>gi|26553586|ref|NP_757520.1| prolipoprotein signal peptidase [Mycoplasma penetrans HF-2] >gi|81846241|sp|Q8EWS0|LSPA_MYCPE Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|26453592|dbj|BAC43924.1| prolipoprotein signal peptidase [Mycoplasma penetrans HF-2] (240 aa)
Score = 1089, Expect = 3.4e-117, Identities = 240/240 (100%), Positives = 240/240 (100%)
  Q:     1 MIKQFFSNVYEGIKHYSNYLWELSKKQLIKIYLNKKHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKKPIKDVVLDEERNKTKKEPIKKPIVIQKS 240
           MIKQFFSNVYEGIKHYSNYLWELSKKQLIKIYLNKKHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKKPIKDVVLDEERNKTKKEPIKKPIVIQKS
  S:     1 MIKQFFSNVYEGIKHYSNYLWELSKKQLIKIYLNKKHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKKPIKDVVLDEERNKTKKEPIKKPIVIQKS 240
>gi|31544414|ref|NP_852992.1| hypothetical protein MGA_0997 [Mycoplasma gallisepticum R] >gi|81834143|sp|Q7NBQ3|LSPA_MYCGA Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|31541258|gb|AAP56560.1| LspA [Mycoplasma gallisepticum R] (304 aa)
Score = 219, Expect = 2.6e-16, Identities = 58/170 (34%), Positives = 94/170 (55%)
  Q:    35 KKHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKE 204
           KK +  K  I+ +  F VLL  F+ R+  L     +     GF+ IN+  N+GV F +L + NP++ Y +QS+  ++     +FS N  L + + L+ FGGL+N+IDRS+       +G    N+V+DYFQ  F ++SAIFNF D  ++ G   + +  ++    D KK+
  S:    25 KKLIKIKYPILAVMGFFVLLIVFVLRDYFLKLGIGH-STSTGFITINVITNSGVGF-SLFNQNPAVPYLLQSLLTIIFLITFIFSKNKALIVLLPLITFGGLANVIDRSVPVTLS--NGTVETNSVLDYFQ--FFRSSAIFNFADICIVTGFALIFLTFVVDIFLDLKKK 188
>gi|12045062|ref|NP_072872.1| signal peptidase II [Mycoplasma genitalium G37] >gi|2497632|sp|Q49401|LSPA_MYCGE Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|3844808|gb|AAC71428.1| signal peptidase II [Mycoplasma genitalium G37] >gi|166078960|gb|ABY79578.1| signal peptidase II [synthetic Mycoplasma genitalium JCVI-1.0] (181 aa)
Score = 162, Expect = 1.2e-09, Identities = 52/172 (30%), Positives = 82/172 (47%)
  Q:    35 KKHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKD 206
           K  L +K+++I    FI+LL  F+ RN++     +      GF+ I +  N GV F  L +    LVYF+Q +  V+    L+F   Y     ++ + FG L N  DR            S N++V+DYF F     S++FNF D  +  G I +    +I   K++K  K+
  S:    22 KPFLFYKLTMIGFVGFIILLQVFILRNALNGEMDNTMVANSGFINIYVIRNKGVGFSLLQNQT-GLVYFLQGLLSVIALVFLVFMVKYSYIFWITTLAFGSLGNFFDRL----------TSANDSVLDYFIFQ--NGSSVFNFADCCITFGFIGLFFCFLIQMFKEFKHSKN 180
>gi|13508032|ref|NP_109981.1| signal peptidase II [Mycoplasma pneumoniae M129] >gi|2497633|sp|P75484|LSPA_MYCPN Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|1674239|gb|AAB96190.1| prolipoprotein signal peptidase [Mycoplasma pneumoniae M129] (184 aa)
Score = 159, Expect = 2.4e-09, Identities = 51/171 (29%), Positives = 82/171 (47%)
  Q:    35 KKHLIWKISIILICAFIVLLTSFLTRNSI-----LNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEK 205
           K  L +K+++IL   F++L   F+ R ++     +N           F+ I + GN GV F  L D  P LVYF+Q     +  F L+FS++Y     ++ + FG L N  DR            S +  V+DYF F     +++FN  D  +    I + +  +I F K+ K+ K
  S:    21 KPFLYYKLALILFVGFVILFQVFMLRAALNGEKGINGANGTDVARSSFISIYVIGNKGVGFSLLAD-QPGLVYFLQGFLSFIALFFLVFSTSYNYIFWITTLAFGSLGNFFDRL----------TSGSGEVLDYFVFS--GGNSVFNLADCCITFSFIGLFLSFLIQFFKEMKQTK 183
>gi|148996980|ref|ZP_01824634.1| signal peptidase II [Streptococcus pneumoniae SP11-BS70] >gi|149006398|ref|ZP_01830110.1| signal peptidase II [Streptococcus pneumoniae SP18-BS74] >gi|168491016|ref|ZP_02715159.1| signal peptidase II [Streptococcus pneumoniae CDC0288-04] >gi|168575591|ref|ZP_02721527.1| signal peptidase II [Streptococcus pneumoniae MLV-016] >gi|147756680|gb|EDK63720.1| signal peptidase II [Streptococcus pneumoniae SP11-BS70] >gi|147762175|gb|EDK69137.1| signal peptidase II [Streptococcus pneumoniae SP18-BS74] >gi|183574751|gb|EDT95279.1| signal peptidase II [Streptococcus pneumoniae CDC0288-04] >gi|183578465|gb|EDT98993.1| signal peptidase II [Streptococcus pneumoniae MLV-016] (153 aa)
Score = 127, Expect = 1.2e-05, Identities = 45/160 (28%), Positives = 81/160 (50%)
  Q:    35 KKHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLL---FSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQII 194
           KK  I  + ++L+     L+ S++ +   L   +S+   IP F+ +    N G +F  L D    L++ V ++ +V+G    L      ++ + +G++L+  GGL N IDR            ++   VVD F   FI N AIFN  D+++ +G+I + I ++
  S:     2 KKRAIVAVIVLLLIGLDQLVKSYIVQQIPLGEVRSW---IPNFVSLTYLQNRGAAFSILQDQQ--LLFAVITLVVVIGAIWYLHKHMEDSFWMVLGLTLIIAGGLGNFIDR------------ASQGFVVDMFHLDFI-NFAIFNVADSYLTVGVIILLIAML 146
>gi|149002473|ref|ZP_01827407.1| signal peptidase II [Streptococcus pneumoniae SP14-BS69] >gi|147759410|gb|EDK66402.1| signal peptidase II [Streptococcus pneumoniae SP14-BS69] (159 aa)
Score = 127, Expect = 1.2e-05, Identities = 46/167 (27%), Positives = 85/167 (50%)
  Q:    28 LIKIYLNKKHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLL---FSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQII 194
           +IK   ++K  I  + ++L+     L+ S++ +   L   +S+   IP F+ +    N G +F  L D    L++ V ++ +V+G    L      ++ + +G++L+  GGL N IDR            ++   VVD F   FI N AIFN  D+++ +G+I + I ++
  S:     1 MIKRGNHEKRAIVAVIVLLLIGLDQLVKSYIVQQIPLGEVRSW---IPNFVSLTYLQNRGAAFSILQDQQ--LLFAVITLVVVIGAIWYLHKHMEDSFWMVLGLTLIIAGGLGNFIDR------------ASQGFVVDMFHLDFI-NFAIFNVADSYLTVGVIILLIAML 152
>gi|188568600|ref|ZP_03005393.1| hypothetical protein Uurealyserovar_00355 [Ureaplasma urealyticum serovar 2] (263 aa)
Score = 125, Expect = 2.0e-05, Identities = 62/179 (34%), Positives = 101/179 (56%)
  Q:    52 VLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSI--VDNYKYLSGISTN---------------NAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKKPIKDVVLDEERNKTKKEP 230
           VLL+ FL R   +N   +  E+  G  + + T N G++ G + ++N  +VY +QSIPI+LGF   +F         +  + FGGL NIIDRSI  ++ YK L  I  N               N VVDY++F     ++I N  D ++++G+  + + +II F+  +K + D+++  K   D   D E N+   +P
  S:    66 VLLSGFLVREWAINLVINTKEIYHG-PIFHFTLNNGIALGRI-NNNSGIVYALQSIPIILGFLSFIFLKKSYHYTPLLFLLFGGLGNIIDRSIPELELYKALPDIFHNSLINPNSVGGGNDVINGVVDYWKFV----NSIINLFDVYIVVGVCVLVVILIIGFIIKWKSDNDTKDTTKKAADEN-DLEINEVSNKP 254
>gi|188518626|ref|ZP_03004072.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188997841|gb|EDU66938.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (263 aa)
Score = 125, Expect = 2.2e-05, Identities = 62/179 (34%), Positives = 101/179 (56%)
  Q:    52 VLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSI--VDNYKYLSGISTN---------------NAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKKPIKDVVLDEERNKTKKEP 230
           VLL+ FL R   +N   +  E+  G  + + T N G++ G + ++N  +VY +QSIPI+LGF   +F         +  + FGGL NIIDRSI  ++ YK L  I  N               N VVDY++F     ++I N  D ++++G+  + + +II F+  +K + D+++  K   D   D E N+   +P
  S:    66 VLLSGFLVREWAINLVINTKEIYHG-PIFHFTLNNGIALGRI-NNNSGIVYALQSIPIILGFLSFIFLKKSYHYAPLLFLLFGGLGNIIDRSIPELELYKALPDIFHNSLINPNSVGGGNDVINGVVDYWKFV----NSIINLFDVYIVVGVCVLVVILIIGFIIKWKSDNDTKDTTKKAADEN-DLEINEVSNKP 254
>gi|171920988|ref|ZP_02932111.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185179167|ref|ZP_02964874.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024291|ref|ZP_02996981.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039439|ref|ZP_02998202.1| hypothetical protein Uures_01886 [Ureaplasma urealyticum serovar 8] >gi|188524490|ref|ZP_03004492.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530878|ref|ZP_03005163.1| hypothetical protein Uurese_01000004_0200001940 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|195867620|ref|ZP_03079622.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903019|gb|EDT49308.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184208901|gb|EDU05944.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018964|gb|EDU57004.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|195659593|gb|EDX52973.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660677|gb|EDX53932.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (263 aa)
Score = 125, Expect = 2.3e-05, Identities = 62/179 (34%), Positives = 101/179 (56%)
  Q:    52 VLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSI--VDNYKYLSGISTN---------------NAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKKPIKDVVLDEERNKTKKEP 230
           VLL+ FL R   +N   +  E+  G  + + T N G++ G + ++N  +VY +QSIPI+LGF   +F         +  + FGGL NIIDRSI  ++ YK L  I  N               N VVDY++F     ++I N  D ++++G+  + + +II F+  +K + D+++  K   D   D E N+   +P
  S:    66 VLLSGFLVREWAINLVINTKEIYHG-PIFHFTLNNGIALGRI-NNNSGIVYALQSIPIILGFLSFIFLKKSYHYAPLLFLLFGGLGNIIDRSIPELELYKALPDIFHNSLINPNSVGGGNDVINGVVDYWKFV----NSIINLFDVYIVVGVCVLVVILIIGFIIKWKSDNDTKDTTKKAADEN-DLEINEVSNKP 254
>gi|188592411|ref|ZP_03005778.1| hypothetical protein Uureaserovar_00390 [Ureaplasma urealyticum serovar 10] (263 aa)
Score = 124, Expect = 2.5e-05, Identities = 62/179 (34%), Positives = 101/179 (56%)
  Q:    52 VLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSI--VDNYKYLSGISTN---------------NAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKKPIKDVVLDEERNKTKKEP 230
           VLL+ FL R   +N   +  E+  G  + + T N G++ G + ++N  +VY +QSIPI+LGF   +F         +  + FGGL NIIDRSI  ++ YK L  I  N               N VVDY++F     ++I N  D ++++G+  + + +II F+  +K + D+++  K   D   D E N+   +P
  S:    66 VLLSGFLVREWAINLVINTKEIYHG-PIFHFTLNNGIALGRI-NNNSGIVYALQSIPIILGFLSFIFLKKSYHYAPLLFLLFGGLGNIIDRSIPELELYKALPDIFHNSFINPNSVGGGNDVINGVVDYWKFV----NSIINLFDVYIVVGVCVLVVILIIGFIIKWKSDNDTKDTTKKAADEN-DLEINEVSNKP 254
>gi|15900808|ref|NP_345412.1| lipoprotein signal peptidase [Streptococcus pneumoniae TIGR4] >gi|15902873|ref|NP_358423.1| Signal peptidase type II; lipoprotein signal peptidase [Streptococcus pneumoniae R6] >gi|111658132|ref|ZP_01408830.1| hypothetical protein SpneT_02000698 [Streptococcus pneumoniae TIGR4] >gi|116516537|ref|YP_816302.1| signal peptidase II [Streptococcus pneumoniae D39] >gi|148984669|ref|ZP_01817937.1| signal peptidase II [Streptococcus pneumoniae SP3-BS71] >gi|148988364|ref|ZP_01819811.1| signal peptidase II [Streptococcus pneumoniae SP6-BS73] >gi|148992940|ref|ZP_01822559.1| signal peptidase II [Streptococcus pneumoniae SP9-BS68] >gi|149010430|ref|ZP_01831801.1| signal peptidase II [Streptococcus pneumoniae SP19-BS75] >gi|149019515|ref|ZP_01834834.1| signal peptidase II [Streptococcus pneumoniae SP23-BS72] >gi|168482998|ref|ZP_02707950.1| signal peptidase II [Streptococcus pneumoniae CDC1873-00] >gi|168485878|ref|ZP_02710386.1| signal peptidase II [Streptococcus pneumoniae CDC1087-00] >gi|168490256|ref|ZP_02714455.1| signal peptidase II [Streptococcus pneumoniae SP195] >gi|168494357|ref|ZP_02718500.1| signal peptidase II [Streptococcus pneumoniae CDC3059-06] >gi|169833793|ref|YP_001694381.1| signal peptidase II [Streptococcus pneumoniae Hungary19A-6] >gi|182683873|ref|YP_001835620.1| lipoprotein signal peptidase [Streptococcus pneumoniae CGSP14] >gi|194397876|ref|YP_002037565.1| signal peptidase (SPase) II [Streptococcus pneumoniae G54] >gi|81845116|sp|Q8DQ64|LSPA_STRR6 Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|14972403|gb|AAK75052.1| signal peptidase II [Streptococcus pneumoniae TIGR4] >gi|15458430|gb|AAK99633.1| Signal peptidase type II; lipoprotein signal peptidase [Streptococcus pneumoniae R6] >gi|116077113|gb|ABJ54833.1| signal peptidase II [Streptococcus pneumoniae D39] >gi|147764911|gb|EDK71840.1| signal peptidase II [Streptococcus pneumoniae SP19-BS75] >gi|147923060|gb|EDK74175.1| signal peptidase II [Streptococcus pneumoniae SP3-BS71] >gi|147926045|gb|EDK77119.1| signal peptidase II [Streptococcus pneumoniae SP6-BS73] >gi|147928392|gb|EDK79408.1| signal peptidase II [Streptococcus pneumoniae SP9-BS68] >gi|147930890|gb|EDK81870.1| signal peptidase II [Streptococcus pneumoniae SP23-BS72] >gi|168996295|gb|ACA36907.1| signal peptidase II [Streptococcus pneumoniae Hungary19A-6] >gi|172043495|gb|EDT51541.1| signal peptidase II [Streptococcus pneumoniae CDC1873-00] >gi|182629207|gb|ACB90155.1| lipoprotein signal peptidase [Streptococcus pneumoniae CGSP14] >gi|183570941|gb|EDT91469.1| signal peptidase II [Streptococcus pneumoniae CDC1087-00] >gi|183571371|gb|EDT91899.1| signal peptidase II [Streptococcus pneumoniae SP195] >gi|183575711|gb|EDT96239.1| signal peptidase II [Streptococcus pneumoniae CDC3059-06] >gi|194357543|gb|ACF55991.1| signal peptidase (SPase) II [Streptococcus pneumoniae G54] (153 aa)
Score = 124, Expect = 3.1e-05, Identities = 45/160 (28%), Positives = 80/160 (50%)
  Q:    35 KKHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLL---FSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQII 194
           KK  I  + ++L+     L+ S++ +   L   +S+   IP F+ +    N G +F  L D    L++ V ++ +V+G    L      ++ + +G++L+  GGL N IDR             +   VVD F   FI N AIFN  D+++ +G+I + I ++
  S:     2 KKRAIVAVIVLLLIGLDQLVKSYIVQQIPLGEVRSW---IPNFVSLTYLQNRGAAFSILQDQQ--LLFAVITLVVVIGAIWYLHKHMEDSFWMVLGLTLIIAGGLGNFIDR------------VSQGFVVDMFHLDFI-NFAIFNVADSYLTVGVIILLIAML 146
>gi|186701822|ref|ZP_02971493.1| conserved hypothetical protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186701109|gb|EDU19391.1| conserved hypothetical protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (263 aa)
Score = 121, Expect = 7.2e-05, Identities = 70/210 (33%), Positives = 122/210 (58%)
  Q:     7 SNVYEGIKHYSNYLWELSKKQLIKIYLNKKHL-------------IWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSI--------VDNYKYLSGISTN---------NAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKKPIKD 216
           SN Y  IK ++  L +++  + I + +N K +              +KI   +I A IVLL+ FL R   ++      E   G  + + T N G++ G + +++  +VY +QSIPI+LGF   +F  N    + + L+ FGGL NIIDRSI        + N  + S I+ N         N VVDY++F     ++I N  D ++++G+  + + ++I F+  +K + D+++  K + D
  S:     8 SNFYIIIKKFNQSLRKINFFEKIILKINNKSIRDYFLSITSLDVIFYKIINFIIVALIVLLSGFLVREWAIDLVVKTKETHHG-PIFHFTLNNGIALGRI-NNHSGIVYTLQSIPIILGFLSFIFLKNSCYYVPLLLLLFGGLGNIIDRSIPEFELFNALPNIFHNSLINPNSVGGGDDVINGVVDYWKFV----NSIINLFDVYIVVGVCVLVVILVIRFIIKWKNDSDNQDIIKKVAD 241
>gi|13357874|ref|NP_078148.1| hypothetical protein UU314 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762336|ref|YP_001752396.1| hypothetical protein UPA3_0329 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920218|ref|ZP_02931595.1| conserved hypothetical protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508704|ref|ZP_02958191.1| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|11356767|pir||A82908 conserved hypothetical protein (probable signal peptidase II, lspA) UU314 [imported] - Ureaplasma urealyticum >gi|6899290|gb|AAF30723.1|AE002128_11 conserved hypothetical protein (possible signal peptidase II - lspA) [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827913|gb|ACA33175.1| conserved hypothetical protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902609|gb|EDT48898.1| conserved hypothetical protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675626|gb|EDT87531.1| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] (263 aa)
Score = 121, Expect = 7.2e-05, Identities = 69/210 (32%), Positives = 121/210 (57%)
  Q:     7 SNVYEGIKHYSNYLWELSKKQLIKIYLNKKHL-------------IWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSI--------VDNYKYLSGISTN---------NAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKKPIKD 216
           SN Y  IK ++  L +++  + I + +N K +              +KI   +I A IVLL+ FL R   ++      E   G  + + T N G++ G + +++  +VY +QSIPI+LGF   +F  N    + +  + FGGL NIIDRSI        + N  + S I+ N         N VVDY++F     ++I N  D ++++G+  + + ++I F+  +K + D+++  K + D
  S:     8 SNFYIIIKKFNQSLRKINFFEKIILKINNKSIRDYFLSITSLDVIFYKIINFIIVALIVLLSGFLVREWAIDLVVKTKETHHG-PIFHFTLNNGIALGRI-NNHSGIVYTLQSIPIILGFLSFIFLKNSCYYVPLLFLLFGGLGNIIDRSIPEFELFNALPNIFHNSLINPNSVGGGDDVINGVVDYWKFV----NSIINLFDVYIVVGVCVLVVILVIRFIIKWKNDSDNQDIIKKVAD 241
>gi|114570884|ref|YP_757564.1| lipoprotein signal peptidase [Maricaulis maris MCS10] >gi|114341346|gb|ABI66626.1| lipoprotein signal peptidase [Maricaulis maris MCS10] (190 aa)
Score = 115, Expect = 3.2e-04, Identities = 43/150 (28%), Positives = 73/150 (48%)
  Q:    42 ISIILICAFIVLLTSFLTRNSILNATQSYWE----LIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSS---NYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIK-NSAIFNFPDTFVIIGMIFVGI 191
           +SI  + A  VL+   L    +L +  + WE    + PGF  + +  N GVSFG L + +  + Y +  + ++L   VL++++   +  +++   LV  GGL+N IDR              + AV DY  F +       FN  D  + IG+  + I
  S:    32 VSIAQLTAISVLVGMELITKQVLESKLAVWEGATSIFPGFR-LTLNHNRGVSFGMLDNGHWLMPYLLAIVALILVVAVLIWTAQQKSKCINVAGILVAAGGLANAIDR------------LGDGAVTDYLDFGWQALRWPTFNLADVLIFIGVALLLI 176
>gi|28378454|ref|NP_785346.1| signal peptidase II [Lactobacillus plantarum WCFS1] >gi|38258043|sp|Q88W75|LSPA_LACPL Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|28271290|emb|CAD64194.1| signal peptidase II [Lactobacillus plantarum WCFS1] (149 aa)
Score = 114, Expect = 3.8e-04, Identities = 44/153 (28%), Positives = 77/153 (50%)
  Q:    42 ISIILICAFIVL---LTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIP-IVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQII 194
           I +IL+ A +++   + + +  +  L A+ S   ++ G L +    N G ++  L +      Y +  I  IV+G+ +      +L ++G+SL+  G L N IDR  +              VVD FQ  FI N  IFNF D+ + +G+IF+ I ++
  S:     3 IYLILMVALVIIDQVIKAAIVSHIALGASTS---IVTGLLSLTNLHNNGAAWSIL-EGKMWFFYLISVIALIVMGYLLWRLRGKWLYEVGISLMIAGTLGNFIDRLRI------------GYVVDMFQLDFI-NFPIFNFADSCLTVGVIFILIGVL 142
>gi|194468024|ref|ZP_03074010.1| lipoprotein signal peptidase [Lactobacillus reuteri 100-23] >gi|194452877|gb|EDX41775.1| lipoprotein signal peptidase [Lactobacillus reuteri 100-23] (148 aa)
Score = 110, Expect = 1.1e-03, Identities = 45/154 (29%), Positives = 71/154 (46%)
  Q:    53 LLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKD 206
           LL S++  + +L  ++   +LIPG + +    N+G ++                  IV+G+F+  +  N L+ IG+SL+  G + N IDR                 VVD F+  FI N  IFN  D  + IG+I++ I I+        KEKD
  S:    19 LLKSWVASSIVLGGSK---QLIPGIIELTNLRNSGAAWSIFEGQQTFFTIITIVAIIVIGYFIWQYRKNILMLIGLSLIMAGTIGNFIDR------------LRQGYVVDMFETTFI-NFPIFNIADMCLTIGVIWLIICIL--------KEKD 148
>gi|2497630|sp|Q59835|LSPA_STACA Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|459545|emb|CAA54991.1| signalpeptidase II [Staphylococcus carnosus] (159 aa)
Score = 110, Expect = 1.2e-03, Identities = 51/164 (31%), Positives = 80/164 (48%)
  Q:    42 ISIILICAFIVLLTSFLTRNSILN--ATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF----SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFP-FIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEK 205
           +SI L     VL+   +T+  I    A    + +IP FL I    N G ++G L  S     +F+ +I +VLG  V  +      N+L+ + +SL+F G L N IDR +            +  VVD+     F  +  IFN  D+ + IG+I V    +I+ + D +K K
  S:     7 VSITLFITIAVLILDQVTKAVIAKSMAIGDSYTVIPKFLYITSHRNNGAAWGIL--SGRMSFFFIVTI-VVLGLLVFFYIKEAKGNFLMQVAISLLFAGALGNFIDRML------------HGEVVDFIDTKIFSYDFPIFNGADSSLTIGVILV----LIALLFDSRKSK 158
>gi|15643229|ref|NP_228273.1| lipoprotein signal peptidase [Thermotoga maritima MSB8] >gi|4980979|gb|AAD35555.1|AE001724_13 lipoprotein signal peptidase [Thermotoga maritima MSB8] (186 aa)
Score = 109, Expect = 1.6e-03, Identities = 44/181 (24%), Positives = 85/181 (46%)
  Q:    49 AFIVLLTSFLTR--NSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEK-DSEENKKPI--------KDVVLDEERNKTKKE 229
           AF+++LT  L +    I +     + ++PGFL      N G++ G   + +  L++ V  + + L     +F  + L  I +  +  G L N++DR     + Y         V+D+    F+    IFN  D F+I+G    G  +I+   +    E  +S + ++ +        +D ++D E N +K +
  S:     2 AFVMVLTIVLDQLTKRIASEIHGTFFIVPGFLRFVKATNRGIALGLFKNLSEQLLWTVMFVVVFLSLLPYIFKFSRLERIAMGFILGGALGNLLDRI---RFGY---------VLDFLNLTFL--PTIFNLADVFIIVG----GALMILGVFRGGDNESLESRKKRRGLETGSVFEGEDTIMDLEINDSKSD 175
>gi|73662885|ref|YP_301666.1| lipoprotein signal peptidase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72495400|dbj|BAE18721.1| lipoprotein signal peptidase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (158 aa)
Score = 108, Expect = 1.9e-03, Identities = 49/166 (29%), Positives = 85/166 (51%)
  Q:    40 WKISIILICAFIVLLTSFLTRNSILNATQ--SYWELIPGFLVINITGNTGVSFGTL-GDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQ-FPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEK 205
           + I I L    I+L+   +T+  I ++ +    +E+IP FL I    N G ++G L G  +   +  +  + +++ F++    +N L+ I +SL+F G L N IDR +            +  VVD+   + F  N  IFN  D+ + IG++     III+ + D KKE+
  S:     5 YYIGISLFITIIILVLDQITKFIIASSMKVGDSFEVIPNFLNITSHRNDGAAWGILSGKMSFFFIITIIILVVLIVFYIKEAKNNLLMQIAISLLFAGALGNFIDRVL------------HGEVVDFVDTYIFGYNFPIFNVADSSLTIGVLL----IIIALLTDMKKEE 158
>gi|116333480|ref|YP_795007.1| lipoprotein signal peptidase [Lactobacillus brevis ATCC 367] >gi|116098827|gb|ABJ63976.1| signal peptidase II. Aspartic peptidase. MEROPS family A08 [Lactobacillus brevis ATCC 367] (154 aa)
Score = 108, Expect = 2.0e-03, Identities = 45/161 (27%), Positives = 76/161 (47%)
  Q:    42 ISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIV----LGFFVLLF---SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYK 202
           I IIL+      +   +  N +L        LIPG L +    N G ++  L       ++F   I +V    +G+F   +    ++ L ++G++L+  G + N IDR             T   VVD FQ  FI N  IFNF D+ + +G+I + I + ++  ++ K
  S:     7 ILIILLVGVDQFIKHAVVANIVLGGEHP---LIPGVLSLTHLRNNGAAWSILQGQ----MWFFAVIAVVALGIMGYFFWQYRRDQNHRLEELGLALMMAGTIGNFIDRL------------TQGYVVDMFQLDFI-NFPIFNFADSCLTVGVILIAIGVYLADRREAK 154
>gi|163757827|ref|ZP_02164916.1| probable lipoprotein signal peptidase transmembrane [Hoeflea phototrophica DFL-43] >gi|162285329|gb|EDQ35611.1| probable lipoprotein signal peptidase transmembrane [Hoeflea phototrophica DFL-43] (167 aa)
Score = 107, Expect = 2.5e-03, Identities = 40/139 (28%), Positives = 73/139 (52%)
  Q:    70 YWELIPGFLVINI--TGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF----SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNS-AIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSE 208
           + ELIP   ++ +  T N G++F  L D   + +  + ++ IV  F + L+    S   +  +G +L+  G L N++DR+I  +            VVDY  F     S A+FN  D+F+ IG   + +  +I+ +++ K +K S+
  S:    36 FHELIPVMPMLGLFRTWNEGIAFSLLKDLPDTGLLMLTAMVIV--FVIFLWWRTPSDRSIAHLGFALIIGGALGNLVDRAIYGH------------VVDYILFYTSTWSFAVFNLADSFISIGAGLIVLDEVIAALRERKAKKQSD 167
>gi|118047867|ref|ZP_01516493.1| lipoprotein signal peptidase [Chloroflexus aggregans DSM 9485] >gi|117995616|gb|EAV09831.1| lipoprotein signal peptidase [Chloroflexus aggregans DSM 9485] (191 aa)
Score = 107, Expect = 2.7e-03, Identities = 44/146 (30%), Positives = 68/146 (46%)
  Q:    85 NTGVSFGTLGDSNPSLVYFVQSIPIVLG--FFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKKPIKDVVLDEERNKTKKEP 230
           NTGV+FG   D    L      I +VL   +  LL + +  + +   LVF GGLSN+ DR +   Y           VVD+ QF +     +FN  D+ + +G+  +   II  F+ D     + E    PI D +L+E  ++  + P
  S:    51 NTGVAFGLFPDQGGVLSISAGFILLVLALTYQYLLPAESRWVTVATGLVFGGGLSNLFDR-LRQGY-----------VVDFIQFGWW---PMFNLADSAITLGVAALAFHII--FIGDEPSGIEPE----PIDDGLLNELLSRAPESP 177
>gi|90419235|ref|ZP_01227145.1| putative signal peptidase [Aurantimonas sp. SI85-9A1] >gi|90336172|gb|EAS49913.1| putative signal peptidase [Aurantimonas sp. SI85-9A1] (175 aa)
Score = 106, Expect = 3.3e-03, Identities = 28/80 (35%), Positives = 49/80 (61%)
  Q:    63 ILNATQSYWELIP--GFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFV-LLFSSNYLLDIGVSLVFFGGLSNIIDR 142
           I+N+      +IP   F  + +  NTGVSFG  GD++P ++    ++ +V+G  + L+ ++N L  I + L+  G L+NI+DR
  S:    36 IINSVMQPPRVIPVTEFFNLVLWHNTGVSFGLFGDTSPWML-MTFTLAMVIGLIIWLMRAANRLTAIALGLIIGGALANILDR 117
>gi|146305989|ref|YP_001186454.1| lipoprotein signal peptidase [Pseudomonas mendocina ymp] >gi|167008961|sp|A4XQV6|LSPA_PSEMY Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|145574190|gb|ABP83722.1| lipoprotein signal peptidase [Pseudomonas mendocina ymp] (169 aa)
Score = 106, Expect = 3.5e-03, Identities = 47/173 (27%), Positives = 84/173 (48%)
  Q:    37 HLIWKISIILICAFIVLLTSFLTRNSILNATQSYW---ELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPI-----VLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDY--------FQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEE 209
           HL W     L+ + ++L+   +T++ I   T S +   E+IPG+    +  NTG +F  L D+     +F  +I I     ++ +   L     LL + +++V  G L N+ DR ++ +            VVD+        + FP       FN  DTF+ IG I + + +       +K +K ++E
  S:     9 HLPW-----LLLSVLILVADRVTKD-IFEGTLSMYQRIEVIPGYFDWTLAYNTGAAFSFLADAAGWQRWFFAAIAIVVSVVLVVWLKRLKRHETLLAVALAMVLGGALGNLYDRVVLGH------------VVDFILVHWQSRWFFP------AFNLADTFITIGAILLALDM-------FKSDKSAKE 166
>gi|110004583|emb|CAK98920.1| hypothetical signal peptidase II transmembrane protein [Spiroplasma citri] (195 aa)
Score = 106, Expect = 3.7e-03, Identities = 42/156 (26%), Positives = 74/156 (47%)
  Q:    30 KIYLNKKHLIWKISI-ILICAFIVLLTSFLTRNSILNATQSYWELIP------GFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVL-GFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIG 185
           K +   ++ IWK  I + +  FI LL   +    +     S+    P      GF+      N G++FGT  D+ P ++  V ++ I L  F + L+ +N +  +G+ ++  GG  N+IDR           +  +  VVD+  +      ++FN  DT+V  G
  S:    13 KDHFKNRNYIWKYKIQVCLSIFISLLILDIITKQLAFHLLSHDPAAPEVKFLDGFINFKFMVNKGIAFGTNADNLPLVI--VGAVFITLFAFSIFLYINNKIAAVGLIMITTGGFGNLIDR-----------MWNHGGVVDFLAWILFPPYSVFNLADTWVTFG 163
>gi|68160766|gb|AAY86829.1| lr0877 [Lactobacillus reuteri] (148 aa)
Score = 106, Expect = 3.7e-03, Identities = 47/169 (27%), Positives = 79/169 (46%)
  Q:    38 LIWKISIILICAFIV---LLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKD 206
           ++  I+I++I    +   LL S++  + +L  ++   +LIPG + +    N+G ++                  IV+G+F+  +  N  + IG+SL+  G + N IDR                 VVD F+  FI N  IFN  D  + IG+I++ I I+        KEKD
  S:     1 MLLGIAIVIILILTICDQLLKSWVASSIVLGGSK---QLIPGIIELTNLRNSGAAWSIFEGQQTFFTIITIIAIIVIGYFIWQYRKNIPMLIGLSLIMAGTIGNFIDR------------LRQGYVVDMFETTFI-NFPIFNIADMCLTIGVIWLIICIL--------KEKD 148
>gi|400202|sp|P31024|LSPA_STAAU Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|153045|gb|AAA26653.1| prolipoprotein signal peptidase (163 aa)
Score = 105, Expect = 4.5e-03, Identities = 52/176 (29%), Positives = 85/176 (48%)
  Q:    33 LNKKHLIWKISIILICAFIVLLTSFLTRNSILNATQ--SYWELIPGFLVINITGNTGVSFGTL-GDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSE 208
           ++KK+ I   + ILI  F+V+    +T+  I    +    +E+IP FL I    N G ++G L G      +  +  +  ++ FF+     N  + + +SL+F G L N IDR        L+G   +    + F + F     IFN  D+ + IG+I     III+ +KD   +KD E
  S:     1 MHKKYFIG--TSILIAVFVVIFDQ-VTKYIIATTMKIGDSFEVIPHFLNITSHRNNGAAWGILSGKMTFFFIITIIILIALVYFFIKDAQYNLFMQVAISLLFAGALGNFIDR-------ILTGEVVDFIDTNIFGYDF----PIFNIADSSLTIGVIL----IIIALLKDTSNKKDKE 161
>gi|148544157|ref|YP_001271527.1| lipoprotein signal peptidase [Lactobacillus reuteri F275] >gi|184153529|ref|YP_001841870.1| lipoprotein signal peptidase [Lactobacillus reuteri F275] >gi|148531191|gb|ABQ83190.1| lipoprotein signal peptidase [Lactobacillus reuteri F275] >gi|183224873|dbj|BAG25390.1| lipoprotein signal peptidase [Lactobacillus reuteri F275] (148 aa)
Score = 105, Expect = 4.8e-03, Identities = 47/169 (27%), Positives = 79/169 (46%)
  Q:    38 LIWKISIILICAFIV---LLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKD 206
           ++  I+I++I    +   LL S++  + +L  ++   +LIPG + +    N+G ++                  IV+G+F+  +  N  + IG+SL+  G + N IDR                 VVD F+  FI N  IFN  D  + IG+I++ I I+        KEKD
  S:     1 MLLGIAIVIILILTICDQLLKSWVASSIVLGGSK---QLIPGIIELTNLRNSGAAWSIFEGQQTFFTIITIVAIIVIGYFIWQYRKNIPMLIGLSLIMAGTIGNFIDR------------LRQGYVVDMFETTFI-NFPIFNIADMCLTIGVIWLIICIL--------KEKD 148
>gi|148269597|ref|YP_001244057.1| lipoprotein signal peptidase [Thermotoga petrophila RKU-1] >gi|147735141|gb|ABQ46481.1| lipoprotein signal peptidase [Thermotoga petrophila RKU-1] (186 aa)
Score = 104, Expect = 5.8e-03, Identities = 34/137 (24%), Positives = 62/137 (45%)
  Q:    49 AFIVLLTSFLTR--NSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIG 185
           AF+++LT  L +    I +     + ++PGFL      N G++ G   + +  L++ V  + + L     +F  + L    +  +  G L N++DR     + Y         V+D+    F+    IFN  D F+I+G
  S:     2 AFVMVLTIVLDQLTKRIASEIHGTFFIVPGFLRFVKATNRGIALGLFKNLSEQLLWTVMFVVVFLSLLPYIFKFSRLERTAMGFILGGALGNLLDRI---RFGY---------VLDFLNLTFL--PTIFNLADVFIIVG 126
>gi|118727640|ref|ZP_01576234.1| lipoprotein signal peptidase [Clostridium cellulolyticum H10] >gi|118662971|gb|EAV69638.1| lipoprotein signal peptidase [Clostridium cellulolyticum H10] (163 aa)
Score = 104, Expect = 5.9e-03, Identities = 39/144 (27%), Positives = 64/144 (44%)
  Q:    73 LIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNS-AIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKKPIKD 216
           +I  F  +    N G +F  L      L+  V  + + + ++ L+   N  L + +SL+  G L N+ DR           I +N  VVD+ +F F       FN  D  V++G I + I I+      YK+EK     ++ +KD
  S:    32 VIKDFFYLRHLENDGAAFSILQGKTVFLILMVSVVSLAMLYY-LIKEKNKFLRLSLSLILGGALGNLYDR-----------IFSNGKVVDFLEFHFGSYVFPTFNVADILVVVGTILLAIYILFL----YKEEKPEPVQQEQVKD 160
>gi|77454683|ref|YP_345551.1| putative signal peptidase II [Rhodococcus erythropolis PR4] >gi|77019683|dbj|BAE46059.1| putative signal peptidase II [Rhodococcus erythropolis PR4] (175 aa)
Score = 104, Expect = 6.1e-03, Identities = 40/171 (23%), Positives = 76/171 (44%)
  Q:    34 NKKHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF----SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKE 204
           ++K  I   + +L+   + L    + R  +  A     E+  G + + +  N+GV+F +LG+  PS V    +    +G  V  +     S  +  IG +L+  G  SN++DR++            +  V DYF   +      FN  DT++  G I V + ++    +  ++E
  S:    14 HRKKRILFATTVLVSVVVALTIEPVARKHLSGAN----EMDLGVVSLRLAYNSGVAF-SLGNQLPSAVIIAFTGLATMGIAVYAWRSVPQSRGVAVIGFALIVAGAASNVVDRAL------------DGKVTDYFHTGWWPT---FNLADTYLTCGFILVAVSLLFESARGSERE 168
>gi|172057959|ref|YP_001814419.1| lipoprotein signal peptidase [Exiguobacterium sibiricum 255-15] >gi|171990480|gb|ACB61402.1| lipoprotein signal peptidase [Exiguobacterium sibiricum 255-15] (157 aa)
Score = 104, Expect = 6.2e-03, Identities = 37/123 (30%), Positives = 58/123 (47%)
  Q:    72 ELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF---SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQF-PFIKNSAIFNFPDTFVIIGMIFVGIQII 194
           E+IP F  +N   N G ++G L        +FV ++ +V+G    L+   + N +    V+L+  G + N IDR                 VVD+F F PF  N  IFN  D  +  G+I + I ++
  S:    33 EIIPNFFYLNSYRNRGAAWGML--EGKFGFFFVITLVVVIGLIYFLYKEGTKNKVFAWSVALLLGGAVGNFIDRM------------ARGEVVDFFHFYPFGYNFPIFNVADVSLTFGVILMLISVM 145
>gi|170288273|ref|YP_001738511.1| lipoprotein signal peptidase [Thermotoga sp. RQ2] >gi|170175776|gb|ACB08828.1| lipoprotein signal peptidase [Thermotoga sp. RQ2] (186 aa)
Score = 104, Expect = 6.7e-03, Identities = 34/136 (25%), Positives = 62/136 (45%)
  Q:    50 FIVLLTSFLTR--NSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIG 185
           F+++LT  L +    I +     + ++PGFL      N G++ G   + +  L++ V  + + L     +F  + L  I +  +  G L N++DR     + Y         V+D+    F+    IFN  D F+I+G
  S:     3 FVMVLTIVLDQLTKRIASEIHGTFFIVPGFLRFVKATNRGIALGLFKNLSEQLLWTVMFVVVFLSLLPYIFKFSRLERIAMGFILGGALGNLLDRI---RFGY---------VLDFLNLTFL--PTIFNLADVFIIVG 126
>gi|158320449|ref|YP_001512956.1| lipoprotein signal peptidase [Alkaliphilus oremlandii OhILAs] >gi|158140648|gb|ABW18960.1| lipoprotein signal peptidase [Alkaliphilus oremlandii OhILAs] (144 aa)
Score = 103, Expect = 8.1e-03, Identities = 42/110 (38%), Positives = 54/110 (49%)
  Q:    85 NTGVSFGTLGDSNPSLVYFVQSIPIVLG---FFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQII 194
           N G +FG L +     V+FV +  I+LG   F+V     N  L I +SL+  G L N IDR  +              VVDYF F  I N  +FN  D+ V+IG   V I II
  S:    44 NRGAAFGMLQNQK---VFFVVTTIIILGAIYFYVRNNKPNRFLTISLSLIVGGALGNFIDRIRL------------GFVVDYFNFTLI-NFPVFNIADSAVVIGAFLVSIYII 140
>gi|125717900|ref|YP_001035033.1| lipoprotein signal peptidase, putative [Streptococcus sanguinis SK36] >gi|125497817|gb|ABN44483.1| Lipoprotein signal peptidase, putative [Streptococcus sanguinis SK36] (155 aa)
Score = 103, Expect = 8.3e-03, Identities = 49/176 (27%), Positives = 82/176 (46%)
  Q:    35 KKHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSN--PSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEEN 210
           K+ +I   +++++ A   L+  ++  +  L   +S+   IP  + +    NTG +F  L +     +LV F+     V      L +S ++L  G++LV  GGL N IDR                 V+D FQ  FI N AIFN  D ++  G+  + + I+       K+EKD  +N
  S:     2 KRKIIIPFAVLVLIAVDQLVKLYIVSDFKLGQVKSF---IPHLVSLTYLQNTGAAFSMLENQQWLFTLVTFLVIGGAVYYLIKHLHASKWML-AGLTLVIAGGLGNFIDR------------IRQGFVIDMFQLDFI-NFAIFNVADMYLTFGVAILLLMIL-------KEEKDGSKN 155
>gi|49483359|ref|YP_040583.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus MRSA252] >gi|56749037|sp|Q6GHN9|LSPA_STAAR Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|49241488|emb|CAG40174.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus MRSA252] (163 aa)
Score = 102, Expect = 9.5e-03, Identities = 52/176 (29%), Positives = 87/176 (49%)
  Q:    33 LNKKHLIWKISIILICAFIVLLTSFLTRNSILNATQ--SYWELIPGFLVINITGNTGVSFGTL-GDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSE 208
           ++KK+ I   + ILI  F+V+    +T+  I    +    +E+IP FL I    N G ++G L G      +  +  +  ++ FF+     N  + + +SL+F G L N IDR +    + +  I TN   +  + FP      IFN  D+ + IG+I     III+ +KD   +K+ E
  S:     1 MHKKYFIG--TSILIAVFVVIFDQ-VTKYIIATTMKIGDSFEVIPHFLNITSHRNNGAAWGILSGKMTFFFIITIIILIALVYFFIKDAQYNLFMQVAISLLFAGALGNFIDRVLTG--EVVDFIDTN---IFGYDFP------IFNIADSSLTIGVIL----IIIALLKDTSNKKEKE 161
>gi|150020880|ref|YP_001306234.1| peptidase A8, signal peptidase II [Thermosipho melanesiensis BI429] >gi|149793401|gb|ABR30849.1| peptidase A8, signal peptidase II [Thermosipho melanesiensis BI429] (181 aa)
Score = 102, Expect = 1.0e-02, Identities = 34/123 (27%), Positives = 56/123 (45%)
  Q:    69 SYWELIPG---FLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGI 191
           +YW   P    F       N GV+FG   +S   +VY   +I I L    L+   ++L ++ +  +  G L N++DR     + Y         VVD+   P+     I+N  D F+++G I + I
  S:    20 NYWRFNPKKVLFFYFTYATNKGVAFGLFSNSKEIVVYLTLAITIFLSIIPLVKRLDFLTNMFLGFIIGGALGNVVDRI---RFGY---------VVDFVTMPYW--PTIYNLADFFILLGGIGIAI 131
>gi|33867186|ref|NP_898744.1| putative lipoprotein signal peptidase [Rhodococcus erythropolis] >gi|77454712|ref|YP_345580.1| putative signal peptidase II [Rhodococcus erythropolis PR4] >gi|33669020|gb|AAP74014.1| putative lipoprotein signal peptidase [Rhodococcus erythropolis] >gi|77019712|dbj|BAE46088.1| putative signal peptidase II [Rhodococcus erythropolis PR4] (174 aa)
Score = 101, Expect = 1.2e-02, Identities = 37/169 (21%), Positives = 76/169 (44%)
  Q:    44 IILICAFIVLLTSFLTRNSILNATQSYWELIP-GFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF----SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKK 212
           +IL+   + L+   L+   +   T S    +  G L + +  N+GV+F ++G   P+ +    +  I LG  +  +    +++ +  +G S +  G  +N+IDR++            +  V DYF   +      FN  DT++  G++ +   +I     D      ++E+ K
  S:    17 VILVVVGLALIAIALSAEPVARRTLSGARTVDMGLLQLKLAYNSGVAF-SIGQQLPAWIILAVTAAITLGVGIYAWRTVPTASLVGTVGWSAILAGAAANVIDRAV------------DGKVTDYFHTGWWPT---FNLADTYITCGVVLLVASLIFESTHDPADPPPAQESSK 174
>gi|82750801|ref|YP_416542.1| lipoprotein signal peptidase [Staphylococcus aureus RF122] >gi|123549042|sp|Q2YXH2|LSPA_STAAB Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|82656332|emb|CAI80749.1| lipoprotein signal peptidase [Staphylococcus aureus RF122] (163 aa)
Score = 101, Expect = 1.3e-02, Identities = 52/176 (29%), Positives = 87/176 (49%)
  Q:    33 LNKKHLIWKISIILICAFIVLLTSFLTRNSILNATQ--SYWELIPGFLVINITGNTGVSFGTL-GDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSE 208
           ++KK+ I   + ILI  F+V+    +T+  I    +    +E+IP FL I    N G ++G L G      +  +  +  ++ FF+     N  + + +SL+F G L N IDR +    + +  I TN   +  + FP      IFN  D+ + IG+I     III+ +KD   +K+ E
  S:     1 MHKKYFIG--TSILIAVFVVIFDQ-VTKYIIATTMKIGDSFEVIPHFLNITSHRNNGAAWGILSGKMTFFFIITIIILIALVYFFINDAQYNLFMQVAISLLFAGALGNFIDRVLTG--EVVDFIDTN---IFGYDFP------IFNIADSSLTIGVIL----IIIALLKDTSNKKEKE 161
>gi|15924186|ref|NP_371720.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus Mu50] >gi|15926779|ref|NP_374312.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus N315] >gi|21282808|ref|NP_645896.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus MW2] >gi|49486035|ref|YP_043256.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651765|ref|YP_186071.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus COL] >gi|87160722|ref|YP_493786.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus USA300] >gi|88194902|ref|YP_499702.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148267687|ref|YP_001246630.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus JH9] >gi|150393745|ref|YP_001316420.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus JH1] >gi|151221319|ref|YP_001332141.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156979517|ref|YP_001441776.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus Mu3] >gi|161509369|ref|YP_001575028.1| A8 signal peptidase II family protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168729555|ref|ZP_02761832.1| A8 family signal peptidase II [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|166232880|sp|A7X1E3|LSPA_STAA1 Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|172048847|sp|A6QG97|LSPA_STAAE Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|189028668|sp|A6U115|LSPA_STAA2 Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|189028779|sp|A5IS81|LSPA_STAA9 Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|189028780|sp|A8Z3N3|LSPA_STAAT Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|54037760|sp|P65267|LSPA_STAAN Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|54037761|sp|P65268|LSPA_STAAW Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|54041424|sp|P65266|LSPA_STAAM Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|56748983|sp|Q6GA17|LSPA_STAAS Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|71153814|sp|Q5HGN6|LSPA_STAAC Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|122539731|sp|Q2FZ79|LSPA_STAA8 Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|123486251|sp|Q2FHP2|LSPA_STAA3 Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|13700995|dbj|BAB42291.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus N315] >gi|14246966|dbj|BAB57358.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus Mu50] >gi|21204246|dbj|BAB94944.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus MW2] >gi|49244478|emb|CAG42907.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57285951|gb|AAW38045.1| signal peptidase II [Staphylococcus aureus subsp. aureus COL] >gi|87126696|gb|ABD21210.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202460|gb|ABD30270.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740756|gb|ABQ49054.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus JH9] >gi|149946197|gb|ABR52133.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus JH1] >gi|150374119|dbj|BAF67379.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156721652|dbj|BAF78069.1| lipoprotein signal peptidase [Staphylococcus aureus subsp. aureus Mu3] >gi|160368178|gb|ABX29149.1| A8 family signal peptidase II [Staphylococcus aureus subsp. aureus USA300_TCH1516] (163 aa)
Score = 101, Expect = 1.3e-02, Identities = 51/176 (28%), Positives = 85/176 (48%)
  Q:    33 LNKKHLIWKISIILICAFIVLLTSFLTRNSILNATQ--SYWELIPGFLVINITGNTGVSFGTL-GDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSE 208
           ++KK+ I   + ILI  F+V+    +T+  I    +    +E+IP FL I    N G ++G L G      +  +  +  ++ FF+     N  + + +SL+F G L N IDR        L+G   +    + F + F     IFN  D+ + IG+I     III+ +KD   +K+ E
  S:     1 MHKKYFIG--TSILIAVFVVIFDQ-VTKYIIATTMKIGDSFEVIPHFLNITSHRNNGAAWGILSGKMTFFFIITIIILIALVYFFIKDAQYNLFMQVAISLLFAGALGNFIDR-------ILTGEVVDFIDTNIFGYDF----PIFNIADSSLTIGVIL----IIIALLKDTSNKKEKE 161
>gi|192812125|ref|ZP_03040794.1| lipoprotein signal peptidase [Geobacillus sp. Y412MC10] >gi|192799272|gb|EDV75783.1| lipoprotein signal peptidase [Geobacillus sp. Y412MC10] (166 aa)
Score = 101, Expect = 1.4e-02, Identities = 50/162 (30%), Positives = 78/162 (48%)
  Q:    44 IILICAFIVLLTSFLTRNSILNATQSYWEL--IPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSS-----NYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNS-AIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEK 205
           +  + AF++ L    T+  I    + Y ++  I  F +I  + N G +FG L D    L +F+    IV+G  V            LL   ++LV  G L N IDR I+              VVD+ QF F   +  IFN  D+ ++IG   VG+ II+  + + ++EK
  S:     2 VYYLIAFVLFLIDQGTKYLIATRLELYEQIPVIGDFFLITSSRNRGAAFGILQD---QLWFFIVVTLIVVGGIVWYLQKVSKEGRKLLPTALALVLGGALGNFIDRLIM------------GEVVDFLQFNFGSYTFPIFNIADSCIVIG---VGL-IILDTLLEGRREK 152
>gi|157736351|ref|YP_001489034.1| lipoprotein signal peptidase [Arcobacter butzleri RM4018] >gi|157698205|gb|ABV66365.1| lipoprotein signal peptidase [Arcobacter butzleri RM4018] (154 aa)
Score = 100, Expect = 1.8e-02, Identities = 38/136 (27%), Positives = 70/136 (51%)
  Q:    71 WELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLD--IGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKD 206
           W++   ++ + +  N GV+F      + +L Y +Q + ++L    LL + +   +  + ++L++ GGLSNI+DR             T  AVVDYF + +    AIFNF D  + + ++     II   ++  KK+K+
  S:    31 WDVDGPYMSLKLAYNYGVAFSMFSFLDQNLKY-IQLVIVILATLYLLKNRDVFKEYYLPIALLYAGGLSNILDRF------------TYGAVVDYFYWHYGFEFAIFNFADVIIDLAVVI----IIYKQLRQSKKDKE 151
>gi|125973426|ref|YP_001037336.1| signal peptidase II [Clostridium thermocellum ATCC 27405] >gi|196253291|ref|ZP_03151925.1| lipoprotein signal peptidase [Clostridium thermocellum DSM 4150] >gi|152032416|sp|A3DDW4|LSPA_CLOTH Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|125713651|gb|ABN52143.1| signal peptidase II. Aspartic peptidase. MEROPS family A08 [Clostridium thermocellum ATCC 27405] >gi|196197306|gb|EDX92169.1| lipoprotein signal peptidase [Clostridium thermocellum DSM 4150] (151 aa)
Score = 100, Expect = 1.9e-02, Identities = 42/161 (26%), Positives = 76/161 (47%)
  Q:    42 ISIILICAFIVL--LTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIK-NSAIFNFPDTFVIIGMIFVGIQIIISFVKDYK 202
           I I+LI AF+    LT ++   +I    +    +I  F  +    NTG ++G + +    LV     + I++ +F+   +SN      +S++  G L N+IDR           +   + VVD+  F F   +  +FN  DTFV++G + +    +  + +D K
  S:     2 IFIVLIAAFVAADQLTKYIVVRNIEFGDKI--SVIDNFFYLTHWRNTGAAWGIMQNGRYILVPVTVVLSILIVYFIFK-NSNKFYRFSLSMILGGALGNLIDR-----------VFRTDGVVDFLDFQFGNYHFPVFNVADTFVVVGTLLLAYYTLFIYKEDKK 151
>gi|33867153|ref|NP_898711.1| putative lipoprotein signal peptidase [Rhodococcus erythropolis] >gi|33668987|gb|AAP73981.1| putative lipoprotein signal peptidase [Rhodococcus erythropolis] (184 aa)
Score = 99, Expect = 2.0e-02, Identities = 39/154 (25%), Positives = 70/154 (45%)
  Q:    42 ISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF----SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIII 195
           ++  LI A I L    + R  +  +     E+  G + + +  N+GV+F +LG+  PS V    +    +G  V  +     S  +  IG +L+  G  SN++DR++            +  V DYF   +      FN  DT++  G I V + +++
  S:    31 VTTALISAGIALAVEPVARKHLSGSN----EIDLGVVRLRLAYNSGVAF-SLGNQLPSAVIIAFTALATIGIAVYAWRSVPQSRGVAVIGFALIVAGAASNVVDRAL------------DGKVTDYFHTGWWPT---FNLADTYLTCGFILVVVSLLV 168
>gi|40445310|ref|NP_954770.1| lipoprotein signal peptidase [Gordonia westfalica] >gi|40217340|emb|CAE09091.1| putative lipoprotein signal peptidase [Gordonia westfalica] (165 aa)
Score = 99, Expect = 2.5e-02, Identities = 35/119 (29%), Positives = 58/119 (48%)
  Q:    76 GFLVINITGNTGVSFGTLGDSNPSLVYFVQS--IPIVLGFFVLLFSSNYLL--DIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQ---FPFIKNSAIFNFPDTFVIIGMIFVGIQII 194
           G L + +  N GV+F +LGD  PS      +  I + L  + +  + +  +   IG + V  G L+N+IDR+             +  V DYF    FP       FN  DTF+ IG++ + + ++
  S:    49 GVLQLRLAFNPGVAF-SLGDQLPSWAILAVAGLITLALAGYAVHVAPDAGVAGRIGFAAVLGGALTNLIDRA------------ADGVVTDYFHTGWFP------TFNLADTFITIGVVLIVLDVL 155
>gi|57866711|ref|YP_188345.1| lipoprotein signal peptidase [Staphylococcus epidermidis RP62A] >gi|71153815|sp|Q5HPZ5|LSPA_STAEQ Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|57637369|gb|AAW54157.1| lipoprotein signal peptidase [Staphylococcus epidermidis RP62A] (161 aa)
Score = 99, Expect = 2.5e-02, Identities = 53/161 (32%), Positives = 87/161 (54%)
  Q:    40 WKISIILICAFIVLLTSFLTRNSILNATQ--SYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLG---FFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKD 200
           + ISI L+  FIVL+   +++  I  + +    +E+IP FL I    N G ++G L  S   L +++ +I I++    F++     N  + + +SL+F G L N IDR  V + + +  I TN   +  + FP      IFN  D+ + IG+IFV    II+ +KD
  S:     5 YYISISLLMTFIVLVFDQVSKWLITISMKVGDSYEIIPNFLNITSHRNNGAAWGIL--SGKMLFFYIITIIILIVLVIFYIKEAQFNLFMQVAISLLFAGALGNFIDR--VLHGEVVDFIDTN---IFGYDFP------IFNIADSSLTIGVIFV----IITLIKD 153
>gi|82703768|ref|YP_413334.1| lipoprotein signal peptidase [Nitrosospira multiformis ATCC 25196] >gi|82411833|gb|ABB75942.1| lipoprotein signal peptidase [Nitrosospira multiformis ATCC 25196] (160 aa)
Score = 98, Expect = 2.7e-02, Identities = 38/151 (25%), Positives = 73/151 (48%)
  Q:    41 KISIILICAFIVLLTSFLTRNSILNATQSYWELIP--GFLVINITGNTGVSFGTLGDSNPSLVYFVQSIP----IVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIK-NSAIFNFPDTFVIIGMIFVGI 191
           K+ + L+ A IV++  F+T+  I      Y E +P  GF  + +  N G +F  L D+     +F  ++     +++ F +   +++ L  I +SL+  G L N+ DR+ + +            VVD+  F     +   FN  D+ + +G + + I
  S:     2 KLWVSLVIALIVVVLDFVTKRWI-EGVLDYGEHVPLTGFFNLVLAYNAGAAFSFLSDAGGWQRWFFTTVSAGASVLIVFLLYRHAADKLFCIALSLILGGALGNLWDRATLGH------------VVDFLDFHVAGYHWPAFNVADSAISLGAVLLVI 146
>gi|157150312|ref|YP_001450378.1| signal peptidase II [Streptococcus gordonii str. Challis substr. CH1] >gi|157075106|gb|ABV09789.1| signal peptidase II [Streptococcus gordonii str. Challis substr. CH1] (155 aa)
Score = 98, Expect = 2.7e-02, Identities = 36/122 (29%), Positives = 60/122 (49%)
  Q:    73 LIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLG---FFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQII 194
            IP  + +    NTG +F  L   N   ++ + ++ ++ G   + +     ++ L  G++L+  GGL N IDR                 VVD FQF FI N A+FN  DT++  G++ + + II
  S:    37 FIPSIMSLTYLQNTGAAFSIL--ENQQWLFTIITLLVIGGAIWYLIKNIKGSFWLISGLTLIIAGGLGNFIDR------------LRQGFVVDMFQFDFI-NFAVFNVADTYLTFGVLIMLLVII 146
>gi|114706461|ref|ZP_01439363.1| Signal peptidase II, family A8 [Fulvimarina pelagi HTCC2506] >gi|114538322|gb|EAU41444.1| Signal peptidase II, family A8 [Fulvimarina pelagi HTCC2506] (168 aa)
Score = 98, Expect = 3.0e-02, Identities = 42/168 (25%), Positives = 85/168 (50%)
  Q:    43 SIILICAFIVLLTSFLTR--NSILNATQSYWELIP--GFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIV--LGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDY--FQFPFIKNSAIFNFPDTFVIIGMIFVGI-QIIISFVKDYKKEKDSEEN 210
           +++L+   IV+L  FL +   +++  T    E IP   FL +    NTG++F    D+ P  +  +  + +V  L  +V       L    +++V  G + N+IDR ++              VVDY  F  P  +  A+FN  D+F+ +G   + + +I+++ +++ + ++ S  +
  S:     5 NLVLVNITIVVLAVFLDQAVKALVVMTMELGEAIPILPFLALLHARNTGIAFSMFADTGPLGLALLAGVVLVAVLYLWVKTPPDRKLTHFALAIVVGGAIGNLIDRLLL------------GYVVDYVFFHTPLFE-FAVFNLADSFISVGAFLIVLDEIVLTPMRERRIKRQSASD 168
>gi|91205701|ref|YP_538056.1| lipoprotein signal peptidase [Rickettsia bellii RML369-C] >gi|157826840|ref|YP_001495904.1| lipoprotein signal peptidase [Rickettsia bellii OSU 85-389] >gi|166232873|sp|A8GVJ0|LSPA_RICB8 Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|122425492|sp|Q1RI47|LSPA_RICBR Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|91069245|gb|ABE04967.1| Lipoprotein signal peptidase [Rickettsia bellii RML369-C] >gi|157802144|gb|ABV78867.1| lipoprotein signal peptidase [Rickettsia bellii OSU 85-389] (196 aa)
Score = 98, Expect = 3.2e-02, Identities = 41/138 (29%), Positives = 64/138 (46%)
  Q:    74 IPGFLVINITGNTGVSFGTLGD--SNPSLVYFVQSIPIVLGFFVLLFSSNYLLDI-GVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNS-AIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENK 211
           +  FL +  T N G+SFG + D     ++V+ + +  IV   + L+ SS  +    G S V  G + N+IDRS               AV D+  F +   S  +FN  D F+ +G+I +        V+DY   K + E K
  S:    47 VTSFLNMVYTWNYGISFGLMRDYYQYSNIVFLITNTIIVCYLYYLMMSSKTIGGFAGYSFVIGGAIGNLIDRSF------------RGAVFDFIHFYYQDYSFPVFNLADCFITLGVIIL--------VEDYYSAKKNIEEK 168
>gi|85375536|ref|YP_459598.1| lipoprotein signal peptidase [Erythrobacter litoralis HTCC2594] >gi|84788619|gb|ABC64801.1| lipoprotein signal peptidase [Erythrobacter litoralis HTCC2594] (184 aa)
Score = 97, Expect = 3.4e-02, Identities = 46/144 (31%), Positives = 72/144 (50%)
  Q:    68 QSYWELIPGFLVINITGNTGVSFGTLGDSNP----SLVYFVQSIPIVLGFFVLLFSSNYLLDI-GVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQF-PFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENK 211
           +  +EL+P F  +  T N G+S G    ++     +LV     I +V+G ++L      L DI G+ L+F G L NI DR       Y  G   + A + + +F PF+    IFN  D  + IG++ +   +  SF+   KK   SE +K
  S:    44 EGLYELLP-FFDLRWTQNFGISLGMFEATSVEMRWALVLGTALIAVVVGIWML--REKTLGDIIGLGLIFGGALGNIYDR-------YTWGYVIDYADLHFGEFRPFL----IFNIADAAITIGVLII---LARSFLVPEKKTTTSEPDK 176
>gi|145953052|ref|ZP_01802060.1| hypothetical protein CdifQ_04003029 [Clostridium difficile QCD-32g58] (429 aa)
Score = 97, Expect = 3.8e-02, Identities = 35/115 (30%), Positives = 54/115 (46%)
  Q:    85 NTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLD-IGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVK 199
           N G +FG L  +N  +   V  +  V G + L     ++   +G+ L+  G L N+IDR  +              VVDYF F  I    +FN  D FV++G +F+ I ++   VK
  S:    21 NRGAAFGLL-QNNQWIFIIVALLATVFGLYYLNTRKVHIFGRLGIILIISGALGNLIDRVRL------------GFVVDYFDFRVIW-EYVFNVADVFVVVGTVFLCIYVLFLKVK 122
>gi|189347287|ref|YP_001943816.1| lipoprotein signal peptidase [Chlorobium limicola DSM 245] >gi|189341434|gb|ACD90837.1| lipoprotein signal peptidase [Chlorobium limicola DSM 245] (168 aa)
Score = 97, Expect = 3.8e-02, Identities = 38/137 (27%), Positives = 66/137 (48%)
  Q:    49 AFIVLLTSFLTRNSILN-ATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSS-NYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNS---------AIFNFPDTFVIIG 185
           + +VLL  F  + ++L    +    +IP +L +    N G++FG    S   ++  V SI +++  +VL   +   L  +  SL+F GG+ N+IDR  V              V+D+  F   + +          IFN  D+ + IG
  S:     9 SVVVLLDQFTKKLAVLFLRDRGTVTIIPDWLKLTYAENNGIAFGVEFASQAIMILLVGSISLMIALYVLKSGNRKTLFLLPFSLIFGGGIGNLIDRLTVGR------------VIDFIHFDLYQGTIMGSWVSLWPIFNVADSAITIG 144
>gi|114769577|ref|ZP_01447187.1| lipoprotein signal peptidase [alpha proteobacterium HTCC2255] >gi|114549282|gb|EAU52164.1| lipoprotein signal peptidase [alpha proteobacterium HTCC2255] (154 aa)
Score = 97, Expect = 3.9e-02, Identities = 33/119 (27%), Positives = 58/119 (48%)
  Q:    71 WELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNY---LLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF--IKNSAIFNFPDTFVIIGMIFV 189
           +++   FL + +  NTG++FG   +S  S+ + + +I + +  F+L +S         I + L+  G + N+IDR                AV+D+       I N  IFN  D FV  G++F+
  S:    34 YDVYSPFLTLKMGWNTGINFGLFSESYFSMRWILVAISLGICLFLLFWSRKLKGNFAPILIGLIIGGAVGNVIDRVRF------------GAVIDFLNMSCCGINNPYIFNLADIFVFTGLVFL 145
>gi|83859477|ref|ZP_00952998.1| Putative lipoprotein signal peptidase [Oceanicaulis alexandrii HTCC2633] >gi|83852924|gb|EAP90777.1| Putative lipoprotein signal peptidase [Oceanicaulis alexandrii HTCC2633] (166 aa)
Score = 97, Expect = 4.1e-02, Identities = 27/125 (21%), Positives = 60/125 (48%)
  Q:    72 ELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF---SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIIS 196
           E++  +  + +  N GVSFG     +P+  Y +  + + +   ++++   ++  L  +   L+  G + N+IDR I              AVVD+F F  +    +FN  D  + +G+  + + ++++
  S:    48 EVLSPWFNLTMVWNHGVSFGMFQADSPAQRYLLAGVSLAIAGMLVVWMFQTTRRLQALAFGLIIGGAIGNVIDRFIY------------GAVVDFFDFSGLYFPYVFNVADAGICVGVAVMVLDLVLN 163
>gi|110636003|ref|YP_676211.1| signal peptidase II [Mesorhizobium sp. BNC1] >gi|110286987|gb|ABG65046.1| signal peptidase II. Aspartic peptidase. MEROPS family A08 [Mesorhizobium sp. BNC1] (160 aa)
Score = 97, Expect = 4.3e-02, Identities = 36/126 (28%), Positives = 62/126 (49%)
  Q:    72 ELIPGFLVINITGNTGVSFGTL-GDSNPSLVYFVQSIPIVLGFFVLLFSSNYLL-DIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF-IKNSAIFNFPDTFVIIGMIFVGIQIIISF 197
           +++P FL +  + NTG++F  L G     L   V  + I +        SN+L   +G +L+  G + N+IDR+            T   VVDY  F   + + AIFN  D F+ +G + V ++ +++ 
  S:    38 DILP-FLALLHSQNTGIAFSFLSGVGGFWLSLLVLGVIIFIAVLAFRTDSNHLFARLGFALILGGAVGNLIDRA------------TRGYVVDYIYFHTPVWSFAIFNLADAFITVGALLVVLEEVLNL 153
>gi|158320118|ref|YP_001512625.1| lipoprotein signal peptidase [Alkaliphilus oremlandii OhILAs] >gi|158140317|gb|ABW18629.1| lipoprotein signal peptidase [Alkaliphilus oremlandii OhILAs] (154 aa)
Score = 96, Expect = 4.5e-02, Identities = 37/120 (30%), Positives = 57/120 (47%)
  Q:    85 NTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVL--LFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKE 204
           NTG +F  L      L+     + I L  +++    + NYLL I ++LV  G L N+IDR  +            N VVD+  F  I N  IFN  D FV+ G   +   ++++   + +KE
  S:    45 NTGAAFSILQGKQAFLITVTSIVTIALIVYLIKNYKTQNYLLLISLTLVISGALGNLIDRVRL------------NYVVDFLDFTLI-NYPIFNTADIFVVSGTTLLAYFMLLASPNNSQKE 153
>gi|42519112|ref|NP_965042.1| lipoprotein signal peptidase [Lactobacillus johnsonii NCC 533] >gi|81832233|sp|Q74JC2|LSPA_LACJO Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|41583399|gb|AAS09008.1| lipoprotein signal peptidase [Lactobacillus johnsonii NCC 533] (154 aa)
Score = 96, Expect = 4.6e-02, Identities = 48/160 (30%), Positives = 79/160 (49%)
  Q:    41 KISIILICAFIVLLTSFLTRNSILNATQSYWE--LIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNY---LLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKD 200
           K ++ LI + +V++   L +N I+   +   E  +IPG L      N G ++     S   +++++ SI  +      LF+  Y   L D G++LV  G + N IDR    + KY         V+D  Q  FI+ + IFN  D+ + +G+I V I +I    KD
  S:     5 KQALYLIVSLLVIIADQLLKNYIVTNFKIGDEKTIIPGVLSFTYLQNDGAAWNIF--SGQMILFYLISIAAIAVVIYYLFNPKYKNGLFDTGLALVLGGIIGNFIDRL---HLKY---------VIDMLQLDFIQFN-IFNIADSAITVGIILVFIYLIFISEKD 154
>gi|157363877|ref|YP_001470644.1| lipoprotein signal peptidase [Thermotoga lettingae TMO] >gi|157314481|gb|ABV33580.1| lipoprotein signal peptidase [Thermotoga lettingae TMO] (153 aa)
Score = 96, Expect = 5.0e-02, Identities = 31/109 (28%), Positives = 50/109 (45%)
  Q:    74 IPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFV 182
           IPG L    T NTG++FG    S P +++   ++  +L    +    + L  +G+ +V  G + N+IDR       +  G   +   V YF        AIFN  D+F+
  S:    29 IPGILWFTYTRNTGIAFGMFSRS-PWVLWITFAVTFLLAALPIFIRCSLLTRVGLQMVVGGAIGNMIDR-------FRFGYVVDFISVRYF-------PAIFNIADSFI 122
>gi|81428559|ref|YP_395559.1| Signal peptidase II (lipoprotein signal peptidase) (prolipoprotein signal peptidase) [Lactobacillus sakei subsp. sakei 23K] >gi|123564272|sp|Q38X31|LSPA_LACSS Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|78610201|emb|CAI55250.1| Signal peptidase II (Lipoprotein signal peptidase) (Prolipoprotein signal peptidase) [Lactobacillus sakei subsp. sakei 23K] (151 aa)
Score = 96, Expect = 5.2e-02, Identities = 43/123 (34%), Positives = 58/123 (47%)
  Q:    73 LIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPI-VLGF-FVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIII 195
           +IP  L +    N G ++  L        Y V  I + V+G+ F     S  L  IG++L+  G L N IDR    + KY         VVD FQ  FI N  IFN  DT +  G+I V I I++
  S:    34 VIPNILGLTYVQNDGAAWSMLAGQQ-WFFYIVTIIAVGVIGYLFYTSERSEKLYRIGLTLMLAGALGNFIDRL---HLKY---------VVDMFQLEFI-NFPIFNVADTALTCGVICVFIAILL 144
>gi|27467789|ref|NP_764426.1| lipoprotein signal peptidase [Staphylococcus epidermidis ATCC 12228] >gi|27315333|gb|AAO04468.1|AE016746_258 lipoprotein signal peptidase [Staphylococcus epidermidis ATCC 12228] (177 aa)
Score = 96, Expect = 5.3e-02, Identities = 52/161 (32%), Positives = 86/161 (53%)
  Q:    40 WKISIILICAFIVLLTSFLTRNSILNATQ--SYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLG---FFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKD 200
           + ISI L+   IVL+   +++  I  + +    +E+IP FL I    N G ++G L  S   L +++ +I I++    F++     N  + + +SL+F G L N IDR  V + + +  I TN   +  + FP      IFN  D+ + IG+IFV    II+ +KD
  S:    21 YYISISLLMTIIVLVFDQVSKWLITISMKVGDSYEIIPNFLNITSHRNNGAAWGIL--SGKMLFFYIITIIILIVLVIFYIKEAQFNLFMQVAISLLFAGALGNFIDR--VLHGEVVDFIDTN---IFGYDFP------IFNIADSSLTIGVIFV----IIALIKD 169
>gi|161830767|ref|YP_001596340.1| signal peptidase II [Coxiella burnetii RSA 331] >gi|189028645|sp|A9NBM6|LSPA_COXBR Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|161762634|gb|ABX78276.1| signal peptidase II [Coxiella burnetii RSA 331] (163 aa)
Score = 96, Expect = 5.4e-02, Identities = 35/120 (29%), Positives = 61/120 (50%)
  Q:    77 FLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF-----SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKN--SAIFNFPDTFVIIGMIFVGIQIIIS 196
           FL   +  NTG +F  LG  N   + F  +I  V+  F++L+      S  ++ +G+SL+  G L N IDR     + Y         V D+  F  IK+   A FN  D+ + +G+  + + ++++
  S:    45 FLNFTLNYNTGAAFSFLGTENGWQIIFFAAISFVVSIFLILWLSRTSRSEIMMSLGLSLIIGGALGNFIDRL---RWSY---------VTDFIDF-HIKDWHFATFNVADSAICVGVFLLIVHMLLT 158
>gi|163739803|ref|ZP_02147210.1| lipoprotein signal peptidase [Phaeobacter gallaeciensis BS107] >gi|161386837|gb|EDQ11199.1| lipoprotein signal peptidase [Phaeobacter gallaeciensis BS107] (160 aa)
Score = 95, Expect = 5.9e-02, Identities = 30/114 (26%), Positives = 56/114 (49%)
  Q:    72 ELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLD-----IGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF--IKNSAIFNFPDTFVIIG 185
           +++P  L      NTG++FG  GD   +  + + S+ +++   ++++ S    D     +   LV  G L N++DR +   Y Y         V+D+       I+N  +FN  D F+ +G
  S:    37 DVLPPLLRFRYGENTGINFGLFGDGTDTTRWVLISLSMLICMVLVIWISRLPADARAMQLSAGLVIGGALGNVVDRLL---YGY---------VLDFLNTSCCGIENPFVFNVADVFIFVG 145
>gi|165918855|ref|ZP_02218941.1| signal peptidase II [Coxiella burnetii RSA 334] >gi|165917487|gb|EDR36091.1| signal peptidase II [Coxiella burnetii RSA 334] (163 aa)
Score = 95, Expect = 6.0e-02, Identities = 35/120 (29%), Positives = 61/120 (50%)
  Q:    77 FLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF-----SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKN--SAIFNFPDTFVIIGMIFVGIQIIIS 196
           FL   +  NTG +F  LG  N   + F  +I  V+  F++L+      S  ++ +G+SL+  G L N IDR     + Y         V D+  F  IK+   A FN  D+ + +G+  + + ++++
  S:    45 FLNFTLNYNTGAAFSFLGTENGWQIIFFAAISFVVSIFLILWLSRTSRSEIMMSLGLSLIIGGALGNFIDRL---RWSY---------VTDFIDF-HIKDWHFATFNVADSAICVGVFLLIVHMLLT 158
>gi|86606198|ref|YP_474961.1| lipoprotein signal peptidase [Synechococcus sp. JA-3-3Ab] >gi|86554740|gb|ABC99698.1| signal peptidase II [Synechococcus sp. JA-3-3Ab] (156 aa)
Score = 95, Expect = 6.4e-02, Identities = 34/120 (28%), Positives = 53/120 (44%)
  Q:    72 ELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSS-NYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGM--IFVGI 191
           EL PG   +    NTG ++    DS   L +    + + L    +  SS      +G  LV+ G + N IDR +            N  VVD+F F +I    +FN  D  + +G+  + VG+
  S:    35 ELWPGVFHLTYVENTGAAWSLFADSAEFLKWVSLGVAVALALLAIRGSSLGRWEQVGYGLVWAGAMGNGIDRFL------------NGYVVDFFNFVWI-GFPVFNVADVAINVGVACLLVGL 144
>gi|51246403|ref|YP_066287.1| lipoprotein signal peptidase [Desulfotalea psychrophila LSv54] >gi|81826764|sp|Q6AK46|LSPA_DESPS Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|50877440|emb|CAG37280.1| probable lipoprotein signal peptidase [Desulfotalea psychrophila LSv54] (165 aa)
Score = 95, Expect = 6.5e-02, Identities = 45/161 (27%), Positives = 84/161 (52%)
  Q:    44 IILICAFIVLLTSFLTRNSILNATQSY--WELIPGFLVINITGNTGVSFGTLGD-SNPSLVYFVQSIPI--VLGFFVLLFS---SNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKE 204
           I+++C  +V++   LT+  IL+  Q Y   E+IP F  +    NTG +F  L D  +P   YF   I +  VLG  V  ++    ++L  +G++ +  G L N+IDR    +Y Y+  +   +  V  + +P       FN  D+ + +G++      +++  K+ K++
  S:    10 ILIVC--LVIVCDQLTKLWILHNFQLYEVREVIPDFFNLVYVVNTGAAFSMLADVDSPWRHYFFLFIGLGAVLGLTVYTYTLRKEHFLHMVGLACIVGGALGNLIDRV---SYGYV--VDFLDVYVGGYHWP------AFNVADSAICVGVVLYMTMTLLAGNKEKKQK 165
>gi|124520890|ref|ZP_01695962.1| lipoprotein signal peptidase [Bacillus coagulans 36D1] >gi|124497259|gb|EAY44824.1| lipoprotein signal peptidase [Bacillus coagulans 36D1] (165 aa)
Score = 95, Expect = 6.9e-02, Identities = 46/163 (28%), Positives = 73/163 (44%)
  Q:    49 AFIVLLTSFLTRNSILN--ATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPI--VLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIK-NSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENK 211
           A IV++   L +  +L   A     E+IPGF  +  T NTG +F  L +    L Y +  I I  +L +         L+ I + L+  G + N IDR                 VVD+    F   + AIFN  D  + IG++     ++IS + + +K K+  + K
  S:     9 ALIVIILDQLAKWLVLKGMALGESIEVIPGFFFLTSTRNTGAAFSIL-EGQMWLFYLITLIVIAGILYYIQKYAKDRALVGISLGLILGGAIGNFIDRLF------------RGEVVDFVHLRFGSYDFAIFNVADASLTIGVVL----LLISMLLEDRKTKEKTDGK 159
>gi|84503200|ref|ZP_01001285.1| putative lipoprotein signal peptidase [Oceanicola batsensis HTCC2597] >gi|84686766|ref|ZP_01014653.1| putative lipoprotein signal peptidase [Rhodobacterales bacterium HTCC2654] >gi|114762615|ref|ZP_01442059.1| putative lipoprotein signal peptidase [Roseovarius sp. HTCC2601] >gi|159046156|ref|YP_001541828.1| lipoprotein signal peptidase [Dinoroseobacter shibae DFL 12] >gi|159046491|ref|YP_001542161.1| lipoprotein signal peptidase [Dinoroseobacter shibae DFL 12] >gi|84388441|gb|EAQ01390.1| putative lipoprotein signal peptidase [Oceanicola batsensis HTCC2597] >gi|84665197|gb|EAQ11676.1| putative lipoprotein signal peptidase [Rhodobacterales bacterium HTCC2654] >gi|114544870|gb|EAU47875.1| putative lipoprotein signal peptidase [Roseovarius sp. HTCC2601] >gi|157913915|gb|ABV95347.1| lipoprotein signal peptidase [Dinoroseobacter shibae DFL 12] >gi|157914250|gb|ABV95680.1| lipoprotein signal peptidase [Dinoroseobacter shibae DFL 12] (157 aa)
Score = 95, Expect = 7.1e-02, Identities = 49/146 (33%), Positives = 74/146 (50%)
  Q:    46 LICAFIVLLTSFLTRNSIL-NAT--QSYWELIPGFLVINITGNTGVSFGTLGDSNP--SLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNS--AIFNFPDTFVIIGMIFVGI 191
           L+ A I  L    T+  ++ NAT   S   + PGF +I +  N GV+FG LG + P  SLV     I + L F +L+ +S+ +  I    +  G L NI+DR      +Y        AV D+  F +I  +    FN  D FV+ G++ + I
  S:     9 LLAALIAFLVDQATKAIVVSNATVLSSGVSVFPGFNLIYLR-NDGVTFGLLGGA-PWWSLVLLALGICVWLAF-MLVRTSSRVEAIAYGAIIGGALGNILDR-----LRY-------RAVTDFLDF-YIGTAHWPAFNMADVFVVGGVMLLLI 145
>gi|113869001|ref|YP_727490.1| lipoprotein signal peptidase II [Ralstonia eutropha H16] >gi|123133655|sp|Q0K799|LSPA_RALEH Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|113527777|emb|CAJ94122.1| lipoprotein signal peptidase II [Ralstonia eutropha H16] (175 aa)
Score = 95, Expect = 7.2e-02, Identities = 42/152 (27%), Positives = 72/152 (47%)
  Q:    38 LIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIP--GFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFV--LLF--SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNS--AIFNFPDTFVIIGMIFV 189
           L+W    +L+    V+L  F     ++  T +Y E  P  GF  + +  N G +F  L D+     +F   + IV+G F+  LL+  +   L    VSL+  G + N+IDR +  +            VVD+  F +++N     FN  D  + +G + +
  S:    24 LLWMAFALLV----VVLDQFF--KIVIVRTFTYGESRPVTGFFNLVLVYNKGAAFSFLADAGGWQRWFFTGLGIVVGAFIVWLLYRHTGQRLFCFAVSLILGGAVGNVIDRVVYGH------------VVDFLDF-YVRNYHWPAFNVADCAITVGAVLL 164
>gi|161507612|ref|YP_001577566.1| lipoprotein signal peptidase A [Lactobacillus helveticus DPC 4571] >gi|160348601|gb|ABX27275.1| Lipoprotein signal peptidase A [Lactobacillus helveticus DPC 4571] (154 aa)
Score = 95, Expect = 7.2e-02, Identities = 43/129 (33%), Positives = 61/129 (47%)
  Q:    72 ELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSS--NYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKD 200
           ++IPG L  N   N G ++  L      L Y +  I I +  + L      N L D+G++LV  G + N IDR    + KY         VVD  +  FI N  IFN  DT + IG++ + I +I    KD
  S:    34 QIIPGILSFNYLQNDGAAWNIL-TGQMWLFYGISVIAIGVCLYFLFNKKYKNALFDVGLALVLGGIIGNFIDRL---HLKY---------VVDMLRLDFI-NFNIFNIADTAITIGVLIIFIYLIFFADKD 150
>gi|187918336|ref|YP_001883899.1| lipoprotein signal peptidase [Borrelia hermsii DAH] >gi|119861184|gb|AAX16979.1| lipoprotein signal peptidase [Borrelia hermsii DAH] (170 aa)
Score = 95, Expect = 7.3e-02, Identities = 47/154 (30%), Positives = 71/154 (46%)
  Q:    33 LNKKHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLV-YFVQSIPIVLGFFVLLF---SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF-----IKNSAIFNFPDTFVIIGM 186
           +++  LI  +  I I  FI   + +L    I   T+ Y      F  I    NTG+ F    + N SL   F   IPI++  FV  F    +N +  I + L+  GG+ NIIDR           +     VVD+    F     ++    FNF D++V+IG+
  S:     3 IDRNRLIGSVIFIFILVFIDQWSKYLVVKYISIGTE-YLSFFGDFFKIIHVRNTGILFSIGANINSSLKNLFFLVIPIIILVFVFCFILKETNKIARIALILILSGGIGNIIDR-----------LFRPLGVVDFLDVKFFGIFGLQRWPTFNFADSYVVIGI 153
>gi|16803141|ref|NP_464626.1| hypothetical protein lmo1101 [Listeria monocytogenes EGD-e] >gi|16410503|emb|CAC99179.1| lmo1101 [Listeria monocytogenes] (166 aa)
Score = 95, Expect = 7.3e-02, Identities = 51/171 (29%), Positives = 84/171 (49%)
  Q:    33 LNKKHLIWKISIILICAFI-VLLTSFLTRNSILNATQ--SYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVL--GFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIK-NSAIFNFPDTFVIIGMIFVGI-QIIISFVKDYKK 203
           +  K +I K +++LI   +   LT  L++  I +  Q     E+IP F  I    NTG ++  L +   +  Y +  + ++L   +F  L     +  IGV+L+  G L N IDR +   ++Y         V D   F  +  N  IFN  D  +I G++F+ I +++ SF   YKK
  S:     1 MKNKTIISKQNLVLIVIMVGATLTDQLSKIWITSNLQLGESIEIIPSFFKITYAQNTGAAWSIL-EGQMTFFYVITLVALILLGWYFYRLKDYQIIQKIGVALMVSGTLGNFIDRLL---FQY---------VRDSLDFHILGYNFPIFNVADVLLICGVLFIIIDEVLKSFGVSYKK 165
>gi|195947486|ref|ZP_03088672.1| signal peptidase II [Borrelia garinii PBr] (168 aa)
Score = 94, Expect = 7.7e-02, Identities = 41/119 (34%), Positives = 58/119 (48%)
  Q:    70 YWELIPGFLVINITGNTGVSFGTLGDSNPSLV-YFVQSIPIVLGFFVL---LFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF-----IKNSAIFNFPDTFVIIGMIF 188
           Y+     F  I    NTG+ F    D + SL   F  ++PI +  FV    L   N +  I + L+F GG+ NIIDR           +   + VVD+  F F     +     FNF D++V+IGMI 
  S:    39 YFSFFDNFFRIIHVRNTGILFSMGSDIHYSLKKIFFLAMPIFILIFVFSLALKEKNCITKISLLLIFSGGVGNIIDR-----------LFRPSGVVDFLDFKFYGIFGLDRWPTFNFADSYVVIGMIL 155
>gi|111115299|ref|YP_709917.1| signal peptidase II [Borrelia afzelii PKo] >gi|167942187|ref|ZP_02529261.1| signal peptidase II [Borrelia afzelii ACA-1] >gi|123341338|sp|Q0SN37|LSPA_BORAP Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|110890573|gb|ABH01741.1| signal peptidase II [Borrelia afzelii PKo] (170 aa)
Score = 94, Expect = 7.9e-02, Identities = 39/119 (32%), Positives = 58/119 (48%)
  Q:    70 YWELIPGFLVINITGNTGVSFGTLGDSNPSLV-YFVQSIPIVLGFFVLLFS---SNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF-----IKNSAIFNFPDTFVIIGMIF 188
           Y+     F  I    NTG+ F    + N SL   F  ++PI +  F+   S    N +  I + L+F GG+ N+IDR           +   + VVD+  F F     +     FNF D++V+IGMI 
  S:    39 YFSFFENFFRIIHVRNTGILFSIGSNINYSLKKIFFLAMPIFILIFIFSLSLKEKNRIARISLLLIFSGGVGNVIDR-----------LFRPSGVVDFLDFKFYGIFGLDRWPTFNFADSYVVIGMIL 155
>gi|70726719|ref|YP_253633.1| lipoprotein signal peptidase (prolipoprotein signal peptidase) [Staphylococcus haemolyticus JCSC1435] >gi|123660011|sp|Q4L5P8|LSPA_STAHJ Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|68447443|dbj|BAE05027.1| Lipoprotein signal peptidase (Prolipoprotein signal peptidase) [Staphylococcus haemolyticus JCSC1435] (158 aa)
Score = 94, Expect = 8.1e-02, Identities = 42/139 (30%), Positives = 71/139 (51%)
  Q:    62 SILNATQSYWELIPGFLVINITGNTGVSFGTL-GDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKD 200
           + +N   SY E+IP FL I    N G ++G L G      +  +  + +++ F++     N  + + +SL+F G L N IDR +  N + +  + TN   +  + FP      IFN  D+ + IG++F    III+ +KD
  S:    30 TTMNIGDSY-EVIPNFLNITSHRNNGAAWGILSGKMGFFYIITIVILIVLVLFYIKEAKYNLFMQVAISLLFAGALGNFIDRLV--NGEVVDFVDTN---IFGYDFP------IFNVADSSLTIGVLF----IIIALLKD 153
>gi|153010526|ref|YP_001371740.1| lipoprotein signal peptidase [Ochrobactrum anthropi ATCC 49188] >gi|151562414|gb|ABS15911.1| lipoprotein signal peptidase [Ochrobactrum anthropi ATCC 49188] (154 aa)
Score = 94, Expect = 8.5e-02, Identities = 40/147 (27%), Positives = 69/147 (46%)
  Q:    50 FIVLLTSFLTRNSILNATQSYWELIP--GFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDI-GVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNS--AIFNFPDTFVIIGMIFVGIQIIIS 196
           F+   T +   N ++N  Q    +IP  GF  + +  NTGVSFG  G + P+ +    ++ IV G  V +  S+  L    + LV  G L N++DR                AV D+  F +I +     FN  D  ++ G+  + ++ +++
  S:    14 FLDQATKWWVLNHVMNPPQ----VIPVTGFFNLVLGFNTGVSFGLFGQA-PAWLLMAFTLAIVAGLLVWIHRSDSRLTASALGLVVGGALGNLLDR------------LRQGAVADFLDF-YIGSYHWPAFNLADVAIVCGVGLLLVESVLA 147
>gi|153207854|ref|ZP_01946431.1| signal peptidase II [Coxiella burnetii 'MSU Goat Q177'] >gi|120576280|gb|EAX32904.1| signal peptidase II [Coxiella burnetii 'MSU Goat Q177'] (163 aa)
Score = 94, Expect = 8.8e-02, Identities = 35/120 (29%), Positives = 60/120 (50%)
  Q:    77 FLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF-----SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKN--SAIFNFPDTFVIIGMIFVGIQIIIS 196
           FL   +  NTG +F  LG  N   + F   I  V+  F++L+      S  ++ +G+SL+  G L N IDR     + Y         V D+  F  IK+   A FN  D+ + +G+  + + ++++
  S:    45 FLNFTLNYNTGAAFSFLGTENGWQIIFFADISFVVSIFLILWLSRTSRSEIMMSLGLSLIIGGALGNFIDRL---RWSY---------VTDFIDF-HIKDWHFATFNVADSAICVGVFLLIVHMLLT 158
>gi|51598725|ref|YP_072913.1| signal peptidase II [Borrelia garinii PBi] >gi|81825631|sp|Q661F0|LSPA_BORGA Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|51573296|gb|AAU07321.1| signal peptidase II [Borrelia garinii PBi] (170 aa)
Score = 94, Expect = 9.1e-02, Identities = 41/119 (34%), Positives = 61/119 (51%)
  Q:    70 YWELIPGFLVINITGNTGVSFGTLGDSNPSL--VYFVQSIPIVLGFFVL---LFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF-----IKNSAIFNFPDTFVIIGMIF 188
           Y+     F  I    NTG+ F    D + SL  ++F+ ++PI +  FV    L   N +  I + L+F GG+ NIIDR           +   + VVD+  F F     +     FNF D++V+IGMI 
  S:    39 YFSFFDNFFRIIHVRNTGILFSMGSDIHYSLKKIFFI-AMPIFILIFVFSLALKEKNCITRISLLLIFSGGVGNIIDR-----------LFRPSGVVDFLDFKFYGIFGLDRWPTFNFADSYVVIGMIL 155
>gi|112148550|gb|ABI13557.1| putative prolipoprotein signal peptidase [Lactobacillus helveticus CNRZ32] (154 aa)
Score = 94, Expect = 9.6e-02, Identities = 43/129 (33%), Positives = 61/129 (47%)
  Q:    72 ELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSS--NYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKD 200
           ++IPG L  N   N G ++  L      L Y +  I I +  + L      N L D+G++LV  G + N IDR    + KY         VVD  +  FI N  IFN  DT + IG++ + I +I    KD
  S:    34 QIIPGTLSFNYLQNDGAAWNIL-TGQMWLFYGISVIAIGVCLYFLFNKKYKNALFDVGLALVLGGIIGNFIDRL---HLKY---------VVDMLRLDFI-NFNIFNIADTAITIGVLIIFIYLIFFADKD 150
>gi|148887168|sp|Q8CPK0|LSPA_STAES Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) (161 aa)
Score = 93, Expect = 9.8e-02, Identities = 52/161 (32%), Positives = 86/161 (53%)
  Q:    40 WKISIILICAFIVLLTSFLTRNSILNATQ--SYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLG---FFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKD 200
           + ISI L+   IVL+   +++  I  + +    +E+IP FL I    N G ++G L  S   L +++ +I I++    F++     N  + + +SL+F G L N IDR  V + + +  I TN   +  + FP      IFN  D+ + IG+IFV    II+ +KD
  S:     5 YYISISLLMTIIVLVFDQVSKWLITISMKVGDSYEIIPNFLNITSHRNNGAAWGIL--SGKMLFFYIITIIILIVLVIFYIKEAQFNLFMQVAISLLFAGALGNFIDR--VLHGEVVDFIDTN---IFGYDFP------IFNIADSSLTIGVIFV----IIALIKD 153
>gi|154706469|ref|YP_001425007.1| signal peptidase II [Coxiella burnetii Dugway 5J108-111] >gi|189028644|sp|A9KEI7|LSPA_COXBN Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|154355755|gb|ABS77217.1| signal peptidase II [Coxiella burnetii Dugway 5J108-111] (163 aa)
Score = 93, Expect = 9.8e-02, Identities = 35/120 (29%), Positives = 61/120 (50%)
  Q:    77 FLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF-----SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKN--SAIFNFPDTFVIIGMIFVGIQIIIS 196
           FL   +  NTG +F  LG  N   + F  +I  V+  F++L+      S  ++ +G+SL+  G L N IDR     + Y         V D+  F  IK+   A FN  D+ + +G+  + + ++++
  S:    45 FLNFTLNYNTGAAFSFLGTENGWQIIFFAAISFVVSIFLILWLSRTSRSEIMMSLGLSLIIGGALGNFIDRL---RWSY---------VTDFIDF-HIKDWHFATFNVADSAICVGVFLLIVYMLLT 158
>gi|167771409|ref|ZP_02443462.1| hypothetical protein ANACOL_02775 [Anaerotruncus colihominis DSM 17241] >gi|167666049|gb|EDS10179.1| hypothetical protein ANACOL_02775 [Anaerotruncus colihominis DSM 17241] (165 aa)
Score = 93, Expect = 1.1e-01, Identities = 34/123 (27%), Positives = 55/123 (44%)
  Q:    73 LIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSS--NYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIII 195
           +IPG L      N G +FG        L  F  ++ IV+   +L+     + LL   V L+  GG+ N+IDR               + VVDY     + +  +FNF D  V+IG   + + +++
  S:    36 VIPGLLQFTYVENRGAAFGIFQGRVGLLSLFTLAV-IVVALILLIRGRLRHPLLMWSVGLIIAGGVGNLIDRVF------------RSFVVDYIDISPLFSFPVFNFADCCVVIGTAMLAVYMLL 147
>gi|167040455|ref|YP_001663440.1| lipoprotein signal peptidase [Thermoanaerobacter sp. X514] >gi|166854695|gb|ABY93104.1| lipoprotein signal peptidase [Thermoanaerobacter sp. X514] (144 aa)
Score = 93, Expect = 1.2e-01, Identities = 38/150 (25%), Positives = 69/150 (46%)
  Q:    45 ILICAFIVLL---TSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQII 194
           I+I AF+V L   T +L    ++      + +I  F  +    N G +FG L +     +     +  VL + ++    N + +  ++++  G + N+IDR  +              VVD+  F F    A+FN  D+F++IG I +G  +I
  S:     3 IVIVAFVVFLDQLTKYLAVKYLM--LIGSYPVIKNFFHLTYVENKGAAFGMLQNKTLFFIVITVIVGAVLIYSMIKLPGNSVYNYTLAMILGGAIGNLIDRVRL------------GYVVDFIDFKFF--PAVFNVADSFIVIGAIILGYLMI 139
>gi|29653744|ref|NP_819436.1| signal peptidase II [Coxiella burnetii RSA 493] >gi|81839101|sp|Q83EC8|LSPA_COXBU Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|29541007|gb|AAO89950.1| signal peptidase II [Coxiella burnetii RSA 493] (163 aa)
Score = 92, Expect = 1.3e-01, Identities = 35/120 (29%), Positives = 61/120 (50%)
  Q:    77 FLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF-----SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKN--SAIFNFPDTFVIIGMIFVGIQIIIS 196
           FL   +  NTG +F  LG  N   + F  +I  V+  F++L+      S  ++ +G+SL+  G L N IDR     + Y         V D+  F  IK+   A FN  D+ + +G+  + + ++++
  S:    45 FLNFTLNYNTGAAFSFLGTENGWQIIFFAAISFVVSIFLILWLSRTSRSEIMMLLGLSLIIGGALGNFIDRL---RWSY---------VTDFIDF-HIKDWHFATFNVADSAICVGVFLLIVHMLLT 158
>gi|167037762|ref|YP_001665340.1| lipoprotein signal peptidase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856596|gb|ABY95004.1| lipoprotein signal peptidase [Thermoanaerobacter pseudethanolicus ATCC 33223] (144 aa)
Score = 92, Expect = 1.4e-01, Identities = 38/150 (25%), Positives = 69/150 (46%)
  Q:    45 ILICAFIVLL---TSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQII 194
           I+I AF+V L   T +L    ++      + +I  F  +    N G +FG L +     +     +  VL + ++    N + +  ++++  G + N+IDR  +              VVD+  F F    A+FN  D+F++IG I +G  +I
  S:     3 IVIVAFVVFLDQLTKYLAVKYLM--LIGSYPVIKNFFHLTYVENKGAAFGMLQNKTLFFIIITVIVGAVLIYSMIKLPENSVYNYTLAMILGGAIGNLIDRVRL------------GYVVDFIDFKFF--PAVFNVADSFIVIGAIILGYLMI 139
>gi|169182634|ref|ZP_02843149.1| lipoprotein signal peptidase [Thauera sp. MZ1T] >gi|169010260|gb|EDS57027.1| lipoprotein signal peptidase [Thauera sp. MZ1T] (178 aa)
Score = 92, Expect = 1.4e-01, Identities = 37/141 (26%), Positives = 66/141 (46%)
  Q:    46 LICAFIVLLTSFLTRNSILNATQSYWELIP--GFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNY----LLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNS-AIFNFPDTFVIIGM 186
           LI A +V +   +T+  ++ A     EL+P  GF  + +  NTG +F  L D +    +F   +   +  ++L    ++    LL    +L+  G L N+ DR +            + AVVD+  F +   S   FN  D+ + +G+
  S:    21 LILAVVVGVLDQVTKQMVM-ANLRLGELVPITGFFDLVLVFNTGAAFSFLADHSGWQRWFFTILAFGISAWLLTLMHHHRHEKLLPTAFALIIGGALGNVYDRLV------------HGAVVDFLHFHYAGWSWPAFNLADSAITVGV 155
>gi|119509357|ref|ZP_01628506.1| signal peptidase II [Nodularia spumigena CCY9414] >gi|119465971|gb|EAW46859.1| signal peptidase II [Nodularia spumigena CCY9414] (158 aa)
Score = 92, Expect = 1.4e-01, Identities = 46/165 (27%), Positives = 70/165 (42%)
  Q:    35 KKHLIWKISIILICAFIVLLTSFLTRNSILN--ATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYF---VQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVK 199
           K HL W      I AF+      LT+  ++   +      +IP         NTG +F         L +    V  + I LG+F      N+   +G  L+  G + N IDR ++              VVD+  F  I N A+FN  D+F+ IG++ +   +I SF K
  S:     4 KNHLFW------IAAFVAFFLDQLTKYWVVQTFSLGQTLPIIPDVFHFTYVTNTGAAFSLFSGKVEWLRWLSLGVSLVLIALGWFGQEL--NHWDQLGYGLILGGAMGNGIDRFVL------------GYVVDFLDFRLI-NFAVFNMADSFISIGIVCL---LIASFQK 149
>gi|20807975|ref|NP_623146.1| lipoprotein signal peptidase [Thermoanaerobacter tengcongensis MB4] >gi|33112380|sp|Q8R9R0|LSPA_THETN Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|20516548|gb|AAM24750.1| Lipoprotein signal peptidase [Thermoanaerobacter tengcongensis MB4] (145 aa)
Score = 92, Expect = 1.4e-01, Identities = 41/150 (27%), Positives = 68/150 (45%)
  Q:    45 ILICAFIVLLTSFLT--RNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQII 194
           I+I AF+V L  F        L    SY  +I  F  +    N G +FG L +     +     + IVL + ++    N L +  ++++  G + N+IDR  +              VVD+  F F    A+FN  D+F+++G I +G  +I
  S:     3 IVIVAFVVFLDQFTKYLAAKYLMPIGSY-PVIKHFFHLTYVENRGAAFGMLQNKTLFFIVITVVVGIVLIYSMIKLPENSLYNYTLAMILGGAIGNLIDRVRL------------GYVVDFIDFKFF--PAVFNVADSFIVVGAIILGYLMI 139
>gi|116492704|ref|YP_804439.1| signal peptidase II [Pediococcus pentosaceus ATCC 25745] >gi|116102854|gb|ABJ67997.1| signal peptidase II. Aspartic peptidase. MEROPS family A08 [Pediococcus pentosaceus ATCC 25745] (150 aa)
Score = 92, Expect = 1.6e-01, Identities = 44/148 (29%), Positives = 69/148 (46%)
  Q:    47 ICAFIVLLTSFLTRNSILN--ATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLL-DIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQII 194
           I   ++L+   L ++++ N  A  +    IPG L +    N G ++  L   N    Y +  + +V+  ++L+    +LL   G++L+  G L N IDR      KY         VVD FQ  F  N  IFN  D  +  G+I + I II
  S:     7 IVGLLLLVIDQLVKSAVSNQIALGTVKSFIPGVLSLTNLRNDGAAWSIL-SGNQIFFYLITVVALVVLIYLLVTQRQHLLYQWGLTLMITGTLGNFIDRI---RLKY---------VVDMFQIDFF-NFPIFNIADMCLTFGVIILFIAII 143
>gi|13472802|ref|NP_104369.1| lipoprotein signal peptidase [Mesorhizobium loti MAFF303099] >gi|81855541|sp|Q98GR1|LSPA_RHILO Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|14023549|dbj|BAB50155.1| lipoprotein signal peptidase [Mesorhizobium loti MAFF303099] (168 aa)
Score = 91, Expect = 1.7e-01, Identities = 42/149 (28%), Positives = 69/149 (46%)
  Q:    68 QSYWELIPGFLVINITGNTGVSFG---TLGDSNPSL---------VYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF-IKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKKPIKD 216
           Q   +L+P FL +  T NTG++F    + GD+   +         +Y     P          S + +   G +L+  G L N+IDR++  +            V+DY  F   + + AIFN  D F+ +G   V    +I + ++    K S+   KP KD
  S:    32 QEKLDLVP-FLALFRTYNTGIAFSMFSSFGDTGLVVIAVLVVAFVLYLATRTP----------SGHVIARTGFALIIGGALGNLIDRAVYGH------------VIDYILFHTPVWSFAIFNLADAFISVGAALVVFDELIGWRREPSNAKPSK--AKPSKD 168
>gi|66880195|ref|ZP_00405179.1| COG0597: Lipoprotein signal peptidase [Mycoplasma genitalium G-37] (113 aa)
Score = 91, Expect = 1.7e-01, Identities = 28/88 (31%), Positives = 44/88 (50%)
  Q:    35 KKHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNY 122
           K  L +K+++I    FI+LL  F+ RN++     +      GF+ I +  N GV F  L +    LVYF+Q +  V+    L+F   Y
  S:    22 KPFLFYKLTMIGFVGFIILLQVFILRNALNGEMDNTMVANSGFINIYVIRNKGVGFSLLQNQT-GLVYFLQGLLSVIALVFLVFMVKY 108
>gi|58337437|ref|YP_194022.1| lipoprotein signal peptidase A [Lactobacillus acidophilus NCFM] >gi|58254754|gb|AAV42991.1| lipoprotein signal peptidase A [Lactobacillus acidophilus NCFM] (167 aa)
Score = 91, Expect = 1.7e-01, Identities = 45/142 (31%), Positives = 65/142 (45%)
  Q:    45 ILICAFIVLLTSFLTRNSILN-ATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSS--NYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGM 186
           ++I  F+VL    L    + N +     ++IPG L  N   N G ++  L +    L YF+  I I +  + L      N L DIG+S V  G + N IDR      KY         VVD  Q  F+  + IFN  D+ + IG+
  S:    19 LIITLFVVLADQGLKNYIVSNYSVGEVHQIIPGILSFNYLQNNGAAWNILTNQM-WLFYFISIIAIGVCLYFLFNKKYKNVLFDIGLSFVLGGIIGNFIDRL---RLKY---------VVDMLQLDFVHFN-IFNIADSAITIGV 149
>gi|160945090|ref|ZP_02092316.1| hypothetical protein FAEPRAM212_02609 [Faecalibacterium prausnitzii M21/2] >gi|158442821|gb|EDP19826.1| hypothetical protein FAEPRAM212_02609 [Faecalibacterium prausnitzii M21/2] (160 aa)
Score = 91, Expect = 2.1e-01, Identities = 36/128 (28%), Positives = 59/128 (46%)
  Q:    73 LIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSS--NYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKD 200
           LIP  + +    N G++F  L      L+    S+ ++   + L F S    L    + LV  GG+ N+IDR +            N  VVDY    F++  A+FNF D  V +G   V + +++ F+ +
  S:    37 LIPRVVELRFVLNPGMAFSLLSGKQLFLI-IATSVALLAVAYGLFFRSRGKRLQQAALVLVLGGGIGNLIDRVL------------NGEVVDYINLLFMR-FAVFNFADICVCVG---VALWVLVIFLDE 149
>gi|164687827|ref|ZP_02211855.1| hypothetical protein CLOBAR_01471 [Clostridium bartlettii DSM 16795] >gi|164603102|gb|EDQ96567.1| hypothetical protein CLOBAR_01471 [Clostridium bartlettii DSM 16795] (150 aa)
Score = 91, Expect = 2.2e-01, Identities = 38/122 (31%), Positives = 60/122 (49%)
  Q:    85 NTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFS--SNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKD 206
           N G +FG L  +N  +   V  I  ++G + L     ++ +    + L+  G L N+IDR  +D             VVDYF F FI N  +FN  D F+++G I + + ++I   K  K EK+
  S:    44 NRGAAFG-LFQNNQIIFIVVALIASIVGLYALHSKKINSKICKTSIMLIIAGALGNLIDRIRLD------------FVVDYFDFVFIWNY-VFNLADCFIVVGTILLCLYVLI---KSDKTEKE 150
>gi|114327129|ref|YP_744286.1| lipoprotein signal peptidase [Granulibacter bethesdensis CGDNIH1] >gi|114315303|gb|ABI61363.1| lipoprotein signal peptidase [Granulibacter bethesdensis CGDNIH1] (184 aa)
Score = 91, Expect = 2.2e-01, Identities = 41/154 (26%), Positives = 78/154 (50%)
  Q:    42 ISIILICAFIVLLTSFLTRNSIL---NATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFV--QSIPIVLGFFVLL-FSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNS-AIFNFPDTFVIIGMIFVGIQIII 195
           + I ++ A IVLL    ++  IL   N  + +  ++   L + +  N GV+FG L    P+ ++ +   +I IV G  + +  + N L+ I + ++  G + N+IDR     +++        AVVD+      + S  +FN  D  ++IG+  + I  +I
  S:    24 MPIGILAALIVLLADQGSKWFILETVNLPEKHQIVLLPVLNLTMVWNRGVTFGLLNGFGPAGIWILGGGAILIVAGLLLWMRRAENRLIAIALGMIGGGAIGNVIDR-----FRF-------GAVVDFIHAHVGELSWFVFNVADAAIVIGVALLIIDTLI 172
>gi|29376274|ref|NP_815428.1| lipoprotein signal peptidase [Enterococcus faecalis V583] >gi|81838904|sp|Q834D8|LSPA_ENTFA Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|29343737|gb|AAO81498.1| lipoprotein signal peptidase [Enterococcus faecalis V583] (161 aa)
Score = 90, Expect = 2.3e-01, Identities = 38/124 (30%), Positives = 58/124 (46%)
  Q:    72 ELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNY----LLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIII 195
           E IPGFL +    NTG ++  L      +++F     IV    + L   NY       +G+S V  G + N IDR  +              VVD  Q  F+ N  IFN  D+ +++G+I + I +I+
  S:    37 EFIPGFLSLTHLRNTGAAWSLL---EGKMIFFYVITVIVSVVIIYLLIKNYKKSIWYSVGLSFVLAGAIGNFIDRVRL------------GYVVDMLQTDFM-NFPIFNVADSTLVVGVICIFIYLIL 148
>gi|116629657|ref|YP_814829.1| lipoprotein signal peptidase [Lactobacillus gasseri ATCC 33323] >gi|122273405|sp|Q043I1|LSPA_LACGA Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|116095239|gb|ABJ60391.1| signal peptidase II. Aspartic peptidase. MEROPS family A08 [Lactobacillus gasseri ATCC 33323] (154 aa)
Score = 90, Expect = 2.3e-01, Identities = 38/128 (29%), Positives = 63/128 (49%)
  Q:    73 LIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFS---SNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKD 200
           +IPG L      N G ++     S   +++++ SI  +      LF+    N+L D G++LV  G + N IDR    + KY         V+D  Q  F++ + IFN  D+ + +G++ V I +I    KD
  S:    39 VIPGILSFTYLQNDGAAWNIF--SGQMILFYLISIAAIAVVVYYLFNPKYKNWLFDTGLALVLGGIIGNFIDRL---HLKY---------VIDMLQLDFVQFN-IFNIADSAITVGIVLVFIYLIFMSEKD 154
>gi|118602653|ref|YP_903868.1| lipoprotein signal peptidase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567592|gb|ABL02397.1| lipoprotein signal peptidase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (152 aa)
Score = 90, Expect = 2.4e-01, Identities = 37/115 (32%), Positives = 56/115 (48%)
  Q:    77 FLVINITGNTGVSFGTLGDSNPSLVYFVQSIP----IVLGFFVLLFSSNYLLD-IGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIK-NSAIFNFPDTFVIIGMIFVGI 191
           FL +  T N G SF  L DS     YF+ S+     IV+   +L  S  + L  + + L+  G + N+IDR              N+ VVD+    +   N  IFNF D F+ +G++ + I
  S:    39 FLSLTFTRNYGASFSFLADSGGWQRYFLSSVSAIASIVISVLILKTSLKHQLKLVSLVLILSGAIGNMIDRI------------ANSFVVDFIDLYYAGFNYPIFNFADIFISVGVVVLII 147
>gi|50365206|ref|YP_053631.1| lipoprotein signal peptidase [Mesoplasma florum L1] >gi|50363762|gb|AAT75747.1| lipoprotein signal peptidase [Mesoplasma florum L1] (207 aa)
Score = 90, Expect = 2.7e-01, Identities = 53/187 (28%), Positives = 89/187 (47%)
  Q:    40 WKISIIL---ICAFIVLLTSFLTRNSILNATQSYWE-LIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQ--SIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYF--QFPFIKNSA-IFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKKPIKDVVLDEERNKT 226
           WK  +I+   I +F++LL   +    +    ++  +  I GFL I    N G ++G  GD    L   V   ++ + L   V +F ++    I  S++  GG +N++ R+         G      VVD F   F F+ +S  IFN  D +V IG+    +  II  +  +K +K  E NK+      +D+  NK+
  S:    20 WKFKLIIATPIMSFLILLDWIIKWVVVATMKENDSKTFINGFLNIQYKINLGSAYGR-GDYADGLAKTVTLAALFVALLIIVFIFLNDKKWIITCSILLAGGFANLLARAWAPA-TIRDGQEIYGGVVDMFVWGFDFLGSSGYIFNLADMWVNIGIGIGAVCFIIEMINIFKPKKQKEINKE------VDKNENKS 207
>gi|71893386|ref|YP_278832.1| lipoprotein signal peptidase [Mycoplasma hyopneumoniae J] (175 aa)
Score = 90, Expect = 2.8e-01, Identities = 30/113 (26%), Positives = 55/113 (48%)
  Q:   100 LVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKK 212
             +F+ +I ++L    + FS  + L I ++ +  G   N IDR           I  NN V D    P++ +S  FNF D F+  G I + +  +I+F+K++   +  ++ K+
  S:    74 FAFFLTAILLIL----IPFSRKFSLTIFMATLLAGNWGNEIDR-----------ILNNNTVKDLLFLPYLPSSGTFNFADLFIFSGPIGIVLVHLINFLKNFDGRRMKKQPKE 171
>gi|149916310|ref|ZP_01904830.1| lipoprotein signal peptidase [Roseobacter sp. AzwK-3b] >gi|149809764|gb|EDM69616.1| lipoprotein signal peptidase [Roseobacter sp. AzwK-3b] (157 aa)
Score = 89, Expect = 2.9e-01, Identities = 32/104 (30%), Positives = 49/104 (47%)
  Q:    85 NTGVSFGTLGDSNPSLVYFVQSIPIVLGFF---VLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF--IKNSAIFNFPDTFVIIGMIF 188
           N GV+FG +   N S  + +  I IV+G     +LL        I   ++F G LSN++DR             T   V DY   PF  + N   +N  D F+++ +I+
  S:    56 NRGVNFGLMAGDNGSNQFILAGIAIVVGAVMATILLGKRRVSHAIAGGMIFGGALSNVMDR------------LTFGYVFDYINTPFLGLTNPFSYNIADIFIVLPIIW 152
>gi|186681373|ref|YP_001864569.1| lipoprotein signal peptidase [Nostoc punctiforme PCC 73102] >gi|186463825|gb|ACC79626.1| lipoprotein signal peptidase [Nostoc punctiforme PCC 73102] (158 aa)
Score = 89, Expect = 3.0e-01, Identities = 46/165 (27%), Positives = 72/165 (43%)
  Q:    35 KKHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIP---GFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLD-IGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVK 199
           K  L W      I AFI      +T+  ++  T S  + +P   G        NTG +F  L      L +    + +VL    L   +  L D +G  L+  G + N IDR ++ +            VVD+  F  I +  +FN  D+F+ IG++F+   +I SF K
  S:     4 KNRLFW------IAAFIAFFLDQITKYWVVQ-TFSLGQTLPLLTGIFHFTYVTNTGAAFSLLSGKVEWLRWLSLGVSLVLIALALFGPTLNLWDQLGYGLILGGAMGNGIDRFVLGH------------VVDFLDFRLI-SFPVFNVADSFISIGIVFL---LIASFQK 149
>gi|149916551|ref|ZP_01905066.1| lipoprotein signal peptidase [Roseobacter sp. AzwK-3b] >gi|149809525|gb|EDM69384.1| lipoprotein signal peptidase [Roseobacter sp. AzwK-3b] (157 aa)
Score = 89, Expect = 3.0e-01, Identities = 41/150 (27%), Positives = 72/150 (48%)
  Q:    39 IWKISIILICAFIVL--LTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFF---VLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF--IKNSAIFNFPDTFVIIGMIF 188
           ++ +++  IC F++   +T +LT ++ L        ++   LV   + N GV+FG +   N S  + +  I IV+G     +LL        I   ++F G LSN++DR             T   V DY   PF  + N   +N  D F+++ +I+
  S:    10 VFVLAVTTICIFLLCQAITYYLTAHANLPVQVFSTPMLELNLVH--SENRGVNFGLMAGDNGSNQFILAGIAIVVGAVMATILLGKRRVSHAIAGGMIFGGALSNVMDR------------LTFGYVFDYINTPFLGLTNPFSYNIADIFIVLPIIW 152
>gi|154504403|ref|ZP_02041141.1| hypothetical protein RUMGNA_01907 [Ruminococcus gnavus ATCC 29149] >gi|153795332|gb|EDN77752.1| hypothetical protein RUMGNA_01907 [Ruminococcus gnavus ATCC 29149] (153 aa)
Score = 89, Expect = 3.1e-01, Identities = 42/128 (32%), Positives = 63/128 (49%)
  Q:    73 LIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYL--------LDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKD 200
           +IPG        N G +FG L   N  +V+ V ++ I   FF ++F    +        L +   L+  G + N+IDR +  NY           VVD+  F  I +  IFN  D +V+IG I  GI +I+ + KD
  S:    23 IIPGVFQFRYLENRGAAFGIL--QNRQIVFAVGALLI---FFAVVFIYGRIPQKRRFVPLRVCAILLASGAIGNLIDR-LARNY-----------VVDFCYFNLI-DFPIFNVADCYVVIGCILFGI-LILFYYKD 139
>gi|126738331|ref|ZP_01754052.1| lipoprotein signal peptidase [Roseobacter sp. SK209-2-6] >gi|126720828|gb|EBA17533.1| lipoprotein signal peptidase [Roseobacter sp. SK209-2-6] (161 aa)
Score = 89, Expect = 3.1e-01, Identities = 36/132 (27%), Positives = 59/132 (44%)
  Q:    72 ELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF-----SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF--IKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKK 203
           +++P FL      NTG++FG  G  +    + + ++P+ +   + L+     S   ++     LV  G L N++DR +   Y Y         V+D+       I N  +FN  D F     IF G   +I F    KK
  S:    38 DVLPPFLNFRYGENTGINFGLFGGGDEIGRWVLIALPLAICLGLALWAGRDASKGPVVHCSAGLVIGGALGNVVDRLL---YGY---------VLDFLNMSCCGINNPFVFNLADVF-----IFAGAAGLILFDNSSKK 159
>gi|195959238|ref|ZP_03095447.1| signal peptidase II [Borrelia sp. SV1] (170 aa)
Score = 89, Expect = 3.3e-01, Identities = 38/119 (31%), Positives = 58/119 (48%)
  Q:    70 YWELIPGFLVINITGNTGVSFGTLGDSNPSLV-YFVQSIPIVLGFFVLLFS---SNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF-----IKNSAIFNFPDTFVIIGMIF 188
           Y+     F  I    NTG+ F    + + SL  +F  ++PI +  FV   S    N +  I + L+F GG+ N+IDR           +   + VVD+    F     +     FNF D++V+IGMI 
  S:    39 YFSFFDDFFRIIHVRNTGILFSMGSNIHYSLKKFFFLAMPIFILIFVFYLSLKERNCIARISLLLIFSGGVGNVIDR-----------LFRPSGVVDFLDLKFYGIFGLDRWPTFNFADSYVVIGMIL 155
>gi|157825686|ref|YP_001493406.1| lipoprotein signal peptidase [Rickettsia akari str. Hartford] >gi|166232872|sp|A8GNC3|LSPA_RICAH Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|157799644|gb|ABV74898.1| lipoprotein signal peptidase [Rickettsia akari str. Hartford] (196 aa)
Score = 89, Expect = 3.3e-01, Identities = 38/138 (27%), Positives = 61/138 (44%)
  Q:    74 IPGFLVINITGNTGVSFGTLGD--SNPSLVYFVQSIPIVLGFFVLLFSSNYLLDI-GVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNS-AIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENK 211
           +  FL +  T N G+SFG + +     + ++ + +  IV   + L+  SN +    G S V  G + N+IDR                AV D+  F +   S  +FN  D F+ IG+I +        ++DY   K   E K
  S:    47 VTSFLNMVYTWNYGISFGLMREYYQYSNAIFLITNTLIVCYLYYLMIRSNTIGSFAGYSFVIGGAVGNLIDRCF------------RGAVFDFIHFHYHNYSFPVFNLADCFITIGVIIL--------IEDYDNTKKVIEEK 168
>gi|144227431|gb|AAZ44121.2| lipoprotein signal peptidase [Mycoplasma hyopneumoniae J] (197 aa)
Score = 89, Expect = 3.4e-01, Identities = 30/113 (26%), Positives = 55/113 (48%)
  Q:   100 LVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKK 212
             +F+ +I ++L    + FS  + L I ++ +  G   N IDR           I  NN V D    P++ +S  FNF D F+  G I + +  +I+F+K++   +  ++ K+
  S:    96 FAFFLTAILLIL----IPFSRKFSLTIFMATLLAGNWGNEIDR-----------ILNNNTVKDLLFLPYLPSSGTFNFADLFIFSGPIGIVLVHLINFLKNFDGRRMKKQPKE 193
>gi|194014837|ref|ZP_03053454.1| signal peptidase II [Bacillus pumilus ATCC 7061] >gi|194013863|gb|EDW23428.1| signal peptidase II [Bacillus pumilus ATCC 7061] (155 aa)
Score = 89, Expect = 3.7e-01, Identities = 43/161 (26%), Positives = 76/161 (47%)
  Q:    47 ICAFIVLLTSFLTRNSILNATQ--SYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLL---FSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIK-NSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDS 207
           I AF+++    LT+  I+        + +I GF  I    N+G ++G L        ++V ++ ++ G    L      + LL + ++L+  G + N IDR                 VVD+  F F   +  IFN  D+ + +G+I + IQ+++    D KK K+S
  S:     5 IIAFVMICLDQLTKWLIVKNMMPGDSYPVIDGFFYITSHRNSGAAWGIL--QGQMWFFYVITLVVIAGIVYYLQKHGQKDKLLGVALALMLGGAIGNFIDRVF------------RQEVVDFAHFVFGNYHYPIFNIADSSLCVGVILLFIQMLL----DGKKTKES 153
>gi|163846480|ref|YP_001634524.1| lipoprotein signal peptidase [Chloroflexus aurantiacus J-10-fl] >gi|187602982|ref|ZP_02989203.1| lipoprotein signal peptidase [Chloroflexus sp. Y-400-fl] >gi|163667769|gb|ABY34135.1| lipoprotein signal peptidase [Chloroflexus aurantiacus J-10-fl] >gi|187484880|gb|EDU22860.1| lipoprotein signal peptidase [Chloroflexus sp. Y-400-fl] (194 aa)
Score = 89, Expect = 3.7e-01, Identities = 33/110 (30%), Positives = 55/110 (50%)
  Q:    85 NTGVSFGTLGDSNP--SLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQII 194
           NTGV+FG   D     S+   +  + + L +  +L + +  + + V ++F GGLSN++DR I   Y           VVD+ QF +     +FN  D+ + IG+  +   II
  S:    54 NTGVAFGLFPDQGGVLSVGAGLVLLLLALTYQYILPADSRWITVAVGMIFGGGLSNLVDR-IRQGY-----------VVDFIQFGWW---PVFNLADSAITIGVAALAFHII 150
>gi|183602393|ref|ZP_02963759.1| possible lipoprotein signal peptidase [Bifidobacterium animalis subsp. lactis HN019] >gi|183218312|gb|EDT88957.1| possible lipoprotein signal peptidase [Bifidobacterium animalis subsp. lactis HN019] (168 aa)
Score = 88, Expect = 3.8e-01, Identities = 36/126 (28%), Positives = 62/126 (49%)
  Q:    70 YWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF----SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIII 195
           Y ++IP FL + +  N G S G   +S      +V S+  ++   VL++    +++    + ++L F G L N+IDR       Y  G   N  VVD+  + +    ++ N  D F++I     GI II+
  S:    31 YIQVIPRFLHLTLVHNPGASLGMGANST-----WVISLFAIVACCVLVWMAWRTTSMAWTVFLALAFAGALGNLIDR-----VAYAQGF-LNGKVVDFLNYGW----SVGNVADIFLMIA----GIGIIV 141
>gi|77920048|ref|YP_357863.1| lipoprotein signal peptidase [Pelobacter carbinolicus DSM 2380] >gi|123573563|sp|Q3A1R4|LSPA_PELCD Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|77546131|gb|ABA89693.1| signal peptidase II. Aspartic peptidase. MEROPS family A08 [Pelobacter carbinolicus DSM 2380] (161 aa)
Score = 88, Expect = 3.8e-01, Identities = 29/102 (28%), Positives = 52/102 (50%)
  Q:    41 KISIILICAFIVLLTSFLTRNSILNATQSYWEL--IPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLD-----IGVSLVFFGGLSNIIDR 142
           +  I+L+ A +V+    LT+  I+   + +  L  +P F  +    N G +FG L ++   + +F+ +  + +  F+  F   Y  D       VSLV  G + N+IDR
  S:     5 QFRILLLIATLVVAVDQLTKGLIVRCLKLHEALPVVPNFFDLVYVRNKGAAFGILANTEYRVPFFIITTSVAV-VFLAWFYRQYRPDQVLGRCAVSLVLGGAIGNLIDR 112
>gi|86139368|ref|ZP_01057937.1| lipoprotein signal peptidase [Roseobacter sp. MED193] >gi|85823871|gb|EAQ44077.1| lipoprotein signal peptidase [Roseobacter sp. MED193] (161 aa)
Score = 88, Expect = 4.0e-01, Identities = 29/114 (25%), Positives = 51/114 (44%)
  Q:    72 ELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF-----SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF--IKNSAIFNFPDTFVIIG 185
           +++P  L      NTG++FG  GD   S  + +  + + +   ++L+         L+ +   LV  G L N+ DR +   Y Y         V+D+       + N  +FN  D F+  G
  S:    38 DVLPPLLNFRYGENTGINFGLFGDGADSARWILIGLSLAICLALVLWVGRGHDKGGLMQVSAGLVIGGALGNVADRLL---YGY---------VLDFLNMSCCGLNNPYVFNLADVFIFAG 146
>gi|196185368|gb|EDX80344.1| signal peptidase II [Brevundimonas sp. BAL3] (168 aa)
Score = 88, Expect = 4.1e-01, Identities = 39/131 (29%), Positives = 57/131 (43%)
  Q:    70 YWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSN-YLLDIGVSLVFFGGLSNIIDR---SIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKD 200
           + E++P  L      NTGVSFG  G         + S+ +  G       SN  LL   +  V  G L N+IDR     V ++   SG            FP+     +FN  D+ + IG+I +   I+ SF+ D
  S:    46 FAEVLPPILRFTFVQNTGVSFGLFGGGEARWGLTIFSVIVSAGLAWWATQSNRRLLITAIGFVMGGALGNVIDRVRFGYVVDFIDFSGTGV---------FPW-----VFNIADSAITIGVILL---ILDSFLSD 163
>gi|72080373|ref|YP_287431.1| lipoprotein signal peptidase [Mycoplasma hyopneumoniae 7448] (175 aa)
Score = 88, Expect = 4.2e-01, Identities = 28/103 (27%), Positives = 51/103 (49%)
  Q:   110 VLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKK 212
           V+   ++ FS  + L I ++ +  G   N IDR           I  NN V D    P++ +S  FNF D F+  G I + +  +I+F+K++  ++  ++ K+
  S:    80 VILLILIPFSRKFSLTIFMATLLAGNWGNEIDR-----------ILNNNTVKDLLFLPYLPSSGTFNFADLFIFSGPIGIVLVHLINFLKNFDGKRMKKQPKE 171
>gi|157692225|ref|YP_001486687.1| lipoprotein signal peptidase [Bacillus pumilus SAFR-032] >gi|157680983|gb|ABV62127.1| A8 family signal peptidase II [Bacillus pumilus SAFR-032] (155 aa)
Score = 88, Expect = 4.3e-01, Identities = 43/161 (26%), Positives = 76/161 (47%)
  Q:    47 ICAFIVLLTSFLTRNSILNATQ--SYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLL---FSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIK-NSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDS 207
           I AF+++    LT+  I+        + +I GF  I    N+G ++G L        ++V ++ ++ G    L      + LL + ++L+  G + N IDR                 VVD+  F F   +  IFN  D+ + +G+I + IQ+++    D KK K+S
  S:     5 IIAFVMICLDQLTKWLIVKNMMLGDSYPVIDGFFYITSHRNSGAAWGIL--QGQMWFFYVITLVVIAGIVYYLQKHGQKDKLLGVALALMLGGAIGNFIDRVF------------RQEVVDFAHFVFGNYHYPIFNIADSSLCVGVILLFIQMLL----DGKKTKES 153
>gi|144575245|gb|AAZ53408.2| lipoprotein signal peptidase [Mycoplasma hyopneumoniae 7448] (197 aa)
Score = 88, Expect = 4.4e-01, Identities = 28/103 (27%), Positives = 51/103 (49%)
  Q:   110 VLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKK 212
           V+   ++ FS  + L I ++ +  G   N IDR           I  NN V D    P++ +S  FNF D F+  G I + +  +I+F+K++  ++  ++ K+
  S:   102 VILLILIPFSRKFSLTIFMATLLAGNWGNEIDR-----------ILNNNTVKDLLFLPYLPSSGTFNFADLFIFSGPIGIVLVHLINFLKNFDGKRMKKQPKE 193
>gi|54020317|ref|YP_115547.1| lipoprotein signal peptidase [Mycoplasma hyopneumoniae 232] >gi|53987490|gb|AAV27691.1| lipoprotein signal peptidase (prolipoprotein signal peptidase) (signal peptidase II) (spase II) [Mycoplasma hyopneumoniae 232] (199 aa)
Score = 88, Expect = 4.5e-01, Identities = 28/103 (27%), Positives = 51/103 (49%)
  Q:   110 VLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKK 212
           V+   ++ FS  + L I ++ +  G   N IDR           I  NN V D    P++ +S  FNF D F+  G I + +  +I+F+K++  ++  ++ K+
  S:   104 VILLILIPFSRKFSLTIFMATLLAGNWGNEIDR-----------ILNNNTVKDLLFLPYLPSSGTFNFADLFIFSGPIGIVLVHLINFLKNFDGKRMKKQPKE 195
>gi|195962305|ref|ZP_03098510.1| signal peptidase II [Borrelia spielmanii A14S] (170 aa)
Score = 88, Expect = 4.7e-01, Identities = 39/119 (32%), Positives = 57/119 (47%)
  Q:    70 YWELIPGFLVINITGNTGVSFGTLGDSNPSLV-YFVQSIPIVLGFFVLLFS---SNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF-----IKNSAIFNFPDTFVIIGMIF 188
           Y+     F  I    NTG+ F    + + SL   F   +PI +  FV   S    N +  I + L+F GG+ N+IDR           +   + VVD+  F F     +     FNF D++V+IGMI 
  S:    39 YFSFFDNFFRIIHVRNTGILFSMGSNIHYSLKKIFFLVMPIFILIFVFYLSLKEKNRIARISLLLIFSGGVGNVIDR-----------LFRPSGVVDFLDFKFYGIFGLDRWPTFNFADSYVVIGMIL 155
>gi|50914001|ref|YP_059973.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS10394] >gi|73920909|sp|Q5XCS3|LSPA_STRP6 Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|50903075|gb|AAT86790.1| Lipoprotein signal peptidase [Streptococcus pyogenes MGAS10394] (152 aa)
Score = 87, Expect = 4.9e-01, Identities = 39/156 (25%), Positives = 74/156 (47%)
  Q:    36 KHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDI----GVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGI 191
           K  ++ +S+IL+ A   L   ++  +  L   + +   IPG + +    N G +F  L D      +FV    +V+G+ +   +++  L+I     + L+  GG+ N IDR  +              V+D     F+ + AIFN  D+++ +G+I + I
  S:     2 KKRLFVLSLILLVALDQLSKFWIVSHIALGEVKPF---IPGIVSLTYLQNNGAAFSILQDQQ---WFFVAITVLVIGYAIYYLATHPHLNIWKQLALLLIISGGIGNFIDRLRL------------AYVIDMVHLDFV-DFAIFNVADSYLTVGVILLVI 142
>gi|150390557|ref|YP_001320606.1| lipoprotein signal peptidase [Alkaliphilus metalliredigens QYMF] >gi|149950419|gb|ABR48947.1| lipoprotein signal peptidase [Alkaliphilus metalliredigens QYMF] (147 aa)
Score = 87, Expect = 5.8e-01, Identities = 34/124 (27%), Positives = 55/124 (44%)
  Q:    73 LIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYL---LDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIIS 196
           +I  F  +    N G +FG L   N  + + + ++ IV+G    L+ +  L   + +G SL+  G + N+ DR  +              VVD+F F       +FN  D  V+ G I V   I+ S
  S:    34 IISNFFHLTYVENRGAAFGIL--QNQKVFFVIMTLSIVVGMLFYLYKNKDLPKPMKLGFSLIIAGAIGNLTDRLRL------------GYVVDFFDFRIF---PVFNIADMSVVFGAILVSYVILKS 143
>gi|56477954|ref|YP_159543.1| lipoprotein signal peptidase [Azoarcus sp. EbN1] >gi|56313997|emb|CAI08642.1| lipoprotein signal peptidase [Azoarcus sp. EbN1] (183 aa)
Score = 87, Expect = 6.0e-01, Identities = 34/144 (23%), Positives = 66/144 (45%)
  Q:    70 YWELIP--GFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNY----LLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNS-AIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEENKKP 213
           + E +P  GF  + +  N G +F  L D +    +F  ++ +V+  ++L    ++     L +  SL+  G + N+IDR +            + AVVD+  F   ++    FN  D+ + +G   V + +   F       +DS  ++ P
  S:    47 FGEAVPVTGFFQLVLVYNPGAAFSFLADHSGWQRWFFIALALVVCGWLLAMLRHHQHERALPLAFSLIIGGAVGNVIDRIV------------HGAVVDFLYFHIGRHGWPAFNVADSAITVG---VAVMLWAQFRSPRDASRDSSTSENP 182
>gi|149919703|ref|ZP_01908181.1| Peptidase A8, signal peptidase II [Plesiocystis pacifica SIR-1] >gi|149819474|gb|EDM78904.1| Peptidase A8, signal peptidase II [Plesiocystis pacifica SIR-1] (257 aa)
Score = 87, Expect = 6.2e-01, Identities = 35/122 (28%), Positives = 56/122 (45%)
  Q:    72 ELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSS-----NYLLDIGVSLVFFGGLSNIIDRSI-VDNY--KYLSGISTNNAVVDYFQFPFIKNS----AIFNFPDTFVIIGMIFVGIQI 193
           E++PG        NTG +F  L D+  +  +F+      L +   L S       Y   + V L+  G   N+ DR + VD    K        + VVD+ QF +  N      IFN  D+ ++ G+  + I +
  S:    67 EVVPGIFFFKYGFNTGAAFSFLRDATWARTFFITVTFAALAYMGYLASQMPTKRAYGF-VAVGLIAAGAAGNLHDRFVRVDTVWDKAAGAFVEKHGVVDFLQFYYPWNPEKYWPIFNVADSALVCGVFLLLIYL 199
>gi|144898683|emb|CAM75547.1| Lipoprotein signal peptidase [Magnetospirillum gryphiswaldense MSR-1] (171 aa)
Score = 87, Expect = 6.3e-01, Identities = 37/120 (30%), Positives = 57/120 (47%)
  Q:    70 YWELIPGFLVINITGNTGVSFGTLGDSNP--SLVYFVQSIPIVLGFFVLL-FSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQF-PFIKNSAIFNFPDTFVIIGMIFV 189
           + E+ P F ++ +T N GVSFG   +  P  ++   V SI IV G  V L  + N L+ + +  +  G L N+IDR            +   AV D+     F  +   FN  D+ + IG I +
  S:    47 FIEVTPFFNLV-MTWNRGVSFGIFNNGGPWNAVALSVLSIVIVAGLLVWLKRADNGLMALALGSIIGGALGNVIDR------------ARWGAVADFLDVHAFGWHWPAFNLADSAITIGAILL 157
>gi|171912970|ref|ZP_02928440.1| lipoprotein signal peptidase [Verrucomicrobium spinosum DSM 4136] (166 aa)
Score = 86, Expect = 6.3e-01, Identities = 32/114 (28%), Positives = 49/114 (42%)
  Q:    72 ELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNY----LLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQF----PFIKNSAIFNFPDTFVIIG 185
           E+I  F  ++   NTGV+FG+      S   F     + LGFF+  +   +    L  + ++L+  G   N  DR I  +            VVD+  F    P       FN  D+ V+I 
  S:    35 EVIENFFTLHYIDNTGVAFGSFNGGEYSNYIFGGIALVALGFFIWAYRKGFFPGLLNRVAIALIVAGVCGNFTDRLIYHH------------VVDFLSFDLHLPMASPWPSFNVADSCVVIA 144
>gi|163764828|ref|ZP_02171881.1| cytochrome oxidase assembly [Bacillus selenitireducens MLS10] >gi|160354722|gb|EDP81382.1| cytochrome oxidase assembly [Bacillus selenitireducens MLS10] (155 aa)
Score = 86, Expect = 6.5e-01, Identities = 41/137 (29%), Positives = 67/137 (48%)
  Q:    72 ELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF----SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQ-FPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSE 208
           ELI GFL +    N G +FG L       ++++ ++ IV+G  V +       +    I + LV  G + N IDR +               VVD+   F F  N  IFN  D+ ++IG   VG+ ++I F+ + K++  S+
  S:    33 ELISGFLYLTSHRNAGAAFGIL--QGQMWLFYIATV-IVVGVIVYMIITQAKESRFFGISLGLVLGGAIGNFIDRLL------------EGEVVDFIDVFIFTYNFPIFNVADSALVIG---VGL-MMIYFILEEKRQGTSK 155
>gi|83855199|ref|ZP_00948729.1| lipoprotein signal peptidase [Sulfitobacter sp. NAS-14.1] >gi|83843042|gb|EAP82209.1| lipoprotein signal peptidase [Sulfitobacter sp. NAS-14.1] (169 aa)
Score = 86, Expect = 6.8e-01, Identities = 29/116 (25%), Positives = 55/116 (47%)
  Q:    72 ELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLL----DIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF--IKNSAIFNFPDTFVIIGMI 187
           +++P  +      N G++FG  GD + +  + +  +   +   VL+++S   +    +I   L+  G L+N++DR I   Y Y         V+D+       I N  +FN  D F+  G +
  S:    35 DVLPPLINFRYGENRGINFGLFGDGSDASRWILIGLACAICVGVLIWASRQTMSLWANISAGLLIGGALANVVDRLI---YGY---------VLDFLNMSCCGINNPFVFNIADVFIFAGAL 144
>gi|116494945|ref|YP_806679.1| lipoprotein signal peptidase [Lactobacillus casei ATCC 334] >gi|191638455|ref|YP_001987621.1| Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) [Lactobacillus casei] >gi|116105095|gb|ABJ70237.1| Lipoprotein signal peptidase [Lactobacillus casei ATCC 334] >gi|190712757|emb|CAQ66763.1| Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) [Lactobacillus casei BL23] (154 aa)
Score = 86, Expect = 6.8e-01, Identities = 43/151 (28%), Positives = 71/151 (47%)
  Q:    44 IILICAFIVLLTSFLTRNSI-----LNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNY---LLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKN---SAIFNFPDTFVIIGMIFVGIQII 194
           I LI A  ++L  FL +  +     L  +Q   +LIPG + +    NTG +F           +F  +  +  G   +L+  +    +  +G++L+  G + N IDR     ++Y         V D F   F+     +AIFNF D  +  G+I V I I+
  S:     3 IYLIIAAALVLIDFLIKAWVTAHIPLGESQ---QLIPGVIDLTHIRNTGAAFSMFEGKQ---WFFYITTLLAFGVVAMLWRDSLHKPIYRLGLTLITAGAIGNFIDRL---RFQY---------VTDMFHLEFLDQWRFNAIFNFADMCITFGVILVLIFIL 146
>gi|75676727|ref|YP_319148.1| peptidase A8, signal peptidase II [Nitrobacter winogradskyi Nb-255] >gi|74421597|gb|ABA05796.1| peptidase A8, signal peptidase II [Nitrobacter winogradskyi Nb-255] (165 aa)
Score = 86, Expect = 7.2e-01, Identities = 30/111 (27%), Positives = 57/111 (51%)
  Q:    77 FLVINITGNTGVSFGTLGDSNP---SLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDY--FQFPFIKNS---AIFNFPDTFVIIGMI 187
           F  + +  NTG+S+G     +P   +++  V+++ +VL    +  S  ++  IG+ L+  G + N IDR     + Y        AV+D+  F   +   +    IFN  D  +++G+I
  S:    43 FFDLVLAWNTGISYGWFQTDSPVGAAVLLVVKALAVVLLAVWMARSHTHMATIGLGLIIGGAIGNAIDR-----FAY-------GAVMDFALFHLQYAGQTYSWYIFNLADVAIVVGVI 149
>gi|25011478|ref|NP_735873.1| hypothetical protein gbs1436 [Streptococcus agalactiae NEM316] >gi|76787896|ref|YP_330007.1| signal peptidase II [Streptococcus agalactiae A909] >gi|77408215|ref|ZP_00784959.1| lipoprotein signal peptidase [Streptococcus agalactiae COH1] >gi|77412099|ref|ZP_00788424.1| lipoprotein signal peptidase [Streptococcus agalactiae CJB111] >gi|81845590|sp|Q8E4G5|LSPA_STRA3 Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|123601591|sp|Q3K0E6|LSPA_STRA1 Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|24413016|emb|CAD47095.1| Unknown [Streptococcus agalactiae NEM316] >gi|76562953|gb|ABA45537.1| signal peptidase II [Streptococcus agalactiae A909] >gi|77161855|gb|EAO72841.1| lipoprotein signal peptidase [Streptococcus agalactiae CJB111] >gi|77173156|gb|EAO76281.1| lipoprotein signal peptidase [Streptococcus agalactiae COH1] (154 aa)
Score = 86, Expect = 7.5e-01, Identities = 36/122 (29%), Positives = 57/122 (46%)
  Q:    72 ELIPGFLVINITGNTGVSFGTLGDSN---PSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQI 193
           E IP  + +    N G +F  L +       +  FV  + I+  + +   + +Y L I ++L+  GGL N IDR  +              VVD     FI N AIFN  D+++ IG+I + I +
  S:    35 EFIPNIVSLTYLRNYGAAFSILQNQQWLFTLITIFVVCVAII--YLMKHINGSYWLLISLTLIISGGLGNFIDRLRL------------GYVVDMVHLDFI-NFAIFNVADSYLTIGIICLMIAL 144
>gi|149374348|ref|ZP_01892122.1| Lipoprotein signal peptidase [Marinobacter algicola DG893] >gi|149361051|gb|EDM49501.1| Lipoprotein signal peptidase [Marinobacter algicola DG893] (178 aa)
Score = 86, Expect = 7.9e-01, Identities = 37/139 (26%), Positives = 63/139 (45%)
  Q:    72 ELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF---SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIK-NSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKEKDSEEN 210
           E+ P F  +++  N G +     DS+    YF  +I IV+   ++     S      +  ++V  G L N+IDR +   Y           VVDY  F +   +   FN  D F+++GMI +   + +SF  +    K  E++
  S:    42 EITPFFNWVHVW-NEGAALSLFADSSGWQRYFFIAIAIVVSVVLVKLIQDSRQRAEALACAMVLGGALGNVIDR-VFRGY-----------VVDYLDFHWQSWHWPAFNLADVFIVLGMIMI---LAMSFRANKSPNKQVEDS 168
>gi|22537513|ref|NP_688364.1| lipoprotein signal peptidase [Streptococcus agalactiae 2603V/R] >gi|76797716|ref|ZP_00779984.1| lipoprotein signal peptidase [Streptococcus agalactiae 18RS21] >gi|77406373|ref|ZP_00783434.1| lipoprotein signal peptidase [Streptococcus agalactiae H36B] >gi|77414615|ref|ZP_00790755.1| lipoprotein signal peptidase [Streptococcus agalactiae 515] >gi|81845410|sp|Q8DYV7|LSPA_STRA5 Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|22534393|gb|AAN00237.1|AE014254_17 lipoprotein signal peptidase [Streptococcus agalactiae 2603V/R] >gi|76586940|gb|EAO63430.1| lipoprotein signal peptidase [Streptococcus agalactiae 18RS21] >gi|77159328|gb|EAO70499.1| lipoprotein signal peptidase [Streptococcus agalactiae 515] >gi|77174997|gb|EAO77805.1| lipoprotein signal peptidase [Streptococcus agalactiae H36B] (154 aa)
Score = 86, Expect = 7.9e-01, Identities = 36/122 (29%), Positives = 57/122 (46%)
  Q:    72 ELIPGFLVINITGNTGVSFGTLGDSN---PSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQI 193
           E IP  + +    N G +F  L +       +  FV  + I+  + +   + +Y L I ++L+  GGL N IDR  +              VVD     FI N AIFN  D+++ IG+I + I +
  S:    35 EFIPNIVSLTYLRNYGAAFSILQNQQWLFTLITIFVVGVAII--YLMKHINGSYWLLISLTLIISGGLGNFIDRLRL------------GYVVDMVHLDFI-NFAIFNVADSYLTIGIICLMIAL 144
>gi|19703420|ref|NP_602982.1| lipoprotein signal peptidase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|81848297|sp|Q8RH46|LSPA_FUSNN Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|19713492|gb|AAL94281.1| Lipoprotein signal peptidase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (165 aa)
Score = 86, Expect = 7.9e-01, Identities = 40/132 (30%), Positives = 66/132 (50%)
  Q:    63 ILNATQSYWELIP---GFLVINITGNTGVSFGTL-GDSNPSLVYFVQSIPIVLGFFVLLFSS-NYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQII 194
           I+++T S  E +P   GF  +    N GV+FG   G  +   +  V +I ++L +F   F   ++L  I  +++F G + N+IDR                 VVD   F  I  S IFNF D ++ IG++ + ++ I
  S:    33 IVDSTLSVGETVPVIDGFFNLTYVQNRGVAFGLFQGKIDIVSILAVIAIGLILFYFCKNFKKISFLERIAYTMIFSGAIGNMIDRLF------------RAYVVDMLDFRGIW-SFIFNFADVWINIGVVLIIVEHI 156
>gi|189218022|ref|YP_001938664.1| Lipoprotein signal peptidase [Methylokorus infernorum V4] >gi|189184880|gb|ACD82065.1| Lipoprotein signal peptidase [Methylacidiphilum infernorum V4] (145 aa)
Score = 86, Expect = 8.1e-01, Identities = 40/123 (32%), Positives = 63/123 (51%)
  Q:    63 ILNATQSYW-----------ELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVL---LFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIG 185
           +L+ T  YW            +IPGFL +    NTG++FG    +N     F   + I++GFF     +F +   + IG +++F G L N IDR I        G  T+   V +F + +      FN  DT++ +G
  S:     2 LLDLTTKYWISSFLEVSYDRTIIPGFLDLVYVENTGIAFGLFAGNNRFWEVFTLLL-ILIGFFYFRKKIFKTIPYMVIG-AMIFAGALGNGIDRII-------HGHVTDFIDVHFFNYHW----PAFNLADTYLTLG 125
>gi|163744100|ref|ZP_02151466.1| lipoprotein signal peptidase [Phaeobacter gallaeciensis 2.10] >gi|161382647|gb|EDQ07050.1| lipoprotein signal peptidase [Phaeobacter gallaeciensis 2.10] (160 aa)
Score = 86, Expect = 8.1e-01, Identities = 34/153 (22%), Positives = 69/153 (45%)
  Q:    33 LNKKHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLF-----SSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF--IKNSAIFNFPDTFVIIG 185
           +  K +IW   + L+   I   + +L    +  A +   +++P  L      NTG++FG  G    +  + +  + +V+   ++++     ++  ++ +   LV  G L N++DR +   Y Y         V+D+       I N  +FN  D F+  G
  S:     1 MRAKVMIWAAILALLADQI---SKYLVVRVMDVANRGGIDVLPPLLRFRYGENTGINFGLFGGGTDTTRWILIGLSLVICVVLVIWIARLPANARMMQLSAGLVIGGALGNVVDRLL---YGY---------VLDFLNMSCCGINNPFVFNVADIFIFAG 145
>gi|195942051|ref|ZP_03087433.1| signal peptidase II [Borrelia burgdorferi 80a] (170 aa)
Score = 86, Expect = 8.2e-01, Identities = 38/119 (31%), Positives = 57/119 (47%)
  Q:    70 YWELIPGFLVINITGNTGVSFGTLGDSNPSLV-YFVQSIPIVLGFFVLLFS---SNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF-----IKNSAIFNFPDTFVIIGMIF 188
           Y+     F  I    NTG+ F    + + SL   F  ++PI +  FV   S    N +  I + L+F GG+ N+IDR           +   + VVD+    F     +     FNF D++V+IGMI 
  S:    39 YFSFFDDFFRIIHVRNTGILFSMGSNIHYSLKKIFFLAMPIFILIFVFYLSLKERNCIARISLLLIFSGGVGNVIDR-----------LFRPSGVVDFLDLKFYGIFGLDRWPTFNFADSYVVIGMIL 155
>gi|83941721|ref|ZP_00954183.1| lipoprotein signal peptidase [Sulfitobacter sp. EE-36] >gi|83847541|gb|EAP85416.1| lipoprotein signal peptidase [Sulfitobacter sp. EE-36] (169 aa)
Score = 85, Expect = 8.3e-01, Identities = 29/116 (25%), Positives = 55/116 (47%)
  Q:    72 ELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLL----DIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF--IKNSAIFNFPDTFVIIGMI 187
           +++P  +      N G++FG  GD + +  + +  +   +   VL+++S   +    +I   L+  G L+N++DR I   Y Y         V+D+       I N  +FN  D F+  G +
  S:    35 DVLPPLINFRYGENRGINFGLFGDGSDASRWILIGLACAICVGVLIWASRQTMSLWANISAGLLIGGALANVVDRLI---YGY---------VLDFLNMSCCGINNPFVFNIADIFIFAGAL 144
>gi|90961802|ref|YP_535718.1| lipoprotein signal peptidase [Lactobacillus salivarius UCC118] >gi|122449056|sp|Q1WTX7|LSPA_LACS1 Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|90820996|gb|ABD99635.1| Lipoprotein signal peptidase [Lactobacillus salivarius UCC118] (148 aa)
Score = 85, Expect = 8.4e-01, Identities = 40/132 (30%), Positives = 59/132 (44%)
  Q:    73 LIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIV----LGFFVLLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQIIISFVKDYKKE 204
           ++P  L +    N G ++  L        +F   I IV    +G+F     S+ L  + +SL+  G L N IDR  +              VVD F+  F+ N  IFN  D  +  G+I V    II+ +KD K E
  S:    34 ILPNVLALTNVRNDGAAWSVLSGQQ----WFFTVITIVALGLMGYFFWKLRSDNLYMLAISLLIAGTLGNFIDRIRL------------GYVVDMFETLFM-NFPIFNVADMCLTFGVIIV----IIALIKDEKDE 148
>gi|19745905|ref|NP_607041.1| putative prolipoprotein signal peptidase [Streptococcus pyogenes MGAS8232] >gi|139473996|ref|YP_001128712.1| lipoprotein signal peptidase [Streptococcus pyogenes str. Manfredo] >gi|73920910|sp|Q8P1G4|LSPA_STRP8 Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|152032579|sp|A2RF66|LSPA_STRPG Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|19748059|gb|AAL97540.1| putative prolipoprotein signal peptidase [Streptococcus pyogenes MGAS8232] >gi|134272243|emb|CAM30495.1| lipoprotein signal peptidase [Streptococcus pyogenes str. Manfredo] (152 aa)
Score = 85, Expect = 8.8e-01, Identities = 39/156 (25%), Positives = 74/156 (47%)
  Q:    36 KHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDI----GVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGI 191
           K  ++ +S+IL+ A   L   ++  +  L   + +   IPG + +    N G +F  L D      +FV    +V+G+ +   +++  L+I     + L+  GG+ N IDR  +              V+D     F+ + AIFN  D+++ +G+I + I
  S:     2 KKRLFVLSLILLVALDQLSKFWIVSHIALGEVKPF---IPGIVSLTYLQNNGAAFSILQDQQ---WFFVVITVLVIGYAIYYLATHPHLNIWKQLALLLIISGGIGNFIDRLRL------------AYVIDMIHLDFV-DFAIFNVADSYLTVGVILLVI 142
>gi|195960107|ref|ZP_03096312.1| signal peptidase II [Borrelia burgdorferi 64b] (170 aa)
Score = 85, Expect = 9.0e-01, Identities = 38/119 (31%), Positives = 57/119 (47%)
  Q:    70 YWELIPGFLVINITGNTGVSFGTLGDSNPSLV-YFVQSIPIVLGFFVLLFS---SNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF-----IKNSAIFNFPDTFVIIGMIF 188
           Y+     F  I    NTG+ F    + + SL   F  ++PI +  FV   S    N +  I + L+F GG+ N+IDR           +   + VVD+    F     +     FNF D++V+IGMI 
  S:    39 YFSFFDDFFRIIHVRNTGILFSMGSNIHYSLKKIFFLAMPIFILIFVFYLSLKERNCIARISLLLIFSGGVGNVIDR-----------LFRPSGVVDFLDLKFYGIFGLDRWPTFNFADSYVVIGMIL 155
>gi|170781581|ref|YP_001709913.1| putative signal peptidase [Clavibacter michiganensis subsp. sepedonicus] >gi|169156149|emb|CAQ01290.1| putative signal peptidase [Clavibacter michiganensis subsp. sepedonicus] (200 aa)
Score = 85, Expect = 9.4e-01, Identities = 30/103 (29%), Positives = 47/103 (45%)
  Q:    85 NTGVSFGTLGDSNPSLVYFVQSIPIVLGFFV---LLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMI 187
           N GVSFG   +  P L   + ++ + L  +V   +   ++ L  + +S V  G L N+ DR        LSG   +   V++F        A+FN  D   + GMI
  S:    63 NPGVSFGMGAEVGPLLTVGIMALALGLAVWVGWQIRHRASLLQVLLLSAVLAGALGNLFDRITRAEDGPLSGHVVDFIAVEWF--------AVFNVADILTVCGMI 160
>gi|148273239|ref|YP_001222800.1| putative lipoprotein signal peptidase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147831169|emb|CAN02121.1| putative lipoprotein signal peptidase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (204 aa)
Score = 85, Expect = 9.4e-01, Identities = 30/103 (29%), Positives = 47/103 (45%)
  Q:    85 NTGVSFGTLGDSNPSLVYFVQSIPIVLGFFV---LLFSSNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMI 187
           N GVSFG   +  P L   + ++ + L  +V   +   ++ L  + +S V  G L N+ DR        LSG   +   V++F        A+FN  D   + GMI
  S:    63 NPGVSFGMGAEVGPLLTVGIMALALGLAVWVGWQIRHRASLLQVLLLSAVLAGALGNLFDRITRAEDGPLSGHVVDFIAVEWF--------AVFNVADILTVCGMI 160
>gi|15674864|ref|NP_269038.1| putative prolipoprotein signal peptidase [Streptococcus pyogenes M1 GAS] >gi|71910450|ref|YP_282000.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS5005] >gi|73920911|sp|Q9A0D2|LSPA_STRP1 Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|13622000|gb|AAK33759.1| putative prolipoprotein signal peptidase [Streptococcus pyogenes M1 GAS] >gi|71853232|gb|AAZ51255.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS5005] (152 aa)
Score = 85, Expect = 9.4e-01, Identities = 39/156 (25%), Positives = 74/156 (47%)
  Q:    36 KHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDI----GVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGI 191
           K  ++ +S+IL+ A   L   ++  +  L   + +   IPG + +    N G +F  L D      +FV    +V+G+ +   +++  L+I     + L+  GG+ N IDR  +              V+D     F+ + AIFN  D+++ +G+I + I
  S:     2 KKRLFVLSLILLVALDQLSKFWIVSHIALGEVKPF---IPGIVSLTYLQNNGAAFSILQDQQ---WFFVVITVLVIGYAIYYLATHPHLNIWKQLALLLIISGGIGNFIDRLRL------------AYVIDMIHLDFV-DFAIFNVADSYLTVGVILLLI 142
>gi|126700217|ref|YP_001089114.1| lipoprotein signal peptidase [Clostridium difficile 630] >gi|168716043|ref|ZP_02748320.1| lipoprotein signal peptidase [Clostridium difficile QCD-63q42] >gi|196126744|ref|ZP_03118493.1| lipoprotein signal peptidase [Clostridium difficile ATCC 43255] >gi|122973641|sp|Q182T8|LSPA_CLOD6 Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|115251654|emb|CAJ69487.1| lipoprotein signal peptidase [Clostridium difficile 630] (148 aa)
Score = 85, Expect = 9.5e-01, Identities = 33/110 (30%), Positives = 52/110 (47%)
  Q:    85 NTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLD-IGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGIQII 194
           N G +FG L  +N  +   V  +  V G + L     ++   +G+ L+  G L N+IDR  +              VVDYF F  I    +FN  D FV++G +F+ I ++
  S:    45 NRGAAFGLL-QNNQWIFIIVALLATVFGLYYLNTRKVHIFGRLGIILIISGALGNLIDRVRL------------GFVVDYFDFRIIW-EYVFNIADVFVVVGTVFLCIYVL 141
>gi|195950935|ref|ZP_03092032.1| signal peptidase II [Borrelia burgdorferi 29805] (170 aa)
Score = 85, Expect = 9.8e-01, Identities = 38/119 (31%), Positives = 57/119 (47%)
  Q:    70 YWELIPGFLVINITGNTGVSFGTLGDSNPSLV-YFVQSIPIVLGFFVLLFS---SNYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPF-----IKNSAIFNFPDTFVIIGMIF 188
           Y+     F  I    NTG+ F    + + SL   F  ++PI +  FV   S    N +  I + L+F GG+ N+IDR           +   + VVD+    F     +     FNF D++V+IGMI 
  S:    39 YFSFFDDFFRIIHVRNTGILFSMGSNIHYSLKKIFFLAMPIFILIFVFYLSLKERNCITRISLLLIFSGGVGNVIDR-----------LFRPSGVVDFLDLKFYGIFGLDRWPTFNFADSYVVIGMIL 155
>gi|21910092|ref|NP_664360.1| putative prolipoprotein signal peptidase [Streptococcus pyogenes MGAS315] >gi|28896210|ref|NP_802560.1| putative prolipoprotein signal peptidase [Streptococcus pyogenes SSI-1] >gi|71903283|ref|YP_280086.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS6180] >gi|94988323|ref|YP_596424.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS9429] >gi|94992200|ref|YP_600299.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS2096] >gi|94994122|ref|YP_602220.1| Lipoprotein signal peptidase [Streptococcus pyogenes MGAS10750] >gi|73920908|sp|Q8K7Y7|LSPA_STRP3 Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|123640097|sp|Q48U75|LSPA_STRPM Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|148887162|sp|Q1JCF3|LSPA_STRPB Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|148887163|sp|Q1JMD2|LSPA_STRPC Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|148887165|sp|Q1J798|LSPA_STRPF Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) >gi|21904283|gb|AAM79163.1| putative prolipoprotein signal peptidase [Streptococcus pyogenes MGAS315] >gi|28811461|dbj|BAC64393.1| putative prolipoprotein signal peptidase [Streptococcus pyogenes SSI-1] >gi|71802378|gb|AAX71731.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS6180] >gi|94541831|gb|ABF31880.1| lipoprotein signal peptidase [Streptococcus pyogenes MGAS9429] >gi|94545708|gb|ABF35755.1| Lipoprotein signal peptidase [Streptococcus pyogenes MGAS2096] >gi|94547630|gb|ABF37676.1| Lipoprotein signal peptidase [Streptococcus pyogenes MGAS10750] (152 aa)
Score = 85, Expect = 9.9e-01, Identities = 39/156 (25%), Positives = 74/156 (47%)
  Q:    36 KHLIWKISIILICAFIVLLTSFLTRNSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSSNYLLDI----GVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDTFVIIGMIFVGI 191
           K  ++ +S+IL+ A   L   ++  +  L   + +   IPG + +    N G +F  L D      +FV    +V+G+ +   +++  L+I     + L+  GG+ N IDR  +              V+D     F+ + AIFN  D+++ +G+I + I
  S:     2 KKRLFVLSLILLVALDQLSKFWIVSHIALGEVKPF---IPGIVSLTYLQNNGAAFSILQDQQ---WFFVVITVLVIGYAIYYLATHPHLNIWKQLALLLIISGGIGNFIDRLRL------------AYVIDMVHLDFV-DFAIFNVADSYLTVGVILLVI 142