDEVLAEITTDSKQNHSVQLMPAISQLFEQSKIAKQQLDAIIVAEGPGSYTGLRIGVTVAKTLAYAL-DVKLYGVSSLKALAATIDHTDKLLVPVFDARRQAVYTG 133
>gi|149005883|ref|ZP_01829612.1| hypothetical protein CGSSp18BS74_06890 [Streptococcus pneumoniae SP18-BS74] >gi|147762239|gb|EDK69200.1| hypothetical protein CGSSp18BS74_06890 [Streptococcus pneumoniae SP18-BS74] (227 aa)
Score = 104, Expect = 3.2e-03, Identities = 36/129 (27%), Positives = 62/129 (48%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENE---IVLIDAKTKLFYIGANGMEKPFLIQS 136
           L  D     L LAI++DK ++  +     KN +  L P+I F++E      ++L+ I +  GPGS+T ++  V  A T      N+ L  ++S       + E   + L+DA+    Y G     KP + ++
  S:     4 LAFDTSSKALSLAILEDKQVLAETTINIKKNHSITLMPAIDFLMESLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLTHTL-NIELVGMSSLLALVPYQQEGLFVPLMDARRNNVYAGFYENAKPVMPEA 134
>gi|182683100|ref|YP_001834847.1| hypothetical protein SPCG_0130 [Streptococcus pneumoniae CGSP14] >gi|182628434|gb|ACB89382.1| hypothetical protein SPCG_0130 [Streptococcus pneumoniae CGSP14] (227 aa)
Score = 104, Expect = 3.6e-03, Identities = 35/129 (27%), Positives = 61/129 (47%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENE---IVLIDAKTKLFYIGANGMEKPFLIQS 136
           L  D     L LAI++DK ++  +     KN +  L P+I F++       ++L+ I +  GPGS+T ++  V  A T      N+ L  ++S       + E   + L+DA+    Y G     KP + ++
  S:     4 LAFDTSSKALSLAILEDKQVLAETTINIKKNHSITLMPAIDFLMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAHTL-NIELVGMSSLLALVPHQQEGLFVPLMDARRNNVYAGFYENSKPVMAEA 134
>gi|55823664|ref|YP_142105.1| glycoprotein endopeptidase [Streptococcus thermophilus CNRZ1066] >gi|55739649|gb|AAV63290.1| glycoprotein endopeptidase [Streptococcus thermophilus CNRZ1066] (253 aa)
Score = 104, Expect = 3.8e-03, Identities = 31/117 (26%), Positives = 59/117 (50%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLI---DAKTKLFYIG 124
           L  D     L +A+++D+ +V  +     KN +  L P+I F++ +   +  +L+ + +  GPGS+T ++  V  A T      N++L  ++S Q       + V+I   DA+    Y+G
  S:    29 LAFDTSSTALSVALLEDENLVAEATVTVKKNHSISLMPTIDFLVAQVSWQPADLDRVVVAQGPGSYTGLRVAVATAKTLAYAL-NIDLVGVSSLQALMDHSADGVVIPIMDARRNNVYVG 147
>gi|168492398|ref|ZP_02716541.1| glycoprotein endopeptidase [Streptococcus pneumoniae CDC0288-04] >gi|168493838|ref|ZP_02717981.1| glycoprotein endopeptidase [Streptococcus pneumoniae CDC3059-06] >gi|183573404|gb|EDT93932.1| glycoprotein endopeptidase [Streptococcus pneumoniae CDC0288-04] >gi|183576048|gb|EDT96576.1| glycoprotein endopeptidase [Streptococcus pneumoniae CDC3059-06] (227 aa)
Score = 104, Expect = 3.8e-03, Identities = 35/129 (27%), Positives = 62/129 (48%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENE---IVLIDAKTKLFYIGANGMEKPFLIQS 136
           L  D     L LAI++DK ++  +     KN +  L P+I F++       ++L+ I +  GPGS+T ++  V  A T      N+ L  ++S      ++ E   + ++DA+    Y G     KP L ++
  S:     4 LAFDTSSKALSLAILEDKQVLAETTINIKKNHSITLMPAIDFLMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAHTL-NIELVGMSSLLALVPRQKEGLVVPIMDARRNNVYAGFYENAKPVLPEA 134
>gi|104774429|ref|YP_619409.1| putative peptidase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103423510|emb|CAI98412.1| Putative peptidase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (240 aa)
Score = 104, Expect = 3.8e-03, Identities = 28/109 (25%), Positives = 57/109 (52%)
  Q:    17 LELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQN--VNLYFLNSTQWNTTKENEIVL--IDAKTKLFYIGA 125
           L +A+ +   +V    E   +N +  L+P IA ++ +N L  ++++   +  GPGS+T ++  +  A  F  +     V +  L +   N   E+ +++  +DA+ K F+ GA
  S:    13 LSIALNEADHLVSEKIEENQRNHSVDLDPDIASLLAENGLSLKDIDRFAVAIGPGSYTGLRVGLTTAKMFASILNKELVGVSTLQALAQNFAGEDALIVAALDARNKNFFAGA 125
>gi|55821744|ref|YP_140186.1| glycoprotein endopeptidase [Streptococcus thermophilus LMG 18311] >gi|55737729|gb|AAV61371.1| glycoprotein endopeptidase [Streptococcus thermophilus LMG 18311] (253 aa)
Score = 104, Expect = 3.9e-03, Identities = 31/117 (26%), Positives = 59/117 (50%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLI---DAKTKLFYIG 124
           L  D     L +A+++D+ +V  +     KN +  L P+I F++ +   +  +L+ + +  GPGS+T ++  V  A T      N++L  ++S Q       + V+I   DA+    Y+G
  S:    29 LAFDTSSTALSVALLEDENLVAEATVTVKKNHSISLMPTIDFLVAQVSWQPADLDRVVVAQGPGSYTGLRVAVATAKTLAYAL-NIDLVGVSSLQALMDHSADGVVIPIMDARRNNVYVG 147
>gi|116628465|ref|YP_821084.1| glycoprotein endopeptidase [Streptococcus thermophilus LMD-9] >gi|116101742|gb|ABJ66888.1| Inactive homolog of metal-dependent protease, putative molecular chaperone [Streptococcus thermophilus LMD-9] (228 aa)
Score = 103, Expect = 4.2e-03, Identities = 31/117 (26%), Positives = 59/117 (50%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLI---DAKTKLFYIG 124
           L  D     L +A+++D+ +V  +     KN +  L P+I F++ +   +  +L+ + +  GPGS+T ++  V  A T      N++L  ++S Q       + V+I   DA+    Y+G
  S:     4 LAFDTSSTALSVALLEDENLVAEATVTVKKNHSISLMPTIDFLVAQVSWQPADLDRVVVAQGPGSYTGLRVAVATAKTLAYAL-NIDLVGVSSLQALMDHSADGVVIPIMDARRNNVYVG 122
>gi|15902173|ref|NP_357723.1| hypothetical protein spr0129 [Streptococcus pneumoniae R6] >gi|116516776|ref|YP_815654.1| hypothetical protein SPD_0134 [Streptococcus pneumoniae D39] >gi|15457668|gb|AAK98933.1| Conserved hypothetical protein [Streptococcus pneumoniae R6] >gi|116077352|gb|ABJ55072.1| conserved hypothetical protein [Streptococcus pneumoniae D39] (227 aa)
Score = 103, Expect = 4.3e-03, Identities = 36/129 (27%), Positives = 61/129 (47%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENE---IVLIDAKTKLFYIGANGMEKPFLIQS 136
           L  D     L LAI++DK ++  +     KN +  L P+I F++       ++L+ I +  GPGS+T ++  V  A T      N+ L  ++S       + E   I L+DA+    Y G     KP + ++
  S:     4 LAFDTSSKALSLAILEDKQVLAETTINIKKNHSITLMPAIDFLMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAHTL-NIELVGMSSLLALVPYQQEGLFIPLMDARRNNVYAGFYENAKPVMAEA 134
>gi|15900069|ref|NP_344673.1| hypothetical protein SP_0127 [Streptococcus pneumoniae TIGR4] >gi|111658065|ref|ZP_01408766.1| hypothetical protein SpneT_02000754 [Streptococcus pneumoniae TIGR4] >gi|169832717|ref|YP_001693662.1| glycoprotein endopeptidase [Streptococcus pneumoniae Hungary19A-6] >gi|14971595|gb|AAK74313.1| conserved hypothetical protein [Streptococcus pneumoniae TIGR4] >gi|168995219|gb|ACA35831.1| glycoprotein endopeptidase [Streptococcus pneumoniae Hungary19A-6] (227 aa)
Score = 103, Expect = 5.1e-03, Identities = 35/129 (27%), Positives = 61/129 (47%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENE---IVLIDAKTKLFYIGANGMEKPFLIQS 136
           L  D     L LAI++DK ++  +     KN +  L P+I F++       ++L+ I +  GPGS+T ++  V  A T      N+ L  ++S       + E   + L+DA+    Y G     KP + ++
  S:     4 LAFDTSSKALSLAILEDKQVLAETTINIKKNHSITLMPAIDFLMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAHTL-NIELVGMSSLLALVPHQQEGLFVPLMDARRNNVYAGFYENAKPVMAEA 134
>gi|89896722|ref|YP_520209.1| hypothetical protein DSY3976 [Desulfitobacterium hafniense Y51] >gi|109647349|ref|ZP_01371253.1| peptidase M22, glycoprotease [Desulfitobacterium hafniense DCB-2] >gi|89336170|dbj|BAE85765.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109642595|gb|EAT52149.1| peptidase M22, glycoprotease [Desulfitobacterium hafniense DCB-2] (238 aa)
Score = 102, Expect = 5.8e-03, Identities = 31/115 (26%), Positives = 59/115 (51%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQ--NVNLYFLNSTQW--NTTKENEIVLIDAKTKLFY 122
           L ID       LA+  D  +V   F    K  ++ L P +  ++E +  + ++L+ I +V GPGSFT ++  +  A    +V +   + +  L+S  W  ++ KE  + ++DA+   +Y
  S:     4 LTIDTTTKVTALALADDGQLVAEGFLHTSKTHSERLIPVLDQVLEASAWKLQDLDFIGVVRGPGSFTGIRIGIATAQGLAQVLKLPLIGVLSLDSLAWAGHSRKEEIVPILDARKNEWY 122
>gi|148996551|ref|ZP_01824269.1| hypothetical protein CGSSp11BS70_07645 [Streptococcus pneumoniae SP11-BS70] >gi|168483778|ref|ZP_02708730.1| glycoprotein endopeptidase [Streptococcus pneumoniae CDC1873-00] >gi|168576436|ref|ZP_02722319.1| glycoprotein endopeptidase [Streptococcus pneumoniae MLV-016] >gi|147757126|gb|EDK64165.1| hypothetical protein CGSSp11BS70_07645 [Streptococcus pneumoniae SP11-BS70] >gi|172042884|gb|EDT50930.1| glycoprotein endopeptidase [Streptococcus pneumoniae CDC1873-00] >gi|183577846|gb|EDT98374.1| glycoprotein endopeptidase [Streptococcus pneumoniae MLV-016] (227 aa)
Score = 101, Expect = 8.2e-03, Identities = 35/129 (27%), Positives = 61/129 (47%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENE---IVLIDAKTKLFYIGANGMEKPFLIQS 136
           L  D     L LAI++DK ++  +     KN +  L P+I F++       ++L+ I +  GPGS+T ++  V  A T      N+ L  ++S       + E   + L+DA+    Y G     KP + ++
  S:     4 LAFDTSSKALSLAILEDKQVLAETTINIKKNHSITLMPAIDFLMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAYTL-NIELVGMSSLLALVPHQQEGLFVPLMDARRNNVYAGFYENAKPVMAEA 134
>gi|194397265|ref|YP_002036845.1| conserved hypothetical protein [Streptococcus pneumoniae G54] >gi|194356932|gb|ACF55380.1| conserved hypothetical protein [Streptococcus pneumoniae G54] (227 aa)
Score = 100, Expect = 1.0e-02, Identities = 35/129 (27%), Positives = 61/129 (47%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENE---IVLIDAKTKLFYIGANGMEKPFLIQS 136
           L  D     L LAI++DK ++  +     KN +  L P+I F++       ++L+ I +  GPGS+T ++  V  A T      N+ L  ++S       + E   + L+DA+    Y G     KP + ++
  S:     4 LAFDTSSKALSLAILEDKQVLAETTINIKKNHSITLMPAIDFLMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAYTL-NIELVGMSSLLALVPHQQEGLFVPLMDARRNNVYAGFYENAKPVMAEA 134
>gi|49486846|ref|YP_044067.1| hypothetical protein SAS1956 [Staphylococcus aureus subsp. aureus MSSA476] >gi|49245289|emb|CAG43763.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MSSA476] (220 aa)
Score = 100, Expect = 1.1e-02, Identities = 32/118 (27%), Positives = 64/118 (54%)
  Q:     7 SLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQW-----NTTKENEIVLIDAKTKLFYIG 124
           SLLID     L +A++++  ++        +N +  L P+I+ + E++K+ K+ L++I +  GPGS+T ++  V  A        +V LY ++S +      + T +  + + DA+ +  Y G
  S:     3 SLLIDTSNQPLSVALMQNDEVLAEITTDSKQNHSVQLMPAISQLFEQSKIAKQQLDAIIVAEGPGSYTGLRIGVTVAKILAYAL-DVKLYGVSSLKALAATIDHTDKLLVPVFDARRQAVYTG 124
>gi|21283704|ref|NP_646792.1| hypothetical protein MW1975 [Staphylococcus aureus subsp. aureus MW2] >gi|21205146|dbj|BAB95840.1| MW1975 [Staphylococcus aureus subsp. aureus MW2] (229 aa)
Score = 100, Expect = 1.1e-02, Identities = 32/118 (27%), Positives = 64/118 (54%)
  Q:     7 SLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQW-----NTTKENEIVLIDAKTKLFYIG 124
           SLLID     L +A++++  ++        +N +  L P+I+ + E++K+ K+ L++I +  GPGS+T ++  V  A        +V LY ++S +      + T +  + + DA+ +  Y G
  S:    12 SLLIDTSNQPLSVALMQNDEVLAEITTDSKQNHSVQLMPAISQLFEQSKIAKQQLDAIIVAEGPGSYTGLRIGVTVAKILAYAL-DVKLYGVSSLKALAATIDHTDKLLVPVFDARRQAVYTG 133
>gi|148987870|ref|ZP_01819333.1| hypothetical protein CGSSp6BS73_10171 [Streptococcus pneumoniae SP6-BS73] >gi|147926334|gb|EDK77407.1| hypothetical protein CGSSp6BS73_10171 [Streptococcus pneumoniae SP6-BS73] (227 aa)
Score = 99, Expect = 1.3e-02, Identities = 35/129 (27%), Positives = 61/129 (47%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENE---IVLIDAKTKLFYIGANGMEKPFLIQS 136
           L  D     L LAI++DK ++  +     KN +  L P+I F++       ++L+ I +  GPGS+T ++  V  A T      N+ L  ++S       + E   + L+DA+    Y G     KP + ++
  S:     4 LAFDTSSKALSLAILEDKQVLAETTINIKKNHSITLMPAIDFLMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLTHTL-NIELVGMSSLLALVPYQQEGLFVPLMDARRNNVYAGFYENAKPVMPEA 134
>gi|116514528|ref|YP_813434.1| metal-dependent protease-like protein, putative molecular chaperone [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116093843|gb|ABJ58996.1| Metal-dependent protease-like protein, putative molecular chaperone [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (240 aa)
Score = 99, Expect = 1.3e-02, Identities = 27/108 (25%), Positives = 56/108 (51%)
  Q:    17 LELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQN--VNLYFLNSTQWNTTKENEIVL--IDAKTKLFYIG 124
           L +A+ +   +V    E   +N +  L+P IA ++ +N L  ++++   +  GPGS+T ++  +  A  F  +     V +  L +   N   E+ +++  +DA+ K F+ G
  S:    13 LSIALNEADHLVSEKIEENQRNHSVDLDPDIASLLAENGLSLKDIDRFAVAIGPGSYTGLRVGLTTAKMFASILNKELVGVSTLQALAQNFAGEDALIVAALDARNKNFFAG 124
>gi|149011004|ref|ZP_01832309.1| hypothetical protein CGSSp19BS75_11128 [Streptococcus pneumoniae SP19-BS75] >gi|147764640|gb|EDK71570.1| hypothetical protein CGSSp19BS75_11128 [Streptococcus pneumoniae SP19-BS75] (227 aa)
Score = 99, Expect = 1.5e-02, Identities = 36/129 (27%), Positives = 60/129 (46%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENE---IVLIDAKTKLFYIGANGMEKPFLIQS 136
           L  D     L LAI++DK I+        KN +  L P+I F++       ++L+ I +  GPGS+T ++  V  A T      N+ L  ++S       + E   + L+DA+    Y G     KP + ++
  S:     4 LAFDTSSKALSLAILEDKQILAEMTINIKKNHSITLMPAIDFLMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAHTL-NIELVGMSSLLALVPYQQEGLFVSLMDARRNNVYAGFYENAKPVMPEA 134
>gi|148983531|ref|ZP_01816850.1| hypothetical protein CGSSp3BS71_05354 [Streptococcus pneumoniae SP3-BS71] >gi|147923678|gb|EDK74790.1| hypothetical protein CGSSp3BS71_05354 [Streptococcus pneumoniae SP3-BS71] (227 aa)
Score = 98, Expect = 1.6e-02, Identities = 33/129 (25%), Positives = 61/129 (47%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENE---IVLIDAKTKLFYIGANGMEKPFLIQS 136
           L  D     L L I++DK ++  +     KN +  L P+I F++       ++L+ I +  GPGS+T ++  V  A T      N+ L  ++S      ++ E   + ++DA+    Y G     KP + ++
  S:     4 LAFDTSSKALSLVILEDKQVLAETTINIKKNHSITLMPAIDFLMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAHTL-NIELVGMSSLLALVPRQQEGLVVPIMDARRNNVYAGFYENAKPVMAEA 134
>gi|42525114|ref|NP_970494.1| glycoprotein endopeptidase [Bdellovibrio bacteriovorus HD100] >gi|39577325|emb|CAE81148.1| glycoprotein endopeptidase [Bdellovibrio bacteriovorus HD100] (234 aa)
Score = 98, Expect = 1.7e-02, Identities = 29/113 (25%), Positives = 58/113 (51%)
  Q:    19 LAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVV----LFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLIDAKTKLFYIGANGM--EKP 131
           +AII D  IV     ++ K  ++I++P     ++K  L+ E+++   +  GPGSFT ++        F+ +F K    ++   L + +   + +  + +I+A   + Y G   M  E+P
  S:    15 VAIIVDGKIVAEETTLRQKTHSEIISPFTEHCLQKAGLKLEDIDVFAVGQGPGSFTGIRVAANAGKTFSYSFNKPLVTIDSLVLLAERARGSDKPVLAIINAYKNMVYTGLFDMSGEEP 133
>gi|149017808|ref|ZP_01834267.1| hypothetical protein CGSSp23BS72_10735 [Streptococcus pneumoniae SP23-BS72] >gi|147931372|gb|EDK82350.1| hypothetical protein CGSSp23BS72_10735 [Streptococcus pneumoniae SP23-BS72] (227 aa)
Score = 98, Expect = 2.0e-02, Identities = 36/129 (27%), Positives = 60/129 (46%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENE---IVLIDAKTKLFYIGANGMEKPFLIQS 136
           L  D     L LAI++DK I+        KN +  L P+I F++       ++L+ I +  GPGS+T ++  V  A T      N+ L  ++S       + E   + L+DA+    Y G     KP + ++
  S:     4 LAFDTSSKALSLAILEDKQILAEMTINIKKNHSITLMPAIDFLMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAHTL-NIELVGMSSLLALVPYQQEGLFVSLMDARRNNVYAGFYENAKPVMPEA 134
>gi|125717190|ref|YP_001034323.1| hypothetical protein SSA_0316 [Streptococcus sanguinis SK36] >gi|125497107|gb|ABN43773.1| Conserved hypothetical protein [Streptococcus sanguinis SK36] (228 aa)
Score = 97, Expect = 2.1e-02, Identities = 22/75 (29%), Positives = 40/75 (53%)
  Q:    17 LELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQ 91
           L LAI++D+T++        KN +  L P+I F++    ++  +L+ I +  GPGS+T ++  V  A T     +
  S:    13 LTLAILEDETLLAQMTLNIKKNHSITLMPAIDFLMNSLDMKPTDLDRIVVAQGPGSYTGLRMAVATAKTLAHTLK 87
>gi|160914293|ref|ZP_02076512.1| hypothetical protein EUBDOL_00301 [Eubacterium dolichum DSM 3991] >gi|158433766|gb|EDP12055.1| hypothetical protein EUBDOL_00301 [Eubacterium dolichum DSM 3991] (195 aa)
Score = 96, Expect = 3.3e-02, Identities = 36/156 (23%), Positives = 74/156 (47%)
  Q:    10 IDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNT-TKENEIVLIDAKTKLFYIGANGMEKPFLIQSDEINKLTNKYEKYFYSLETKKSIYEKWQF 165
           +D    YL L + +D  ++    +   KN ++++ P +  + E+   + ++++ + I +GPGS+T V+  +  A     + +++ LY L+S Q    +  + + ++DA++   Y       K  LI  +EI            +LE  K I +  QF
  S:     1 MDSSHKYLVLGLYEDNQLIAGYAKESWKNQSEMIFPQLIALCEQAGWKSDDIDEVVITDGPGSYTGVRIAMSIAKVLCTI-KHIPLYVLSSLQLLVGSHAHALAVMDARSNRAYCARYSEGK--LIGKEEI-----------LTLEELKQIQKDHQF 143
>gi|161506959|ref|YP_001576913.1| putative glycoprotein endopeptidase [Lactobacillus helveticus DPC 4571] >gi|160347948|gb|ABX26622.1| putative glycoprotein endopeptidase [Lactobacillus helveticus DPC 4571] (244 aa)
Score = 95, Expect = 3.6e-02, Identities = 23/81 (28%), Positives = 49/81 (60%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVK----SVVLFANTFKK 88
           L +    ++L +A+ +D+ ++    E  ++N +K L+P I  I+++NKL   +++   +  GPGS+T ++    +V +FA+   K
  S:     4 LSVSTATNHLSVALNEDQQVIVEKNERDERNHSKHLDPLIEEILKENKLTLNDIDRFAVAIGPGSYTGLRIGITTVKMFASILNK 88
>gi|76787251|ref|YP_330378.1| M22 peptidase [Streptococcus agalactiae A909] >gi|77406204|ref|ZP_00783274.1| protein of unknown function [Streptococcus agalactiae H36B] >gi|77412354|ref|ZP_00788666.1| protein of unknown function [Streptococcus agalactiae CJB111] >gi|76562308|gb|ABA44892.1| peptidase, putative, M22 (O-sialoglycoprotein endopeptidase) family [Streptococcus agalactiae A909] >gi|77161610|gb|EAO72609.1| protein of unknown function [Streptococcus agalactiae CJB111] >gi|77175198|gb|EAO77997.1| protein of unknown function [Streptococcus agalactiae H36B] (230 aa)
Score = 95, Expect = 3.7e-02, Identities = 32/88 (36%), Positives = 51/88 (57%)
  Q:    37 KNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVV----LFANTFKKVFQNV-NLYFLNSTQWNTTKENEIV--LIDAKTKLFYIG 124
           KN +  L P+I F+++   LE ++L+ I +  GPGS+T ++  V    + A T K     V +LY L     N   EN+++  LIDA+    Y+G
  S:    34 KNHSINLMPAIDFLMQSIDLEPQDLDRIVVAEGPGSYTGLRVAVATAKMLAYTLKIDLVGVSSLYALT----NGFSENDLLVPLIDARRNNVYVG 124
>gi|112148552|gb|ABI13558.1| putative glycoprotein endopeptidase [Lactobacillus helveticus CNRZ32] (244 aa)
Score = 95, Expect = 3.7e-02, Identities = 23/81 (28%), Positives = 49/81 (60%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVK----SVVLFANTFKK 88
           L +    ++L +A+ +D+ ++    E  ++N +K L+P I  I+++NKL   +++   +  GPGS+T ++    +V +FA+   K
  S:     4 LSVSTATNHLSVALNEDQQVIVEKNERDERNHSKHLDPLIEEILKENKLTLNDIDRFAVAIGPGSYTGLRIGITTVKMFASILNK 88
>gi|168807417|ref|ZP_02828476.1| glycoprotease family protein [Ureaplasma urealyticum serovar 2] (191 aa)
Score = 95, Expect = 3.8e-02, Identities = 35/120 (29%), Positives = 59/120 (49%)
  Q:     3 NNKFSLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEI-VLIDAKTKLFY 122
           N+ + L ID       LAI K+  I+ +     + NLT I+   I  +++   L+ ++L++IY+  GPGSFT V+   + A T       + L+  +S       +N + V +DAK    Y
  S:     2 NSLYQLFIDVTSKKCVLAIYKNFKILANIIVETNNNLTDIIVEHIIALLKAVHLKYQDLDAIYLDIGPGSFTGVRVGAIVAKTICTTHNQIKLFINDSLNIIANNQNNVFVHLDAKGNKSY 122
>gi|77414542|ref|ZP_00790687.1| protein of unknown function [Streptococcus agalactiae 515] >gi|77159414|gb|EAO70580.1| protein of unknown function [Streptococcus agalactiae 515] (230 aa)
Score = 95, Expect = 4.3e-02, Identities = 32/88 (36%), Positives = 51/88 (57%)
  Q:    37 KNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVV----LFANTFKKVFQNV-NLYFLNSTQWNTTKENEIV--LIDAKTKLFYIG 124
           KN +  L P+I F+++   LE ++L+ I +  GPGS+T ++  V    + A T K     V +LY L     N   EN+++  LIDA+    Y+G
  S:    34 KNHSINLMPAIDFLMQSIDLEPQDLDRIVVAEGPGSYTGLRVAVATAKMLAYTLKIDLVGVSSLYALT----NGFSENDLLVPLIDARRNNVYVG 124
>gi|25011841|ref|NP_736236.1| hypothetical protein gbs1802 [Streptococcus agalactiae NEM316] >gi|24413382|emb|CAD47461.1| Unknown [Streptococcus agalactiae NEM316] (229 aa)
Score = 95, Expect = 4.4e-02, Identities = 32/88 (36%), Positives = 51/88 (57%)
  Q:    37 KNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVV----LFANTFKKVFQNV-NLYFLNSTQWNTTKENEIV--LIDAKTKLFYIG 124
           KN +  L P+I F+++   LE ++L+ I +  GPGS+T ++  V    + A T K     V +LY L     N   EN+++  LIDA+    Y+G
  S:    33 KNHSINLMPAIDFLMQSIDLEPQDLDRIVVAEGPGSYTGLRVAVATAKMLAYTLKIDLVGVSSLYALT----NGFSENDLLVPLIDARRNNVYVG 123
>gi|167974715|ref|ZP_02556992.1| glycoprotease family protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188997859|gb|EDU66956.1| glycoprotease family protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (191 aa)
Score = 94, Expect = 4.8e-02, Identities = 36/120 (30%), Positives = 58/120 (48%)
  Q:     3 NNKFSLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQ-WNTTKENEIVLIDAKTKLFY 122
           N+ + L ID       LAI K+  I+ +     + NLT I+   I  +++   L+ ++L++IY+  GPGSFT V+   + A T       + L+  +S       K N  V +DAK    Y
  S:     2 NSLYQLFIDVTSKKCVLAIYKNFKILANIIVETNNNLTDIIVEHIIALLKAVHLKYQDLDAIYLDIGPGSFTGVRVGAIVAKTICTTHDQIKLFINDSLNIIANNKNNVFVHLDAKGNKSY 122
>gi|22537898|ref|NP_688749.1| hypothetical protein SAG1759 [Streptococcus agalactiae 2603V/R] >gi|76798248|ref|ZP_00780497.1| glycoprotein endopeptidase [Streptococcus agalactiae 18RS21] >gi|22534795|gb|AAN00622.1|AE014271_17 protein of unknown function [Streptococcus agalactiae 2603V/R] >gi|76586401|gb|EAO62910.1| glycoprotein endopeptidase [Streptococcus agalactiae 18RS21] (230 aa)
Score = 94, Expect = 4.8e-02, Identities = 32/88 (36%), Positives = 51/88 (57%)
  Q:    37 KNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVV----LFANTFKKVFQNV-NLYFLNSTQWNTTKENEIV--LIDAKTKLFYIG 124
           KN +  L P+I F+++   LE ++L+ I +  GPGS+T ++  V    + A T K     V +LY L     N   EN+++  LIDA+    Y+G
  S:    34 KNHSINLMPAIDFLMQSIDLEPQDLDRIVVAEGPGSYTGLRVAVATAKMLAYTLKIDLVGVSSLYALT----NGFSENDLLVPLIDARRNNVYVG 124
>gi|3341437|emb|CAA76861.1| hypothetical protein [Enterococcus faecalis] (204 aa)
Score = 94, Expect = 4.9e-02, Identities = 30/118 (25%), Positives = 56/118 (47%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQN--VNLYFLNSTQWNTTKENEIV--LIDAKTKLFYIGA 125
           L ID     L +A+ +++ I+ S      +N +  L P+I +++ +  L    ++   +  GPGS+T ++  V  A T     +   V +  L +   N   +  ++  L DA+ K  Y GA
  S:    16 LAIDTSNQTLSIAVCENQKILGSYTATVKRNHSLTLMPAIDYLMSQLNLAPTAIDRFVVAEGPGSYTGLRLGVTTAKTLAYTLKKELVGISSLQALAANCVGQTGLIVPLFDARRKNVYAGA 137
>gi|167941324|ref|ZP_02528399.1| glycoprotease family protein [Ureaplasma urealyticum serovar 8] >gi|167959591|ref|ZP_02546661.1| glycoprotease family protein [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167973545|ref|ZP_02555822.1| glycoprotease family [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167976123|ref|ZP_02558400.1| glycoprotease family protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|167988622|ref|ZP_02570293.1| glycoprotease family [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|168337207|ref|ZP_02693822.1| glycoprotease family protein [Ureaplasma urealyticum serovar 10] >gi|168363197|ref|ZP_02696367.1| glycoprotease family [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|195867638|ref|ZP_03079640.1| glycoprotease family protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903024|gb|EDT49313.1| glycoprotease family [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184208904|gb|EDU05947.1| glycoprotease family [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018934|gb|EDU56974.1| glycoprotease family [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|195659596|gb|EDX52976.1| glycoprotease family protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660695|gb|EDX53950.1| glycoprotease family protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (191 aa)
Score = 94, Expect = 5.1e-02, Identities = 36/120 (30%), Positives = 58/120 (48%)
  Q:     3 NNKFSLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQ-WNTTKENEIVLIDAKTKLFY 122
           N+ + L ID       LAI K+  I+ +     + NLT I+   I  +++   L+ ++L++IY+  GPGSFT V+   + A T       + L+  +S       K N  V +DAK    Y
  S:     2 NSLYQLFIDVTSKKCVLAIYKNFKILANIIVETNNNLTDIIVEHIIALLKAVHLKYQDLDAIYLDIGPGSFTGVRVGAIVAKTICTTHNQIKLFINDSLNIIANNKNNVFVHLDAKGNKSY 122
>gi|157150006|ref|YP_001449540.1| glycoprotein endopeptidase [Streptococcus gordonii str. Challis substr. CH1] >gi|157074800|gb|ABV09483.1| glycoprotein endopeptidase [Streptococcus gordonii str. Challis substr. CH1] (230 aa)
Score = 93, Expect = 6.2e-02, Identities = 31/117 (26%), Positives = 58/117 (49%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENE---IVLIDAKTKLFYIG 124
           L  D     L LAI++D+ ++  +     KN +  L P+I F++    ++  +L+ I +  GPGS+T ++  V  A T     + + L  ++S      ++ E   I ++DA+    Y G
  S:     4 LAFDTSNQALSLAILEDEHLLAQTTLNIKKNHSITLMPAIDFLMNSLDMKPTDLDRIAVAQGPGSYTGLRIAVATAKTLAHTLK-IELVGVSSLLALVPEQVEGLVIPIVDARRNNVYAG 122
>gi|29376968|ref|NP_816122.1| hypothetical protein EF2475 [Enterococcus faecalis V583] >gi|29344433|gb|AAO82192.1| conserved hypothetical protein [Enterococcus faecalis V583] (251 aa)
Score = 93, Expect = 7.4e-02, Identities = 30/118 (25%), Positives = 56/118 (47%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQN--VNLYFLNSTQWNTTKENEIV--LIDAKTKLFYIGA 125
           L ID     L +A+ +++ I+ S      +N +  L P+I +++ +  L    ++   +  GPGS+T ++  V  A T     +   V +  L +   N   +  ++  L DA+ K  Y GA
  S:    16 LAIDTSNQTLSIAVCENQKILGSYTATVKRNHSLTLMPAIDYLMSQLNLAPTAIDRFVVAEGPGSYTGLRLGVTTAKTLAYTLKKELVGISSLQTLAANCVGQTGLIVPLFDARRKNVYAGA 137
>gi|194015891|ref|ZP_03054506.1| M22 family peptidase [Bacillus pumilus ATCC 7061] >gi|194012246|gb|EDW21813.1| M22 family peptidase [Bacillus pumilus ATCC 7061] (229 aa)
Score = 92, Expect = 9.6e-02, Identities = 23/79 (29%), Positives = 38/79 (48%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTF 86
           L ID     L +A++KD T++  S     KN +    P++  ++ +  +    L  I +  GPGS+T V+  V  A T 
  S:     4 LAIDTSNHTLGIALVKDSTVIGESITYLKKNHSVRAMPTVEALMIECGVAPSELSKIVVAKGPGSYTGVRIGVTIAKTL 82
>gi|409859|gb|AAD10606.1| unknown [Mycoplasma genitalium] (129 aa)
Score = 92, Expect = 9.7e-02, Identities = 23/72 (31%), Positives = 38/72 (52%)
  Q:    53 KNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLIDAKTKLFYIG 124
           KNKL+K +++  Y+  GPGSFT  +   + A ++  ++ +  LY LNS ++    E+ I  I       Y G
  S:     2 KNKLKKSSIKQFYVTIGPGSFTGQRIATIIAKSWCLLYPSCELYALNSLRFQIPYEHGISKISCGNDQNYCG 73
>gi|157691316|ref|YP_001485778.1| M22 family peptidase [Bacillus pumilus SAFR-032] >gi|157680074|gb|ABV61218.1| M22 family peptidase [Bacillus pumilus SAFR-032] (229 aa)
Score = 90, Expect = 1.4e-01, Identities = 22/79 (27%), Positives = 38/79 (48%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTF 86
           L ID     L +A++KD  ++  S     KN +    P++  ++++  +    L  I +  GPGS+T V+  V  A T 
  S:     4 LAIDTSNHTLGIALVKDSIVIGESITYLKKNHSVRAMPTVEALMKECGVAPSELSKIVVAKGPGSYTGVRIGVTIAKTL 82
>gi|195977431|ref|YP_002122675.1| putative molecular chaperone metal-dependent protease-like [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974136|gb|ACG61662.1| putative molecular chaperone metal-dependent protease-like [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (232 aa)
Score = 90, Expect = 1.5e-01, Identities = 26/88 (29%), Positives = 47/88 (53%)
  Q:    37 KNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFAN--TFKKVFQNVNLYFLNSTQWNTTKENE----IVLIDAKTKLFYIG 124
           KN +  L P+I F++    L+ ++L+ I +  GPGS+T ++     A    +      V +  L +   +T +EN     + LIDA+ +  Y+G
  S:    33 KNHSISLMPAIDFLMSSADLKPKDLDRIVVAEGPGSYTGLRVATATAKMLAYSLSIDLVGVSSLYALAASTCRENPDSLVVPLIDARRRHVYVG 126
>gi|167462252|ref|ZP_02327341.1| peptidase M22 glycoprotease [Paenibacillus larvae subsp. larvae BRL-230010] (292 aa)
Score = 90, Expect = 1.7e-01, Identities = 21/79 (26%), Positives = 40/79 (50%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTF 86
           L +D     + +A+++    +       ++N +  L P++  +I +      +LES+ + NGPGS+T V+  V  A TF
  S:    15 LALDTSTSSMTVALLRQGKQIAQVNSRAERNHSIHLLPAVQKLIREQGYRSSDLESVAVGNGPGSYTGVRIAVTAAKTF 93
>gi|146317822|ref|YP_001197534.1| putative molecular chaperone [Streptococcus suis 05ZYH33] >gi|146320016|ref|YP_001199727.1| putative molecular chaperone [Streptococcus suis 98HAH33] >gi|145688628|gb|ABP89134.1| putative molecular chaperone [Streptococcus suis 05ZYH33] >gi|145690822|gb|ABP91327.1| putative molecular chaperone [Streptococcus suis 98HAH33] (227 aa)
Score = 89, Expect = 1.8e-01, Identities = 30/117 (25%), Positives = 55/117 (47%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENE---IVLIDAKTKLFYIG 124
           L +D     L +A+++D  +   +     KN +  L P + F++ +     ++L+ I +  GPGS+T ++  V  A T     + ++L  L+S Q           + LIDA+    Y G
  S:     4 LALDSSNQALSVALVEDGRLQAETLLAVKKNHSISLMPVVDFLVAQVGWTPKDLDRIVVAQGPGSYTGLRVAVATAKTLAYTLK-IDLVGLSSLQSLVPPSLTGLVVPLIDARRNCVYAG 122
>gi|153167936|ref|ZP_01928006.1| hypothetical protein LMHG_02383 [Listeria monocytogenes FSL N1-017] >gi|133726645|gb|EBA28343.1| hypothetical protein LMHG_02383 [Listeria monocytogenes FSL N1-017] (230 aa)
Score = 89, Expect = 2.0e-01, Identities = 22/78 (28%), Positives = 41/78 (52%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANT 85
           L +D   D + +A+  +  ++        KN +  L P+IA ++E+  ++  +LE I +  GPGS+T ++  V  A T
  S:     3 LGMDTSSDTMAIALFNEGVVIGEYTTNLKKNHSVRLLPAIAVLMEECGVKPTDLEKIAVAKGPGSYTGLRIGVTVAKT 80
>gi|46908313|ref|YP_014702.1| hypothetical protein LMOf2365_2109 [Listeria monocytogenes str. 4b F2365] >gi|47091745|ref|ZP_00229540.1| conserved hypothetical protein [Listeria monocytogenes str. 4b H7858] >gi|153203135|ref|ZP_01944503.1| hypotehtical protein [Listeria monocytogenes HPB2262] >gi|167454610|ref|ZP_02320833.1| hypothetical protein LmonocytoFSL_14468 [Listeria monocytogenes FSL J2-064] >gi|46881584|gb|AAT04879.1| conserved hypothetical protein [Listeria monocytogenes str. 4b F2365] >gi|47019756|gb|EAL10494.1| conserved hypothetical protein [Listeria monocytogenes str. 4b H7858] >gi|133734819|gb|EBA36517.1| hypotehtical protein [Listeria monocytogenes HPB2262] (230 aa)
Score = 89, Expect = 2.0e-01, Identities = 22/78 (28%), Positives = 41/78 (52%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANT 85
           L +D   D + +A+  +  ++        KN +  L P+IA ++E+  ++  +LE I +  GPGS+T ++  V  A T
  S:     3 LGMDTSSDTMAIALFNEGVVIGEYTTNLKKNHSVRLLPAIAVLMEECGVKPTDLEKIAVAKGPGSYTGLRIGVTVAKT 80
>gi|154685092|ref|YP_001420253.1| YdiC [Bacillus amyloliquefaciens FZB42] >gi|154350943|gb|ABS73022.1| YdiC [Bacillus amyloliquefaciens FZB42] (229 aa)
Score = 89, Expect = 2.2e-01, Identities = 23/79 (29%), Positives = 39/79 (49%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTF 86
           L ID     L  A+++DKT++        KN +    P++  +++   L  ++L  I +  GPGS+T V+  V  A T 
  S:     4 LAIDTSNYTLGAALVRDKTVMAEYITYLKKNHSVRAMPAVNSLLKDCGLTPQDLTKIAVAKGPGSYTGVRIGVTLAKTL 82
>gi|81097415|ref|ZP_00875700.1| Peptidase M22, glycoprotease [Streptococcus suis 89/1591] >gi|80976543|gb|EAP40141.1| Peptidase M22, glycoprotease [Streptococcus suis 89/1591] (227 aa)
Score = 89, Expect = 2.2e-01, Identities = 30/117 (25%), Positives = 55/117 (47%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENE---IVLIDAKTKLFYIG 124
           L +D     L +A+++D  +   +     KN +  L P + F++ +     ++L+ I +  GPGS+T ++  V  A T     + ++L  L+S Q           + LIDA+    Y G
  S:     4 LALDSSNQALSVALVEDGRLQAETLLAVKKNHSISLMPVVDFLVAQVGWTPKDLDRIVVAEGPGSYTGLRVAVATAKTLAYTLK-IDLVGLSSLQSLVPPSLTGLVVPLIDARRNCVYAG 122
>gi|83590982|ref|YP_430991.1| peptidase M22, glycoprotease [Moorella thermoacetica ATCC 39073] >gi|83573896|gb|ABC20448.1| Peptidase M22, glycoprotease [Moorella thermoacetica ATCC 39073] (228 aa)
Score = 89, Expect = 2.2e-01, Identities = 22/70 (31%), Positives = 37/70 (52%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVK 77
           L +D        AI+ DK +V   F    KN ++ L P IA ++ +  +E  +L+ + +  GPGSFT ++
  S:     4 LGVDSATQVAAAAIVDDKQLVAELFFNTRKNHSQRLLPMIAALLAETGVELADLDGLAVSLGPGSFTGLR 73
>gi|167730312|emb|CAO81224.1| putative Peptidase M22, glycoprotease [Candidatus Cloacamonas acidaminovorans] (230 aa)
Score = 88, Expect = 2.3e-01, Identities = 31/118 (26%), Positives = 60/118 (50%)
  Q:     5 KFSLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFT-------SVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLIDAKTKLFY 122
           K  L +D   ++  +A+  +K ++ S++       ++ L P+I +  +   +E++ L+ IY+  GPGSFT       +VK +          F ++ L  L +++     +N +  IDAK K  Y
  S:     6 KLKLALDTTQNFGSIALADEKRVIYSAYFDIKITHSETLMPAIDYAFQFCNVERKELKEIYVCIGPGSFTGLRIGLATVKGIAFALGLPLYAFSSLELSALPASRLG---KNILSAIDAKMKEVY 127
>gi|167212757|ref|ZP_02283064.1| hypothetical protein LmonL_18680 [Listeria monocytogenes LO28] (91 aa)
Score = 88, Expect = 2.5e-01, Identities = 22/78 (28%), Positives = 41/78 (52%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANT 85
           L +D   D + +A+  +  ++        KN +  L P+IA ++E+  ++  +LE I +  GPGS+T ++  V  A T
  S:     3 LGMDTSSDTMTIALFNEGVVIGEYTTNLRKNHSVRLLPAIAVLMEECGVKPTDLEKIAVAKGPGSYTGLRIGVTVAKT 80
>gi|16804116|ref|NP_465601.1| hypothetical protein lmo2077 [Listeria monocytogenes EGD-e] >gi|47095786|ref|ZP_00233391.1| conserved hypothetical protein [Listeria monocytogenes str. 1/2a F6854] >gi|153175302|ref|ZP_01930697.1| hypothetical protein LMIG_00724 [Listeria monocytogenes FSL N3-165] >gi|153183557|ref|ZP_01934417.1| hypotehtical protein [Listeria monocytogenes J0161] >gi|153191598|ref|ZP_01938788.1| hypothetical protein LMPG_02087 [Listeria monocytogenes J2818] >gi|16411547|emb|CAD00155.1| lmo2077 [Listeria monocytogenes] >gi|47015790|gb|EAL06718.1| conserved hypothetical protein [Listeria monocytogenes str. 1/2a F6854] >gi|126943848|gb|EBA21565.1| hypotehtical protein [Listeria monocytogenes J0161] >gi|127765032|gb|EBA25384.1| hypothetical protein LMPG_02087 [Listeria monocytogenes J2818] >gi|133729755|gb|EBA31453.1| hypothetical protein LMIG_00724 [Listeria monocytogenes FSL N3-165] (230 aa)
Score = 88, Expect = 2.5e-01, Identities = 22/78 (28%), Positives = 41/78 (52%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANT 85
           L +D   D + +A+  +  ++        KN +  L P+IA ++E+  ++  +LE I +  GPGS+T ++  V  A T
  S:     3 LGMDTSSDTMTIALFNEGVVIGEYTTNLRKNHSVRLLPAIAVLMEECGVKPTDLEKIAVAKGPGSYTGLRIGVTVAKT 80
>gi|169825733|ref|YP_001695891.1| YdiC [Lysinibacillus sphaericus C3-41] >gi|168990221|gb|ACA37761.1| YdiC [Lysinibacillus sphaericus C3-41] (235 aa)
Score = 87, Expect = 3.1e-01, Identities = 25/75 (33%), Positives = 40/75 (53%)
  Q:    17 LELAIIKDKTIVDSSFEIQDKNLTKILN--PSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQ 91
           L +A+IKD  IV     +Q+  LT      P+I  I+ +  ++  +L++I +  GPGS+T V+  V  A T     Q
  S:    13 LSIAVIKDGKIVAEM--VQNIKLTHSAGAMPAIEEILARIDVKPNDLDAIAVSEGPGSYTGVRIGVTLAKTLAWTLQ 87
>gi|188996702|ref|YP_001930953.1| peptidase M22 glycoprotease [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931769|gb|ACD66399.1| peptidase M22 glycoprotease [Sulfurihydrogenibium sp. YO3AOP1] (194 aa)
Score = 87, Expect = 3.2e-01, Identities = 28/93 (30%), Positives = 47/93 (50%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNS 100
           L ID   D   +AIIKD  ++     ++ K  +++L P I  I  K K+E   L+ + +  G GS T ++  ++ A T      N+NLY+  +
  S:     3 LSIDTFSDNFGVAIIKDNKVLVIREYLKPKPFSEVLMPEIQDIFNKLKIEPSQLKGVIVNQGLGSNTGLRVGLITAKTLAYSL-NINLYYFRT 94
>gi|89100193|ref|ZP_01173060.1| probable O-sialoglycoprotein endopeptidase (glycoprotease) [Bacillus sp. NRRL B-14911] >gi|89085043|gb|EAR64177.1| probable O-sialoglycoprotein endopeptidase (glycoprotease) [Bacillus sp. NRRL B-14911] (236 aa)
Score = 87, Expect = 3.2e-01, Identities = 23/84 (27%), Positives = 39/84 (46%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQ 91
           L ID     L +A+I D+ ++        KN +  + P+I  ++    L   ++E + +  GPGS+T V+  V  A T     Q
  S:     4 LAIDTSNYVLGIAVIDDEKVIGEYITNLKKNHSVRIMPAIETLLRDCDLTAADIEKVVVAQGPGSYTGVRIGVTIAKTLAWSLQ 87
>gi|28377583|ref|NP_784475.1| glycoprotein endopeptidase [Lactobacillus plantarum WCFS1] >gi|28270415|emb|CAD63318.1| glycoprotein endopeptidase [Lactobacillus plantarum WCFS1] (241 aa)
Score = 86, Expect = 4.2e-01, Identities = 34/131 (25%), Positives = 62/131 (47%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQN--VNLYFLNSTQWNTTKENEIV--LIDAKTKLFYIGANGM--EKPFLIQSDE 138
           L ID     L +A+++D  I+ ++     +N +  L P I   + + KL   +L+ I +  GPGS+T ++  V  A T         V +  L     N   E ++V  L DA+    + G   +  ++P  + +D+
  S:     4 LAIDTSNRPLSVAVLEDTQILATTTTNVGRNHSSTLLPIIEQAMAQAKLAPADLDRIVVAAGPGSYTGLRIGVTTAKTLAFTLDKALVGVSSLAVLAGNIVTEGQLVAPLFDARRDNIFAGLYRIKNQRPVAVIADQ 140
>gi|77409376|ref|ZP_00786076.1| protein of unknown function [Streptococcus agalactiae COH1] >gi|77172017|gb|EAO75186.1| protein of unknown function [Streptococcus agalactiae COH1] (182 aa)
Score = 86, Expect = 4.2e-01, Identities = 31/87 (35%), Positives = 50/87 (57%)
  Q:    37 KNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVV----LFANTFKKVFQNV-NLYFLNSTQWNTTKENEIV--LIDAKTKLFYI 123
           KN +  L P+I F+++   LE ++L+ I +  GPGS+T ++  V    + A T K     V +LY L     N   EN+++  LIDA+    Y+
  S:    34 KNHSINLMPAIDFLMQSIDLEPQDLDRIVVAEGPGSYTGLRVAVATAKMLAYTLKIDLVGVSSLYALT----NGFSENDLLVPLIDARRNNVYV 123
>gi|187604121|ref|ZP_02990331.1| peptidase M22 glycoprotease [Exiguobacterium sp. AT1b] >gi|187483670|gb|EDU21664.1| peptidase M22 glycoprotease [Exiguobacterium sp. AT1b] (218 aa)
Score = 86, Expect = 4.4e-01, Identities = 34/117 (29%), Positives = 52/117 (44%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENE----IVLIDAKTKLFYIG 124
           L+ID     L +A+ +   I   +  +  KN    L P I  ++   K     LE I +  GPGS+T ++  V  A T      N+ L  +++ Q      N     + LIDA+    YIG
  S:     4 LMIDTATTRLSVALSEAGEIQAEATVMVSKNHAVTLMPMIEQLMAAVKWTPNMLERIIVTTGPGSYTGIRIGVTTAKTLAYTL-NLPLIGVSALQIMAAAPNTDLPVVSLIDARRGNAYIG 123
>gi|110598873|ref|ZP_01387125.1| Peptidase M22, glycoprotease [Chlorobium ferrooxidans DSM 13031] >gi|110339510|gb|EAT58033.1| Peptidase M22, glycoprotease [Chlorobium ferrooxidans DSM 13031] (224 aa)
Score = 86, Expect = 4.7e-01, Identities = 19/62 (30%), Positives = 35/62 (56%)
  Q:    16 YLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVK 77
           +L +A++ +   V      + K   + L P I  +I  + L++  L++I I +GPGSFTS++
  S:    12 HLSVALLTESGAVTEVLSAEWKKAAETLVPLIEQVIGDSGLDRHELDAIAISSGPGSFTSLR 73
>gi|167404961|ref|ZP_02309731.1| hypothetical protein LmonocytFSL_17261 [Listeria monocytogenes FSL J2-003] (230 aa)
Score = 85, Expect = 5.2e-01, Identities = 21/78 (26%), Positives = 41/78 (52%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANT 85
           L +D   D + +A+  +  ++        KN +  L P++A ++E+  ++  +LE I +  GPGS+T ++  V  A T
  S:     3 LGMDTSSDTMTIALFNEGVVIGEYTTNLRKNHSVRLLPALAVLMEECGVKPTDLEKIAVAKGPGSYTGLRIGVTVAKT 80
>gi|52079048|ref|YP_077839.1| peptidase M22, glycoprotease YdiC [Bacillus licheniformis ATCC 14580] >gi|52784419|ref|YP_090248.1| YdiC [Bacillus licheniformis ATCC 14580] >gi|52002259|gb|AAU22201.1| Peptidase M22, glycoprotease YdiC [Bacillus licheniformis ATCC 14580] >gi|52346921|gb|AAU39555.1| YdiC [Bacillus licheniformis DSM 13] (229 aa)
Score = 85, Expect = 5.5e-01, Identities = 24/79 (30%), Positives = 39/79 (49%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTF 86
           L ID     L +A+IKD  ++        KN +    P+I  ++++  L+  +L  I +  GPGS+T V+  V  A T 
  S:     4 LAIDTSNLTLGVALIKDGKVIAEHISHLKKNHSVRAMPAIDELLKECGLKPSDLTQIAVAKGPGSYTGVRIGVTIAKTL 82
>gi|116629050|ref|YP_814222.1| metal-dependent protease-like protein, putative molecular chaperone [Lactobacillus gasseri ATCC 33323] >gi|116094632|gb|ABJ59784.1| Metal-dependent protease-like protein, putative molecular chaperone [Lactobacillus gasseri ATCC 33323] (241 aa)
Score = 85, Expect = 5.8e-01, Identities = 29/117 (24%), Positives = 63/117 (53%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQWNTTKENEIVLI---DAKTKLFYIG 124
           L I    ++L +A+     IV+ + E   +N ++ L+P I  ++++N L  ++++   +  GPGS+T ++  +  A  F  +  N +L  +++      + N+ V++   DA+ K F+ G
  S:     4 LSITTATNHLSVALNDGDKIVEKNEE-DHRNHSEHLDPLINELLKENNLTLKDIDRFAVAEGPGSYTGLRIGITTAKMFASIL-NKDLVGVSTLAALANRVNDGVIVSELDARNKNFFAG 121
>gi|153196584|ref|ZP_01940954.1| hypothetical protein LMRG_01228 [Listeria monocytogenes 10403S] >gi|127634045|gb|EBA23437.1| hypothetical protein LMRG_01228 [Listeria monocytogenes 10403S] (230 aa)
Score = 85, Expect = 6.1e-01, Identities = 21/78 (26%), Positives = 41/78 (52%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANT 85
           L +D   D + +A+  +  ++        KN +  L P+IA ++++  ++  +LE I +  GPGS+T ++  V  A T
  S:     3 LGMDTSSDTMTIALFNEGVVIGEYTTNLRKNHSVRLLPAIAVLMQECGVKPTDLEKIAVAKGPGSYTGLRIGVTVAKT 80
>gi|163763011|ref|ZP_02170074.1| Imetal-dependent protease putative molecular chaperone-like protein [Bacillus selenitireducens MLS10] >gi|160356279|gb|EDP82929.1| Imetal-dependent protease putative molecular chaperone-like protein [Bacillus selenitireducens MLS10] (238 aa)
Score = 84, Expect = 6.9e-01, Identities = 24/78 (30%), Positives = 41/78 (52%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANT 85
           L ID     L + ++KD   + S    + KN +  L P+I  + E+  +  ++L+ I + +GPGS+T V+  V  A T
  S:     4 LAIDTASYVLGVGLLKDGKPLGSIVTHEKKNHSLRLMPAIRSLFEEVDMTPKDLDRIVVDHGPGSYTGVRIGVTTAKT 81
>gi|21672591|ref|NP_660658.1| hypothetical protein BUsg315 [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|25091602|sp|Q8K9L9|Y315_BUCAP Uncharacterized protein BUsg_315 >gi|21623221|gb|AAM67869.1| hypothetical 25.2 kDa protein [Buchnera aphidicola str. Sg (Schizaphis graminum)] (210 aa)
Score = 84, Expect = 7.6e-01, Identities = 33/117 (28%), Positives = 55/117 (47%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFK-----KVFQNVNLYFLNSTQWNTTKENEI-VLIDAKTKLFYIG 124
           L ID  +D+  +A+ K K I   S   + ++  KIL P I  ++   K+  ++L  +    GPG FT ++  +  A +        +F    L  L    W   K+ +I V ++AK    Y G
  S:     6 LAIDTSIDHCSVAVYKKKVIYSLSENCKKEHTIKIL-PMIKKVLMNAKITLKDLNYVAFSKGPGKFTGIRISIGIAQSLSLSLKIPIFGISTLSILAQKAWRKYKKKQILVAVNAKIGQVYWG 127
>gi|194682512|emb|CAR42489.1| resuscitation-promoting factor (putative glycoprotease) [Proteus mirabilis HI4320] (233 aa)
Score = 83, Expect = 8.6e-01, Identities = 21/70 (30%), Positives = 39/70 (55%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVK 77
           L ID   +   +A+  ++ +V S FEI  +  T+ + P +   +E+  L  ++L+++    GPGSFT V+
  S:     6 LAIDTATESCTVAVW-NEGVVASRFEISPREHTQKILPMVKSALEEANLSLQSLDALAFGRGPGSFTGVR 74
>gi|146737947|gb|ABQ42562.1| glycoprotease protein [Peanut witches'-broom phytoplasma] (208 aa)
Score = 83, Expect = 8.7e-01, Identities = 24/80 (30%), Positives = 42/80 (52%)
  Q:     4 NKFSLLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFA 83
           NK  L+ID   D   + +  ++ I+D  F ++ K+    + P I  I++ N ++   ++ I +  GPGS+T  K  VL A
  S:    22 NKNILIIDTSTDMQIVILTYEQNIIDICFNVKSKSFVSCMMPLINKILKANSVDLFKIKKIIVGCGPGSYTGTKIGVLTA 101
>gi|163790866|ref|ZP_02185290.1| glycoprotein endopeptidase [Carnobacterium sp. AT7] >gi|159873819|gb|EDP67899.1| glycoprotein endopeptidase [Carnobacterium sp. AT7] (240 aa)
Score = 83, Expect = 8.7e-01, Identities = 36/154 (23%), Positives = 71/154 (46%)
  Q:     8 LLIDGCLDYLELAIIKDKTIVDSSFEIQDKNLTKILNPSIAFIIEKNKLEKENLESIYIVNGPGSFTSVKSVVLFANTFKKVFQNVNLYFLNSTQ-----WNTTKENEIVLIDAKTKLFYIGANGMEKPFLIQSDEINKLTNKYEKYFYSLETKKSIYE 161
           L ID     + +A++ D+ ++        +N ++ L P+I  +++  + +   L  I +  GPGS+T ++  V  A T       V L  ++S +       ++    + L DA+ K  Y G    +   LIQ +E   ++   E++   L  K+  +E
  S:     4 LAIDTSNQAMSIAVLDDEKVIGEITTNIKRNHSERLMPAIDELMKDVQWQSSELNRIVVAKGPGSYTGLRIGVTVAKTLAWTL-GVELVGISSLKILAGNCESSPHYLVPLFDARRKNIYTGLYQWQNGKLIQIEEDKHISA--EQWAEYLSKKEGTFE 159