>gi|26553587|ref|NP_757521.1| lytB protein [Mycoplasma penetrans HF-2] >gi|50401052|sp|Q8EWR9|ISPH_MYCPE 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|26453593|dbj|BAC43925.1| lytB protein [Mycoplasma penetrans HF-2] (299 aa)
Score = 1397, Expect = 1.1e-152, Identities = 299/299 (100%), Positives = 299/299 (100%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAND 299
           MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAND
  S:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAND 299
>gi|51892048|ref|YP_074739.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Symbiobacterium thermophilum IAM 14863] >gi|71152196|sp|Q67QZ8|ISPH_SYMTH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|51855737|dbj|BAD39895.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase [Symbiobacterium thermophilum IAM 14863] (295 aa)
Score = 547, Expect = 4.1e-54, Identities = 116/292 (39%), Positives = 181/292 (61%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK--YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIK-KQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M++IKITPRG+C GVV A    +++A+  PN  +  Y++G +VHN+ +++E+E LG+ T D +        D + + +K +   VIF+AHG       +AREKGL V D TC  VT+TH+LI E + +GY++ YIG   HPE    + +    + L+E   D+E +     + + VTNQTT+S ++ + + E +K+++   E  N+IC A + RQ+AV  M  E DL++VVGD +SNNS +LV++  +    E+HL+ + + I   W   K+ +A+TSG STPT +   VI FLEK
  S:     1 MEVIKITPRGYCHGVVGAIQLVRRVAR-DPNVPRPIYVLGQIVHNRHVVEEMEALGVITLDGE--------DRLSLLEKIDAGTVIFTAHGVSPAVKIRAREKGLYVVDATCPDVTRTHELIAELVSRGYEVIYIGKKGHPEPEGAVGVAPGHVHLVERAEDLEALSFAPGQKLAVTNQTTLSQWDTQALMEQVKARWPQTEIYNEICLATQQRQEAVARMAPEADLVIVVGDRRSNNSNRLVQVAQELAAREAHLVDSVEEIDPAWLKGKRKVAVTSGASTPTHITRAVIEFLEK 287
>gi|110004385|emb|CAK98723.1| probable 4-hydroxy-3-methylbut-2-enyl diphosphate reductase protein [Spiroplasma citri] (293 aa)
Score = 516, Expect = 1.4e-50, Identities = 123/292 (42%), Positives = 191/292 (65%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQ-GYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENI--RTESEKPIFVTNQTTISIYEFEEITETLKSKYKN-IEFKNDICNAAKDRQDAVINM-PSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           MK++K+TPRG+C GVV +    K+ A  Y   + Y++G+LVHNK +I E+  LG+   +D   +R E+I ++      +  +VI SAHG+D +  D A +K + + DT C +VT T +LIKE + +  YQI +IG + HPET + L++  +I L+ T  ++ +I    +  K I +TNQTT+S  + E I E LK+   N I FKND+CNA  +RQ+AV+++ P+ +DLLLVVGD +S+N+ KLV +G +  IES+ I +  +I+  W  NK C+A+T+G STP+ +   VI +LE+
  S:     1 MKVVKVTPRGYCLGVVKSIKWAKEAAIKYAGRQIYMLGYLVHNKHVIDEIVNLGVIPVNDFKLNRLELIQTLP-----DNAVVILSAHGSDDRIKDVAVQKNITLVDTECEWVTVTKNLIKEYLAKPDYQIIFIGKHFHPETNAMLALSPTINLVTTEQEVVSILPNLDPTKKILITNQTTLSKIDIEAIVEKLKTLVPNEIIFKNDLCNATLERQNAVLSLDPTTIDLLLVVGDERSSNTLKLVAMGEQIGIESYRINDKSDIQPTWLANKTCVAVTAGASTPSIIQLEVIRYLEQ 292
>gi|152976720|ref|YP_001376237.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189045804|sp|A7GSY4|ISPH_BACCN 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|152025472|gb|ABS23242.1| hydroxymethylbutenyl pyrophosphate reductase [Bacillus cereus subsp. cytotoxis NVH 391-98] (315 aa)
Score = 495, Expect = 4.1e-48, Identities = 121/292 (41%), Positives = 172/292 (58%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIA--KLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIK-KQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           MKIIKI+PRG+C GVVDA    +  A  K  P    Y++G +VHNK +    EE GI T D    SR EI+D I+         VIF+AHG   +   +A+EKGL   D TC  VTKTHDLI+ K  +GY + YIG   HPE    + I   I+ LIE  +D++ +   ++K I VTNQTT+S ++ + + E +K K+   EF  +IC A + RQ+AV       DL +VVGD KSNNS +L ++  +    +++ + +   I+ EW    + +A+T+G STPT +   VI FLE+
  S:     1 MKIIKISPRGYCYGVVDAMVIARNAALDKSLP-RPIYILGMIVHNKHVTDAFEEDGIITLDGP--SRLEILDQID------SGTVIFTAHGVSPEVKQRAKEKGLTTIDATCPDVTKTHDLIEAKKSEGYHVIYIGKKGHPEPEGAVGIAPDIVHLIEKADDLKTLEIPTDK-ILVTNQTTMSQWDVQHLMEDIKKKFPTAEFHKEICLATQVRQEAVAKQADVADLTIVVGDPKSNNSNRLAQVSQEIAGTKAYRVADVSEIQLEWLQGVEAVAVTAGASTPTPITKEVIAFLEQ 286
>gi|15613945|ref|NP_242248.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus halodurans C-125] >gi|20138759|sp|Q9KD37|ISPH_BACHD 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|10173998|dbj|BAB05101.1| penicillin tolerance protein [Bacillus halodurans C-125] (314 aa)
Score = 492, Expect = 1.0e-47, Identities = 116/292 (39%), Positives = 175/292 (59%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI---ESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M ++KI+PRG+C GVVDA    ++ A+ L      Y++G +VHNK +    EE GI + D  N      +D ++  DK     VIF+AHG   +    A+EKGL V D TC  VT+THDLI+EK ++GY+  Y+G   HPE    + +    + L+E V D+E++   ++K I +TNQTT+S ++  EI +    KY   E  N+IC A + RQ+AV     E DL++VVGD KSNNS +L +  + +QI   +++ I +   ++ EWF   + + +T+G STPT +   VI F+EK
  S:     1 MNVVKISPRGYCYGVVDAMVLARQAAQNLDLPRPIYILGMIVHNKHVTDAFEEEGIISLDGPNR-----LDILKQVDKGT---VIFTAHGVSPQVRKLAKEKGLTVVDATCPDVTRTHDLIREKSQEGYKFIYVGKKGHPEPEGAIGVAPEFVHLVENVEDVESLDISADK-IIITNQTTMSQWDVSEIMKKAMEKYPQAEVHNEICLATQVRQEAVAEQARECDLVIVVGDPKSNNSNRLAQ--VSEQIAGTKAYRIGDVTELQQEWFDGVETVGVTAGASTPTPITKEVIAFIEK 286
>gi|89100486|ref|ZP_01173348.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus sp. NRRL B-14911] >gi|89084829|gb|EAR63968.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus sp. NRRL B-14911] (313 aa)
Score = 490, Expect = 1.4e-47, Identities = 121/292 (41%), Positives = 176/292 (60%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK--YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI-DKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIK-KQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M ++KI+PRG+C GVVDA    +  A L  N  +  Y++G +VHNK +    EE GI T D +N  R +II+ +   DK     VIF+AHG   +  + A+ KGLV  D TC  VT+THDLI+EK  +GYQI YIG   HPE    L +   ++ L++T  D+  +  +S K I VTNQTT+S ++   + + +K KY + EF  +IC A + RQ+AV     E D+L+VVGD KSNNS +L ++  +     ++ I +   +K EW  + K  A+T+G STPT +   VI FL++
  S:     1 MDVLKISPRGYCYGVVDAMVIARN-AALDKNLPRPIYILGMIVHNKHVTDAFEEEGIITLDGEN--RKDIIEKV---DKGT---VIFTAHGVSPEIREIAKSKGLVTIDATCPDVTRTHDLIREKDAEGYQIIYIGKKGHPEPEGALGVAPHAVSLVQTAEDVGKLTLDSSK-IIVTNQTTMSQWDVVTVMDKIKEKYPHAEFHKEICMATQVRQEAVAEQAGEADVLIVVGDPKSNNSNRLAQVSEEIAGTTAYRIADLSELKIEWLKDAKKAAVTAGASTPTPITKEVITFLQQ 286
>gi|52081053|ref|YP_079844.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus licheniformis ATCC 14580] >gi|52786431|ref|YP_092260.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus licheniformis ATCC 14580] >gi|71152172|sp|Q65H97|ISPH_BACLD 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|52004264|gb|AAU24206.1| isopentenyl diphosphate biosynthesis protein IspH [Bacillus licheniformis ATCC 14580] >gi|52348933|gb|AAU41567.1| YqfP [Bacillus licheniformis DSM 13] (314 aa)
Score = 490, Expect = 1.5e-47, Identities = 122/292 (41%), Positives = 175/292 (59%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIA--KLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIK-KQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M +IKI+PRG+C GVVDA    K  A  K  P    Y++G +VHNK +    E+ GI T D  N  R EI++ +   DK     VIF+AHG   +    A +KGLV  D TC  VTKTHDLI++   +GY + YIG   HPE    + +   I+ L+ET  D+E +  E+EK + VTNQTT+S ++  +I E +K KY ++EF  +IC A + RQ+AV     + DL +VVGD KSNNS +L ++  +    +++ I +   +K EW    + +A+T+G STPT +   VI FLE+
  S:     1 MNVIKISPRGYCYGVVDAMVIAKNAALDKSLP-RPIYILGMIVHNKHVTDAFEKEGIYTLDGPN--RLEILNQV---DKGT---VIFTAHGVSPEVRKIAEDKGLVAIDATCPDVTKTHDLIRKMKAEGYHVIYIGKKGHPEPEGAVGVAPDIVHLVETEEDVERLDIEAEK-LIVTNQTTMSQWDVHDIMEKVKEKYPDVEFHQEICLATQVRQEAVSEQAKKADLTIVVGDPKSNNSNRLAQVSEEIAGTKAYRIGDLSELKLEWLDGVETVAVTAGASTPTPITKEVIRFLEQ 286
>gi|30264358|ref|NP_846735.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus anthracis str. Ames] >gi|42783414|ref|NP_980661.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus cereus ATCC 10987] >gi|47529807|ref|YP_021156.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49187186|ref|YP_030438.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus anthracis str. Sterne] >gi|49478601|ref|YP_038346.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52141212|ref|YP_085617.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus cereus E33L] >gi|65321662|ref|ZP_00394621.1| COG0761: Penicillin tolerance protein [Bacillus anthracis str. A2012] >gi|165872101|ref|ZP_02216741.1| penicillin tolerance protein LytB [Bacillus anthracis str. A0488] >gi|167634678|ref|ZP_02392998.1| penicillin tolerance protein LytB [Bacillus anthracis str. A0442] >gi|167638550|ref|ZP_02396826.1| penicillin tolerance protein LytB [Bacillus anthracis str. A0193] >gi|170687508|ref|ZP_02878725.1| penicillin tolerance protein LytB [Bacillus anthracis str. A0465] >gi|170707425|ref|ZP_02897879.1| penicillin tolerance protein LytB [Bacillus anthracis str. A0389] >gi|196041654|ref|ZP_03108946.1| penicillin tolerance protein LytB [Bacillus cereus NVH0597-99] >gi|50400905|sp|Q730P8|ISPH_BACC1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|50400989|sp|Q81LU9|ISPH_BACAN 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|71152169|sp|Q634Q0|ISPH_BACCZ 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|71152171|sp|Q6HDN0|ISPH_BACHK 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|30259016|gb|AAP28221.1| penicillin tolerance protein LytB [Bacillus anthracis str. Ames] >gi|42739343|gb|AAS43269.1| penicillin tolerance protein LytB [Bacillus cereus ATCC 10987] >gi|47504955|gb|AAT33631.1| penicillin tolerance protein LytB [Bacillus anthracis str. 'Ames Ancestor'] >gi|49181113|gb|AAT56489.1| penicillin tolerance protein LytB [Bacillus anthracis str. Sterne] >gi|49330157|gb|AAT60803.1| penicillin tolerance protein, 4-hydroxy-3-methylbut-2-enyl diphosphate [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51974681|gb|AAU16231.1| penicillin tolerance protein; 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus cereus E33L] >gi|164712232|gb|EDR17769.1| penicillin tolerance protein LytB [Bacillus anthracis str. A0488] >gi|167513398|gb|EDR88768.1| penicillin tolerance protein LytB [Bacillus anthracis str. A0193] >gi|167530130|gb|EDR92865.1| penicillin tolerance protein LytB [Bacillus anthracis str. A0442] >gi|170127669|gb|EDS96542.1| penicillin tolerance protein LytB [Bacillus anthracis str. A0389] >gi|170668703|gb|EDT19449.1| penicillin tolerance protein LytB [Bacillus anthracis str. A0465] >gi|196027642|gb|EDX66257.1| penicillin tolerance protein LytB [Bacillus cereus NVH0597-99] (316 aa)
Score = 488, Expect = 2.3e-47, Identities = 118/292 (40%), Positives = 171/292 (58%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIA-KLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIK-KQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           MKI+KI+PRG+C GVVDA    +  A         Y++G +VHNK +    EE GI T D    SR +I+D I+         VIF+AHG   +   +A+EKGL   D TC  VTKTHDLI+ K  +GY + YIG  NHPE    + I   I+ LIE  +D++ +   ++K I VTNQTT+S ++ + + E ++ K+   EF  +IC A + RQ+AV       DL +VVGD KSNNS +L ++  +    +++ + +   IK EW    + +A+T+G STPT +   VI FLE+
  S:     1 MKIVKISPRGYCYGVVDAMVIARNAALDTSLPRPIYILGMIVHNKHVTDAFEEDGIITLDGP--SRLDILDKID------SGTVIFTAHGVSPEVKQRAKEKGLTTIDATCPDVTKTHDLIEAKKAEGYHVIYIGKKNHPEPEGAVGIAPDIVHLIERADDLKTLEIPTDK-ILVTNQTTMSQWDVQHLMEDIQKKFPTAEFHKEICLATQVRQEAVAKQADVADLTIVVGDPKSNNSNRLAQVSQEIAGTKAYRVADVSEIKLEWLQGVENVAVTAGASTPTPITKEVIAFLEQ 286
>gi|118479460|ref|YP_896611.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus thuringiensis str. Al Hakam] >gi|166217147|sp|A0RIR1|ISPH_BACAH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|118418685|gb|ABK87104.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus thuringiensis str. Al Hakam] (316 aa)
Score = 485, Expect = 5.2e-47, Identities = 118/292 (40%), Positives = 170/292 (58%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIA-KLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIK-KQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           MKI+KI+PRG+C GVVDA    +  A         Y++G +VHNK +    EE GI T D    SR +I+D I+         VIF+AHG   +   +A+EKGL   D TC  VTKTHDLI+ K  +GY + YIG  NHPE    + I   I+ LIE  +D++ +   + K I VTNQTT+S ++ + + E ++ K+   EF  +IC A + RQ+AV       DL +VVGD KSNNS +L ++  +    +++ + +   IK EW    + +A+T+G STPT +   VI FLE+
  S:     1 MKIVKISPRGYCYGVVDAMVIARNAALDTSLPRPIYILGMIVHNKHVTDAFEEDGIITLDGP--SRLDILDKID------SGTVIFTAHGVSPEVKQRAKEKGLTTIDATCPDVTKTHDLIEAKKAEGYHVIYIGKKNHPEPEGAVGIAPDIVHLIEKADDLKTLEIPTNK-ILVTNQTTMSQWDVQHLMEDIQKKFPTAEFHKEICLATQVRQEAVAKQADVADLTIVVGDPKSNNSNRLAQVSQEIAGTKAYRVADVSEIKLEWLQGVENVAVTAGASTPTPITKEVIAFLEQ 286
>gi|56421012|ref|YP_148330.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Geobacillus kaustophilus HTA426] >gi|71152184|sp|Q5KX24|ISPH_GEOKA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|56380854|dbj|BAD76762.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426] (316 aa)
Score = 483, Expect = 1.1e-46, Identities = 118/292 (40%), Positives = 176/292 (60%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK--YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSID-KSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIK-KQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M++IKITPRG+C GVVDA    +  A L P+  +  Y++G +VHNK +     E GI T D +N         +EI +K +   VIF+AHG   +   +A EKGLV  D TC  VTKTH LI++K+  GY I YIG   HPE    + I+ + I L+ET++D+E +   +E+ I VTNQTT+S ++  +I   +K KY ++E   +IC A + RQ+AV     E D+ +VVGD +SNNS +L ++  +    +++ + +   I   W  + K +A+T+G STPT +   VI FLE+
  S:     1 MEVIKITPRGYCYGVVDAMVIARN-AALDPSLPRPIYILGMIVHNKHVTDAFAEEGIITLDGENR--------LEILEKIDQGTVIFTAHGVSPEVKKRALEKGLVTIDATCPDVTKTHRLIEQKLADGYDIIYIGKKGHPEPEGAVGINPERIHLVETIDDVERLSIHNER-IMVTNQTTMSQWDVADIMAKVKEKYPHVEMHKEICLATQLRQEAVAEQAKEADVTIVVGDPRSNNSNRLAQVSEEIAGTKAYRVADVTEIDINWIKDAKKVAVTAGASTPTPITKEVIDFLEQ 286
>gi|16079571|ref|NP_390395.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus subtilis subsp. subtilis str. 168] >gi|1731004|sp|P54473|ISPH_BACSU 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|1303837|dbj|BAA12493.1| YqfP [Bacillus subtilis] >gi|2634949|emb|CAB14446.1| yqfP [Bacillus subtilis subsp. subtilis str. 168] (314 aa)
Score = 482, Expect = 1.2e-46, Identities = 121/292 (41%), Positives = 173/292 (59%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIA--KLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIK-KQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M +IKI+PRG+C GVVDA    K  +  K  P    Y++G +VHNK +    EE GI T D  N      +D ++  DK     VIF+AHG   +    A EKGLV  D TC  VTKTH+LI E  E+GY + YIG   HPE    + +   I+ L+ET  D++N+  +SEK + VTNQTT+S ++  +I E +K KY ++E+  +IC A + RQ+AV     + DL +VVGD KSNNS +L ++  +    +++ I +   +K EW      +A+T+G STPT +   VI FLE+
  S:     1 MDVIKISPRGYCYGVVDAMVIAKNASLDKSLP-RPIYILGMIVHNKHVTDAFEEEGILTLDGSNR-----LDILKQVDKGT---VIFTAHGVSPEVRRIAEEKGLVAIDATCPDVTKTHNLILEMKEKGYHVIYIGKKGHPEPEGAVGVAPEIVHLVETEEDVKNLDIQSEK-LIVTNQTTMSQWDVHDIMELVKEKYPHVEYHQEICLATQVRQEAVSEQAKKADLTIVVGDPKSNNSNRLAQVSEEIAGTKAYRIGDLSELKLEWLKGVNTVAVTAGASTPTPITKEVIRFLEQ 286
>gi|56963459|ref|YP_175190.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus clausii KSM-K16] >gi|71152173|sp|Q5WHC6|ISPH_BACSK 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|56909702|dbj|BAD64229.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacillus clausii KSM-K16] (314 aa)
Score = 479, Expect = 3.0e-46, Identities = 116/291 (39%), Positives = 173/291 (59%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI-DKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE---SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           M ++KI+PRG+C GVVDA    ++ A+ L      Y++G +VHN+ +    +E GI + D  N  R EI+ ++          VIF+AHG   +    A+EKGL   D TC  VT+THDLI+EK E+GYQ  YIG   HPE    + +   S+ L+ET+ D+E + T  ++ I +TNQTT+S ++  +I +     Y N E  N+IC A + RQ+AV    S+ D+++VVGD KSNNS +L +  + +QI    ++ I +   +K EW    K + +TSG STPT +   VI F+E
  S:     1 MDVLKISPRGYCYGVVDAMVMARQAAQNLDLPRPLYILGQIVHNQHVTDAFKEDGIISLDGPN--RLEILKNV------THGTVIFTAHGVSPEVRRLAKEKGLTCIDATCPDVTRTHDLIREKAEEGYQFIYIGKQGHPEPEGAMGVAPDSVHLVETMEDLEQL-TLDDRDIIITNQTTMSQWDVADIMKRAMELYPNAEVHNEICLATQVRQEAVAEQASQCDIVIVVGDPKSNNSNRLAQ--VSEQIAGTPAYRIGDLSELKLEWIKEAKKVGVTSGASTPTPITKEVITFIE 285
>gi|47567849|ref|ZP_00238557.1| hydroxymethylbutenyl pyrophosphate reductase [Bacillus cereus G9241] >gi|47555526|gb|EAL13869.1| hydroxymethylbutenyl pyrophosphate reductase [Bacillus cereus G9241] (283 aa)
Score = 473, Expect = 1.4e-45, Identities = 114/282 (40%), Positives = 164/282 (58%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIA-KLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIK-KQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWL 282
           MKI+KI+PRG+C GVVDA    +  A         Y++G +VHNK +    EE GI T D    SR EI+D I+         VIF+AHG   +   +A+EKGL   D TC  VTKTHDLI+ K  +GY + YIG  NHPE    + I   I+ LIE  +D++ +   ++K I VTNQTT+S ++ + + E ++ K+   EF  +IC A + RQ+AV       DL +VVGD KSNNS +L ++  +    +++ + +   IK EW    + +A+T+G STP  L
  S:     1 MKIVKISPRGYCYGVVDAMVIARNAALDTSLPRPIYILGMIVHNKHVTDAFEEDGIITLDGP--SRLEILDKID------SGTVIFTAHGVSPEVKQRAKEKGLTTIDATCPDVTKTHDLIEAKKAEGYHVIYIGKKNHPEPEGAVGIAPDIVHLIERADDLKTLEIPTDK-ILVTNQTTMSQWDVQHLMEDIQKKFPTAEFHKEICLATQVRQEAVAKQADVADLTIVVGDPKSNNSNRLAQVSQEIAGTKAYRVADVSEIKLEWLQGVENVAVTAGASTPLQL 276
>gi|172056873|ref|YP_001813333.1| hydroxymethylbutenyl pyrophosphate reductase [Exiguobacterium sibiricum 255-15] >gi|171989394|gb|ACB60316.1| hydroxymethylbutenyl pyrophosphate reductase [Exiguobacterium sibiricum 255-15] (315 aa)
Score = 464, Expect = 1.5e-44, Identities = 108/292 (36%), Positives = 170/292 (58%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK--YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI-DKSIILIETVNDIENIRTE-SEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIK-KQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M + KI+PRG+C GVVDA    ++ A L  N  +  +++G +VHN  + +E E +G+ T D  +  R E +++I+         VIF+AHG       +A EK L V D TC  VT+THDLI+  +   Y++ Y+G + HPE    + +  + + LIE V DIE +    ++K I VTNQTT+S ++ + + E ++ KY ++E  N+ICNA + RQ+AV     + DL++VVGD +SNNS +L ++        +H I +   +   W      + +TSG STPT +   VI FL++
  S:     1 MLVKKISPRGYCYGVVDAMKLAQQ-AALNDNLPRPIHILGMIVHNAHVTREFERMGVLTVDGPD--RLEALETIK------EGTVIFTAHGISPAVYARAAEKKLTVVDATCPDVTRTHDLIRSVVADDYEVIYVGKHGHPEPEGAVGVAPEHVHLIEKVEDIEALPAHLADKKIIVTNQTTMSQWDVQALMEHVRKKYPHVEVHNEICNATQVRQEAVAEQAGDCDLVIVVGDPRSNNSNRLAQVSFDIAATPAHRIGDLTELDLSWLDGVNQVGVTSGASTPTPITKKVIDFLQQ 288
>gi|47095402|ref|ZP_00233012.1| hydroxymethylbutenyl pyrophosphate reductase [Listeria monocytogenes str. 1/2a F6854] >gi|153174578|ref|ZP_01930079.1| hydroxymethylbutenyl pyrophosphate reductase [Listeria monocytogenes FSL N3-165] >gi|153183806|ref|ZP_01934623.1| hydroxymethylbutenyl pyrophosphate reductase [Listeria monocytogenes J0161] >gi|153190860|ref|ZP_01938205.1| hydroxymethylbutenyl pyrophosphate reductase [Listeria monocytogenes J2818] >gi|47016223|gb|EAL07146.1| hydroxymethylbutenyl pyrophosphate reductase [Listeria monocytogenes str. 1/2a F6854] >gi|126943458|gb|EBA21179.1| hydroxymethylbutenyl pyrophosphate reductase [Listeria monocytogenes J0161] >gi|127765619|gb|EBA25965.1| hydroxymethylbutenyl pyrophosphate reductase [Listeria monocytogenes J2818] >gi|133730182|gb|EBA31880.1| hydroxymethylbutenyl pyrophosphate reductase [Listeria monocytogenes FSL N3-165] (331 aa)
Score = 464, Expect = 1.8e-44, Identities = 116/292 (39%), Positives = 168/292 (57%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK--YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQ-IESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+IIKI+PRG+C GV+DA    K  A L PN  +  +++G +VHNK +    E +GI T D  N  R EI+D I          VIF+AHG       KA  KGL   D TC  V  T++LI EK   GY+I YIG   HPE          ++ L+ET  DI+ +   S+K IFVTNQTT+S ++  ++   +K K+       +IC A + RQ+AV     + DL +VVGD +SNN+ +L ++ I+K   +++ I +   +  EW  + K +A+T+G STPT L   V++FLE+
  S:     1 MEIIKISPRGYCYGVIDAMVIAKN-ASLDPNLPRPIHILGMIVHNKHVTDAFESIGIYTVDGAN--REEILDKITTG------TVIFTAHGVSPSVKAKAVAKGLTTIDATCPDVLHTYNLILEKQAAGYEIIYIGKKGHPEPEGAYGTAPDVVHLVETKADIDALSLLSDK-IFVTNQTTMSKWDVADLMHYIKGKFPKAIQHQEICMATQVRQEAVALQAKDADLTIVVGDPRSNNTARLAQVSIEKAGTKAYRIADITELDIEWIKDAKKVAVTAGASTPTQLVREVLLFLEQ 286
>gi|16803491|ref|NP_464976.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Listeria monocytogenes EGD-e] >gi|20138570|sp|P58676|ISPH_LISMO 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|16410880|emb|CAC99529.1| lmo1451 [Listeria monocytogenes] (331 aa)
Score = 463, Expect = 2.0e-44, Identities = 116/292 (39%), Positives = 168/292 (57%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK--YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQ-IESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+IIKI+PRG+C GV+DA    K  A L PN  +  +++G +VHNK +    E +GI T D  N  R EI+D I          VIF+AHG       KA  KGL   D TC  V  T++LI EK   GY+I YIG   HPE          ++ L+ET  DI+ +   S+K IFVTNQTT+S ++  ++   +K K+       +IC A + RQ+AV     + DL +VVGD +SNN+ +L ++ I+K   +++ I +   +  EW  + K +A+T+G STPT L   V++FLE+
  S:     1 MEIIKISPRGYCYGVIDAMVIAKN-ASLDPNLPRPIHILGMIVHNKHVTDAFESIGIYTVDGAN--REEILDKITTG------TVIFTAHGVSPSVKAKAVAKGLTTIDATCPDVLHTYNLILEKQAAGYEIIYIGKKGHPEPEGAYGTAPDVVHLVETKADIDALSLLSDK-IFVTNQTTMSKWDVADLMHYIKGKFPKAIQHQEICMATQVRQEAVALQAKDADLTIVVGDPRSNNTARLAQVSIEKAGTKAYRIADITELDIEWIKDAKKVAVTAGASTPTQLVREVLLFLEQ 286
>gi|46907679|ref|YP_014068.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Listeria monocytogenes str. 4b F2365] >gi|153202287|ref|ZP_01943916.1| hydroxymethylbutenyl pyrophosphate reductase [Listeria monocytogenes HPB2262] >gi|50400893|sp|Q71ZL9|ISPH_LISMF 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|46880947|gb|AAT04245.1| hydroxymethylbutenyl pyrophosphate reductase [Listeria monocytogenes str. 4b F2365] >gi|133735570|gb|EBA37268.1| hydroxymethylbutenyl pyrophosphate reductase [Listeria monocytogenes HPB2262] (331 aa)
Score = 460, Expect = 4.1e-44, Identities = 115/292 (39%), Positives = 167/292 (57%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK--YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQ-IESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+IIKI+PRG+C GV+DA    K  A L PN  +  +++G +VHNK +    E +GI T D  N  R EI+D I          VIF+AHG       KA  KGL   D TC  V  T++LI EK   GY+I YIG   HPE          ++ L+ET  DI+ +   S+  IFVTNQTT+S ++  ++ + +K K+       +IC A + RQ+AV       DL +VVGD +SNN+ +L ++ I+K   +++ I +   +  EW  + K +A+T+G STPT L   V++FLE+
  S:     1 MEIIKISPRGYCYGVIDAMVIAKN-ASLDPNLPRPIHILGMIVHNKHVTDAFESIGIYTVDGAN--REEILDKITTG------TVIFTAHGVSPSVKAKAAAKGLTTIDATCPDVLHTYNLILEKQAAGYEIIYIGKKGHPEPEGAYGTAPDVVHLVETKADIDALSLLSDN-IFVTNQTTMSKWDVADLMDYIKEKFPKAIQHQEICMATQVRQEAVAVQAKGADLTIVVGDPRSNNTARLAQVSIEKAGTKAYRIADITELDIEWIKDAKKVAVTAGASTPTQLVREVLLFLEQ 286
>gi|47092741|ref|ZP_00230527.1| hydroxymethylbutenyl pyrophosphate reductase [Listeria monocytogenes str. 4b H7858] >gi|47018929|gb|EAL09676.1| hydroxymethylbutenyl pyrophosphate reductase [Listeria monocytogenes str. 4b H7858] (331 aa)
Score = 458, Expect = 8.3e-44, Identities = 114/292 (39%), Positives = 167/292 (57%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK--YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQ-IESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+IIKI+PRG+C GV+DA    K  A L PN  +  +++G +VHNK +    E +GI T D  N  R EI+D I          VIF+AHG       KA  KGL   D +C  V  T++LI EK   GY+I YIG   HPE          ++ L+ET  DI+ +   S+  IFVTNQTT+S ++  ++ + +K K+       +IC A + RQ+AV       DL +VVGD +SNN+ +L ++ I+K   +++ I +   +  EW  + K +A+T+G STPT L   V++FLE+
  S:     1 MEIIKISPRGYCYGVIDAMVIAKN-ASLDPNLPRPIHILGMIVHNKHVTDAFESIGIYTVDGAN--REEILDKITTG------TVIFTAHGVSPSVKAKAAAKGLTTIDASCPDVLHTYNLILEKQAAGYEIIYIGKKGHPEPEGAYGTAPDVVHLVETKADIDALSLLSDN-IFVTNQTTMSKWDVADLMDYIKEKFPKAIQHQEICMATQVRQEAVAVQAKGADLTIVVGDPRSNNTARLAQVSIEKAGTKAYRIADITELDIEWIKDAKKVAVTAGASTPTQLVREVLLFLEQ 286
>gi|145589911|ref|YP_001156508.1| hydroxymethylbutenyl pyrophosphate reductase [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145048317|gb|ABP34944.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Polynucleobacter sp. QLW-P1DMWA-1] (311 aa)
Score = 408, Expect = 4.5e-38, Identities = 106/286 (37%), Positives = 158/286 (55%)
  Q:     2 KIIKITPRGFCKGVVDAY-----ATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIR-TESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +I+   PRGFC GV  A      A  +    +Y  HE      +VHN  ++ EL   G    D             E+ +     IV+FSAHG  Q+    A E+GL V+D TC  VTK H  + +  ++G+ +  IG   HPE   T+  + + + LIE V+D++ +    SEK  FVT QTT+S+ E +EI E L  K+ NI    K DIC A ++RQDAV  M  +V+L++VVG   S+NS +L E+  K  + S+++   + +K EWF+ KK + +T+G S P  LA  ++
  S:     6 EILMAQPRGFCAGVDRAINIVNEALTRFGPPIYVRHE------IVHNAYVVNELRNKGAVFVD-------------ELDEVPKGGIVVFSAHGVSQEVRVDAEERGLQVYDATCPLVTKVHLEVIKMCKEGFTVLMIGHAGHPEVEGTMGQVKEGVFLIEKVSDVDTLTFPASEKIAFVT-QTTLSVDETKEIVEALTKKFPNIVQPRKQDICYATQNRQDAVKFMAPQVELVIVVGSAASSNSNRLRELSEKLGVPSYMVDAPEQLKPEWFVGKKRIGLTAGASAPESLAQSIV 280
>gi|34499022|ref|NP_903237.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chromobacterium violaceum ATCC 12472] >gi|50400940|sp|Q7NS59|ISPH_CHRVO 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|34104872|gb|AAQ61229.1| lytB protein [Chromobacterium violaceum ATCC 12472] (311 aa)
Score = 407, Expect = 6.2e-38, Identities = 98/285 (34%), Positives = 156/285 (54%)
  Q:     3 IIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           I+   PRGFC GV  A A  ++  +LY     Y+   +VHN+ ++ +L   G           +  I+  E+KD      +I+SAHG       +A   GL VFD TC  VTK H  +K   + G +I  IG   HPE   T+  +D  I L++TV+D+  +R  +E  +   +QTT+S+ E  +I   LK+++ NI    K+DIC A ++RQDAV  +  + D+++VVG   S+NS +L E+   K ++++++ N   ++ EWF  K+ + +T+G S P  L   VI
  S:     5 IMLANPRGFCAGVDRAIAIVERAIELY-GAPIYVRHEVVHNRFVVDDLRGKG-----------AVFIE--ELKDVPPGSTLIYSAHGVPLSVRAEAEALGLTVFDATCPLVTKVHVEVKRMNKAGMEIIMIGHAGHPEVEGTMGQVDAGIYLVQTVDDVATLRVVNEDQLSYVSQTTLSVDETRDIIAALKARFPNIHSPKKDDICYATQNRQDAVKLLADQCDIVVVVGSPNSSNSNRLREVAALKGVDAYMVDNASLLEPEWFAGKRRVGVTAGASAPEVLVQAVI 278
>gi|109899480|ref|YP_662735.1| hydroxymethylbutenyl pyrophosphate reductase [Pseudoalteromonas atlantica T6c] >gi|123360480|sp|Q15R07|ISPH_PSEA6 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|109701761|gb|ABG41681.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudoalteromonas atlantica T6c] (314 aa)
Score = 405, Expect = 1.1e-37, Identities = 98/287 (34%), Positives = 160/287 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+I    PRGFC GV  A    ++  +++ +   Y+   +VHNK ++  L+E G    D+           +E+ D +   IVIFSAHG  Q   ++A  +GL VFD TC  VTK H  +     +G +   IG   HPE   T+    + D  I L+E+V+D+  +  ++   ++  +QTT+S+ +  ++ + L++K+  IE   K+DIC A ++RQD+V  + ++ D+LLVVG   S+NS +L E+  K   ++HLI +   I+ EW  N K + +T+G S P  L   V+
  S:     1 MQIHLANPRGFCAGVDRAITIVERALEIF-SPPIYVRHEVVHNKFVVDGLKERGAVFVDEL----------VEVPDDS---IVIFSAHGVSQAVRNEASSRGLKVFDATCPLVTKVHMEVMRASSKGTECVLIGHQGHPEVEGTMGQYDNQDGGIYLVESVDDVARLEVKNPSALYYCSQTTLSVDDTADVIDALRAKFPAIEGPRKDDICYATQNRQDSVRELSADCDILLVVGAQNSSNSNRLRELAEKIGAKAHLIADANCIQKEWLANAKHIGVTAGASAPEVLVQGVV 279
>gi|127512035|ref|YP_001093232.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella loihica PV-4] >gi|126637330|gb|ABO22973.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella loihica PV-4] (316 aa)
Score = 405, Expect = 1.2e-37, Identities = 97/287 (33%), Positives = 162/287 (56%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           ++I    PRGFC GV  A +  ++  +L+ +   Y+   +VHN+ +++ L++ G    D             E+    +  IVIFSAHG  Q    +A+++GL VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  ++L+E+  D+E +  +    +    QTT+S+ +  ++   L+ ++ +I+   K+DIC A ++RQDAV N+  +VDL +VVG   S+NS +L+E+ IKK  +S+L+ N  +IK EWF + + +A+T+G S P  L   VI
  S:     8 LQIKLANPRGFCAGVDRAISIVERALELF-SPPIYVRHEVVHNRYVVQNLKDRGAVFVD-------------ELDQVPDDSIVIFSAHGVSQAVRAEAKKRGLRVFDATCPLVTKVHLQVTRASRKGIECILIGHAGHPEVEGTMGQYDNPEGGVLLVESPADVEALVVKDPDNLCFVTQTTLSMDDTADVIAALQKRFPSIQGPRKDDICYATQNRQDAVRNVADDVDLFIVVGSKNSSNSNRLMELAIKKGTQSYLVDNADDIKPEWFNDIEKVAVTAGASAPEVLVQQVI 286
>gi|170725655|ref|YP_001759681.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella woodyi ATCC 51908] >gi|169811002|gb|ACA85586.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella woodyi ATCC 51908] (315 aa)
Score = 401, Expect = 3.2e-37, Identities = 95/287 (33%), Positives = 162/287 (56%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           ++I    PRGFC GV  A +  ++  +L+P    Y+   +VHN+ +++ L++ G           +  ++ ++    N+  IVIFSAHG  Q    +A+ +GL VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  ++L+E+  D+E++  +    +    QTT+S+ +  ++ E L+S++ +I+   K+DIC A ++RQDAV N+  +VDL +VVG   S+NS +L E+  K+  +S+L+ N+ +I   WF     +A+T+G S P  L   VI
  S:     7 LQIKLANPRGFCAGVDRAISIVERALELFPA-PIYVRHEVVHNRYVVQNLKDRG-----------AVFVEELDQVPDNS--IVIFSAHGVSQAVRKEAKHRGLKVFDATCPLVTKVHLQVTRASRKGIECILIGHAGHPEVEGTMGQYDNPEGGVLLVESPADVESLEVKDPNNLCFVTQTTLSMDDTADVIEALQSRFPSIQGPRKDDICYATQNRQDAVRNVADDVDLFIVVGSKNSSNSNRLRELAQKRGTQSYLVDNSDDIDSSWFEGVTKVAVTAGASAPEVLVQQVI 285
>gi|56416914|ref|YP_153988.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Anaplasma marginale str. St. Maries] >gi|71152167|sp|Q5PAE7|ISPH_ANAMM 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|56388146|gb|AAV86733.1| lytB protein [Anaplasma marginale str. St. Maries] (342 aa)
Score = 397, Expect = 1.0e-36, Identities = 90/290 (31%), Positives = 154/290 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYP-NHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFL 290
           +++I   PRGFC GV  A  T + +A  Y    E Y +  +VHN  ++   +++G++                 + +     +++FSAHG  Q+  +++R KGL V D TC  VTK H  I+   + GYQ+  +G   H E   ++  +   ++L++ V D+++I+  S   +    QTT+S+ +  EI   LK ++  I   +  DIC A ++RQ AV  M   VD++L +G   S+NS +L+++   +   ++LI + +NI  EW I  + + IT+G S P  L   VI +L
  S:    36 VEVILARPRGFCAGVERAVRTLESVASRYAGTREVYALHEIVHNLHVVNSFKKMGVKFVS-------------ALHEVPEGAVLVFSAHGVSQQVKEESRRKGLTVVDATCPLVTKVHLEIQRYDKSGYQVILVGHKGHREVEGSMGQVSNPVVLVQNVQDVQSIKIPSAAKLAYVTQTTLSMDDTAEIISALKLRFPRIVGPDLRDICYATQNRQTAVKAMSQMVDVVLAIGSKNSSNSNRLLDLAKAQNARAYLIDSYRNIDLEWLIGARRIGITAGASAPEILVQEVIDYL 316
>gi|46446712|ref|YP_008077.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Candidatus Protochlamydia amoebophila UWE25] >gi|50400881|sp|Q6MC97|ISPH_PARUW 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|46400353|emb|CAF23802.1| probable protein involved in isoprenoid biosynthesis and penicillin tolerance [Candidatus Protochlamydia amoebophila UWE25] (313 aa)
Score = 397, Expect = 1.0e-36, Identities = 101/279 (36%), Positives = 160/279 (57%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPI---VIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           MK++   PRGFC GV  A  T +K      + +Y  HE      +VHN+ +++     G++TK            +I I+D  + P+   +I+SAHG      ++A+++ L+  D TC  VT+ H  +K    QGYQI  IG +NH E I T      +  ++E+V D++N+   S+  +F   QTT+S+ + +EIT+ L  KY ++E    + IC A  +RQ A+  +    DL+LVVGD +S+NS +L E    + IES+LI + K I  EW + K+ + +T+G STP
  S:     1 MKLLLSKPRGFCAGVERAIETVEKALLLWGSPIYVKHE------IVHNRHVVQ-----GLKTKG-----------AIFIEDVEDVPVGARLIYSAHGVSPAVREQAKKRQLIEIDATCGLVTRVHSAVKRYALQGYQIILIGHHNHVEIIGTAGEAPDVTTIVESVEDVKNLNFSSQDKLFYITQTTLSLDDVKEITQALIVKYPHVETLPSSSICYATTNRQMALREITDLTDLVLVVGDPQSSNSNRLREAASTRGIESYLINDEKEIHPEWLLGKQVIGLTAGASTP 268
>gi|3892229|gb|AAC78334.1| LytB [Burkholderia pseudomallei] (313 aa)
Score = 396, Expect = 1.2e-36, Identities = 93/290 (32%), Positives = 155/290 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFL 290
           M++I   PRGFC GVV A    ++      A +Y  HE      +VHN+ +++ L   G +  +             E+ +  +  + IFSAHG  Q     A+ +GL V D TC  VTK H   ++ +  G ++  IG   HPE   T+  I   +IL+++  +++ +   ++ P+    QTT+S+ +   I E L+ ++ +I   +  DIC A ++RQ AV  +  +VD+LLVVG   S+NS +L EIG +  + S+L+ +   ++ EWF N + + +T+G S P  +   VI  L
  S:     1 MRVILAQPRGFCAGVVRAIEIVERALQQNGAPVYVRHE------IVHNRHVVENLRNKGARFVE-------------ELDEVPHGAVAIFSAHGVAQTVEQDAQARGLDVLDATCPLVTKVHVQGRQYVAAGRRLILIGHAGHPEVEGTIGQIPAEVILVQSEAEVDTLTLPADTPVAYVTQTTLSVDDTRGIIEALQRRFTDIVGPDTRDICYATQNRQAAVRELSEQVDVLLVVGATNSSNSNRLREIGTESGVPSYLVADGSEVRAEWFANARTVGLTAGASAPEEMVEDVIAAL 279
>gi|53716137|ref|YP_106485.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia mallei ATCC 23344] >gi|53723184|ref|YP_112169.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei K96243] >gi|76818269|ref|YP_336443.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 1710b] >gi|121596456|ref|YP_990579.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia mallei SAVP1] >gi|126443459|ref|YP_001064045.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 668] >gi|126458046|ref|YP_001076958.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 1106a] >gi|134281748|ref|ZP_01768455.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 305] >gi|161358101|ref|ZP_02103975.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 1106b] >gi|161374772|ref|ZP_02114315.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 1710a] >gi|167004130|ref|ZP_02269900.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia mallei PRL-20] >gi|167725214|ref|ZP_02408450.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei DM98] >gi|167744144|ref|ZP_02416918.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 14] >gi|167821342|ref|ZP_02453022.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 91] >gi|167829682|ref|ZP_02461153.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 9] >gi|167851153|ref|ZP_02476661.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei B7210] >gi|167899784|ref|ZP_02487185.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 7894] >gi|167908100|ref|ZP_02495305.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei NCTC 13177] >gi|167916446|ref|ZP_02503537.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 112] >gi|167924301|ref|ZP_02511392.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei BCC215] >gi|194315313|ref|YP_002011348.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei ATCC 10399] >gi|194503674|ref|YP_002033249.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 1655] >gi|194512139|ref|YP_002024665.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei Pasteur 52237] >gi|194521724|ref|YP_002057259.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei FMH] >gi|194530947|ref|YP_002066467.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei JHU] >gi|194571908|ref|YP_002106905.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 406e] >gi|55977894|sp|Q9ZFL0|ISPH2_BURPS 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 2 >gi|71152164|sp|Q629Z7|ISPH1_BURMA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 1 >gi|52213598|emb|CAH39652.1| IspH protein [Burkholderia pseudomallei K96243] >gi|52422107|gb|AAU45677.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei ATCC 23344] >gi|76582742|gb|ABA52216.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 1710b] >gi|121224254|gb|ABM47785.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei SAVP1] >gi|126222950|gb|ABN86455.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 668] >gi|126231814|gb|ABN95227.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 1106a] >gi|134246810|gb|EBA46897.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 305] >gi|147745734|gb|EDK52813.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei FMH] >gi|147754957|gb|EDK62021.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei JHU] >gi|157806507|gb|EDO83677.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 406e] >gi|157934847|gb|EDO90517.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei Pasteur 52237] >gi|160697029|gb|EDP86999.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei ATCC 10399] >gi|184213147|gb|EDU10190.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 1655] (313 aa)
Score = 396, Expect = 1.2e-36, Identities = 93/290 (32%), Positives = 155/290 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFL 290
           M++I   PRGFC GVV A    ++      A +Y  HE      +VHN+ +++ L   G +  +             E+ +  +  + IFSAHG  Q     A+ +GL V D TC  VTK H   ++ +  G ++  IG   HPE   T+  I   +IL+++  +++ +   ++ P+    QTT+S+ +   I E L+ ++ +I   +  DIC A ++RQ AV  +  +VD+LLVVG   S+NS +L EIG +  + S+L+ +   ++ EWF N + + +T+G S P  +   VI  L
  S:     1 MRVILAQPRGFCAGVVRAIEIVERALQQNGAPVYVRHE------IVHNRHVVENLRNKGARFVE-------------ELDEVPHGAVAIFSAHGVAQTVEQDAQARGLDVLDATCPLVTKVHVQGRQYVAAGRRLILIGHAGHPEVEGTIGQIPAEVILVQSEAEVDTLTLPADTPVAYVTQTTLSVDDTRGIIEALQRRFTDIVGPDTRDICYATQNRQAAVRELSEQVDVLLVVGATNSSNSNRLREIGTESGVPSYLVADGSEVRAEWFANARTVGLTAGASAPEEMVEDVIAAL 279
>gi|120599898|ref|YP_964472.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella sp. W3-18-1] >gi|124546933|ref|ZP_01705938.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella putrefaciens 200] >gi|120559991|gb|ABM25918.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella sp. W3-18-1] >gi|124509627|gb|EAY53704.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella putrefaciens 200] (318 aa)
Score = 396, Expect = 1.2e-36, Identities = 95/287 (33%), Positives = 159/287 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           + I+   PRGFC GV  A +  ++  +L+ +   Y+   +VHN+ +++ L++ G           +  ++ ++    NN  IVIFSAHG  Q    +A+ +GL VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  + LIE+  D+E +       +    QTT+S+ +  +I   L+ ++ +IE   K+DIC A ++RQDAV N+ ++VDLL+VVG   S+NS +L E+ +K   +S+L+    +++  WF N   +A+T+G S P  L   V+
  S:    10 LNILLANPRGFCAGVDRAISIVERALELF-SPPIYVRHEVVHNRYVVQNLKDRG-----------AVFVEELDQVPDNN--IVIFSAHGVSQAVRQEAKARGLRVFDATCPLVTKVHLQVTRASRKGIECILIGHEGHPEVEGTMGQYDNPNGGVYLIESPADVEALEVRDPNNLCFVTQTTLSVDDTLDIIVALQKRFPSIEGPRKDDICYATQNRQDAVRNLSADVDLLIVVGSKNSSNSNRLRELALKTGTQSYLVDTADDVESSWFDNVTRVAVTAGASAPEVLVQQVV 288
>gi|126173301|ref|YP_001049450.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella baltica OS155] >gi|149115787|ref|ZP_01842525.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella baltica OS223] >gi|160874279|ref|YP_001553595.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella baltica OS195] >gi|125996506|gb|ABN60581.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella baltica OS155] >gi|146864322|gb|EDK49746.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella baltica OS223] >gi|160859801|gb|ABX48335.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella baltica OS195] (318 aa)
Score = 395, Expect = 1.5e-36, Identities = 95/292 (32%), Positives = 161/292 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           + I+   PRGFC GV  A +  ++  +L+ +   Y+   +VHN+ +++ L++ G           +  ++ ++    NN  IVIFSAHG  Q    +A+ +GL VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  + LIE+  D++ +       +    QTT+S+ +  +I   L+ ++ +IE   K+DIC A ++RQDAV N+ ++VDLL+VVG   S+NS +L E+ +K   +S+L+    +++  WF N   +A+T+G S P  L   V+  + K
  S:    10 LNIMLANPRGFCAGVDRAISIVERALELF-SPPIYVRHEVVHNRYVVQNLKDRG-----------AVFVEELDQVPDNN--IVIFSAHGVSQAVRQEAKARGLRVFDATCPLVTKVHLQVTRASRKGIECILIGHEGHPEVEGTMGQYDNPNGGVYLIESPADVDALEVRDPNNLCFVTQTTLSVDDTLDIIAALQKRFPSIEGPRKDDICYATQNRQDAVRNLSADVDLLIVVGSKNSSNSNRLRELALKTGTQSYLVDTADDVESSWFDNVSRVAVTAGASAPEVLVQQVVQAIAK 293
>gi|119774064|ref|YP_926804.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Shewanella amazonensis SB2B] >gi|119766564|gb|ABL99134.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Shewanella amazonensis SB2B] (313 aa)
Score = 395, Expect = 1.5e-36, Identities = 96/287 (33%), Positives = 163/287 (56%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M I+   PRGFC GV  A +  ++  +L+ +   Y+   +VHN+ +++ L++ G                +I +++ +  P   IVIFSAHG  Q    +A+++GL VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  + LIE+V D+E ++ +  + +    QTT+S+ +  +I   L++K+ +IE   K+DIC A ++RQDAV ++ ++  L +VVG   S+NS +L E+  K   +++L+ +  ++K EWF N   +A+T+G S P  L   VI
  S:     5 MNILLANPRGFCAGVDRAISIVERALELF-SPPIYVRHEVVHNRYVVQNLKDRG----------------AIFVEELDQVPDNSIVIFSAHGVSQAVRAEAKKRGLKVFDATCPLVTKVHLQVTRASRKGVECILIGHEGHPEVEGTMGQYDNPEGGVYLIESVEDVEALQVKDPENLCFVTQTTLSVDDTLDIIAALQAKFPSIEGPRKDDICYATQNRQDAVRSLATQAKLFIVVGSKNSSNSNRLRELAEKSGAQAYLVDSAADVKAEWFANVDKVAVTAGASAPEVLVKQVI 283
>gi|113971289|ref|YP_735082.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Shewanella sp. MR-4] >gi|114048527|ref|YP_739077.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Shewanella sp. MR-7] >gi|117921571|ref|YP_870763.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Shewanella sp. ANA-3] >gi|113885973|gb|ABI40025.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella sp. MR-4] >gi|113889969|gb|ABI44020.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella sp. MR-7] >gi|117613903|gb|ABK49357.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella sp. ANA-3] (318 aa)
Score = 395, Expect = 1.5e-36, Identities = 97/292 (33%), Positives = 160/292 (54%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           + I+   PRGFC GV  A +  ++  +L+ +   Y+   +VHN+ +++ L++ G           +  ++ ++    NN  IVIFSAHG  Q    +A+ +GL VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  + LIE+  D+E +       +    QTT+S+ +  +I   L+ ++ +IE   K+DIC A ++RQDAV N+ ++VDLL+VVG   S+NS +L E+ +K   +S+L+    +I   WF N   +A+T+G S P  L   V+  + K
  S:    10 LNIMLANPRGFCAGVDRAISIVERALELF-SPPIYVRHEVVHNRYVVQNLKDRG-----------AVFVEELDQVPDNN--IVIFSAHGVSQAVRAEAKARGLRVFDATCPLVTKVHLQVTRASRKGIECILIGHEGHPEVEGTMGQYDNPNGGVYLIESPADVETLEVRDPNNLCFVTQTTLSVDDTLDIITALQKRFPSIEGPRKDDICYATQNRQDAVRNLSADVDLLIVVGSKNSSNSNRLRELALKTGTQSYLVDTADDIDSSWFENVTKVAVTAGASAPEVLVQQVVQAIAK 293
>gi|88811399|ref|ZP_01126654.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nitrococcus mobilis Nb-231] >gi|88791288|gb|EAR22400.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nitrococcus mobilis Nb-231] (306 aa)
Score = 395, Expect = 1.6e-36, Identities = 92/287 (32%), Positives = 155/287 (54%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFK--NDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M +I   PRGFC GVV A    +    L+     Y++  +VHN+ ++++L E G           +  ++S+E  +     ++IFSAHG       +AR +GL V D TC  VTK H   +   + G ++  IG   HPE   T   +D  + +I T+ D++ ++ +  + +    QTT+S+ +  E+   LK+++  I+    NDIC A ++RQ+AV  + ++VD+LLVVG   S+NS +L E+G +  + S+L+    +++ EWF     + IT+G S P  L   V+
  S:     1 MDVILAQPRGFCAGVVRAVEIVESALALH-GAPVYVLHEIVHNQHVVRDLSERG-----------AIFVESVE--EVPAQSVIIFSAHGVANAVAQRARGRGLRVIDATCPLVTKVHRQAQRYRDAGRELIIIGHGGHPEVQGTRGRVDGPVHVIATLEDVDALQVQDPQALAYVTQTTLSLDDTHEVVTALKARFPKIQGPGLNDICYATQNRQNAVRELTAQVDVLLVVGARNSSNSNRLREVGEQMGVRSYLVQTEDDLEPEWFSACTRVGITAGASAPEVLVQRVL 276
>gi|77165221|ref|YP_343746.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nitrosococcus oceani ATCC 19707] >gi|76883535|gb|ABA58216.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nitrosococcus oceani ATCC 19707] (320 aa)
Score = 394, Expect = 1.9e-36, Identities = 95/287 (33%), Positives = 157/287 (54%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFK--NDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           MK+    PRGFC GVV A    +   ++Y     Y++  +VHN+ ++++L+  G+   +D        + SI         + IFSAHG     ++ A++  L V D TC  VTK H   K+   QG ++  IG   HPE   T   +  ++ ++++V ++EN+  +  + I    QTT+SI +  ++ + LK ++  I     +DIC A ++RQ+AV  M  +VD+LLVVG   S+NS +L E+G +  I +HLI + K++   WF ++  + IT+G STP  L   V+
  S:     1 MKVTLAQPRGFCAGVVRAIDIVEHALEIY-GAPIYVLHEIVHNQHVVEDLQRRGVIFTED--------LASIPAGS-----VTIFSAHGVSTAVVETAKKNDLQVIDATCPLVTKVHLQAKKYYRQGDELIIIGHAGHPEVEGTRGRVKGTVYVLDSVAEVENLAVKDPEHIAYVTQTTLSIDDTRDVVDALKKRFPKIHGPGLDDICYATQNRQNAVREMSKKVDILLVVGARNSSNSNRLREVGEQNGITAHLIQDAKDLDSSWFTSQSRVGITAGASTPEILVQGVL 276
>gi|161523975|ref|YP_001578987.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia multivorans ATCC 17616] >gi|160341404|gb|ABX14490.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia multivorans ATCC 17616] (496 aa)
Score = 393, Expect = 2.4e-36, Identities = 99/297 (33%), Positives = 161/297 (54%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           +I+   PRGFC GV  A    ++      A +Y  HE      +VHNK ++++L++ G           +  ++ +E     N   VIFSAHG  +   D+A  +GL ++D TC  VTK H  + +  + G  I  IG   HPE   T+  +++ + L+E+V D++ +     + I +  QTT+S+ +  EI   LK+KY  I    K DIC A ++RQDAV  M  + D+++VVG   S+NS +L E+  K+ + ++++   + I   W   K+ + +T+G S P  LA  VI  L ++LG  N
  S:   188 EILLAQPRGFCAGVDRAIEIVERAIAMHGAPIYVRHE------IVHNKYVVEDLKKKG-----------AIFVEELEEVPAGN--TVIFSAHGVSKAVRDEAGVRGLRIYDATCPLVTKVHVEVAKMRQDGVDIVMIGHKGHPEVEGTMGQVERGMHLVESVEDVQKLELADPERIALVTQTTLSVDDAAEIIAALKAKYPKIREPKKQDICYATQNRQDAVKFMAPQCDVVIVVGSPNSSNSSRLREVAEKRGVAAYMVDAPEQIDPAWVAGKRRIGVTAGASAPEVLAQAVIARL-RELGVRN 472
>gi|91794071|ref|YP_563722.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella denitrificans OS217] >gi|91716073|gb|ABE55999.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella denitrificans OS217] (319 aa)
Score = 393, Expect = 2.6e-36, Identities = 98/287 (34%), Positives = 159/287 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKL-----YPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           + I+   PRGFC GV  A +  ++  +L     Y  HE      +VHN+ ++  L++ G           +  +D +E    N+  IVIFSAHG  Q    +A+++GL VFD TC  VTK H  +     +  +   IG   HPE   T+    + +  + LIE+  D+  ++ ++   +    QTT+S+ +  +I   L+ K+ +IE   K+DIC A ++RQDAV NM ++VDLL+VVG   S+NS +L E+ IK   +++L+    +++ +WF     +A+T+G S P  L   VI
  S:    11 LNILLANPRGFCAGVDRAISIVERALELFEPPIYVRHE------VVHNRYVVDNLKQRG-----------ALFVDELEQVPDNS--IVIFSAHGVSQAVRKEAKDRGLKVFDATCPLVTKVHLQVTRASRKAIECILIGHEGHPEVEGTMGQYDNPNGGVYLIESPEDVAKLKVKNPDNLCFVTQTTLSVDDTLDIIAALQQKFPSIEGPRKDDICYATQNRQDAVRNMAADVDLLIVVGSQNSSNSNRLRELAIKSGTQAYLVDTAADVELDWFTGVTRVAVTAGASAPEILVQQVI 289
>gi|146292165|ref|YP_001182589.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella putrefaciens CN-32] >gi|145563855|gb|ABP74790.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella putrefaciens CN-32] (318 aa)
Score = 393, Expect = 2.7e-36, Identities = 95/287 (33%), Positives = 159/287 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           + I+   PRGFC GV  A +  ++  +L+ +   Y+   +VHN+ +++ L++ G           +  ++ ++    NN  IVIFSAHG  Q    +A+ +GL VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  + LIE+  D+E +       +    QTT+S+ +  +I   L+ ++ +IE   K+DIC A ++RQDAV N+ ++VDLL+VVG   S+NS +L E+ +K   +S+L+    +++  WF N   +A+T+G S P  L   V+
  S:    10 LNILLANPRGFCAGVDRAISIVERALELF-SPPIYVRHEVVHNRYVVQNLKDRG-----------AVFVEELDQVPDNN--IVIFSAHGVSQAVRLEAKARGLRVFDATCPLVTKVHLQVTRASRKGIECILIGHEGHPEVEGTMGQYDNPNGGVYLIESPADVEALEVRDPNNLCFVTQTTLSVDDTLDIIVALQKRFPSIEGPRKDDICYATQNRQDAVRNLSADVDLLIVVGSKNSSNSNRLRELALKTGTQSYLVDTADDVESSWFDNVTRVAVTAGASAPEVLVQQVV 288
>gi|114773700|ref|ZP_01450731.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [alpha proteobacterium HTCC2255] (314 aa)
Score = 393, Expect = 3.0e-36, Identities = 97/287 (33%), Positives = 151/287 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M++    PRGFC GV  A    ++   L+  H  Y+   +VHNK ++  L+E G    +             E+    +  IVIFSAHG  Q    +A ++GL VFD TC  VTK H  +    ++G +   IG   HPE   T+    +    I L+ET  D   ++ ++   ++  +QTT+S+ +  ++ + L+  + NI+   K+DIC A ++RQDAV  M    DLLLVVG   S+NS +L E+ +K    S+LI +   I+ +W   K+ + +T+G S P  L   VI
  S:     1 MQVQLANPRGFCAGVDRAITIVERALDLF-EHPIYVRHEVVHNKFVVDGLKERGAVFVE-------------ELHQVPDDSIVIFSAHGVSQAVRTEATQRGLKVFDATCPLVTKVHMEVMRASKKGIECILIGHKGHPEVEGTMGQYDNPQGGIYLVETAEDARQLQVKNPDALYYCSQTTLSVDDTADVIDALRETFPNIDGPRKDDICYATQNRQDAVREMAVSCDLLLVVGATNSSNSNRLSELAVKLGTPSYLIDDASMIQPQWLEGKQAIGVTAGASAPEILVQGVI 279
>gi|134296672|ref|YP_001120407.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia vietnamiensis G4] >gi|134139829|gb|ABO55572.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia vietnamiensis G4] (326 aa)
Score = 392, Expect = 3.7e-36, Identities = 99/297 (33%), Positives = 160/297 (53%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           +I+   PRGFC GV  A    ++      A +Y  HE      +VHNK ++++L + G           +  ++ +E     N   VIFSAHG  +   D+A  +GL ++D TC  VTK H  + +  + G  I  IG   HPE   T+  +++ + L+E+V D++ +     + I +  QTT+S+ +  EI   LK+KY  I    K DIC A ++RQDAV  M  + D+++VVG   S+NS +L E+  K+ + ++++   + I   W   K+ + +T+G S P  LA  VI  L ++LG  N
  S:    17 EILLAQPRGFCAGVDRAIEIVERAIAMHGAPIYVRHE------IVHNKYVVEDLRKKG-----------AIFVEELEEVPAGN--TVIFSAHGVSKAVRDEADVRGLRIYDATCPLVTKVHVEVAKMRQDGVDIVMIGHKGHPEVEGTMGQVERGMHLVESVEDVQKLELADPERIALVTQTTLSVDDAAEIIGALKAKYPKIREPKKQDICYATQNRQDAVKFMAPQCDVVIVVGSPNSSNSSRLREVAEKRGVAAYMVDAPEQIDPAWVAGKRRIGVTAGASAPEVLAQAVIARL-RELGVRN 301
>gi|19705086|ref|NP_602581.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|50401078|sp|Q8RI52|ISPH_FUSNN 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|19713008|gb|AAL93880.1| LytB protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (827 aa)
Score = 392, Expect = 4.0e-36, Identities = 100/294 (34%), Positives = 169/294 (57%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSI-EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKL 294
           M+II+    GFC GV++A   C  + +      KY++G LVHNK++++++E  G      K  +  E+++ + E+K+ +   IV+  AHGT +   +K +E+ + VFD TCI+V K    I+   E GY I ++G  NHPE    +S    I + E+  + + ++ + +K   ++ QTT++  +FEEI +  K  YKN+   + IC A   RQ AV ++  +V+++++VGD KS+N+KKL EI  K    S+L+ N + +    F  K+ + IT+G STP       I+ +EKK+
  S:     1 MEIIRAKHMGFCFGVLEAINVCNSLVE--EKGRKYILGMLVHNKQVVEDMERKGF-----KLVTEDELLNDMDELKEDD---IVVIRAHGTSKSVHEKLKERKVKVFDATCIFVNKIRQEIEIANENGYSILFMGDKNHPEVKGVISFADDIQIFESFEEAKKLKIDLDKTYLLSTQTTLNKKKFEEIKKYFKENYKNVVIFDKICGATAVRQKAVEDLAVKVEVMIIVGDTKSSNTKKLYEISKKLNDNSYLVENEEQLDLSIFRGKEVVGITAGASTP----EETIMNIEKKV 281
>gi|78060959|ref|YP_370867.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia sp. 383] >gi|77968844|gb|ABB10223.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia sp. 383] (313 aa)
Score = 391, Expect = 4.1e-36, Identities = 93/287 (32%), Positives = 151/287 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M++I   PRGFC GVV A     +      A +Y  HE      +VHN+ +++ L   G +  +             E+ +  +  + IFSAHG  Q     A  +GL V D TC  VTK H   ++ +  G ++  IG   HPE   T+  I   +IL+++  +++ +    + P+    QTT+S+ +   I E L+ ++ ++   +  DIC A ++RQ AV  +  +VD+LLVVG   S+NS +L EIG +  + S+L+ +   +K EWF N K + +T+G S P  +   VI
  S:     1 MRVILAQPRGFCAGVVRAIEIVDRALQQHGAPVYVRHE------IVHNRHVVENLRNKGARFVE-------------ELDEVPHGAVAIFSAHGVAQTVERDAETRGLDVLDATCPLVTKVHVQGRQYVAAGRRLILIGHAGHPEVEGTIGQIPAEVILVQSEAEVDTLTVPVDTPVAYITQTTLSVDDTRGIIEALQRRFTDLVGPDTRDICYATQNRQAAVRELSEQVDVLLVVGATNSSNSNRLREIGTESGVPSYLVADGSEVKAEWFANAKTVGLTAGASAPEEMVEDVI 276
>gi|115352597|ref|YP_774436.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia ambifaria AMMD] >gi|170697686|ref|ZP_02888774.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia ambifaria IOP40-10] >gi|172061459|ref|YP_001809111.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia ambifaria MC40-6] >gi|115282585|gb|ABI88102.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia ambifaria AMMD] >gi|170137434|gb|EDT05674.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia ambifaria IOP40-10] >gi|171993976|gb|ACB64895.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia ambifaria MC40-6] (326 aa)
Score = 391, Expect = 4.5e-36, Identities = 100/297 (33%), Positives = 160/297 (53%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           +I+   PRGFC GV  A    ++      A +Y  HE      +VHNK ++++L++ G           +  ++ +E     N   VIFSAHG  +   D+A  +GL ++D TC  VTK H  + +  + G  I  IG   HPE   T+  +++ + L+E+V D++ +     + I +  QTT+S+ +  EI   LKSKY  I    K DIC A ++RQDAV  M  + D+++VVG   S+NS +L E+  K+ + ++++     I   W   K+ + +T+G S P  LA  VI  L ++LG  N
  S:    17 EILLAQPRGFCAGVDRAIEIVERAIAMHGAPIYVRHE------IVHNKYVVEDLKKKG-----------AIFVEELEEVPAGN--TVIFSAHGVSKAVRDEADVRGLRIYDATCPLVTKVHVEVAKMRQDGVDIVMIGHKGHPEVEGTMGQVERGMHLVESVEDVQKLELADPERIALVTQTTLSVDDAAEIIGALKSKYPKIREPKKQDICYATQNRQDAVKFMAPQCDVVIVVGSPNSSNSSRLREVAEKRGVAAYMVDAPDQIDPAWVAGKRRIGVTAGASAPEVLAQAVIARL-RELGVRN 301
>gi|24375033|ref|NP_719076.1| penicillin tolerance protein LytB [Shewanella oneidensis MR-1] >gi|50401051|sp|Q8EBI7|ISPH_SHEON 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|24349776|gb|AAN56520.1|AE015789_7 penicillin tolerance protein LytB [Shewanella oneidensis MR-1] (318 aa)
Score = 391, Expect = 4.8e-36, Identities = 97/292 (33%), Positives = 159/292 (54%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           + I+   PRGFC GV  A +  ++  +L+ +   Y+   +VHN+ +++ L++ G           +  ++ ++    NN  IVIFSAHG  Q    +A+ +GL VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  + LIE+  D+E +       +    QTT+S+ +  +I   L  ++ +IE   K+DIC A ++RQDAV N+ ++VDLL+VVG   S+NS +L E+ +K   +S+L+    +I   WF N   +A+T+G S P  L   V+  + K
  S:    10 LNIMLANPRGFCAGVDRAISIVERALELF-SPPIYVRHEVVHNRYVVQNLKDRG-----------AVFVEELDQVPDNN--IVIFSAHGVSQAVRAEAKARGLRVFDATCPLVTKVHLQVTRASRKGIECILIGHAGHPEVEGTMGQYDNPNGGVYLIESPADVETLEVRDPNNLCFVTQTTLSVDDTLDIISALLKRFPSIEGPRKDDICYATQNRQDAVRNLSADVDLLIVVGSKNSSNSNRLRELALKTGTQSYLVDTADDIDSSWFENITKVAVTAGASAPEVLVQQVVQAIAK 293
>gi|78067300|ref|YP_370069.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia sp. 383] >gi|77968045|gb|ABB09425.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia sp. 383] (326 aa)
Score = 391, Expect = 4.9e-36, Identities = 99/297 (33%), Positives = 161/297 (54%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           +I+   PRGFC GV  A    ++      A +Y  HE      +VHNK ++++L++ G           +  ++ +E     N   VIFSAHG  +   D+A  +GL ++D TC  VTK H  + +  + G  I  IG   HPE   T+  +++ + L+E+V D++ +     + I +  QTT+S+ +  EI   LK+KY  I    K DIC A ++RQDAV  M  + D+++VVG   S+NS +L E+  K+ ++++++     I   W   K+ + +T+G S P  LA  VI  L ++LG  N
  S:    17 EILLAQPRGFCAGVDRAIEIVERAIAMHGAPIYVRHE------IVHNKYVVEDLKKKG-----------AIFVEELEEVPAGN--TVIFSAHGVSKAVRDEADVRGLRIYDATCPLVTKVHVEVAKMRQDGVDIVMIGHKGHPEVEGTMGQVERGMHLVESVEDVQKLELADPERIALVTQTTLSVDDAAEIIGALKAKYPKIREPKKQDICYATQNRQDAVKFMAPQCDVVIVVGSPNSSNSSRLREVAEKRGVDAYMVDAPDQIDPAWVAGKRRIGVTAGASAPEVLAQAVIARL-RELGVRN 301
>gi|107023437|ref|YP_621764.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia cenocepacia AU 1054] >gi|105893626|gb|ABF76791.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia cenocepacia AU 1054] (326 aa)
Score = 390, Expect = 5.7e-36, Identities = 99/297 (33%), Positives = 160/297 (53%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           +I+   PRGFC GV  A    ++      A +Y  HE      +VHNK ++++L++ G           +  ++ +E     N   VIFSAHG  +   D+A  +GL ++D TC  VTK H  + +  + G  I  IG   HPE   T+  +++ + L+E+V D++ +     + I +  QTT+S+ +  EI   LK+KY  I    K DIC A ++RQDAV  M  + D+++VVG   S+NS +L E+  K+ + ++++     I   W   K+ + +T+G S P  LA  VI  L ++LG  N
  S:    17 EILLAQPRGFCAGVDRAIEIVERAIAMHGAPIYVRHE------IVHNKYVVEDLKKKG-----------AIFVEELEEVPAGN--TVIFSAHGVSKAVRDEADVRGLRIYDATCPLVTKVHVEVAKMRQDGVDIVMIGHKGHPEVEGTMGQVERGMHLVESVEDVQKLELADPERIALVTQTTLSVDDAAEIIGALKAKYPKIREPKKQDICYATQNRQDAVKFMAPQCDVVIVVGSPNSSNSSRLREVAEKRGVAAYMVDAPDQIDPAWVAGKRRIGVTAGASAPEALAQAVIARL-RELGVRN 301
>gi|121595742|ref|YP_987638.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Acidovorax sp. JS42] >gi|120607822|gb|ABM43562.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Acidovorax sp. JS42] (331 aa)
Score = 390, Expect = 6.0e-36, Identities = 99/294 (33%), Positives = 159/294 (54%)
  Q:     2 KIIKITPRGFCKGVVDAY-----ATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           +I+   PRGFC GV  A      A  K  A +Y  HE      +VHN  ++ +L+  G                +I I+D +  P    +IFSAHG  +   D+AR +G  +FD TC  VTK H  + +  ++GY+   IG   HPE   T+  +D  I L+E V D+  ++    + + V  QTT+S+ +  EIT  +++++ +I    + DIC A ++RQDAV  +  +VDL++VVG   S+NS +L E+  +    +++I +   ++ EWF     + +T+G S P  L   VI  + K+LG
  S:     6 EIVLAEPRGFCAGVDRAIEIVERAIAKFGAPIYVRHE------IVHNTYVVNDLKAKG----------------AIFIEDLDEVPPGATLIFSAHGVSRAVQDEARARGFTIFDATCPLVTKVHVEVAKLAKEGYEFIMIGHKGHPEVEGTMGQLDHGIHLVEDVADVARVQPAQTEKLAVVTQTTLSVDDAAEITAAVRARFPSIREPKQQDICYATQNRQDAVKLLSPQVDLVVVVGSPTSSNSNRLRELAARLGTPAYMIDSVDELRHEWFDGISRVGLTAGASAPEVLVQAVITRI-KELG 287
>gi|116690519|ref|YP_836142.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia cenocepacia HI2424] >gi|170733860|ref|YP_001765807.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia cenocepacia MC0-3] >gi|116648608|gb|ABK09249.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia cenocepacia HI2424] >gi|169817102|gb|ACA91685.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia cenocepacia MC0-3] (326 aa)
Score = 390, Expect = 6.6e-36, Identities = 99/297 (33%), Positives = 160/297 (53%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           +I+   PRGFC GV  A    ++      A +Y  HE      +VHNK ++++L++ G           +  ++ +E     N   VIFSAHG  +   D+A  +GL ++D TC  VTK H  + +  + G  I  IG   HPE   T+  +++ + L+E+V D++ +     + I +  QTT+S+ +  EI   LK+KY  I    K DIC A ++RQDAV  M  + D+++VVG   S+NS +L E+  K+ + ++++     I   W   K+ + +T+G S P  LA  VI  L ++LG  N
  S:    17 EILLAQPRGFCAGVDRAIEIVERAIAMHGAPIYVRHE------IVHNKYVVEDLKKKG-----------AIFVEELEEVPAGN--TVIFSAHGVSKAVRDEADVRGLRIYDATCPLVTKVHVEVAKMRQDGVDIVMIGHKGHPEVEGTMGQVERGMHLVESVEDVQKLELADPERIALVTQTTLSVDDAAEIIGALKAKYPKIREPKKQDICYATQNRQDAVKFMAPQCDVVIVVGSPNSSNSSRLREVAEKRGVAAYMVDAPDQIDPAWVAGKRRIGVTAGASAPEVLAQAVIARL-RELGVRN 301
>gi|83717856|ref|YP_440431.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia thailandensis E264] >gi|167579084|ref|ZP_02371958.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia thailandensis TXDOH] >gi|167617197|ref|ZP_02385828.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia thailandensis Bt4] >gi|83651681|gb|ABC35745.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia thailandensis E264] (313 aa)
Score = 389, Expect = 8.2e-36, Identities = 93/290 (32%), Positives = 154/290 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFL 290
           M++I   PRGFC GVV A    ++      A +Y  HE      +VHN+ +++ L   G +  +             E+ +  +  + IFSAHG  Q     A  +GL V D TC  VTK H   ++ +  G ++  IG   HPE   T+  I   +IL+++  +++ +   ++ P+    QTT+S+ +   I E L+ ++ +I   +  DIC A ++RQ AV  +  +VD+LLVVG   S+NS +L EIG +  + S+L+ +   I+ EWF + + + +T+G S P  +   VI  L
  S:     1 MRVILAQPRGFCAGVVRAIEIVERALQQNGAPVYVRHE------IVHNRHVVENLRNKGARFVE-------------ELDEVPHGAVAIFSAHGVAQTVEKDADARGLDVLDATCPLVTKVHVQGRQYVAAGRRLILIGHAGHPEVEGTIGQIPAEVILVQSEAEVDTLTLPADTPVAYVTQTTLSVDDTRGIIEALQRRFTDIVGPDTRDICYATQNRQAAVRELSEQVDVLLVVGATNSSNSNRLREIGTESGVPSYLVADGSEIRAEWFASARTVGLTAGASAPEEMVEDVIAAL 279
>gi|91780048|ref|YP_555256.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia xenovorans LB400] >gi|91692708|gb|ABE35906.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia xenovorans LB400] (314 aa)
Score = 388, Expect = 9.6e-36, Identities = 95/287 (33%), Positives = 150/287 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M++I   PRGFC GVV A     +      A +Y  HE      +VHN+ ++  L + G +  +             E+ +     + IFSAHG  Q     A  +GL V D TC  VTK H   ++ +  G  +  IG   HPE   T+  I   ++L+++  ++EN+    + P+    QTT+S+ +   I + L S++ +I   +  DIC A ++RQ AV  +  +VD+LLVVG   S+NS +L EIG +  + S+L+ +   +K EWF N + + IT+G S P  +   VI
  S:     1 MRVILAQPRGFCAGVVRAIEIVDRALQQHGAPVYVRHE------IVHNRHVVDNLRQKGARFVE-------------ELDEVPQGAVAIFSAHGVAQTVERDAEARGLDVLDATCPLVTKVHVQGRQYVGAGRTLILIGHAGHPEVEGTVGQIPGKVLLVQSEAEVENLDLPLDTPLAYVTQTTLSVDDTRGIIDALLSRFTDIVGPDTRDICYATQNRQAAVRELSKQVDVLLVVGATNSSNSNRLREIGSESGVASYLVADGSEVKPEWFANVQTVGITAGASAPEEMVKNVI 276
>gi|114564051|ref|YP_751565.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella frigidimarina NCIMB 400] >gi|114335344|gb|ABI72726.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella frigidimarina NCIMB 400] (319 aa)
Score = 388, Expect = 1.0e-35, Identities = 100/287 (34%), Positives = 158/287 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKL-----YPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           + I+   PRGFC GV  A +  ++  +L     Y  HE      +VHN+ +++ L++ G           +  ID ++    N+  IVIFSAHG  Q    +A+ +GL VFD TC  VTK H  +     +G +   IG   HPE   T+    +    + LIE+  D+ N++  +   +    QTT+S+ +  +I   L+ ++ +IE   K+DIC A ++RQDAV +M SEVDLL+VVG   S+NS +L E+  K   +S+L+    +++  WF   K +A+T+G S P  L   V+
  S:    11 LSILLANPRGFCAGVDRAISIVERALELFEPPIYVRHE------VVHNRYVVENLKQRG-----------ALFIDELDQVPDNS--IVIFSAHGVSQAVRKEAKNRGLKVFDATCPLVTKVHLQVTRASRKGIECILIGHEGHPEVEGTMGQYDNPKGGVYLIESPEDVNNLQVNNPDNLCFVTQTTLSVDDTLDIITALQKRFPSIEGPRKDDICYATQNRQDAVRSMSSEVDLLIVVGSKNSSNSNRLRELAEKTGTQSYLVDTAADVEAMWFDGVKKVAVTAGASAPEVLVQQVV 289
>gi|33151334|ref|NP_872687.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus ducreyi 35000HP] >gi|50400968|sp|Q7VPK4|ISPH_HAEDU 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|33147554|gb|AAP95076.1| hydroxymethylbutenyl pyrophosphate reductase [Haemophilus ducreyi 35000HP] (314 aa)
Score = 388, Expect = 1.0e-35, Identities = 102/291 (35%), Positives = 151/291 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           M I+   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++ +L+  G              I   E+ +  +  IVIFSAHG  Q    +A+ +GL VFD TC  VTK H  +    ++G +   IG   HPE I T+    +    I L+ETV DI N+     + +    QTT+S+ +   + E LK+KY  I+   KNDIC A  +RQ AV  +  +  L+LVVG   S+NS +L E+  +  + + LI   ++I  EW  N + + IT+G S P  L   V+  L+
  S:     1 MNILLANPRGFCAGVDRAISIVELALEVHGAPIYVRHE------VVHNRFVVDDLKAKGA-------------IFVEELDEVPDSAIVIFSAHGVSQAVRQEAKRRGLKVFDATCPLVTKVHMQVARASKKGTKAILIGHQGHPEVIGTMGQYYNEQAGIFLVETVEDIANLPIHHHEDLTFMTQTTLSVDDTSGMIEALKNKYPAIQGPRKNDICYATTNRQQAVRELAKQAQLVLVVGSKNSSNSNRLAELASRMGVLAKLIDGPQDILPEWLDNVETIGITAGASAPEILVQSVVAHLQ 283
>gi|121600321|ref|YP_993941.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia mallei SAVP1] >gi|126451397|ref|YP_001081628.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia mallei NCTC 10247] >gi|121229131|gb|ABM51649.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei SAVP1] >gi|126244267|gb|ABO07360.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei NCTC 10247] (320 aa)
Score = 388, Expect = 1.1e-35, Identities = 97/297 (32%), Positives = 161/297 (54%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           +I+   PRGFC GV  A    ++      A +Y  HE      +VHNK ++++L++ G           +  ++ +E     N   VIFSAHG  +   D+A  +GL ++D TC  VTK H  + +  ++G  I  IG   HPE   T+  +++ + L+E+V D+  +     + + +  QTT+S+ +  EI   LK+K+  I    K DIC A ++RQDAV  M  + D+++VVG   S+NS +L E+  K+ + ++++   + I   W   K+ + +T+G S P  LA  VI  L ++LG  N
  S:    11 EILLAQPRGFCAGVDRAIEIVERAIAMHGAPIYVRHE------IVHNKYVVEDLKKKG-----------AIFVEELEEVPSGN--TVIFSAHGVSKAVRDEAAVRGLRIYDATCPLVTKVHVEVAKMRQEGVDIVMIGHKGHPEVEGTMGQVERGMHLVESVEDVRRLELPDPERVALVTQTTLSVDDAAEIIGALKAKFPAIREPKKQDICYATQNRQDAVKFMAPQCDVVIVVGSPNSSNSSRLREVAEKRGVAAYMVDAPEQIDPAWVAGKRRIGVTAGASAPEVLAQAVIARL-RELGVTN 295
>gi|53718560|ref|YP_107546.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei K96243] >gi|53726243|ref|YP_103792.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia mallei ATCC 23344] >gi|67641252|ref|ZP_00440034.1| COG0761: Penicillin tolerance protein [Burkholderia mallei GB8 horse 4] >gi|76811645|ref|YP_332553.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 1710b] >gi|124385365|ref|YP_001027005.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia mallei NCTC 10229] >gi|126440135|ref|YP_001058032.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 668] >gi|134281185|ref|ZP_01767894.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 305] >gi|161370779|ref|ZP_02110345.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 1710a] >gi|166998915|ref|ZP_02264767.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia mallei PRL-20] >gi|167718471|ref|ZP_02401707.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei DM98] >gi|167814640|ref|ZP_02446320.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 91] >gi|167901653|ref|ZP_02488858.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei NCTC 13177] >gi|167909903|ref|ZP_02496994.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 112] >gi|194316441|ref|YP_002012051.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei ATCC 10399] >gi|194504183|ref|YP_002033755.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 1655] >gi|194508566|ref|YP_002021100.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei Pasteur 52237] >gi|194516524|ref|YP_002051419.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei S13] >gi|194522731|ref|YP_002058264.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei FMH] >gi|194527713|ref|YP_002063236.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei JHU] >gi|194577015|ref|YP_002111896.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei 2002721280] >gi|71152165|sp|Q63WH0|ISPH1_BURPS 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 1 >gi|71152166|sp|Q62HM8|ISPH2_BURMA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 2 >gi|52208974|emb|CAH34913.1| LytB protein [Burkholderia pseudomallei K96243] >gi|52429666|gb|AAU50259.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei ATCC 23344] >gi|76581098|gb|ABA50573.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 1710b] >gi|124293385|gb|ABN02654.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei NCTC 10229] >gi|126219628|gb|ABN83134.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 668] >gi|134247491|gb|EBA47576.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 305] >gi|147746741|gb|EDK53818.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei FMH] >gi|147751723|gb|EDK58790.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei JHU] >gi|148025273|gb|EDK83427.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei 2002721280] >gi|157938545|gb|EDO94215.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei Pasteur 52237] >gi|160696739|gb|EDP86709.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia mallei ATCC 10399] >gi|169653757|gb|EDS86450.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei S13] >gi|184212020|gb|EDU09063.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 1655] (326 aa)
Score = 388, Expect = 1.1e-35, Identities = 97/297 (32%), Positives = 161/297 (54%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           +I+   PRGFC GV  A    ++      A +Y  HE      +VHNK ++++L++ G           +  ++ +E     N   VIFSAHG  +   D+A  +GL ++D TC  VTK H  + +  ++G  I  IG   HPE   T+  +++ + L+E+V D+  +     + + +  QTT+S+ +  EI   LK+K+  I    K DIC A ++RQDAV  M  + D+++VVG   S+NS +L E+  K+ + ++++   + I   W   K+ + +T+G S P  LA  VI  L ++LG  N
  S:    17 EILLAQPRGFCAGVDRAIEIVERAIAMHGAPIYVRHE------IVHNKYVVEDLKKKG-----------AIFVEELEEVPSGN--TVIFSAHGVSKAVRDEAAVRGLRIYDATCPLVTKVHVEVAKMRQEGVDIVMIGHKGHPEVEGTMGQVERGMHLVESVEDVRRLELPDPERVALVTQTTLSVDDAAEIIGALKAKFPAIREPKKQDICYATQNRQDAVKFMAPQCDVVIVVGSPNSSNSSRLREVAEKRGVAAYMVDAPEQIDPAWVAGKRRIGVTAGASAPEVLAQAVIARL-RELGVTN 301
>gi|88858000|ref|ZP_01132642.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudoalteromonas tunicata D2] >gi|88819617|gb|EAR29430.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudoalteromonas tunicata D2] (309 aa)
Score = 388, Expect = 1.1e-35, Identities = 98/292 (33%), Positives = 157/292 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKK-----IAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           MK++   PRGFC GV  A +  ++      A +Y  HE      +VHNK ++  L++ G    D+ +          ++ D N   IVIFSAHG  Q    +A+ + L VFD TC  VTK H  +     +G +   IG   HPE   T+    S    I L+ET  D+ N+  +    +F  +QTT+S+ +  ++ + L++K+  I+   K+DIC A ++RQDAV  +  + D+LLVVG   S+NS +L E+  K    ++LI +  +++  WF     + +T+G S P  L   V+  L++
  S:     1 MKVLLANPRGFCAGVDRAISIVERALDIFTAPIYVRHE------VVHNKYVVDSLKKRGAVFVDELD----------QVPDDN---IVIFSAHGVSQAVRAEAKRRALRVFDATCPLVTKVHMEVTRASRRGTECILIGHQGHPEVEGTMGQYDSKKGGIYLVETAEDVTNLVVKDPSNLFYCSQTTLSVDDTADVIDALRAKFPQIDGPRKDDICYATQNRQDAVRELAEKADVLLVVGAKNSSNSNRLRELADKMGTTAYLIDDASSMEQTWFKASDTIGVTAGASAPEILVKQVVAQLKE 284
>gi|186472955|ref|YP_001860297.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia phymatum STM815] >gi|184195287|gb|ACC73251.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia phymatum STM815] (314 aa)
Score = 387, Expect = 1.2e-35, Identities = 95/287 (33%), Positives = 148/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M++I   PRGFC GVV A     +      A +Y  HE      +VHN+ ++  L + G +  +             E+ +     + IFSAHG  Q     A ++GL V D TC  VTK H   ++ +  G  +  IG   HPE   T+  I   ++L+++  ++  +    + P+    QTT+S+ +   I   LK ++ +I   +  DIC A ++RQ AV  + S+VD+LLVVG   S+NS +L EIG +  + S+L+ +   IK EWF N   + IT+G S P  +   VI
  S:     1 MRVILAQPRGFCAGVVRAIEIVDRALQQHGAPVYVRHE------IVHNRHVVDNLRQKGARFVE-------------ELDEVPQGAVAIFSAHGVSQSVERDAEQRGLDVLDATCPLVTKVHVQGRQYVAGGRTLILIGHAGHPEVEGTIGQIPGKVLLVQSEAEVAQLELPIDTPLAYVTQTTLSVDDTRGIINALKRRFPDIVGPDTRDICYATQNRQAAVRELSSQVDVLLVVGATNSSNSNRLREIGSESGVPSYLVADGSEIKPEWFANVTTVGITAGASAPEEMVENVI 276
>gi|91786853|ref|YP_547805.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Polaromonas sp. JS666] >gi|123165316|sp|Q12EY5|ISPH_POLSJ 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|91696078|gb|ABE42907.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Polaromonas sp. JS666] (333 aa)
Score = 386, Expect = 1.7e-35, Identities = 96/286 (33%), Positives = 155/286 (54%)
  Q:     2 KIIKITPRGFCKGVVDAY-----ATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +I+   PRGFC GV  A      A  K  A +Y  HE      +VHN  ++ EL+  G                +I I++ ++ P    ++FSAHG  +   D+AR +G  +FD TC  VTK H  + +  ++GY+   IG   HPE   T+  +D  I L+E V D+  I     + + V  QTT+S+ +  EI+  +K+++  +    + DIC A ++RQDAV  +  +VD+L+VVG   S+NS +L E+  K   E++++ +   +++ WF  K  + +T+G S P  L   VI
  S:    10 EILLAEPRGFCAGVDRAIEIVERALTKFGAPIYVRHE------IVHNTYVVNELKAKG----------------AIFIEELSDVPPGATLVFSAHGVSKAIQDEARARGFQIFDATCPLVTKVHVEVAKLHKEGYEFIMIGHKGHPEVEGTMGQLDSGIHLVEDVADVARITPSQTERLAVVTQTTLSVDDAAEISAAVKARFPQVREPKQQDICYATQNRQDAVKVLSPQVDILIVVGSPTSSNSNRLRELAAKLGTEAYMVDDASELRESWFEGKSRVGLTAGASAPEILVKQVI 284
>gi|59711077|ref|YP_203853.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio fischeri ES114] >gi|71152199|sp|Q5E7N1|ISPH_VIBF1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|59479178|gb|AAW84965.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase, 4Fe-4S protein [Vibrio fischeri ES114] (314 aa)
Score = 386, Expect = 1.8e-35, Identities = 100/297 (33%), Positives = 165/297 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTA 297
           MKI+   PRGFC GV  A +  ++  +LY     Y+   +VHN+ +++ L++ G    ++ +          E+ D N   IVIFSAHG  Q    +A+E+ L VFD TC  VTK H  +    ++  ++  IG   HPE   T+    S    + L+ET +D+  +  +    +   +QTT+S+ E  ++ + L+  +  I+   K+DIC A ++RQDAV +M S+VD+++VVG   S+NS +L E+  K    S+LI   +++K+EW   +  + +T+G S P  L N +I  ++   GTA
  S:     1 MKIVLANPRGFCAGVDRAISIVERALELY-EAPIYVRHEVVHNRFVVEGLKQRGAIFVEELH----------EVPDDN---IVIFSAHGVSQAVRKEAKERALTVFDATCPLVTKVHMEVARASKKNIEVVLIGHAGHPEVEGTMGQYASDSAGMYLVETPDDVIKLNVKDPSNLHYVSQTTLSVDETADVIDELRRVFPEIQGPRKDDICYATQNRQDAVRDMASQVDVMIVVGSKNSSNSNRLRELSEKLGTTSYLIDCPEDLKEEWLTEQTKVGVTAGASAPEELVNQIIEQVKAFGGTA 289
>gi|68249590|ref|YP_248702.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus influenzae 86-028NP] >gi|145634181|ref|ZP_01789892.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus influenzae PittAA] >gi|145637311|ref|ZP_01792972.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus influenzae PittHH] >gi|81335981|sp|Q4QLQ5|ISPH_HAEI8 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|68057789|gb|AAX88042.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus influenzae 86-028NP] >gi|145268625|gb|EDK08618.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus influenzae PittAA] >gi|145269563|gb|EDK09505.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus influenzae PittHH] (314 aa)
Score = 386, Expect = 1.9e-35, Identities = 105/292 (35%), Positives = 152/292 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           MKII   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L + G              I   E+ +  +  IVIFSAHG  Q    +A+++ L VFD TC  VTK H  +     +G +   IG   HPE   T+    + D  I LIE V DI  +  +    +    QTT+S+ +  E    LK KY  I+   KNDIC A  +RQ+AV  +    DL+LVVG   S+NS +L E+  +  I+S L+ +  +I+D+WF + K + IT+G S P  L   +I  L++
  S:     1 MKIILANPRGFCAGVDRAISIVELALEIHGAPIYVRHE------VVHNRFVVNGLRDRGA-------------IFVEELSEVPDGAIVIFSAHGVSQAVRQEAKDRNLKVFDATCPLVTKVHMQVARASRKGTKAILIGHKGHPEVEGTMGQYSNEDGGIFLIEKVEDIARLPMQDNDDLTFMTQTTLSLDDTAETIAALKEKYPAIQGPHKNDICYATTNRQEAVRELAKLSDLVLVVGSKNSSNSNRLAELASRMGIKSQLLDDPSDIQDDWFNDVKTIGITAGASAPEELVQSIISRLKE 284
>gi|126454143|ref|YP_001065267.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 1106a] >gi|161357141|ref|ZP_02103017.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 1106b] >gi|167844671|ref|ZP_02470179.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei B7210] >gi|167893200|ref|ZP_02480602.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 7894] >gi|167917925|ref|ZP_02505016.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei BCC215] >gi|126227785|gb|ABN91325.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 1106a] (326 aa)
Score = 385, Expect = 2.2e-35, Identities = 96/297 (32%), Positives = 161/297 (54%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           +I+   PRGFC GV  A    ++      A +Y  HE      +VHNK ++++L++ G           +  ++ +E     N   VIFSAHG  +   D+A  +GL ++D TC  VTK H  + +  ++G  I  IG   HPE   T+  +++ + L+E+V D+  +     + + +  QTT+S+ +  EI   L++K+  I    K DIC A ++RQDAV  M  + D+++VVG   S+NS +L E+  K+ + ++++   + I   W   K+ + +T+G S P  LA  VI  L ++LG  N
  S:    17 EILLAQPRGFCAGVDRAIEIVERAIAMHGAPIYVRHE------IVHNKYVVEDLKKKG-----------AIFVEELEEVPSGN--TVIFSAHGVSKAVRDEAAVRGLRIYDATCPLVTKVHVEVAKMRQEGVDIVMIGHKGHPEVEGTMGQVERGMHLVESVEDVRRLELPDPERVALVTQTTLSVDDAAEIIGALRAKFPAIREPKKQDICYATQNRQDAVKFMAPQCDVVIVVGSPNSSNSSRLREVAEKRGVAAYMVDAPEQIDPAWVAGKRRIGVTAGASAPEVLAQAVIARL-RELGVTN 301
>gi|83720986|ref|YP_441339.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia thailandensis E264] >gi|167580125|ref|ZP_02372999.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia thailandensis TXDOH] >gi|167618189|ref|ZP_02386820.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia thailandensis Bt4] >gi|83654811|gb|ABC38874.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia thailandensis E264] (326 aa)
Score = 385, Expect = 2.3e-35, Identities = 97/297 (32%), Positives = 161/297 (54%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           +I+   PRGFC GV  A    ++      A +Y  HE      +VHNK ++++L++ G           +  ++ +E     N   VIFSAHG  +   D+A  +GL ++D TC  VTK H  + +  ++G  I  IG   HPE   T+  +++ + L+E+V D+  +     + + +  QTT+S+ +  EI   LK+K+  I    K DIC A ++RQDAV  M  + D+++VVG   S+NS +L E+  K+ + ++++   + I   W   K+ + +T+G S P  LA  VI  L ++LG  N
  S:    17 EILLAQPRGFCAGVDRAIEIVERAIAMHGAPIYVRHE------IVHNKYVVEDLKKKG-----------AIFVEELEEVPSGN--TVIFSAHGVSKAVRDEAAVRGLRIYDATCPLVTKVHVEVAKMRQEGVDIVMIGHKGHPEVEGTMGQVERGMHLVESVEDVLKLELPDPERVALVTQTTLSVDDAAEIIGALKAKFPAIREPKKQDICYATQNRQDAVKFMAPQCDVVIVVGSPNSSNSSRLREVAEKRGVAAYMVDAPEQIDPAWVAGKRRIGVTAGASAPEVLAQAVIARL-RELGVTN 301
>gi|46129067|ref|ZP_00201988.1| COG0761: Penicillin tolerance protein [Haemophilus influenzae R2846] (314 aa)
Score = 385, Expect = 2.3e-35, Identities = 105/292 (35%), Positives = 152/292 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           MKII   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L + G              I   E+ +  +  IVIFSAHG  Q    +A+++ L VFD TC  VTK H  +     +G +   IG   HPE   T+    + D  I LIE V DI  +  +    +    QTT+S+ +  E    LK KY  I+   KNDIC A  +RQ+AV  +    DL+LVVG   S+NS +L E+  +  I+S L+ +  +I+D+WF + K + IT+G S P  L   +I  L++
  S:     1 MKIILANPRGFCAGVDRAISIVELALEIHGAPIYVRHE------VVHNRFVVNGLRDRGA-------------IFVEELSEVPDGAIVIFSAHGVSQAVRQEAKDRNLKVFDATCPLVTKVHMQVARASRKGTKAILIGHKGHPEVEGTMGQYSNEDGGIFLIEKVEDIARLPMQENDNLTFMTQTTLSLDDTAETIAALKEKYPAIQGPHKNDICYATTNRQEAVRELAKLSDLVLVVGSKNSSNSNRLAELASRMGIKSQLLDDPSDIQDDWFNDVKTIGITAGASAPEELVQSIISRLKE 284
>gi|34762725|ref|ZP_00143715.1| LytB protein; SSU ribosomal protein S1P [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887624|gb|EAA24703.1| LytB protein; SSU ribosomal protein S1P [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (827 aa)
Score = 385, Expect = 2.5e-35, Identities = 97/294 (32%), Positives = 167/294 (56%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKL 294
           M+II+    GFC GV++A   C  + +      KY++G LVHNK+++++++  G      K  + +E+++ ++   + +  IV+  AHGT +   +K +E+ + VFD TCI+V K    I+   E GY I ++G  NHPE    +S    I + E   + + ++ + +K   ++ QTT++  +FEEI +  K  YKN+   + IC A   RQ AV ++  +V+++++VGD KS+N+KKL EI  K    S+L+ N + +    F  K+ + IT+G STP       I+ +EKK+
  S:     1 MEIIRAKHMGFCFGVLEAINVCNSLVE--EKGRKYILGMLVHNKQVVEDMQRKGF-----KLVTENELLEDMDGLKEGD--IVVIRAHGTSKSVHEKLKERKVKVFDATCIFVNKIRQEIEIANENGYSILFMGDKNHPEVKGVISFADDIQIFEGFEEAKKLKIDLDKTYLLSTQTTLNKKKFEEIKKYFKENYKNVIIFDKICGATAVRQKAVEDLAIKVEVMIIVGDTKSSNTKKLYEISKKLNGNSYLVENEEQLDLTIFRGKEVVGITAGASTP----EETIMNIEKKI 281
>gi|116620382|ref|YP_822538.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Solibacter usitatus Ellin6076] >gi|116223544|gb|ABJ82253.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Solibacter usitatus Ellin6076] (323 aa)
Score = 384, Expect = 2.8e-35, Identities = 101/291 (34%), Positives = 147/291 (50%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           KI  + PRGFC GVV A    K    LY     Y+   +VHNK +++EL E G    +             E+ +  +    IFSAHG       +A+E+ L + D TC  VTK H         G+ I  IG  +H E I TL  +     L+ET +D++N+       +    QTT+S+ E  +I + LK ++  IE     DIC A ++RQ AV  + + VDLLLVVG   S+NSK+LVE+G    + SHL+ +  ++   W    K + +T+G S P  L   +I FL +
  S:    15 KIFLLKPRGFCAGVVRAIDVVKIALDLY-GPPVYVRKEIVHNKHVVEELREAGAVFVE-------------ELDEVPSGARAIFSAHGVSPAVRAQAKERNLEIIDATCPLVTKVHLEAVRFARDGFSIVLIGHKDHDEVIGTLGEVPDRSYLVETTDDVDNLVLPDPTRVRYLTQTTLSLDETRDIVDRLKQRFPMIEGPHSQDICYATENRQMAVKAISTNVDLLLVVGSENSSNSKRLVEVGDNFGVRSHLVNDRGDVDASWLDGVKNVGVTAGASAPEHLVQELIEFLRE 294
>gi|17547161|ref|NP_520563.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ralstonia solanacearum GMI1000] >gi|20138571|sp|P58677|ISPH_RALSO 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|17429463|emb|CAD16149.1| probable 4-hydroxy-3-methylbut-2-enyl diphosphate reductase protein [Ralstonia solanacearum] (324 aa)
Score = 384, Expect = 3.3e-35, Identities = 89/286 (31%), Positives = 155/286 (54%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPI---VIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRGFC GV  A    ++      A +Y  HE      +VHN  ++ +L   G                ++ +++ ++ P+   VIFSAHG  +     A  +GL VFD TC  VTK H  + +   QG++I  IG   HPE   T+   D  ++L+E+V+D+  +  +    +    QTT+S+ E +EI   +K+++  +    K DIC A ++RQDAV  M  +V++++VVG   S+NS +L E+  K  + ++++   + ++ EW   K+ + +T+G S P  LA  ++
  S:    18 EVLLAQPRGFCAGVDRAIEIVERALQRFGAPIYVRHE------IVHNAYVVSDLRSKG----------------AVFVQELDDVPVGGTVIFSAHGVSRAVRQAAEARGLRVFDATCPLVTKVHVEVSKMRTQGFEIIMIGHKGHPEVEGTMGQADDGMLLVESVDDVARLAVKDPARLAYVTQTTLSVDETQEIVAAIKARFPAVHEPKKQDICYATQNRQDAVKFMAPQVEVVIVVGSPNSSNSNRLRELAEKLGVPAYMVDTPEQVRPEWLAGKRRVGLTAGASAPEELAQSIV 292
>gi|1074602|pir||A64164 lytB protein homolog HI1007 - Haemophilus influenzae (strain Rd KW20) (318 aa)
Score = 383, Expect = 3.5e-35, Identities = 104/292 (35%), Positives = 150/292 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           MKII   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L E G              I   E+ +  +  IVIFSAHG  Q    +A+++ L VFD TC  VTK H  +     +G +   IG   HPE   T+    + D  I LIE V DI  +  +    +    QTT+S+ +  E    LK KY  I+   KNDIC A  +RQ+AV  +    DL+LVVG   S+NS +L E+  +  ++S L+    +I+ +WF + K + IT+G S P  L   +I  L++
  S:     5 MKIILANPRGFCAGVDRAISIVELALEIHGAPIYVRHE------VVHNRFVVNGLRERGA-------------IFVEELSEVPDGAIVIFSAHGVSQAVRQEAKDRNLKVFDATCPLVTKVHMQVARASRKGTKAILIGHKGHPEVEGTMGQYSNEDGGIFLIEKVEDIARLPMQENDNLTFMTQTTLSLDDTAETIAALKEKYPAIQGPHKNDICYATTNRQEAVRELAKLSDLVLVVGSKNSSNSNRLAELASRMGVKSQLLDEPADIQADWFNDVKTIGITAGASAPEELGQSIISRLKR 288
>gi|16272942|ref|NP_439168.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus influenzae Rd KW20] >gi|1170849|sp|P44976|ISPH_HAEIN 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|1574037|gb|AAC22668.1| penicillin tolerance protein (lytB) [Haemophilus influenzae Rd KW20] (314 aa)
Score = 383, Expect = 3.6e-35, Identities = 104/292 (35%), Positives = 150/292 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           MKII   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L E G              I   E+ +  +  IVIFSAHG  Q    +A+++ L VFD TC  VTK H  +     +G +   IG   HPE   T+    + D  I LIE V DI  +  +    +    QTT+S+ +  E    LK KY  I+   KNDIC A  +RQ+AV  +    DL+LVVG   S+NS +L E+  +  ++S L+    +I+ +WF + K + IT+G S P  L   +I  L++
  S:     1 MKIILANPRGFCAGVDRAISIVELALEIHGAPIYVRHE------VVHNRFVVNGLRERGA-------------IFVEELSEVPDGAIVIFSAHGVSQAVRQEAKDRNLKVFDATCPLVTKVHMQVARASRKGTKAILIGHKGHPEVEGTMGQYSNEDGGIFLIEKVEDIARLPMQENDNLTFMTQTTLSLDDTAETIAALKEKYPAIQGPHKNDICYATTNRQEAVRELAKLSDLVLVVGSKNSSNSNRLAELASRMGVKSQLLDEPADIQADWFNDVKTIGITAGASAPEELGQSIISRLKR 284
>gi|161519802|ref|YP_001583229.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia multivorans ATCC 17616] >gi|189354019|ref|YP_001949646.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia multivorans ATCC 17616] >gi|160343852|gb|ABX16937.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia multivorans ATCC 17616] >gi|189338041|dbj|BAG47110.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia multivorans ATCC 17616] (313 aa)
Score = 383, Expect = 4.0e-35, Identities = 92/287 (32%), Positives = 151/287 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M++I   PRGFC GVV A     +      A +Y  HE      +VHN+ +++ L   G +  +             E+ +  +  + IFSAHG  Q     A+ +GL V D TC  VTK H   ++ +  G ++  IG   HPE   T+  I   +IL+++  +++ +    + P+    QTT+S+ +   I E L+ ++ +I   +  DIC A ++RQ AV  +  +VD+LLVVG   S+NS +L EIG +  + S+L+ +   +K EWF   + + +T+G S P  +   VI
  S:     1 MRVILAQPRGFCAGVVRAIEIVDRALQQHGAPVYVRHE------IVHNRHVVENLRNKGARFVE-------------ELDEVPHGAVAIFSAHGVAQTVERDAQTRGLDVLDATCPLVTKVHVQGRQYVAAGRRLILIGHAGHPEVEGTIGQIPAEVILVQSEAEVDTLTLPVDTPVAYVTQTTLSVDDTRGIIEALQRRFTDIVGPDTRDICYATQNRQAAVRELSGQVDVLLVVGATNSSNSNRLREIGTESGVPSYLVADGSEVKAEWFAGVQTVGLTAGASAPEEMVEDVI 276
>gi|107027644|ref|YP_625155.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia cenocepacia AU 1054] >gi|116693645|ref|YP_839178.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia cenocepacia HI2424] >gi|170737080|ref|YP_001778340.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia cenocepacia MC0-3] >gi|105897018|gb|ABF80182.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia cenocepacia AU 1054] >gi|116651645|gb|ABK12285.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia cenocepacia HI2424] >gi|169819268|gb|ACA93850.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia cenocepacia MC0-3] (313 aa)
Score = 382, Expect = 4.7e-35, Identities = 92/287 (32%), Positives = 151/287 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M++I   PRGFC GVV A     +      A +Y  HE      +VHN+ +++ L   G +  +             E+ +  +  + IFSAHG  Q     A+ +GL V D TC  VTK H   ++ +  G ++  IG   HPE   T+  I   +IL+++  +++ +    + P+    QTT+S+ +   I E L+ ++ +I   +  DIC A ++RQ AV  +  +VD+LLVVG   S+NS +L EIG +  + S+L+ +   +K EWF   + + +T+G S P  +   VI
  S:     1 MRVILAQPRGFCAGVVRAIEIVDRALQQHGAPVYVRHE------IVHNRHVVENLRNKGARFVE-------------ELDEVPHGAVAIFSAHGVAQTVERDAQTRGLDVLDATCPLVTKVHVQGRQYVAAGRRLILIGHAGHPEVEGTIGQIPAEVILVQSEAEVDTLTLPVDTPVAYITQTTLSVDDTRGIIEALQRRFTDIVGPDTRDICYATQNRQAAVRELSEQVDVLLVVGATNSSNSNRLREIGTESGVPSYLVADGSEVKAEWFAGVQTVGLTAGASAPEEMVEDVI 276
>gi|42631326|ref|ZP_00156864.1| COG0761: Penicillin tolerance protein [Haemophilus influenzae R2866] >gi|145628051|ref|ZP_01783852.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus influenzae 22.1-21] >gi|145638173|ref|ZP_01793783.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus influenzae PittII] >gi|148826350|ref|YP_001291103.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus influenzae PittEE] >gi|166217169|sp|A5UD69|ISPH_HAEIE 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|144979826|gb|EDJ89485.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus influenzae 22.1-21] >gi|145272502|gb|EDK12409.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus influenzae PittII] >gi|148716510|gb|ABQ98720.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus influenzae PittEE] (314 aa)
Score = 382, Expect = 4.8e-35, Identities = 104/292 (35%), Positives = 151/292 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           MKII   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L E G              I   E+ +  +  IVIFSAHG  Q    +A+++ L VFD TC  VTK H  +     +G +   IG   HPE   T+    + D  I LIE V DI  +  +    +    QTT+S+ +  E    LK KY  I+   KNDIC A  +RQ+AV  +    DL+LVVG   S+NS +L E+  +  ++S L+ +  +I+ +WF + K + IT+G S P  L   +I  L++
  S:     1 MKIILANPRGFCAGVDRAISIVELALEIHGAPIYVRHE------VVHNRFVVNGLRERGA-------------IFVEELSEVPDGAIVIFSAHGVSQAVRQEAKDRNLKVFDATCPLVTKVHMQVARASRKGTKAILIGHKGHPEVEGTMGQYSNEDGGIFLIEKVEDIARLPMQENDNLTFMTQTTLSLDDTAETIAALKEKYPAIQGPHKNDICYATTNRQEAVRELAKLSDLVLVVGSKNSSNSNRLAELASRMGVKSQLLDDPADIQADWFNDVKTIGITAGASAPEELVQSIISRLKR 284
>gi|115359621|ref|YP_776759.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia ambifaria AMMD] >gi|172064432|ref|YP_001812083.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia ambifaria MC40-6] >gi|115284909|gb|ABI90425.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia ambifaria AMMD] >gi|171996949|gb|ACB67867.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia ambifaria MC40-6] (313 aa)
Score = 382, Expect = 5.2e-35, Identities = 92/287 (32%), Positives = 150/287 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M++I   PRGFC GVV A     +      A +Y  HE      +VHN+ +++ L   G +  +             E+ +  +  + IFSAHG  Q     A  +GL V D TC  VTK H   ++ +  G ++  IG   HPE   T+  I   +IL+++  +++ +    + P+    QTT+S+ +   I E L+ ++ +I   +  DIC A ++RQ AV  +  +VD+LLVVG   S+NS +L EIG +  + S+L+ +   +K EWF   + + +T+G S P  +   VI
  S:     1 MRVILAQPRGFCAGVVRAIEIVDRALQQHGAPVYVRHE------IVHNRHVVENLRNKGARFVE-------------ELDEVPHGAVAIFSAHGVAQTVERDAETRGLDVLDATCPLVTKVHVQGRQYVAAGRRLILIGHAGHPEVEGTIGQIPAEVILVQSEAEVDTLTLPVDTPVAYVTQTTLSVDDTRGIIEALQRRFTDIVGPDTRDICYATQNRQAAVRELSGQVDVLLVVGATNSSNSNRLREIGTESGVPSYLVADGSEVKPEWFAGVQTVGLTAGASAPEEMVEDVI 276
>gi|134292430|ref|YP_001116166.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia vietnamiensis G4] >gi|134135587|gb|ABO56701.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia vietnamiensis G4] (313 aa)
Score = 382, Expect = 5.2e-35, Identities = 91/287 (31%), Positives = 151/287 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M++I   PRGFC GVV A     +      A +Y  HE      +VHN+ +++ L   G +  +             E+ +  +  + IFSAHG  Q     A  +GL V D TC  VTK H   ++ +  G ++  IG   HPE   T+  I   ++L+++  +++ +    + P+    QTT+S+ +   I E L+ ++ +I   +  DIC A ++RQ AV  + ++VD+LLVVG   S+NS +L EIG +  + S+L+ +   +K EWF   + + +T+G S P  +   VI
  S:     1 MRVILAQPRGFCAGVVRAIEIVDRALQQHGAPVYVRHE------IVHNRHVVENLRNKGARFVE-------------ELDEVPHGAVAIFSAHGVAQTVERDAETRGLDVLDATCPLVTKVHVQGRQYVAAGRRLILIGHAGHPEVEGTIGQIPAEVVLVQSEAEVDTLTLPVDTPVAYVTQTTLSVDDTRGIIEALQRRFTDIVGPDTRDICYATQNRQAAVRELSTQVDVLLVVGATNSSNSNRLREIGTESGVPSYLVADGSEVKAEWFAGVQTVGLTAGASAPEEMVEDVI 276
>gi|187478893|ref|YP_786917.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase ( drug tolerance protein) [Bordetella avium 197N] >gi|115423479|emb|CAJ50013.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (putative drug tolerance protein) [Bordetella avium 197N] (328 aa)
Score = 382, Expect = 5.3e-35, Identities = 102/286 (35%), Positives = 154/286 (53%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKS-IILIETVNDIEN-IRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRGFC GV  A    ++      A +Y  HE      +VHN+ ++++L   G           +  ID  E+       IV+FSAHG  +    +A  +GL VFD TC  VTK H  +      G +I  IG   HPE   TL   +S + L+ETV D+E  I T+ +   FVT QTT+S+ +   ++  LK+++  I    K+DIC A ++RQDAV  +  E DL+LVVG   S+NS +L E+  +  +E++L+    +I   W   ++ + IT+G S P  L N VI
  S:    14 EVLLAQPRGFCAGVDRAIEIVERALELHGAPIYVRHE------IVHNRYVVEDLRAKG-----------AIFID--ELDQAPTGSIVVFSAHGVSKAVRAEAEARGLRVFDATCPLVTKVHIEVARMRAAGREIIMIGHKGHPEVEGTLGQAQSGMYLVETVADVEGLIVTDPDNLAFVT-QTTLSVDDAAAVSRALKARFPGIVEPKKSDICYATQNRQDAVKVLAPECDLVLVVGSPNSSNSNRLREVAERIGVEAYLVDGASSIDPAWLRERRRIGITAGASAPEVLVNQVI 288
>gi|187929780|ref|YP_001900267.1| hydroxymethylbutenyl pyrophosphate reductase [Ralstonia pickettii 12J] >gi|187726670|gb|ACD27835.1| hydroxymethylbutenyl pyrophosphate reductase [Ralstonia pickettii 12J] (327 aa)
Score = 382, Expect = 5.7e-35, Identities = 92/294 (31%), Positives = 161/294 (54%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPI---VIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           +++   PRGFC GV  A    ++      A +Y  HE      +VHN  ++ +L   G                ++ +++ ++ P+   VIFSAHG  +   + A  +GL VFD TC  VTK H  + +   QG++I  IG   HPE   T+   +  ++L+E+V+D+ ++  +    +    QTT+S+ E +EI   +K+++  +    K DIC A ++RQDAV  M  +V++++VVG   S+NS +L E+  K  + ++++   + ++ EW   K+ + +T+G S P  LA  ++  L K LG
  S:    21 EVLLAQPRGFCAGVDRAIEIVERALELFGAPIYVRHE------IVHNAYVVGDLRNKG----------------AVFVQELDDVPVGGTVIFSAHGVSRAVREAAEARGLRVFDATCPLVTKVHVEVSKMRAQGFEIIMIGHKGHPEVEGTMGQANDGMLLVESVDDVAHLEVKDSTRLAYVTQTTLSVDETQEIVAAIKARFPAVHEPKKQDICYATQNRQDAVKFMAPQVEVVIVVGSPNSSNSNRLRELAEKLGVPAYMVDTPEQVRPEWVAGKRRVGLTAGASAPEELAQSIVDRL-KALG 302
>gi|78035278|emb|CAJ22923.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Xanthomonas campestris pv. vesicatoria str. 85-10] (319 aa)
Score = 381, Expect = 7.3e-35, Identities = 103/297 (34%), Positives = 158/297 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPE---TISTLSIDKSIILIETVNDIENIRT-ESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTA 297
           M ++   PRGFC GV  A    K+      A +Y  HE      +VHN+ ++ +L++ G              I   E+ +  +   VIFSAHG  Q    +A  +GL VFD TC  VTK H  +      G  +  IG   HPE   T+   S ++    I  V DIE + T +  +P  +  T QTT+S+ +   I E L+++Y  ++    +DIC A ++RQDAV ++  + DL+LVVG   S+NS +L E+  +  +ES+LI N   I   W + K+ + +T+G S P  L + V+  L ++LG A
  S:     4 MDVLLANPRGFCAGVDRAIEIVKRAIETLGAPIYVRHE------VVHNRFVVDDLKQRGA-------------IFVEELDEVPDDATVIFSAHGVSQAVRQEAERRGLRVFDATCPLVTKVHFEVARHCRAGRDVVLIGHAGHPEVEGTMGQWSRERGAGTIYLVEDIEQVATLDVRQPDNLAYTTQTTLSVDDTMGIIEALRARYPAMQGPRHDDICYATQNRQDAVRDLARQCDLVLVVGSPNSSNSNRLSELARRDGVESYLIDNASEIDPAWIVGKQHIGLTAGASAPQVLVDGVLARL-RELGAA 293
>gi|32034925|ref|ZP_00135016.1| COG0761: Penicillin tolerance protein [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126208984|ref|YP_001054209.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Actinobacillus pleuropneumoniae L20] >gi|166217141|sp|A3N2G8|ISPH_ACTP2 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|126097776|gb|ABN74604.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Actinobacillus pleuropneumoniae L20] (314 aa)
Score = 381, Expect = 7.3e-35, Identities = 104/295 (35%), Positives = 152/295 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           M I+   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L+  G    +             E+ +  +  IVIFSAHG  Q+   +A+ +GL VFD TC  VTK H  +    ++G +   IG   HPE I T+    + D  I L+E+V DI  +   S+  +    QTT+SI +  ++ E LK KY  I+   KNDIC A  +RQ AV  +  +  L+LVVG   S+NS +L E+  +  + S LI   ++I   W    + + IT+G S P  L   V+  L K LG
  S:     1 MNILLANPRGFCAGVDRAISIVELALEIHGAPIYVRHE------VVHNRFVVDGLKAKGAVFVE-------------ELDEVPDGAIVIFSAHGVSQEVRQEAKRRGLKVFDATCPLVTKVHMQVARASKKGTKAILIGHEGHPEVIGTMGQYDNQDAGIFLVESVEDIAKLPVSSQDDLTFMTQTTLSIDDTSDVIEALKEKYPAIQGPRKNDICYATTNRQQAVRELAKQSQLVLVVGSKNSSNSNRLAELASRMGVPSKLIDGPQDIDPSWLDGVETIGITAGASAPEVLVQSVVEHL-KTLG 286
>gi|77359868|ref|YP_339443.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudoalteromonas haloplanktis TAC125] >gi|123587345|sp|Q3IE99|ISPH_PSEHT 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|76874779|emb|CAI86000.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudoalteromonas haloplanktis TAC125] (309 aa)
Score = 380, Expect = 8.0e-35, Identities = 99/295 (33%), Positives = 164/295 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK--YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           M+I+   PRGFC GV  A +  ++   ++   EK  Y+   +VHN+ ++  L+  G    ++ +          +I D +   IVIFSAHG  Q    +A+ + L +FD TC  VTK H  +     +G +   IG   HPE   T+    +    I L+ETV D+  +  ++   +F  +QTT+S+ +  ++ + L++K+  I+   K+DIC A ++RQDAV ++  +VD+LLVVG   S+NS +L E+  K   +++LI +  N+++ WF     + +T+G S P  L   VI  L K+LG
  S:     1 MEILLANPRGFCAGVDRAISIVERALDIF---EKPIYVRHEVVHNRYVVDGLKSRGAVFVEELD----------QIPDDS---IVIFSAHGVSQAVRTEAKRRDLKIFDATCPLVTKVHMEVTRASRKGIECILIGHQGHPEVEGTMGQYGNDGGGIYLVETVEDVAKLNVKNADNLFYCSQTTLSVDDTADVIDALRAKFPAIDGPRKDDICYATQNRQDAVRDLADKVDVLLVVGAKNSSNSNRLRELADKMGTKAYLIDDATNVQESWFTGINAVGVTAGASAPEVLVQQVITRL-KELG 286
>gi|83746662|ref|ZP_00943711.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ralstonia solanacearum UW551] >gi|83726615|gb|EAP73744.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ralstonia solanacearum UW551] (324 aa)
Score = 380, Expect = 8.5e-35, Identities = 89/286 (31%), Positives = 154/286 (53%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPI---VIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRGFC GV  A    ++      A +Y  HE      +VHN  ++ +L   G                ++ +++ ++ P+   VIFSAHG  +     A  +GL VFD TC  VTK H  + +   QG++I  IG   HPE   T+   D  ++L+E+V D+  +  +    +    QTT+S+ E +EI   +K+++  +    K DIC A ++RQDAV  M  +V++++VVG   S+NS +L E+  K  + ++++   + ++ EW   K+ + +T+G S P  LA  ++
  S:    18 EVLLAQPRGFCAGVDRAIEIVERALQRFGAPIYVRHE------IVHNAYVVSDLRSKG----------------AVFVQELDDVPVGGTVIFSAHGVSRAVRQAAEARGLRVFDATCPLVTKVHVEVSKMRAQGFEIVMIGHKGHPEVEGTMGQADDGMLLVESVEDVARLVVKDPARLAYVTQTTLSVDETQEIVAAIKARFPAVHEPKKQDICYATQNRQDAVKFMAPQVEVVIVVGSPNSSNSNRLRELAEKLGVPAYMVDTPEQVRPEWLAGKRRVGLTAGASAPEELAQSIV 292
>gi|119476946|ref|ZP_01617227.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [marine gamma proteobacterium HTCC2143] >gi|119449753|gb|EAW30990.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [marine gamma proteobacterium HTCC2143] (320 aa)
Score = 380, Expect = 9.1e-35, Identities = 97/291 (33%), Positives = 155/291 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKS----IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           ++I    PRGFC GV  A     +      A +Y  HE      +VHNK ++ +L   G             + + +E+ D     IVIFSAHG      ++A+ +GL VFD TC  VTK H  + +   +G++   IG   HPE   T+   D+S    I L+E V  +  +R  +   +    QTT+S+ + + + E L++++  I    K+DIC A ++RQDAV  + ++ DL+LVVG   S+NS +L E+  + + E++LI ++  I  +W   K  + +T+G S P  L   VI  L+
  S:    10 LEIKLANPRGFCAGVDRAIEIVNRALEVFGAPIYVRHE------VVHNKYVVDDLRARGAVF----------VEELVEVPDD---AIVIFSAHGVSLAVQEEAKNRGLKVFDATCPLVTKVHMEVAQYSRRGHECILIGHKGHPEVEGTMGQYDRSGGGDIYLVEDVAQVAELRVNNPSALSYVTQTTLSVDDTQLVIEALRARFPEISGPRKDDICYATQNRQDAVKQLAADCDLVLVVGSPNSSNSNRLRELAERMRTEAYLIESSSAINPDWLNGKTVVGVTAGASAPDVLVRQVIARLQ 293
>gi|119897493|ref|YP_932706.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Azoarcus sp. BH72] >gi|166217145|sp|A1K4R4|ISPH_AZOSB 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|119669906|emb|CAL93819.1| probable 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Azoarcus sp. BH72] (312 aa)
Score = 379, Expect = 1.0e-34, Identities = 96/286 (33%), Positives = 147/286 (51%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +I+   PRGFC GV  A    ++      A +Y  HE      +VHNK ++ +L   G    ++ +          E+   N    VIFSAHG  Q   ++A ++GL VFD TC  VTK H  +    EQG ++  IG   HPE   T+  +   I L+ET  D+ N++      +    QTT+S+ +   I   L+ ++ NI    K+DIC A ++RQDAV  M    D++ VVG   S+NS +L E+   + + ++L+ N   I   W + K+ + +T+G S P  L   VI
  S:     5 EILLANPRGFCAGVERAIEIVERALQRFGAPIYVRHE------VVHNKFVVDDLRAKGAVFVEELD----------EVPTGNT---VIFSAHGVSQAVREEADKRGLRVFDATCPLVTKVHIEVGRMREQGRELVMIGHKGHPEVEGTMGQVKDGIHLVETAADVANLQVADPDKLAYVTQTTLSVDDAAAIVTALRERFPNIMGPKKDDICYATQNRQDAVKFMTPHADVVFVVGSKNSSNSNRLREVAELRGVPAYLVDNAAGIDPAWIVGKRRIGVTAGASAPEVLVAEVI 279
>gi|157960914|ref|YP_001500948.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella pealeana ATCC 700345] >gi|189045821|sp|A8H1H6|ISPH_SHEPA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|157845914|gb|ABV86413.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella pealeana ATCC 700345] (309 aa)
Score = 379, Expect = 1.1e-34, Identities = 96/287 (33%), Positives = 154/287 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKS---IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M I+   PRGFC GV  A +  ++  +L+ +   Y+   +VHN+ +++ L+E G    +             E+    +  IVIFSAHG  Q    +A+ +GL VFD TC  VTK H  +     +G +   IG   HPE   T+   D S   + L+E+  D+  +  +    +    QTT+S+ +  ++  +L+ KY +IE   K+DIC A ++RQDAV N+  EV+L +VVG   S+NS +L E+  KK  ++ L+ N  ++   WF   + +A+T+G S P  L   V+
  S:     1 MNILLANPRGFCAGVDRAISIVERALELF-SPPIYVRHEVVHNRYVVQNLKERGAVFVE-------------ELDQVPDDSIVIFSAHGVSQAVRAEAKRRGLKVFDATCPLVTKVHLQVARASRKGIECILIGHAGHPEVEGTMGQYDNSAGGVHLVESPEDVAKLVVKDPDNLCFVTQTTLSMDDTADVISSLQKKYPSIEGPRKDDICYATQNRQDAVRNVAEEVELFIVVGSKNSSNSNRLRELAQKKGTQAFLVDNADDVDATWFNGVERVAVTAGASAPEVLVKQVV 279
>gi|21242010|ref|NP_641592.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Xanthomonas axonopodis pv. citri str. 306] >gi|24211878|sp|Q8PN17|ISPH_XANAC 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|21107408|gb|AAM36128.1| penicillin tolerance protein [Xanthomonas axonopodis pv. citri str. 306] (316 aa)
Score = 379, Expect = 1.2e-34, Identities = 103/297 (34%), Positives = 158/297 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPE---TISTLSIDKSIILIETVNDIENIRT-ESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTA 297
           M ++   PRGFC GV  A    K+      A +Y  HE      +VHN+ ++ +L++ G              I   E+ +  +   VIFSAHG  Q    +A  +GL VFD TC  VTK H  +      G  +  IG   HPE   T+   S ++    I  V DIE + T +  +P  +  T QTT+S+ +   I E L+++Y  ++    +DIC A ++RQDAV ++  + DL+LVVG   S+NS +L E+  +  +ES+LI N   I   W + K+ + +T+G S P  L + V+  L ++LG A
  S:     1 MDVLLANPRGFCAGVDRAIEIVKRAIETLGAPIYVRHE------VVHNRFVVDDLKQRGA-------------IFVEELDEVPDDATVIFSAHGVSQAVRQEAERRGLKVFDATCPLVTKVHFEVARHCRAGRDVVLIGHAGHPEVEGTMGQWSRERGAGTIYLVEDIEQVATLDVRQPDNLAYTTQTTLSVDDTMGIIEALRARYPAMQGPRHDDICYATQNRQDAVRDLARQCDLVLVVGSPNSSNSNRLSELARRDGVESYLIDNASEIDPAWIVGKQHIGLTAGASAPQVLVDGVLERL-RELGAA 290
>gi|186475354|ref|YP_001856824.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia phymatum STM815] >gi|184191813|gb|ACC69778.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia phymatum STM815] (319 aa)
Score = 378, Expect = 1.3e-34, Identities = 99/297 (33%), Positives = 158/297 (53%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           +I+   PRGFC GV  A    ++  KLY     Y+   +VHN  ++++L + G           +  I+ +E  +  +   VIFSAHG  +    +A E+GL V+D TC  VTK H  + +    G+ I  IG   HPE   T+    + + L+E ++D++ ++      I    QTT+S+ +  +I   LK KY NI+   K DIC A ++RQDAV  M  + D+++VVG   S+NS +L E+  K  + S+++ +   I   W  +K+ + +T+G S P  LA  VI  L ++LG  N
  S:    12 EILLAQPRGFCAGVDRAIEIVERAIKLY-GSPIYVRHEIVHNAYVVEDLRKKG-----------AIFIEQLE--EVPSGSTVIFSAHGVSKAVRAEADERGLRVYDATCPLVTKVHIEVAKMRADGFDIVMIGHKGHPEVEGTMGQTAEGMYLVEDIDDVQALQLADPDRIAYVTQTTLSVDDAAQIIGALKVKYPNIKEPKKQDICYATQNRQDAVKFMAPQCDVVIVVGSPNSSNSNRLRELAEKLGVPSYMVDSPDQIDPAWVADKRRIGVTAGASAPEALAQAVIGRL-RELGVRN 296
>gi|15603529|ref|NP_246603.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pasteurella multocida subsp. multocida str. Pm70] >gi|13431628|sp|P57960|ISPH_PASMU 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|12722070|gb|AAK03748.1| LytB [Pasteurella multocida subsp. multocida str. Pm70] (314 aa)
Score = 378, Expect = 1.5e-34, Identities = 103/292 (35%), Positives = 148/292 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           MKII   PRGFC GV  A +  +       + +Y  HE      +VHN+ ++  L E G              I   E+ +  +  IVIFSAHG  Q    +A+ + L VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  I L+E+V DI  +    E  +    QTT+SI +  E+ E LK KY  I+   KNDIC A  +RQ AV  +  + DL++VVG   S+NS +L E+  +  + S LI +  +I   W  N   + IT+G S P  L   V+  L++
  S:     1 MKIILANPRGFCAGVDRAISIVESALEIHGSPIYVRHE------VVHNRFVVNGLRERGA-------------IFVEELHEVPDGAIVIFSAHGVSQAVRQEAKNRNLKVFDATCPLVTKVHMQVARASRKGTKAILIGHEGHPEVEGTMGQYDNPEGGIFLVESVEDIAKLGLRQEDDLTFMTQTTLSIDDTSEVIEALKQKYPAIQGPRKNDICYATTNRQQAVRELAQQSDLVIVVGSKNSSNSNRLAELASRMGVVSKLIDDANDIDPTWLENVTTIGITAGASAPEVLVQSVVKRLQE 284
>gi|121587771|ref|ZP_01677531.1| hydroxymethylbutenyl pyrophosphate reductase [Vibrio cholerae 2740-80] >gi|153818721|ref|ZP_01971388.1| hydroxymethylbutenyl pyrophosphate reductase [Vibrio cholerae NCTC 8457] >gi|153823999|ref|ZP_01976666.1| hydroxymethylbutenyl pyrophosphate reductase [Vibrio cholerae B33] >gi|153829359|ref|ZP_01982026.1| hydroxymethylbutenyl pyrophosphate reductase [Vibrio cholerae 623-39] >gi|194531577|ref|YP_002067026.1| hydroxymethylbutenyl pyrophosphate reductase [Vibrio cholerae MO10] >gi|9655124|gb|AAF93850.1| lytB protein [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121547998|gb|EAX58078.1| hydroxymethylbutenyl pyrophosphate reductase [Vibrio cholerae 2740-80] >gi|125617531|gb|EAZ46093.1| hydroxymethylbutenyl pyrophosphate reductase [Vibrio cholerae MO10] >gi|126510743|gb|EAZ73337.1| hydroxymethylbutenyl pyrophosphate reductase [Vibrio cholerae NCTC 8457] >gi|126518480|gb|EAZ75703.1| hydroxymethylbutenyl pyrophosphate reductase [Vibrio cholerae B33] >gi|148875142|gb|EDL73277.1| hydroxymethylbutenyl pyrophosphate reductase [Vibrio cholerae 623-39] >gi|150422102|gb|EDN14069.1| hydroxymethylbutenyl pyrophosphate reductase [Vibrio cholerae AM-19226] (320 aa)
Score = 377, Expect = 1.7e-34, Identities = 95/287 (33%), Positives = 160/287 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           MKI+   PRGFC GV  A +  ++  +LY     Y+   +VHN+ +++ L++ G +  ++ N          E+ D N   IVIFSAHG  Q    +A+E+ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S    + L+E   D+ +++ + + P  +   +QTT+S+ E  ++ + L+  +  I+   K+DIC A ++RQDAV  +  +VD+++VVG   S+NS +L E+  K     +LI   ++I  EWF++ + + +T+G S P  L N ++
  S:     5 MKILLANPRGFCAGVDRAISIVERALELY-QPPIYVRHEVVHNRFVVEGLKQRGARFVEELN----------EVPDDN---IVIFSAHGVSQAVRQEAKERSLTVFDATCPLVTKVHMEVARASRKHMEVVLIGHAGHPEVEGTMGQYASDTGGMYLVEKPEDVVSLQAKVKDPSNLHYVSQTTLSVDETADVIDELRRVFPKIQGPRKDDICYATQNRQDAVRILAEQVDVMVVVGSKNSSNSTRLKELAEKLGTPGYLIDCPQDIDPEWFVDAQLIGVTAGASAPEELVNQIL 285
>gi|90423234|ref|YP_531604.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodopseudomonas palustris BisB18] >gi|90105248|gb|ABD87285.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodopseudomonas palustris BisB18] (314 aa)
Score = 377, Expect = 1.8e-34, Identities = 94/292 (32%), Positives = 157/292 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP--IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           +++    PRGFC GVV A    ++  +     +Y  HE      +VHNK +++ L+  G    +D     SE+           PP  + +FSAHG  +   ++A  +GL V + TC  VTK H+  K  + +G  +  IG   HPE + T+  +   ++L++ V D+  +   ++ P+    QTT+S+ + ++I   L  ++ +I+  +  DIC A ++RQ AV ++   VDL+LVVG   S+NS +L EIG +  I S+LI +   +  +W    K + IT+G S P  L + VI  L +
  S:     7 LEVFLAQPRGFCAGVVRAIEIVERALEKYGPPVYVRHE------IVHNKYVVESLKAKGAIFVED----LSEV-----------PPQAVTVFSAHGVARSVEEEAAARGLPVLNATCPLVTKVHNQGKRYMSKGRALILIGHAGHPEVVGTMGQVPGPVLLVQNVEDVAALTLPADTPVAYITQTTLSVDDTKDIIAALAQRFSDIQGPDIRDICYATQNRQSAVRDLSKLVDLILVVGATNSSNSNRLREIGTEVGIPSYLIADGSELNPDWLKGVKAVGITAGASAPEVLVDDVIEALRR 287
>gi|161582020|ref|NP_230334.2| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|20138764|sp|Q9KU44|ISPH_VIBCH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (316 aa)
Score = 377, Expect = 1.8e-34, Identities = 95/287 (33%), Positives = 160/287 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           MKI+   PRGFC GV  A +  ++  +LY     Y+   +VHN+ +++ L++ G +  ++ N          E+ D N   IVIFSAHG  Q    +A+E+ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S    + L+E   D+ +++ + + P  +   +QTT+S+ E  ++ + L+  +  I+   K+DIC A ++RQDAV  +  +VD+++VVG   S+NS +L E+  K     +LI   ++I  EWF++ + + +T+G S P  L N ++
  S:     1 MKILLANPRGFCAGVDRAISIVERALELY-QPPIYVRHEVVHNRFVVEGLKQRGARFVEELN----------EVPDDN---IVIFSAHGVSQAVRQEAKERSLTVFDATCPLVTKVHMEVARASRKHMEVVLIGHAGHPEVEGTMGQYASDTGGMYLVEKPEDVVSLQAKVKDPSNLHYVSQTTLSVDETADVIDELRRVFPKIQGPRKDDICYATQNRQDAVRILAEQVDVMVVVGSKNSSNSTRLKELAEKLGTPGYLIDCPQDIDPEWFVDAQLIGVTAGASAPEELVNQIL 281
>gi|75676451|ref|YP_318872.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nitrobacter winogradskyi Nb-255] >gi|74421321|gb|ABA05520.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nitrobacter winogradskyi Nb-255] (314 aa)
Score = 377, Expect = 1.9e-34, Identities = 93/292 (31%), Positives = 159/292 (54%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP--IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           ++++   PRGFC GVV A  T ++  + Y     Y+   +VHNK +++ L+  G    +D     SE+           PP  + +FSAHG  Q   ++A  +GL V + TC  VTK H+  K    +G  +  IG   HPE   T+  +   ++L++ V+D+  +   ++ P+    QTT+S+ + ++I   L+ ++ +I+  +  DIC A ++RQ AV ++   VD++LVVG   S+NS +L EIG +  + S+LI +   +  EW    K + +T+G S P  L + VI  L++
  S:     7 IEVLLAQPRGFCAGVVRAIETVERALEKY-GPPVYVRHEIVHNKYVVESLKNKGAIFVED----LSEV-----------PPKAVTVFSAHGVAQSVEEEAAARGLPVLNATCPLVTKVHNQGKRYTSKGRTLILIGHAGHPEVEGTMGQVPGPVLLVQNVDDVAALTLPADTPVAYITQTTLSVDDTKDIIIALQQRFTDIQGPDTRDICYATQNRQSAVRDLSKLVDVILVVGAANSSNSNRLREIGTEVGVASYLIADGSELNAEWLEGAKAVGVTAGASAPEVLVDDVIEALKR 287
>gi|56707942|ref|YP_169838.1| IspH protein [Francisella tularensis subsp. tularensis SCHU S4] >gi|110670413|ref|YP_666970.1| IspH protein [Francisella tularensis subsp. tularensis FSC198] >gi|134302265|ref|YP_001122234.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Francisella tularensis subsp. tularensis WY96-3418] >gi|187931248|ref|YP_001891232.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4- diphosphate reductase [Francisella tularensis subsp. mediasiatica FSC147] >gi|123359510|sp|Q14I06|ISPH_FRAT1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|166217167|sp|A4IYW2|ISPH_FRATW 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|71152183|sp|Q5NGK4|ISPH_FRATT 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|56604434|emb|CAG45466.1| IspH protein [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320746|emb|CAL08849.1| IspH protein [Francisella tularensis subsp. tularensis FSC 198] >gi|134050042|gb|ABO47113.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Francisella tularensis subsp. tularensis WY96-3418] >gi|151568674|gb|EDN34328.1| hypothetical protein FTBG_00198 [Francisella tularensis subsp. tularensis FSC033] >gi|187712157|gb|ACD30454.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4- diphosphate reductase [Francisella tularensis subsp. mediasiatica FSC147] (318 aa)
Score = 377, Expect = 2.1e-34, Identities = 100/296 (33%), Positives = 158/296 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGT 296
           MKI+   PRGFC GV  A  T +K+     + +Y  HE      +VHNK ++  L++ G+             +   E+ +  +  + IFSAHG   K  + A +K LV++D TC  VTK H  ++       +   IG   HPE   T+    S   +I LIE+  D+  +  +    ++   QTT+S+ E + I + LK KY NI+   K DIC A ++RQ A+  M   +D+L+VVG   S+NS +L E+   + I+++L+ N K++   WF NKK   +++G S P +L   +I  + K   T
  S:     1 MKILLANPRGFCAGVSRAVETVEKVLEVEKSPVYVRHE------VVHNKVVVDSLKKKGV-------------VFVKEVDEVPDDAVCIFSAHGVSLKVEEAAAKKNLVLYDATCPLVTKVHRGVRLASNNDAECILIGHKGHPEVQGTMGQYRSKKGAIYLIESEEDLNKLTIKDPDNLYYATQTTLSVDETQGIIQALKDKYPNIKGPKKEDICYATQNRQTAIKAMLKHIDVLVVVGSQNSSNSNRLKELATLEGIDAYLVDNPKDVDKLWFDNKKVCGVSAGASAPEYLVQQIISQISKVCST 288
>gi|92112617|ref|YP_572545.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chromohalobacter salexigens DSM 3043] >gi|122420756|sp|Q1R0B2|ISPH_CHRSD 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|91795707|gb|ABE57846.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chromohalobacter salexigens DSM 3043] (317 aa)
Score = 377, Expect = 2.1e-34, Identities = 100/299 (33%), Positives = 152/299 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAND 299
           M+I    PRGFC GV  A     +        +Y  HE      +VHN+ ++  L E G    ++ +    E+ D +         IVIFSAHG  +    +A  +GL +FD TC  VTK H  +    ++G +   IG   HPE   T+     S    I L+E   D+EN+     + +    QTT+S+ +   + + L++K+  I+   K+DIC A ++RQDAV  + SE DL+LVVG   S+NS +L E+  +    ++LI   + I+ EW  +   + IT+G S P  L   VI  L+     A D
  S:     1 MQIKLANPRGFCAGVDRAIEIVNRALDVFGPPIYVRHE------VVHNRFVVDSLRERGAVFVEELH----EVPDDV---------IVIFSAHGVSRAVQQEAERRGLRIFDATCPLVTKVHMEVLRYAKRGQECVLIGHAGHPEVEGTMGRYDTSFGGQIYLVEDEADVENLEVNGPERLAFVTQTTLSMDDTSRVIDALRAKFPQIDGPRKDDICYATQNRQDAVRGLASESDLVLVVGSPNSSNSNRLRELAERTGTPAYLIDTAEQIRPEWLTDVSAIGITAGASAPEVLVQAVIERLQSLGAEAPD 292
>gi|30248660|ref|NP_840730.1| LytB protein [Nitrosomonas europaea ATCC 19718] >gi|50400994|sp|Q82WM1|ISPH_NITEU 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|30180255|emb|CAD84560.1| LytB protein [Nitrosomonas europaea ATCC 19718] (323 aa)
Score = 376, Expect = 2.4e-34, Identities = 93/292 (31%), Positives = 163/292 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKS---IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           ++++   PRGFC GV  A    ++      A +Y  HE      +VHN+ ++++LE+ G           +  ++++E  +     ++IFSAHG   +   +A  + L +FD TC  VTK H  + +  ++G +I  IG   HPE   T+  I KS   + L+ET  D+  ++ ++E  +    QTT+S+ +   + E LK ++  I    K+DIC A ++RQDAV  +    DL++VVG   S+NS +L E+   + +E++++   + +++ W  NK+C+ IT+G S P  L   V+  LE+
  S:     2 IRVLLANPRGFCAGVDRAIEIVERALAMYGAPIYVRHE------VVHNRFVVEDLEKKG-----------AVFVENLE--EVPEGSMLIFSAHGVSHEVRREAAARKLQIFDATCPLVTKVHVEVAKMDKEGKEIVMIGHQGHPEVEGTMGQIAKSKGTMYLVETAEDVARLQVKNESNLAYVTQTTLSVDDAARVIEALKQRFPKIIGPKKDDICYATQNRQDAVKKLVKLCDLVVVVGSPNSSNSNRLCEVARNENVEAYMVDQAEQLQESWLTNKRCIGITAGASAPEILVQQVLERLEQ 285
>gi|15839007|ref|NP_299695.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Xylella fastidiosa 9a5c] >gi|28199316|ref|NP_779630.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Xylella fastidiosa Temecula1] >gi|71901176|ref|ZP_00683280.1| LytB protein [Xylella fastidiosa Ann-1] >gi|182682041|ref|YP_001830201.1| hydroxymethylbutenyl pyrophosphate reductase [Xylella fastidiosa M23] >gi|54037482|sp|P65194|ISPH_XYLFT 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|54041397|sp|P65193|ISPH_XYLFA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|9107602|gb|AAF85215.1|AE004050_8 drug tolerance protein [Xylella fastidiosa 9a5c] >gi|28057422|gb|AAO29279.1| drug tolerance protein [Xylella fastidiosa Temecula1] >gi|71729058|gb|EAO31185.1| LytB protein [Xylella fastidiosa Ann-1] >gi|182632151|gb|ACB92927.1| hydroxymethylbutenyl pyrophosphate reductase [Xylella fastidiosa M23] (316 aa)
Score = 376, Expect = 2.4e-34, Identities = 96/287 (33%), Positives = 151/287 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKS-----IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           MK++   PRGFC GV  A    K+        +Y  HE      +VHN+ ++ +L++ G                +I +++ +  P    VIFSAHG  Q    +A ++GL VFD TC  VTK H  +      G  +  IG   HPE   T+   D+      I L+E ++D+  +       +  T QTT+S+ +   I + L+ ++  I+    NDIC A ++RQDAV  +  E DL+LVVG   S+NS +L E+  ++ + S+LI +   I   W I+K  + +T+G S P  L + V+
  S:     1 MKVLLANPRGFCAGVDRAIEIVKRTIDMLGTPIYVRHE------VVHNRFVVDDLKQRG----------------AIFVEELHQVPDGATVIFSAHGVSQAVRRQAAQRGLKVFDATCPLVTKVHLDVARHCRTGRDMILIGHAGHPEVEGTMGQWDQERGTGRIYLVENIDDVATLHVAQPHHLAYTTQTTLSVDDTRNIIDALRQRFPTIQGPKNNDICYATQNRQDAVRELARECDLVLVVGSPNSSNSNRLSELAQREGVASYLIDSAAEIDPAWVIDKHHIGVTAGASAPQVLVDGVL 281
>gi|152979531|ref|YP_001345160.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Actinobacillus succinogenes 130Z] >gi|171704360|sp|A6VQH8|ISPH_ACTSZ 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|150841254|gb|ABR75225.1| hydroxymethylbutenyl pyrophosphate reductase [Actinobacillus succinogenes 130Z] (314 aa)
Score = 376, Expect = 2.4e-34, Identities = 101/295 (34%), Positives = 150/295 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           MKII   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L E G    +             E+ +  +  IVIFSAHG  Q    +A+ + L VFD TC  VTK H  +     +G +   IG   HPE   T+    + D  I L+E V DI  +    +  +    QTT+SI +  ++ E LK KY NI+   KNDIC A  +RQ AV ++  + DL++V+G   S+NS +L E+  +    + L+ +  ++   W  N   + +T+G S P  L   V+  L K+LG
  S:     1 MKIILANPRGFCAGVDRAISIVELALEIHGAPIYVRHE------VVHNRFVVNGLRERGAVFVE-------------ELDEVPDGAIVIFSAHGVSQAVRQEAKRRNLKVFDATCPLVTKVHMQVARASRKGTKAILIGHEGHPEVQGTMGQYDNRDGGIFLVENVEDIAKLHLRDDDDLTFMTQTTLSIDDTADVIEALKQKYPNIQGPRKNDICYATTNRQQAVRDLAEQCDLVIVIGSKNSSNSNRLAELANRMGTPAKLLDDANDVDPAWLENVDIIGVTAGASAPEVLVQSVVSRL-KELG 286
>gi|90412469|ref|ZP_01220472.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Photobacterium profundum 3TCK] >gi|90326506|gb|EAS42912.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Photobacterium profundum 3TCK] (313 aa)
Score = 376, Expect = 2.7e-34, Identities = 95/295 (32%), Positives = 159/295 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           MKI+   PRGFC GV  A +  ++  ++Y     Y+   +VHN+ +++ L++ G    ++ +          E+ D N   IVIFSAHG  Q   ++A+E+ L VFD TC  VTK H  +     +G ++  IG   HPE   T+    S    + L+E  +D+E ++ +    +   +QTT+S+ E   + + L+  +  I+   K+DIC A ++RQDAV  M   VD+++VVG   S+NS +L E+  K      L    ++++  WF  K  + +T+G S P  L N +I+ ++  +G
  S:     1 MKILLANPRGFCAGVDRAISIVERALEMY-QPPIYVRHEVVHNRFVVEGLKQRGAIFVEELS----------EVPDDN---IVIFSAHGVSQAVRNEAKERQLTVFDATCPLVTKVHMEVARASRRGMEVVLIGHAGHPEVEGTMGQYASETGGMYLVEKPDDVEKLQVKDPSNLHYVSQTTLSVDETAGVIDQLRKVFPEIQGPRKDDICYATQNRQDAVREMAESVDVMIVVGSKNSSNSNRLRELSEKLGTPGFLTDCPEDVQPVWFEGKTKVGVTAGASAPEDLVNQIIVRIQALIG 287
>gi|71276191|ref|ZP_00652470.1| LytB protein [Xylella fastidiosa Dixon] >gi|71902289|ref|ZP_00684283.1| LytB protein [Xylella fastidiosa Ann-1] >gi|71162952|gb|EAO12675.1| LytB protein [Xylella fastidiosa Dixon] >gi|71727966|gb|EAO30187.1| LytB protein [Xylella fastidiosa Ann-1] (316 aa)
Score = 376, Expect = 2.7e-34, Identities = 96/287 (33%), Positives = 151/287 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKS-----IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           MK++   PRGFC GV  A    K+        +Y  HE      +VHN+ ++ +L++ G                +I +++ +  P    VIFSAHG  Q    +A ++GL VFD TC  VTK H  +      G  +  IG   HPE   T+   D+      I L+E ++D+  +       +  T QTT+S+ +   I + L+ ++  I+    NDIC A ++RQDAV  +  E DL+LVVG   S+NS +L E+  ++ + S+LI +   I   W I+K  + +T+G S P  L + V+
  S:     1 MKVLLANPRGFCAGVDRAIEIVKRTIDMLGTPIYVRHE------VVHNRFVVDDLKQRG----------------AIFVEELHQVPDGATVIFSAHGVSQAVRRQAAQRGLKVFDATCPLVTKVHLDVARHCRTGRDMILIGHAGHPEVEGTMGQWDQERGTGRIYLVENIDDVAALHVAQRHHLAYTTQTTLSVDDTRNIIDALRQRFPTIQGPKNNDICYATQNRQDAVRELARECDLVLVVGSPNSSNSNRLSELAQREGVASYLIDSAAEIDPAWVIDKHHIGVTAGASAPQVLVDGVL 281
>gi|118496958|ref|YP_898008.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4- diphosphate reductase [Francisella tularensis subsp. novicida U112] >gi|194324187|ref|ZP_03057961.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Francisella tularensis subsp. novicida FTE] >gi|166217166|sp|A0Q4T9|ISPH_FRATN 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|118422864|gb|ABK89254.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4- diphosphate reductase [Francisella tularensis subsp. novicida U112] >gi|194321634|gb|EDX19118.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Francisella tularensis subsp. novicida FTE] (320 aa)
Score = 375, Expect = 3.1e-34, Identities = 100/296 (33%), Positives = 157/296 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGT 296
           MKI+   PRGFC GV  A  T +K+     + +Y  HE      +VHNK ++  L++ G+             +   E+ +  +  + IFSAHG   K  + A +K LV++D TC  VTK H  ++       +   IG   HPE   T+    S   +I LIE+  D+  +  +    ++   QTT+S+ E + I + LK KY NI+   K DIC A ++RQ A+  M   +D+L+VVG   S+NS +L E+     I+++L+ N K++   WF NKK   +++G S P +L   +I  + K   T
  S:     1 MKILLANPRGFCAGVSRAVETVEKVLEVEKSPVYVRHE------VVHNKVVVDSLKKKGV-------------VFVKEVDEVPDDAVCIFSAHGVSLKVEEAAAKKNLVLYDATCPLVTKVHRGVRLASNNDAECILIGHKGHPEVQGTMGQYRSKKGAIYLIESEEDLNKLTIKDPDNLYYATQTTLSVDETQGIIQALKDKYPNIKGPKKEDICYATQNRQTAIKAMLKHIDVLVVVGSQNSSNSNRLKELATLAGIDAYLVDNPKDVDKLWFDNKKVCGVSAGASAPEYLVQQIISQISKVCST 288
>gi|89255753|ref|YP_513115.1| IspH protein [Francisella tularensis subsp. holarctica] >gi|115314247|ref|YP_762970.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Francisella tularensis subsp. holarctica OSU18] >gi|156501716|ref|YP_001427781.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167009205|ref|ZP_02274136.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Francisella tularensis subsp. holarctica FSC200] >gi|122325717|sp|Q0BNK1|ISPH_FRATO 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|122501209|sp|Q2A587|ISPH_FRATH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|166217165|sp|A7NA22|ISPH_FRATF 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|89143584|emb|CAJ78767.1| IspH protein [Francisella tularensis subsp. holarctica LVS] >gi|115129146|gb|ABI82333.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Francisella tularensis subsp. holarctica OSU18] >gi|134252948|gb|EBA52042.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase ispH [Francisella tularensis subsp. holarctica 257] >gi|156252319|gb|ABU60825.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|157121949|gb|EDO66119.1| IspH protein [Francisella tularensis subsp. holarctica FSC022] (318 aa)
Score = 375, Expect = 3.4e-34, Identities = 100/296 (33%), Positives = 157/296 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGT 296
           MKI+   PRGFC GV  A  T +K+     + +Y  HE      +VHNK ++  L++ G+             +   E+ +  +  + IFSAHG   K  + A +K LV++D TC  VTK H  ++       +   IG   HPE   T+    S   +I LIE+  D+  +  +    ++   QTT+S+ E   I + LK KY NI+   K DIC A ++RQ A+  M   +D+L+VVG   S+NS +L E+   + I+++L+ N K++   WF NKK   +++G S P +L   +I  + K   T
  S:     1 MKILLANPRGFCAGVSRAVETVEKVLEVEKSPVYVRHE------VVHNKVVVDSLKKKGV-------------VFVKEVDEVPDDAVCIFSAHGVSLKVEEAAAKKNLVLYDATCPLVTKVHRGVRLASNNDAECILIGHKGHPEVQGTMGQYRSKKGAIYLIESEEDLNKLTIKDPDNLYYATQTTLSVDETHGIIQALKDKYPNIKGPKKEDICYATQNRQTAIKAMLKHIDVLVVVGSQNSSNSNRLKELATLEGIDAYLVDNPKDVDKLWFDNKKVCGVSAGASAPEYLVQQIISQISKVCST 288
>gi|120612414|ref|YP_972092.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120590878|gb|ABM34318.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Acidovorax avenae subsp. citrulli AAC00-1] (332 aa)
Score = 375, Expect = 3.5e-34, Identities = 90/286 (31%), Positives = 151/286 (52%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +I+   PRGFC GV  A    ++      A +Y  HE      +VHN  ++ +L+  G                +I I+D  + P    ++FSAHG  +    +A  +G  +FD TC  VTK H  + +  ++GY+   IG   HPE   T+  +D  I L+E V D+  ++      + V  QTT+S+ +  EIT  +++++  +    + DIC A ++RQDAV  +  +VDL++VVG   S+NS +L E+ ++    S+++ +   ++ EWF     + +T+G S P  L   VI
  S:     7 EIVLAEPRGFCAGVDRAIEIVERALQKFGAPIYVRHE------IVHNTYVVNDLKAKG----------------AIFIEDLADVPPGATLVFSAHGVSKAVQAEAEARGFSIFDATCPLVTKVHVEVAKLAKEGYEFIMIGHKGHPEVEGTMGQLDHGIHLVEDVEDVARVQPSQTAKLAVVTQTTLSVDDAAEITAAVRARFPQVREPKQQDICYATQNRQDAVKVLSGQVDLVIVVGSPTSSNSNRLRELAVRLGTPSYMVDSADELRPEWFDGAARVGLTAGASAPEVLVRQVI 281
>gi|115523833|ref|YP_780744.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodopseudomonas palustris BisA53] >gi|115517780|gb|ABJ05764.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodopseudomonas palustris BisA53] (314 aa)
Score = 374, Expect = 3.9e-34, Identities = 93/292 (31%), Positives = 157/292 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           +++    PRGFC GVV A    ++  +     +Y  HE      +VHNK +++ L+  G                +I ++D +  P   + +FSAHG  +   ++A ++GL V + TC  VTK H+  K  + +G  +  IG   HPE   T+  +   ++L++ V D+  +   S+ P+    QTT+S+ + ++I   L  ++ +I+  +  DIC A ++RQ AV ++   VDL+LVVG   S+NS +L EIG +  I S+LI +   +  +W    K + IT+G S P  L + VI  L +
  S:     7 LEVFLAQPRGFCAGVVRAIEIVERALEKYGPPVYVRHE------IVHNKYVVESLKAKG----------------AIFVEDLSAVPPKAVTVFSAHGVARSVEEEAAQRGLPVLNATCPLVTKVHNQGKRYMAKGRVLILIGHAGHPEVEGTMGQVPGPVLLVQNVEDVAGLTLPSQTPVAYITQTTLSVDDTKDIIAALSERFPDIQGPDTRDICYATQNRQSAVRDLSKLVDLILVVGANNSSNSNRLREIGTEAGIPSYLIADGSELDPDWLTGVKAVGITAGASAPEVLVDDVIEALRR 287
>gi|58425845|gb|AAW74882.1| penicillin tolerance protein [Xanthomonas oryzae pv. oryzae KACC10331] (366 aa)
Score = 374, Expect = 4.5e-34, Identities = 98/297 (32%), Positives = 157/297 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPE---TISTLSIDK---SIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTA 297
           M ++   PRGFC GV  A    K+      A +Y  HE      +VHN+ ++ +L++ G              I   E+ +  +   VIFSAHG  Q    +A  +GL VFD TC  VTK H  +      G  +  IG   HPE   T+   S ++   +I L+E +  +  +     + +  T QTT+S+ +   I E L+++Y  ++    +DIC A ++RQDAV ++  + DL+LVVG   S+NS +L E+  +  +ES+LI N   I   W + K+ + +T+G S P  L + V+  L ++LG +
  S:    51 MYVLLANPRGFCAGVDRAIEIVKRAIETLGAPIYVRHE------VVHNRFVVDDLKQRGA-------------IFVEELDEVPDDATVIFSAHGVPQAVRQEAERRGLKVFDATCPLVTKVHFEVARHCRAGRDVVLIGHAGHPEVEGTMGQWSRERGPGTIYLVEDIEQVATLDVRQPENLAYTTQTTLSVDDTMGIIEALRARYPAMQGPRHDDICYATQNRQDAVRDLARQCDLVLVVGSPNSSNSNRLSELARRDGVESYLIDNASEIDPAWIVGKQHIGLTAGASAPQVLVDGVLARL-RELGAS 340
>gi|84623171|ref|YP_450543.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|161899003|ref|YP_200267.2| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|188575774|ref|YP_001912703.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|71152201|sp|Q5H2D9|ISPH_XANOR 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|123522548|sp|Q2P5A8|ISPH_XANOM 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|84367111|dbj|BAE68269.1| penicillin tolerance protein [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188520226|gb|ACD58171.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Xanthomonas oryzae pv. oryzae PXO99A] (316 aa)
Score = 374, Expect = 4.5e-34, Identities = 98/297 (32%), Positives = 157/297 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPE---TISTLSIDK---SIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTA 297
           M ++   PRGFC GV  A    K+      A +Y  HE      +VHN+ ++ +L++ G              I   E+ +  +   VIFSAHG  Q    +A  +GL VFD TC  VTK H  +      G  +  IG   HPE   T+   S ++   +I L+E +  +  +     + +  T QTT+S+ +   I E L+++Y  ++    +DIC A ++RQDAV ++  + DL+LVVG   S+NS +L E+  +  +ES+LI N   I   W + K+ + +T+G S P  L + V+  L ++LG +
  S:     1 MYVLLANPRGFCAGVDRAIEIVKRAIETLGAPIYVRHE------VVHNRFVVDDLKQRGA-------------IFVEELDEVPDDATVIFSAHGVPQAVRQEAERRGLKVFDATCPLVTKVHFEVARHCRAGRDVVLIGHAGHPEVEGTMGQWSRERGPGTIYLVEDIEQVATLDVRQPENLAYTTQTTLSVDDTMGIIEALRARYPAMQGPRHDDICYATQNRQDAVRDLARQCDLVLVVGSPNSSNSNRLSELARRDGVESYLIDNASEIDPAWIVGKQHIGLTAGASAPQVLVDGVLARL-RELGAS 290
>gi|114331878|ref|YP_748100.1| hydroxymethylbutenyl pyrophosphate reductase [Nitrosomonas eutropha C91] >gi|114308892|gb|ABI60135.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nitrosomonas eutropha C91] (323 aa)
Score = 374, Expect = 4.5e-34, Identities = 93/292 (31%), Positives = 160/292 (54%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDK---SIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           +K++   PRGFC GV  A    ++      A +Y  HE      +VHN+ ++++LE+ G           +  ++++E  +     ++IFSAHG   +    A  + L +FD TC  VTK H  + +   +G +I  IG   HPE   T+  I+K   ++ L+ET  D+  ++ + E  +    QTT+S+ +   + E LK ++  I    K+DIC A ++RQDAV  +    DL++VVG   S+NS +L E+   + +E++++     +++ W  NK+C+ IT+G S P  L   V+  LE+
  S:     2 IKVLLANPRGFCAGVDRAIEIVERALTMYGAPIYVRHE------VVHNRFVVEDLEKKG-----------AVFVENLE--EVPEGSMLIFSAHGVSHEVRRDAAARKLQIFDATCPLVTKVHVEVAKMDREGKEIVMIGHQGHPEVEGTMGQIEKKKGTMYLVETAEDVSGLQVKDEDNLAYVTQTTLSVDDAARVIEALKRRFPKIVGPKKDDICYATQNRQDAVKKLVKLCDLVIVVGSPNSSNSNRLCEVARNENVEAYMVDQAAQLQESWLANKQCIGITAGASAPEILVQQVLERLEQ 285
>gi|56477952|ref|YP_159541.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Azoarcus sp. EbN1] >gi|71152168|sp|Q5P224|ISPH_AZOSE 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|56313995|emb|CAI08640.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (EC 1.17.1.2),gene: ISPH OR LYTB OR RSC2442 OR RS01352 [Azoarcus sp. EbN1] (312 aa)
Score = 374, Expect = 4.6e-34, Identities = 101/297 (34%), Positives = 155/297 (52%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPI---VIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           +I+   PRGFC GV  A    ++      A +Y  HE      +VHNK ++  L   G                +I +++ +  P    VIFSAHG  Q    +A  +GL VFD TC  VTK H  +    EQG +I  IG   HPE   T+  +   I L+E V D+ NI     + +    QTT+S+ +   +   L++++  I    K+DIC A ++RQDAV  M   VD++ VVG   S+NS +L E+     + ++L+ N + I+  W  +KK + +T+G S P  L + V+  L K+LG ++
  S:     5 EILLANPRGFCAGVERAIEIVEQALARFGAPIYVRHE------VVHNKFVVDGLRAKG----------------AIFVEELDEVPTGQTVIFSAHGVPQAVRSEAERRGLRVFDATCPLVTKVHLEVARMREQGREIVMIGHKGHPEVEGTMGQVGDGIHLVEVVQDVANIEVADPQQLAYVTQTTLSVDDAATLVAALRARFPAIVGPKKDDICYATQNRQDAVKFMAPRVDVVFVVGSRNSSNSNRLREVAELLGVPAYLVDNAEGIEPIWLEDKKRVGVTAGASAPEVLVDAVVERL-KELGASS 289
>gi|90407189|ref|ZP_01215377.1| 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase [Psychromonas sp. CNPT3] >gi|90311765|gb|EAS39862.1| 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase [Psychromonas sp. CNPT3] (314 aa)
Score = 373, Expect = 5.4e-34, Identities = 103/295 (34%), Positives = 156/295 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKS---IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           M+II   PRGFC GV  A A  ++   ++P    Y+   +VHN+ ++  L+  G    +D +          E+ D N   IVIFSAHG  Q    +A+ + L VFD TC  VTK H  +     +G +   IG   HPE   T+   D S   I L+E V+D+  +  +    +  ++QTT+SI +  +I + L+  +  IE   KNDIC A ++RQD+V ++    DL+LVVG   S+NS +L E      + ++LI +  +I+  WF N   + +T+G S P  L   V+  L K LG
  S:     1 MQIILANPRGFCAGVHRAIAIVERALDIFPA-PIYVRHEVVHNQYVVDGLKARGAIFVEDLD----------EVPDDN---IVIFSAHGVSQAVRAEAKRRALKVFDATCPLVTKVHMEVTRASRRGQECILIGHQGHPEVEGTMGQYDNSAGGIYLVENVSDVAQLSIKDPTNLCYSSQTTLSIDDTADIIDALRKHFPEIEGPRKNDICYATQNRQDSVKDLAKLTDLVLVVGSPNSSNSNRLREKANYAGVNAYLINSAADIEAVWFDNVDKVGVTAGASAPEVLVQAVLAKL-KALG 286
>gi|187921663|ref|YP_001890695.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia phytofirmans PsJN] >gi|187720101|gb|ACD21324.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia phytofirmans PsJN] (314 aa)
Score = 373, Expect = 5.6e-34, Identities = 92/287 (32%), Positives = 148/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M++I   PRGFC GVV A     +      A +Y  HE      +VHN+ ++  L + G +  +             E+ +     + IFSAHG  Q     A  +GL V D TC  VTK H   ++ +  G  +  IG   HPE   T+  I   ++L+++  ++ ++    + P+    QTT+S+ +   I + L  ++ +I   +  DIC A ++RQ AV  +  +VD+LLVVG   S+NS +L EIG +  + S+L+ +   +K EWF N + + IT+G S P  +   VI
  S:     1 MRVILAQPRGFCAGVVRAIEIVDRALQQHGAPVYVRHE------IVHNRHVVDNLRQKGARFVE-------------ELDEVPQGAVAIFSAHGVAQTVERDAEARGLDVLDATCPLVTKVHVQGRQYVGAGRTLILIGHAGHPEVEGTIGQIPGKVLLVQSEAEVAHLDLPVDTPLAYVTQTTLSVDDTRGIIDALLRRFTDIVGPDTRDICYATQNRQAAVRELSKQVDVLLVVGATNSSNSNRLREIGSESGVASYLVADGSEVKPEWFANVQTVGITAGASAPEEMVKNVI 276
>gi|117619589|ref|YP_855227.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|170072762|ref|XP_001870260.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Culex quinquefasciatus] >gi|166217142|sp|A0KG42|ISPH_AERHH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|117560996|gb|ABK37944.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (311 aa)
Score = 373, Expect = 5.7e-34, Identities = 97/295 (32%), Positives = 158/295 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           M I+   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++ +L+E G    ++ +          E+ D +   IVIFSAHG  +   + A+ + L VFD TC  VTK H  +     +G +   IG   HPE I T+    + +  + L+ET  D+  ++ ++   +    QTT+S+ E  ++ + L++ +  I+   K+DIC A ++RQDAV  M   VD +LVVG   S+NS +L E+  K   +++LI +   I+ +W    + + +T+G S P  L   VI  L ++LG
  S:     1 MNILLANPRGFCAGVDRAISIVESALEKFGAPIYVRHE------VVHNRYVVNKLKEAGAVFVEELD----------EVPDDS---IVIFSAHGVSKAVREMAKSRALKVFDATCPLVTKVHMEVHRASRKGSEAVLIGHAGHPEVIGTMGQYENREGGMYLVETPEDVAKLKVKNPDDLCFVTQTTLSVDETSDVIDALRAHFPKIQGPRKDDICYATQNRQDAVREMAGLVDAMLVVGSRNSSNSNRLRELAEKVGAKAYLIDDASMIEADWLAGVEAIGVTAGASAPEVLVQSVITRL-RELG 286
>gi|170718647|ref|YP_001783405.1| hydroxymethylbutenyl pyrophosphate reductase [Haemophilus somnus 2336] >gi|189045810|sp|B0UV08|ISPH_HAES2 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|168826776|gb|ACA32147.1| hydroxymethylbutenyl pyrophosphate reductase [Haemophilus somnus 2336] (314 aa)
Score = 373, Expect = 5.7e-34, Identities = 110/295 (37%), Positives = 152/295 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI---DK-SIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           MKII   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L E G              I   E+ +  N  IVIFSAHG  Q    +A+E+ L VFD TC  VTK H  +     +G +   IG   HPE I T+     DK  I L+E V DI  +   +++ I    QTT+SI +   + E LK KY  I+   KNDIC A  +RQ AV  +    DL++VVG   S+NS +L E+  +  + + LI +  +I+  W  N   + +T+G S P  L   VI  L K+LG
  S:     1 MKIILANPRGFCAGVDRAISIVELALEIHGAPIYVRHE------VVHNRFVVNGLRERGA-------------IFVEELDEVPNGAIVIFSAHGVSQAVRQEAKERNLKVFDATCPLVTKVHMQVARASRKGTKAILIGHEGHPEVIGTMGQYDNDKGGIYLVEDVEDIAKLTLRNDEDITFMTQTTLSIDDTAGVIEVLKQKYPAIQGPRKNDICYATTNRQQAVRELAKLSDLVIVVGSKNSSNSNRLAELASRMGVTAKLIDDANDIEVSWLDNVTVIGLTAGASAPEILVQSVISRL-KELG 286
>gi|50086306|ref|YP_047816.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Acinetobacter sp. ADP1] >gi|20138781|sp|Q9RBJ0|ISPH_ACIAD 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|5915671|gb|AAD55804.1| LytB [Acinetobacter sp. BD413] >gi|49532282|emb|CAG69994.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (also involved in penicillin tolerance and control of the stringent response. Seems to directly or indirectly interact with relA to maintain it in an inactive form during normal growth.) [Acinetobacter sp. ADP1] (316 aa)
Score = 372, Expect = 8.2e-34, Identities = 102/291 (35%), Positives = 156/291 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKS----IILIETVNDIENIRT-ESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           M+I+   PRGFC GV  A A   +  + + N   Y+   +VHNK ++ +L + G    D             E+    +  IVIFSAHG  +    +A  +GL VFD TC  VTK H  + +   +G +   IG   HPE   T+   DKS    I L+E   D+E +     EK  FVT QTT+SI +  ++ + L++K+  I+   K+DIC A ++RQDAV ++ S  D++LVVG   S+NS +L E+  +    ++L+ N   ++ +WF     + +T+G S P  L   VI  L+
  S:     1 MEIVLANPRGFCAGVDRAIAIVNRALECF-NPPIYVRHEVVHNKFVVDDLRQRGAIFVD-------------ELDQVPDDSIVIFSAHGVSKAVQQEAEHRGLKVFDATCPLVTKVHIEVTKYAREGTEAILIGHEGHPEVEGTMGQYDKSKGGHIYLVEDEADVEALAVNHPEKLAFVT-QTTLSIDDTAKVIDALRTKFPQIQGPRKDDICYATQNRQDAVRDLASRCDVVLVVGSPNSSNSNRLRELAERMGKAAYLVDNADQLEQQWFDGVAKIGVTAGASAPEILIKQVIQRLQ 284
>gi|54307799|ref|YP_128819.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Photobacterium profundum SS9] >gi|50400871|sp|Q6LUK8|ISPH_PHOPR 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|46912222|emb|CAG19017.1| putative LytB protein [Photobacterium profundum SS9] (313 aa)
Score = 371, Expect = 8.7e-34, Identities = 95/295 (32%), Positives = 158/295 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           MKI+   PRGFC GV  A +  ++  ++Y     Y+   +VHN+ +++ L++ G    ++ +          E+ D N   IVIFSAHG  Q   ++A+E+ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S D  + L+E   D+E ++ +    +   +QTT+S+ E  ++ + L+  +  I+   K+DIC A ++RQDAV  M   VD+++VVG   S+NS +L E+  K      L    ++++  WF  K  + +T+G S P  L N +I  ++  +G
  S:     1 MKILLANPRGFCAGVDRAISIVERALEMY-QPPIYVRHEVVHNRFVVEGLKQRGAIFVEELS----------EVPDDN---IVIFSAHGVSQAVRNEAKERQLTVFDATCPLVTKVHMEVARASRRSVEVVLIGHAGHPEVEGTMGQYASEDGGMYLVEKPEDVEKLQVKDPSNLHYVSQTTLSVDETADVIDQLRKVFPEIQGPRKDDICYATQNRQDAVREMAESVDVMIVVGSKNSSNSNRLRELSEKLGTPGFLTDCPEDVQPVWFEGKTKVGVTAGASAPEDLVNQIISRIQALIG 287
>gi|119470029|ref|ZP_01612834.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Alteromonadales bacterium TW-7] >gi|119446739|gb|EAW28012.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Alteromonadales bacterium TW-7] (309 aa)
Score = 371, Expect = 8.8e-34, Identities = 98/296 (33%), Positives = 162/296 (54%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK--YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGT 296
           M I+   PRGFC GV  A +  ++   ++   EK  Y+   +VHNK ++  L+  G    +             E+    +  IVIFSAHG  Q    +A+ + L VFD TC  VTK H  +     +G +   IG + HPE   T+    +    I L+ETV+D+  +  + E+ +F  +QTT+S+ +  ++ + L+ K+  I+   K+DIC A ++RQDAV ++  +VD+LLVVG   S+NS +L E+  K    ++LI +  +++++W  +   + +T+G S P  L   VI  L++  GT
  S:     1 MDILLANPRGFCAGVDRAISIVERALDIF---EKPIYVRHEVVHNKYVVDGLKNRGAVFVE-------------ELHQVPDDSIVIFSAHGVSQAVRFEAKRRELKVFDATCPLVTKVHMEVTRASRKGIECILIGHHGHPEVEGTMGQYDNDAGGIYLVETVDDVIALNVKDEENLFYCSQTTLSVDDTADVIDALREKFPAIDGPRKDDICYATQNRQDAVRDLADKVDVLLVVGAKNSSNSNRLRELADKMGTTAYLIDDATDVQEQWVSSANSVGVTAGASAPEVLVQQVISRLKELGGT 288
>gi|21230615|ref|NP_636532.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|24211874|sp|Q8PBG4|ISPH_XANCP 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|21112196|gb|AAM40456.1| penicillin tolerance protein [Xanthomonas campestris pv. campestris str. ATCC 33913] (316 aa)
Score = 371, Expect = 8.8e-34, Identities = 98/295 (33%), Positives = 155/295 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPE---TISTLSIDK---SIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           M ++   PRGFC GV  A    K+      A +Y  HE      +VHN+ ++ +L++ G              I   E+ +  +   VIFSAHG  Q    +A  +GL VFD TC  VTK H  +      G  +  IG   HPE   T+   S ++    I L+E +  +  ++    + +  T QTT+S+ +   I E L+ +Y  ++    +DIC A ++RQDAV ++  + DL+LVVG   S+NS +L E+  +  +ES+LI N   I   W + K+ + +T+G S P  L + V+  L ++LG
  S:     1 MDVLLANPRGFCAGVDRAIEIVKRAIETLGAPIYVRHE------VVHNRFVVDDLKQRGA-------------IFVEELDEVPDDATVIFSAHGVSQAVRVEAERRGLKVFDATCPLVTKVHFEVARHCRAGRDVVLIGHAGHPEVEGTMGQWSRERGPGQIYLVEDIEQVATLQVRQPESLAYTTQTTLSVDDTMGIIEALRVRYPAMQGPKHDDICYATQNRQDAVRDLARQCDLVLVVGSPNSSNSNRLSELARRDGVESYLIDNASEIDPAWIVGKQHIGLTAGASAPQVLVDGVLARL-RELG 288
>gi|114320015|ref|YP_741698.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Alkalilimnicola ehrlichei MLHE-1] >gi|114226409|gb|ABI56208.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Alkalilimnicola ehrlichei MLHE-1] (316 aa)
Score = 371, Expect = 9.6e-34, Identities = 94/286 (32%), Positives = 147/286 (51%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-------IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRGFC GV  A     +      A +Y  HE      +VHN+ ++  L         DK     E +D  E+ D      VIFSAHG  Q    +A  +GL VFD TC  VTK H  +++   +G ++  IG   HPE   T+            I L+E   D++ +       +    QTT+S+ +   + + L+ ++ NI    KNDIC A ++RQDAV  +  +VDL+LVVG   S+NS +L E+  +K +E+HL+   + ++  W   +  + +T+G S P  L   V+
  S:     3 QVLLANPRGFCAGVDRAIDIVDRALELFGAPIYVRHE------VVHNRYVVNNLR--------DKGAVFVEELD--EVPDG---ATVIFSAHGVSQAVRREAERRGLQVFDATCPLVTKVHMEVQKYAREGREVVLIGHAGHPEVEGTIGQYERQGGAGGDIYLVEKPEDVQALVVRDPDSLAFVTQTTLSMDDTANVIDALRERFPNITGPRKNDICYATQNRQDAVKQLAEQVDLMLVVGSPNSSNSNRLRELAERKGVEAHLVDGPEQLQRAWLEGRHAIGVTAGASAPEVLVRQVL 283
>gi|187925120|ref|YP_001896762.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia phytofirmans PsJN] >gi|187716314|gb|ACD17538.1| hydroxymethylbutenyl pyrophosphate reductase [Burkholderia phytofirmans PsJN] (319 aa)
Score = 371, Expect = 1.0e-33, Identities = 99/297 (33%), Positives = 157/297 (52%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKL-----YPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           +I+   PRGFC GV  A    ++  KL     Y  HE      +VHN  ++++L + G           +  I+ +E     N   VIFSAHG  +    +A  +GL V+D TC  VTK H  + +  + G+ I  IG   HPE   T+    + + L+E ++D++ ++    + I    QTT+S+ +  EI   LK+KY +I    K DIC A ++RQDAV  M  + D+++VVG   S+NS +L E+  K  + ++++ +   I   W   K+ + +T+G S P  LA  VI  L ++LG  N
  S:    12 EILLAQPRGFCAGVDRAIEIVERAIKLHGSPIYVRHE------IVHNAYVVEDLRKKG-----------AIFIERLEEVPAGN--TVIFSAHGVSKAVRSEAESRGLRVYDATCPLVTKVHIEVAKMRQDGFDIVMIGHKGHPEVEGTMGQAGEGMHLVEDIDDVQALQLADPERIAFVTQTTLSVDDAAEIIGALKAKYPSIREPKKQDICYATQNRQDAVKFMAPQCDVVIVVGSPNSSNSNRLRELAEKLGVPAYMVDSPDQIDPVWVEGKRRIGVTAGASAPEVLAQAVIARL-RELGVRN 296
>gi|71908656|ref|YP_286243.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Dechloromonas aromatica RCB] >gi|123626813|sp|Q47BK8|ISPH_DECAR 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|71848277|gb|AAZ47773.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Dechloromonas aromatica RCB] (306 aa)
Score = 370, Expect = 1.1e-33, Identities = 92/297 (30%), Positives = 157/297 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKS-IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTA 297
           M+II   PRGFC GV  A A  ++      A +Y  HE      +VHNK +  +L   G                ++ +++ +  P    VIFSAHG  +   + A  +GL VFD TC  VTK H  + +   Q  ++  IG   HPE   T+   +  + L+ET +++  ++      +    QTT+S+ +   + + LK ++  I+   K+DIC A ++RQDAV  +  + DL+LVVG   S+NS++L E+ + + + + LI + + I++ W   K+ + +T+G S P  L   V++ ++   G +
  S:     1 MEIILANPRGFCAGVERAIAIVERALEKFGAPIYVRHE------VVHNKFVCDDLRAKG----------------AVFVEELDEVPAGSTVIFSAHGVSKAVREDAEARGLKVFDATCPLVTKVHVEVGKMRNQTREVVMIGHKGHPEVEGTMGQSQGGMYLVETADEVAQLQVSDPLHLSFVTQTTLSVDDATVVIDALKQRFPEIQGPKKDDICYATQNRQDAVKELAGKCDLVLVVGSPNSSNSRRLKEVAVGRNVMAFLIDDAEEIEESWLRGKQHIGVTAGASAPETLVERVVMHIQALTGAS 286
>gi|56460233|ref|YP_155514.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Idiomarina loihiensis L2TR] >gi|71152186|sp|Q5QZR7|ISPH_IDILO 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|56179243|gb|AAV81965.1| 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase [Idiomarina loihiensis L2TR] (314 aa)
Score = 370, Expect = 1.1e-33, Identities = 95/292 (32%), Positives = 155/292 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKL-----YPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+I+   PRGFC GV  A    ++  ++     Y  HE      +VHNK ++ +L E G    +             E+ +  +  IVIFSAHG  Q    +A+++GL VFD TC  VTK H  +     +G++   IG   HPE   T+    + +  I L+E+  D+  +  +    +   +QTT+S+ +  ++ + L+ K+ +I    K+DIC A ++RQDAV  + S+ D++LVVG   S+NS +L E+  K    ++LI +   I   W    + +A+T+G S P  L   VI  L++
  S:     1 MQILLANPRGFCAGVDRAITIVERALEIFEPPIYVRHE------VVHNKYVVSKLREAGAVFVE-------------ELHEVPDDQIVIFSAHGVSQAVRQEAKDRGLRVFDATCPLVTKVHMEVTRASRKGHECILIGHAGHPEVEGTMGQYNNDEGGIYLVESPEDVAKLEVKDPGNLHYMSQTTLSVDDTADVIDALRQKFPDINGPRKDDICYATQNRQDAVRELASDADVMLVVGARNSSNSNRLRELSEKMGTPAYLIDDASCIDKAWLEGHEKVAVTAGASAPEVLVKEVIAKLQE 284
>gi|146305991|ref|YP_001186456.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas mendocina ymp] >gi|166217478|sp|A4XQV8|ISPH_PSEMY 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|145574192|gb|ABP83724.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas mendocina ymp] (314 aa)
Score = 370, Expect = 1.2e-33, Identities = 97/287 (33%), Positives = 149/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M I    PRGFC GV  A     +  +     +Y  HE      +VHNK ++++L   G    ++ +    ++I             VIFSAHG  +   D+A  +GL VFD TC  VTK H  +     +G +   IG   HPE   T+     S   +I L+E   D+  ++  +   +    QTT+S+ +  ++ + L+SK+  I    K+DIC A ++RQDAV  + SE D+LLVVG   S+NS +L E+  +    ++LI   +++K EWF   K + IT+G S P  L   V+
  S:     1 MHIKLANPRGFCAGVDRAIEIVNRALEVFGPPIYVRHE------VVHNKFVVEDLRARGAVFVEELDQVPDDVI-------------VIFSAHGVSKAVRDEAARRGLKVFDATCPLVTKVHMEVVRYSREGRECILIGHEGHPEVEGTMGQYDASNGGAIYLVEDEADVAELQVRNPDNLAFVTQTTLSMDDTSKVIDALRSKFPAIGGPRKDDICYATQNRQDAVKQLASECDVLLVVGSPNSSNSNRLRELAERMGTPAYLIDGAEDLKHEWFEGVKGIGITAGASAPEVLVRGVV 280
>gi|121606226|ref|YP_983555.1| hydroxymethylbutenyl pyrophosphate reductase [Polaromonas naphthalenivorans CJ2] >gi|120595195|gb|ABM38634.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Polaromonas naphthalenivorans CJ2] (331 aa)
Score = 370, Expect = 1.2e-33, Identities = 93/286 (32%), Positives = 154/286 (53%)
  Q:     2 KIIKITPRGFCKGVVDAY-----ATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +I+   PRGFC GV  A      A  K  A +Y  HE      +VHN  ++ +L+  G                +I I++ ++ P    ++FSAHG  +   ++AR +G  +FD TC  VTK H  + +  ++GY+   IG   HPE   T+  +D  I L+E V D+  I     + + V  QTT+S+ +  EI+  + +++  +    + DIC A ++RQDAV  +  +VD+L+VVG   S+NS +L E+  K   E++++ +   +++ WF  K  + +T+G S P  L   VI
  S:     8 EILLAEPRGFCAGVDRAIEIVERALVKFGAPIYVRHE------IVHNTYVVNDLKVKG----------------AIFIEELSDVPAGATLVFSAHGVSRAVQEEARARGFQIFDATCPLVTKVHVEVAKLNKEGYEFIMIGHKGHPEVEGTMGQLDSGIHLVEDVADVARISPLQTERLAVVTQTTLSVDDAAEISAAIVARFPQVRKPKQQDICYATQNRQDAVKVLSPQVDILIVVGSPTSSNSNRLRELAAKLGTEAYMVDDASELQEAWFDGKSRVGLTAGASAPEVLVRQVI 282
>gi|66769389|ref|YP_244151.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Xanthomonas campestris pv. campestris str. 8004] >gi|188992576|ref|YP_001904586.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Xanthomonas campestris pv. campestris] >gi|81304654|sp|Q4US42|ISPH_XANC8 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|66574721|gb|AAY50131.1| penicillin tolerance protein [Xanthomonas campestris pv. campestris str. 8004] >gi|167734336|emb|CAP52546.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Xanthomonas campestris pv. campestris] (316 aa)
Score = 370, Expect = 1.2e-33, Identities = 98/295 (33%), Positives = 155/295 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPE---TISTLSIDK---SIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           M ++   PRGFC GV  A    K+      A +Y  HE      +VHN+ ++ +L++ G              I   E+ +  +   VIFSAHG  Q    +A  +GL VFD TC  VTK H  +      G  +  IG   HPE   T+   S ++    I L+E +  +  ++    + +  T QTT+S+ +   I E L+ +Y  ++    +DIC A ++RQDAV ++  + DL+LVVG   S+NS +L E+  +  +ES+LI N   I   W + K+ + +T+G S P  L + V+  L ++LG
  S:     1 MDVLLANPRGFCAGVDRAIEIVKRAIETLGAPIYVRHE------VVHNRFVVDDLKQRGA-------------IFVEELDEVPDDATVIFSAHGVSQAVRVEAERRGLKVFDATCPLVTKVHFEVARHCRAGRDVVLIGHAGHPEVEGTMGQWSRERGPGQIYLVEDIEQVATLQVRQPENLAYTTQTTLSVDDTMGIIEALRVRYPAMQGPKHDDICYATQNRQDAVRDLARQCDLVLVVGSPNSSNSNRLSELARRDGVESYLIDNASEIDPAWIVGKQHIGLTAGASAPQVLVDGVLARL-RELG 288
>gi|91978035|ref|YP_570694.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodopseudomonas palustris BisB5] >gi|91684491|gb|ABE40793.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodopseudomonas palustris BisB5] (314 aa)
Score = 370, Expect = 1.3e-33, Identities = 94/292 (32%), Positives = 155/292 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP--IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           +++    PRGFC GVV A    ++  +     +Y  HE      +VHNK +++ L+  G    +D     SE+           PP  + +FSAHG  +   ++A  +GL V + TC  VTK H+  K    +G  +  IG   HPE   T+  +   ++L++ + D+  +   ++  +    QTT+S+ + ++I   L  ++ +I+  +  DIC A ++RQ AV  M   VDL+LVVG   S+NS +L EIG +  I S+LI +   +  +W + KK + IT+G S P  L + VI  L +
  S:     7 LEVFLAQPRGFCAGVVRAIEIVERALEKYGPPVYVRHE------IVHNKYVVESLKAKGAIFVED----LSEV-----------PPKAVTVFSAHGVARSVEEEAAARGLPVLNATCPLVTKVHNQGKRYTSKGRTLILIGHAGHPEVEGTMGQVPGPVLLVQNLEDVAALTLPADTQVAYITQTTLSVDDTKDIIAALSKRFSDIQGPDTRDICYATQNRQSAVRTMSKLVDLILVVGANNSSNSNRLREIGTEAGIPSYLIADGSELNPDWLVGKKAVGITAGASAPEVLVDDVIEALRR 287
>gi|86748852|ref|YP_485348.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodopseudomonas palustris HaA2] >gi|86571880|gb|ABD06437.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodopseudomonas palustris HaA2] (314 aa)
Score = 370, Expect = 1.4e-33, Identities = 95/292 (32%), Positives = 155/292 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP--IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           +++    PRGFC GVV A    ++  +     +Y  HE      +VHNK +++ L+  G    ++     SE+           PP  + +FSAHG  +   ++A  +GL V + TC  VTK H+  K    +G  +  IG   HPE   T+  +   ++L++ ++D+  +   S+ P+    QTT+S+ +  +I   L  ++ +I+  +  DIC A ++RQ AV  M   VDL+LVVG   S+NS +L EIG +  I S+LI +   +  +W   KK + IT+G S P  L + VI  L +
  S:     7 LEVFLAQPRGFCAGVVRAIEIVERALEKYGPPVYVRHE------IVHNKYVVESLKAKGAIFVEE----LSEV-----------PPKAVTVFSAHGVARSIEEEAASRGLPVLNATCPLVTKVHNQGKRYTAKGRTLILIGHAGHPEVEGTMGQVPGPVLLVQNLDDVAALTLPSDTPVAYITQTTLSVDDTRDIIAALSKRFSDIQGPDTRDICYATQNRQSAVRAMSKLVDLILVVGANNSSNSNRLREIGTEAGIPSYLISDGSELNPDWLEGKKAVGITAGASAPEVLVDDVIEALRR 287
>gi|119946874|ref|YP_944554.1| hydroxymethylbutenyl pyrophosphate reductase [Psychromonas ingrahamii 37] >gi|166217480|sp|A1SZP0|ISPH_PSYIN 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|119865478|gb|ABM04955.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Psychromonas ingrahamii 37] (314 aa)
Score = 369, Expect = 1.5e-33, Identities = 101/296 (34%), Positives = 158/296 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKK-----IAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGT 296
           M+II   PRGFC GV  A +   +        +Y  HE      +VHN+ ++ +L   G           +  ++ ++   +N+  IVIFSAHG  Q    +A+ + L +FD TC  VTK H  +     +G +   IG   HPE + T+    +    I LIE+  DI+ +  ++   +  ++QTT+S+ +   I + L+ K+  I+   K+DIC A ++RQDAV  +    DL+LVVG   S+NS +L E      + ++LI + K+IK EW  N K + +T+G S P  L   VI  L+K  GT
  S:     1 MEIILANPRGFCAGVHRAISIVDRALDIFTPPIYVRHE------VVHNQYVVDDLRARG-----------AVFVEELDEVPENS--IVIFSAHGVAQSVRAEAKRRDLKIFDATCPLVTKVHMEVTRASRRGQECILIGHQGHPEVVGTMGQYDNPQGGIYLIESPEDIKKLEVKNPNSLCFSSQTTLSVDDTANIIKALREKFPKIDGPRKDDICYATQNRQDAVKALAERSDLVLVVGSTNSSNSNRLQEKASCVGVNAYLIDSEKDIKTEWLENVKVVGVTAGASAPEVLVKEVIARLKKLGGT 288
>gi|89072557|ref|ZP_01159129.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Photobacterium sp. SKA34] >gi|89051661|gb|EAR57114.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Photobacterium sp. SKA34] (315 aa)
Score = 369, Expect = 1.7e-33, Identities = 95/284 (33%), Positives = 157/284 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLAN 284
           MKI+   PRGFC GV  A +  ++  ++Y     Y+   +VHN+ +++ L++ G    ++ +          E+ D N   IVIFSAHG  Q   ++++++ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    + D  + L+ET ND++ ++T    P  +   +QTT+S+ E  ++ + L+  +  I+   K+DIC A ++RQDAV  M   VD+++VVG   S+NS +L E+  K     +L    ++I+  WF NK  + +T+G S P  L N
  S:     1 MKILLANPRGFCAGVDRAISIVERALEMY-QPPIYVRHEVVHNRFVVEGLKQRGAIFVEELS----------EVPDDN---IVIFSAHGVSQAVRNESKQRQLTVFDATCPLVTKVHMEVARASRKAMEVVLIGHAGHPEVEGTMGQYANQDGGMYLVETPNDVDKLKTIVRDPSNLHYVSQTTLSVDETADVIDRLRIVFPEIQGPRKDDICYATQNRQDAVREMAETVDVMIVVGSKNSSNSNRLRELSEKLGTPGYLTDCVEDIEPSWFENKTKVGVTAGASAPEELVN 278
>gi|152998222|ref|YP_001343057.1| hydroxymethylbutenyl pyrophosphate reductase [Marinomonas sp. MWYL1] >gi|150839146|gb|ABR73122.1| hydroxymethylbutenyl pyrophosphate reductase [Marinomonas sp. MWYL1] (316 aa)
Score = 369, Expect = 1.8e-33, Identities = 100/290 (34%), Positives = 158/290 (54%)
  Q:     8 PRGFCKGV---VDAYATCKKI--AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI--DK---SIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTA 297
           PRGFC GV   +D    C  +  A +Y  HE      +VHNK +++ L+  G    D+ +          ++ D N   IVIFSAHG  +   D+A  +GL VFD TC  VTK H  +      G +   IG + HPE   T+    D+   +I L+E+  D+E +  ++ + +    QTT+S+ +   + + L+  +  I    K+DIC A ++RQDAV  +  E +L+LVVG + S+NS +L E+  +   +++LI N   I+ +W    + + +T+G S P  L N VI  L K+ G+A
  S:    10 PRGFCAGVDRAIDIVNRCLDLFEAPIYVRHE------VVHNKFVVESLKARGAVFVDELD----------QVPDDN---IVIFSAHGVSKAVRDEATNRGLKVFDATCPLVTKVHLEVLRYSRDGMECVLIGHDGHPEVEGTMGQYDDRQGGAIYLVESPADVEKLEVKNPERLAFVTQTTLSMDDTSVVIDALRKHFPLIRGPKKDDICYATQNRQDAVKTLAEESELVLVVGSVNSSNSNRLRELAERMGAKAYLIDNASEIQCDWLKGIRSIGVTAGASAPEVLVNEVIDRLVKEGGSA 292
>gi|194364905|ref|YP_002027515.1| hydroxymethylbutenyl pyrophosphate reductase [Stenotrophomonas maltophilia R551-3] >gi|194347709|gb|ACF50832.1| hydroxymethylbutenyl pyrophosphate reductase [Stenotrophomonas maltophilia R551-3] (316 aa)
Score = 368, Expect = 2.2e-33, Identities = 93/287 (32%), Positives = 149/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL------SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M ++   PRGFC GV  A    K+      A +Y  HE      +VHN+ ++ +L++ G    ++ +          E+ D N    VIFSAHG  Q    +A  +GL VFD TC  VTK H  +      G  +  IG   HPE   T+      +    I L+E V  +  ++ +  +    T QTT+S+ +   I + L+ ++  ++    +DIC A ++RQDAV ++    DL+LVVG   S+NS +L E+  ++ +ES+LI     I   W + K+ + +T+G S P  L + V+
  S:     1 MDVLLANPRGFCAGVDRAIEIVKRAIETLGAPIYVRHE------VVHNRFVVDDLKQRGAIFVEELD----------EVPDNNT---VIFSAHGVSQAVRQEAERRGLKVFDATCPLVTKVHFEVARHCRAGRDVVLIGHAGHPEVEGTMGQWNREAGTGQIYLVEDVEQVATLQIKQPENFAYTTQTTLSVDDTRGIIDALRERFPAMQGPKNDDICYATQNRQDAVRDLAKRCDLVLVVGSPNSSNSNRLSELARREGVESYLIDGAHEIDPAWVVGKQHIGVTAGASAPQVLVDGVL 281
>gi|148254417|ref|YP_001239002.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bradyrhizobium sp. BTAi1] >gi|146406590|gb|ABQ35096.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bradyrhizobium sp. BTAi1] (314 aa)
Score = 368, Expect = 2.4e-33, Identities = 91/292 (31%), Positives = 156/292 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP--IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           ++I    PRGFC GVV A    ++  + Y     Y+   +VHNK +++ L+  G    +D     SE+           PP  + +FSAHG  +   ++A  +GL V + TC  VTK H+  K  + +G  +  IG   HPE   T+  +   + L++ V D+  +   S+ P+    QTT+S+ + ++I   L++++ +++  +  DIC A ++RQ AV ++   VD++LVVG   S+NS +L EIG +  + S+L+ +   +  EW    + + IT+G S P  L + VI  L +
  S:     7 LQIYLAQPRGFCAGVVRAIEIVERALEKY-GRPVYVRHEIVHNKYVVESLKAKGAIFVED----LSEV-----------PPRAVTVFSAHGVARSVEEEAAARGLPVLNATCPLVTKVHNQGKRYMSKGRTLVLIGHAGHPEVEGTMGQVPGPVHLVQNVADVAALPLPSDTPVAYITQTTLSVDDTKDIISALQARFTDLQGPDIRDICYATQNRQSAVWDLSKLVDVILVVGAANSSNSNRLREIGTEAGVASYLVADGSELNPEWLKGARAVGITAGASAPEVLVDDVIEALRR 287
>gi|94501192|ref|ZP_01307714.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Oceanobacter sp. RED65] >gi|94426619|gb|EAT11605.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Oceanobacter sp. RED65] (314 aa)
Score = 367, Expect = 3.0e-33, Identities = 98/297 (32%), Positives = 155/297 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTA 297
           M+I    PRGFC GV  A     +        +Y  HE      +VHNK ++  L + G    D             E+ +  +  IVIFSAHG  +    +A ++GL VFD TC  VTK H  +    ++G ++  IG   HPE   T+     S    I L+E   D++ +   +   +   +QTT+S+ +   + + L+ K+ NI     +DIC A ++RQDAV ++ S+ DL+LVVG   S+NS +L E+G +   +++LI N + I   WF ++  + IT+G S P  L   V+  +++  G A
  S:     1 MEITLANPRGFCAGVDRAIDIVNRALDIFEPPIYVRHE------VVHNKFVVDNLRDRGAVFVD-------------ELHEVPDDSIVIFSAHGVSKAVQKEAADRGLKVFDATCPLVTKVHMEVTRYAKKGSEVILIGHKGHPEVEGTMGQYDHSAGGEIYLVEDEADVQALEPNNPNALAYVSQTTLSMDDTAIVIKALRKKFPNIHGPKTDDICYATQNRQDAVKDLASQCDLILVVGSPNSSNSNRLRELGERMNAQAYLIDNAEQIDAAWFNDETKVGITAGASAPEILVQQVVSRVQELGGAA 290
>gi|52425804|ref|YP_088941.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mannheimia succiniciproducens MBEL55E] >gi|71152188|sp|Q65RQ4|ISPH_MANSM 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|52307856|gb|AAU38356.1| LytB protein [Mannheimia succiniciproducens MBEL55E] (314 aa)
Score = 367, Expect = 3.1e-33, Identities = 103/295 (34%), Positives = 153/295 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           MKII   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L E G    ++ N          E+ D     IVIFSAHG  Q    +A+ + L VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  I L+E V DI  +  +  + +    QTT+SI +  ++   LK+KY  I+   KNDIC A  +RQ AV  +  + DL++VVG   S+NS +L E+  +  + + LI ++ +I+ +W      + +T+G S P  L   VI  L K+LG
  S:     1 MKIILANPRGFCAGVDRAISIVELALEIHGAPIYVRHE------VVHNRFVVNGLRERGAVFVEELN----------EVPDG---AIVIFSAHGVSQAVRQEAKNRNLKVFDATCPLVTKVHMQVARASRKGTKAILIGHEGHPEVQGTMGQYDNPEGGIFLVENVEDIAKLGLKDNEELTFMTQTTLSIDDTSDVIVALKAKYPAIQGPRKNDICYATTNRQQAVRELAEQSDLVIVVGSKNSSNSNRLAELASRMGVPAKLIDDSNDIEPDWLKGINTIGVTAGASAPEVLVQSVIARL-KELG 286
>gi|71277944|ref|YP_267954.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Colwellia psychrerythraea 34H] >gi|123633443|sp|Q486R1|ISPH_COLP3 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|71143684|gb|AAZ24157.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Colwellia psychrerythraea 34H] (309 aa)
Score = 366, Expect = 3.3e-33, Identities = 97/287 (33%), Positives = 155/287 (54%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+II   PRGFC GV  A +  ++      A +Y  HE      +VHNK ++  L++ G    D+ +          E+ D N    VIFSAHG  +    +A+ + L VFD TC  VTK H  +     +  +   IG   HPE   T+    S    I L+E+  D+ ++  ++ + ++  +QTT+S+ +  ++   L++K+  IE   K+DIC A ++RQDAV  +  +VDL+LVVG   S+NS +L E+  K  + S+LI   +NI+ +W      + +T+G S P  L   V+
  S:     1 MEIILANPRGFCAGVDRAISIVERALDLFGAPIYVRHE------VVHNKFVVDGLKDRGAIFVDELD----------EVPDDNT---VIFSAHGVSKAVRQEAKTRALKVFDATCPLVTKVHMEVSRVSRKDIECILIGHAGHPEVEGTMGQYSSDSAGIYLVESPEDVASLVVKNPEKLYFCSQTTLSVDDTMDVIAALQAKFPLIEGPRKDDICYATQNRQDAVREIADKVDLMLVVGAKNSSNSNRLKELASKMGVTSYLIDTAENIETDWLTGVNKVGVTAGASAPAVLIKQVV 279
>gi|92118189|ref|YP_577918.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nitrobacter hamburgensis X14] >gi|91801083|gb|ABE63458.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nitrobacter hamburgensis X14] (314 aa)
Score = 366, Expect = 3.4e-33, Identities = 95/292 (32%), Positives = 158/292 (54%)
  Q:     1 MKIIKITPRGFCKGVVDAY-----ATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP--IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           ++++   PRGFC GVV A      A  K    +Y  HE      +VHNK +++ L+  G    +D     SE+           PP  + +FSAHG  +   ++A  +GL V + TC  VTK H+  K    +G  +  IG   HPE   T+  +   ++L++ V+D+  +   ++ P+    QTT+S+ + ++I   L+ ++ +I+  +  DIC A ++RQ AV ++   VD++LVVG   S+NS +L EIG +  + S+LI +   +  EW  + K + IT+G S P  L + VI  L +
  S:     7 IEVLLAQPRGFCAGVVRAIEIVECALEKYGPPVYVRHE------IVHNKYVVESLKNKGAIFVED----LSEV-----------PPKAVTVFSAHGVARSVEEEAAARGLPVLNATCPLVTKVHNQGKRYKSKGRTLILIGHAGHPEVEGTMGQVPGPVLLVQDVDDVAALTLHADTPVAYITQTTLSVDDTKDIILALQQRFTDIQGPDTRDICYATQNRQSAVRDLSKLVDVILVVGAANSSNSNRLREIGTEVGVASYLIADGSELNAEWLRDAKTVGITAGASAPEVLVDDVIEALRR 287
>gi|113460330|ref|YP_718391.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus somnus 129PT] >gi|112822373|gb|ABI24462.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus somnus 129PT] (310 aa)
Score = 366, Expect = 3.5e-33, Identities = 106/288 (36%), Positives = 150/288 (52%)
  Q:     8 PRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI---DKS-IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L + G              I   E+ +  N  IVIFSAHG  Q    +A+E+ L VFD TC  VTK H  +     +G +   IG   HPE I T+     DK  I L+E V DI  +   +++ I    QTT+SI +  ++ E LK KY  I+   KNDIC A  +RQ AV  +    DL++VVG   S+NS +L E+  +  + + LI +  +I+  W  N K + +T+G S P  L   VI  L K+LG
  S:     4 PRGFCAGVDRAISIVELALEIHGAPIYVRHE------VVHNRFVVDGLRDRGA-------------IFVEELDEVPNGAIVIFSAHGVSQAVRQEAKERNLKVFDATCPLVTKVHMQVARASRKGTKAILIGHEGHPEVIGTMGQYDNDKGGIYLVEDVEDIAKLTLRNDEDITFMTQTTLSIDDTADVIEVLKQKYPAIQGPRKNDICYATTNRQQAVRELAELSDLVIVVGSKNSSNSNRLAELASRMGVTAKLIDDANDIEVSWLNNVKVIGLTAGASAPEILVQSVISRL-KELG 282
>gi|85712280|ref|ZP_01043331.1| 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase [Idiomarina baltica OS145] >gi|85693907|gb|EAQ31854.1| 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase [Idiomarina baltica OS145] (309 aa)
Score = 365, Expect = 4.2e-33, Identities = 94/287 (32%), Positives = 150/287 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKL-----YPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+I+   PRGFC GV  A    ++  ++     Y  HE      +VHNK ++ +L + G    +             E+ +  +  IVIFSAHG  Q     A+++GL VFD TC  VTK H  +     +G++   IG   HPE   T+    +    I L+E+  D+  +  +    +   +QTT+S+ +  ++ + L+ ++ NI    K+DIC A ++RQDAV  +  E  L+LVVG   S+NS +L E+  K    ++LI +   I+ EW  +   +A+T+G S P  L   VI
  S:     1 MQILLANPRGFCAGVDRAITIVERALEIFEPPIYVRHE------VVHNKYVVNKLRDAGAVFVE-------------ELDEVPDEAIVIFSAHGVSQAVRQNAKDRGLKVFDATCPLVTKVHMEVTRASRKGHECVLIGHAGHPEVEGTMGQYANPKGGIYLVESPEDVGTLEIKDPNNLHYMSQTTLSVDDTADVIDALRQRFPNINGPRKDDICYATQNRQDAVRQLAEEAQLMLVVGAKNSSNSNRLRELSEKMGTPAYLIDDANGIQREWLNDIDRVAVTAGASAPEVLVREVI 279
>gi|160897349|ref|YP_001562931.1| hydroxymethylbutenyl pyrophosphate reductase [Delftia acidovorans SPH-1] >gi|160362933|gb|ABX34546.1| hydroxymethylbutenyl pyrophosphate reductase [Delftia acidovorans SPH-1] (332 aa)
Score = 365, Expect = 4.3e-33, Identities = 93/294 (31%), Positives = 158/294 (53%)
  Q:     2 KIIKITPRGFCKGVVDAY-----ATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           +I+   PRGFC GV  A      A  K  A +Y  HE      +VHN  ++ +L+  G                +I I++ ++ P    ++FSAHG  +   ++AR +G  +FD TC  VTK H  + +  ++GY+   IG   HPE   T+  + + I L+E   D+  +     + + V  QTT+S+ +   IT  +++++  +    + DIC A ++RQDAV  +  +VD+L+VVG   S+NS +L E+  +    ++++ N   + +EWF N   + +T+G S P  L + VI  L ++LG
  S:     9 EILLAEPRGFCAGVDRAIEIVERALAKFGAPIYVRHE------IVHNTFVVNDLKAKG----------------AIFIEELDDVPPGSTLVFSAHGVSRAVQEEARRRGFSIFDATCPLVTKVHVEVAKLAKEGYEFLMIGHKGHPEVEGTMGQLSEGIHLVEDEADVARVTPRQTEKLAVVTQTTLSVDDAAGITAAIRARFPQVREPKQQDICYATQNRQDAVKVLAPQVDVLIVVGSPTSSNSNRLRELAARLGTPAYMVDNAGELCEEWFANAGRVGLTAGASAPEVLVDEVIQRL-RQLG 290
>gi|91784960|ref|YP_560166.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia xenovorans LB400] >gi|91688914|gb|ABE32114.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia xenovorans LB400] (319 aa)
Score = 365, Expect = 4.9e-33, Identities = 99/297 (33%), Positives = 157/297 (52%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKL-----YPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP--IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           +I+   PRGFC GV  A    ++  KL     Y  HE      +VHN  ++++L + G           +  I+ +E      PP   VIFSAHG  +    +A  +GL V+D TC  VTK H  + +  + G+ I  IG   HPE   T+    + + L+E + D++ ++    + I    QTT+S+ +  +I   LK+KY +I    K DIC A ++RQDAV  M  + D+++VVG   S+NS +L E+  K  + ++++ +   I   W   K+ + +T+G S P  LA  VI  L ++LG  N
  S:    12 EILLAQPRGFCAGVDRAIEIVERAIKLHGSPIYVRHE------IVHNAYVVEDLRKKG-----------AIFIERLE----EVPPGNTVIFSAHGVSKAVRSEAEIRGLRVYDATCPLVTKVHIEVAKMRQDGFDIVMIGHKGHPEVEGTMGQAGEGMHLVEDIEDVQALQLADPERIAFVTQTTLSVDDAAQIIAALKAKYPSIREPKKQDICYATQNRQDAVKFMAPQCDVVIVVGSPNSSNSNRLRELAEKLGVPAYMVDSPDQIDPVWVEGKRRIGVTAGASAPEVLAQAVIARL-RELGVRN 296
>gi|29840501|ref|NP_829607.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chlamydophila caviae GPIC] >gi|33301241|sp|Q822D9|ISPH_CHLCV 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|29834850|gb|AAP05485.1| hydroxymethylbutenyldiphosphate reductase [Chlamydophila caviae GPIC] (309 aa)
Score = 365, Expect = 5.0e-33, Identities = 94/278 (33%), Positives = 154/278 (55%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPI---VIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           ++I   PRGFC GVV A    +       A +Y  HE      +VHN+ ++ +L+  G                +I I+D ++ P    V++SAHG   +  ++AR + L   D TC+ VTK H  +K    +GYQI  IG   H E I       +S+ ++E V D+ N+  E   P+F   QTT+S+ +  EIT+ LK +Y +I     + +C A ++RQ+A+ ++  +V+ + V+GD++S+NS +L E+  K+ I + L+ +  +I DE       +AIT+G STP
  S:     3 RVILNNPRGFCAGVVRAIQVVETALEKWGAPIYVKHE------IVHNRHVVDDLKRRG----------------AIFIEDLSDVPSGEKVVYSAHGIPPEVREEARTRNLFDIDATCVLVTKIHSAVKLYASKGYQIILIGKKKHVEVIGIRGEAPESVTVVEKVEDVANLPFEESVPLFFVTQTTLSLDDVAEITQALKVRYPHIITLPSSSVCYATQNRQEALRSVLPKVNFVYVIGDVQSSNSNRLREVAEKRNIPARLVNSPDHISDEILNYSGDIAITAGASTP 269
>gi|90022208|ref|YP_528035.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Saccharophagus degradans 2-40] >gi|123090297|sp|Q21HK6|ISPH_SACD2 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|89951808|gb|ABD81823.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Saccharophagus degradans 2-40] (311 aa)
Score = 364, Expect = 5.6e-33, Identities = 99/287 (34%), Positives = 149/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+I    PRGFC GV  A     +      A +Y  HE      +VHNK +++ L+E G    D             E++   +  IVIFSAHG  Q    +A  +GL VFD TC  VTK H  + +    G +   IG   HPE   T+     +   +I L+E  +D+E +       +    QTT+S+ +   + ++L++K+ +I    K+DIC A ++RQDAV  +  E DL+LVVG   S+NS +L E+  +    ++LI   +++   WF N K + IT+G S P  L   VI
  S:     1 MEIKLANPRGFCAGVDRAIDIVNRALDVFGAPIYVRHE------VVHNKFVVERLKERGAIFVD-------------ELEAVPDDVIVIFSAHGVSQAVRQEADRRGLKVFDATCPLVTKVHMEVAKYSNDGCECVLIGHEGHPEVEGTMGQYDTANGGAIYLVEDESDVEQLEVRDPTRLSYVTQTTLSMDDTARVIDSLRAKFPHITGPRKDDICYATQNRQDAVKQLALECDLVLVVGSPNSSNSNRLRELAERCGTAAYLIDGPEDLDKSWFANCKNIGITAGASAPEVLVRDVI 280
>gi|89898079|ref|YP_515189.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chlamydophila felis Fe/C-56] >gi|123483657|sp|Q255J4|ISPH_CHLFF 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|89331451|dbj|BAE81044.1| penicillin tolerance metalloproteinase [Chlamydophila felis Fe/C-56] (309 aa)
Score = 364, Expect = 5.8e-33, Identities = 93/278 (33%), Positives = 152/278 (54%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPI---VIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           ++I   PRGFC GVV A    +       A +Y  HE      +VHN+ ++ +L   G                +I I++ ++ P    VI+SAHG   +  ++A+ + L   D TC+ VTK H  +K    +GYQI  IG   H E I        S+ ++E V D+EN+    + P+F   QTT+S+ +  EIT+ LK +Y N+     + +C A ++RQ+A+ ++   V+ + VVGD++S+NS +L E+  ++ I + L+ +  +I DE       +AIT+G STP
  S:     3 RVILSNPRGFCAGVVRAIQVVEAALEKWGAPIYVKHE------IVHNRHVVDDLRRRG----------------AIFIENLSDIPCGGKVIYSAHGIPPEVREEAKNRNLFDIDATCVLVTKIHSAVKLYASKGYQIILIGKKKHVEVIGIYGEAPDSVTVVEKVEDVENLPFGIDTPLFFVTQTTLSLDDVAEITQALKVRYPNVITLPSSSVCYATQNRQEALRSVLPRVNFVYVVGDVQSSNSNRLREVAERRNIPARLVNSPDHISDEILNYSGDIAITAGASTP 269
>gi|53804096|ref|YP_114253.1| hydroxymethylbutenyl pyrophosphate reductase [Methylococcus capsulatus str. Bath] >gi|71152189|sp|Q607E5|ISPH_METCA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|53757857|gb|AAU92148.1| hydroxymethylbutenyl pyrophosphate reductase [Methylococcus capsulatus str. Bath] (313 aa)
Score = 364, Expect = 5.9e-33, Identities = 98/292 (33%), Positives = 152/292 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+II   PRGFC GV  A     +      A +Y  HE      +VHN+ ++  L E G    +             E+ +      VIFSAHG  ++  ++ARE+GL VFD TC  VTK H  + +   +G +I +IG   HPE   T+    +    I L+E+  D+E ++ ++   +    QTT+SI +   + E LK ++  I    K+DIC A ++RQDAV  + ++ D +LVVG   S+NS +L EI  K   ++ LI N   +  +     + + +T+G S P  L   VI  L++
  S:     1 MEIILANPRGFCAGVDRAIEIVDRAIEVFGAPIYVRHE------VVHNRYVVDGLRERGAVFVE-------------ELSEVPENSTVIFSAHGVSKQIQEEARERGLQVFDATCPLVTKVHIEVHQHASEGREIVFIGHAGHPEVEGTMGQYDNPAGGIYLVESPEDVEMLQVKNPDNLAYVTQTTLSIDDTGAVVEALKMRFPKILGPRKDDICYATQNRQDAVKKLAAQCDTILVVGSPNSSNSNRLREIADKLGRKAFLIDNAAQLTRDMVAGAQRIGVTAGASAPEILVQQVIAQLKE 284
>gi|37524598|ref|NP_927942.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|50400936|sp|Q7N8W9|ISPH_PHOLL 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|36784022|emb|CAE12889.1| penicillin tolerance protein [Photorhabdus luminescens subsp. laumondii TTO1] (317 aa)
Score = 364, Expect = 5.9e-33, Identities = 97/295 (32%), Positives = 159/295 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGL-VVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           M+I+   PRGFC GV  A +  ++  +LY     Y+   +VHN+ ++  L + G              I   EI +  +  I+IFSAHG  Q    +AR + L ++FD TC  VTK H  +     +G +   IG   HPE   T+    + +  + L+E+  D+ N++ + E  +    QTT+S+ +  E+ + L +++ NI    K+DIC A  +RQ+AV ++ S+ D++LVVG   S+NS +L E+  +    ++LI + ++IK+EW      + +T+G S P  L   VI  L K LG
  S:     1 MQILLANPRGFCAGVDRAISIVERALELY-GAPIYVRHEVVHNRYVVDNLRKRGA-------------IFIEEISEVPDDAILIFSAHGVSQAIRAEARSRNLTMLFDATCPLVTKVHMEVARASRKGKEAILIGHAGHPEVEGTMGQYNNAEGGMYLVESPADVWNLKVKDEDNLCFMTQTTLSVDDTSEVIDALNARFPNIVGPRKDDICYATTNRQEAVRDLASDADVVLVVGSKNSSNSNRLAELAQRVGKPAYLIDSAEDIKEEWITGISLVGVTAGASAPDILVQQVIERL-KSLG 287
>gi|50122794|ref|YP_051961.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pectobacterium atrosepticum SCRI1043] >gi|71152182|sp|Q6D0C6|ISPH_ERWCT 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|49613320|emb|CAG76771.1| IspH protein (1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase) [Erwinia carotovora subsp. atroseptica SCRI1043] (316 aa)
Score = 364, Expect = 5.9e-33, Identities = 95/295 (32%), Positives = 158/295 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKL-----YPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           M+I+   PRGFC GV  A +  ++  +L     Y  HE      +VHN+ ++  L E G           +  I+ IE  D  +  I+IFSAHG  Q   ++A+ + L VFD TC  VTK H  +    ++G +   IG   HPE   T+    + D  + L+E+ +D+  ++ + EK +    QTT+S+ +   + + L+ ++  I    K+DIC A  +RQ+AV ++  + D++ VVG   S+NS +L E+  +    ++LI +  +I++ W      + +T+G S P  L   VI  L K+LG
  S:     1 MQILLANPRGFCAGVDRAISIVERALELFGTPIYVRHE------VVHNRYVVNGLRERG-----------AIFIEQIE--DVPDGAILIFSAHGVSQAVRNEAKNRDLTVFDATCPLVTKVHMEVARASKKGVEAILIGHAGHPEVEGTMGQYSNADGGMYLVESPDDVWQLQVKDEKNLCFMTQTTLSVDDTYAVIDALRERFPRIIGPRKDDICYATTNRQEAVRHLSDKADVVFVVGSKNSSNSNRLAELAQRAGKAAYLIDSADDIQESWLTGASYVGVTAGASAPDILVQQVIQRL-KELG 286
>gi|160872865|ref|ZP_02062997.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rickettsiella grylli] >gi|159121664|gb|EDP47002.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rickettsiella grylli] (316 aa)
Score = 364, Expect = 6.7e-33, Identities = 93/287 (32%), Positives = 151/287 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           MKI+   PRGFC GV  A    K+   L+     Y+   +VHN+ I+ EL++ G+        +  E I  I +         IFSAHG      + A+++ L +FD TC  VTK H  +      G +   IG  +HPE   +L    +    I L+E ++DI ++  ++   +    QTT+S+ + + I + LK+++  I    K DIC A ++RQ AV  +  + D++ V+G + S+NS +L E+  +    ++LI + K+I   WFI KK + IT+G S P +L   V+
  S:     1 MKIVLANPRGFCAGVDRAIEIVKRALHLF-GRPLYVRHEVVHNRMIVAELQQKGV--------TFVEHIQQIPMG-----ATAIFSAHGVSLSVREAAKQRNLKIFDATCPLVTKVHMEVARYNRLGQECILIGHADHPEVEGSLGHYDNPRGGIYLVENLDDIASLNVKNPSLLSYVTQTTLSLDDTQVIVKALKARFPKISTPKKEDICYATQNRQQAVKELTQQCDIVFVLGSVNSSNSNRLKELAERLGKPAYLIDSAKDILAHWFIGKKSIGITAGASAPEFLVQEVV 279
>gi|74317878|ref|YP_315618.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Thiobacillus denitrificans ATCC 25259] >gi|74057373|gb|AAZ97813.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, LytB protein [Thiobacillus denitrificans ATCC 25259] (308 aa)
Score = 364, Expect = 6.9e-33, Identities = 92/290 (31%), Positives = 151/290 (52%)
  Q:     3 IIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKS-IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           ++   PRGFC GV  A A  ++      A +Y  HE      +VHN  ++ +L+  G                ++ +++ +  P    VIFSAHG  Q    +A  +GL VFD TC  VTK H  + +  ++GY+I  IG   HPE   TL      + L+ET  D+  +   +   +    QTT+S+ +   + + L++++  I    K+DIC A ++RQDAV ++ S+ D+++VVG   S+NS +L E+     I ++++ N   I   W    + + +T+G S P  L   VI  LE+
  S:     5 VLLANPRGFCAGVDRAIAIVERALEKFGAPIYVRHE------VVHNTFVVDDLKRKG----------------AVFVEELSEVPAGATVIFSAHGVSQAVRTEAAARGLTVFDATCPLVTKVHVEVSKMRDKGYEIVMIGHKGHPEVEGTLGQSAGGMYLVETPGDVATLEVTNPDCLAYVTQTTLSVDDAARVVDALRARFPTITGPKKDDICYATQNRQDAVKHLASQCDVVIVVGSPTSSNSNRLREVAENLGIAAYMVDNADEIDPRWVSGNQRVGVTAGASAPDVLVRAVIDRLER 283
>gi|26106347|gb|AAN78533.1|AE016755_33 IspH protein [Escherichia coli CFT073] (331 aa)
Score = 363, Expect = 7.5e-33, Identities = 91/292 (31%), Positives = 156/292 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+I+   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L E G              I   +I +  +  I+IFSAHG  Q   ++A+ + L VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  + L+E+ +D+  +  ++E+ +    QTT+S+ +  ++ + L+ ++  I    K+DIC A  +RQ+AV  +  + +++LVVG   S+NS +L E+  +    + LI + K+I++EW    KC+ +T+G S P  L   V+  L++
  S:    16 MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHE------VVHNRYVVDSLRERGA-------------IFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQQ 299
>gi|30061597|ref|NP_835768.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Shigella flexneri 2a str. 2457T] >gi|56479587|ref|NP_705985.2| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Shigella flexneri 2a str. 301] >gi|110804096|ref|YP_687616.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Shigella flexneri 5 str. 8401] >gi|122957685|sp|Q0T8G5|ISPH_SHIF8 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|50400952|sp|Q7UDT8|ISPH_SHIFL 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|30039839|gb|AAP15573.1| LytB protein [Shigella flexneri 2a str. 2457T] >gi|56383138|gb|AAN41692.2| LytB protein [Shigella flexneri 2a str. 301] >gi|110613644|gb|ABF02311.1| penicillin tolerance protein [Shigella flexneri 5 str. 8401] (316 aa)
Score = 363, Expect = 7.6e-33, Identities = 91/292 (31%), Positives = 156/292 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+I+   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L E G              I   +I +  +  I+IFSAHG  Q   ++A+ + L VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  + L+E+ +D+  +  ++E+ +    QTT+S+ +  ++ + L+ ++  I    K+DIC A  +RQ+AV  +  + +++LVVG   S+NS +L E+  +    + LI + K+I++EW    KC+ +T+G S P  L   V+  L++
  S:     1 MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHE------VVHNRYVVDSLRERGA-------------IFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKHAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQQ 284
>gi|157159496|ref|YP_001456814.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli HS] >gi|170021612|ref|YP_001726566.1| hydroxymethylbutenyl pyrophosphate reductase [Escherichia coli ATCC 8739] >gi|191168896|ref|ZP_03030667.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli B7A] >gi|166973797|sp|A7ZVX7|ISPH_ECOHS 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|189045807|sp|B1IRE6|ISPH_ECOLC 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|157065176|gb|ABV04431.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli HS] >gi|169756540|gb|ACA79239.1| hydroxymethylbutenyl pyrophosphate reductase [Escherichia coli ATCC 8739] >gi|190901062|gb|EDV60840.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli B7A] (316 aa)
Score = 363, Expect = 7.6e-33, Identities = 91/292 (31%), Positives = 156/292 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+I+   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L E G              I   +I +  +  I+IFSAHG  Q   ++A+ + L VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  + L+E+ +D+  +  ++E+ +    QTT+S+ +  ++ + L+ ++  I    K+DIC A  +RQ+AV  +  + +++LVVG   S+NS +L E+  +    + LI + K+I++EW    KC+ +T+G S P  L   V+  L++
  S:     1 MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHE------VVHNRYVVDSLRERGA-------------IFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKSAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQQ 284
>gi|15799711|ref|NP_285723.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 EDL933] >gi|15829286|ref|NP_308059.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. Sakai] >gi|16128023|ref|NP_414570.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase, 4Fe-4S protein [Escherichia coli str. K-12 substr. MG1655] >gi|74310647|ref|YP_309066.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Shigella sonnei Ss046] >gi|82542645|ref|YP_406592.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Shigella boydii Sb227] >gi|82775431|ref|YP_401778.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Shigella dysenteriae Sd197] >gi|89106913|ref|AP_000693.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase, 4Fe-4S protein [Escherichia coli W3110] >gi|157155637|ref|YP_001461197.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli E24377A] >gi|161486340|ref|NP_751989.2| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli CFT073] >gi|168707747|ref|ZP_02740024.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC4045] >gi|168721764|ref|ZP_02754041.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC4206] >gi|168739178|ref|ZP_02771455.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC4115] >gi|168751717|ref|ZP_02776739.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC4113] >gi|168756853|ref|ZP_02781860.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC4401] >gi|168762789|ref|ZP_02787796.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC4501] >gi|168766717|ref|ZP_02791724.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC4486] >gi|168776945|ref|ZP_02801952.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC4196] >gi|168781726|ref|ZP_02806733.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC4076] >gi|168785080|ref|ZP_02810087.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC869] >gi|168792397|ref|ZP_02817404.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC4042] >gi|168801910|ref|ZP_02826917.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC508] >gi|170079692|ref|YP_001729012.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase, 4Fe-4S protein [Escherichia coli str. K12 substr. DH10B] >gi|170684275|ref|YP_001742144.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli SMS-3-5] >gi|187731568|ref|YP_001878853.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Shigella boydii CDC 3083-94] >gi|188494610|ref|ZP_03001880.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli 53638] >gi|193066217|ref|ZP_03047270.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli E22] >gi|193070970|ref|ZP_03051899.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli E110019] >gi|194429876|ref|ZP_03062388.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli B171] >gi|194434544|ref|ZP_03066802.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Shigella dysenteriae 1012] >gi|194439679|ref|ZP_03071749.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli 101-1] >gi|195937702|ref|ZP_03083084.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC4024] >gi|50402182|sp|P62623|ISPH_ECOLI 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|123560614|sp|Q326J4|ISPH_SHIBS 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|123563559|sp|Q32K68|ISPH_SHIDS 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|123618115|sp|Q3Z5Y1|ISPH_SHISS 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|166973796|sp|A7ZHB8|ISPH_ECO24 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|50402183|sp|P62624|ISPH_ECOL6 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|50402184|sp|P62625|ISPH_ECO57 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|12512712|gb|AAG54331.1|AE005179_8 control of stringent response; involved in penicillin tolerance [Escherichia coli O157:H7 EDL933] >gi|41933|emb|CAA38707.1| ORF 2 [Escherichia coli] >gi|1786212|gb|AAC73140.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase, 4Fe-4S protein [Escherichia coli str. K-12 substr. MG1655] >gi|13359488|dbj|BAB33455.1| LytB protein [Escherichia coli O157:H7 str. Sakai] >gi|18652795|gb|AAL38655.1| IspH; LytB [Escherichia coli] >gi|21321911|dbj|BAB96598.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase, 4Fe-4S protein [Escherichia coli W3110] >gi|73854124|gb|AAZ86831.1| control of stringent response [Shigella sonnei Ss046] >gi|81239579|gb|ABB60289.1| control of stringent response [Shigella dysenteriae Sd197] >gi|81244056|gb|ABB64764.1| LytB [Shigella boydii Sb227] >gi|157077667|gb|ABV17375.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli E24377A] >gi|169887527|gb|ACB01234.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase, 4Fe-4S protein [Escherichia coli str. K12 substr. DH10B] >gi|170521993|gb|ACB20171.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli SMS-3-5] >gi|187428560|gb|ACD07834.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Shigella boydii CDC 3083-94] >gi|187767735|gb|EDU31579.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC4196] >gi|188014310|gb|EDU52432.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC4113] >gi|188489809|gb|EDU64912.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli 53638] >gi|189000791|gb|EDU69777.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC4076] >gi|189356043|gb|EDU74462.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC4401] >gi|189364175|gb|EDU82594.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC4486] >gi|189366997|gb|EDU85413.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC4501] >gi|189374871|gb|EDU93287.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC869] >gi|189376005|gb|EDU94421.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli O157:H7 str. EC508] >gi|192926142|gb|EDV80783.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli E22] >gi|192955700|gb|EDV86174.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli E110019] >gi|194412095|gb|EDX28405.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli B171] >gi|194417197|gb|EDX33308.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Shigella dysenteriae 1012] >gi|194421364|gb|EDX37381.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli 101-1] (316 aa)
Score = 363, Expect = 7.6e-33, Identities = 91/292 (31%), Positives = 156/292 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+I+   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L E G              I   +I +  +  I+IFSAHG  Q   ++A+ + L VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  + L+E+ +D+  +  ++E+ +    QTT+S+ +  ++ + L+ ++  I    K+DIC A  +RQ+AV  +  + +++LVVG   S+NS +L E+  +    + LI + K+I++EW    KC+ +T+G S P  L   V+  L++
  S:     1 MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHE------VVHNRYVVDSLRERGA-------------IFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQQ 284
>gi|82701224|ref|YP_410790.1| hydroxymethylbutenyl pyrophosphate reductase [Nitrosospira multiformis ATCC 25196] >gi|82409289|gb|ABB73398.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nitrosospira multiformis ATCC 25196] (319 aa)
Score = 363, Expect = 8.2e-33, Identities = 91/287 (31%), Positives = 153/287 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDK----SIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +K++   PRGFC GV  A    ++      A +Y  HE      +VHN+ ++++LE+ G                ++ +++ +  P   I+IFSAHG       +A      VFD TC  VTK H  + +  +QG +I  IG   HPE   T+   +    S+ L+ET  D+E ++ +    +    QTT+S+ +   + + LK ++ NI    K+DIC A ++RQDAV  M  + DL++VVG   S+NS +L E+     ++++++   + +++ W   K  + IT+G S P  L   VI
  S:     7 IKVLLANPRGFCAGVDRAIEIVERALSVHGAPIYVRHE------VVHNRFVVEDLEKKG----------------AVFVENLDEVPAGSILIFSAHGVSHAVRREAEAGQFKVFDATCPLVTKVHIEVAKMRDQGREIIMIGHAGHPEVEGTMGQAEGDGPSMYLVETEEDVEKLQVQDPAHLAYVTQTTLSVDDANRVIQALKGRFPNILGPKKDDICYATQNRQDAVKTMVKQCDLVIVVGSPNSSNSNRLCEVARNAGVDAYMLDRAEQLQEAWLKGKMRIGITAGASAPEVLVQEVI 285
>gi|77976148|ref|ZP_00831681.1| COG0761: Penicillin tolerance protein [Yersinia frederiksenii ATCC 33641] (317 aa)
Score = 362, Expect = 9.6e-33, Identities = 92/287 (32%), Positives = 152/287 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGL-VVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+I+   PRGFC GV  A +  ++  ++Y     Y+   +VHN+ ++  L E G                +I I+D +  P   I+IFSAHG  Q    +AR + L ++FD TC  VTK H  +     +G +   IG   HPE   T+    +    + L+E+ +D+  +  + E  +    QTT+S+ +   + + L  ++  I    K+DIC A  +RQ+AV N+ S+ D++LVVG   S+NS +L E+  +    ++LI +  +I++ W  N  C+ +T+G S P  L   VI
  S:     1 MQILLANPRGFCAGVDRAISIVERAIEMY-GAPIYVRHEVVHNRYVVDSLRERG----------------AIFIEDISEVPDGSILIFSAHGVSQAVRAEARARDLTMLFDATCPLVTKVHMEVARASRKGKEAILIGHAGHPEVEGTMGQYSNPKGGMYLVESPDDVWKLDVKDENNLCFMTQTTLSVDDTSAVIDALHKRFPKIIGPRKDDICYATTNRQEAVRNLASDADVVLVVGSKNSSNSNRLAELAQRMGKSAYLIDSADDIQESWLQNAACIGVTAGASAPDILVQQVI 280
>gi|90580540|ref|ZP_01236345.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio angustum S14] >gi|90438198|gb|EAS63384.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio angustum S14] (315 aa)
Score = 362, Expect = 1.1e-32, Identities = 93/284 (32%), Positives = 157/284 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLAN 284
           MKI+   PRGFC GV  A +  ++  ++Y     Y+   +VHN+ +++ L++ G    ++ +          E+ D N   IVIFSAHG  Q   ++++++ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    + D  + L+ET +D++ ++   + P  +   +QTT+S+ E  ++ + L+  +  I+   K+DIC A ++RQDAV  M   VD+++VVG   S+NS +L E+  K     +L    ++I+  WF NK  + +T+G S P  L N
  S:     1 MKILLANPRGFCAGVDRAISIVERALEMY-QPPIYVRHEVVHNRFVVEGLKQRGAIFVEELS----------EVPDDN---IVIFSAHGVSQAVRNESKQRQLTVFDATCPLVTKVHMEVARASRKAMEVVLIGHAGHPEVEGTMGQYANQDGGMYLVETTDDVDKLKAIVKDPSNLHYVSQTTLSVDETADVIDRLRIVFPEIQGPRKDDICYATQNRQDAVREMAETVDVMIVVGSKNSSNSNRLRELSEKLGTPGYLTDCVEDIEASWFENKTKVGVTAGASAPEELVN 278
>gi|27378118|ref|NP_769647.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bradyrhizobium japonicum USDA 110] >gi|50401024|sp|Q89QW7|ISPH2_BRAJA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 2 >gi|27351265|dbj|BAC48272.1| penicillin tolerance protein [Bradyrhizobium japonicum USDA 110] (308 aa)
Score = 362, Expect = 1.1e-32, Identities = 89/287 (31%), Positives = 156/287 (54%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP--IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M++    PRGFC GVV A    ++  +     +Y  HE      +VHNK +++ L+  G    ++     SE+           PP  + +FSAHG  +   ++A  + L V + TC  VTK H+  K  I +G  +  IG   HPE   T+  +   ++L+++V ++  +   ++ P+    QTT+S+ +  +I   L++++ +I+  +  DIC A ++RQ AV ++   VD++LVVG   S+NS +L EIG +  + S+LI +   +  EW  + + + +T+G S P  L + VI
  S:     1 MEVYLAQPRGFCAGVVRAIEIVERALEKFGPPVYVRHE------IVHNKYVVESLKNKGAIFVEE----LSEV-----------PPKAVTVFSAHGVARSVEEEAAARDLPVLNATCPLVTKVHNQGKRYITKGRTLILIGHAGHPEVEGTMGQVPAPVLLVQSVEEVNALTLPADTPVAYITQTTLSVDDTRDIISALQARFTDIQGPDIRDICYATQNRQSAVRDLSKLVDVILVVGAANSSNSNRLREIGTEAGVASYLIADGSELNPEWLKDARTVGVTAGASAPEVLVDDVI 276
>gi|68165336|gb|AAY87628.1| LytB [Vibrio cholerae] (280 aa)
Score = 362, Expect = 1.2e-32, Identities = 91/279 (32%), Positives = 155/279 (55%)
  Q:     9 RGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           RGFC GV  A +  ++  +LY     Y+   +VHN+ +++ L++ G +  ++ N          E+ D N   IVIFSAHG  Q    +A+E+ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S    + L+E   D+ +++ + + P  +   +QTT+S+ E  ++ + L+  +  I+   K+DIC A ++RQDAV  +  +VD+++VVG   S+NS +L E+  K     +LI   ++I  EWF++ + + +T+G S P  L N ++
  S:     1 RGFCAGVDRAISIVERALELY-QPPIYVRHEVVHNRFVVEGLKQRGARFVEELN----------EVPDDN---IVIFSAHGVSQAVRQEAKERSLTVFDATCPLVTKVHMEVARASRKNMEVVLIGHAGHPEVEGTMGQYASDTGGMYLVEKPEDVVSLQAKVKDPSNLHYVSQTTLSVDETADVIDELRRVFPKIQGPRKDDICYATQNRQDAVRILAEQVDVMVVVGSKNSSNSTRLKELAEKLGTPGYLIDCPQDIDPEWFVDAQLIGVTAGASAPEELVNQIL 273
>gi|88608647|ref|YP_506323.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Neorickettsia sennetsu str. Miyayama] >gi|123491974|sp|Q2GDX3|ISPH_NEOSM 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|88600816|gb|ABD46284.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Neorickettsia sennetsu str. Miyayama] (303 aa)
Score = 361, Expect = 1.4e-32, Identities = 91/297 (30%), Positives = 161/297 (54%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKS-IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTA 297
           M+I    PRGFC GV  A  T +   + YP  + ++   +VHN  +I++ +  G+   +D        I  +E K      ++IFSAHG  ++     +   LV+ D TC  V+K H  ++   ++G+ I  IG  NH E I T+   K+   +++   DI+N+ + + K  +VT Q+T+++     +   +K K+ N+  ++D+C A ++RQ+AV  +  EVDL+L+VG   S+NS+ L+++  K   ++ LI N   ++ +WF     + I+SG S P  L   ++ FL+K+  +A
  S:     1 MQIFVACPRGFCAGVERAIETVEIAIRRYPEKKIFVYHEIVHNSRVIQDFKARGVDFIED--------ITKVEPKS-----VLIFSAHGVSEEIEKYVKSLDLVLVDATCPLVSKIHREVQRFEKEGFIILVIGNRNHAEIIGTVGRTKTQAYIVQDPEDIDNLPSITGKLAYVT-QSTLALEYTSTMINKIKEKFPNVVGRSDVCYATQNRQEAVKALAKEVDLMLIVGSTNSSNSRNLMQVSSKICQKAFLIDNYNEVEPDWFEGVDRVGISSGASAPEILVQDLVSFLKKRFPSA 284
>gi|91209086|ref|YP_539072.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli UTI89] >gi|117622318|ref|YP_851231.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli APEC O1] >gi|191174097|ref|ZP_03035611.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli F11] >gi|122425074|sp|Q1RGH3|ISPH_ECOUT 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|166217163|sp|A1A777|ISPH_ECOK1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|91070660|gb|ABE05541.1| IspH protein [Escherichia coli UTI89] >gi|115511442|gb|ABI99516.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli APEC O1] >gi|190905591|gb|EDV65216.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli F11] (316 aa)
Score = 361, Expect = 1.4e-32, Identities = 90/292 (30%), Positives = 155/292 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+I+   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L E G              I   +I +  +  I+IFSAHG  Q   ++A+ + L VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  + L+E+ +D+  +  ++E+ +    QTT+S+ +  ++ + L+ ++  I    K+DIC A  +RQ+AV  +  + +++LVVG   S+NS +L E+  +    + LI +  +I++EW    KC+ +T+G S P  L   V+  L++
  S:     1 MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHE------VVHNRYVVDSLRERGA-------------IFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDATDIQEEWVKEAKCVGVTAGASAPDILVQNVVARLQQ 284
>gi|39936795|ref|NP_949071.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodopseudomonas palustris CGA009] >gi|50400884|sp|Q6N3G0|ISPH1_RHOPA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 1 >gi|39650652|emb|CAE29175.1| penicillin tolerance protein [Rhodopseudomonas palustris CGA009] (306 aa)
Score = 361, Expect = 1.5e-32, Identities = 95/285 (33%), Positives = 149/285 (52%)
  Q:     8 PRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP--IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           PRGFC GVV A    ++  + Y     Y+   +VHNK +++ L+  G    ++     SE+           PP  + +FSAHG  +   ++A  + L V + TC  VTK H+  K    +G  +  IG   HPE   T+  +   ++L++ ++D+  +    E P+    QTT+S+ + ++I   L  K+ +IE  +  DIC A ++RQ AV  M   VDL+LVVG   S+NS +L EIG +  I S+LI +   +   W   KK + IT+G S P  L + VI  L +
  S:     6 PRGFCAGVVRAIEIVERALEKY-GPPVYVRHEIVHNKYVVESLKAKGAIFVEE----LSEV-----------PPKAVTVFSAHGVARSIEEEAAARDLPVLNATCPLVTKVHNQGKRYTSKGRTLILIGHAGHPEVEGTMGQVPGPVLLVQNLDDVAALTLPPETPVAYITQTTLSVDDTKDIIVALSKKFHDIEGPDTRDICYATQNRQSAVRQMSKLVDLILVVGANNSSNSNRLREIGTEAGIPSYLIADGSELDPAWLDGKKAVGITAGASAPEVLVDDVIEALRR 279
>gi|120553797|ref|YP_958148.1| hydroxymethylbutenyl pyrophosphate reductase [Marinobacter aquaeolei VT8] >gi|166217172|sp|A1TYZ2|ISPH_MARAV 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|120323646|gb|ABM17961.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Marinobacter aquaeolei VT8] (316 aa)
Score = 361, Expect = 1.6e-32, Identities = 99/295 (33%), Positives = 146/295 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           M+I    PRGFC GV  A     +      A +Y  HE      +VHNK ++  L   G    D             E+ +  +  +VIFSAHG  Q   ++A  +GL VFD TC  VTK H  +      G +   IG + HPE   T+     S    I L+E   D++ +  +    +    QTT+S+ +   + + L++K+  IE   K+DIC A ++RQDAV  +  + D++LVVG   S+NS +L E+  +    ++LI     I   W   KK + +T+G S P  L   VI  L K LG
  S:     1 MQIRLANPRGFCAGVDRAIEIVNRALDVFGAPIYVRHE------VVHNKFVVDNLRNRGAIFVD-------------ELGEVPDDKLVIFSAHGVSQAVQNEAARRGLKVFDATCPLVTKVHMEVMRYSRDGRECILIGHHGHPEVEGTMGQYDHSNGGDIYLVEDEADVQKLEVKDPSRLSFVTQTTLSMDDTARVIDALRAKFPQIEGPRKDDICYATQNRQDAVKQLAGDCDIMLVVGSPNSSNSNRLRELAERMGTPAYLIDEAAQIDPAWLYGKKAIGVTAGASAPEVLVADVIKRL-KALG 287
>gi|68165322|gb|AAY87621.1| LytB [Vibrio cholerae] >gi|68165324|gb|AAY87622.1| LytB [Vibrio cholerae] >gi|68165326|gb|AAY87623.1| LytB [Vibrio cholerae] >gi|68165338|gb|AAY87629.1| LytB [Vibrio cholerae] >gi|68165340|gb|AAY87630.1| LytB [Vibrio cholerae] >gi|68165342|gb|AAY87631.1| LytB [Vibrio cholerae] >gi|68165344|gb|AAY87632.1| LytB [Vibrio cholerae] >gi|68165346|gb|AAY87633.1| LytB [Vibrio cholerae] >gi|68165348|gb|AAY87634.1| LytB [Vibrio cholerae] (280 aa)
Score = 360, Expect = 1.8e-32, Identities = 91/279 (32%), Positives = 155/279 (55%)
  Q:     9 RGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           RGFC GV  A +  ++  +LY     Y+   +VHN+ +++ L++ G +  ++ N          E+ D N   IVIFSAHG  Q    +A+E+ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S    + L+E   D+ +++ + + P  +   +QTT+S+ E  ++ + L+  +  I+   K+DIC A ++RQDAV  +  +VD+++VVG   S+NS +L E+  K     +LI   ++I  EWF++ + + +T+G S P  L N ++
  S:     1 RGFCAGVDRAISIVERALELY-QPPIYVRHEVVHNRFVVEGLKQRGARFVEELN----------EVPDDN---IVIFSAHGVSQAVRQEAKERSLTVFDATCPLVTKVHMEVARASRKHMEVVLIGHAGHPEVEGTMGQYASDTGGMYLVEKPEDVVSLQAKVKDPSNLHYVSQTTLSVDETADVIDELRRVFPKIQGPRKDDICYATQNRQDAVRILAEQVDVMVVVGSKNSSNSTRLKELAEKLGTPGYLIDCPQDIDPEWFVDAQLIGVTAGASAPEELVNQIL 273
>gi|85716678|ref|ZP_01047647.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nitrobacter sp. Nb-311A] >gi|85696518|gb|EAQ34407.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nitrobacter sp. Nb-311A] (308 aa)
Score = 360, Expect = 1.9e-32, Identities = 93/292 (31%), Positives = 158/292 (54%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP--IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+++   PRGFC GVV A    ++  +     +Y  HE      +VHNK +++ L+  G    +D     SE+           PP  + +FSAHG  +   ++A  +GL V + TC  VTK H+  K    +G  +  IG   HPE   T+  +   ++L++ V+D+  +   ++ P+    QTT+S+ + ++I   L+ ++ +I+  +  DI  A ++RQ AV ++   VD++LVVG   S+NS +L EIG +  + S+LI +   +  EW    K + IT+G S P  L + VI  L++
  S:     1 MEVLLAQPRGFCAGVVRAIEIVERALEKYGPPVYVRHE------IVHNKYVVESLKNKGAIFVED----LSEV-----------PPKAVTVFSAHGVARSVEEEAFARGLPVLNATCPLVTKVHNQGKRYTSKGRTLILIGHAGHPEVEGTMGQVPGPVLLVQDVDDVAALTLPADTPVAYITQTTLSVDDTKDIILALQQRFTDIQGPDTRDIRYATQNRQSAVRDLSKLVDVILVVGAANSSNSNRLREIGTEVGVASYLIADGSELNAEWLKGAKAVGITAGASAPEVLVDDVIEALKR 281
>gi|94313096|ref|YP_586305.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ralstonia metallidurans CH34] >gi|93356948|gb|ABF11036.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ralstonia metallidurans CH34] (332 aa)
Score = 360, Expect = 2.0e-32, Identities = 91/295 (30%), Positives = 148/295 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAY-----ATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           M++I   PRGFC GVV A      A  K  A +Y  HE      +VHNK +++ L + G +  +             E+ +     + IFSAHG  +  + +A  + L   D TC  V K H+  ++    G  +  IG   HPE   T+  I   +IL++   D+  +   ++ P+    QTT+S+ +   I   L +++ N+      DIC A ++RQ AV  + + VD++LV+G   S+NS +L EIG +  + S+LI +   +   W  +   + IT+G S P  +   VI  L ++LG
  S:     1 MQVILAQPRGFCAGVVRAIEIVDRALVKHGAPVYVRHE------IVHNKHVVESLRQKGARFVE-------------ELDEVPGNAVTIFSAHGVSRDVVSEAARRELHAIDATCPLVIKVHNQGRQYAAAGRHVVLIGHAGHPEVEGTMGQIPGKVILVQNEADVATLDLPNDAPVAYITQTTLSVDDTRNIIAALGARFTNLVGPSTRDICYATQNRQSAVRELSTRVDVILVIGATNSSNSNRLREIGTESGVPSYLIADGSELDPTWVRDAAVVGITAGASAPEEMVEDVIAAL-RRLG 283
>gi|68165330|gb|AAY87625.1| LytB [Vibrio cholerae] >gi|68165334|gb|AAY87627.1| LytB [Vibrio cholerae] (280 aa)
Score = 358, Expect = 2.7e-32, Identities = 91/279 (32%), Positives = 154/279 (55%)
  Q:     9 RGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           RGFC GV  A +  ++  +LY     Y+   +VHN+ +++ L++ G +  ++ N          E+ D N   IVIFSAHG  Q    +A+E+ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S    + L+E   D+ +++ + + P  +   +QTT+S+ E  ++ + L+  +  I+   K+DIC A ++RQDAV  +  +VD+++VVG   S+NS +L E+  K     +LI   ++I  EWF+  + + +T+G S P  L N ++
  S:     1 RGFCAGVDRAISIVERALELY-QPPIYVRHEVVHNRFVVEGLKQRGARFVEELN----------EVPDDN---IVIFSAHGVSQAVRQEAKERSLTVFDATCPLVTKVHMEVARASRKHMEVVLIGHAGHPEVEGTMGQYASDTGGMYLVEKPEDVVSLQAKVKDPSNLHYVSQTTLSVDETADVIDELRRVFPKIQGPRKDDICYATQNRQDAVRILAEQVDVMVVVGSKNSSNSTRLKELAEKLGTPGYLIDCPQDIDPEWFVAAQLIGVTAGASAPEELVNQIL 273
>gi|62185324|ref|YP_220109.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chlamydophila abortus S26/3] >gi|71152178|sp|Q5L5D3|ISPH_CHLAB 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|62148391|emb|CAH64158.1| putative IspH/LytB protein [Chlamydophila abortus S26/3] (309 aa)
Score = 358, Expect = 2.8e-32, Identities = 91/278 (32%), Positives = 152/278 (54%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPI---VIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           ++I   PRGFC GVV A    +       A +Y  HE      +VHN+ ++ +L+  G                +I I+D  + P    VI+SAHG   +  ++A+ + L   D TC+ VTK H  +K    +GYQI  IG   H E I       +S+ ++E V D+ N+  +   P+F   QTT+S+ +  E+T+ LK++Y +I     + +C A ++RQ+A+  +   V+ + V+GD++S+NS +L E+  K+ I + L+ +  +I DE       +A+T+G STP
  S:     3 RVILSNPRGFCAGVVRAIQVVESALEKWGAPIYVKHE------IVHNRHVVDDLKRRG----------------AIFIEDLKDVPCGEKVIYSAHGIPPEVREEAKARNLFDIDATCVLVTKIHSAVKLYASKGYQIILIGKKKHVEVIGIRGEAPESVTVVEKVEDVANLPFDIHVPLFFVTQTTLSLDDVAEVTQALKARYPHIITLPSSSVCYATQNRQEALRAVLPRVNFVYVIGDVQSSNSNRLREVAEKRNIPARLVNSPDHISDEILHYSGDIAVTAGASTP 269
>gi|86137264|ref|ZP_01055842.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Roseobacter sp. MED193] >gi|85826588|gb|EAQ46785.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Roseobacter sp. MED193] (319 aa)
Score = 358, Expect = 3.0e-32, Identities = 98/280 (35%), Positives = 146/280 (52%)
  Q:     8 PRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV  A      A  K  A +Y  HE      +VHNK ++ EL + G           +  ++ +E   ++ P  VIFSAHG  +     A  + +V  D TC  V+K H   +   EQG Q+  IG   HPETI T+    D  ++L+ET  D+ N++    + +    QTT+S+ + + I   L++++  I    K DIC A  +RQ+AV  +  + D +LVVG   S+NS++LVE+G K   + + L+    NI          +AIT+G S P  L N VI
  S:    13 PRGFCAGVDRAIKIVELALEKWGAPVYVRHE------IVHNKFVVDELRDKG-----------AVFVEELEECPEDRP--VIFSAHGVPKSVPAAAEARQMVYVDATCPLVSKVHIEAQRHAEQGLQMIMIGHKGHPETIGTMGQLPDGEVLLVETPEDVANVQVRDPEQLAYVTQTTLSVDDTKGIVAALEARFPAIIGPHKEDICYATTNRQEAVKAVAPKSDAMLVVGAPNSSNSRRLVEVGSKAGCKYAQLVQRADNIDWRALEGISSIAITAGASAPELLVNEVI 283
>gi|110640240|ref|YP_667968.1| LytB protein [Escherichia coli 536] >gi|123049528|sp|Q0TLW2|ISPH_ECOL5 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|110341832|gb|ABG68069.1| LytB protein [Escherichia coli 536] (321 aa)
Score = 357, Expect = 3.7e-32, Identities = 89/287 (31%), Positives = 152/287 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+I+   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L E G              I   +I +  +  I+IFSAHG  Q   ++A+ + L VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  + L+E+ +D+  +  ++E+ +    QTT+S+ +  ++ + L+ ++  I    K+DIC A  +RQ+AV  +  + +++LVVG   S+NS +L E+  +    + LI +  +I++EW    KC+ +T+G S P  L   V+
  S:     1 MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHE------VVHNRYVVDSLRERGA-------------IFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDATDIQEEWVKEAKCVGVTAGASAPDILVQNVV 279
>gi|88607179|ref|YP_504986.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Anaplasma phagocytophilum HZ] >gi|88598242|gb|ABD43712.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Anaplasma phagocytophilum HZ] (324 aa)
Score = 357, Expect = 4.1e-32, Identities = 86/294 (29%), Positives = 159/294 (54%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLY-PNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKL 294
           +++I   PRGFC GV  A A    +   Y  + E Y++  +VHN  +++   +  ++            + S++  +     +++FSAHG  ++    A+E+GLVV D TC  VTK H  I    + GY+I  IG   H E   ++  I   ++L++ V+D+ N+  ++E  +    QTT+S+ +   I E LK+++ +I   +  DIC A ++RQ AV  + S VD++L++G   S+N+ +L+++   +   S LI + +++   WF + K + +T+G S P  L   ++ +   K+
  S:     8 VEVILAQPRGFCAGVERAVAILDMVVDQYIASKEVYVLHEIVHNAYVVESFRKRNVK-----------FVASLD--EVPTGAVLVFSAHGVAKQVRAAAQERGLVVIDATCPLVTKVHLEIHRYNKNGYKIILIGHKGHREVEGSMGQIQSEVLLVQNVDDVYNLPVDAETKLAYVTQTTLSVDDTRVIVEALKTRFPDIVGPDLKDICYATQNRQTAVKELASMVDVMLIMGGKNSSNTNRLLDLAKVRNPRSFLIGSYEDVDLSWFADTKKIGVTAGASAPAILVEELLKYFSSKM 292
>gi|94968766|ref|YP_590814.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Acidobacteria bacterium Ellin345] >gi|94550816|gb|ABF40740.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Acidobacteria bacterium Ellin345] (324 aa)
Score = 357, Expect = 4.2e-32, Identities = 96/291 (32%), Positives = 150/291 (51%)
  Q:     3 IIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           ++ + PRGFC GVV A    + IA        Y+   +VHN+ ++ +L   G    D             EI +  N   VI+SAHG   +  + ++++GL V D TC  VTK H    +  ++G+ +  IG ++H E + TL     +  +I T  +++ +       +    QTT+S+ E   +   LK K+ NI+     DIC A ++RQ AV ++ +E DLLLVVG   S+NS +LVE+    + +SHLI N K I+ EW    + + +T+G S P  L   V+ FL  K
  S:    10 LLLLKPRGFCAGVVRAIDIVR-IALEAFGAPIYVRKEIVHNRYVVDDLASKGAIFVD-------------EIDEVPNGQRVIYSAHGVSPEVREASKKRGLRVIDATCPLVTKVHVEAIKFAKEGHSLVLIGHHDHDEVVGTLGEAPDVTYVISTPEEVQTLEIPDPNRVAYLTQTTLSLDETVHVIAALKQKFPNIKGPHAQDICYATENRQTAVKDVSAECDLLLVVGSDNSSNSNRLVEVARNLRTKSHLIENFKAIQSEWLEGVRTVGVTAGASAPEILVEQVVEFLTSK 289
>gi|68165328|gb|AAY87624.1| LytB [Vibrio cholerae] (280 aa)
Score = 357, Expect = 4.3e-32, Identities = 91/279 (32%), Positives = 154/279 (55%)
  Q:     9 RGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           RGFC GV  A +  +   +LY     Y+   +VHN+ +++ L++ G +  ++ N          E+ D N   IVIFSAHG  Q    +A+E+ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S    + L+E   D+ +++ + + P  +   +QTT+S+ E  ++ + L+  +  I+   K+DIC A ++RQDAV  +  +VD+++VVG   S+NS +L E+  K     +LI   ++I  EWF++ + + +T+G S P  L N ++
  S:     1 RGFCAGVDRAISIVECALELY-QPPIYVRHEVVHNRFVVEGLKQRGARFVEELN----------EVPDDN---IVIFSAHGVSQAVRQEAKERSLTVFDATCPLVTKVHMEVARASRKHMEVVLIGHAGHPEVEGTMGQYASDTGGMYLVEKPEDVVSLQAKVKDPSNLHYVSQTTLSVDETADVIDELRRVFPKIQGPRKDDICYATQNRQDAVRILAEQVDVMVVVGSKNSSNSTRLKELAEKLGTPGYLIDCPQDIDPEWFVDAQLIGVTAGASAPEELVNQIL 273
>gi|68165332|gb|AAY87626.1| LytB [Vibrio cholerae] (280 aa)
Score = 356, Expect = 4.7e-32, Identities = 90/279 (32%), Positives = 155/279 (55%)
  Q:     9 RGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           RGFC GV  A +  ++  +LY     Y+   +VHN+ +++ L++ G +  ++ N          E+ D N   IVIFSAHG  Q    +A+++ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S    + L+E   D+ +++ + + P  +   +QTT+S+ E  ++ + L+  +  I+   K+DIC A ++RQDAV  +  +VD+++VVG   S+NS +L E+  K     +LI   ++I  EWF++ + + +T+G S P  L N ++
  S:     1 RGFCAGVDRAISIVERALELY-QPPIYVRHEVVHNRFVVEGLKQRGARFVEELN----------EVPDDN---IVIFSAHGVSQAVRQEAKDRSLTVFDATCPLVTKVHMEVARASRKHMEVVLIGHAGHPEVEGTMGQYASDTGGMYLVEKPEDVVSLQAKVKDPSNLHYVSQTTLSVDETADVIDELRRVFPKIQGPRKDDICYATQNRQDAVRILAEQVDVMVVVGSKNSSNSTRLKELAEKLGTPGYLIDCPQDIDPEWFVDAQLIGVTAGASAPEELVNQIL 273
>gi|15605595|ref|NP_220381.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chlamydia trachomatis D/UW-3/CX] >gi|8928182|sp|O84867|ISPH_CHLTR 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|3329333|gb|AAC68457.1| Metalloprotease [Chlamydia trachomatis D/UW-3/CX] (307 aa)
Score = 356, Expect = 5.3e-32, Identities = 91/278 (32%), Positives = 147/278 (52%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPI---VIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           KII  +PRGFC GV+ A  T +   +     +Y  HE      +VHN+ ++ +L E G                +I I+D    P    VIFSAHG      ++A E+GL+  D TC  VTK H  +K   ++GY I  IG   H E I         I ++E + ++E +   ++ P+F   QTT+S+ +  +I   LK++Y  I     + IC A ++RQ A+ N+  +VD + V+GD +S+NS +L E+  ++ + + L+ +   + +E       + IT+G STP
  S:     3 KIILCSPRGFCAGVIRAIQTVEVALEKWGRPIYVKHE------IVHNRHVVDKLREKG----------------AIFIEDLQEVPRNSRVIFSAHGVPPSVREEAEERGLIAIDATCGLVTKVHSAVKMYAKKGYHIILIGKRKHVEIIGIRGEAPDQITVVENIAEVEALPFSAQDPLFYVTQTTLSMDDAADIVAALKARYPRIFTLPSSSICYATQNRQGALRNILPQVDFVYVIGDTQSSNSNRLREVAERRGVTARLVNHPDEVTEEILQYSGNIGITAGASTP 269
>gi|113868985|ref|YP_727474.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ralstonia eutropha H16] >gi|113527761|emb|CAJ94106.1| penicillin tolerance protein [Ralstonia eutropha H16] (308 aa)
Score = 356, Expect = 5.4e-32, Identities = 92/290 (31%), Positives = 153/290 (52%)
  Q:     8 PRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKS-IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTA 297
           PRGFC GV  A    ++      A +Y  HE      +VHN  ++  L   G                ++ +++ +  P    VIFSAHG  ++    A  +GL VFD TC  VTK H  + +   +G +I  IG   HPE   T+    S ++L+E+V D+  ++      +    QTT+S+ E  EI   LK+++  I    K DIC A ++RQDAV  M  +V++++VVG   S+NS +L E+  +  + ++++   + ++ EW   K+ + +T+G S P  LA  ++  L ++LG +
  S:     4 PRGFCAGVDRAIEIVERALERFGAPIYVRHE------IVHNAYVVAGLRRKG----------------AVFVRELDEVPAGATVIFSAHGVSREVRADAAARGLHVFDATCPLVTKVHVEVSKMRAEGCEIVMIGHRGHPEVEGTMGQASSGMLLVESVADVATLQVTDPSRLAYVTQTTLSVDETREIVAALKARFPQIREPKKQDICYATQNRQDAVKFMAPQVEVVIVVGSPNSSNSNRLRELAERLGVPAYMVDAPEQVRPEWIAGKRRIGLTAGASAPEALAQSIVERL-RELGAS 281
>gi|88813003|ref|ZP_01128246.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nitrococcus mobilis Nb-231] >gi|88789781|gb|EAR20905.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nitrococcus mobilis Nb-231] (325 aa)
Score = 356, Expect = 5.5e-32, Identities = 85/286 (29%), Positives = 156/286 (54%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-------SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +I+   PRGFC GV  A +  +K      A +Y  HE      +VHN+ ++ +L   G +  ++     SE+ D            VIFSAHG  +    +A ++GL VFD TC  VTK H  +++   +G ++  IG + HPE   T+       +   +I L++   D+E++   +   +   +QTT+S+ +  ++   L+ ++ +I    ++DIC A ++RQDAV+ +  +VD+++VVG   S+N+++L E+  +  + ++ I    ++   W   ++ + IT+G S P  L   V+
  S:     3 RILLANPRGFCAGVERAISIVEKALEAFGAPIYVRHE------VVHNRSVVDDLRRKGARFVEE----LSEVPDG---------STVIFSAHGVSKAVRAEAAQRGLRVFDATCPLVTKVHIEVQKHAREGREVILIGHDGHPEVAGTIGQYEGKGAERGAIYLVQGPEDVESLTVRNADDLAYVSQTTLSMDDAAQVIAALRQRFPDIHGPTRDDICYATQNRQDAVMGLARQVDVMIVVGSGNSSNTRRLRELAERIGVPAYQIDTAADLDRRWLEGREVIGITAGASAPEILVQGVV 283
>gi|21960677|gb|AAM87245.1|AE013973_4 penicillin tolerance protein [Yersinia pestis KIM] >gi|45438303|gb|AAS63850.1| LytB protein [Yersinia pestis biovar Microtus str. 91001] (325 aa)
Score = 355, Expect = 6.3e-32, Identities = 94/297 (31%), Positives = 157/297 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGL-VVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTA 297
           M+I+   PRGFC GV  A +  ++  ++Y     Y+   +VHN+ +++ L E G              I   EI +  +  I+IFSAHG  Q    +AR + L ++FD TC  VTK H  +     +G +   IG   HPE   T+    + +  + L+E+ +D+  +  + E  +    QTT+S+ +   + + L +++  I    K+DIC A  +RQ+AV N+ ++ D++LVVG   S+NS +L E+  +    ++LI +  +I++ W    KC+ +T+G S P  L   VI  L K LG  
  S:     9 MQILLANPRGFCAGVDRAISIVERAIEMY-GAPIYVRHEVVHNRYVVESLCERGA-------------IFIEEISEVPDGSILIFSAHGVSQAVRAEARSRNLTMLFDATCPLVTKVHMEVARASRKGKEAILIGHAGHPEVEGTMGQYSNPNGGMYLVESPDDVWQLNVKDENNLCFMTQTTLSVDDTSAVIDALNTRFPKIVGPRKDDICYATTNRQEAVRNLANDADIVLVVGSKNSSNSNRLAELVQRMGKPAYLIDSAADIQEFWLQGAKCIGVTAGASAPDILVQQVIARL-KDLGAG 297
>gi|121998613|ref|YP_001003400.1| hydroxymethylbutenyl pyrophosphate reductase [Halorhodospira halophila SL1] >gi|121590018|gb|ABM62598.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Halorhodospira halophila SL1] (318 aa)
Score = 355, Expect = 6.3e-32, Identities = 88/278 (31%), Positives = 141/278 (50%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI------DKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           KI    PRGFC GV  A A   +   +Y     Y+   +VHN+ ++ +L   G    +             E+ +  +   VIFSAHG  Q   D+A  +GL VFD TC  VTK H  ++     G ++  IG   HPE   T+           I L++   +   ++      +    QTT+S+ +   I E L+ ++  I+   K+DIC A ++RQDAV  +  EVDL+LVVG + S+NS +L E+ ++   E++LI    ++  +W   ++ + +T+G S P
  S:     3 KIHLANPRGFCAGVDRAIAIVDRALAVY-GSPVYVRHEVVHNRFVVDDLRGRGAVFVE-------------ELHEVPDGATVIFSAHGVPQWVADEAERRGLQVFDATCPLVTKVHKEVRGHARAGREVVLIGHAGHPEVEGTMGQYLAPEGQGGIYLVQNQEEAAALQVRRPDDLAFVTQTTLSVDDAAGIVEALQRRFPAIQGPRKDDICYATQNRQDAVRALAEEVDLMLVVGSVNSSNSNRLRELAVRCGTEAYLIDGAADLDRDWLDGRQAIGVTAGASAP 274
>gi|153950430|ref|YP_001402412.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pseudotuberculosis IP 31758] >gi|166973803|sp|A7FMD4|ISPH_YERP3 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|152961925|gb|ABS49386.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pseudotuberculosis IP 31758] (317 aa)
Score = 355, Expect = 7.3e-32, Identities = 94/297 (31%), Positives = 157/297 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGL-VVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTA 297
           M+I+   PRGFC GV  A +  ++  ++Y     Y+   +VHN+ +++ L E G              I   EI +  +  I+IFSAHG  Q    +AR + L ++FD TC  VTK H  +     +G +   IG   HPE   T+    + +  + L+E+ +D+  +  + E  +    QTT+S+ +   + + L +++  I    K+DIC A  +RQ+AV N+ ++ D++LVVG   S+NS +L E+  +    ++LI +  +I++ W    KC+ +T+G S P  L   VI  L K LG  
  S:     1 MQILLANPRGFCAGVDRAISIVERAIEMY-GAPIYVRHEVVHNRYVVESLCERGA-------------IFIEEISEVPDGSILIFSAHGVSQAVRAEARSRNLTMLFDATCPLVTKVHMEVARASRKGKEAILIGHAGHPEVEGTMGQYSNPNGGMYLVESPDDVWQLSVKDENNLCFMTQTTLSVDDTSAVIDALNTRFPKIVGPRKDDICYATTNRQEAVRNLANDADIVLVVGSKNSSNSNRLAELVQRMGKPAYLIDSAADIQEFWLQGAKCIGVTAGASAPDILVQQVIARL-KDLGAG 289
>gi|16120807|ref|NP_404120.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis CO92] >gi|108810061|ref|YP_653977.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis Antiqua] >gi|108810515|ref|YP_646282.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis Nepal516] >gi|145600409|ref|YP_001164485.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis Pestoides F] >gi|150260486|ref|ZP_01917214.1| LytB protein [Yersinia pestis CA88-4125] >gi|161484743|ref|NP_670994.2| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis KIM] >gi|161511299|ref|NP_994973.2| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis biovar Microtus str. 91001] >gi|162420358|ref|YP_001605362.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis Angola] >gi|165927279|ref|ZP_02223111.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165937835|ref|ZP_02226396.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis biovar Orientalis str. IP275] >gi|166009038|ref|ZP_02229936.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166212005|ref|ZP_02238040.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167401592|ref|ZP_02307086.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167419149|ref|ZP_02310902.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167426015|ref|ZP_02317768.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167469835|ref|ZP_02334539.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis FV-1] >gi|122382440|sp|Q1C0J0|ISPH_YERPA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|122385314|sp|Q1CMU8|ISPH_YERPN 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|166218354|sp|A4TQF0|ISPH_YERPP 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|20138574|sp|P58680|ISPH_YERPE 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|108774163|gb|ABG16682.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis Nepal516] >gi|108781974|gb|ABG16032.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis Antiqua] >gi|115346286|emb|CAL19157.1| LytB protein [Yersinia pestis CO92] >gi|145212105|gb|ABP41512.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis Pestoides F] >gi|149289894|gb|EDM39971.1| LytB protein [Yersinia pestis CA88-4125] >gi|162353173|gb|ABX87121.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis Angola] >gi|165914247|gb|EDR32863.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis biovar Orientalis str. IP275] >gi|165920741|gb|EDR37989.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165992377|gb|EDR44678.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166206751|gb|EDR51231.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166963143|gb|EDR59164.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167048974|gb|EDR60382.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167054938|gb|EDR64738.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pestis biovar Mediaevalis str. K1973002] (317 aa)
Score = 355, Expect = 7.4e-32, Identities = 94/297 (31%), Positives = 157/297 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGL-VVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTA 297
           M+I+   PRGFC GV  A +  ++  ++Y     Y+   +VHN+ +++ L E G              I   EI +  +  I+IFSAHG  Q    +AR + L ++FD TC  VTK H  +     +G +   IG   HPE   T+    + +  + L+E+ +D+  +  + E  +    QTT+S+ +   + + L +++  I    K+DIC A  +RQ+AV N+ ++ D++LVVG   S+NS +L E+  +    ++LI +  +I++ W    KC+ +T+G S P  L   VI  L K LG  
  S:     1 MQILLANPRGFCAGVDRAISIVERAIEMY-GAPIYVRHEVVHNRYVVESLCERGA-------------IFIEEISEVPDGSILIFSAHGVSQAVRAEARSRNLTMLFDATCPLVTKVHMEVARASRKGKEAILIGHAGHPEVEGTMGQYSNPNGGMYLVESPDDVWQLNVKDENNLCFMTQTTLSVDDTSAVIDALNTRFPKIVGPRKDDICYATTNRQEAVRNLANDADIVLVVGSKNSSNSNRLAELVQRMGKPAYLIDSAADIQEFWLQGAKCIGVTAGASAPDILVQQVIARL-KDLGAG 289
>gi|77959747|ref|ZP_00823764.1| COG0761: Penicillin tolerance protein [Yersinia bercovieri ATCC 43970] (317 aa)
Score = 354, Expect = 8.0e-32, Identities = 91/291 (31%), Positives = 152/291 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGL-VVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           M+I+   PRGFC GV  A +  ++  ++Y     Y+   +VHN+ ++  L E G              I   EI +  +  I+IFSAHG  Q    +ARE+ L ++FD TC  VTK H  +     +G +   IG   HPE   T+    +    + L+E+ +D+  +  + E  +    QTT+S+ +   + + L  ++  I    K+DIC A  +RQ+AV N+ ++ DL+LVVG   S+NS +L E+  +    ++LI +  +I++ W +    + +T+G S P  L   VI  L+
  S:     1 MQILLANPRGFCAGVDRAISIVERAIEMY-GAPIYVRHEVVHNRYVVDSLRERGA-------------IFIEEISEVPDGSILIFSAHGVSQAVRAEARERKLTMLFDATCPLVTKVHMEVARASRKGKEAILIGHAGHPEVEGTMGQYSNPKGGMYLVESPDDVWGLNVKDENNLCFMTQTTLSVDDTSAVIDALHKRFPKIVGPRKDDICYATTNRQEAVRNLANDADLVLVVGSKNSSNSNRLAELAQRMGKPAYLIDSAVDIQESWLLGAARIGVTAGASAPDILVQQVIARLQ 284
>gi|76789606|ref|YP_328692.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chlamydia trachomatis A/HAR-13] >gi|123606524|sp|Q3KKH8|ISPH_CHLTA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|76168136|gb|AAX51144.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chlamydia trachomatis A/HAR-13] (307 aa)
Score = 354, Expect = 8.3e-32, Identities = 91/278 (32%), Positives = 147/278 (52%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPI---VIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           KII  +PRGFC GV+ A  T +   +     +Y  HE      +VHN+ ++ +L E G                +I I+D    P    VIFSAHG      ++A E+GL+  D TC  VTK H  +K   ++GY I  IG   H E I         I ++E + ++E +   ++ P+F   QTT+S+ +  +I   LK++Y  I     + IC A ++RQ A+ N+  +VD + V+GD +S+NS +L E+  ++ + + L+ +   + +E       + IT+G STP
  S:     3 KIILCSPRGFCAGVIRAIQTVEVALEKWGRPIYVKHE------IVHNRHVVDKLREKG----------------AIFIEDLQEVPRNSRVIFSAHGVPPSVREEAAERGLIAIDATCGLVTKVHSAVKMYAKKGYHIILIGKRKHVEIIGIRGEAPDQITVVENIAEVEALPFSAQDPLFYVTQTTLSMDDAADIVAALKARYPRIFTLPSSSICYATQNRQGALRNILPQVDFVYVIGDSQSSNSNRLREVAERRGVTARLVNHPDEVTEEILQYSGNIGITAGASTP 269
>gi|148545897|ref|YP_001265999.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas putida F1] >gi|166217479|sp|A5VY55|ISPH_PSEP1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|148509955|gb|ABQ76815.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas putida F1] (315 aa)
Score = 354, Expect = 8.8e-32, Identities = 95/287 (33%), Positives = 148/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+I    PRGFC GV  A     +  +     +Y  HE      +VHNK ++++L   G                +I +++ +  P   IVIFSAHG  Q    +A  +GL VFD TC  VTK H  + +    G +   IG   HPE   T+     S   +I L+E   D+ N++      +    QTT+S+ +   + + L++++ NI    K+DIC A ++RQDAV  +  E D++LVVG   S+NS +L E+  +    ++LI   ++++  WF     + IT+G S P  L   VI
  S:     1 MQIKLANPRGFCAGVDRAIEIVNRALEVFGPPIYVRHE------VVHNKFVVEDLRNRG----------------AIFVEELDQVPDDVIVIFSAHGVSQAVRQEAAGRGLKVFDATCPLVTKVHIEVAKYSRDGRECILIGHEGHPEVEGTMGQYDASNGGAIYLVEDEEDVANLQVRDPNHLAFVTQTTLSMDDTSRVIDALRARFPNIGGPRKDDICYATQNRQDAVKQLAGESDVVLVVGSPNSSNSNRLRELAERMGTPAYLIDGAEDMQRGWFDQTARIGITAGASAPEVLVRGVI 280
>gi|87199109|ref|YP_496366.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Novosphingobium aromaticivorans DSM 12444] >gi|87134790|gb|ABD25532.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Novosphingobium aromaticivorans DSM 12444] (322 aa)
Score = 354, Expect = 9.2e-32, Identities = 92/287 (32%), Positives = 143/287 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           ++++   PRGFC GV  A    ++      A +Y  HE      +VHN+ ++  L+  G           +  ++ ++      P  V+FSAHG  +     A E+GL   D TC  V+K H   + ++E G  I ++G   HPE I T+    + +I L+ETV D+  +      P+    QTT+S+ +  EI   L +++  I      DIC A  +RQ AV  +  E DLLLV+G   S+NS +LVE+  +    S LI     I+ EW    + L +T+G S P  L   V+
  S:    15 LRLLIAAPRGFCAGVDRAIEIVERSLERFGAPVYVRHE------IVHNRYVVDGLKAKG-----------AVFVEELDQVPDGAP--VVFSAHGVPKVVPQTATERGLDWLDATCPLVSKVHRQAERQVEAGRHILFVGHKGHPEVIGTMGQVPEGTISLVETVEDVAGLDFPEGTPLAFLTQTTLSVDDTAEIVAALHTRFPQIVGPKAEDICYATSNRQAAVKAIAGECDLLLVIGAPNSSNSLRLVEVAERLGTRSRLIQRASEIEPEWLDGVETLGLTAGASAPEVLVREVV 291
>gi|26987343|ref|NP_742768.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas putida KT2440] >gi|167031668|ref|YP_001666899.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas putida GB-1] >gi|189045816|sp|B0KM87|ISPH_PSEPG 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|38258015|sp|Q88Q89|ISPH_PSEPK 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|24981994|gb|AAN66232.1|AE016251_8 hydroxymethylbutenyl pyrophosphate reductase [Pseudomonas putida KT2440] >gi|166858156|gb|ABY96563.1| hydroxymethylbutenyl pyrophosphate reductase [Pseudomonas putida GB-1] (315 aa)
Score = 354, Expect = 9.4e-32, Identities = 95/287 (33%), Positives = 148/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+I    PRGFC GV  A     +  +     +Y  HE      +VHNK ++++L   G                +I +++ +  P   IVIFSAHG  Q    +A  +GL VFD TC  VTK H  + +    G +   IG   HPE   T+     S   +I L+E   D+ N++      +    QTT+S+ +   + + L++++ NI    K+DIC A ++RQDAV  +  E D++LVVG   S+NS +L E+  +    ++LI   ++++  WF     + IT+G S P  L   VI
  S:     1 MQIKLANPRGFCAGVDRAIEIVNRALEVFGPPIYVRHE------VVHNKFVVEDLRNRG----------------AIFVEELDQVPDDVIVIFSAHGVSQAVRQEAAGRGLKVFDATCPLVTKVHIEVAKYSRDGRECILIGHEGHPEVEGTMGQYDASNGGAIYLVEDEEDVANLQVRDPDHLAFVTQTTLSMDDTSRVIDALRARFPNIGGPRKDDICYATQNRQDAVKQLAGESDVVLVVGSPNSSNSNRLRELAERMGTPAYLIDGAEDLQRGWFDQAARIGITAGASAPEVLVRGVI 280
>gi|56551771|ref|YP_162610.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Zymomonas mobilis subsp. mobilis ZM4] >gi|71152203|sp|Q5NP61|ISPH_ZYMMO 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|56543345|gb|AAV89499.1| penicillin tolerance protein [Zymomonas mobilis subsp. mobilis ZM4] (340 aa)
Score = 354, Expect = 1.0e-31, Identities = 93/287 (32%), Positives = 148/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP--IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +KII   PRGFC GV+ A     +      A +Y  HE      +VHN+ ++  L+  G    ++     SE+           PP  + +FSAHG  +    +A E+GL V D TC  V K H   +  +  G  +  IG   HPE   TL  ID  + L+ +   ++++   S+ P+    QTT+S+ +   +   L+ K+ ++     +DIC A ++RQ AV ++  + DL+LVVG   S+NS +L EIG+++ + S+LI +   I   WF     + +T+G S P  L   VI
  S:     2 IKIILAQPRGFCAGVIRAIEIVDQALDRVGAPVYVRHE------IVHNRHVVDTLKAKGAVFVEE----LSEV-----------PPGEVTVFSAHGVARTVQKEAEERGLPVVDATCPLVNKVHAQGRRYLSHGRTLILIGHAGHPEIEGTLGQIDGPVHLVGSAEQVDSLDIPSDTPVAFITQTTLSVDDTRSVIAALRKKFTDVIGPDTSDICYATQNRQAAVRDLCKQSDLILVVGSPNSSNSNRLREIGLEEGLPSYLIADGSEIDPVWFEGINTVGLTAGASAPEELVQSVI 277
>gi|73542415|ref|YP_296935.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ralstonia eutropha JMP134] >gi|72119828|gb|AAZ62091.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ralstonia eutropha JMP134] (324 aa)
Score = 353, Expect = 1.0e-31, Identities = 93/297 (31%), Positives = 154/297 (51%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           +I+   PRGFC GV  A    ++      A +Y  HE      +VHN  ++ +L   G                ++ +++ +  P    VIFSAHG  +    +A  +GL VFD TC  VTK H  + +   +G +I  IG   HPE   T+   +  ++L+E+V D+  +       +    QTT+S+ E  EI   LK+++  I    K DIC A ++RQDAV  M  +VD+++VVG   S+NS +L E+  +  + ++++     +  EW   K+ + +T+G S P  LA  ++  L ++LG  +
  S:    11 EILMAQPRGFCAGVDRAIEIVERALTRFGAPIYVRHE------IVHNAYVVADLRRKG----------------AVFVRELDEVPAGATVIFSAHGVSKDVRAEAASRGLNVFDATCPLVTKVHVEVGKMRAEGCEIVMIGHRGHPEVEGTMGQAEGGMLLVESVADVAGLVVADPARLAYVTQTTLSVDETLEIVAALKARFPLIREPKKQDICYATQNRQDAVKFMAPQVDVVIVVGSPNSSNSNRLRELAARLGVPAYMVDAPDQVHPEWVAGKRRIGLTAGASAPEELAQSIVARL-RELGAGH 295
>gi|104783643|ref|YP_610141.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas entomophila L48] >gi|122401810|sp|Q1I4S8|ISPH_PSEE4 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|95112630|emb|CAK17358.1| hydroxymethylbutenyl pyrophosphate reductase [Pseudomonas entomophila L48] (315 aa)
Score = 353, Expect = 1.1e-31, Identities = 93/287 (32%), Positives = 146/287 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+I    PRGFC GV  A     +  +     +Y  HE      +VHNK ++++L   G    ++ +    ++I             VIFSAHG  Q    +A  +GL VFD TC  VTK H  + +    G +   IG   HPE   T+     S   SI L+E   D+  ++  +   +    QTT+S+ +   + + L+ ++ NI    K+DIC A ++RQDAV  +  E D++LVVG   S+NS +L E+  +    ++LI   ++++  WF   + + IT+G S P  L   VI
  S:     1 MQIKLANPRGFCAGVDRAIEIVNRALEVFGPPIYVRHE------VVHNKFVVEDLRNRGAVFVEELDQVPDDVI-------------VIFSAHGVSQAVRQEAAGRGLKVFDATCPLVTKVHIEVAKYSRDGRECILIGHAGHPEVEGTMGQYDASNGGSIYLVEDEKDVAALQVRNPDHLAFVTQTTLSMDDTSRVIDALRERFPNIGGPRKDDICYATQNRQDAVKQLADECDVVLVVGSPNSSNSNRLRELAERMSTPAYLIDGAEDLQRSWFDGAQRIGITAGASAPEVLVRGVI 280
>gi|49085104|gb|AAT51252.1| PA4557 [synthetic construct] (315 aa)
Score = 353, Expect = 1.3e-31, Identities = 96/292 (32%), Positives = 146/292 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+I    PRGFC GV  A     +        +Y  HE      +VHNK ++  L + G              I   E+    N  IVIFSAHG  Q    +A  +GL VFD TC  VTK H  +      G++   IG   HPE   T+     S   +I L+E   D+  +     + +    QTT+S+ +  ++ + L++K+  I+   KNDIC A ++RQDAV  +  + D++LVVG   S+NS +L E+  +    ++LI   ++++  WF   + + IT+G S P  L   VI  L +
  S:     1 MQIKLANPRGFCAGVDRAIEIVNRALDVFGPPIYVRHE------VVHNKFVVDNLRQRGA-------------IFVEELDQVPNNVIVIFSAHGVSQAVRKEAEGRGLKVFDATCPLVTKVHMEVVRYSRDGHECVLIGHEGHPEVEGTMGQYDASNGGAIYLVEDEADVAALEVRKPEALHYVTQTTLSMDDTSKVIDALRAKFPQIQGPRKNDICYATQNRQDAVKELADQCDMVLVVGSPNSSNSNRLRELAERMGTPAYLIDGAEDMQRGWFDGVRRIGITAGASAPEVLVRGVIAQLRE 285
>gi|15599753|ref|NP_253247.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas aeruginosa PAO1] >gi|107099780|ref|ZP_01363698.1| hypothetical protein PaerPA_01000798 [Pseudomonas aeruginosa PACS2] >gi|13629483|sp|Q9HVM7|ISPH_PSEAE 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|9950802|gb|AAG07945.1|AE004869_9 LytB protein [Pseudomonas aeruginosa PAO1] (314 aa)
Score = 353, Expect = 1.3e-31, Identities = 96/292 (32%), Positives = 146/292 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+I    PRGFC GV  A     +        +Y  HE      +VHNK ++  L + G              I   E+    N  IVIFSAHG  Q    +A  +GL VFD TC  VTK H  +      G++   IG   HPE   T+     S   +I L+E   D+  +     + +    QTT+S+ +  ++ + L++K+  I+   KNDIC A ++RQDAV  +  + D++LVVG   S+NS +L E+  +    ++LI   ++++  WF   + + IT+G S P  L   VI  L +
  S:     1 MQIKLANPRGFCAGVDRAIEIVNRALDVFGPPIYVRHE------VVHNKFVVDNLRQRGA-------------IFVEELDQVPNNVIVIFSAHGVSQAVRKEAEGRGLKVFDATCPLVTKVHMEVVRYSRDGHECVLIGHEGHPEVEGTMGQYDASNGGAIYLVEDEADVAALEVRKPEALHYVTQTTLSMDDTSKVIDALRAKFPQIQGPRKNDICYATQNRQDAVKELADQCDMVLVVGSPNSSNSNRLRELAERMGTPAYLIDGAEDMQRGWFDGVRRIGITAGASAPEVLVRGVIAQLRE 285
>gi|83591399|ref|YP_425151.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodospirillum rubrum ATCC 11170] >gi|83574313|gb|ABC20864.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodospirillum rubrum ATCC 11170] (336 aa)
Score = 353, Expect = 1.3e-31, Identities = 90/287 (31%), Positives = 142/287 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++I   PRGFC GV  A     K  +LY     Y+   +VHNK ++  L   G    D             E+ +  +  + +FSAHG  +  I+ A+++ L V D TC  V+K H   +    +G ++  IG   HPE   T   I   + L+   +D++ +     + +    QTT+S+ +  E+ E LK ++  I   +  DIC A ++RQ AV  +  E DLLLVVG   S+NS +L EIG +    S LI + + ++ EW      +A+T+G S P  L   +I
  S:    19 IRVILANPRGFCAGVTRAIEIVDKCLELY-GPPVYVRHEIVHNKHVVDSLRARGAVFVD-------------ELDEVPHGAVTVFSAHGVSKAVINDAKQRQLPVVDATCPLVSKVHKEGQNHAARGREVVLIGHAGHPEVEGTQGQIPGGVYLVSAASDVDGLVVRDPENLAYVTQTTLSVDDTREVIEALKLRFPAIVGPDVKDICYATQNRQSAVREIAREADLLLVVGSRNSSNSNRLREIGAEMGKPSFLIADAEALRPEWMEGVATVAVTAGASAPEALVQGLI 294
>gi|119505898|ref|ZP_01627962.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [marine gamma proteobacterium HTCC2080] >gi|119458279|gb|EAW39390.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [marine gamma proteobacterium HTCC2080] (316 aa)
Score = 352, Expect = 1.5e-31, Identities = 94/293 (32%), Positives = 152/293 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           M ++   PRGFC GV  A     +  +++     Y+   +VHN+ ++ +L   G    ++ +          EI D     IVIFSAHG  +   + AR++GL VFD TC  VTK H  +    + G +   IG   HPE   T+     S    I LIE    + ++  +  + +    QTT+S+ +   + + L+ ++  IE   K+DIC A ++RQDAV ++  +V+++LVVG   S+NS +L E+  +   +S+LI N + I  EW      + +T+G S P  L   VI  L++K
  S:     1 MDVLLANPRGFCAGVDRAIDIVNRALEVF-GRPIYVRHEVVHNRFVVDDLRSRGAVFVEELD----------EIPDD---AIVIFSAHGVSKAVQEGARQRGLRVFDATCPLVTKVHVEVAAFSDNGRECVLIGHGGHPEVEGTMGQYDTSSGGQIYLIEDEEQVAHLMVKDPENLAYVTQTTLSVDDTARVIDALRDRFPAIEGPRKDDICYATQNRQDAVKSLAEKVEVVLVVGSTNSSNSNRLRELAERCGAKSYLIDNAEQISGEWLKGVTGVGVTAGASAPEVLVAEVIDRLQEK 286
>gi|91776781|ref|YP_546537.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Methylobacillus flagellatus KT] >gi|91710768|gb|ABE50696.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Methylobacillus flagellatus KT] (320 aa)
Score = 352, Expect = 1.5e-31, Identities = 97/298 (32%), Positives = 153/298 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           M I+   PRGFC GV  A    ++      A +Y  HE      +VHNK ++ +L++ G                +I +++ +  P    VIFSAHG  +    +A  +GL VFD TC  VTK H  + +    G +I  IG   HPE   T+   +  + L+E+  D+  +  +    +    QTT+SI +   I   LK+K+  I     + IC A ++RQDAV  M  + DL++VVG   S+NS +L E+   + +ES+++ N   +   W + KK + +++G S P  L   VI  L + LG A+
  S:    13 MDIVLANPRGFCAGVDRAIIIVEQALEKFGAPIYVRHE------VVHNKFVVDDLKKKG----------------AIFVEELDEVPAGNTVIFSAHGVSKDVRAEAEARGLQVFDATCPLVTKVHLEVAKMRASGKEIIMIGHKGHPEVEGTMGQAEGGMYLVESPEDVAMLEVKDPSQLAYVTQTTLSIDDAAAIVSALKAKFPEITPPRSDSICYATQNRQDAVKVMARDCDLVIVVGSPNSSNSNRLREVAQNQGVESYMVDNASFLDPAWIVGKKRIGVSAGASAPEVLVQEVINKL-RALGAAD 298
>gi|118594280|ref|ZP_01551627.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Methylophilales bacterium HTCC2181] >gi|118440058|gb|EAV46685.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Methylophilales bacterium HTCC2181] (314 aa)
Score = 352, Expect = 1.6e-31, Identities = 103/285 (36%), Positives = 146/285 (51%)
  Q:     8 PRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL------SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           PRGFC GV  A    ++  K     +Y  HE      +VHN+ +I +L+  G    D+             I D      VIFSAHG  +     A+ + L+  D TC  VTK H  + +   + Y I  IG   HPE   T+      S D SI LIE   D+ N+       +   +QTT+S+ + +EI E LK KY NI+    +DIC A ++RQD+V  M +  D++LVVG   S+NS +LVEI  K+ IE+HLI N      +    K  + +T+G S P      VI F+ +
  S:    13 PRGFCAGVERAIIIVEQALKKFGAPIYVRHE------VVHNRFVIDDLKSKGAIFVDN-------------IADIPEGSHVIFSAHGVSKVVKTDAKNRKLIAIDATCPLVTKVHREVNKMYGENYHIIMIGHTGHPEVEGTMGQIEKNSPDASIHLIENKEDVSNLTIPVNNRVSYVSQTTLSVDDTQEIIEALKYKYPNIQGPKSSDICYATQNRQDSVKKMIAYQDIILVVGSANSSNSNRLVEIAKKQGIEAHLIDNPDEFDSDILKGKNRIGLTAGASAPEAQVQLVINFISQ 291
>gi|51594971|ref|YP_069162.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Yersinia pseudotuberculosis IP 32953] >gi|170025800|ref|YP_001722305.1| hydroxymethylbutenyl pyrophosphate reductase [Yersinia pseudotuberculosis YPIII] >gi|186893973|ref|YP_001871085.1| hydroxymethylbutenyl pyrophosphate reductase [Yersinia pseudotuberculosis PB1/+] >gi|71152202|sp|Q66ES1|ISPH_YERPS 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|51588253|emb|CAH19860.1| regulates the activity of guanosine 3',5'-bispyrophosphate synthetase I (RelA) [Yersinia pseudotuberculosis IP 32953] >gi|169752334|gb|ACA69852.1| hydroxymethylbutenyl pyrophosphate reductase [Yersinia pseudotuberculosis YPIII] >gi|186696999|gb|ACC87628.1| hydroxymethylbutenyl pyrophosphate reductase [Yersinia pseudotuberculosis PB1/+] (317 aa)
Score = 352, Expect = 1.7e-31, Identities = 93/297 (31%), Positives = 157/297 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGL-VVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTA 297
           M+I+   PRGFC GV  A +  ++  ++Y     Y+   +VHN+ +++ L E G              I   EI +  +  I+IFSAHG  Q    +AR + L ++FD TC  VTK H  +     +G +   IG   HPE   T+    + +  + L+E+ +D+  +  + E  +    QTT+S+ +   + + L +++  I    K+DIC A  +RQ+AV N+ ++ D++LVVG   S+NS +L E+  +    ++LI +  +I++ W    +C+ +T+G S P  L   VI  L K LG  
  S:     1 MQILLANPRGFCAGVDRAISIVERAIEMY-GAPIYVRHEVVHNRYVVESLCERGA-------------IFIEEISEVPDGSILIFSAHGVSQAVRAEARSRNLTMLFDATCPLVTKVHMEVARASRKGKEAILIGHAGHPEVEGTMGQYSNPNGGMYLVESPDDVWQLNVKDENNLCFMTQTTLSVDDTSAVIDALNTRFPKIVGPRKDDICYATTNRQEAVRNLANDADIVLVVGSKNSSNSNRLAELVQRMGKPAYLIDSAADIQEFWLQGAQCIGVTAGASAPDILVQQVIARL-KDLGAG 289
>gi|58584307|ref|YP_197880.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|71152200|sp|Q5GTN6|ISPH_WOLTR 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|58418623|gb|AAW70638.1| 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase, IspH [Wolbachia endosymbiont strain TRS of Brugia malayi] (309 aa)
Score = 352, Expect = 1.7e-31, Identities = 98/296 (33%), Positives = 160/296 (54%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK-YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSI-EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGT 296
           M+II   PRGFC GV  A        K Y N  K Y++  +VHNK I+++ +  G+             ++SI +IKD  N  I+IFSAHG  +   DKA+ KG+ V D TC  V+K H   K   + G ++  IG  NHPE       ++  I+L++T+ ++ +++ ++   +    QTT+S  +  EI   LK ++ NI   N  DIC A ++RQ+AV  +   VD++L++G   S+NS +L+++   +   ++LI N   +   W    + + IT+G S P  L + +I  L+  + T
  S:     1 MEIILAEPRGFCAGVKRAVDILAITLKKYRNKRKVYVLHEIVHNKYIVEDFKRQGVI-----------FVNSIRDIKD--NRGILIFSAHGVSKNIEDKAKRKGIQVIDATCPLVSKVHKEAKRYEDSGKELILIGHKNHPEVKGIRGRVNNPIVLVQTLQNVRDLKVKNPDNLSYVTQTTLSTDDTREIITALKLRFPNITGPNLKDICYATQNRQNAVKKLTEIVDIVLIIGSKNSSNSNRLLDLCTARGKRAYLIDNYSYMDKSWLQGIEKIGITAGASAPDILVDELINHLKINVNT 288
>gi|16759043|ref|NP_454660.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29140593|ref|NP_803935.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|20138572|sp|P58678|ISPH_SALTI 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|25303495|pir||AD0508 LytB protein [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16501333|emb|CAD01204.1| LytB protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29136217|gb|AAO67784.1| LytB protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] (316 aa)
Score = 352, Expect = 1.7e-31, Identities = 91/292 (31%), Positives = 153/292 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSI-EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+I+   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L + G           +  I+ I E+ D     I+IFSAHG  Q   ++A+ + L VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  + L+E+  D+  +  ++E  +    QTT+S+ +  ++ + L+ ++  I    K+DIC A  +RQ+AV  +  + D++LVVG   S+NS +L E+  +    + LI +  +I++ W  +  C+ +T+G S P  L   VI  L +
  S:     1 MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHE------VVHNRYVVDSLRQRG-----------AIFIEQISEVPDG---AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGSKNSSNSNRLAELAQRMGRTAFLIDDAADIQEAWVKDAACVGVTAGASAPDILVQNVIARLRE 284
>gi|196157826|ref|YP_002127315.1| 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase [Alteromonas macleodii 'Deep ecotype'] >gi|88772153|gb|EAR03451.1| 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase [Alteromonas macleodii 'Deep ecotype'] >gi|196113605|gb|ACG67321.1| 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase [Alteromonas macleodii 'Deep ecotype'] (314 aa)
Score = 351, Expect = 2.0e-31, Identities = 95/287 (33%), Positives = 150/287 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKL-----YPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPE---TISTLSIDKS-IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+I    PRGFC GV  A    ++  ++     Y  HE      +VHNK ++  L E G    D             E+ +  +  IVIFSAHG  Q    +A  +GL VFD TC  VTK H  +    + G +   IG   HPE   T+   S D+  I L+E+  D+  +  +    ++  +QTT+S+ +  ++ + L++K+  I    K+DIC A ++RQDAV ++  +  +LLVVG   S+NS +L E+  K   +++LI +   I+ EW    + + +T+G S P  L   V+
  S:     1 MQIHLANPRGFCAGVDRAITIVERALEMFEPPIYVRHE------VVHNKFVVDGLRERGALFVD-------------ELHEVPDDSIVIFSAHGVSQAVRKEAENRGLKVFDATCPLVTKVHMEVTRASKTGTECILIGHAGHPEVEGTMGQYSNDEGGIYLVESEADVATLEVKDPTNLYYCSQTTLSVDDTADVIDALRAKFPKINGPRKDDICYATQNRQDAVRDLAQDCQVLLVVGAQNSSNSNRLRELAEKIGAKAYLIADADCIQQEWLEGIEHIGVTAGASAPEVLVQGVV 279
>gi|116052700|ref|YP_793016.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas aeruginosa UCBPP-PA14] >gi|194549680|ref|YP_002084708.1| LytB protein [Pseudomonas aeruginosa C3719] >gi|194555530|ref|YP_002090557.1| LytB protein [Pseudomonas aeruginosa 2192] >gi|122257290|sp|Q02GC0|ISPH_PSEAB 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|32423755|gb|AAP81279.1| drug tolerance protein [Pseudomonas aeruginosa] >gi|115587921|gb|ABJ13936.1| penicillin tolerance protein, LytB [Pseudomonas aeruginosa UCBPP-PA14] >gi|126170626|gb|EAZ56137.1| LytB protein [Pseudomonas aeruginosa C3719] >gi|126197923|gb|EAZ61986.1| LytB protein [Pseudomonas aeruginosa 2192] (314 aa)
Score = 351, Expect = 2.1e-31, Identities = 95/292 (32%), Positives = 149/292 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+I    PRGFC GV  A     +        +Y  HE      +VHNK ++  L + G                +I +++ +  P   IVIFSAHG  Q    +A  +GL VFD TC  VTK H  +      G++   IG   HPE   T+     S   +I L+E   D+  +     + +    QTT+S+ +  ++ + L++K+  I+   KNDIC A ++RQDAV  +  + D++LVVG   S+NS +L E+  +    ++LI   ++++  WF   + + IT+G S P  L   VI  L +
  S:     1 MQIKLANPRGFCAGVDRAIEIVNRALDVFGPPIYVRHE------VVHNKFVVDNLRQRG----------------AIFVEELDQVPDNVIVIFSAHGVSQAVRKEAEGRGLKVFDATCPLVTKVHMEVVRYSRDGHECVLIGHEGHPEVEGTMGQYDASNGGAIYLVEDEADVAALEVRKPEALHYVTQTTLSMDDTSKVIDALRAKFPQIQGPRKNDICYATQNRQDAVKELADQCDMVLVVGSPNSSNSNRLRELAERMGTPAYLIDGAEDMQRGWFDGVRRIGITAGASAPEVLVRGVIAQLRE 285
>gi|56412322|ref|YP_149397.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|71152194|sp|Q5PKI4|ISPH_SALPA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|56126579|gb|AAV76085.1| LytB protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (316 aa)
Score = 351, Expect = 2.1e-31, Identities = 91/292 (31%), Positives = 153/292 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSI-EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+I+   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L + G           +  I+ I E+ D     I+IFSAHG  Q   ++A+ + L VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  + L+E+  D+  +  ++E  +    QTT+S+ +  ++ + L+ ++  I    K+DIC A  +RQ+AV  +  + D++LVVG   S+NS +L E+  +    + LI +  +I++ W  +  C+ +T+G S P  L   VI  L +
  S:     1 MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHE------VVHNRYVVDSLRKRG-----------AIFIEQISEVPDG---AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMFLVESPEDVWTLNVKNEGKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGSKNSSNSNRLAELAQRMGRTAFLIDDAADIQEAWVKDAACVGVTAGASAPDILVQNVIARLRE 284
>gi|59800535|ref|YP_207247.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Neisseria gonorrhoeae FA 1090] >gi|194097690|ref|YP_002000731.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Neisseria gonorrhoeae NCCP11945] >gi|71152190|sp|Q5FAF2|ISPH_NEIG1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|59717430|gb|AAW88835.1| putative penicillin tolerance protein [Neisseria gonorrhoeae FA 1090] >gi|193932980|gb|ACF28804.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Neisseria gonorrhoeae NCCP11945] (322 aa)
Score = 351, Expect = 2.3e-31, Identities = 90/285 (31%), Positives = 145/285 (50%)
  Q:     3 IIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           II   PRGFC GV  A +  ++      A +Y  HE      +VHNK ++  L E G                ++ I+D    P    +++SAHG  +    +A E+G  VFD TC  VTK H  +     Q  +I  IG   H E   T+       ++L+ETV D+  +   +   +   +QTT+S+ E ++I   L +++ NI    K DIC A  +RQ AV  +  + D+++VVG   S+NS +L E+   + I+++++ N   ++  WF  K  + +T+G S P  L   V+
  S:     6 IILANPRGFCAGVDRAISIVERALEEFGAPVYVRHE------VVHNKFVVDNLREKG----------------AVFIEDLAEVPPGATLVYSAHGVSKAVQQEAAERGFRVFDATCPLVTKVHKEVARLDAQDCEIIMIGHKGHAEVEGTMGQLAPGKMLLVETVGDVAKLEVRNPDKLAYVSQTTLSVDETKDIIAALNARFPNIRNPHKEDICYATTNRQTAVKELAEQCDIVIVVGSPNSSNSNRLREVAASRGIDAYMVDNASYLQRTWFEGKSKVGVTAGASAPEVLVREVL 280
>gi|152984227|ref|YP_001350529.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas aeruginosa PA7] >gi|150959385|gb|ABR81410.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas aeruginosa PA7] (314 aa)
Score = 350, Expect = 2.5e-31, Identities = 94/292 (32%), Positives = 150/292 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+I    PRGFC GV  A     +        +Y  HE      +VHNK ++  L + G    ++ +    ++ D++         IVIFSAHG  Q    +A  +GL VFD TC  VTK H  +      G++   IG   HPE   T+     S   +I L+E   D+  +     + +    QTT+S+ +  ++ + L++K+  I+   KNDIC A ++RQDAV  +  + D++LVVG   S+NS +L E+  +    ++LI   ++++  WF   + + IT+G S P  L   VI  L +
  S:     1 MQIKLANPRGFCAGVDRAIEIVNRALDVFGPPIYVRHE------VVHNKFVVDNLRQRGAVFVEELD----QVPDNV---------IVIFSAHGVSQAVRKEAEGRGLKVFDATCPLVTKVHMEVVRYSRDGHECVLIGHEGHPEVEGTMGQYDTSNGGAIYLVEDEADVAALEVRKPEALHYVTQTTLSMDDTSKVIDALRAKFPQIQGPRKNDICYATQNRQDAVKELADQCDMVLVVGSPNSSNSNRLRELAERMGTPAYLIDGAEDMQRGWFDGVRRIGITAGASAPEVLVRGVIAQLRE 285
>gi|42521069|ref|NP_966984.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Wolbachia endosymbiont of Drosophila melanogaster] >gi|50400907|sp|Q73FQ1|ISPH_WOLPM 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|42410810|gb|AAS14918.1| penicillin tolerance protein LytB [Wolbachia endosymbiont of Drosophila melanogaster] (309 aa)
Score = 350, Expect = 2.8e-31, Identities = 95/294 (32%), Positives = 157/294 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK-YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKL 294
           M+II   PRGFC GV  A        + Y N  + Y++  +VHNK I+++ ++ G+             + SIE + ++N  I+IFSAHG  +   D+A+ KG+ V D TC  V K H   K     G ++  IG  NHPE       ++  I L++T+ D+ +++ +    +    QTT+SI +  +I   LK ++  I   +  DIC A ++RQ+AV  +   VD++LVVG   S+NS +L+++   +   ++LI N   +   WF   + + IT+G S P  L + +I +L+  L
  S:     1 MEIILAEPRGFCAGVKRAVDILAITLEKYKNERQVYVLHEIVHNKYIVEDFKKQGVV-----------FVSSIE-EIEDNEGILIFSAHGVSKNIEDEAKRKGIQVIDATCPLVNKVHKEAKRYENSGKELILIGHENHPEVKGIRGRVNNPITLVQTLQDVYDLKVKDPDNLSYVTQTTLSIDDTRDIIAALKLRFPGITGPDLKDICYATQNRQNAVKKLAEIVDMVLVVGSKNSSNSNRLLDLCTARGKRAYLIDNYSCVNKSWFQGVEKIGITAGASAPDILVDELIDYLKVNL 286
>gi|90416605|ref|ZP_01224536.1| hydroxymethylbutenyl pyrophosphate reductase [marine gamma proteobacterium HTCC2207] >gi|90331804|gb|EAS47032.1| hydroxymethylbutenyl pyrophosphate reductase [marine gamma proteobacterium HTCC2207] (311 aa)
Score = 350, Expect = 2.8e-31, Identities = 98/287 (34%), Positives = 146/287 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M I    PRGFC GV  A     +      A +Y  HE      +VHNK ++ +L   G    D+ +    EI D +         IVIFSAHG      ++AR + L VFD TC  VTK H  + +    G +   IG   HPE   T+     S   ++ L+E  +D+  +  +    +    QTT+S+ +   + + L+ K+  IE   K+DIC A ++RQDAV  +  E DL+LVVG + S+NS +L E+  +    ++LI   ++I  +W    K + IT+G S P  L   VI
  S:     1 MDIKLANPRGFCAGVDRAIDIVNRALEIFGAPIYVRHE------VVHNKFVVDDLRSRGAVFVDELD----EIPDDV---------IVIFSAHGVSLAVQEEARRRSLKVFDATCPLVTKVHMEVAKFSLDGMESVLIGHAGHPEVEGTMGQYDYSQGGNMYLVEDESDVAKLEVKDPSRLAFVTQTTLSMDDTARVIDALREKFPAIEGPRKDDICYATQNRQDAVKQLAIESDLILVVGSVASSNSNRLRELAERCGCTAYLIDGPEDIDAQWLKQTKAIGITAGASAPDVLVRDVI 280
>gi|77961930|ref|ZP_00825758.1| COG0761: Penicillin tolerance protein [Yersinia mollaretii ATCC 43969] (317 aa)
Score = 349, Expect = 3.1e-31, Identities = 90/291 (30%), Positives = 152/291 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGL-VVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           M+I+   PRGFC GV  A +  ++  ++Y     Y+   +VHN+ ++  L E G              I   EI +  +  I+IFSAHG  Q    +ARE+ L ++FD TC  VTK H  +     +G +   IG   HPE   T+    +    + L+E+ +D+  ++ + E  +    QTT+S+ +   + + L  ++  I    K+DIC A  +RQ+AV N+ ++ D++LVVG   S+NS +L E+  +    ++LI +  +I++ W      + +T+G S P  L   VI  L+
  S:     1 MQILLANPRGFCAGVDRAISIVERAIEMY-GAPIYVRHEVVHNRYVVDSLRERGA-------------IFIEEISEVPDGSILIFSAHGVSQAVRAEARERKLTMLFDATCPLVTKVHMEVARASRKGKEAILIGHAGHPEVEGTMGQYSNPKGGMYLVESPDDVWALKVKDENNLCFMTQTTLSVDDTSAVIDALNKRFPKIVGPRKDDICYATTNRQEAVRNLANDADVVLVVGSKNSSNSNRLAELAQRMGKPAYLIDSAADIQESWLQGAAQIGVTAGASAPDVLVQQVITRLQ 284
>gi|33602232|ref|NP_889792.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bordetella bronchiseptica RB50] >gi|50400973|sp|Q7WHF2|ISPH_BORBR 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|33576671|emb|CAE33748.1| putative drug tolerance protein [Bordetella bronchiseptica RB50] (326 aa)
Score = 349, Expect = 3.1e-31, Identities = 96/286 (33%), Positives = 144/286 (50%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRGFC GV  A    ++      A +Y  HE      +VHN+ ++++L   G           +  ID  E+       IV+FSAHG  Q    +A  +GL VFD TC  VTK H  +      G +I  IG   HPE   TL      + L+ETV D+  +R      +    QTT+S+ +   +   LK+++  I    K+DIC A ++RQDAV  +  E DL+LVVG   S+NS +L E+  +K + ++LI     I   W   ++ + IT+G S P  L   V+
  S:    12 EVLLAQPRGFCAGVDRAIDIVERALELHGAPIYVRHE------IVHNRYVVEDLRGKG-----------AVFID--ELDQAPAGAIVVFSAHGVSQAVRGEAEARGLRVFDATCPLVTKVHIEVARMRAAGREIVMIGHKGHPEVEGTLGQAQGGMYLVETVEDVAALRVSDPGNLAYVTQTTLSVDDAAAVAGALKARFPGIVEPKKSDICYATQNRQDAVKLLAPECDLVLVVGSTNSSNSNRLREVAERKGVAAYLIDGAHAIDPAWLQGRRSIGITAGASAPEVLVQQVV 286
>gi|62178613|ref|YP_215030.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|167555705|ref|ZP_02348722.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|168222604|ref|ZP_02647836.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168230307|ref|ZP_02655365.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168243559|ref|ZP_02668491.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168473733|ref|ZP_02702756.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168820984|ref|ZP_02832984.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194449983|ref|YP_002044016.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194472511|ref|ZP_03078495.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|71152193|sp|Q57TL2|ISPH_SALCH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|62126246|gb|AAX63949.1| regulates the activity of guanosine 3',5'-bispyrophosphate synthetase I (RelA) [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|194408287|gb|ACF68506.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194458875|gb|EDX47714.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (316 aa)
Score = 349, Expect = 3.2e-31, Identities = 91/292 (31%), Positives = 152/292 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSI-EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+I+   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L + G           +  I+ I E+ D     I+IFSAHG  Q   ++A+ + L VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  + L+E+  D+  +  ++E  +    QTT+S+ +  ++ + L+ ++  I    K+DIC A  +RQ+AV  +  + D++LVVG   S+NS +L E+  +    + LI +  +I++ W     C+ +T+G S P  L   VI  L +
  S:     1 MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHE------VVHNRYVVDSLRQRG-----------AIFIEQISEVPDG---AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGSKNSSNSNRLAELAQRMGRTAFLIDDAADIQEAWVKEAACVGVTAGASAPDILVQNVIARLRE 284
>gi|146310251|ref|YP_001175325.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Enterobacter sp. 638] >gi|166973798|sp|A4W6E4|ISPH_ENT38 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|145317127|gb|ABP59274.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Enterobacter sp. 638] (316 aa)
Score = 349, Expect = 3.3e-31, Identities = 89/292 (30%), Positives = 155/292 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSI-EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+I+   PRGFC GV  A +  +   ++Y     Y+   +VHN+ +++ L E G           +  I+ I E+ D     I+IFSAHG  Q   ++A+ + L VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  + L+E+  D+  +  +++  +    QTT+S+ +  ++ + L+ ++  I    K+DIC A  +RQ+AV  +  + D++LVVG   S+NS +L E+  +    + LI +  +I++ W  +  C+ +T+G S P  L   VI  L++
  S:     1 MQILLANPRGFCAGVDRAISIVENALEIY-GAPIYVRHEVVHNRYVVESLRERG-----------AIFIEQISEVPDGT---ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVLTLNVKNDAKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGSKNSSNSNRLAELAQRMGKTAFLIDDATDIQEAWVKDVNCVGVTAGASAPDILVQNVIARLQE 284
>gi|83648572|ref|YP_437007.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Hahella chejuensis KCTC 2396] >gi|123530802|sp|Q2S9U2|ISPH_HAHCH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|83636615|gb|ABC32582.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Hahella chejuensis KCTC 2396] (317 aa)
Score = 349, Expect = 3.3e-31, Identities = 95/297 (31%), Positives = 145/297 (48%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKS-----IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTA 297
           MKI    PRGFC GV  A     +      A +Y  HE      +VHN+ +++ L   G    D             E+ +  +  +VIFSAHG  Q+   +A  +GL VFD TC  VTK H  +      G +   IG   HPE   T+    S     I L+E   D+  +       +    QTT+S+ +   + + L+  +  I+   K+DIC A ++RQDAV  + +  D++LVVG + S+NS +L E+  + Q  ++LI     I+ +WF     + +T+G S P  L   V+  L +  G A
  S:     1 MKIKLANPRGFCAGVDRAIEIVNRALDVFGAPIYVRHE------VVHNRFVVEGLRTRGAVFVD-------------ELDEVPDGALVIFSAHGVSQEVRQEADARGLKVFDATCPLVTKVHMEVMRYSRDGRECILIGHAGHPEVEGTMGQYDSANGGAIYLVEDEEDVGRLIVNDPGNLAYVTQTTLSVDDTARVIDALRQTFPEIKGPRKDDICYATQNRQDAVKELAATCDVVLVVGSVNSSNSNRLRELAERMQTPAYLIDGAHEIQPDWFAGAASVGVTAGASAPEVLVQQVVQRLRELGGEA 290
>gi|71026230|ref|XP_762798.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase LytB [Theileria parva strain Muguga] >gi|68349750|gb|EAN30515.1| LytB protein, putative [Theileria parva] (371 aa)
Score = 349, Expect = 3.6e-31, Identities = 88/278 (31%), Positives = 154/278 (55%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLY--PNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           K+  + PRGFC+GV  A  T ++  +++  P + K+ I   VHN+ +   L   G+             I+ + +  +N+  ++I+SAHG   +  + A+ + LV  D +C  V K H  +K K ++GY+I  IG  NH E I T     +++ ++E V D+E +       ++   QTT+S+ + +EI E L  KY  IE      IC A  +RQ A+  +   VDL+L+VG   S+N+K+LVE  + + I S+L++++ ++ +E   + + +A++S  STP
  S:    43 KVYLVKPRGFCEGVSRAIRTVEEALRVFGPPIYVKHEI---VHNEAVCNRLRARGVV-----------FIEDLNLVPENS--VLIYSAHGVSPEVKELAKTRNLVEIDASCPLVNKVHVYVKNKAKEGYKIVLIGHKNHQEIIGTSGEAPEAVTVVENVADVEKLDYPEGTKLYYVTQTTLSLDDCKEIKEALVKKYPQIETIPSGSICYATTNRQTAIHKVTEFVDLVLIVGSTMSSNAKRLVEAALNRNIRSYLVFDSNDVTEELVGSARNIALSSSASTP 309
>gi|99082409|ref|YP_614563.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Silicibacter sp. TM1040] >gi|122397573|sp|Q1GDG5|ISPH_SILST 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|99038689|gb|ABF65301.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Silicibacter sp. TM1040] (316 aa)
Score = 349, Expect = 3.7e-31, Identities = 99/280 (35%), Positives = 148/280 (52%)
  Q:     8 PRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRT-ESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV  A      A  K  A +Y  HE      +VHNK ++  L + G           +  ++ +E    + P  VIFSAHG  +     A  + +V  D TC  V+K H   +   E G Q+  IG   HPET+ T+    +  ++L+ETV D+  +   + E+  FVT QTT+S+ + ++I   L++++  I    K DIC A  +RQ+AV  +  + D LLVVG   S+NS++LVE+G K     + L+   +NI        + +AIT+G S P  L N VI
  S:    14 PRGFCAGVDRAIKIVEMALEKWGAPVYVRHE------IVHNKFVVDGLRDKG-----------AVFVEELEECPDDRP--VIFSAHGVPKSVPAAAEARQMVYVDATCPLVSKVHIEAQRHAEAGLQMIMIGHKGHPETVGTMGQLPEGEVLLVETVEDVAQVEVRDPERLAFVT-QTTLSVDDTKDIVAALQARFPAIVGPHKEDICYATTNRQEAVKEVAPKADALLVVGAPNSSNSRRLVEVGAKNGCSYAQLVQRAENIDWRALEGIQSIAITAGASAPELLVNEVI 284
>gi|170723717|ref|YP_001751405.1| hydroxymethylbutenyl pyrophosphate reductase [Pseudomonas putida W619] >gi|169761720|gb|ACA75036.1| hydroxymethylbutenyl pyrophosphate reductase [Pseudomonas putida W619] (315 aa)
Score = 348, Expect = 4.2e-31, Identities = 94/287 (32%), Positives = 147/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+I    PRGFC GV  A     +  +     +Y  HE      +VHNK ++++L   G                +I +++ +  P   IVIFSAHG  Q    +A  +GL VFD TC  VTK H  + +    G +   IG   HPE   T+     S   +I L+E   D+  ++      +    QTT+S+ +   + + L++++ NI    K+DIC A ++RQDAV  +  E D++LVVG   S+NS +L E+  +    ++LI   ++++  WF     + IT+G S P  L   VI
  S:     1 MQIKLANPRGFCAGVDRAIEIVNRALEVFGPPIYVRHE------VVHNKFVVEDLRSRG----------------AIFVEELDQVPDDVIVIFSAHGVSQAVRQEAAGRGLKVFDATCPLVTKVHIEVAKYSRDGRECILIGHEGHPEVEGTMGQYDASNGGAIYLVEDEEDVARLQVRDPDNLAFVTQTTLSMDDTSRVIDALRTRFPNIGGPRKDDICYATQNRQDAVKQLAGECDVVLVVGSPNSSNSNRLRELAERMGTPAYLIDGAEDMQRGWFDQAARIGITAGASAPEVLVRGVI 280
>gi|87308181|ref|ZP_01090323.1| LytB protein [Blastopirellula marina DSM 3645] >gi|87289263|gb|EAQ81155.1| LytB protein [Blastopirellula marina DSM 3645] (313 aa)
Score = 348, Expect = 4.4e-31, Identities = 94/295 (31%), Positives = 150/295 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           MK+I  +PRGFC GV  A  +         A +Y  HE      +VHNK ++   +E G                +I I D N  P    ++FSAHG   +    A+++ L   D TC  VTK H       +Q Y IF IG   H E I T+    ++IIL+E+  D+ N++      +    QTT+S+ +   I   LK ++  +    K DIC A ++RQ+AV  + +E DL+LV+G   S+NS++L E+  +   + +L+    ++K EWF   + + +T+G S P  +    + +L +  G
  S:     1 MKVILASPRGFCAGVNMAIESLDLALQAFGAPVYVYHE------IVHNKYVVTTFKEKG----------------AIFIDDLNEAPEGSTLLFSAHGVSPEIRQMAKDRKLFAIDATCPLVTKVHLEAIRFAKQHYTIFLIGHEGHDEVIGTMGEAPEAIILVESAEDVPNLQVADGSKLAYLTQTTLSVDDANRIIGALKQRFPQVIGPPKEDICYATQNRQEAVRILATEADLVLVLGSQNSSNSQRLKELARESGTKGYLLDGASDLKPEWFEGVETVLVTAGASAPEEVVQECLDYLVENHG 284
>gi|87122998|ref|ZP_01078857.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Marinomonas sp. MED121] >gi|86161715|gb|EAQ63021.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Marinomonas sp. MED121] (318 aa)
Score = 348, Expect = 4.4e-31, Identities = 98/290 (33%), Positives = 152/290 (52%)
  Q:     8 PRGFCKGV---VDAYATCKKI--AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIE-IKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTA 297
           PRGFC GV   +D    C  +  A +Y  HE      +VHNK +++ L+  G           +  +D +E + D N   +VIFSAHG  +    +A  +GL VFD TC  VTK H  +      G +   IG + HPE   T+     S    I L+E+  D+  ++ ++ + +    QTT+S+ +   + ++L+  +  I    K+DIC A ++RQDAV  +  E  L+LVVG + S+NS +L E+  +    ++LI N   I+ EW      + IT+G S P  L   VI  LE + G +
  S:    10 PRGFCAGVDRAIDIVNRCLDLFEAPIYVRHE------VVHNKFVVESLKARG-----------AVFVDELEQVPDDN---LVIFSAHGVSKAVRLEAEHRGLKVFDATCPLVTKVHLEVVRYSRDGMECVLIGHDGHPEVEGTMGQYDYSKGGHIYLVESPEDVAKLKVKNPEKLAFVTQTTLSMDDASVVIDSLREHFPLIRGPKKDDICYATQNRQDAVKKLAEESSLVLVVGSVNSSNSNRLKELSERMGTTAYLIDNADEIQFEWLKGIDSIGITAGASAPEVLVQEVIARLESEGGES 292
>gi|117929065|ref|YP_873616.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Acidothermus cellulolyticus 11B] >gi|189045803|sp|A0LW20|ISPH_ACIC1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|117649528|gb|ABK53630.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Acidothermus cellulolyticus 11B] (340 aa)
Score = 348, Expect = 4.6e-31, Identities = 90/292 (30%), Positives = 151/292 (51%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           +++   PRG+C GV  A  T +K  +LY     Y+   +VHNK ++ ELE  G                +I +++ +  P   IV+ SAHG      ++AR++ L   D TC  VTK H   +   EQG +I  IG  NH E + T      SI L++   + E+++ +    +   +QTT+S+ E  +  E L+ ++  +     +DIC A ++RQ AV  + +  DL++VVG   S+NS +LVE+ +    + S+L+ +   I + W      + +TSG S P  L   V+ +L ++
  S:    11 RVLLAQPRGYCAGVERAVDTVEKALELY-GPPVYVRKQIVHNKHVVAELEAKG----------------AIFVEEADEVPEGSIVVLSAHGVAPSVYEQARQRRLKTIDATCPLVTKVHQEARRFAEQGLEILLIGHANHEEVVGTTGEAPSSITLVDGPEEAEHVQVKDPSRVAWLSQTTLSVDETLQTVEVLRRRFPQLIDPPSDDICYATQNRQAAVKRIAAIADLVIVVGSRNSSNSARLVEVALDSGAKASYLVDDASEIDERWLDGVWTVGVTSGASVPESLVTGVLAWLAER 292
>gi|77976918|ref|ZP_00832383.1| COG0761: Penicillin tolerance protein [Yersinia intermedia ATCC 29909] (317 aa)
Score = 348, Expect = 4.7e-31, Identities = 91/291 (31%), Positives = 152/291 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGL-VVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           M+I+   PRGFC GV  A +  ++  ++Y     Y+   +VHN+ ++  L E G              I   EI +  +  I+IFSAHG  Q    +ARE+ L ++FD TC  VTK H  +     +G +   IG   HPE   T+    +    + L+E+ +D+  ++ + E  +    QTT+S+ +   I + L  ++  I    K+DIC A  +RQ+AV N+ ++ D++LVVG   S+NS +L E+  +    ++LI +  +I++ W      + +T+G S P  L   VI  L+
  S:     1 MQILLANPRGFCAGVDRAISIVERAIEMY-GAPIYVRHEVVHNRYVVDSLRERGA-------------IFIEEIAEVPDGSILIFSAHGVSQAVRAEARERKLTMLFDATCPLVTKVHMEVARASRKGKEAILIGHAGHPEVEGTMGQYSNPQGGMYLVESPDDVWALQVKDENNLCFMTQTTLSVDDTSAIIDALHQRFPKIVGPRKDDICYATTNRQEAVRNLANDADVVLVVGSKNSSNSNRLAELAQRMGKPAYLIDSAADIQELWLQGAARIGVTAGASAPDILVQQVIARLQ 284
>gi|16763439|ref|NP_459054.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella typhimurium LT2] >gi|161612370|ref|YP_001586335.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167545064|ref|ZP_02340634.1| hypothetical protein Sentent_17424 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167550779|ref|ZP_02344536.1| hypothetical protein Sentente_09855 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167989902|ref|ZP_02571002.1| hypothetical protein Sententer_01000001_0100000545 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168228504|ref|ZP_02653735.1| hypothetical protein Sententeric_22229 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168262286|ref|ZP_02684259.1| hypothetical protein Salmentericaenterica_14477 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|194443769|ref|YP_002039279.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|189045819|sp|A9MYG8|ISPH_SALPB 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|20138573|sp|P58679|ISPH_SALTY 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|16418544|gb|AAL19013.1| regulates the activity of guanosine 3',5'-bispyrophosphate synthetase I (RelA) [Salmonella typhimurium LT2] >gi|161361734|gb|ABX65502.1| hypothetical protein SPAB_00059 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194402432|gb|ACF62654.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Newport str. SL254] (316 aa)
Score = 347, Expect = 5.2e-31, Identities = 91/292 (31%), Positives = 152/292 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSI-EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M+I+   PRGFC GV  A +  +       A +Y  HE      +VHN+ ++  L + G           +  I+ I E+ D     I+IFSAHG  Q   ++A+ + L VFD TC  VTK H  +     +G +   IG   HPE   T+    + +  + L+E+  D+  +  ++E  +    QTT+S+ +  ++ + L+ ++  I    K+DIC A  +RQ+AV  +  + D++LVVG   S+NS +L E+  +    + LI +  +I++ W     C+ +T+G S P  L   VI  L +
  S:     1 MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHE------VVHNRYVVDSLRKRG-----------AIFIEQISEVPDG---AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGSKNSSNSNRLAELAQRMGRTAFLIDDAADIQEAWVKEAACVGVTAGASAPDILVQNVIARLRE 284
>gi|148652390|ref|YP_001279483.1| hydroxymethylbutenyl pyrophosphate reductase [Psychrobacter sp. PRwf-1] >gi|172048503|sp|A5WCZ2|ISPH_PSYWF 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|148571474|gb|ABQ93533.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Psychrobacter sp. PRwf-1] (318 aa)
Score = 347, Expect = 5.6e-31, Identities = 95/299 (31%), Positives = 149/299 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKK-IAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAND 299
           M+I    PRGFC GV  A A   + +A+  P    Y+   +VHNK ++ +L   G    +             E+ +  +  IVIFSAHG  +   D+A  + L VFD TC  VTK H  + +   +      IG   HPE   T+          I L+E   D+E +       +    QTT+S+ +   + + L+ K+ NI+   K+DIC A ++RQDAV ++    +++LVVG   S+NS +L E+  +   +++LI N   +K EWF     + +T+G S P  L   V+  L++  G   D
  S:     1 MQIYLANPRGFCAGVDRAIAIVNEALARFEP--PIYVRHEVVHNKFVVSDLANRGAVFVE-------------ELHEVPDGSIVIFSAHGVSKAVEDEAERRDLTVFDATCPLVTKVHIEVAKFAREKMDAVLIGHQGHPEVEGTMGRFSAQYGGEIHLVENEADVEKLEVSDPDRLAFVTQTTLSMDDTAVVIDALRKKFPNIQGPRKDDICYATQNRQDAVKDLAQRCEVVLVVGSPNSSNSNRLRELAERMNCKAYLIDNAGEMKKEWFAGVGAVGVTAGASAPEILIQEVLNQLQQWGGDLPD 292
>gi|118602984|ref|YP_904199.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|166217483|sp|A1AXS1|ISPH_RUTMC 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|118567923|gb|ABL02728.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (306 aa)
Score = 347, Expect = 6.2e-31, Identities = 99/293 (33%), Positives = 151/293 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           MK++   PRGFC GV  A    ++  KL+     Y+   +VHNK ++  L+  G    +D             I D  N  +VIFSAHG       + ++    ++D TC  VTK H  +  K +Q +Q+  IG   HPE   TL   ++ + L+ET+ D+  +      PI  T QTT+SI + + I + LKSK+  I+   K++IC A ++RQD V  +    D+LLV+G   S+NS +L EI  K  I ++LI +   I + W  +   + +T+G S P  L   VI +L  K
  S:     1 MKVLLANPRGFCAGVDRAIEIVERALKLH-GAPVYVRHEVVHNKFVVDGLKAKGAIFVED-------------IADVPNEQVVIFSAHGVSMAVRKQTQDIDATIYDATCPLVTKVHKEVIRKQKQQHQVILIGHKGHPEVEGTLGQSNEELQLVETIEDVGRLNLSKNTPISYTTQTTLSIDDTKHIVDYLKSKFPTIDAPKKDNICYATQNRQDGVKILMQSSDILLVLGSSNSSNSNRLREIAEKMDIPAYLINDADEIDELWLKDVNTIGVTAGASAPEVLVQEVIHYLCDK 282
>gi|68304944|gb|AAY89955.1| predicted LytB [uncultured bacterium BAC13K9BAC] (316 aa)
Score = 347, Expect = 6.5e-31, Identities = 99/289 (34%), Positives = 164/289 (56%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSI-EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKS----IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFL 290
           +I+   PRGFC GV  A     +  +++ + + ++   +VHNK +I+EL + G+             I+S+ E+ DK+   I+I+SAHG  ++  D A++K L +FD TC  VTK H  I +   +   +  IG N HPE   T+   KS    I L+E  +D+E +  ++EK  +VT QTT+S+ + ++I + LK +Y +I+   K+DIC A ++RQ+AV  +    D L+VVG   S+NS++L EI ++   +++LI +   +        K + IT+G S P      +I FL
  S:     8 EILLTEPRGFCAGVERAIGIVNRAIEMF-DEDIFVKHEVVHNKNVIEELTKKGVV-----------FIESLTEVPDKS---ILIYSAHGVSKEVTDIAKKKNLRIFDATCPLVTKVHFEIHKYARENVDVILIGHNGHPEVEGTMGQYKSKEGRIYLVENKSDVETLEIKNEKISYVT-QTTLSVDDTQDIVDALKGRYPHIQGPKKSDICYATQNRQEAVKKILDLCDSLIVVGSQNSSNSQRLKEIAVQHDKDAYLIDHESQLDINKLGKNKVIGITAGASAPEHTVQALIRFL 287
>gi|21672430|ref|NP_660497.1| hypothetical protein BUsg140 [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|25008664|sp|Q8K9Z4|ISPH_BUCAP 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|21623041|gb|AAM67708.1| LytB [Buchnera aphidicola str. Sg (Schizaphis graminum)] (313 aa)
Score = 347, Expect = 6.6e-31, Identities = 109/298 (36%), Positives = 156/298 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           M II   PRGFC GV  A    +   K+Y     Y+   LVHN+ +I+ L + G+   +D             I D  N  IV+FSAHG  +K   KA +K L + + TC  VTK H  + +  + G +   IG   HPE I T+    +    I LIE + D+  +  + +K +    QTT+SI   + I   LK K+ NI    K DIC A  +RQ+A+I +    D++LV+G   S+NS +L E+G +  + +  I +  +IK+EW  NKK + IT+G S P  L   VI  L KKLG  N
  S:     1 MNIILAKPRGFCAGVKRALLIVENALKIY-KKTIYVQHELVHNQYVIETLRQKGVVFVED-------------ISDIPNNSIVVFSAHGVSKKIKKKAIKKNLTILNATCPLVTKVHLEVSKSSKNGIETILIGHRGHPEVIGTIGQYDNKKGKIHLIEDIEDVNQLTIKIDKKLNFFTQTTLSIKNTQSIILALKKKFLNISGPKKEDICYATTNRQNAIIKLSKITDIILVIGSKNSSNSSRLSELGKETGVFTKQIESFSDIKEEWLKNKKNIGITAGASAPDILVEEVIKHL-KKLGFKN 289
>gi|88800789|ref|ZP_01116346.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Reinekea sp. MED297] >gi|88776495|gb|EAR07713.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Reinekea sp. MED297] (315 aa)
Score = 346, Expect = 7.6e-31, Identities = 95/287 (33%), Positives = 149/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKS----IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M I    PRGFC GV  A     +      A LY  HE      +VHNK ++++L+  G    D+ +          E+ D N    VIFSAHG  Q    +A  +GL V+D TC  VTK H  +     +G +   IG   HPE   T+   D+S    I L+E    ++ ++ +    +    QTT+S+ +   I + L++K+  I+   K+DIC A ++RQDAV  +  + D+++VVG   S+NS +L E+  +   +++LI +   ++  WF  K  + +T+G S P  L   VI
  S:     1 MDIKLANPRGFCAGVDRAIDIVNRALEVHGAPLYVRHE------VVHNKFVVEDLKSRGAIFVDELD----------EVPDDN---WVIFSAHGVSQAVRKEADRRGLRVYDATCPLVTKVHLEVARYSREGMECILIGHRGHPEVEGTMGQYDRSNGGEIYLVEAEACVDALQVKHPDRLAYVTQTTLSMDDTARIIDALRAKFPQIQGPRKDDICYATQNRQDAVKTLARDCDVVIVVGSPNSSNSNRLRELAERIGCDAYLIDSVDQLEPAWFEGKSQIGVTAGASAPDILVKQVI 280
>gi|70732623|ref|YP_262386.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas fluorescens Pf-5] >gi|123652817|sp|Q4K5U7|ISPH_PSEF5 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|68346922|gb|AAY94528.1| hydroxymethylbutenyl pyrophosphate reductase [Pseudomonas fluorescens Pf-5] (315 aa)
Score = 346, Expect = 8.2e-31, Identities = 96/299 (32%), Positives = 152/299 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAND 299
           M+I    PRGFC GV  A     +  +     +Y  HE      +VHNK ++++L   G                +I +++ +  P   IVIFSAHG  Q    +A  +GL VFD TC  VTK H  +      G +   IG   HPE   T+     S   +I L+E   D+  ++  + + +    QTT+S+ +   + + L++++  I    K+DIC A ++RQDAV  +  E D++LVVG   S+NS +L E+  +    ++LI   ++++  WF   + + IT+G S P  L   VI  L+    T  D
  S:     1 MQIKLANPRGFCAGVDRAIEIVNRALEVFGPPIYVRHE------VVHNKFVVEDLRNRG----------------AIFVEELDQVPDDVIVIFSAHGVSQAVRSEAAGRGLKVFDATCPLVTKVHIEVARYSRDGRECILIGHAGHPEVEGTMGQYDASNGGAIYLVEDEKDVAELQVRNPERLAFVTQTTLSMDDTSRVIDALRTRFPAIGGPRKDDICYATQNRQDAVKQLADECDVVLVVGSPNSSNSNRLRELAERMATPAYLIDGAEDLQRSWFDGVERIGITAGASAPEVLVRGVIQQLQAWGATGAD 292
>gi|15677667|ref|NP_274828.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Neisseria meningitidis MC58] >gi|15793614|ref|NP_283436.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Neisseria meningitidis Z2491] >gi|121634251|ref|YP_974496.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Neisseria meningitidis FAM18] >gi|166217177|sp|A1KS64|ISPH_NEIMF 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|54037481|sp|P65192|ISPH_NEIMB 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|54041396|sp|P65191|ISPH_NEIMA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|7227085|gb|AAF42166.1| lytB protein [Neisseria meningitidis MC58] >gi|120865957|emb|CAM09694.1| lytB protein [Neisseria meningitidis FAM18] >gi|121051592|emb|CAM07890.1| lytB protein [Neisseria meningitidis Z2491] (322 aa)
Score = 345, Expect = 1.0e-30, Identities = 90/285 (31%), Positives = 145/285 (50%)
  Q:     3 IIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           II   PRGFC GV  A +  ++      A +Y  HE      +VHNK ++  L E G                ++ I+D    P    +++SAHG  +    +A E+G  VFD TC  VTK H  +     Q  +I  IG   H E   T+       ++L+ETV D+  +   +   +   +QTT+S+ E ++I   L +++ NI    K DIC A  +RQ AV  +  + D+++VVG   S+NS +L E+   + I+++++ N   ++  WF  K  + +T+G S P  L   V+
  S:     6 IILANPRGFCAGVDRAISIVERALEEFGAPIYVRHE------VVHNKFVVDNLREKG----------------AVFIEDLAEVPPGATLVYSAHGVSKAVRQEAAERGFRVFDATCPLVTKVHKEVARLDAQDCEIIMIGHKGHVEVEGTMGQLAPGKMLLVETVGDVAKLEVRNPDKLAYVSQTTLSVDETKDIIAALNARFPNIRNPHKEDICYATTNRQTAVKELAEQCDIVIVVGSPNSSNSNRLREVAASRGIDAYMVDNAGYLQRAWFEGKNKVGVTAGASAPEVLVREVL 280
>gi|110833323|ref|YP_692182.1| LytB protein [Alcanivorax borkumensis SK2] >gi|123050715|sp|Q0VSD8|ISPH_ALCBS 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|110646434|emb|CAL15910.1| LytB protein [Alcanivorax borkumensis SK2] (311 aa)
Score = 345, Expect = 1.0e-30, Identities = 95/295 (32%), Positives = 149/295 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLY--PNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKS----IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           M+I    PRGFC GV  A     +  +++  P H ++ +   VHN+ ++++L + G    +             E+ +  +  IVIFSAHG  +   ++A+ + L VFD TC  VTK H  +     +G +   IG   HPE   T+   DKS    I L+E   D+  +    E  +    QTT+S+ +   + + L+ ++  I    + DIC A  +RQDAV  +  E  L+LVVG + S+NS +L E+  +   E++LI     I+  W   K  + +T+G S P  L   VI  L K LG
  S:     1 MQIRLANPRGFCAGVDRAIDIVNRALEVFGPPIHVRHEV---VHNRYVVEDLRQRGAVFVE-------------ELHEVPDDAIVIFSAHGVSKAVQEEAKRRQLQVFDATCPLVTKVHMEVIRYAREGRESILIGHAGHPEVEGTMGQYDKSYGGDIYLVEDEADVVALTVRDESKLAFVTQTTLSVDDTARVIDALRQRFPAIIGPKREDICYATTNRQDAVRQLALECGLVLVVGSVNSSNSNRLRELAERCGAEAYLIDEPSQIEASWLKGKAAVGVTAGASAPEDLVQQVIATL-KNLG 287
>gi|85707711|ref|ZP_01038777.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Erythrobacter sp. NAP1] >gi|85689245|gb|EAQ29248.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Erythrobacter sp. NAP1] (327 aa)
Score = 345, Expect = 1.0e-30, Identities = 92/292 (31%), Positives = 148/292 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPI---VIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDK--SIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           + ++   PRGFC GV  A    +K      A +Y  HE      +VHNK +++ L+  G                +I +K+ +  P    V+FSAHG  +    +A  + +V  D TC  V+K H   + ++E+G  I +IG   HPE I T+   +   + L+E + D++ +  ES++ +    QTT+S+ +  E+ + L+ +Y NI      DIC A  +RQ AV  +  + DL+LVVG   S+NS +LVE+  +      LI   + I   W      + +T+G S P  L   V+  L K
  S:    20 LNLLIAAPRGFCAGVDRAIEIVEKALERYGAPVYVRHE------IVHNKYVVEGLKAKG----------------AIFVKELDEVPTDAPVVFSAHGVPKSVPAEAERRNMVYVDATCPLVSKVHRQAERQLEKGRHIIFIGHEGHPEVIGTMGQVEPGQMTLVENIEDVDKLPFESDEELAYLTQTTLSVDDTREVIDALEWRYPNIRGPKAEDICYATSNRQAAVKELAHDCDLVLVVGAPNSSNSLRLVEVAERLGTPGKLIQRAEEIDPAWLEGIDTIGLTAGASAPEVLVREVVDALAK 301
>gi|33596474|ref|NP_884117.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bordetella parapertussis 12822] >gi|50400972|sp|Q7W9B4|ISPH_BORPA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|33566243|emb|CAE37153.1| putative drug tolerance protein [Bordetella parapertussis] (326 aa)
Score = 345, Expect = 1.1e-30, Identities = 95/286 (33%), Positives = 144/286 (50%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRGFC GV  A    ++      A +Y  HE      +VHN+ ++++L   G           +  ID  E+       IV+FSAHG  Q    +A  +GL VFD TC  VTK H  +      G +I  IG   HPE   TL      + L+ETV D+  ++      +    QTT+S+ +   +   LK+++  I    K+DIC A ++RQDAV  +  E DL+LVVG   S+NS +L E+  +K + ++LI     I   W   ++ + IT+G S P  L   V+
  S:    12 EVLLAQPRGFCAGVDRAIDIVERALELHGAPIYVRHE------IVHNRYVVEDLRGKG-----------AVFID--ELDQAPAGAIVVFSAHGVSQAVRGEAEARGLRVFDATCPLVTKVHIEVARMRAAGREIVMIGHKGHPEVEGTLGQAQGGMYLVETVEDVAALQVSDPGNLAYVTQTTLSVDDAAAVAGALKARFPGIVEPKKSDICYATQNRQDAVKLLAPECDLVLVVGSTNSSNSNRLREVAERKGVAAYLIDGAHAIDPAWLQGRRSIGITAGASAPEVLVQQVV 286
>gi|93006826|ref|YP_581263.1| hydroxymethylbutenyl pyrophosphate reductase [Psychrobacter cryohalolentis K5] >gi|122414939|sp|Q1Q974|ISPH_PSYCK 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|92394504|gb|ABE75779.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Psychrobacter cryohalolentis K5] (318 aa)
Score = 345, Expect = 1.1e-30, Identities = 94/287 (32%), Positives = 148/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI-----DKSIILIETVNDIENIRTE-SEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+I    PRGFC GV  A A   +        +Y  HE      +VHNK ++ +L   G    +             E+ +  +  IVIFSAHG  +   D+A  + L VFD TC  VTK H  + +  + G     IG   HPE   T+          I L+E  +D+E +  + +E+  FVT QTT+S+ +   + + L+ K+ +I+   K+DIC A ++RQDAV ++    +++LVVG   S+NS +L E+  +    ++LI N   +   WF   + + +T+G S P  L   V+
  S:     1 MQIYLANPRGFCAGVDRAIAIVNEALLRFEPPIYVRHE------VVHNKFVVSDLANRGAVFVE-------------ELHEVPDGSIVIFSAHGVSKAVEDEAERRDLTVFDATCPLVTKVHIEVAKFAQDGMDAVLIGHAGHPEVEGTMGRFNHRHGGQIHLVENESDVEALSVQDAERLAFVT-QTTLSMDDTARVIDALREKFPSIQGPRKDDICYATQNRQDAVKDLAGRCEVVLVVGSPNSSNSNRLRELAERMNCRAYLIDNATEMNKSWFDGIQSVGVTAGASAPEVLIQEVL 280
>gi|33592365|ref|NP_880009.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bordetella pertussis Tohama I] >gi|50400970|sp|Q7VYS2|ISPH_BORPE 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|33572010|emb|CAE41533.1| putative drug tolerance protein [Bordetella pertussis Tohama I] (325 aa)
Score = 344, Expect = 1.1e-30, Identities = 95/286 (33%), Positives = 144/286 (50%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRGFC GV  A    ++      A +Y  HE      +VHN+ ++++L   G           +  ID  E+       IV+FSAHG  Q    +A  +GL VFD TC  VTK H  +      G +I  IG   HPE   TL      + L+ETV D+  ++      +    QTT+S+ +   +   LK+++  I    K+DIC A ++RQDAV  +  E DL+LVVG   S+NS +L E+  +K + ++LI     I   W   ++ + IT+G S P  L   V+
  S:    11 EVLLAQPRGFCAGVDRAIDIVERALELHGAPIYVRHE------IVHNRYVVEDLRGKG-----------AVFID--ELDQAPAGAIVVFSAHGVSQAVRGEAEARGLRVFDATCPLVTKVHIEVARMRAAGREIVMIGHKGHPEVEGTLGQAQGGMYLVETVEDVAALQVSDPGNLAYVTQTTLSVDDAAAVAGALKARFPGIVEPKKSDICYATQNRQDAVKLLAPECDLVLVVGSTNSSNSNRLREVAERKGVAAYLIDGAHAIDPAWLQGRRSIGITAGASAPEVLVQQVV 285
>gi|88707058|ref|ZP_01104754.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [gamma proteobacterium KT 71] >gi|88698708|gb|EAQ95831.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Congregibacter litoralis KT71] (315 aa)
Score = 344, Expect = 1.2e-30, Identities = 93/287 (32%), Positives = 142/287 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M I    PRGFC GV  A     +      A +Y  HE      +VHN+ ++ +L   G    D             E+++  +  IVIFSAHG  Q    +A  +GL VFD TC  VTK H  +     +G +   IG   HPE   T+     S    I L+E      ++   + + +    QTT+S+ +   + E L++++  I    K+DIC A ++RQDAV  + ++ DL++VVG   S+NS +L E+  +   E+ L+     I  EW   K+ + +T+G S P  L   VI
  S:     1 MDIQLANPRGFCAGVDRAIDIVNRALEVFGAPIYVRHE------VVHNRFVVDDLRSRGAVFVD-------------ELEEVPDDCIVIFSAHGVSQAVRKQADSRGLKVFDATCPLVTKVHIEVARYSAEGRECVLIGHEGHPEVEGTMGQYDHSKGGDIYLVEDEAQAASLTVRNPEKLSYVTQTTLSMDDTARVIEALRARFPAITGPRKDDICYATQNRQDAVKQLAADCDLMIVVGSPNSSNSNRLRELAERMGAEAFLLDRADEINPEWLSGKQNIGVTAGASAPEILVQEVI 280
>gi|71066277|ref|YP_265004.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Psychrobacter arcticus 273-4] >gi|123648062|sp|Q4FQY8|ISPH_PSYA2 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|71039262|gb|AAZ19570.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Psychrobacter arcticus 273-4] (318 aa)
Score = 344, Expect = 1.4e-30, Identities = 95/287 (33%), Positives = 149/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI-----DKSIILIETVNDIENIRTE-SEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+I    PRGFC GV  A A   +        +Y  HE      +VHNK ++ +L   G    +             E+ +  +  IVIFSAHG  +   D+A  + L VFD TC  VTK H  + +  + G     IG   HPE   T+          I L+E  +D+E +  + +E+  FVT QTT+S+ +   + + L+ K+ +I+   K+DIC A ++RQDAV ++ S  +++LVVG   S+NS +L E+  +    ++LI N   +   WF   + + +T+G S P  L   V+
  S:     1 MQIYLANPRGFCAGVDRAIAIVNEALLRFEPPIYVRHE------VVHNKFVVSDLANRGAVFVE-------------ELHEVPDGSIVIFSAHGVSKAVEDEAERRDLTVFDATCPLVTKVHIEVAKFAQDGMDAVLIGHAGHPEVEGTMGRFNHRHGGRIHLVENESDVEALSVQDAERLAFVT-QTTLSMDDTARVIDALREKFPHIQGPRKDDICYATQNRQDAVKHLASRCEVVLVVGSPNSSNSNRLRELAERMNCRAYLIDNATEMDINWFDGIQSVGVTAGASAPEVLIQEVL 280
>gi|157368946|ref|YP_001476935.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Serratia proteamaculans 568] >gi|166973801|sp|A8G9L7|ISPH_SERP5 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|157320710|gb|ABV39807.1| hydroxymethylbutenyl pyrophosphate reductase [Serratia proteamaculans 568] (317 aa)
Score = 344, Expect = 1.5e-30, Identities = 94/298 (31%), Positives = 159/298 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGL-VVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           M+I+   PRGFC GV  A +  ++      A +Y  HE      +VHN+ ++  L E G           +  I+  EI +  +  I+IFSAHG  Q    +A+ + L ++FD TC  VTK H  +     +G +   IG   HPE   T+    +    + L+E+ +D+  ++ + E  +    QTT+S+ +  ++ + L+ ++ +I    K+DIC A  +RQ+AV N+  + D++LVVG   S+NS +L E+  +    ++LI +  +I++ W  +   + +T+G S P  L   VI  L K LG  N
  S:     1 MQILLANPRGFCAGVDRAISIVERALEIYGAPIYVRHE------VVHNRYVVDSLRERG-----------AVFIE--EITEVPDGSILIFSAHGVSQAVRAEAKARDLTMLFDATCPLVTKVHMEVARASRRGTEAILIGHAGHPEVEGTMGQYSNPKGGMYLVESPDDVWKLQVKDESNLCFMTQTTLSVDDTSDVIDALRKRFPSIIGPRKDDICYATTNRQEAVRNLAGDADVVLVVGSKNSSNSNRLAELAQRVGKPAYLIDSAADIQEAWLKDAHNIGVTAGASAPDVLVQDVISRL-KALGGVN 290
>gi|85058395|ref|YP_454097.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Sodalis glossinidius str. 'morsitans'] >gi|123520106|sp|Q2NVY3|ISPH_SODGM 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|84778915|dbj|BAE73692.1| penicillin tolerance protein (lytB) [Sodalis glossinidius str. 'morsitans'] (316 aa)
Score = 343, Expect = 1.6e-30, Identities = 89/287 (31%), Positives = 153/287 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSI-EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKS----IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+I+   PRGFC GV  A +  ++      A +Y  HE      +VHN+ ++  L + G           +  I+ I E+ D +   I+IFSAHG  Q    +AR + L VFD TC  VTK H  +     +G +   IG   HPE   T+    +    + L+E+  D+  +  ++   +    QTT+S+ +  ++ + L++++  I    K+DIC A  +RQ+AV ++ ++ D++LVVG   S+NS +L E+  +    ++LI +  +I++ W    + + +T+G S P  L   VI
  S:     1 MRILLANPRGFCAGVDRAISIVERALEIYGAPIYVRHE------VVHNRYVVDTLRQRG-----------AIFIEQITEVPDGS---ILIFSAHGVSQAVRAEARSRDLTVFDATCPLVTKVHMEVARASRKGTEAILIGHTGHPEVEGTMGQYNNPAGGMYLVESPEDVWQLEVKNVDNLCFMTQTTLSVDDTSDVIDALRARFPAIIGPRKDDICYATTNRQEAVRSLAADADVVLVVGSKNSSNSNRLSELAQRVGKPAYLIDSAGDIQESWLQGTQTIGVTAGASAPDILVQQVI 279
>gi|77461070|ref|YP_350577.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas fluorescens PfO-1] >gi|123603233|sp|Q3K6L8|ISPH_PSEPF 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|77385073|gb|ABA76586.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas fluorescens PfO-1] (314 aa)
Score = 343, Expect = 1.6e-30, Identities = 96/299 (32%), Positives = 152/299 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAND 299
           M+I    PRGFC GV  A     +  +     +Y  HE      +VHNK ++++L   G                +I +++ +  P   IVIFSAHG  Q    +A  +GL VFD TC  VTK H  + +    G +   IG   HPE   T+     S   +I L+E   D+  ++  +   +    QTT+S+ +   + + L++++  I    K+DIC A ++RQDAV  +  E D++LVVG   S+NS +L E+  +    ++LI   ++++  WF   + + IT+G S P  L   VI  L+    T  D
  S:     1 MQIKLANPRGFCAGVDRAIEIVNRALEVFGPPIYVRHE------VVHNKFVVEDLRIRG----------------AIFVEELDQVPDDVIVIFSAHGVSQAVRTEAAGRGLKVFDATCPLVTKVHIEVAKYSRDGRECILIGHAGHPEVEGTMGQYDASNGGAIYLVEDEKDVAELQVHNPDKLAFVTQTTLSMDDTSRVIDALRTRFPAIGGPRKDDICYATQNRQDAVKQLADECDVVLVVGSPNSSNSNRLRELAERMATPAYLIDGAEDLQKSWFDGVERIGITAGASAPEVLVRGVIQQLQAWGATGAD 292
>gi|71738057|ref|YP_273016.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|123638244|sp|Q48NK3|ISPH_PSE14 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|71558610|gb|AAZ37821.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas syringae pv. phaseolicola 1448A] (315 aa)
Score = 343, Expect = 1.9e-30, Identities = 96/299 (32%), Positives = 151/299 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAND 299
           M+I    PRGFC GV  A     +  +     +Y  HE      +VHNK ++++L   G                +I +++ +  P   IVIFSAHG  Q    +A  +GL VFD TC  VTK H  +      G +   IG   HPE   T+     S   +I L+E   D+ +++  +   +    QTT+S+ +   + + L+ ++  I    K+DIC A ++RQDAV  +  E D++LVVG   S+NS +L E+  +    ++LI   ++++  WF   + + IT+G S P  L   VI  L+    T  D
  S:     1 MQIKLANPRGFCAGVDRAIEIVNRALEVFGPPIYVRHE------VVHNKFVVEDLRSRG----------------AIFVEELDQVPDDVIVIFSAHGVSQAVRTEAAGRGLKVFDATCPLVTKVHIEVARYSRDGRECILIGHAGHPEVEGTMGQYDASNGGAIYLVEDEEDVASLQVRNPDSLAFVTQTTLSMDDTSRVIDALRKRFPAIGGPRKDDICYATQNRQDAVKQLADECDVVLVVGSPNSSNSNRLRELAERMATPAYLIDGAEDMQQGWFEGVERIGITAGASAPEVLVRGVIQQLQAWGATGAD 292
>gi|94311800|ref|YP_585010.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ralstonia metallidurans CH34] >gi|93355652|gb|ABF09741.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ralstonia metallidurans CH34] (330 aa)
Score = 342, Expect = 2.0e-30, Identities = 91/286 (31%), Positives = 150/286 (52%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +I+   PRGFC GV  A    ++      A +Y  HE      +VHN  ++ +L + G    D             E+ +      VIFSAHG  ++    A  +GL VFD TC  VTK H  + +   +G +I  IG   HPE   T+   +  ++L+E+V+D+  +     + +    QTT+S+ E  EI   LK ++  I    K DIC A ++RQDAV  M  +V++++VVG   S+NS +L E+  +  + ++++ + + +K EW   K+ + +T+G S P  LA  ++
  S:    20 EILMAQPRGFCAGVDRAIEIVERALSRFGAPIYVRHE------IVHNAYVVADLRKKGAIFVD-------------ELDEVPQGSTVIFSAHGVSKEVRADATARGLTVFDATCPLVTKVHVEVGKMRGEGCEIIMIGHRGHPEVEGTMGQSEHGMLLVESVDDVNRLVVADPQQLAYVTQTTLSVDETAEIVAALKVRFPQIREPKKQDICYATQNRQDAVKFMVPQVEVVIVVGSPNSSNSNRLRELADRLGVPAYMVDDPEQLKPEWVTGKRRIGLTAGASAPEALAQAIV 294
>gi|121608620|ref|YP_996427.1| hydroxymethylbutenyl pyrophosphate reductase [Verminephrobacter eiseniae EF01-2] >gi|121553260|gb|ABM57409.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Verminephrobacter eiseniae EF01-2] (331 aa)
Score = 342, Expect = 2.4e-30, Identities = 85/285 (29%), Positives = 148/285 (51%)
  Q:     3 IIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP--IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           I+   PRGFC GV  A    ++      A +Y  HE      +VHN  ++ +L   G           +  I+ +     + PP   ++FSAHG  +    +A+ +G  +FD TC  V+K H  + +  +QGY+   IG   HPE   T+  ++  I L++ V D+  +R      + +  QTT+S+ +  EI   +++++  +    + DIC A ++RQDAV  +  +VD+++VVG   S+NS +L E+  K    ++++ +   ++ EWF     + +T+G S P  L   VI
  S:     7 ILLAEPRGFCAGVDRAIEIVERAIQKFGAPIYVRHE------IVHNTYVVNDLRAKG-----------AVFIEML----ADVPPGATLVFSAHGVSRAVQQEAQARGFSIFDATCPLVSKVHVEVAKLAKQGYEFIMIGHKGHPEVEGTMGQLEHGIHLVQDVPDVARVRPAQTHKLALVTQTTLSVDDAAEIAAAVRTRFPGVREPKQQDICYATQNRQDAVKLLSPQVDVVIVVGSPTSSNSTRLRELATKLGTTAYMVDSADELQAEWFDGLARVGLTAGASAPEILVRQVI 280
>gi|94676997|ref|YP_588987.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|166217150|sp|Q1LSS7|ISPH_BAUCH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|94220147|gb|ABF14306.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (313 aa)
Score = 341, Expect = 2.6e-30, Identities = 88/291 (30%), Positives = 148/291 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           M+I+   PRGFC GV  A    +K+  +Y     Y+   LVHN  ++  L   G+   +             +I +  +  ++IFSAHG  +    + + + L +FD TC  VTK H  +     +G +   IG   HPE   T+    + D  I L+E++ D+  ++ +++  +    QTT S+ +   I + L+ ++  I+   K DIC A  +RQ+AV N+    D++LVVG   S+NS +LVE+  +    ++LI    +IK+ W      + +T+G S P  L   VI+ L+
  S:     1 MRILLANPRGFCAGVERAINIVEKVIAIY-GPPIYVRHELVHNSYVVNTLRNQGVVFIE-------------QIHEVPDGAVIIFSAHGVSKAIRKEVQSRNLTIFDATCPLVTKVHMEVARASHKGIETILIGHYGHPEVEGTIGQYNNTDGGIYLVESLEDVWQLKVKNKNNLCFITQTTFSVDKSSAIIDALRQRFPFIKGPHKQDICYATTNRQEAVRNLTMATDIVLVVGSKNSSNSNRLVELAQQTGKPAYLIDCASDIKENWLQGINIIGVTAGASAPNILVLQVILKLQ 283
>gi|66043978|ref|YP_233819.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas syringae pv. syringae B728a] >gi|75503513|sp|Q4ZYJ1|ISPH_PSEU2 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|63254685|gb|AAY35781.1| LytB protein [Pseudomonas syringae pv. syringae B728a] (315 aa)
Score = 341, Expect = 2.7e-30, Identities = 95/299 (31%), Positives = 152/299 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAND 299
           M+I    PRGFC GV  A     +  +     +Y  HE      +VHNK ++++L   G                +I +++ +  P   IVIFSAHG  Q    +A  +GL VFD TC  VTK H  +      G +   IG   HPE   T+     +   +I L+E   D+ +++  + + +    QTT+S+ +   + + L+ ++  I    K+DIC A ++RQDAV  +  E D++LVVG   S+NS +L E+  +    ++LI   ++++  WF   + + IT+G S P  L   VI  L+    T  D
  S:     1 MQIKLANPRGFCAGVDRAIEIVNRALEVFGPPIYVRHE------VVHNKFVVEDLRSRG----------------AIFVEELDQVPDDVIVIFSAHGVSQAVRTEAAGRGLKVFDATCPLVTKVHIEVARYSRDGRECILIGHAGHPEVEGTMGQYDAANGGAIYLVEDEEDVASLQVRNPEALAFVTQTTLSMDDTSRVIDALRKRFPAIGGPRKDDICYATQNRQDAVKQLADECDVVLVVGSPNSSNSNRLRELAERMATPAYLIDGAEDMQQGWFDGVERIGITAGASAPEVLVRGVIQQLQAWGATGAD 292
>gi|68165320|gb|AAY87620.1| LytB [Vibrio cholerae] >gi|68165350|gb|AAY87635.1| LytB [Vibrio cholerae] (280 aa)
Score = 341, Expect = 2.7e-30, Identities = 89/279 (31%), Positives = 153/279 (54%)
  Q:     9 RGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           RGFC GV  A +  ++  +LY     Y+   +VHN+ +++ L++ G +  ++ N          E+ D N   IVIFSAHG  Q    +A+E+ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S    + L+E   D+ +++ + + P  +   +QTT+S+ E  ++ + L+  +  I+   K+DIC A ++RQDAV  +  +VD+++VVG   S+NS +L E+  K     +LI   ++I    F++ + + +T+G S P  L N ++
  S:     1 RGFCAGVDRAISIVERALELY-QPPIYVRHEVVHNRFVVEGLKQRGARFVEELN----------EVPDDN---IVIFSAHGVSQAVRQEAKERSLTVFDATCPLVTKVHMEVARASRKHMEVVLIGHAGHPEVEGTMGQYASDTGGMYLVEKPEDVVSLQAKVKDPSNLHYVSQTTLSVDETADVIDELRRVFPKIQGPRKDDICYATQNRQDAVRILAEQVDVMVVVGSKNSSNSTRLKELAEKLGTPGYLIDCPQDIDPGGFVDAQLIGVTAGASAPEELVNQIL 273
>gi|15834869|ref|NP_296628.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chlamydia muridarum Nigg] >gi|13629499|sp|Q9PL59|ISPH_CHLMU 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|7190288|gb|AAF39118.1| penicillin tolerance protein LytB [Chlamydia muridarum Nigg] (308 aa)
Score = 340, Expect = 4.2e-30, Identities = 93/295 (31%), Positives = 156/295 (52%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPI---VIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL--SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGT 296
           K+I  +PRGFC GV+ A  T ++      A +Y  HE      +VHN+ ++ +L   G                +I I+D    P    VI+SAHG      ++A+E+GL+  D TC  VTK H  +K    +GY I  IG   H E I     + DK I ++E + ++E +   ++  +F   QTT+S+ +  ++   LK++Y  I     + IC A ++RQ A+ N+  +V+ + V+GD KS+NS +L  +  ++ + + L+ N + I DE       + +T+G STP  +    +  L+K + T
  S:     3 KVIICSPRGFCAGVIRAVQTVERALEKWGAPIYVKHE------IVHNRHVVDKLRAKG----------------AIFIEDLQEVPCNSRVIYSAHGVPPSVREEAKERGLITIDATCGLVTKIHSAVKMYARRGYLIILIGKRKHVEVIGICGEAPDK-ITVVENIAEVEALTFSTKDLLFYVTQTTLSMDDSADMIAALKARYPQIITLPSSSICYATQNRQSALRNILPKVEFVYVIGDPKSSNSNQLKAVAARRGVVARLVNNPEEITDEILQYSGNIGVTAGASTPEDVVQACLTKLQKLIPT 286
>gi|118049170|ref|ZP_01517721.1| hydroxymethylbutenyl pyrophosphate reductase [Comamonas testosteroni KF-1] >gi|118003037|gb|EAV17190.1| hydroxymethylbutenyl pyrophosphate reductase [Comamonas testosteroni KF-1] (329 aa)
Score = 339, Expect = 4.4e-30, Identities = 88/286 (30%), Positives = 150/286 (52%)
  Q:     2 KIIKITPRGFCKGVVDAY-----ATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRGFC GV  A      A  K  A +Y  HE      +VHN  ++ +L+  G                +I I++ +  P    +IFSAHG  +    +A  +G  +FD TC  VTK H  + +  ++GY+   IG   HPE   T+  + + I L+E   D+  +     + + V  QTT+S+ +   I   +K+++  +    + DIC A ++RQDAV  +  +VDL++VVG   S+NS +L E+  +    ++++ N   +++EWF +   + +T+G S P  L + VI
  S:     6 EVLLAEPRGFCAGVDRAIEIVERALAKFGAPIYVRHE------IVHNTFVVNDLKAKG----------------AIFIEELDEVPPGATLIFSAHGVSKAVQQEAERRGFAIFDATCPLVTKVHVEVAKLAKEGYEFLMIGHKGHPEVEGTMGQLSEGIHLVEDEGDVAKVAPRQTEKLAVVTQTTLSVDDAAGIKAAIKARFPQVREPKQQDICYATQNRQDAVKVLAPQVDLVIVVGSPTSSNSNRLRELADRLGTPAYMVDNALELREEWFADAARVGLTAGASAPEVLVDEVI 280
>gi|121535824|ref|ZP_01667624.1| hydroxymethylbutenyl pyrophosphate reductase [Thermosinus carboxydivorans Nor1] >gi|121305596|gb|EAX46538.1| hydroxymethylbutenyl pyrophosphate reductase [Thermosinus carboxydivorans Nor1] (655 aa)
Score = 338, Expect = 5.7e-30, Identities = 86/286 (30%), Positives = 141/286 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYV 286
           MKII    RGFC GV  A  T        P    Y +G ++HN ++++ L E G+          +  ++ I          VI  +HG   +  D+AR + L V D TC +V K     ++  E+GY +  +G  NHPE  S ++   + + ++ET  D +N+    +  + V  QTT +  +F  I + LK+K + IE    IC A   RQ A I +  +VD+++VVG   S N+ +L E+   +   ++ +   + +K +WF   + + IT+G STP W+   V
  S:     1 MKIILAEYRGFCYGVKRAIETAYACIGQGP---VYTLGPIIHNPQLVQRLSEQGVVM--------ANTLEQIPAGR------VIIRSHGVGPEVYDQARARSLEVVDATCPHVRKAQQAARQLAEKGYYVAVVGEPNHPEVKSIVAWAGERVTVVETPADAQNLPYHEQ--LGVVAQTTFASDQFNTIVDILKTKCREIEVSRTICTATDQRQQAAIKLARKVDVMVVVGGKNSANTSRLAELCRLQGCPTYHVETAQELKIDWFTGVQTVGITAGASTPDWIIEEV 268
>gi|73538723|ref|YP_299090.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ralstonia eutropha JMP134] >gi|72122060|gb|AAZ64246.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ralstonia eutropha JMP134] (323 aa)
Score = 338, Expect = 5.8e-30, Identities = 86/287 (29%), Positives = 142/287 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAY-----ATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M++I   PRGFC GVV A      A  K  A ++  HE      +VHNK +++ L+  G +  +             E+ +     + IFSAHG  +  +  A ++ L   D TC  V K H+  ++    G  +  IG   HPE   T+  I   +IL++   ++E +   ++ P+    QTT+S+ +   I   L  ++ N+   +  DIC A ++RQ AV ++    D++LV+G   S+NS +L EIG +  + S+LI +   +   W      + IT+G S P  +   VI
  S:     1 MQVILAQPRGFCAGVVRAIEIVDRALVKHGAPVFVRHE------IVHNKHVVEGLKNKGARFVE-------------ELDEVPAGAVTIFSAHGVSRAVVADAGQRQLHAIDATCPLVIKVHNQGRQYAASGRTVILIGHAGHPEVEGTMGQIPGKVILVQNEAEVERLDLPADTPVAYVTQTTLSVDDTRNIIAALARRFSNMVGPDTRDICYATQNRQSAVRDLCKVADVILVIGATNSSNSNRLREIGTESGVPSYLIADGSELDPAWVTGANIVGITAGASAPEEMVEDVI 276
>gi|67639445|ref|ZP_00438301.1| COG0761: Penicillin tolerance protein [Burkholderia mallei GB8 horse 4] (251 aa)
Score = 338, Expect = 6.0e-30, Identities = 72/209 (34%), Positives = 119/209 (56%)
  Q:    82 IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFL 290
           + IFSAHG  Q     A+ +GL V D TC  VTK H   ++ +  G ++  IG   HPE   T+  I   +IL+++  +++ +   ++ P+    QTT+S+ +   I E L+ ++ +I   +  DIC A ++RQ AV  +  +VD+LLVVG   S+NS +L EIG +  + S+L+ +   ++ EWF N + + +T+G S P  +   VI  L
  S:     6 VAIFSAHGVAQTVEQDAQARGLDVLDATCPLVTKVHVQGRQYVAAGRRLILIGHAGHPEVEGTIGQIPAEVILVQSEAEVDTLTLPADTPVAYVTQTTLSVDDTRGIIEALQRRFTDIVGPDTRDICYATQNRQAAVRELSEQVDVLLVVGATNSSNSNRLREIGTESGVPSYLVADGSEVRAEWFANARTVGLTAGASAPEEMVEDVIAAL 217
>gi|28868037|ref|NP_790656.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pseudomonas syringae pv. tomato str. DC3000] >gi|38257980|sp|Q889E1|ISPH_PSESM 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|28851273|gb|AAO54351.1| hydroxymethylbutenyl pyrophosphate reductase [Pseudomonas syringae pv. tomato str. DC3000] (315 aa)
Score = 338, Expect = 7.0e-30, Identities = 96/299 (32%), Positives = 149/299 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI-----DKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAND 299
           M+I    PRGFC GV  A     +  +     +Y  HE      +VHNK ++++L             SR  I    E++   +  IVIFSAHG  Q    +A  +GL VFD TC  VTK H  +      G +   IG   HPE   T+         +I L+E   D+ ++   + + +    QTT+S+ +   + + L+ ++  I    K+DIC A ++RQDAV  +  E D++LVVG   S+NS +L E+  +    ++LI   ++++  WF   + + IT+G S P  L   VI  L+    T  D
  S:     1 MQIKLANPRGFCAGVDRAIEIVNRALEVFGPPIYVRHE------VVHNKFVVEDLR------------SRGAIFVE-ELEQVPDDVIVIFSAHGVSQAVRTEAAGRGLKVFDATCPLVTKVHIEVARYSRDGRECILIGHAGHPEVEGTMGQYDAVNGGAIYLVEDEADVASLEVRNPESLAFVTQTTLSMDDTSRVIDALRKRFPAIGGPRKDDICYATQNRQDAVKQLADECDVVLVVGSPNSSNSNRLRELAERMATPAYLIDGAEDMQKGWFDGVERIGITAGASAPEVLVRGVIQQLQAWGATGAD 292
>gi|116696105|ref|YP_841681.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ralstonia eutropha H16] >gi|113530604|emb|CAJ96951.1| drug tolerance protein [Ralstonia eutropha H16] (337 aa)
Score = 336, Expect = 9.8e-30, Identities = 89/295 (30%), Positives = 147/295 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAY-----ATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           M++I   PRGFC GVV A      A  K  A ++  HE      +VHNK +++ L++ G +  +             E+ +     + IFSAHG  ++ I  A ++ L   D TC  V K H   ++    G  +  IG   HPE   T+  I   +IL++   ++  +   ++ P+    QTT+S+ +   I   L  ++ N+   +  DIC A ++RQ AV ++    D++LV+G   S+NS +L EIG +  + S+LI     +   W  +   + IT+G S P  +   VI  L ++LG
  S:     1 MQVILAQPRGFCAGVVRAIEIVDRALVKHGAPVFVRHE------IVHNKHVVEGLKDKGARFVE-------------ELDEVPTGAVTIFSAHGVSREVIADASQRQLHAIDATCPLVIKVHTQGRQYAASGRTVILIGHAGHPEVEGTMGQIPGKVILVQNEAEVAQLDLPADTPVAYVTQTTLSVDDTRNIIAALGRRFSNLVGPDTRDICYATQNRQSAVRDLCKLADVILVIGATNSSNSNRLREIGTESGVPSYLIAEGAELDPAWVRDANVVGITAGASAPEEMVEDVINAL-RRLG 283
>gi|71891907|ref|YP_277637.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase, 4Fe-4S protein [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|123641144|sp|Q493S1|ISPH_BLOPB 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|71796013|gb|AAZ40764.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase, 4Fe-4S protein [Candidatus Blochmannia pennsylvanicus str. BPEN] (311 aa)
Score = 336, Expect = 1.1e-29, Identities = 92/287 (32%), Positives = 152/287 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SID--KSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           MK++  +PRGFC GV  A    +K  ++Y     Y+   LVHN  ++ +L + G+             I    + +  N  ++IFSAHG  +K  ++++ K L++ D TC  VTK H  +        ++  IG + HPE   T+    S++  + I L+E+  D  +++      +F   QTT+SI +  EI   L  ++ NI    KNDIC A  +RQ+A+ N+   V+++ VVG I S+NS +L+E+G +    ++LI +  +I+  W      + IT+G S P  L   VI
  S:     1 MKVVLASPRGFCAGVNRAINIVEKTIQVY-GTPIYVRHELVHNDYVVTQLSKKGV-------------IFIERLNEVPNGSVLIFSAHGVSKKIQEQSKIKNLIIIDATCPLVTKVHKEVSRANRNDMEVILIGHSGHPEVEGTMGQYISVNSRQKIYLVESQADAWSVQVNQPNHLFFVTQTTLSIDDTAEIIAILNKRFPNIMGPRKNDICYATFNRQNALKNLAPMVEMIFVVGSITSSNSVRLMELGRRIGKITYLISHANDIQKNWLRGVNNIGITAGASAPDILVLQVI 281
>gi|89902017|ref|YP_524488.1| hydroxymethylbutenyl pyrophosphate reductase [Rhodoferax ferrireducens T118] >gi|89346754|gb|ABD70957.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodoferax ferrireducens T118] (320 aa)
Score = 336, Expect = 1.2e-29, Identities = 91/285 (31%), Positives = 150/285 (52%)
  Q:     3 IIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           I+   PRGFC GV  A    ++      A +Y  HE      +VHN  ++ +L+  G                +I I+  ++ P    +IFSAHG  +    +A  +G  VFD TC  V+K H  + +  ++GY+   IG   HPE   T+  ++  I L+E+V D+  I       + V  QTT+S+ +  +I   +K+++  +    + DIC A ++RQDAV  M   VD+++VVG   S+NS++L E+  K   ESH++     ++ +WF  ++ + +T+G S P  L   VI
  S:     9 ILLAEPRGFCAGVDRAIEIVERALQKFGAPIYVRHE------IVHNTYVVNDLKAKG----------------AIFIEALDDVPAGATLIFSAHGVSRAVQLEAAARGFQVFDATCPLVSKVHVEVAKLHKEGYEFIMIGHKGHPEVEGTMGQLEGGIHLVESVLDVARINPAQTDKLAVVTQTTLSVDDAADIAAAIKARFPKVREPKQQDICYATQNRQDAVKVMSPLVDVVIVVGSPTSSNSRRLREVARKLGTESHMVDGPDELQAQWFEGRQHVGLTAGASAPDILVRQVI 282
>gi|83941559|ref|ZP_00954021.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Sulfitobacter sp. EE-36] >gi|83847379|gb|EAP85254.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Sulfitobacter sp. EE-36] (316 aa)
Score = 336, Expect = 1.2e-29, Identities = 95/280 (33%), Positives = 139/280 (49%)
  Q:     8 PRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV  A      A  K  A +Y  HE      +VHNK ++  L E G           +  ++ +     + P  VIFSAHG  +    KA  + +V  D TC  V+K H   +   + G Q+  IG   HPETI T+       ++L+ET  D+E ++      +    QTT+S+ +  EI   L  ++  I    K DIC A  +RQ+AV  M  + D +LVVG   S+NS++LVE+G +   + + L+    +I        K + IT+G S P  L N VI
  S:    13 PRGFCAGVDRAIKIVEMAIEKWGAPVYVRHE------IVHNKFVVDGLRERG-----------AIFVEELSECPDDRP--VIFSAHGVPKAVPAKAEARNMVYVDATCPLVSKVHIEAQRHADAGLQMIMIGHAGHPETIGTMGQLPPGEVLLVETPADVETVKVRDPSKLAYVTQTTLSVDDTAEIVAALNKRFPQIIGPHKEDICYATTNRQEAVKAMAPKCDAMLVVGAPNSSNSRRLVEVGSRAGCDYAQLVQRATDIDWRSLEGIKSIGITAGASAPEQLINEVI 283
>gi|89052998|ref|YP_508449.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Jannaschia sp. CCS1] >gi|88862547|gb|ABD53424.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Jannaschia sp. CCS1] (319 aa)
Score = 334, Expect = 1.8e-29, Identities = 98/294 (33%), Positives = 143/294 (48%)
  Q:     1 MKIIKITPRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKL 294
           + I    PRGFC GV  A      A  K  A ++  HE      +VHNK ++ +L+  G    +             E+ D  +   VIFSAHG  +     A  + +V  D TC  V+K H   +   + G Q+  IG   HPETI T+    D  ++L+ETV D+  +       +    QTT+S+ +  EI E L +++  I    K DIC A  +RQ+AV  M  + + +LVVG   S+NSK+LVE+G +     S L+    +I      + K L IT+G S P  L   VI   E + 
  S:     9 LTIYLAAPRGFCAGVDRAIKIVEMALEKWGAPVFVRHE------IVHNKYVVDDLKAKGAVFVE-------------ELSDCPDDRPVIFSAHGVPKSVPQAAAARQMVYVDATCPLVSKVHIEAQRHSDNGLQMVMIGHKGHPETIGTMGQLPDGEVLLVETVEDVATVEVRDPSRLAFVTQTTLSVDDTIEIVEALTTRFPAIVGPHKEDICYATTNRQEAVKAMAPKAEAMLVVGAPNSSNSKRLVEVGSRAGCAYSQLVQRAADIDWRALGDIKTLGITAGASAPEVLIEEVIQAFEDRF 293
>gi|161511061|ref|NP_796916.2| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio parahaemolyticus RIMD 2210633] >gi|50403788|sp|Q87S87|ISPH_VIBPA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (317 aa)
Score = 334, Expect = 2.0e-29, Identities = 98/295 (33%), Positives = 163/295 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           MKI+   PRGFC GV  A +  ++  +LY     Y+   +VHN+ +++ L++ G    ++ +          E+ D N   IVIFSAHG  Q    +A+++ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S    + L+ET  D+E ++   + P  +   +QTT+S+ E  ++ E L+  + +I+   K+DIC A ++RQDAV  +  +VD+++VVG   S+NS +L E+  K     +L    ++IK EWF  K  + +T+G S P  L N ++  +++ +G
  S:     1 MKILLANPRGFCAGVDRAISIVERALELY-QPPIYVRHEVVHNRFVVEGLKQRGAIFVEELH----------EVPDNN---IVIFSAHGVSQAVRQEAKQRDLTVFDATCPLVTKVHMEVARASRRNMEVVLIGHAGHPEVEGTMGQYSSETGGMYLVETPADVEKLKAIVKDPSDLHYVSQTTLSVDETADVIEELRRVFPDIQGPRKDDICYATQNRQDAVRELAGDVDVMVVVGSKNSSNSTRLKELAEKLGTPGYLTDCPEDIKPEWFEGKTKVGVTAGASAPEELVNQILERIKELVG 289
>gi|153838776|ref|ZP_01991443.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio parahaemolyticus AQ3810] >gi|28805520|dbj|BAC58800.1| LytB protein [Vibrio parahaemolyticus RIMD 2210633] >gi|149747808|gb|EDM58698.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio parahaemolyticus AQ3810] (321 aa)
Score = 334, Expect = 2.1e-29, Identities = 98/295 (33%), Positives = 163/295 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           MKI+   PRGFC GV  A +  ++  +LY     Y+   +VHN+ +++ L++ G    ++ +          E+ D N   IVIFSAHG  Q    +A+++ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S    + L+ET  D+E ++   + P  +   +QTT+S+ E  ++ E L+  + +I+   K+DIC A ++RQDAV  +  +VD+++VVG   S+NS +L E+  K     +L    ++IK EWF  K  + +T+G S P  L N ++  +++ +G
  S:     5 MKILLANPRGFCAGVDRAISIVERALELY-QPPIYVRHEVVHNRFVVEGLKQRGAIFVEELH----------EVPDNN---IVIFSAHGVSQAVRQEAKQRDLTVFDATCPLVTKVHMEVARASRRNMEVVLIGHAGHPEVEGTMGQYSSETGGMYLVETPADVEKLKAIVKDPSDLHYVSQTTLSVDETADVIEELRRVFPDIQGPRKDDICYATQNRQDAVRELAGDVDVMVVVGSKNSSNSTRLKELAEKLGTPGYLTDCPEDIKPEWFEGKTKVGVTAGASAPEELVNQILERIKELVG 293
>gi|148824589|ref|YP_001289343.1| lytB-related protein lytB1 [Mycobacterium tuberculosis F11] >gi|167966942|ref|ZP_02549219.1| lytB-related protein lytB1 [Mycobacterium tuberculosis H37Ra] >gi|194542042|ref|YP_002077073.1| lytB-related protein lytB1 [Mycobacterium tuberculosis C] >gi|124599512|gb|EAY58616.1| lytB-related protein lytB1 [Mycobacterium tuberculosis C] >gi|134151508|gb|EBA43553.1| lytB-related protein lytB1 [Mycobacterium tuberculosis str. Haarlem] >gi|148723116|gb|ABR07741.1| lytB-related protein lytB1 [Mycobacterium tuberculosis F11] (331 aa)
Score = 333, Expect = 2.3e-29, Identities = 86/287 (29%), Positives = 144/287 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNP-PIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI-DKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           + ++  +PR FC GV  A  T K++  +      Y+   +VHN  ++ EL + G    +D +          EI D   P  +V+FSAHG        A E+GL V D TC  V K H        +G  + +IG   H ET  TL +  +S +L++T  D+  +       +    QTT+++ E  ++ + L++++  +      DIC A  +RQ A+ +M  E D++LV+G   S+NS++LVE+  +    ++LI    +I+ EW  +   + +T+G S P  L   VI
  S:    20 VTVLLASPRSFCAGVERAIETVKRVLDV-AEGPVYVRKQIVHNTVVVAELRDRGAVFVEDLD----------EIPDPPPPGAVVVFSAHGVSPAVRAGADERGLQVVDATCPLVAKVHAEAARFAARGDTVVFIGHAGHEETEGTLGVAPRSTLLVQTPADVAALNLPEGTQLSYLTQTTLALDETADVIDALRARFPTLGQPPSEDICYATTNRQRALQSMVGECDVVLVIGSCNSSNSRRLVELAQRSGTPAYLIDGPDDIEPEWLSSVSTIGVTAGASAPPRLVGQVI 299
>gi|15842974|ref|NP_338011.1| lytB protein [Mycobacterium tuberculosis CDC1551] >gi|31794562|ref|NP_857055.1| LYTB-like protein LYTB1 [Mycobacterium bovis AF2122/97] >gi|57117100|ref|YP_177967.1| LYTB-like protein LYTB1 [Mycobacterium tuberculosis H37Rv] >gi|121639306|ref|YP_979530.1| putative lytB-related protein lytB1 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148663245|ref|YP_001284768.1| putative lytB-related protein LytB1 [Mycobacterium tuberculosis H37Ra] >gi|61226768|sp|P0A5I2|ISPH2_MYCTU 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 2 >gi|61226769|sp|P0A5I3|ISPH2_MYCBO 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 2 >gi|13883313|gb|AAK47825.1| lytB protein [Mycobacterium tuberculosis CDC1551] >gi|31620158|emb|CAD95586.1| PROBABLE LYTB-RELATED PROTEIN LYTB1 [Mycobacterium bovis AF2122/97] >gi|38490365|emb|CAE55592.1| PROBABLE LYTB-RELATED PROTEIN LYTB1 [Mycobacterium tuberculosis H37Rv] >gi|121494954|emb|CAL73440.1| Probable lytB-related protein lytB1 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148507397|gb|ABQ75206.1| putative lytB-related protein LytB1 [Mycobacterium tuberculosis H37Ra] (329 aa)
Score = 333, Expect = 2.3e-29, Identities = 86/287 (29%), Positives = 144/287 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNP-PIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI-DKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           + ++  +PR FC GV  A  T K++  +      Y+   +VHN  ++ EL + G    +D +          EI D   P  +V+FSAHG        A E+GL V D TC  V K H        +G  + +IG   H ET  TL +  +S +L++T  D+  +       +    QTT+++ E  ++ + L++++  +      DIC A  +RQ A+ +M  E D++LV+G   S+NS++LVE+  +    ++LI    +I+ EW  +   + +T+G S P  L   VI
  S:    18 VTVLLASPRSFCAGVERAIETVKRVLDV-AEGPVYVRKQIVHNTVVVAELRDRGAVFVEDLD----------EIPDPPPPGAVVVFSAHGVSPAVRAGADERGLQVVDATCPLVAKVHAEAARFAARGDTVVFIGHAGHEETEGTLGVAPRSTLLVQTPADVAALNLPEGTQLSYLTQTTLALDETADVIDALRARFPTLGQPPSEDICYATTNRQRALQSMVGECDVVLVIGSCNSSNSRRLVELAQRSGTPAYLIDGPDDIEPEWLSSVSTIGVTAGASAPPRLVGQVI 297
>gi|15618925|ref|NP_225211.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chlamydophila pneumoniae CWL029] >gi|15836548|ref|NP_301072.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chlamydophila pneumoniae J138] >gi|16752009|ref|NP_445375.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chlamydophila pneumoniae AR39] >gi|33242386|ref|NP_877327.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chlamydophila pneumoniae TW-183] >gi|8928201|sp|Q9Z6P2|ISPH_CHLPN 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|4377348|gb|AAD19154.1| Metalloprotease [Chlamydophila pneumoniae CWL029] >gi|7189749|gb|AAF38629.1| penicillin tolerance protein LytB [Chlamydophila pneumoniae AR39] >gi|8979390|dbj|BAA99224.1| metalloprotease [Chlamydophila pneumoniae J138] >gi|33236897|gb|AAP98984.1| putative metalloproteinase [Chlamydophila pneumoniae TW-183] (310 aa)
Score = 333, Expect = 2.5e-29, Identities = 93/278 (33%), Positives = 145/278 (52%)
  Q:     2 KIIKITPRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           K+I   PRGFC GVV A      A  K  A +Y  HE      +VHN+ ++  L   G              I   E+ D      VI+SAHG       +A+ + L+  D TC  VTK H   K    +GY+I  IG   H E I  +  + + I ++E V D+E +   S+ P+F   QTT+S+ + +EI+  L  +Y +I     + IC A  +RQ A+ ++ S V+ + VVGD+ S+NS +L E+ +++ + + LI N ++I      +   +A+T+G STP
  S:     3 KLILCNPRGFCSGVVRAIQVVEVALEKWGAPIYVKHE------IVHNRHVVNALRAKGA-------------IFVEELVDVPEGERVIYSAHGIPPSVRAEAKARKLIDIDATCGLVTKVHSAAKLYASKGYKIILIGHKKHVEVIGIVGEVPEHITVVEKVADVEALPFSSDTPLFYITQTTLSLDDVQEISSALLKRYPSIITLPSSSICYATTNRQKALRSVLSRVNYVYVVGDVNSSNSNRLREVALRRGVPADLINNPEDIDTNIVNHSGDIAMTAGASTP 269
>gi|91762745|ref|ZP_01264710.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Candidatus Pelagibacter ubique HTCC1002] >gi|91718547|gb|EAS85197.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Candidatus Pelagibacter ubique HTCC1002] (314 aa)
Score = 333, Expect = 2.8e-29, Identities = 106/294 (36%), Positives = 151/294 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI-ESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKL 294
           +KI+   PRGFC GV  A    KK      A +Y  HE      +VHNK ++  L+ +G    ++ +          EIKDK+ P  VIFSAHG  +    +A    +   D TC  V+K H   +   + GY I  IG  NHPE I T+    + SI LI+  +D+E    +  K I    QTT+S+ + + I +TLK K+  I+  FK DIC A  +RQ AV N+  + D+  V+G   S+NS +LVE+  +     S LI +   I  E   N K + I+SG S P  L    I  ++ K 
  S:     6 IKILLSAPRGFCAGVERAIEIVKKSITKYGAPVYVRHE------IVHNKYVVDSLKAIGAVFVEELD----------EIKDKSRP--VIFSAHGVPKSVPQQANGYKMEYIDATCPLVSKVHREAENLYKAGYHIVLIGHINHPEVIGTMGQLPEGSIDLIQDEHDVETYELDDNKKIAYVTQTTLSVDDTKNIIKTLKKKFPKIKEPFKEDICYATTNRQSAVKNIAKKCDMFFVLGSRNSSNSVRLVEVAEQSGCPHSELIHSDSEIPFEKLENCKVIGISSGASAPEILVENFINEIKSKF 291
>gi|148555604|ref|YP_001263186.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Sphingomonas wittichii RW1] >gi|148500794|gb|ABQ69048.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Sphingomonas wittichii RW1] (316 aa)
Score = 332, Expect = 2.8e-29, Identities = 90/287 (31%), Positives = 144/287 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYA----TCKKIAK-LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           + ++   PRGFC GV  A      T +K    +Y  HE      +VHNK ++ +L+  G    ++ +    E+ D +          V+FSAHG  +    KA E+GL   D TC  V+K H   +  ++ G+ I +IG   HPE I T     +  + L+ET  D E +      P+   +QTT+S+ +  EI   L+ ++  IE     DIC A  +RQ AV  +  + + +LV+G   S+NS +LVE+  ++ +++ LI     I   W    + L IT+G S P  L   ++
  S:     9 LDLLIAAPRGFCAGVDRAIRIVELTIEKYGPPVYVRHE------IVHNKYVVDDLKAKGAIFVEELD----EVPDDVP---------VVFSAHGVPKAVPAKAAERGLNYLDATCPLVSKVHRQAERLVKNGHHILFIGHKGHPEVIGTFGQVPEGVMTLVETAADAEAVAVPDGAPLAFLSQTTLSVDDTVEIIGVLRRRFPQIEAPRSEDICYATSNRQAAVKAIAPKCEAMLVIGAPNSSNSLRLVEVAERQGVKARLIQRAAEIDFGWLDGVRTLGITAGASAPEILVRELV 285
>gi|50842058|ref|YP_055285.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Propionibacterium acnes KPA171202] >gi|71152192|sp|Q6AA89|ISPH_PROAC 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|50839660|gb|AAT82327.1| IspH, non-mevalonate pathway of isoprenoid biosynthesis [Propionibacterium acnes KPA171202] (323 aa)
Score = 332, Expect = 2.8e-29, Identities = 89/292 (30%), Positives = 147/292 (50%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           K+    PRG+C GV  A  T +K  ++Y     Y+   +VHN+ +++ LE  G    D             E+ +  +  +V+FSAHG   +   +A ++GL   D TC  VTK H   K    Q  QI  IG   H E   T     ++I L++T  D++ +  + ++P+   +QTT+S+ E  E  + ++  +  +     +DIC A ++RQ AV  M  + DL++VVG   S+N+ +LVE+ ++   + S+ + N   I++ W      + +TSG S P  L   VI  L  K
  S:    11 KLYLAAPRGYCAGVDRAVVTVEKALEVY-GAPVYVRKQIVHNRHVVETLEGRGAIFVD-------------ELDEVPDDALVVFSAHGVSPQVKKEATDRGLRTIDATCPLVTKVHHEAKRFANQDTQILLIGHAGHEEVEGTTGEAPENITLVQTPADVDGLALDRDRPVAWLSQTTLSVDETVETVDRIRDLHPQLIDPPSDDICYATQNRQHAVKQMAPQCDLVIVVGSKNSSNTGRLVEVALESGAKASYRVDNAGEIEETWLDGVSTIGVTSGASVPEALVQGVIDLLISK 292
>gi|75676873|ref|YP_319294.1| LytB protein [Nitrobacter winogradskyi Nb-255] >gi|74421743|gb|ABA05942.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nitrobacter winogradskyi Nb-255] (329 aa)
Score = 332, Expect = 3.0e-29, Identities = 93/279 (33%), Positives = 140/279 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSI-EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           +KI+  +PRGFC GVV A  T ++   LY     Y+   +VHN+ ++  L   G           +  ++ + EI D    P+V FSAHG  +     A+ +     D TC  VTK H       ++G++I  IG ++HPE + T+      ++ LIET  D E    +    +    QTT+SI +  EI   LK ++ NI    K DIC A  +RQ AV  +   VD L+VVG   S+NS++L E+  ++  + S L     ++    F   K L IT+G S P
  S:    16 LKIVLCSPRGFCAGVVRAIDTVERALTLY-GAPVYVRHEIVHNRYVVDSLRAKG-----------AIFVEELAEIPDDTTAPVV-FSAHGVPKSVPADAQRRNFFSLDATCPLVTKVHREAAIHFKRGHEILLIGHSHHPEVVGTVGQLPAGAVTLIETAEDAEKFTPKDADNLAFVTQTTLSIDDTAEIVAVLKQRFPNIHGPHKEDICYATTNRQLAVKKVAPVVDALIVVGAPNSSNSQRLREVAEREGCKVSVLAQRAGDLDWSMFEGIKSLGITAGASAP 287
>gi|94496956|ref|ZP_01303530.1| hydroxymethylbutenyl pyrophosphate reductase [Sphingomonas sp. SKA58] >gi|94423632|gb|EAT08659.1| hydroxymethylbutenyl pyrophosphate reductase [Sphingomonas sp. SKA58] (319 aa)
Score = 332, Expect = 3.0e-29, Identities = 90/287 (31%), Positives = 139/287 (48%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFK--NDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M ++   PRGFC GV  A    ++      A +Y  HE      +VHNK ++  L+  G                +I +++ +  P    V+FSAHG  +   ++A+E+GL   D TC  V+K H   + ++  G  I +IG   HPE I T     D S+ LIETV D+E         +    QTT+S+ +   I   L+ ++ +I      DIC A  +RQ AV  +    D L V+G   S+NS +LVE+  ++   + LI     +   W  +   L +T+G S P  L   V+
  S:    11 MTLLIAAPRGFCAGVDRAIVIVERAIEKYGAPVYVRHE------IVHNKYVVDSLKAKG----------------AIFVEELDQVPDGVPVVFSAHGVPKAVPERAQERGLDYLDATCPLVSKVHRQAERQVASGRHILFIGHKGHPEVIGTFGQVPDGSMTLIETVEDVERFAPIDPDNLAFLTQTTLSVDDTAAIVAALQERFPSIAAPRGEDICYATSNRQTAVKAIAGRCDALYVIGAPNSSNSLRLVEVAEREGTPARLIQRADEVDFAWLDSIGTLGLTAGASAPEILVREVV 287
>gi|91227667|ref|ZP_01261944.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio alginolyticus 12G01] >gi|91188446|gb|EAS74740.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio alginolyticus 12G01] (321 aa)
Score = 332, Expect = 3.3e-29, Identities = 97/295 (32%), Positives = 163/295 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           MKI+   PRGFC GV  A +  ++  ++Y     Y+   +VHN+ +++ L++ G    ++ +          E+ D N   IVIFSAHG  Q    +A+++ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S    + L+ET  D+E ++   + P  +   +QTT+S+ E  ++ E L+  + +I+   K+DIC A ++RQDAV  +  +VD+++VVG   S+NS +L E+  K     +L    ++IK EWF  K  + +T+G S P  L N ++  +++ +G
  S:     5 MKILLANPRGFCAGVDRAISIVERALEMY-QPPIYVRHEVVHNRFVVEGLKQRGAIFVEELH----------EVPDNN---IVIFSAHGVSQAVRQEAKQRDLTVFDATCPLVTKVHMEVARASRRNMEVVLIGHAGHPEVEGTMGQYASETGGMYLVETPADVEKLKAIVKDPSDLHYVSQTTLSVDETADVIEELRRVFPDIQGPRKDDICYATQNRQDAVRELAGDVDVMVVVGSKNSSNSTRLKELAEKLGTPGYLTDCPEDIKPEWFEGKTKVGVTAGASAPEELVNQILERIKELVG 293
>gi|83951634|ref|ZP_00960366.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Roseovarius nubinhibens ISM] >gi|83836640|gb|EAP75937.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Roseovarius nubinhibens ISM] (316 aa)
Score = 332, Expect = 3.5e-29, Identities = 97/286 (33%), Positives = 150/286 (52%)
  Q:     8 PRGFCKGVVDAY-----ATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIR-TESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           PRGFC GV  A      A  K  A +Y  HE      +VHNK ++ +L   G           +  ++ +E    + P  VIFSAHG  +    +A  + ++  D TC  V+K H   +   E G QI  IG   HPETI T+    + +++L+ETV+D+  +  T+ EK  +VT QTT+S+ +   I   L++++  I+   K DIC A  +RQ+AV  + +    +LVVG   S+NS++LVE+G K     S L+    +I          + +T+G S P  L + VI  L+ +
  S:    13 PRGFCAGVDRAIKIVEIALEKWGAPVYVRHE------IVHNKYVVDDLRAKG-----------AVFVEELEDCPDDRP--VIFSAHGVPKSVPAEAARREMIYVDATCPLVSKVHIEAERHHENGLQIIMIGHAGHPETIGTMGQLPEGAVLLVETVDDVAKVPVTDPEKLAYVT-QTTLSVDDTAGIVAALQARFPAIQGPHKEDICYATTNRQEAVKAIAAHAQAMLVVGAPNSSNSRRLVEVGAKSGCAYSQLVQRADDIDWRALDGIASIGVTAGASAPEVLVDEVIAALQAR 289
>gi|16127591|ref|NP_422155.1| LytB protein [Caulobacter crescentus CB15] >gi|20138699|sp|Q9A345|ISPH_CAUCR 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|13425065|gb|AAK25323.1| LytB protein [Caulobacter crescentus CB15] (319 aa)
Score = 332, Expect = 3.5e-29, Identities = 89/296 (30%), Positives = 150/296 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI-ESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGT 296
           + ++  +PRGFC GV  A    ++      A +Y  HE      +VHN+ ++  L+ LG           +  I+ +E    + P  V+FSAHG  +    +A+ + ++  D TC  V+K H   ++  + G +I  IG   HPE I T+    + ++ LIE + D      +    +    QTT+S+ +  ++   L+ ++  I    K DIC A  +RQDAV ++  + +L+LVVG   S+NS +L E+G+K    ++HLI +   I   WF     + +T+G S P  L   VI  +  +  T
  S:    11 ISLVLASPRGFCAGVDRAIQIVERAVEKFGAPVYVRHE------IVHNRHVVDRLKALG-----------AVFIEELEEAPDDRP--VVFSAHGVPKSVPAEAKARQMIYLDATCPLVSKVHVEAQKHYDAGREIVLIGHAGHPEVIGTMGQLPEGAVTLIEDLKDAAAWEPKDAANVAFLTQTTLSVDDTADMVALLRERFPGIAAPHKEDICYATTNRQDAVKHLAEQSELILVVGSKNSSNSVRLKEVGLKAGARDAHLIDDASGIDWTWFDGISRVGLTAGASAPEDLVQGVIDAISARFDT 297
>gi|92119200|ref|YP_578929.1| hydroxymethylbutenyl pyrophosphate reductase [Nitrobacter hamburgensis X14] >gi|91802094|gb|ABE64469.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nitrobacter hamburgensis X14] (324 aa)
Score = 331, Expect = 3.8e-29, Identities = 95/279 (34%), Positives = 142/279 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSI-EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKK--------QIESHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           +KI+  +PRGFC GVV A  T ++   LY     Y+   +VHN+ ++  L   G           +  ++ + EI D    P+V FSAHG  +     A+++     D TC  VTK H       ++G +I  IG ++HPE + T+      ++ LIET  D      ++ + +    QTT+SI +  EI   LK ++ NI    K DIC A  +RQ AV  +   VD L+VVG   S+NS++L E+  ++        Q  S L WN+       F   K L IT+G S P
  S:    11 LKIVLCSPRGFCAGVVRAIDTVERALTLY-GAPVYVRHEIVHNRYVVDSLRAKG-----------AIFVEELAEIPDDTKAPVV-FSAHGVPKSVPADAQKRNFFSLDATCPLVTKVHREAAIHFKRGREILLIGHSHHPEVVGTVGQLPAGAVTLIETAEDAATFMPKNPENLAFVTQTTLSIDDTAEIVAMLKQRFPNISGPHKEDICYATTNRQLAVKKVAPVVDALIVVGAPNSSNSQRLREVAEREGCRVSVLAQRASDLDWNS-------FEGIKSLGITAGASAP 282
>gi|73667144|ref|YP_303160.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ehrlichia canis str. Jake] >gi|72394285|gb|AAZ68562.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ehrlichia canis str. Jake] (319 aa)
Score = 331, Expect = 4.3e-29, Identities = 97/294 (32%), Positives = 162/294 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK-YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKL 294
           +++I   PRGFC GV  A    +   K + N+ K Y++  +VHNK II  L+E+G+             ID+++  +  +  I+I+SAHG  ++    A+ + L + + TC  VTK H  ++    +GYQI  IG   H E   T+  I   ++L++T++DI+NI   ++  +    QTT+S+ + +EI   LK K+ NI+  +  DIC A ++RQ+AV  +   VD++ ++G   S+NS +L E+  K +  + LI + K I      N + + IT+G S P  L   VI  L++ L
  S:     9 VEVILANPRGFCAGVSRAIEIVELAIKYHSNNRKVYVLHEIVHNKYIINSLKEMGVL-----------FIDTLDQAEDGS--ILIYSAHGVSKEIEHLAQLRNLEIINATCPLVTKVHKEVQSYDREGYQIILIGHKGHREVEGTIGQITTPVLLVQTISDIDNIAVVNQNKLAYVTQTTLSVDDTKEIINKLKQKFPNIKGPDLKDICYATQNRQNAVKQLSELVDIVFILGSKNSSNSNRLKELA-KLKAPAFLIDSYKEIDLSLLQNVEKIGITAGASAPEILITEVIDSLKQHL 292
>gi|194538667|ref|YP_002073741.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio sp. Ex25] >gi|151937222|gb|EDN56089.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio sp. Ex25] (321 aa)
Score = 331, Expect = 4.3e-29, Identities = 96/295 (32%), Positives = 164/295 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           MKI+   PRGFC GV  A +  ++  ++Y     Y+   +VHN+ +++ L++ G    ++ +          E+ D N   IVIFSAHG  Q    +A+++ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S    + L++T  D+E +++  + P  +   +QTT+S+ E  ++ E L+  + +I+   K+DIC A ++RQDAV  +  +VD+++VVG   S+NS +L E+  K     +L    ++IK EWF  K  + +T+G S P  L N ++  +++ +G
  S:     5 MKILLANPRGFCAGVDRAISIVERALEMY-QPPIYVRHEVVHNRFVVEGLKQRGAVFVEELH----------EVPDNN---IVIFSAHGVSQAVRQEAKQRDLTVFDATCPLVTKVHMEVARASRRNMEVVLIGHAGHPEVEGTMGQYASETGGMYLVQTPADVEKLKSIVKDPSDLHYVSQTTLSVDETADVIEELRRVFPDIQGPRKDDICYATQNRQDAVRELAGDVDVMVVVGSKNSSNSTRLKELAEKLGTPGYLTDCPEDIKPEWFEGKTKVGVTAGASAPEELVNQILERIKELVG 293
>gi|161486655|ref|NP_933483.2| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio vulnificus YJ016] >gi|161501846|ref|NP_759496.2| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio vulnificus CMCP6] >gi|50400931|sp|Q7MNM5|ISPH_VIBVY 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|50403789|sp|Q8DET0|ISPH_VIBVU 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (316 aa)
Score = 330, Expect = 5.8e-29, Identities = 96/295 (32%), Positives = 162/295 (54%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           MKI+   PRGFC GV  A +  ++  +LY     Y+   +VHN+ +++ L++ G    ++ +          E+ D N   IVIFSAHG  Q    +A+E+ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S+   + L+E   D+  ++   + P  +   +QTT+S+ E  ++ + L+  +  I+   K+DIC A ++RQDAV  +  +VD+++VVG   S+NS +L E+  K    ++L    ++I+ +WF  K  + +T+G S P  L N ++  + K+LG
  S:     1 MKILLANPRGFCAGVDRAISIVERALELY-QPPIYVRHEVVHNRFVVEGLKQRGAIFVEELH----------EVPDDN---IVIFSAHGVSQAVRQEAKERALTVFDATCPLVTKVHMEVARASRKHMEVVLIGHAGHPEVEGTMGQYASLQGGMYLVEKPEDVLGLKAIVKDPSNLHYVSQTTLSVDETADVIDELRRVFPEIQGPRKDDICYATQNRQDAVRELAKDVDVVVVVGSKNSSNSTRLKELAEKLGTPAYLTDCPQDIEPQWFDGKVKVGVTAGASAPEELVNQILTRI-KELG 288
>gi|71082832|ref|YP_265551.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Candidatus Pelagibacter ubique HTCC1062] >gi|71061945|gb|AAZ20948.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Candidatus Pelagibacter ubique HTCC1062] (314 aa)
Score = 329, Expect = 6.5e-29, Identities = 105/294 (35%), Positives = 150/294 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI-ESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKL 294
           +KI+   PRGFC GV  A    KK      A +Y  HE      +VHNK ++  L+ +G    ++ +          EIKDK+ P  VIFSAHG  +    +A    +   D TC  V+K H   +   + GY I  IG  NHPE I T+    + SI LI+  +D+E    +  K I    QTT+S+ + + I + LK K+  I+  FK DIC A  +RQ AV N+  + D+  V+G   S+NS +LVE+  +     S LI +   I  E   N K + I+SG S P  L    I  ++ K 
  S:     6 IKILLSAPRGFCAGVERAIEIVKKSITKYGAPVYVRHE------IVHNKHVVDSLKAIGAIFVEELD----------EIKDKSRP--VIFSAHGVPKSVPQQANGYKMEYIDATCPLVSKVHREAENLYKAGYHIVLIGHINHPEVIGTMGQLPEGSIDLIQDEHDVETYELDDNKKIAYVTQTTLSVDDTKNIIKALKKKFPKIKEPFKEDICYATTNRQSAVKNIAKKCDMFFVLGSRNSSNSVRLVEVAEQSGCPHSELIHSDSEIPFEKLENCKVIGISSGASAPEILVENFINEIKSKF 291
>gi|45657402|ref|YP_001488.1| penicillin tolerance protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|50400902|sp|Q72S57|ISPH_LEPIC 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|45600641|gb|AAS70125.1| penicillin tolerance protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (330 aa)
Score = 329, Expect = 6.5e-29, Identities = 87/286 (30%), Positives = 158/286 (55%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIR--TESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINK--KCLAITSGCSTPTWLANYVI 287
           KI    PRGFC GV  A +  +++ +     + Y+   +VHN+ +++++++ GI+  +D             + +  N   VIFSAHG     ++ A+++G+ + D TC  VT+ H   + KI+  +QI YIG   H E I T+  +  + L+E++ DI +++   +  KP+    QTT+S+ + + I + +   +  +E   K+DIC A  +RQ+AV  M  ++D +LV+G   S+NS +L+++  K +  S  +    ++  E+  N   K L +T+G STP  L + +I
  S:    22 KIYLANPRGFCAGVKYAISYVEQV-QANSEEQIYVRKEIVHNRRVVEDMKKNGIRFIND-------------LDEAPNGATVIFSAHGVSPSVVEAAKQRGMKIGDATCPLVTRVHRKAR-KIKDTHQIIYIGHEGHDEAIGTMG-EAEMFLVESLEDIISLKDKIDPNKPLTYLMQTTLSVADTKNIIDQISKTFPFVEHPSKDDICYATTERQEAVSLMMDKIDAMLVIGADNSSNSLRLLQLAQKSKPHSFKVSTADDLSKEYIQNNEIKILGLTAGASTPQVLVDEII 297
>gi|51246018|ref|YP_065902.1| LytB protein [Desulfotalea psychrophila LSv54] >gi|71152179|sp|Q6AL80|ISPH_DESPS 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|50877055|emb|CAG36895.1| probable LytB protein [Desulfotalea psychrophila LSv54] (313 aa)
Score = 329, Expect = 7.0e-29, Identities = 89/287 (31%), Positives = 154/287 (53%)
  Q:     7 TPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTE-SEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF-KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           +PRGFC GV  A  T K   K +     Y++  +VHN+ +I  L + G                ++ +++    P   I IFSAHG   +   +A+  GL   D TC  V+  H ++++   +G  +  IG + HPE   T   +   + ++ T  + E ++   SEK  FVT QTT++  + E++   L+ ++  ++  K++IC A ++RQ+AV  +    DL+LVVG   S+NS +L E+G +    ++LI + K++K+ WF   + + IT+G S P  L   V+++L K+
  S:    15 SPRGFCAGVERAIETVKLALKEH-GEPVYVLHEIVHNRHVIDNLRQGG----------------AVFVEELEQIPAGAICIFSAHGVSLQIEKRAKALGLKTIDATCPLVSSVHRMVEKYHAEGCSVVIIGHHRHPEVEGTAGRVTGEVYVVATAAEAEKLQVNNSEKIAFVT-QTTLAENDIEQVLVVLRRRFPLLQGPKSNICFATQNRQNAVRTLARCTDLILVVGSKNSSNSNRLREVGTETGTPAYLIDDFKDLKESWFRGCERVGITAGASAPESLVEGVVVWLLKR 289
>gi|114777727|ref|ZP_01452687.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mariprofundus ferrooxydans PV-1] >gi|114551943|gb|EAU54477.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mariprofundus ferrooxydans PV-1] (319 aa)
Score = 329, Expect = 7.4e-29, Identities = 85/291 (29%), Positives = 150/291 (51%)
  Q:     3 IIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL--SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           +I   PRGFC GV  A    ++      A +Y  HE      +VHN+ ++++L+  G           +  I+  E+ D  +  ++IFSAHG  +   + A  +GL V D TC  VTK H  +    ++G Q+  IG   HPE   T+  +   +++L+ T  D+E ++ +    +    QTT+S+ +  ++ + L+ ++  ++   + DIC A  +RQ A   +    D++LV+G   S+NS +L E+  +    + LI   ++I  +W      + IT+G S P  L N VI +L+ +
  S:    15 VILAEPRGFCAGVDRAIEIVERSLAVYGAPVYVRHE------IVHNRYVVQDLQAKG-----------AVFIE--EVDDAPDGALLIFSAHGVSKAVRESADRRGLRVIDATCPLVTKVHLELLRHYQRGDQVILIGHAGHPEVEGTMGQAPAGAVLLVATPADVEALQVKDPARLAYVTQTTLSVDDTADVIDALRRRFPLLQGPKREDICYATSNRQAATKELAKASDVVLVIGSKNSSNSNRLREVAERSGSAAWLIDGPEDIDPDWLTPDARIGITAGASAPEVLVNSVIAWLQAR 295
>gi|125620263|gb|EAZ48698.1| hydroxymethylbutenyl pyrophosphate reductase [Vibrio cholerae V51] (289 aa)
Score = 329, Expect = 7.5e-29, Identities = 84/260 (32%), Positives = 144/260 (55%)
  Q:    28 LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +Y  HE      +VHN+ +++ L++ G +  ++ N          E+ D N   IVIFSAHG  Q    +A+E+ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S    + L+E   D+ +++ + + P  +   +QTT+S+ E  ++ + L+  +  I+   K+DIC A ++RQDAV  +  +VD+++VVG   S+NS +L E+  K     +LI   ++I  EWF++ + + +T+G S P  L N ++
  S:     6 IYVRHE------VVHNRFVVEGLKQRGARFVEELN----------EVPDDN---IVIFSAHGVSQAVRQEAKERSLTVFDATCPLVTKVHMEVARASRKHMEVVLIGHAGHPEVEGTMGQYASDTGGMYLVEKPEDVVSLQAKVKDPSNLHYVSQTTLSVDETADVIDELRRVFPKIQGPRKDDICYATQNRQDAVRILAEQVDVMVVVGSKNSSNSTRLKELAEKLGTPGYLIDCPQDIDPEWFVDAQLIGVTAGASAPEELVNQIL 254
>gi|24215120|ref|NP_712601.1| penicillin tolerance protein [Leptospira interrogans serovar Lai str. 56601] >gi|50401055|sp|Q8F3I3|ISPH_LEPIN 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|24196182|gb|AAN49619.1|AE011409_11 penicillin tolerance protein [Leptospira interrogans serovar Lai str. 56601] (330 aa)
Score = 329, Expect = 7.8e-29, Identities = 87/286 (30%), Positives = 158/286 (55%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIR--TESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINK--KCLAITSGCSTPTWLANYVI 287
           KI    PRGFC GV  A +  +++ +     + Y+   +VHN+ +++++++ GI+  +D             + +  N   VIFSAHG     ++ A+++G+ + D TC  VT+ H   + KI+  +QI YIG   H E I T+  +  + L+E++ DI +++   +  KP+    QTT+S+ + + I + +   +  +E   K+DIC A  +RQ+AV  M  ++D +LV+G   S+NS +L+++  K +  S  +    ++  E+  N   K L +T+G STP  L + +I
  S:    22 KIYLANPRGFCAGVKYAISYVEQV-QANSEEQIYVRKEIVHNRRVVEDMKKNGIRFIND-------------LDEAPNGATVIFSAHGVSPSVVEAAKQRGMKIGDATCPLVTRVHRKAR-KIKDTHQIIYIGHEGHDEAIGTMG-EAEMFLVESLEDIISLKDKIDPNKPLTYLMQTTLSVADTKNIIDQISKTFPFVEHPSKDDICYATTERQEAVSLMMDKIDAMLVIGADNSSNSLRLLQLAQKSKPHSFKVSTADDLSKEYIQNNEIKILGLTAGASTPQVLVDEII 297
>gi|103486624|ref|YP_616185.1| hydroxymethylbutenyl pyrophosphate reductase [Sphingopyxis alaskensis RB2256] >gi|98976701|gb|ABF52852.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Sphingopyxis alaskensis RB2256] (326 aa)
Score = 329, Expect = 7.8e-29, Identities = 89/287 (31%), Positives = 144/287 (50%)
  Q:     1 MKIIKITPRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFK--NDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +K++   PRGFC GV  A      A  +  A +Y  HE      +VHN+ +++ L+  G           +  ++S++      P  V+FSAHG  +    KA  +GL   D TC  V+K H   +   E G  I +IG   HPE + TL    D ++ L+E+V+D+  +    E  +    QTT+S+ +  +I   L+ ++  I      DIC A  +RQ+AV  + +  D ++V+G   S+NS +LVE+  +    +HL+    ++   W  +   L IT+G S P  L   VI
  S:    18 LKVLIAAPRGFCAGVDRAIRIVELALERFGAPVYVRHE------IVHNRYVVESLKAKG-----------AIFVESLDQVPDGVP--VVFSAHGVPKAVPAKAEMRGLDYIDATCPLVSKVHRQAERAHEAGRHIIFIGHAGHPEVVGTLGQLPDGAMTLVESVDDVAALAPVDEDRLSFLTQTTLSVDDTRDIVAALRHRFPAIAGPRGEDICYATSNRQEAVKAIAARCDRMIVIGAPNSSNSLRLVEVAERLGTPAHLVQRGHDVDPAWLDSIGTLGITAGASAPETLVREVI 294
>gi|154246297|ref|YP_001417255.1| hydroxymethylbutenyl pyrophosphate reductase [Xanthobacter autotrophicus Py2] >gi|154160382|gb|ABS67598.1| hydroxymethylbutenyl pyrophosphate reductase [Xanthobacter autotrophicus Py2] (335 aa)
Score = 329, Expect = 7.9e-29, Identities = 93/292 (31%), Positives = 144/292 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI-ESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI-IFLEK 292
           +KI+   PRGFC GVV A    ++  KLY     Y+   +VHNK ++++L+  G    ++ +          E+ D + P  VIFSAHG  +   D+A  + L   D TC  VTK H   +    +G  I  IG   HPE + T+    D +  LIET  D   +       +    QTT+S+ +  E+   L+ ++  +    K DIC A  +RQ+AV  +   VD L+VVG   S+NS++L E   +     + L+    +I    F +   L +T+G S P  L   +I  F+E+
  S:    22 LKILLAAPRGFCAGVVRAIDAVEQALKLY-GAPVYVRHEIVHNKYVVEDLKRKGAIFVEELD----------EVPDTSAP--VIFSAHGVPKSVPDEATSRKLFAIDATCPLVTKVHREAQVHFRKGRHILLIGHEGHPEVVGTIGQLPDGAFTLIETAEDARKVMPRDPDNLAYVTQTTLSLDDTAEMIAILRERFPALSEPHKEDICYATTNRQEAVKAIAPRVDALVVVGAPNSSNSQRLREAAERAGCARAVLVQRAADIDWTVFSSIASLGVTAGASAPEVLVEEIIDAFVER 306
>gi|27360085|gb|AAO09023.1|AE016798_183 Penicillin tolerance protein [Vibrio vulnificus CMCP6] >gi|37197615|dbj|BAC93454.1| penicillin tolerance protein [Vibrio vulnificus YJ016] (320 aa)
Score = 328, Expect = 8.4e-29, Identities = 96/295 (32%), Positives = 162/295 (54%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           MKI+   PRGFC GV  A +  ++  +LY     Y+   +VHN+ +++ L++ G    ++ +          E+ D N   IVIFSAHG  Q    +A+E+ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S+   + L+E   D+  ++   + P  +   +QTT+S+ E  ++ + L+  +  I+   K+DIC A ++RQDAV  +  +VD+++VVG   S+NS +L E+  K    ++L    ++I+ +WF  K  + +T+G S P  L N ++  + K+LG
  S:     5 MKILLANPRGFCAGVDRAISIVERALELY-QPPIYVRHEVVHNRFVVEGLKQRGAIFVEELH----------EVPDDN---IVIFSAHGVSQAVRQEAKERALTVFDATCPLVTKVHMEVARASRKHMEVVLIGHAGHPEVEGTMGQYASLQGGMYLVEKPEDVLGLKAIVKDPSNLHYVSQTTLSVDETADVIDELRRVFPEIQGPRKDDICYATQNRQDAVRELAKDVDVVVVVGSKNSSNSTRLKELAEKLGTPAYLTDCPQDIEPQWFDGKVKVGVTAGASAPEELVNQILTRI-KELG 292
>gi|27376425|ref|NP_767954.1| penicillin tolerance protein [Bradyrhizobium japonicum USDA 110] >gi|50401025|sp|Q89UU5|ISPH1_BRAJA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 1 >gi|27349565|dbj|BAC46579.1| penicillin tolerance protein [Bradyrhizobium japonicum USDA 110] (322 aa)
Score = 327, Expect = 1.1e-28, Identities = 96/279 (34%), Positives = 145/279 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSI-EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDK--SIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           +KI+  +PRGFC GVV A  T ++      A +Y  HE      +VHNK ++  L++ G           +  ++ + EI +    P+V FSAHG  +     A+ + L   D TC  VTK H       ++G +IF IG ++HPE + TL      ++ LIET  D + I  +    +    QTT+SI +  EI   LK ++ NI    K DIC A  +RQ AV  +   VD L+VVG   S+NS++L E+  ++    + L     ++  + F N   L IT+G S P
  S:     7 LKIVLCSPRGFCAGVVRAIDTVERALDKYGAPVYVRHE------IVHNKYVVDGLKKKG-----------AIFVEELAEIPESTTAPVV-FSAHGVPKSVPADAQSRNLFSLDATCPLVTKVHREAAIHFKRGREIFLIGHSHHPEVVGTLGQLPVGAVTLIETAEDAKTITPKDPNNLAFVTQTTLSIDDTAEIVALLKERFPNINGPHKEDICYATTNRQLAVKKVAPVVDALIVVGAPNSSNSQRLREVAEREGCPIAVLAQRAADLDWKRFENITSLGITAGASAP 278
>gi|83855036|ref|ZP_00948566.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Sulfitobacter sp. NAS-14.1] >gi|83842879|gb|EAP82046.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Sulfitobacter sp. NAS-14.1] (322 aa)
Score = 327, Expect = 1.1e-28, Identities = 95/280 (33%), Positives = 137/280 (48%)
  Q:     8 PRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV  A      A  K  A +Y  HE      +VHNK ++  L E G           +  ++ +     + P  VIFSAHG  +    KA  + +V  D TC  V+K H   +   + G Q+  IG   HPETI T+       ++L+ET  D+E +       +    QTT+S+ +  EI   L  ++  I    K DIC A  +RQ+AV  M    D +LVVG   S+NS++LVE+G +   + + L+    +I        K + IT+G S P  L N VI
  S:    19 PRGFCAGVDRAIKIVEMAIEKWGAPVYVRHE------IVHNKFVVDGLRERG-----------AIFVEELSECPDDRP--VIFSAHGVPKAVPAKAEARNMVYVDATCPLVSKVHIEAQRHADAGLQMIMIGHAGHPETIGTMGQLPPGEVLLVETPADVETVEVRDPSKLAYVTQTTLSVDDTAEIVAALNKRFPKIIGPHKEDICYATTNRQEAVKAMAPICDAMLVVGAPNSSNSRRLVEVGSRAGCDYAQLVQRATDIDWRSLEGIKSIGITAGASAPEQLINEVI 289
>gi|114766687|ref|ZP_01445626.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Roseovarius sp. HTCC2601] >gi|114541077|gb|EAU44132.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Roseovarius sp. HTCC2601] (315 aa)
Score = 326, Expect = 1.4e-28, Identities = 94/280 (33%), Positives = 143/280 (51%)
  Q:     8 PRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV  A      A  K  A +Y  HE      +VHNK ++  L + G           +  ++ +E    + P  VIFSAHG  +    +A ++ +V  D TC  V+K H       E G Q+  IG   HPETI T+    +  ++L+ETV D+ +++    + +    QTT+S+ +  +I   LK+++  I    K DIC A  +RQ+AV  +  + D LLVVG   S+NSK+LVE+  K     + L+   +NI          + +T+G S P  L + VI
  S:    12 PRGFCAGVDRAIKIVEMALEKWGAPVYVRHE------IVHNKFVVDGLRDKG-----------AVFVEELEDCPPDRP--VIFSAHGVPKAVPAEAAQREMVYVDATCPLVSKVHIEAARHHENGLQMIMIGHAGHPETIGTMGQLPEGEVLLVETVEDVAHVQVRDPEQLAFVTQTTLSVDDTIDIVAALKARFPAIVGPHKEDICYATTNRQEAVKAIAPDCDALLVVGAPNSSNSKRLVEVARKAGCSYAQLVQRAENIDWRALEGIASVGVTAGASAPEVLIDEVI 282
>gi|124267878|ref|YP_001021882.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Methylibium petroleiphilum PM1] >gi|124260653|gb|ABM95647.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Methylibium petroleiphilum PM1] (329 aa)
Score = 326, Expect = 1.5e-28, Identities = 88/280 (31%), Positives = 147/280 (52%)
  Q:     8 PRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV  A    ++      A +Y  HE      +VHN  ++ +L+  G                +I I+D  + P    ++FSAHG  +   D+A  +G  V+D TC  VTK H  + +  ++GY+   IG   HPE   T+  + + I L+E V+D+  +R      + V  QTT+S  +  EI   +K ++  +    + DIC A ++RQDAV  +  +VD+++VVG   S+NS +L E+  +    ++++ +  +++ EWF     + +T+G S P  L   VI
  S:    23 PRGFCAGVDRAIEIVERAIRKFGAPIYVRHE------IVHNTFVVNDLKAKG----------------AIFIEDLADVPPGATLVFSAHGVSRAVRDEAEARGFSVYDATCPLVTKVHVEVAKLHKEGYEFIMIGHKGHPEVEGTMGQLSEGIYLVEDVDDVAQLRVTRPDRLAVVTQTTLSTDDAAEILAAVKRRFPQVREPKQQDICYATQNRQDAVKVLAPQVDVVVVVGSPTSSNSNRLRELAERLGTPAYMVDSASDLRPEWFEGSARVGLTAGASAPELLVREVI 291
>gi|84393575|ref|ZP_00992328.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio splendidus 12B01] >gi|84375784|gb|EAP92678.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio splendidus 12B01] (314 aa)
Score = 326, Expect = 1.5e-28, Identities = 94/287 (32%), Positives = 154/287 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           MKI+   PRGFC GV  A +  ++  ++Y     Y+   +VHN+ +++ L++ G    ++ +          E+ D N   IVIFSAHG  Q    +A+E+ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S    + L+E   D++N+       +   +QTT+S+ E  ++ E L+  +  I+   K+DIC A ++RQDA+  M  +VD+++VVG   S+NS +L E+  K     +L    ++I+ EW   KK + +T+G S P  L N ++
  S:     1 MKIMLANPRGFCAGVDRAISIVERALEMY-QPPIYVRHEVVHNRFVVEGLKQRGAIFVEELS----------EVPDDN---IVIFSAHGVSQAVRKEAKERELTVFDATCPLVTKVHMEVARASRKHMEVVLIGHAGHPEVEGTMGQYASQTGGMYLVEKPEDVQNLVVNDPSNLLYVSQTTLSVDETADVIEELRRVFPEIQGPRKDDICYATQNRQDAIREMAGDVDVVIVVGSKNSSNSTRLKELAEKLGTPGYLTDCPEDIQTEWVEGKKKIGVTAGASAPEELVNQIL 279
>gi|86148419|ref|ZP_01066710.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio sp. MED222] >gi|85833773|gb|EAQ51940.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio sp. MED222] (314 aa)
Score = 326, Expect = 1.5e-28, Identities = 95/287 (33%), Positives = 154/287 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           MKI+   PRGFC GV  A +  ++  +LY     Y+   +VHN+ +++ L++ G    ++ +          E+ D N   IVIFSAHG  Q    +A+E+ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S    + L+E   D++N+       +   +QTT+S+ E  ++ E L+  +  I+   K+DIC A ++RQDA+  M  +VD+++VVG   S+NS +L E+  K     +L    ++I+ EW   KK + +T+G S P  L N ++
  S:     1 MKIMLANPRGFCAGVDRAISIVERALELY-QPPIYVRHEVVHNRFVVEGLKQRGAIFVEELS----------EVPDDN---IVIFSAHGVSQAVRKEAKERELTVFDATCPLVTKVHMEVARASRKHMEVVLIGHAGHPEVEGTMGQYASQAGGMYLVERPEDVQNLVVNDPSNLHYVSQTTLSVDETADVIEELRRVFPEIQGPRKDDICYATQNRQDAIREMAGDVDVVIVVGSKNSSNSTRLKELAEKLGTPGYLTDCPEDIQTEWVEGKKKIGVTAGASAPEELVNQIL 279
>gi|68536535|ref|YP_251240.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Corynebacterium jeikeium K411] >gi|68264134|emb|CAI37622.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Corynebacterium jeikeium K411] (328 aa)
Score = 326, Expect = 1.6e-28, Identities = 93/292 (31%), Positives = 150/292 (51%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           K+    PRG+C GV  A  + +K      A LY   E      +VHNK ++K  E+ G+   D+ +          EI   +N   V+FSAHG      ++AR+  L  FD TC  VTK H  +    +QGYQI  IG + H E   T      ++ L++  +D+  +       +   +QTT+S+ E     + L+ K+ +I+    +DIC A ++RQ AV  +  +V+L++VVG   S+NSK+LVE+ ++   + +HL+   + +   W      + +TSG S P  L   V+  L +K
  S:    17 KVYLAAPRGYCAGVDRAVESVEKALEKHGAPLYVRKE------IVHNKHVVKTFEDRGVIFVDETS----------EIPRGSN---VVFSAHGVSPAVHEEARQLELKTFDATCPLVTKVHHEVTRFAKQGYQIILIGHHGHEEVEGTAGEAPDVVHLVDGEDDVNALEFPEGTKLVWLSQTTLSVDETMTTVKQLREKFPHIQDPPSDDICYATQNRQVAVKAIAPKVELMIVVGSQNSSNSKRLVEVALQHGTQDAHLVDYAEQVDPAWLEGVTHVGVTSGASVPEILVRGVLELLAEK 298
>gi|116331384|ref|YP_801102.1| penicillin tolerance protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116125073|gb|ABJ76344.1| Penicillin tolerance protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (332 aa)
Score = 325, Expect = 1.8e-28, Identities = 87/290 (30%), Positives = 158/290 (54%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESE--KPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINK--KCLAITSGCSTPTWLANYVIIFLE 291
           KI    PRGFC GV  A +  +++ +       Y+   +VHN+ +++++++ GI   +D             + +  +   VIFSAHG     ++ A+++G+ + D TC  VT+ H   + KI+  +QI YIG   H E I T+  +  + L+E+ ND+  ++ + +  KP+    QTT+SI + + I + +   +  +E   K+DIC A  +RQ+AV +M + +D +LV+G   S+NS +L+++  K +  S  +    ++  E+  N     L +T+G STP  L + +I  L+
  S:    24 KIYLANPRGFCAGVKYAISYVEQV-QANSKERIYVRKEIVHNRRVVEDMKKRGILFIND-------------LDEAPDGATVIFSAHGVAPSVVEAAKQRGMKIGDATCPLVTRVHRKAR-KIKDTHQIIYIGHQGHDEAIGTMG-EAEMFLVESPNDVIALKDKIDLNKPLTYLMQTTLSIADTKNIVDQISKTFPFVEHPVKDDICYATTERQEAVSSMMNHIDAMLVIGADNSSNSLRLLQLAQKSKPNSFKVTGADDLSKEYIQNNGIGILGLTAGASTPQVLVDEIIFKLK 303
>gi|85714347|ref|ZP_01045335.1| LytB protein [Nitrobacter sp. Nb-311A] >gi|85698794|gb|EAQ36663.1| LytB protein [Nitrobacter sp. Nb-311A] (320 aa)
Score = 325, Expect = 1.9e-28, Identities = 92/279 (32%), Positives = 139/279 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSI-EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           +KI+  +PRGFC GVV A  T ++   LY     Y+   +VHN+ ++  L   G           +  ++ + EI D    P+V FSAHG  +     A+ +     D TC  VTK H       ++G++I  IG ++HPE + T+      ++ LIET  D E    +    +    QTT+SI +  EI   LK ++ NI    K DIC A  +RQ AV  +   VD L+VVG   S+NS++L E+  ++  + S L     ++    F     L IT+G S P
  S:     7 LKIVLCSPRGFCAGVVRAIDTVERALTLY-GAPVYVRHEIVHNRYVVDSLRAKG-----------AIFVEELAEIPDDTTAPVV-FSAHGVPKSVPADAQRRNFFSLDATCPLVTKVHREAAIHFKRGHEILLIGHSHHPEVVGTVGQLPAGAVTLIETAEDAEKFTPKDVDNLAFVTQTTLSIDDTAEIVAVLKQRFPNIHGPHKEDICYATTNRQLAVKKVAPVVDALIVVGAPNSSNSQRLREVAEREGCKVSVLAQRASDLDWSMFEGITSLGITAGASAP 278
>gi|116328163|ref|YP_797883.1| penicillin tolerance protein [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116120907|gb|ABJ78950.1| Penicillin tolerance protein [Leptospira borgpetersenii serovar Hardjo-bovis L550] (332 aa)
Score = 324, Expect = 2.6e-28, Identities = 86/290 (29%), Positives = 158/290 (54%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESE--KPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINK--KCLAITSGCSTPTWLANYVIIFLE 291
           KI    PRGFC GV  A +  +++ +       Y+   +VHN+ +++++++ GI   +D             + +  +   V+FSAHG     ++ A+++G+ + D TC  VT+ H   + KI+  +QI YIG   H E I T+  +  + L+E+ ND+  ++ + +  KP+    QTT+SI + + I + +   +  +E   K+DIC A  +RQ+AV +M + +D +LV+G   S+NS +L+++  K +  S  +    ++  E+  N     L +T+G STP  L + +I  L+
  S:    24 KIYLANPRGFCAGVKYAISYVEQV-QANSKERIYVRKEIVHNRRVVEDMKKRGILFIND-------------LDEAPDGATVVFSAHGVAPSVVEAAKQRGMKIGDATCPLVTRVHRKAR-KIKDTHQIIYIGHQGHDEAIGTMG-EAEMFLVESPNDVIALKDKIDLNKPLTYLMQTTLSIADTKNIVDQISKTFPFVEHPVKDDICYATTERQEAVSSMMNHIDAMLVIGADNSSNSLRLLQLAQKSKPNSFKVTGADDLSKEYIQNNGIGILGLTAGASTPQVLVDEIIFKLK 303
>gi|114770097|ref|ZP_01447635.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [alpha proteobacterium HTCC2255] >gi|114548934|gb|EAU51817.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [alpha proteobacterium HTCC2255] (316 aa)
Score = 323, Expect = 3.2e-28, Identities = 96/287 (33%), Positives = 147/287 (51%)
  Q:     8 PRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKL 294
           PRGFC GV  A      A  K  A ++  HE      +VHNK ++ EL   G           +  ++++E    + P  VIFSAHG  +    +A  + +V  D TC  V+K H   +     G Q+  IG   HPETI T+       ++L+ET  D+  I   + + +    QTT+S+ +  EI + LK+++ +I    K DIC A  +RQ+AV  +  +VD LLV+G   S+NSK+LVE+G     + S ++    +I        K + IT+G S P  L N VI+ +  + 
  S:    13 PRGFCAGVDRAIKIVEMAIEKWGAPIFVRHE------IVHNKYVVDELRSKG-----------AIFVETLEECPSDRP--VIFSAHGVPKSIPAEASARKMVFVDATCPLVSKVHIEAERHYSNGLQMVMIGHEGHPETIGTMGQLPKGEVLLVETPEDVTKITPRNIEKLAYITQTTLSVDDTIEIVKKLKARFPSIVGPHKEDICYATTNRQEAVKAVSPKVDALLVIGAPNSSNSKRLVEVGKSSGCKYSQMVQRASDIDWRALKGAKSIGITAGASAPEILINEVILAISSRF 290
>gi|56698039|ref|YP_168410.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Silicibacter pomeroyi DSS-3] >gi|71152195|sp|Q5LNJ7|ISPH_SILPO 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|56679776|gb|AAV96442.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Silicibacter pomeroyi DSS-3] (316 aa)
Score = 323, Expect = 3.2e-28, Identities = 93/280 (33%), Positives = 139/280 (49%)
  Q:     8 PRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV  A      A  K  A +Y  HE      +VHNK ++  L   G           +  ++ ++    + P  VIFSAHG  +    +A  + +V  D TC  V+K H   +   E G QI  IG   HPETI T+    +  ++L+ETV D+  I       +    QTT+S+ +  +I   L++++  I    K DIC A  +RQ+AV  +  + D LLVVG   S+NS++LVE+  K     + L+    +I          +A+++G S P  L N VI
  S:    13 PRGFCAGVDRAIKIVEMAIEKWGAPVYVRHE------IVHNKFVVDGLRAKG-----------AVFVEELDECPDDRP--VIFSAHGVPKAIPAEAERRQMVYVDATCPLVSKVHIEAERHAEHGLQIIMIGHRGHPETIGTMGQLPEGEVLLVETVADVARIAVRDPARLAFVTQTTLSVDDTRDIVAALQARFPQIVGPHKEDICYATTNRQEAVKAVAPKSDALLVVGAPNSSNSRRLVEVAAKAGCSYAQLVQRADDIDWRALDGIATIAVSAGASAPELLVNEVI 283
>gi|67153821|ref|ZP_00415566.1| LytB protein [Azotobacter vinelandii AvOP] >gi|67087954|gb|EAM07420.1| LytB protein [Azotobacter vinelandii AvOP] (315 aa)
Score = 323, Expect = 3.9e-28, Identities = 90/287 (31%), Positives = 147/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M I    PRGFC GV  A     +  +     +Y  HE      +VHNK ++ +L   G                +I +++ +  P   IVIFSAHG  Q    +A  +GL VFD TC  VTK H  +     +G +   IG   HPE + T+     +   +I L+E   D+  ++  +   +    QTT+S+ +   + + L++++  I    ++DIC A ++RQDAV  +  E  L+LVVG   S+NS +L E+     + ++L+   ++++ EWF   + + +T+G S P  L   VI
  S:     1 MHIKLANPRGFCAGVDRAIEIVNRALEVFGPPIYVRHE------VVHNKFVVDDLRSRG----------------AIFVEELDQVPDNVIVIFSAHGVSQAVRQEAARRGLKVFDATCPLVTKVHMEVARYSREGRECILIGHQGHPEVVGTMGQYDTANGGAIYLVEDEEDVARLQVRNPVSLAFVTQTTLSMDDAARMIDALRARFPGIGGPRRDDICYATQNRQDAVRQLAGECQLVLVVGSSSSSNSNRLRELAESIGVPAYLVDGAQDLRREWFDGIRRVGVTAGASAPEVLVRDVI 280
>gi|119715315|ref|YP_922280.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nocardioides sp. JS614] >gi|119535976|gb|ABL80593.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nocardioides sp. JS614] (354 aa)
Score = 322, Expect = 4.2e-28, Identities = 88/291 (30%), Positives = 145/291 (49%)
  Q:     3 IIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           ++   PRG+C GV  A  T +K   LY     Y+   +VHNK ++ +LE  G                +I +++ +  P    V+FSAHG   +   +A E+ L   D TC  VTK H   K    + Y I  IG   H E   T       I L++   D+ NI+    K +   +QTT+S+ E  E  + ++ ++ ++     +DIC A ++RQ AV  +  + DL++VVG   S+NS +LVE+ ++     +H + +   I + W    + +++TSG S P  L   V+ FL ++
  S:    41 VLLAAPRGYCAGVDRAVITVEKALDLY-GAPVYVRKQIVHNKHVVADLESRG----------------AIFVEELDEVPEGQTVVFSAHGVSPEVHRQAEERSLKTIDATCPLVTKVHHEAKRFATEDYDILLIGHAGHEEVEGTAGEAPGHIQLVQGPADVPNIKVRDPKRVAWLSQTTLSVDETLETVDAIRERFPDLLDPPSDDICYATQNRQLAVKEIARDSDLVIVVGSGNSSNSVRLVEVALEAGARAAHRVDDASEIDEAWLDGVRTVSVTSGASVPEALVQGVLSFLGER 321
>gi|32491041|ref|NP_871295.1| hypothetical protein WGLp292 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|31340179|sp|Q8D2R2|ISPH_WIGBR 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|25166247|dbj|BAC24438.1| lytB [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (315 aa)
Score = 322, Expect = 4.3e-28, Identities = 93/291 (31%), Positives = 151/291 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           M I    PRGFC GV  A    K   ++Y     Y+   +VHNK ++  L+++G              I   +I D     I+IFSAHG  +  + +A ++ L++FD TC  V+K H  IK   +   ++  IG  NHPE I T+    + +K + +I+++ +I  ++ +    +F   QTT+S+ +  +I   +K KY  I    K DIC A ++RQ ++  +   VD++ ++G   S+NS +L EI  K   +S+LI   K IK  W      + IT+G S P  L   V+ +L+
  S:     1 MNIFLANPRGFCAGVDRAINIVKNAIEIY-GPPIYVYNEVVHNKYVVNSLKKIGS-------------IFVKKICDVPEKSILIFSAHGVSKSILKEANKRKLIIFDATCPLVSKVHHEIKRASKLRSEVIIIGHKNHPEIIGTIGQYNNPNKKVFVIQSIEEICKLKIKDPNNLFYFTQTTLSVDDTNKIIFAIKKKYPYIIEPRKKDICYATENRQKSIKKIIKLVDIIFIIGSKNSSNSNRLFEIANKSGKKSYLIDTYKEIKKSWLNGVNNIGITAGASAPEILVQQVVNYLK 283
>gi|84701738|ref|ZP_01016313.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Parvularcula bermudensis HTCC2503] >gi|84690984|gb|EAQ16824.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Parvularcula bermudensis HTCC2503] (315 aa)
Score = 322, Expect = 4.3e-28, Identities = 96/285 (33%), Positives = 148/285 (51%)
  Q:     8 PRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEI--------GIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTP-TWLANYVIIFLEK 292
           PRGFC GV  A    ++      A +Y  HE      +VHN+ +++ L  LG    D+     SE+ D        + P V+FSAHG  +    +A  + L+  D TC  V+K H         G  +  IG   HPE I T+    D ++ LIET  D      E  +P+    QTT+S+ +   I E LK+++ +I+   K+DIC A  +RQ+AV  + ++ D L VVG   S+NSK+LVE+        G+  + E+ + W          ++ + +A+T+G S P T + N V  F E+
  S:    14 PRGFCAGVDRAILMVERAIDRYGAPVYVRHE------IVHNETVVRRLRALGAVFVDE----LSEVPD--------DAP-VLFSAHGVPKTVPAEAERRQLLYLDATCPLVSKVHIESDRHHRNGCHVLLIGHEGHPEVIGTMGQLPDGAMTLIETEEDAHRFAAEG-RPVAYVTQTTLSVDDTARIVEILKARFPDIQTPIKDDICYATTNRQEAVKILAADADALFVVGSETSSNSKRLVEVGKAAGCPYGVLIEDETRIDWPAVEA-----LSPRIIALTAGASAPETVVQNVVDAFRER 291
>gi|41408782|ref|NP_961618.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium avium subsp. paratuberculosis K-10] >gi|50400912|sp|Q73WH6|ISPH_MYCPA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|41397140|gb|AAS05001.1| LytB' [Mycobacterium avium subsp. paratuberculosis K-10] (332 aa)
Score = 321, Expect = 5.3e-28, Identities = 88/286 (30%), Positives = 141/286 (49%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEI-GIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRG+C GV  A  T ++  +     +Y  HE      +VHN+ ++  LE+ G                ++ +++ +  P   IV+FSAHG        A E+ L   D TC  VTK H+  +      Y I  IG   H E + T       + L++ V  ++N+R   E  +   +QTT+S+ E  EI E L+ ++  ++    +DIC A ++RQ AV  M  E DL++VVG   S+NS +LVE+        +HL+    +I   W      + +TSG S P  L   V+
  S:    24 RVLLAEPRGYCAGVDRAVETVERALEKHGPPVYVRHE------IVHNRHVVSTLEKAG----------------AVFVEETDEVPEGAIVVFSAHGVAPTVHAAAAERNLHTIDATCPLVTKVHNEARRFARNDYDILLIGHEGHEEVVGTAGEAPDHVQLVDGVAAVDNVRVRDEDKVVWLSQTTLSVDETMEIVERLRQRFPKLQDPPSDDICYATQNRQVAVKAMAPECDLVIVVGSRNSSNSVRLVEVALGGGAGAAHLVDWADDIDPAWLEGVTTVGVTSGASVPEVLVQGVL 299
>gi|85373139|ref|YP_457201.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Erythrobacter litoralis HTCC2594] >gi|84786222|gb|ABC62404.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Erythrobacter litoralis HTCC2594] (325 aa)
Score = 321, Expect = 6.3e-28, Identities = 90/295 (30%), Positives = 147/295 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKS--IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           + ++   PRGFC GV  A    ++      A +Y  HE      +VHNK ++  L E G    ++ +    E+ D +          V+FSAHG  +    +A  + L+  D TC  V+K H   + +IE+   I +IG   HPE + T+   ++  + L+ETV D+  +   ++  +    QTT+S+ +  EI   L+++Y  I      DIC A  +RQ AV  +    DL+LV+G   S+NS +LVE+  +   ++ LI    +I   W      + +T+G S P  L   V+    +KLG
  S:    18 LSLLIAAPRGFCAGVDRAIDIVERALDKYGAPVYVRHE------IVHNKYVVDALREKGAIFVEELD----EVPDGVP---------VVFSAHGVPKSVPAEADRRQLLYVDATCPLVSKVHRQAERQIEKDRHIVFIGHAGHPEVVGTMGQVEAGQMTLVETVEDVAALPFGADDKLAYLTQTTLSVDDTAEIIAALEARYPEIAGPKAEDICYATSNRQAAVKRIAPGSDLVLVIGATNSSNSLRLVEVAERLGTKAKLIQRADDIDPAWLEGVGTIGLTAGASAPELLVREVV----EKLG 298
>gi|39937331|ref|NP_949607.1| hydroxymethylbutenyl pyrophosphate reductase [Rhodopseudomonas palustris CGA009] >gi|50400883|sp|Q6N1Y1|ISPH2_RHOPA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 2 >gi|39651189|emb|CAE29712.1| penicillin tolerance protein (lytB) , control of stringent response [Rhodopseudomonas palustris CGA009] (320 aa)
Score = 320, Expect = 7.0e-28, Identities = 90/279 (32%), Positives = 138/279 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           +KI+  +PRGFC GVV A  T ++   LY     Y+   +VHNK ++  L   G    ++            EI D   P  V+FSAHG  +   + A  +     D TC  VTK H       ++G +I  IG ++HPE + TL      ++ LIET  D E  + +    +    QTT+SI +   I   L+ ++ NI    K DIC A  +RQ AV  +   VD ++VVG   S+NS++L E+  ++  + + L+    ++    F   K L +T+G S P
  S:     7 LKIVLCSPRGFCAGVVRAIDTVERALALY-GAPVYVRHEIVHNKYVVDSLRAKGAIFVEELE----------EIPDTKAP--VVFSAHGVPKSVPEHALSRNFFSIDATCPLVTKVHREAAIHFKRGREILLIGHSHHPEVVGTLGQLPAGAVTLIETAADAEAYQPKDPNNLAFVTQTTLSIDDTAGIVTVLRERFPNISGPHKEDICYATTNRQAAVKKVAPVVDAMIVVGAPNSSNSQRLREVAEREGCKVAVLVQRASDLDWSQFEGIKVLGLTAGASAP 277
>gi|85001303|ref|XP_955370.1| lytB protein, putative [Theileria annulata] >gi|65303516|emb|CAI75894.1| lytB protein, putative [Theileria annulata] (318 aa)
Score = 320, Expect = 7.4e-28, Identities = 84/260 (32%), Positives = 138/260 (53%)
  Q:    28 LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +Y  HE      +VHN+ +   L   G+                I I+D N  P   I+I+SAHG   +  + AR + LV  D +C  V K H  +K K ++GY+I  IG  NH E I T     +++ ++E V D+E +       ++   QTT+S+ + ++I E L  KY  IE      IC A  +RQ A+  +   VDL+L+VG   S+N+K+LVE  + + I S+L+++  ++ +E   + + +A++S  STP  L + V+
  S:    46 IYVKHE------IVHNEAVCNRLRARGV----------------IFIEDLNLVPEKSILIYSAHGVSPEVKEMARARNLVEIDASCPLVNKVHVYVKNKAKEGYKIILIGHKNHQEIIGTSGEAPEAVTVVENVADVEALDYPEGTKLYYVTQTTLSLDDCKDIKEALVKKYPQIETIPSGSICYATTNRQTAIHKVTKLVDLVLIVGSTLSSNAKRLVEAALNRNIRSYLVFDANDVTEELVGSARNIALSSSASTPEDLTSAVL 289
>gi|114799593|ref|YP_761393.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Hyphomonas neptunium ATCC 15444] >gi|123322986|sp|Q0BYQ0|ISPH_HYPNA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|114739767|gb|ABI77892.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Hyphomonas neptunium ATCC 15444] (315 aa)
Score = 320, Expect = 7.9e-28, Identities = 90/280 (32%), Positives = 139/280 (49%)
  Q:     8 PRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV  A    ++  K     +Y  HE      +VHN+ +++ LE LG           +  ++ +E    + P  VIFSAHG  +    +A  + ++  D TC  V+K H   +       +I  IG   HPE I T+    + S+ LIETV D    +      +    QTT+S+ +  +I   L+S++  I    K DIC A  +RQ+AV       +L+LV+G   S+NS +LVE+ ++   + + LI +  +I   WF     L +T+G S P  L   VI
  S:    14 PRGFCAGVDRAIQIVEEALKKWGAPVYVRHE------IVHNRHVVERLEALG-----------AIFVEELEECPDDRP--VIFSAHGVPKSVPAEAGRRNMIYVDATCPLVSKVHVEAERHFNAAREIVLIGHAGHPEVIGTMGQLPEGSVALIETVEDARAFQPRDHANLAFITQTTLSVDDTADIVAALQSRFPGIATPHKEDICYATTNRQEAVKVFAPGAELVLVIGARTSSNSVRLVEVALRAGAQDAKLIASADDIDWSWFNGITTLGLTAGASAPEDLVQGVI 284
>gi|15616767|ref|NP_239979.1| LytB protein [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11133461|sp|P57247|ISPH_BUCAI 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|25303490|pir||A84947 lytB protein [imported] - Buchnera sp. (strain APS) >gi|10038830|dbj|BAB12865.1| lytB protein [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (319 aa)
Score = 320, Expect = 7.9e-28, Identities = 99/292 (33%), Positives = 152/292 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIE-IKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           M II   PRGFC GV  A    +   K+Y     Y+   LVHN+ +I  L + G+             ++ IE I D +   +VIFSAHG  +K + +A +K L++ D TC  V K H  + +  E+  +   IG   HPE   T+    + +  I L+E++ D+ N+  ++ K +    QTT+SI   ++I   LK+K+  I   N  DIC A  +RQ AV  +    D++ V+G   S+NS +L E+G +    + LI +  +IK +W  N   + IT+G S P  L   VI +L K
  S:     1 MNIILTNPRGFCAGVKRAILIVENALKVY-KKTIYIRHELVHNQYVINTLRQKGVV-----------FVEKIEQIPDYS---VVIFSAHGVSKKVVQEAVKKKLIILDATCPLVEKVHIEVSKSSEKAIETILIGHRGHPEVEGTIGQYNNKNGKIYLVESIEDVHNLSVQNSKKLNFFTQTTLSITNTKKIIAALKNKFPEISGPNKEDICYATTNRQIAVRQLSKIADIIFVIGSNNSSNSNRLAELGKETGTFTKLISSFLDIKKKWLKNVNYIGITAGASAPEILVTEVIQYLRK 284
>gi|54026769|ref|YP_121011.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nocardia farcinica IFM 10152] >gi|71152191|sp|Q5YQ94|ISPH_NOCFA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|54018277|dbj|BAD59647.1| putative isoprenoid biosynthesis protein [Nocardia farcinica IFM 10152] (336 aa)
Score = 319, Expect = 9.4e-28, Identities = 87/289 (30%), Positives = 142/289 (49%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFL 290
           +++   PRG+C GV  A  T +K      A +Y   E      +VHN+ +++ L E G+   DD          + E+ +     +V+FSAHG      + A  + L   D TC  VTK H   K      Y I  IG   H E   T     + + L++  + ++ +R   E  +   +QTT+S+ E  E  + L+ ++ +++    +DIC A ++RQ AV  M  E DL++VVG   S+NS +LVE+ +    + +HL+   + +   W    + + ITSG S P  L   V+  L
  S:    27 RVLLAEPRGYCAGVDRAVETVEKALEKHGAPIYVRKE------IVHNRHVVETLRERGVVFVDD----------TAEVPEG---AVVVFSAHGVSPAVHEAAAARNLHTIDATCPLVTKVHQEAKRFARDDYDILLIGHEGHEEVEGTAGEAPEHVQLVDGPDAVDRVRVRDENKVIWLSQTTLSVDETMETVQRLRERFPSLQDPPSDDICYATQNRQVAVKAMAPECDLVIVVGSRNSSNSVRLVEVALNAGAKAAHLVDYAREVDPAWLEGVRTIGITSGASVPEILVRGVLDML 305
>gi|158320594|ref|YP_001513101.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Alkaliphilus oremlandii OhILAs] >gi|166973794|sp|A8MFE2|ISPH_ALKOO 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|158140793|gb|ABW19105.1| hydroxymethylbutenyl pyrophosphate reductase [Alkaliphilus oremlandii OhILAs] (279 aa)
Score = 319, Expect = 1.0e-27, Identities = 88/287 (30%), Positives = 149/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHL-IWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           MK++     GFC GV  A  T  K  +   + + Y +G L+HN+++I  LEE GI+   D N  +  +              VI  +HG  +     A EK + + D TC +V K  ++++E  ++GY I  IG  +HPE I      D +  +++  +D+  I       + +  QTTIS   + E+T  ++ K  N+   N IC+A +DRQ++  N+  EVD++++VG   S+N++KLVEI  +++ ++   I     I      N + + +T+G STP W+ + VI
  S:     1 MKVVVADHSGFCFGVEKAIDTAFKELEYKDSKDIYTLGPLIHNQQVISHLEENGIKVVSDLNSGKDGV--------------VIIRSHGVPKDVYKDASEKKIDLVDATCPFVRKIQNIVEEYQKKGYHIVIIGDPSHPEVIGINGWCDNTAHIVKNEDDVHRIPFLDN--LCIVAQTTISTSLYTELTAMIEQKSNNVLKFNTICSATRDRQNSARNLAKEVDVMIIVGGYHSSNTQKLVEICKQEKPDTTFHIETAGEIPMNILKNYESVGVTAGASTPKWIIDEVI 273
>gi|85705119|ref|ZP_01036219.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Roseovarius sp. 217] >gi|85670441|gb|EAQ25302.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Roseovarius sp. 217] (316 aa)
Score = 319, Expect = 1.1e-27, Identities = 91/280 (32%), Positives = 137/280 (48%)
  Q:     8 PRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV  A      A  K  A +Y  HE      +VHNK ++ +L   G           +  ++ ++    + P  VIFSAHG  +    +A  + ++  D TC  V+K H   +   E G QI  IG   HPET+ T+       ++L+ET  D+  +       +    QTT+S+ +  E+   L++++  I    K DIC A  +RQ+AV  M    + +LVVG   S+NSK+LVE+G +     S L+    +I          + IT+G S P  L N VI
  S:    13 PRGFCAGVDRAIKIVEMALAKWGAPVYVRHE------IVHNKYVVDDLRAKG-----------AVFVEELDECPTDRP--VIFSAHGVPKSVPSEAAARQMLYVDATCPLVSKVHIEAERHHENGLQIVMIGHAGHPETVGTMGQLPTGEVLLVETPADVATLAVRDAARLAFVTQTTLSVDDTAEVVAALQARFPAIVGPHKEDICYATTNRQEAVKAMAERAEAMLVVGAPNSSNSKRLVEVGARAGCTYSQLVQRATDIDWRALDGIASIGITAGASAPEVLVNEVI 283
>gi|159036480|ref|YP_001535733.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salinispora arenicola CNS-205] >gi|157915315|gb|ABV96742.1| hydroxymethylbutenyl pyrophosphate reductase [Salinispora arenicola CNS-205] (328 aa)
Score = 318, Expect = 1.5e-27, Identities = 86/292 (29%), Positives = 139/292 (47%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIES-HLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           +++   PRG+C GV  A  T ++  KLY     Y+   +VHN+ +++ LE  G                +I +++    P    V+FSAHG   +  ++AR + L   D TC  VTK H   K    Q Y I  IG   H E + T     + I L++   D + +       +   +QTT+S+ E  E    LK +   ++    +DIC A  +RQ  V  +  + D+++VVG   S+NS +LVE+ +     + HL+   + I D W    + + +TSG S P  L   V+  L  +
  S:    13 RVLLAKPRGYCAGVDRAVQTVEEALKLY-GAPIYVRKQIVHNRHVVRTLEAKG----------------AIFVEENEEVPEGATVVFSAHGVAPEVHEQARARSLKSIDATCPLVTKVHQEAKRFAAQDYDILLIGHEGHEEVVGTSGEAPEHIQLVDGPEDADQVTVRDPDKVVWLSQTTLSVDETLETVARLKKRLPLLQSPPSDDICYATSNRQHVVKQIAPDCDVMIVVGSTNSSNSVRLVEVALDAGARAGHLVDFAREIDDAWLDGARTVGLTSGASVPEELVQEVLAHLAAR 294
>gi|167648346|ref|YP_001686009.1| hydroxymethylbutenyl pyrophosphate reductase [Caulobacter sp. K31] >gi|167350776|gb|ABZ73511.1| hydroxymethylbutenyl pyrophosphate reductase [Caulobacter sp. K31] (323 aa)
Score = 317, Expect = 1.7e-27, Identities = 83/287 (28%), Positives = 149/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI-ESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           ++++  +PRGFC GV  A    ++      A ++  HE      +VHN+ ++  L+ LG           +  ++ ++   ++ P  V+FSAHG  +     A+ + ++  D TC  V+K H   ++  + G +I  IG   HPE + T+    + ++ LIE ++D      +    +    QTT+S+ +  E+ + LK ++  I    K DIC A  +RQ+AV  +    DL+LVVG   S+NS +L+E+G +    ++ LI + + I   WF   + + +T+G S P  L   V+
  S:    15 LRVVLASPRGFCAGVDRAIQIVERTIEKFGAPVFVRHE------IVHNRHVVDRLKALG-----------AVFVEELDEVPEDRP--VVFSAHGVPKTVPAAAKAREMIYLDATCPLVSKVHVEAQKHFDAGREIVLIGHAGHPEVVGTMGQLPEGTVTLIEDIDDAHAWIPKDPANVAFLTQTTLSVDDTAEMVDLLKQRFPGIAAPHKEDICYATTNRQEAVKMLAEVSDLILVVGSKNSSNSVRLMEVGKRAGARDARLIDDARGIDWSWFQGVERVGVTAGASAPEDLVQGVL 292
>gi|8928200|sp|Q9X781|ISPH_MYCLE 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (332 aa)
Score = 317, Expect = 1.7e-27, Identities = 87/292 (29%), Positives = 146/292 (50%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI-ESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           +++   PRG+C GV  A  T ++  +     +Y  HE      +VHN+ +++ LE  G                ++ +++ +  P   IVIFSAHG        A E+ L   D TC  VTK H+ +K      Y I  IG   H E I+T       + L++ +  ++ +    E  +   +QTT+S+ E   I E L+ ++  ++    +DIC A ++RQ AV  M  E +L++VVG   S+NS +LVE+ +      ++L+   K+I   W      + +TSG S P  L   V+ +L ++
  S:    24 RVLLAEPRGYCAGVDRAVETVERSLRKYGPPVYVRHE------IVHNRHVVETLERAG----------------AVFVEETDYVPEGAIVIFSAHGVAPTVYAAAAERNLRTIDATCPLVTKVHNEVKRFARNDYDILLIGHEGHEEVIATAGEAPTHVQLVDGLAAVQQVVVRDENKVVWLSQTTLSVDETMRIVERLRQRFPKLQDPPSDDICYATQNRQVAVKAMAPECELVIVVGSRNSSNSVRLVEVAMGSGAGAAYLVDWAKDIDPAWLAGVTTVGVTSGASVPDILVQGVLKWLAER 305
>gi|15828043|ref|NP_302306.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium leprae TN] >gi|4539094|emb|CAB39812.1| lytB homolog [Mycobacterium leprae] >gi|13093596|emb|CAC30893.1| LytB homolog [Mycobacterium leprae] (335 aa)
Score = 317, Expect = 1.7e-27, Identities = 87/292 (29%), Positives = 146/292 (50%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI-ESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           +++   PRG+C GV  A  T ++  +     +Y  HE      +VHN+ +++ LE  G                ++ +++ +  P   IVIFSAHG        A E+ L   D TC  VTK H+ +K      Y I  IG   H E I+T       + L++ +  ++ +    E  +   +QTT+S+ E   I E L+ ++  ++    +DIC A ++RQ AV  M  E +L++VVG   S+NS +LVE+ +      ++L+   K+I   W      + +TSG S P  L   V+ +L ++
  S:    27 RVLLAEPRGYCAGVDRAVETVERSLRKYGPPVYVRHE------IVHNRHVVETLERAG----------------AVFVEETDYVPEGAIVIFSAHGVAPTVYAAAAERNLRTIDATCPLVTKVHNEVKRFARNDYDILLIGHEGHEEVIATAGEAPTHVQLVDGLAAVQQVVVRDENKVVWLSQTTLSVDETMRIVERLRQRFPKLQDPPSDDICYATQNRQVAVKAMAPECELVIVVGSRNSSNSVRLVEVAMGSGAGAAYLVDWAKDIDPAWLAGVTTVGVTSGASVPDILVQGVLKWLAER 308
>gi|150390387|ref|YP_001320436.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Alkaliphilus metalliredigens QYMF] >gi|166973793|sp|A6TRF9|ISPH_ALKMQ 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|149950249|gb|ABR48777.1| hydroxymethylbutenyl pyrophosphate reductase [Alkaliphilus metalliredigens QYMF] (280 aa)
Score = 317, Expect = 1.7e-27, Identities = 93/287 (32%), Positives = 152/287 (52%)
  Q:     1 MKIIKITPRGFCKGVVDAYATC-KKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEI-GIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+++     GFC GV  A  T  K+I     N+  Y +G L+HN +++  LE  G+ TKD    S SEI D            VI  +HG  + T   A EK L + D TC +V K  ++++E   +GY+I  IG   HPE I      +     ++ + D++ I    +  I V  QTT+ I ++EE++  + +K   +E  N IC+A K+RQ++   +  EVD ++V+G   S+N++KLV I   +K ++++ I    ++  E   N   + IT+G STP W+ + V+
  S:     1 MELVIAKHAGFCFGVEKAINTAFKEIKNNQKNNSIYTLGPLIHNNQVVSSLESHGVYTKD----SISEIDDGS----------VIIRSHGVSKATYGLAEEKNLNIIDATCPFVKKIQNIVEEYFNKGYKIAIIGNPEHPEVIGINGWCNNEAYTVQQITDVDLIPKLDKVCIVV--QTTMPIVQYEELSTLISTKSNQVEQFNTICHATKERQESAKLVSQEVDAMIVIGGYHSSNTQKLVAICKEEKPLDTYHIETVVDLDLEALQNYNRIGITAGASTPIWIVDEVV 274
>gi|83945319|ref|ZP_00957667.1| LytB protein [Oceanicaulis alexandrii HTCC2633] >gi|83851153|gb|EAP89010.1| LytB protein [Oceanicaulis alexandrii HTCC2633] (314 aa)
Score = 317, Expect = 1.8e-27, Identities = 91/287 (31%), Positives = 142/287 (49%)
  Q:     7 TPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIES-HLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           +PRGFC GV  A    +K      A +Y  HE      +VHNK ++  LE +G                ++ +K+ +  P    V+FSAHG  Q+   +A  + ++  D TC  V+K H   +   + G +I  IG   HPE I T+    D  + LIETV D E    +    +    QTT+S+ +  +I   L+ ++  I    K DIC A  +RQ AV  +    DL+LVVG   S+NS +LVE+  +   ++  L+   + I   W    K + I++G S P  L   ++  L ++
  S:    13 SPRGFCAGVDRAIQIVEKALERYGAPVYVRHE------IVHNKHVVNRLEAMG----------------AVFVKELDECPDDRPVVFSAHGVPQRVPAEAARRNMLYVDATCPLVSKVHVEAQRHHKAGQEILLIGHAGHPEVIGTMGQLPDGVMHLIETVEDAETFVPKDPSNVAFVTQTTLSVDDTADIVAALQKRFPGIAAPHKEDICYATTNRQAAVKAIGEGADLVLVVGAPNSSNSVRLVEVAERAGAKTARLVQKAEEIDWSWLEGVKRIGISAGASAPEELVEGLLSALARR 290
>gi|117926703|ref|YP_867320.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Magnetococcus sp. MC-1] >gi|166973799|sp|A0LD71|ISPH_MAGSM 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|117610459|gb|ABK45914.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Magnetococcus sp. MC-1] (307 aa)
Score = 316, Expect = 2.1e-27, Identities = 88/290 (30%), Positives = 139/290 (47%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI--DKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFL 290
           M+I+   PRGFC GV  A A   K  +     +Y  HE      +VHN+ +++ L   G        H   EI D           + I+SAHG  +    +   + L + D TC  V K H   +      YQ+  IG   HPE   T+       + LI   +D+  +R  + + +    QTT+S+ E   +   LK+++  I+   K DIC A ++RQ+AV  +    DL+LV+G   S+NS +L E+  +    + LI N K+++ +W    + L IT+G S P  L   ++  L
  S:     1 MRILLAEPRGFCAGVDRAIAIVLKALEKFGPPIYVRHE------IVHNRWVVEHLRNQGAVFV----HELDEIPDG---------AVAIYSAHGVSKAVQAEGERRPLHILDATCPLVDKVHREAERLDHDHYQVLLIGHAGHPEVEGTMGQLQQARMKLISHPDDVAQLRLSNPQKVAYITQTTLSVDETRAMVAQLKARFPTIKEPAKEDICYATQNRQNAVKALAQASDLILVLGAPNSSNSNRLREVAEQHGCRAFLIENAKDVEIQWLEGVETLGITAGASAPEILVEELLAHL 280
>gi|115526125|ref|YP_783036.1| hydroxymethylbutenyl pyrophosphate reductase [Rhodopseudomonas palustris BisA53] >gi|115520072|gb|ABJ08056.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodopseudomonas palustris BisA53] (320 aa)
Score = 316, Expect = 2.6e-27, Identities = 89/279 (31%), Positives = 140/279 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           +KI+  +PRGFC GVV A  T ++   LY     Y+   +VHNK ++  L   G    ++ +          EI + + P  V+FSAHG  +   ++A  +     D TC  VTK H       ++G +I  IG ++HPE + TL    D ++ LIET  D    + +    +    QTT+SI +   I   L+ ++ NI    K DIC A  +RQ AV  +   VD ++VVG   S+NS++L E+  ++  + + L     +I  + F     L +T+G S P
  S:     7 LKILLCSPRGFCAGVVRAIDTVERALSLY-GAPVYVRHEIVHNKYVVDSLRAKGAIFVEELS----------EIPETDAP--VVFSAHGVPKDVPEEAHRRKFFSLDATCPLVTKVHREAAIHFKRGREILLIGHSHHPEVVGTLGQLPDGAVSLIETAADASAYQPKDPDNLAFVTQTTLSIDDTSGIVSILRKRFPNISGPHKEDICYATTNRQAAVKKVAPIVDAMIVVGAPNSSNSQRLREVAEREGCKIAVLAQRASDIDLKQFEGVTSLGLTAGASAP 277
>gi|84515153|ref|ZP_01002516.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Loktanella vestfoldensis SKA53] >gi|84511312|gb|EAQ07766.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Loktanella vestfoldensis SKA53] (316 aa)
Score = 315, Expect = 2.7e-27, Identities = 93/280 (33%), Positives = 138/280 (49%)
  Q:     8 PRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELG---IQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV  A      A  K  A +Y  HE      +VHNK ++  L + G   ++  DD    R                 VIFSAHG  +     A ++ ++  D TC  V+K H   +   + G Q+  IG   HPETI T+    +  ++L+ETV D+  ++      +    QTT+S+ +   I   L++++  I    K DIC A  +RQ+AV  M  + D +LVVG   S+NS++LVE+G +     S L+    +I          + IT+G S P  L N VI
  S:    13 PRGFCAGVDRAIKIVEMAIQKWGAPVYVRHE------IVHNKFVVDALRDQGAVFVEELDDCPDDRP----------------VIFSAHGVPKAVPAAAAKREMIYVDATCPLVSKVHIEAQRHADNGLQMIMIGHEGHPETIGTMGQLPEGEVLLVETVADVATVQVRDPARLAFVTQTTLSVDDTAGIVAALQARFPAIIGPHKEDICYATTNRQEAVKAMAPKCDAMLVVGAPNSSNSRRLVEVGARAGCTYSQLVQRAADIDWRALDGIGSMGITAGASAPEVLINEVI 283
>gi|70943784|ref|XP_741896.1| LytB protein [Plasmodium chabaudi chabaudi] >gi|56520567|emb|CAH76602.1| LytB protein, putative [Plasmodium chabaudi] >gi|126583149|gb|ABO21667.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Plasmodium chabaudi] >gi|126583170|gb|ABO21668.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Plasmodium chabaudi] >gi|126583192|gb|ABO21669.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Plasmodium chabaudi] >gi|126583212|gb|ABO21670.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Plasmodium chabaudi] (359 aa)
Score = 315, Expect = 3.0e-27, Identities = 97/285 (34%), Positives = 145/285 (50%)
  Q:     6 ITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFL 290
           I PRGFCKGV  A  T ++  K +  +  Y+   +VHN  + K+LE  G                +I I+D N  P   I+I+SAHG   +  + A++K L+  D TC  V K H  +K K ++GY+I  IG  NH E + T +    S  ++E V  + N+     + +F+  QTT+SI +   I   LK KY +IE      IC A  +RQ A+  + +E DL +VVG   S+N+KKLV     +  ++ L+    +       N K +A+TS  STP  L    +  L
  S:    46 INPRGFCKGVSRAIETVEECLKTFKTN-IYVKHKIVHNDIVCKDLESKG----------------AIFIEDLNEVPDGSILIYSAHGISPQIRELAKKKKLIEIDATCPLVNKVHVYVKLKAKEGYKIILIGYKNHVEVVGTYNEAPDSTYIVENVEQVNNLNFPENQKLFLVTQTTLSIDDCSLIVNKLKEKYPHIETIPSGSICYATTNRQKALTKICTECDLTIVVGSQSSSNAKKLVYSSQIRNTDAILVNTVNDFDFSSLKNVKKIALTSAASTPDELTQQFVTVL 319
>gi|158317460|ref|YP_001509968.1| hydroxymethylbutenyl pyrophosphate reductase [Frankia sp. EAN1pec] >gi|158112865|gb|ABW15062.1| hydroxymethylbutenyl pyrophosphate reductase [Frankia sp. EAN1pec] (657 aa)
Score = 315, Expect = 3.0e-27, Identities = 84/297 (28%), Positives = 150/297 (50%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP--IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           +++   PR FC GV  A    ++  +++     Y+   +VHN  ++ +L   G    ++        +D +       PP   V+FSAHG      D+A E+ L V D TC  V K H   +    +G  +  IG + H E   TL      I L+E+   +E+I     + +    QTT+++ E EE+ + L+ ++  +      DIC A  +RQ+AV  + +E +L+LVVG   S+NS++LVE+  +  + +HL+ + ++++ +W    + + I++G S P  L   +   L   LG+A+
  S:   346 RLLLAEPRAFCAGVERAIEVVERALEIH-GAPVYVRKQIVHNTHVVADLASRGAVFVEE--------LDEV-------PPGATVVFSAHGVAPAIWDEAGERDLAVIDATCPLVEKVHAEARRFTARGDTVLLIGHSGHEEVDGTLGEAPGRIQLVESAAAVEDIEVADPERVTYLMQTTLAVDEAEEVVDALRDRFPAVVGPGSADICYATSNRQNAVRRVAAEAELVLVVGSENSSNSRRLVEVSERDGVAAHLVESVEDVQLDWLKGVRTVGISAGASAPPLLVEELTAALS-GLGSAS 630
>gi|110678676|ref|YP_681683.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Roseobacter denitrificans OCh 114] >gi|123065763|sp|Q16AJ6|ISPH_ROSDO 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|109454792|gb|ABG30997.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Roseobacter denitrificans OCh 114] (316 aa)
Score = 315, Expect = 3.0e-27, Identities = 89/280 (31%), Positives = 138/280 (49%)
  Q:     8 PRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV  A      A  K  A +Y  HE      +VHNK ++  L   G           +  ++ +     + P  VIFSAHG  +     A+ + LV  D TC  V+K H   +   + G Q+  IG   HPET+ T+    +  ++L+ET  D+  ++      +    QTT+S+ +  ++   L+ ++  I    K DIC A  +RQ+AV  M  + D +LVVG   S+NS++LVE+G +   + + L+    +I          + IT+G S P  L N VI
  S:    13 PRGFCAGVDRAIKIVELALDKWGAPVYVRHE------IVHNKFVVDGLRAKG-----------AIFVEELSECPDDRP--VIFSAHGVPKSVPTAAQARNLVYVDATCPLVSKVHIEAQRHADNGLQMIMIGHAGHPETVGTMGQLPEGEVLLVETPEDVATVKVRDPAKLAYVTQTTLSVDDTADVVHALQQRFPLIVGPHKEDICYATTNRQEAVKAMAPKCDAMLVVGAPNSSNSRRLVEVGARAGCQYAQLVQRATDIDWRALDGISSIGITAGASAPEVLINEVI 283
>gi|86739537|ref|YP_479937.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Frankia sp. CcI3] >gi|86566399|gb|ABD10208.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Frankia sp. CcI3] (497 aa)
Score = 314, Expect = 3.9e-27, Identities = 84/289 (29%), Positives = 137/289 (47%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFL 290
           +++   PR FC GV  A    ++  ++Y     Y+   +VHN  ++ +L             SR  I    E+ +      V+FSAHG      D+A E+GL V D TC  V K H   +    +G  +  IG + H E   TL      I L+E+  D+ ++     + +    QTT+++ E  E+ + L  ++  I      DIC A  +RQ+AV  +  E  L+LVVG   S NS +LVE+  +  +E+HL+ +  ++   W      + I++G S P  L N ++  L
  S:   183 QVLLAEPRAFCAGVERAIEVVERALEIY-GAPVYVRKQIVHNAHVVADLA------------SRGAIFVE-ELDEVPGGSTVVFSAHGVAPAVWDQAGERGLSVIDATCPLVEKVHTEARRFTARGDTVLLIGHSGHEEVDGTLGEAPGRITLVESSADVGSLDVPDPERVTYLMQTTLALDEAAEVVDALTERFPAIVGPGSTDICYATSNRQNAVRKVAEEAQLVLVVGSANSANSVRLVEVSRRDGVEAHLVGDVGDVHLSWLAGVDTIGISAGASAPPSLVNELLTAL 460
>gi|159042744|ref|YP_001531538.1| hydroxymethylbutenyl pyrophosphate reductase [Dinoroseobacter shibae DFL 12] >gi|157910504|gb|ABV91937.1| hydroxymethylbutenyl pyrophosphate reductase [Dinoroseobacter shibae DFL 12] (318 aa)
Score = 314, Expect = 4.1e-27, Identities = 94/280 (33%), Positives = 138/280 (49%)
  Q:     8 PRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV  A      A  K  A +Y  HE      +VHNK ++  L   G                ++ +K+ ++ P    VIFSAHG  +    +A  + +V  D TC  V+K H   +     G Q+  IG   HPET+ T+    D  +IL+ETV D+  I       +    QTT+S+ +  +I   L++++  I    K DIC A  +RQ AV  M  + D +LV+G   S+NSK+LVE+G       + L+   ++I          + IT+G S P  L N VI
  S:    13 PRGFCAGVDRAIKIVEMALEKWGAPVYVRHE------IVHNKYVVDGLRAKG----------------AVFVKELDDCPDDRPVIFSAHGVPKAVPAEATRREMVYVDATCPLVSKVHIEAERHHAGGLQMVMIGHAGHPETVGTMGQLPDGEVILVETVADVATITPRDPDKLAFITQTTLSVDDTADIVAALQARFPAIVGPHKEDICYATTNRQGAVKAMAPKADAMLVIGAPNSSNSKRLVEVGRSAGCAYAQLVQRAEDIDWRALEGISSIGITAGASAPEVLVNEVI 283
>gi|86748465|ref|YP_484961.1| hydroxymethylbutenyl pyrophosphate reductase [Rhodopseudomonas palustris HaA2] >gi|86571493|gb|ABD06050.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodopseudomonas palustris HaA2] (321 aa)
Score = 313, Expect = 4.5e-27, Identities = 93/279 (33%), Positives = 138/279 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKEL--------EELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           +KI+  +PRGFC GVV A  T ++   LY     Y+   +VHNK ++  L        EELG                  EI D   P  V+FSAHG  +   + A ++     D TC  VTK H       ++G +I  IG ++HPE + TL      ++ LIET  D ++   ++   +    QTT+SI +   I   L+ ++ NI    K DIC A  +RQ AV  +   VD ++VVG   S+NS++L E+  ++    S L     +I    F     L +T+G S P
  S:     7 LKIVLCSPRGFCAGVVRAIDTVERALALY-GAPVYVRHEIVHNKYVVDSLRAKGAIFVEELG------------------EIPDTRAP--VVFSAHGVPKSVPEDALQRNFFSVDATCPLVTKVHREAAIHFKRGREILLIGHSHHPEVVGTLGQLPPGAVTLIETAADAQSFTPKNPDNLAFVTQTTLSIDDTAGIVAILRQRFPNISGPHKEDICYATTNRQAAVKKVAPVVDAMIVVGAPNSSNSQRLREVAEREGCRVSVLAQRAADIDWAQFEGITSLGLTAGASAP 277
>gi|68172030|ref|ZP_00545320.1| LytB protein [Ehrlichia chaffeensis str. Sapulpa] >gi|88658611|ref|YP_507317.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ehrlichia chaffeensis str. Arkansas] >gi|67998548|gb|EAM85311.1| LytB protein [Ehrlichia chaffeensis str. Sapulpa] >gi|88600068|gb|ABD45537.1| hydroxymethylbutenyl pyrophosphate reductase [Ehrlichia chaffeensis str. Arkansas] (319 aa)
Score = 313, Expect = 4.8e-27, Identities = 102/294 (34%), Positives = 164/294 (55%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK-YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIR-TESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQ----IESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKL 294
           +++I   PRGFC GV  A    K   K + ++ K Y++  +VHNK II  L+E+G+             ID+++  +  +  I+I+SAHG  ++     +   L + D TC  V K H  ++   ++GYQI  IG   H E   T+  I   ++L++ ++DI+NI  T S+K  +VT QTT+S+ + +EI   LK K+ NI+  +  DIC A ++RQ AV  +   VD++ V+G   S+NS +L E+   K     I+S+   N   +KD   +NK  + IT+G S P  L   VI  L++ +
  S:     9 VEVILANPRGFCAGVSRAIEIVKLAVKYHSDNRKVYVLHEIVHNKYIINSLKEMGVI-----------FIDTLDQAEDGS--ILIYSAHGISKEIEHLGQSCNLEIIDATCPLVNKVHKEVQAYDKKGYQIILIGHKGHREVEGTMGQITNPVLLVQNLSDIDNIEVTNSDKLAYVT-QTTLSVDDTKEIINKLKQKFPNIKGPDLKDICYATQNRQTAVKQLSELVDIIFVLGSKNSSNSNRLKELAELKTPAFLIDSYQEINLDILKD---VNK--IGITAGASAPEILITEVIDLLKQHM 292
>gi|134299017|ref|YP_001112513.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Desulfotomaculum reducens MI-1] >gi|134051717|gb|ABO49688.1| hydroxymethylbutenyl pyrophosphate reductase [Desulfotomaculum reducens MI-1] (672 aa)
Score = 313, Expect = 5.0e-27, Identities = 89/279 (31%), Positives = 141/279 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDK---SIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           M+I   +  GFC GV  A       AK    +  Y +G L+HN ++++ L E GI           EI D  E+K+      VI  +HG   + I  AREKGL V D TC +V +      E   QG  ++ +G   HPE    L   +   S+I     N  E  R E  K + V  QTT  +  F+ + E L+++   ++ +N IC+A  +RQ A + +  EVD+++VVG   S N+KKL +I  +    ++ + + + ++ EWF+  + + +T+G STP
  S:     1 MRIKLASKAGFCYGVKRAIDLALSTAKEKAGN-IYTLGPLIHNPQVVQNLAENGI----------CEINDIGEVKEGT----VIIRSHGVGPEIIQAAREKGLKVLDATCPFVARAQKYAHEMAAQGIPVYILGDPGHPEVQGILGWTEGKGSVI----DNPSEITRVEHPK-VGVVAQTTQPLSNFQALLEALQNQGVEVDARNTICHATGERQRAAMELAREVDVMVVVGGKNSANTKKLAKICQETGTPTYHVESARELRKEWFLGHEIVGLTAGASTP 262
>gi|118616061|ref|YP_904393.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium ulcerans Agy99] >gi|166217175|sp|A0PKQ3|ISPH_MYCUA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|118568171|gb|ABL02922.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase IspH [Mycobacterium ulcerans Agy99] (332 aa)
Score = 312, Expect = 7.4e-27, Identities = 85/286 (29%), Positives = 141/286 (49%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRG+C GV  A  T ++  +     +Y  HE      +VHN+ ++  L + G                ++ +++ +  P   IV+FSAHG        A E+ L   D TC  VTK H+  +      Y I  IG   H E + T     + + L++ ++ +E +    E  +   +QTT+S+ E  EI   L+ ++  ++    +DIC A ++RQ AV  M  E DL+LVVG   S+NS +LVE+ +    E ++L+    +I   W      + +TSG S P  L   V+
  S:    24 RVLLAEPRGYCAGVDRAVETVERALEKHGPPVYVRHE------IVHNRHVVDTLAKAG----------------AVFVEETDQVPEGAIVVFSAHGVAPTVYAAAAERNLQTIDATCPLVTKVHNEARRFARNDYDILLIGHEGHEEVVGTAGEAPEHVQLVDGLDGVERVTIRDEDKVVWLSQTTLSVDETMEIVARLRQRFAKLQDPPSDDICYATQNRQVAVKAMAPECDLVLVVGSRNSSNSVRLVEVALGAGAEAAYLVDWADDIDQSWLQGVTTVGVTSGASVPEVLVRGVL 299
>gi|146278614|ref|YP_001168773.1| hydroxymethylbutenyl pyrophosphate reductase [Rhodobacter sphaeroides ATCC 17025] >gi|166217482|sp|A4WVQ4|ISPH_RHOS5 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|145556855|gb|ABP71468.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodobacter sphaeroides ATCC 17025] (319 aa)
Score = 311, Expect = 9.5e-27, Identities = 81/236 (34%), Positives = 123/236 (52%)
  Q:     8 PRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYK--NIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIG 243
           PRGFC GV  A      A  K  A +Y  HE      +VHNK ++  L ++G           +  ++ ++    + P  VIFSAHG  +    +A  + +V  D TC  V+K H   +   E G Q+  IG   HPETI T+    +  ++L+ETV D+  +     + +    QTT+SI +   I   L+ ++   NI  K DIC A  +RQ AV  +   ++ LLV+G   S+NS++LVE+G
  S:    13 PRGFCAGVDRAIKIVEMALEKWGAPVYVRHE------IVHNKFVVDRLRDMG-----------AVFVEELDEAPTDRP--VIFSAHGVPKSVPAEAERRNMVYVDATCPLVSKVHLEAERHHENGLQMIMIGHAGHPETIGTMGQLPEGEVLLVETVEDVAGLEVRDPERLAYITQTTLSIDDTAAIVAALRERFPAINIPRKEDICYATTNRQGAVKALSDRIEALLVIGAPNSSNSRRLVEVG 238
>gi|84494714|ref|ZP_00993833.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Janibacter sp. HTCC2649] >gi|84384207|gb|EAQ00087.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Janibacter sp. HTCC2649] (341 aa)
Score = 310, Expect = 1.3e-26, Identities = 86/292 (29%), Positives = 144/292 (49%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIES-HLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           +++   PRG+C GV  A  T +K   LY     Y+   +VHNK ++  LE+ G                +I +++ +  P    VIFSAHG      ++A+  GL   D TC  VTK H          + I  IG   H E + T     + I L+E  + ++ +       +   +QTT+S+ E  E    L+ K+  ++    +DIC A ++RQ AV +M  + DL++VVG   S+NS +LVE+ ++   ++ +L+     I++ W      + +TSG S P  L   V+ +L ++
  S:    11 RVLLAAPRGYCAGVDRAVVTVEKALDLY-GAPVYVRKEIVHNKHVVTTLEKRG----------------AIFVEETDEVPEGSTVIFSAHGVAPVVHEEAKALGLKTIDATCPLVTKVHREAVRFASDDFDILLIGHEGHEEVVGTAGEAPEHITLVEGPDSVDGVEVRDPDKVVWLSQTTLSVDETMETVRRLRQKFPLMQDPPSDDICYATQNRQLAVKHMAPDCDLMIVVGSRNSSNSVRLVEVALEHGSKAGYLVDYADEIEESWLDGVGTVGVTSGASVPELLVRGVLDYLAER 292
>gi|77462211|ref|YP_351715.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodobacter sphaeroides 2.4.1] >gi|123592958|sp|Q3J5X0|ISPH_RHOS4 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|77386629|gb|ABA77814.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodobacter sphaeroides 2.4.1] (319 aa)
Score = 309, Expect = 1.3e-26, Identities = 81/236 (34%), Positives = 122/236 (51%)
  Q:     8 PRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIG 243
           PRGFC GV  A      A  K  A +Y  HE      +VHNK ++  L ++G           +  ++ ++    + P  VIFSAHG  +    +A  + +V  D TC  V+K H   +   E G Q+  IG   HPET+ T+    +  ++L+ETV D+  +     + +    QTT+SI +   I   L+ ++  I    K DIC A  +RQ AV  +   +D LLV+G   S+NSK+LVE+G
  S:    13 PRGFCAGVDRAIKIVEMALEKWGAPVYVRHE------IVHNKFVVDRLRDMG-----------AVFVEELDEAPTDRP--VIFSAHGVPKAIPAEAERRNMVYVDATCPLVSKVHLEAERHHENGLQMIMIGHAGHPETVGTMGQLPEGEVLLVETVEDVAGLEVRDPERLAYITQTTLSIDDTAAIVAALRERFPAIAIPRKEDICYATTNRQGAVKAIAGRIDALLVIGAPNSSNSKRLVEVG 238
>gi|189023705|ref|YP_001934473.1| LytB protein [Brucella abortus S19] >gi|71152176|sp|Q57EP6|ISPH_BRUAB 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|189019277|gb|ACD71999.1| LytB protein [Brucella abortus S19] (346 aa)
Score = 309, Expect = 1.4e-26, Identities = 89/280 (31%), Positives = 137/280 (48%)
  Q:     8 PRGFCKGV-----VDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV     +   A  K  A +Y  HE      +VHN+ +++ L+  G    ++        +D I    +N P  V+FSAHG  +     A  K L   D TC  V+K H         G  +  IG + HPE I T+    D ++ LIETV D      + E  +    QTT+S+ +   I + L++++ N+       IC A  +RQDAV       DL L+VG   S+NSK+LVE+  K     S L+   ++I+ E   +   + +++G S P  + + +I
  S:    15 PRGFCAGVDRAIQIVVLALKKYGAPVYVRHE------IVHNRYVVEGLQARGAIFVEE--------LDEIPAAHRNQP--VVFSAHGVPKSVPADAEAKNLFYLDATCPLVSKVHKQAMRHQRLGRHVILIGHSGHPEVIGTMGQLPDGAVTLIETVEDAHTCHFDDEDNLGFVTQTTLSVDDTAGIIKELQARFPNLAAPAAESICYATTNRQDAVRAAAPGCDLFLIVGAPNSSNSKRLVEVAEKAGARMSMLVQRAEDIEWEQIGDISVVGLSAGASAPEIIVDEII 288
>gi|38258166|sp|Q8G257|ISPH_BRUSU 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (346 aa)
Score = 309, Expect = 1.4e-26, Identities = 89/280 (31%), Positives = 137/280 (48%)
  Q:     8 PRGFCKGV-----VDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV     +   A  K  A +Y  HE      +VHN+ +++ L+  G    ++        +D I    +N P  V+FSAHG  +     A  K L   D TC  V+K H         G  +  IG + HPE I T+    D ++ LIETV D      + E  +    QTT+S+ +   I + L++++ N+       IC A  +RQDAV       DL L+VG   S+NSK+LVE+  K     S L+   ++I+ E   +   + +++G S P  + + +I
  S:    15 PRGFCAGVDRAIQIVVLALKKYGAPVYVRHE------IVHNRYVVEGLQARGAIFVEE--------LDEIPAAHRNQP--VVFSAHGVPKSVPADAEAKNLFYLDATCPLVSKVHKQAMRHQRLGRHVILIGHSGHPEVIGTMGQLPDGAVTLIETVEDAHTCHFDDEDNLGFVTQTTLSVDDTAGIIKELQARFPNLAAPAAESICYATTNRQDAVRAAAPGCDLFLIVGAPNSSNSKRLVEVAEKAGARMSMLVQRAEDIEWEQIGDISVVGLSAGASAPEIIVDEII 288
>gi|20138620|sp|Q8YFR1|ISPH_BRUME 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|17983462|gb|AAL52640.1| LYTB PROTEIN [Brucella melitensis 16M] (346 aa)
Score = 309, Expect = 1.4e-26, Identities = 89/280 (31%), Positives = 137/280 (48%)
  Q:     8 PRGFCKGV-----VDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV     +   A  K  A +Y  HE      +VHN+ +++ L+  G    ++        +D I    +N P  V+FSAHG  +     A  K L   D TC  V+K H         G  +  IG + HPE I T+    D ++ LIETV D      + E  +    QTT+S+ +   I + L++++ N+       IC A  +RQDAV       DL L+VG   S+NSK+LVE+  K     S L+   ++I+ E   +   + +++G S P  + + +I
  S:    15 PRGFCAGVDRAIQIVVLALKKYGAPVYVRHE------IVHNRYVVEGLQARGAIFVEE--------LDEIPAAHRNQP--VVFSAHGVPKSVPADAEAKNLFYLDATCPLVSKVHKQAMRHQRLGRHVILIGHSGHPEVIGTMGQLPDGAVTLIETVEDAHTCHFDDEDNLGFVTQTTLSVDDTAGIIKELQARFPNLAAPAAESICYATTNRQDAVRAAAPGCDLFLIVGAPNSSNSKRLVEVAEKAGARMSMLVQRAEDIEWEQIGDISVVGLSAGASAPEIIVDEII 288
>gi|78043962|ref|YP_360744.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Carboxydothermus hydrogenoformans Z-2901] >gi|77996077|gb|ABB14976.1| hydroxymethylbutenyl pyrophosphate reductase/ribosomal protein S1 [Carboxydothermus hydrogenoformans Z-2901] (653 aa)
Score = 309, Expect = 1.4e-26, Identities = 90/286 (31%), Positives = 138/286 (48%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYV 286
           M+II     GFC GV  A  T +K A+   N+  Y +G L+HN + ++ L++ GI                 E  ++ N   +I  +HGT  + + +  ++G VV D TC +V K   L ++  ++GYQ+  +G   HPE    +       L+   N  E  R      I V  QTT     F ++ E +K K   +   N IC+A + RQ+    + +EV+++LVVG   S N+KKL +I       ++LI     IK EWF  K  + IT+G STP W+   V
  S:     1 MEIIVAQNAGFCFGVKRAIETAQKAAE--NNNPVYSLGPLIHNPQEVERLKKAGIIPI--------------EEIEEGNGKTIIIRSHGTTPEKLQEIVDRGYVVEDATCPFVKKAQILAQKLTDEGYQVVVVGDKKHPEVQGIVGWSGYKALV-VENPEEAARLPFYPKIAVIAQTTQKSENFWQVVEVIKKKGGEVRPFNTICHATRTRQEESRKLATEVEVMLVVGGKNSANTKKLAQICAATNTPTYLIEEASEIKPEWFAGKAKVGITAGASTPAWIIEEV 269
>gi|84500571|ref|ZP_00998820.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Oceanicola batsensis HTCC2597] >gi|84391524|gb|EAQ03856.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Oceanicola batsensis HTCC2597] (316 aa)
Score = 309, Expect = 1.5e-26, Identities = 92/280 (32%), Positives = 135/280 (48%)
  Q:     8 PRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV  A      A  K  A +Y  HE      +VHNK ++  L + G           +  ++ ++    + P  VIFSAHG  +    +A  + +V  D TC  V+K H   +   E G QI  IG   HPETI T+       ++L+ET  D+  +       +    QTT+S+ + + I  TL+ ++  I    K DIC A  +RQ AV  M   +D +LVVG   S+NS++LVE+        + L+    +I          + IT+G S P  L N VI
  S:    13 PRGFCAGVDRAIKIVEMALQKWGAPVYVRHE------IVHNKFVVDALRDQG-----------AVFVEELDECPGDRP--VIFSAHGVPKAVPAEAARREMVYVDATCPLVSKVHIEAERHHENGLQIVMIGHAGHPETIGTMGQLPAGEVLLVETEADVATLEVRDPDRLAFVTQTTLSVDDTKGIVATLQDRFPAIIGPHKEDICYATTNRQAAVKAMAGRIDAMLVVGAPNSSNSRRLVEVAANNGCSYAQLVQRATDIDWRALEGISAIGITAGASAPEVLVNEVI 283
>gi|62289456|ref|YP_221249.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Brucella abortus bv. 1 str. 9-941] >gi|82699382|ref|YP_413956.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Brucella melitensis biovar Abortus 2308] >gi|163842756|ref|YP_001627160.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Brucella suis ATCC 23445] >gi|62195588|gb|AAX73888.1| LytB, penicillin tolerance protein [Brucella abortus biovar 1 str. 9-941] >gi|82615483|emb|CAJ10457.1| LytB protein [Brucella melitensis biovar Abortus 2308] >gi|163673479|gb|ABY37590.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Brucella suis ATCC 23445] (372 aa)
Score = 309, Expect = 1.5e-26, Identities = 89/280 (31%), Positives = 137/280 (48%)
  Q:     8 PRGFCKGV-----VDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV     +   A  K  A +Y  HE      +VHN+ +++ L+  G    ++        +D I    +N P  V+FSAHG  +     A  K L   D TC  V+K H         G  +  IG + HPE I T+    D ++ LIETV D      + E  +    QTT+S+ +   I + L++++ N+       IC A  +RQDAV       DL L+VG   S+NSK+LVE+  K     S L+   ++I+ E   +   + +++G S P  + + +I
  S:    41 PRGFCAGVDRAIQIVVLALKKYGAPVYVRHE------IVHNRYVVEGLQARGAIFVEE--------LDEIPAAHRNQP--VVFSAHGVPKSVPADAEAKNLFYLDATCPLVSKVHKQAMRHQRLGRHVILIGHSGHPEVIGTMGQLPDGAVTLIETVEDAHTCHFDDEDNLGFVTQTTLSVDDTAGIIKELQARFPNLAAPAAESICYATTNRQDAVRAAAPGCDLFLIVGAPNSSNSKRLVEVAEKAGARMSMLVQRAEDIEWEQIGDISVVGLSAGASAPEIIVDEII 314
>gi|158312701|ref|YP_001505209.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Frankia sp. EAN1pec] >gi|158108106|gb|ABW10303.1| hydroxymethylbutenyl pyrophosphate reductase [Frankia sp. EAN1pec] (338 aa)
Score = 309, Expect = 1.6e-26, Identities = 84/292 (28%), Positives = 142/292 (48%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELG---IQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI-ESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           +++   PRG+C GV  A  T +K   LY     Y+   +VHN  ++K LE  G   ++  D+  H  +                V+FSAHG      ++A  + L   D TC  VTK H   +   ++   I  IG   H E + T       I L++   D   ++    K +   +QTT+S+ E +   + L+ ++ +++    +DIC A ++RQ AV  +  +VDLL+VVG   S+NS +LVE+ +     +S L+ +   + + W    + + +TSG S P  L   V+ +L  +
  S:    21 RVLLAKPRGYCAGVDRAVQTVEKALDLY-GSPVYVRKQIVHNAHVVKTLEAKGAIFVEETDEVPHGAT----------------VVFSAHGVAPTVHEEASSRQLRTIDATCPLVTKVHSEARRFAKEDLDILLIGHEGHEEVVGTTGQAPDRIHLVDGPEDAAAVKVRDPKRVAFLSQTTLSVDETQTTVKALRERFPHLQGPPSDDICYATQNRQVAVKEIAEKVDLLIVVGSPNSSNSVRLVEVALDAGAPKSFLVDDCSEVDEGWLDGVETVGVTSGASVPEELVTGVMAWLADR 302
>gi|23501376|ref|NP_697503.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Brucella suis 1330] >gi|23347271|gb|AAN29418.1| penicillin tolerance protein LytB [Brucella suis 1330] (372 aa)
Score = 309, Expect = 1.7e-26, Identities = 89/280 (31%), Positives = 137/280 (48%)
  Q:     8 PRGFCKGV-----VDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV     +   A  K  A +Y  HE      +VHN+ +++ L+  G    ++        +D I    +N P  V+FSAHG  +     A  K L   D TC  V+K H         G  +  IG + HPE I T+    D ++ LIETV D      + E  +    QTT+S+ +   I + L++++ N+       IC A  +RQDAV       DL L+VG   S+NSK+LVE+  K     S L+   ++I+ E   +   + +++G S P  + + +I
  S:    41 PRGFCAGVDRAIQIVVLALKKYGAPVYVRHE------IVHNRYVVEGLQARGAIFVEE--------LDEIPAAHRNQP--VVFSAHGVPKSVPADAEAKNLFYLDATCPLVSKVHKQAMRHQRLGRHVILIGHSGHPEVIGTMGQLPDGAVTLIETVEDAHTCHFDDEDNLGFVTQTTLSVDDTAGIIKELQARFPNLAAPAAESICYATTNRQDAVRAAAPGCDLFLIVGAPNSSNSKRLVEVAEKAGARMSMLVQRAEDIEWEQIGDISVVGLSAGASAPEIIVDEII 314
>gi|69937884|ref|ZP_00632470.1| LytB protein [Paracoccus denitrificans PD1222] >gi|119386327|ref|YP_917382.1| hydroxymethylbutenyl pyrophosphate reductase [Paracoccus denitrificans PD1222] >gi|166973800|sp|A1B842|ISPH_PARDP 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|119376922|gb|ABL71686.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Paracoccus denitrificans PD1222] (316 aa)
Score = 308, Expect = 1.8e-26, Identities = 87/280 (31%), Positives = 137/280 (48%)
  Q:     8 PRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV  A      A  K  A +Y  HE      +VHNK ++  L + G           +  ++ ++    + P  VIFSAHG  +    +AR + +V  D TC  V+K H   +    +G Q+  IG   HPE + T+    +  ++L+ETV D+  I       +    QTT+S+ +   I   L++++  I    K DIC A  +RQ +V  +   +D LLV+G   S+NS++LVE+G       S L+     I        + + +T+G S P  L + V+
  S:    14 PRGFCAGVDRAIKIVEMALQKWGAPVYVRHE------IVHNKFVVDSLRDKG-----------AVFVEELDDVPSDRP--VIFSAHGVPKAVPAEARRREMVFVDATCPLVSKVHVEAERHHAEGLQMVMIGHAGHPEVLGTMGQLPEGEVLLVETVEDVARIEPRDPGRLAFITQTTLSVDDTAAIVAALQARFPGIRGPAKEDICYATTNRQASVKAIAGRIDALLVIGAPNSSNSRRLVEVGSAAGCAYSQLVMRADQIDWRAIAGARAVGVTAGASAPEVLVDEVV 284
>gi|91978491|ref|YP_571150.1| hydroxymethylbutenyl pyrophosphate reductase [Rhodopseudomonas palustris BisB5] >gi|91684947|gb|ABE41249.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodopseudomonas palustris BisB5] (321 aa)
Score = 308, Expect = 2.0e-26, Identities = 92/279 (32%), Positives = 136/279 (48%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKEL--------EELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDK--SIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           +KI+  +PRGFC GVV A  T ++   LY     Y+   +VHNK ++  L        EELG                  EI D   P  V+FSAHG  +   + A  +     D TC  VTK H       ++G +I  IG ++HPE + TL      ++ LIET  D  +   ++   +    QTT+SI +   I   L+ ++ NI    K DIC A  +RQ AV  +   VD ++VVG   S+NS++L E+  ++    + L     +I    F     L +T+G S P
  S:     7 LKIVLCSPRGFCAGVVRAIDTVERALTLY-GAPVYVRHEIVHNKYVVDNLRAKGAIFVEELG------------------EIPDTKAP--VVFSAHGVPKSVPEDATARNFFSVDATCPLVTKVHREAAIHFKRGREILLIGHSHHPEVVGTLGQLPVGAVTLIETAADASSFTPKNPDNLAFVTQTTLSIDDTAGIVAVLRQRFPNISGPHKEDICYATTNRQAAVKKVAPVVDAMIVVGAPNSSNSQRLREVAEREGCRVAVLAQRASDIDWSLFEGISSLGLTAGASAP 277
>gi|111225494|ref|YP_716288.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Frankia alni ACN14a] >gi|111153026|emb|CAJ64773.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase, 4Fe-4S protein [Frankia alni ACN14a] (344 aa)
Score = 307, Expect = 2.2e-26, Identities = 82/292 (28%), Positives = 143/292 (48%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP--IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI-ESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           +++   PRG+C GV  A  T +K  +LY     Y+   +VHN  +++ LE  G    D+ +                 PP   V+FSAHG      ++A  + L   D TC  V+K H   +    + Y I  IG   H E + T       I L++   D   ++    + +   +QTT+S+ E +   + L+ ++ +++    +DIC A ++RQ AV  + S VDL++VVG   S+NS +LVE+ +      ++L+ ++  +   W    + + +TSG S P  L   V+ +L ++
  S:    26 RVLLAKPRGYCAGVDRAVVTVEKALELY-GSPVYVRKQIVHNLHVVRTLEAKGAIFVDETDEV---------------PPGATVVFSAHGVAPTVHEEASARQLRTIDATCPLVSKVHSEARRFAREDYDILLIGHEGHEEVVGTTGQAPDRIHLVDGPEDAAKVKVRDPEHVAFLSQTTLSVDETQTTVKALRERFPHLQGPPSDDICYATQNRQVAVKEISSAVDLVIVVGSPNSSNSVRLVEVALDAGAPAAYLVDDSTEVDASWLDGVETVGVTSGASVPEELVTGVMAWLAER 307
>gi|83590176|ref|YP_430185.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Moorella thermoacetica ATCC 39073] >gi|83573090|gb|ABC19642.1| hydroxymethylbutenyl pyrophosphate reductase [Moorella thermoacetica ATCC 39073] (736 aa)
Score = 307, Expect = 2.7e-26, Identities = 76/290 (26%), Positives = 137/290 (47%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIF----VTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFL 290
           M++I     GFC GV  A    ++  K   +     +G L+HN++++ +L   G++               +   D+ N   ++  +HGT  +T+ +AR+KGL + D TC YV +   L ++   +GYQ+  +G   HPE    L       ++     + + +  +  P      V  QTT      EE+   L+S    +   N +C A   RQ+A + +  +VD+++VVG  +S N++ L E+       ++ +     +  +WFIN + + +T G STP W+   V+  L
  S:     1 MEVIVADYAGFCFGVKRAVEKAREAPKPVAS-----LGMLIHNRQVVDQLAREGVR--------------PVASLDEVNCGRILIRSHGTTPETLVRARDKGLEIIDATCPYVKRAQHLAQKMAAEGYQVIIVGDAAHPEVQGMLGWAGPGAVV-----VPDKKAAAALPFHPRRAVLAQTTQPESRLEEVAAALRSNTDTLVVHNTVCQATHQRQEAAVRLARQVDVMVVVGGKESANTRHLAELCRATGTPTYHVERAGELCRQWFINTRRVGVTGGASTPAWIIEEVVGML 270
>gi|25027635|ref|NP_737689.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Corynebacterium efficiens YS-314] >gi|50401056|sp|Q8FQP0|ISPH_COREF 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|23492917|dbj|BAC17889.1| putative isoprenyl diphosphate biosynthesis protein IspH [Corynebacterium efficiens YS-314] (336 aa)
Score = 306, Expect = 3.0e-26, Identities = 87/286 (30%), Positives = 148/286 (51%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPI---VIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL--SIDKSIIL--IETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           KI+   PRG+C GV  A  T ++  + Y     Y+   +VHN+ ++  L E G+                I +++ +  P    ++FSAHG      ++A  K L   D  C  VTK H+ +K   +QG+ I +IG   H E   T+  S+D++ ++  IE++  +     +    I+++ QTT+S+ E  EI   LK  Y  ++    +DIC A ++RQ AV  +    DL++VVG   S+NS +LVE+ ++   + ++L+     I + W    + + I+SG S P  L   V+
  S:    26 KILLAAPRGYCAGVDRAVETVERALEEY-GAPIYVRKEIVHNRYVVDTLAEKGV----------------IFVEEASEAPEGAHMVFSAHGVSPAVKEEAAAKNLQAIDAACPLVTKVHNEVKRFDKQGFHILFIGHEGHEEVEGTMGHSLDRTHLVDGIESIPGLPAFLADEPNLIWLS-QTTLSVDETMEIVRELKKVYPQLQDPPSDDICYATQNRQVAVKAIAERCDLMIVVGSTNSSNSVRLVEVALQAGAKNAYLVDYAHQIDEAWLDGVQTIGISSGASVPEILVTGVL 303
>gi|118473320|ref|YP_889470.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium smegmatis str. MC2 155] >gi|118174607|gb|ABK75503.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium smegmatis str. MC2 155] (314 aa)
Score = 306, Expect = 3.0e-26, Identities = 86/286 (30%), Positives = 138/286 (48%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRG+C GV  A  T ++      A +Y  HE      +VHN+ +++ L + G                +I + + +  P   IV+FSAHG        A E+ L V D TC  VTK H+  K      Y I  IG   H E + T       + L++    ++ +    E  +   +QTT+S+ E  E    L+ K+  ++    +DIC A ++RQ AV  M  E +L++VVG   S+NS +LVE+ +    + +HL+    +I   W      + +TSG S P  L   V+
  S:     5 RVLLAEPRGYCAGVDRAVETVERALEKHGAPVYVRHE------IVHNRHVVETLAKAG----------------AIFVDETDEVPEGAIVVFSAHGVAPTVHQSAAERNLKVIDATCPLVTKVHNEAKRFARDDYDILLIGHEGHEEVVGTAGEAPDHVQLVDGPESVDAVTVRDESKVIWLSQTTLSVDETMETVRRLREKFPTLQDPPSDDICYATQNRQVAVKAMAPECELVIVVGSRNSSNSVRLVEVALNAGSDAAHLVDYADDIDPAWLDGVTTIGVTSGASVPEILVRGVL 280
>gi|82915121|ref|XP_728969.1| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Plasmodium yoelii yoelii str. 17XNL] >gi|23485703|gb|EAA20534.1| LytB protein, putative [Plasmodium yoelii yoelii] (475 aa)
Score = 306, Expect = 3.4e-26, Identities = 96/285 (33%), Positives = 144/285 (50%)
  Q:     6 ITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFL 290
           + PRGFCKGV  A  T ++  K +  +  Y+   +VHN  + K+LE  G                +I I+D N  P   I+I+SAHG   +  + A++K L+  D TC  V K H  +K K ++GY+I  IG  NH E I T +       ++E V  + N+     + +F   QTT+S+ +   I   LK KY NIE      IC A  +RQ A+  + +E D+ +VVG   S+N+KKLV     +  ++ LI    ++      N K +A+TS  STP  L    +  L
  S:   162 VNPRGFCKGVSRAIETVEECLKTFKTN-IYVKHKIVHNDIVCKDLENKG----------------AIFIEDLNEVPDGSILIYSAHGISPQIKELAKKKKLIEIDATCPLVNKVHVYVKMKAKEGYKIILIGYKNHVEVIGTYNEAPDCTYIVENVEQVNNLNFTENQKLFCVTQTTLSVDDCALILNKLKEKYPNIETIPSGSICYATTNRQRALNKICTECDITIVVGSQSSSNAKKLVYSSQIRNTDAILINTINDLDFSILKNVKKIALTSAASTPDELTQQFVKVL 435
>gi|114570765|ref|YP_757445.1| hydroxymethylbutenyl pyrophosphate reductase [Maricaulis maris MCS10] >gi|114341227|gb|ABI66507.1| hydroxymethylbutenyl pyrophosphate reductase [Maricaulis maris MCS10] (316 aa)
Score = 303, Expect = 7.6e-26, Identities = 85/287 (29%), Positives = 144/287 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEW--FINKKCLAITSGCSTPTWLANYVI 287
           + I++  PRGFC GV  A    ++      A +Y  HE      +VHN+ +++ LE LG           +  ++ ++    + P  V+FSAHG  +    +A+ + ++  D TC  V+K H   +     G +I  IG   HPE + T+    D +I L+ETV D E         I    QTT+S+ +   I + L++++ +++   K DIC A  +RQ AV  M    D++ V+G   S+NS +LVE+  +    +  + +  +  D W    + + + IT+G S P  L   +I
  S:     9 LTILRAAPRGFCAGVDRAIQIVERAIERFGAPVYVRHE------IVHNRHVVERLEALG-----------AVFVEELDECPTDRP--VVFSAHGVAKAVPAEAKRREMIYVDATCPLVSKVHVEAERHFANGDEIILIGHAGHPEVVGTMGQLPDGAISLVETVADAERFEPNDPSRIAFVTQTTLSVDDTSAIVQALQARFPDMKAPHKEDICYATTNRQAAVKAMAPRSDIVFVIGSPNSSNSVRLVEVAQRAGARAAALVSCADDVD-WSSLGSIRTVGITAGASAPEDLVEGLI 286
>gi|13094967|gb|AAK12102.1|AF323927_1 LytB [Plasmodium falciparum] (535 aa)
Score = 302, Expect = 8.9e-26, Identities = 94/274 (34%), Positives = 147/274 (53%)
  Q:     6 ITPRGFCKGVVDAYATCKKIAKLY--PNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           I PRGFCKGV  A  T ++  KL+  P + K+ I   VHN  + K+LE+ G                +I I+D N+ P   I+I+SAHG   +  + A++K L+  D TC  V K H  ++ K ++ Y I  IG  NH E I T +       ++E VND++ +     K +F   QTT+S+ +   I + LK+K+ +IE      IC A  +RQ A+  + ++ DL +VVG   S+N+KKLV     + + + L+    ++  +   N   +A+TS  STP
  S:   225 INPRGFCKGVSRAIETVEECLKLFKPPIYVKHKI---VHNDIVCKKLEKEG----------------AIFIEDLNDVPDGHILIYSAHGISPQIREIAKKKKLIEIDATCPLVNKVHVYVQMKAKENYDIILIGYKNHVEVIGTYNEAPHCTHIVENVNDVDKLNFPLNKKLFYVTQTTLSMDDCALIVQKLKNKFPHIETIPSGSICYATTNRQTALNKICTKCDLTIVVGSSSSSNAKKLVYSSQIRNVPAVLLNTVHDLDQQILKNVNKIALTSAASTP 487
>gi|124505727|ref|XP_001350977.1| LytB protein [Plasmodium falciparum 3D7] >gi|23510620|emb|CAD49005.1| LytB protein [Plasmodium falciparum 3D7] (535 aa)
Score = 302, Expect = 9.0e-26, Identities = 94/274 (34%), Positives = 147/274 (53%)
  Q:     6 ITPRGFCKGVVDAYATCKKIAKLY--PNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           I PRGFCKGV  A  T ++  KL+  P + K+ I   VHN  + K+LE+ G                +I I+D N+ P   I+I+SAHG   +  + A++K L+  D TC  V K H  ++ K ++ Y I  IG  NH E I T +       ++E VND++ +     K +F   QTT+S+ +   I + LK+K+ +IE      IC A  +RQ A+  + ++ DL +VVG   S+N+KKLV     + + + L+    ++  +   N   +A+TS  STP
  S:   225 INPRGFCKGVSRAIETVEECLKLFKPPIYVKHKI---VHNDIVCKKLEKEG----------------AIFIEDLNDVPDGHILIYSAHGISPQIREIAKKKKLIEIDATCPLVNKVHVYVQMKAKENYDIILIGYKNHVEVIGTYNEAPHCTHIVENVNDVDKLNFPLNKKLFYVTQTTLSMDDCALIVQKLKNKFPHIETIPSGSICYATTNRQTALNKICTKCDLTIVVGSSSSSNAKKLVYSSQIRNVPAVLLNTVHDLDQQILKNVNKIALTSAASTP 487
>gi|77919479|ref|YP_357294.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pelobacter carbinolicus DSM 2380] >gi|123573952|sp|Q3A3D3|ISPH_PELCD 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|77545562|gb|ABA89124.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pelobacter carbinolicus DSM 2380] (279 aa)
Score = 302, Expect = 9.1e-26, Identities = 81/287 (28%), Positives = 135/287 (47%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           MKII     GFC GV  A       A+ + +     +G ++H+ +++K+LEE GI+           +I  +E  D      VI  +HG   + +D   ++ L + D TC +V K  D       +GY +  +G  +HPE    +S  +   +    +  E  R  +   + +  QTT S    ++I +    K K +   N IC+A   RQ+    +  E DL+LVVG   S N+ +L +I  + Q  +  +   + I+D WF   +C+ IT+G STP W+ + V+
  S:     1 MKIILADSAGFCFGVKRATNLAFDAAEQFEHICS--LGPIIHSPQVVKKLEEKGIK-----------VIRKVEDIDHG---AVIIRSHGITAEELDIIHDRELKIVDATCPFVKKAQDYATMLCNEGYSVVLVGEKDHPEVQGIISYTRGGEVFVVADCKEAQRLPNRPKLGIVAQTTQSFKNLQQIADICLGKSKEVRIFNTICDATSVRQNEARKIACEADLMLVVGGFNSANTTRLAQICQEIQPRTFHVETVEQIQDGWFEGVECVGITAGASTPRWIIDQVV 271
>gi|126699426|ref|YP_001088323.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Clostridium difficile 630] >gi|168715457|ref|ZP_02747734.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Clostridium difficile QCD-63q42] >gi|123066832|sp|Q187C6|ISPH_CLOD6 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|115250863|emb|CAJ68688.1| putative 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Clostridium difficile 630] (279 aa)
Score = 302, Expect = 9.9e-26, Identities = 87/257 (33%), Positives = 139/257 (54%)
  Q:    35 YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINK----KCLAITSGCSTPTWLANYVIIFLE 291
           Y +G L+HNK+ + + EE G++T ++        ID+I      N   +I  +HG  +    +A++K L + DTTC +V K H ++ E   +GY+I  IG   HPE I      + S I+I+T+  +EN+  ++ K   +  QTTI+   +  I   L  K + I F + IC+A K RQ++   +  EVD ++V+G   S+N++KLV++      E  +       KDE  +N     K L IT+G STP W+   V+ FLE
  S:    34 YALGPLIHNKQAVAKYEEKGLKTVNE--------IDTIP-----NHENMIIRSHGVPENIYKEAKDKKLKIVDTTCPFVKKIHTVVSEYHNKGYEIIVIGDMKHPEVIGINGWCENSAIIIKTLEQMENMEFDNSKRYCLVAQTTINPELYISIVNKLSDKLEEIVFNDTICSATKTRQESAKELAKEVDCMIVIGGKHSSNTQKLVKV-----CEDLVPTFAIETKDELDVNTLKKYKNLGITAGASTPNWIIEEVVTFLE 277
>gi|86742560|ref|YP_482960.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Frankia sp. CcI3] >gi|86569422|gb|ABD13231.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Frankia sp. CcI3] (342 aa)
Score = 302, Expect = 1.1e-25, Identities = 83/286 (29%), Positives = 139/286 (48%)
  Q:     8 PRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELG---IQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI-ESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           PRG+C GV  A  T +K  +LY     Y+   +VHN  ++K LE  G   +   D+  H  +                V+FSAHG      ++A  + L   D TC  VTK H   +    + Y I  IG   H E + T       I L++   D   ++    + +   +QTT+S+ E     + L+ ++ +++    +DIC A ++RQ AV  +   VDL++VVG   S+NS +LVE+ +      ++L+ ++  +   WF   + + +TSG S P  L   V+ +L ++
  S:    32 PRGYCAGVDRAVVTVEKALELY-GSPVYVRKQIVHNLHVVKTLEAKGAIFVDETDEVPHGAT----------------VVFSAHGVAPTVHEEAAVRELRTIDATCPLVTKVHSEARRFAREDYDILLIGHEGHEEVVGTTGQAPDRIHLVDGPEDAAGVKVRDPERVAFLSQTTLSVDETMTTVDALRERFPHLQGPPSDDICYATQNRQVAVKEIAGAVDLVIVVGSRNSSNSVRLVEVALDAGAPAAYLVDDSTEVDLSWFDGVETVGVTSGASVPEELVTGVMAWLAER 307
>gi|89070110|ref|ZP_01157440.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Oceanicola granulosus HTCC2516] >gi|89044331|gb|EAR50474.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Oceanicola granulosus HTCC2516] (316 aa)
Score = 301, Expect = 1.1e-25, Identities = 87/238 (36%), Positives = 127/238 (53%)
  Q:     8 PRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRT-ESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIK 245
           PRGFC GV  A      A  K  A +Y  HE      +VHNK ++ +L + G           +  ++ ++    + P  VIFSAHG  +     A ++ ++  D TC  V+K H       E G Q+  IG   HPET+ T+       ++L+ET  D+  +   + EK  FVT QTT+SI +  EI   LK+++  I    K DIC A  +RQ+AV  M   ++ LLVVG   S+NS++LVE+G K
  S:    13 PRGFCAGVDRAIKIVEMALEKWGAPVYVRHE------IVHNKFVVDDLRDKG-----------AVFVEELDECPDDRP--VIFSAHGVPKAVPAAAAKREMIFVDATCPLVSKVHIEAARHAENGLQMIMIGHAGHPETVGTMGQLPPGEVLLVETPEDVAGVEVRDPEKLAFVT-QTTLSIDDTAEIVAALKARFPAIVGPHKEDICYATTNRQEAVKAMAPHIEALLVVGAPNSSNSRRLVEVGRK 240
>gi|84684020|ref|ZP_01011922.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodobacterales bacterium HTCC2654] >gi|84667773|gb|EAQ14241.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodobacterales bacterium HTCC2654] (322 aa)
Score = 301, Expect = 1.1e-25, Identities = 88/287 (30%), Positives = 141/287 (49%)
  Q:     1 MKIIKITPRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           + +I   PRGFC GV  A      A  K  A +Y  HE      +VHNK ++  L E G           +  ++ ++    + P  VIFSAHG  +    +A  + ++  D TC  V+K H   +     G Q+  IG   HPETI T+    +  ++L+ET  D+  +     + +    QTT+S+ +   I   LK+++  I    K DIC A  +RQ+AV  +  + D LLV+G   S+NS++LVE+   +  + + L+     I        + + +T+G S P  L + VI
  S:    12 LTLILAAPRGFCAGVDRAIKIVEMAIEKWGAPIYVRHE------IVHNKFVVDSLREKG-----------AVFVEELDECPTDRP--VIFSAHGVAKAVPAEANRREMIYVDATCPLVSKVHIEAERHHANGLQMVMIGHAGHPETIGTMGQLPEGEVLLVETEADVATLEPRDPERLAFITQTTLSVDDTAGIVAALKARFPAIIGPHKEDICYATTNRQEAVKAIAPKADALLVIGAPNSSNSRRLVEVARSRGCDYAQLVGRADEIDWRALEGVRAVGLTAGASAPEVLVDEVI 289
>gi|15840547|ref|NP_335584.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium tuberculosis CDC1551] >gi|13880725|gb|AAK45398.1| lytB protein [Mycobacterium tuberculosis CDC1551] (329 aa)
Score = 301, Expect = 1.3e-25, Identities = 84/286 (29%), Positives = 139/286 (48%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRG+C GV  A  T ++  +     +Y  HE      +VHN+ ++  L + G                ++ +++    P   IV+FSAHG        A E+ L V D TC  VTK H+  +      Y I  IG   H E + T       + L++ V+ ++ +    E  +   +QTT+S+ E  EI   L+ ++  ++    +DIC A ++RQ AV  M  E +L++VVG   S+NS +LVE+ +      +HL+    +I   W      + +TSG S P  L   V+
  S:    21 RVLLAEPRGYCAGVDRAVETVERALQKHGPPVYVRHE------IVHNRHVVDTLAKAG----------------AVFVEETEQVPEGAIVVFSAHGVAPTVHVSASERNLQVIDATCPLVTKVHNEARRFARDDYDILLIGHEGHEEVVGTAGEAPDHVQLVDGVDAVDQVTVRDEDKVVWLSQTTLSVDETMEIVGRLRRRFPKLQDPPSDDICYATQNRQVAVKAMAPECELVIVVGSRNSSNSVRLVEVALGAGARAAHLVDWADDIDSAWLDGVTTVGVTSGASVPEVLVRGVL 296
>gi|31792303|ref|NP_854796.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium bovis AF2122/97] >gi|57116829|ref|YP_177788.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium tuberculosis H37Rv] >gi|121637041|ref|YP_977264.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148660896|ref|YP_001282419.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium tuberculosis H37Ra] >gi|148822323|ref|YP_001287077.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium tuberculosis F11] >gi|167969245|ref|ZP_02551522.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium tuberculosis H37Ra] >gi|194543440|ref|YP_002078469.1| lytB-related protein lytB2 [Mycobacterium tuberculosis C] >gi|61226764|sp|P0A5I0|ISPH1_MYCTU 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 1 >gi|61226766|sp|P0A5I1|ISPH1_MYCBO 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 1 >gi|31617891|emb|CAD94001.1| PROBABLE LYTB-RELATED PROTEIN LYTB2 [Mycobacterium bovis AF2122/97] >gi|41353651|emb|CAE55361.1| PROBABLE LYTB-RELATED PROTEIN LYTB2 [Mycobacterium tuberculosis H37Rv] >gi|121492688|emb|CAL71157.1| Probable lytB-related protein lytB2 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124600447|gb|EAY59457.1| lytB-related protein lytB2 [Mycobacterium tuberculosis C] >gi|134149531|gb|EBA41576.1| lytB-related protein lytB2 [Mycobacterium tuberculosis str. Haarlem] >gi|148505048|gb|ABQ72857.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium tuberculosis H37Ra] >gi|148720850|gb|ABR05475.1| lytB-related protein lytB2 [Mycobacterium tuberculosis F11] (335 aa)
Score = 301, Expect = 1.3e-25, Identities = 84/286 (29%), Positives = 139/286 (48%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRG+C GV  A  T ++  +     +Y  HE      +VHN+ ++  L + G                ++ +++    P   IV+FSAHG        A E+ L V D TC  VTK H+  +      Y I  IG   H E + T       + L++ V+ ++ +    E  +   +QTT+S+ E  EI   L+ ++  ++    +DIC A ++RQ AV  M  E +L++VVG   S+NS +LVE+ +      +HL+    +I   W      + +TSG S P  L   V+
  S:    27 RVLLAEPRGYCAGVDRAVETVERALQKHGPPVYVRHE------IVHNRHVVDTLAKAG----------------AVFVEETEQVPEGAIVVFSAHGVAPTVHVSASERNLQVIDATCPLVTKVHNEARRFARDDYDILLIGHEGHEEVVGTAGEAPDHVQLVDGVDAVDQVTVRDEDKVVWLSQTTLSVDETMEIVGRLRRRFPKLQDPPSDDICYATQNRQVAVKAMAPECELVIVVGSRNSSNSVRLVEVALGAGARAAHLVDWADDIDSAWLDGVTTVGVTSGASVPEVLVRGVL 302
>gi|32141252|ref|NP_733653.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Streptomyces coelicolor A3(2)] >gi|20138729|sp|Q9FBM1|ISPH_STRCO 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|24413881|emb|CAD55221.1| hypothetical protein [Streptomyces coelicolor A3(2)] (338 aa)
Score = 300, Expect = 1.5e-25, Identities = 94/292 (32%), Positives = 142/292 (48%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIES---HLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           +++   PRG+C GV  A    +K      A +Y  HE      +VHNK +++ LE+ G    +     R+E     E+ + N   IV+FSAHG      ++A    L   D TC  VTK H          Y I  IG   H E I T       I L++   D+  +       +   +QTT+S+ E  E  + LK K+  +     +DIC A ++RQ AV  M +E +L++VVG   S+NSK+LVE+   KQ  S   +L+     I + W      + +TSG S P  L   V+ +L ++
  S:    11 RVLLAAPRGYCAGVDRAVIAVEKALEQYGAPVYVRHE------IVHNKYVVQTLEKKGAIFVE-----RTE-----EVPEGN---IVMFSAHGVAPVVHEEAERGKLATIDATCPLVTKVHKEAVRFANDDYDILLIGHEGHEEVIGTSGEAPDHIQLVDGPEDVAKVEVRDPSKVVWLSQTTLSVDETMETVDALKDKFPQLISPPSDDICYATQNRQLAVKQMGAEAELVIVVGSRNSSNSKRLVEVA--KQAGSRAAYLVDFADEIDETWLDGVTTVGVTSGASVPDVLVEQVLEWLSRR 292
>gi|118579777|ref|YP_901027.1| hydroxymethylbutenyl pyrophosphate reductase [Pelobacter propionicus DSM 2379] >gi|166217472|sp|A1ANP9|ISPH_PELPD 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|118502487|gb|ABK98969.1| hydroxymethylbutenyl pyrophosphate reductase [Pelobacter propionicus DSM 2379] (280 aa)
Score = 300, Expect = 1.6e-25, Identities = 81/287 (28%), Positives = 137/287 (47%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIF----VTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M++I     GFC GV  A     + A +  + + Y +G ++H+ +++K+LEE+G++   D        +DS++         +I  +HG     I +A +K L + D TC +V K  + +K   E GY +  +G  +HPE    +S     + +  V   E +R   + PI     V  QTT S    + +      +   I   N IC+A   RQ+    +  +VD +LVVG   S N+++L E+  + Q  +H I     I   WF     + +T+G STP W+ + V+
  S:     1 MRVILAKRAGFCFGVKRATQMAFEAAGM--DKKTYTLGPIIHSPQVVKKLEEMGVRALKD--------LDSMD------SGTIIIRSHGVASHEIAEAMQKKLEIVDATCPFVKKAQEHVKSLSETGYGVVVVGDADHPEVQGIVSYGGDKVFV--VGSGEEVR---KLPIMNKIGVVAQTTQSFENLKNVVSECLQRGGEIRVFNTICDATAVRQEEAKELARQVDCMLVVGGFNSANTRRLAEVCAELQPRTHHIETAAEIDPAWFEGVATVGVTAGASTPKWIIDEVM 270
>gi|119026099|ref|YP_909944.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bifidobacterium adolescentis ATCC 15703] >gi|118765683|dbj|BAF39862.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bifidobacterium adolescentis ATCC 15703] (343 aa)
Score = 299, Expect = 1.9e-25, Identities = 88/291 (30%), Positives = 152/291 (52%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK------YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSID-KSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEI---GIKKQIES----------HLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           +I+   PRGFC GV  A  T + I K             Y+   +VHNK ++++L   G     +     +EI D+     +   PIV FSAHG       +A  +G+ V D TC  V+K H  +   +++GY+I YIG   H E +  +    + + LIE  +D++++  + +  + +  QTT+S+ E       LK+++  +E    +DIC A  +RQ AV  +  + D +++VG   S+NS +L+E+   G+  +  S          H + +   +   WF   + + I+SG S P  L + V+  L++
  S:    13 RIVLADPRGFCAGVDRAILTVRTILKSADTPRADGLPPVYVRRQIVHNKHVVEDLAAQGAVFVQE----LAEIPDAAA---EAGIPIV-FSAHGVSPAVKAEATARGMHVVDATCPLVSKVHREVLRFVKEGYEIIYIGHKGHDEAVGVVEESPEHVHLIEHASDVDSLDFQPDTKLVLLTQTTLSVDETAGTITALKARFPWLEMPPNSDICYATSNRQAAVKLVAEQADCVVIVGSANSSNSVRLMEVAQEGLSARYASKTAVGAAGRAHRVDDASELDPAWFEGVESVGISSGASVPDELVSGVVAALQE 317
>gi|114706696|ref|ZP_01439597.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Fulvimarina pelagi HTCC2506] >gi|114538088|gb|EAU41211.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Fulvimarina pelagi HTCC2506] (342 aa)
Score = 299, Expect = 1.9e-25, Identities = 85/280 (30%), Positives = 137/280 (48%)
  Q:     8 PRGFCKGV-----VDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIK-KQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV     +   A  K  A +Y  HE      +VHNK ++  L ++G     + +          E+ D   P  V+FSAHG  +    +A  + +   D TC  V+K H      ++ G  +  IG   HPE + TL    + ++ LIET  D+          +    QTT+S+ +   + + L++K+  ++  +   IC A  +RQDAV     E DL +VVG   S+NSK+LVE+  +    ++ L+ N + I  E       +A+++G S P  L + +I
  S:    25 PRGFCAGVDRAIQIVVLALKKYGAPVYVRHE------IVHNKYVVDGLRDMGAVFVKELH----------EVPDDGQP--VVFSAHGVPKSVPARAEARDMFYLDATCPLVSKVHKQGLRHVKLGRHVLLIGHAGHPEVVGTLGQLPEGTVTLIETEEDVSAFEPADPSALGFITQTTLSVDDTAGVVKALQAKFPEMQAPSSESICYATTNRQDAVKVAAPETDLFVVVGAPNSSNSKRLVEVAKRFGARDAMLVENEREIPWESLKTGATIALSAGASAPDILIDAII 296
>gi|58699872|ref|ZP_00374478.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Wolbachia endosymbiont of Drosophila ananassae] >gi|58533610|gb|EAL58003.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Wolbachia endosymbiont of Drosophila ananassae] (250 aa)
Score = 298, Expect = 2.7e-25, Identities = 84/253 (33%), Positives = 137/253 (54%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK-YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSI-EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLI 253
           M+II   PRGFC GV  A        + Y N  + Y++  +VHNK I+++ ++ G+             + SI EI+D  N  I+IFSAHG  +   D+A+ KG+ V D TC  V K H   K     G ++  IG  NHPE       ++  I L++T+ D+ +++ +    +    QTT+SI +  +I   LK ++  I   +  DIC A ++RQ+AV  +   VD++LVVG   S+NS +L+++   +   ++L+
  S:     1 MEIILAEPRGFCAGVKRAVDILAITLEKYKNERQVYVLHEIVHNKYIVEDFKKQGVV-----------FVSSIKEIED--NGGILIFSAHGVSKNIEDEAKRKGIQVIDATCPLVNKVHKEAKRYENSGKELILIGHENHPEVKGIRGRVNNPITLVQTLQDVYDLKVKDPDNLSYVTQTTLSIDDTRDIIAALKLRFPGITGPDLKDICYATQNRQNAVKKLAEIVDMVLVVGSKNSSNSNRLLDLCTARGKRAYLM 245
>gi|34557671|ref|NP_907486.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Wolinella succinogenes DSM 1740] >gi|50400923|sp|Q7M8Y6|ISPH_WOLSU 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|34483388|emb|CAE10386.1| FUSION PENICILLIN TOLERANCE LYTB DOMAIN N-TERMINUS AND S1RIBOSOMAL PROTEIN C-TERMINUS [Wolinella succinogenes] (276 aa)
Score = 298, Expect = 2.8e-25, Identities = 86/291 (29%), Positives = 146/291 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYL-IGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           MK+      GFC GV       K+  KL  +H+  + +G L+HNK   KE+E L       KN     + +S+E   + +   VI   HG  +  + K  +    + D TC +VTK   + +   ++GYQI   G  NHPE    +S   S  ++  ++  E    + ++ + + +QTT  I +F  +   L  +   +   N ICNA  D Q+A  ++  EVD++++ G   S+N+K+L+ I ++   +S+LI +   +  +WF NKK   +T+G STP W+   V+  +E
  S:     1 MKVKLADKHGFCFGV-------KRAIKLAESHQGGITLGPLIHNK---KEIERL-------KNDFGVTVEESVENLPRGSE--VIIRTHGIPKDDLAKLTQSAEKIIDATCPFVTKPQKICEIMSQEGYQIIIFGDINHPEVQGVMSYSSSEPIV-VMSPKELFGAKLKEKVALVSQTTKKIEDFLGVASFLVQRCAEVRIFNTICNATFDNQEAARHLSQEVDIMIIAGGKNSSNTKQLLSICLEHCQDSYLIEDESELDPQWFTNKKTCGVTAGASTPEWIIERVVRTIE 272
>gi|89210096|ref|ZP_01188489.1| LytB protein [Halothermothrix orenii H 168] >gi|89160436|gb|EAR80091.1| LytB protein [Halothermothrix orenii H 168] (703 aa)
Score = 298, Expect = 2.9e-25, Identities = 84/278 (30%), Positives = 141/278 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEK---YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKS-IILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           GFC GV  A     + A    N E+   Y +G L+HN +++K L+E+GI++           +DS++I D     ++I  +HG     I+KAR+KGL + D TC YV       +E +++GYQ    G  +HPE I      ++  I+I +  +I++I   S+  + +  QTT S   F++I   +  + K +   N IC   + RQ + +++  +VD + V+G   S N+ +L E+  +    ++ I     I      +   + IT+G STP WL   VI
  S:    13 GFCFGVKRAINLAMEAAG--NNKEEIPVYTLGPLIHNPQVVKRLKEMGIES-----------LDSLDIIDNG---VIIIRSHGVPPDIIEKARQKGLHIIDATCPYVKNAQKYARELVDKGYQTIIFGDRDHPEVIGINGAARNESIIISSEKEIKDINLSSK--VGLIAQTTKSPASFQKIVSYILPEVKELRIYNTICRTTETRQKSAVDLARQVDAMFVIGGKNSANTTRLAELCAETGTPTYHIETAGEIDFRQLKSYNKIGITAGASTPDWLIKEVI 276
>gi|71152180|sp|Q5FFL5|ISPH_EHRRG 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (328 aa)
Score = 296, Expect = 5.3e-25, Identities = 88/294 (29%), Positives = 149/294 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK-YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKL 294
           +++I  TPRGFC GV  A    K   + Y + +  Y++  +VHNK I++ L+ +G+   D             ++    +  ++I+SAHG  +     A  + L V D TC  V K H  ++   + GYQ+  IG   H E   T+  I   +I+++ +NDI+ I       +    QTT+S+ + + I + LK K+ NI+  +  DIC A ++RQ     +   VD++ ++G   S+NS +L E+    Q ++ LI + K I      +   + IT+G S P  L   VI FL++ +
  S:    13 VEVILATPRGFCAGVSRAIEIVKLAIEYYKDTKTIYVLHEIVHNKYIVETLKTMGVIFID-------------KVDQAQDGSVLIYSAHGVSKSIKQLAELRDLEVIDATCPLVNKVHKEVQLYDKSGYQVILIGHKGHREVEGTVGQISTPVIIVQNLNDIDKIEIFDPDKLAYVTQTTLSVDDTKVIIDKLKKKFPNIKGPDLKDICYATQNRQTTTKRLAELVDIVFILGSKNSSNSNRLKELA-AIQTQAFLIDSYKEIDLNLLNDITKIGITAGASAPDILVQQVIDFLKQHM 296
>gi|58617260|ref|YP_196459.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ehrlichia ruminantium str. Gardel] >gi|58416872|emb|CAI27985.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (EC 1.17.1.2) [Ehrlichia ruminantium str. Gardel] (332 aa)
Score = 295, Expect = 5.6e-25, Identities = 88/294 (29%), Positives = 149/294 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK-YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKL 294
           +++I  TPRGFC GV  A    K   + Y + +  Y++  +VHNK I++ L+ +G+   D             ++    +  ++I+SAHG  +     A  + L V D TC  V K H  ++   + GYQ+  IG   H E   T+  I   +I+++ +NDI+ I       +    QTT+S+ + + I + LK K+ NI+  +  DIC A ++RQ     +   VD++ ++G   S+NS +L E+    Q ++ LI + K I      +   + IT+G S P  L   VI FL++ +
  S:    17 VEVILATPRGFCAGVSRAIEIVKLAIEYYKDTKTIYVLHEIVHNKYIVETLKTMGVIFID-------------KVDQAQDGSVLIYSAHGVSKSIKQLAELRDLEVIDATCPLVNKVHKEVQLYDKSGYQVILIGHKGHREVEGTVGQISTPVIIVQNLNDIDKIEIFDPDKLAYVTQTTLSVDDTKVIIDKLKKKFPNIKGPDLKDICYATQNRQTTTKRLAELVDIVFILGSKNSSNSNRLKELA-AIQTQAFLIDSYKEIDLNLLNDITKIGITAGASAPDILVQQVIDFLKQHM 300
>gi|88856101|ref|ZP_01130762.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [marine actinobacterium PHSC20C1] >gi|88814669|gb|EAR24530.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [marine actinobacterium PHSC20C1] (363 aa)
Score = 295, Expect = 6.2e-25, Identities = 82/286 (28%), Positives = 136/286 (47%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRG+C GV  A    +K    Y     Y+   +VHN  ++  LE  G    DD +          EI + +    V+FSAHG     +  A ++ L   D TC  VTK H          YQI  IG   H E   T+    +  IL+ +  D+ NI  E+   +   +QTT+S+ E  E    L+ ++  ++    +DIC A ++RQ A+  +  + +L++VVG   S+N+ +LV++ ++   + ++ +     IK EW      + +TSG S P  L   V+
  S:    34 RVVLAAPRGYCAGVDRAVIAVEKALTNY-GAPVYVRKQIVHNIHVVTTLEAQGAIFVDDVD----------EIPEGST---VVFSAHGVSPAVVQGAADRELHAIDATCPLVTKVHREATRFARDNYQILLIGHEGHEEVEGTMGHAPERTILVNSPADVPNIHVENTDNLVWLSQTTLSVDETMETVRLLRERFPTLQDPPSDDICYATQNRQVAIKKVAEDAELVIVVGSANSSNTVRLVDVALEYGAKAAYRVDYASEIKQEWLDGISTVGVTSGASVPEVLVQEVL 309
>gi|111022833|ref|YP_705805.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodococcus sp. RHA1] >gi|123339839|sp|Q0S489|ISPH_RHOSR 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|110822363|gb|ABG97647.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodococcus sp. RHA1] (336 aa)
Score = 295, Expect = 7.0e-25, Identities = 83/291 (28%), Positives = 140/291 (48%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           +++   PRG+C GV  A  T +K      A +Y   E      +VHN+ ++  L + G+   D+ +          E+ +     +++FSAHG      + A  + L   D TC  VTK H   K      + I  IG   H E   T       + L++  + ++ +    E  +   +QTT+S+ E  +    L+ ++ N++    +DIC A ++RQ AV  M  E DL++VVG   S+NS +LVE+ +    + S+L+   + +   W    + + ITSG S P  L   VI  L++
  S:    27 RVLLAEPRGYCAGVDRAVETVEKALEKHGAPIYVRKE------IVHNRHVVDTLTDQGVVFVDETD----------EVPEG---ALLVFSAHGVSPAVHESAAARNLRTIDATCPLVTKVHQEAKRFARDDFDILLIGHEGHEEVEGTAGEAPDHVQLVDGPDSVDAVTVRDESKVIWLSQTTLSVDETMQTVARLRERFPNLQDPPSDDICYATQNRQVAVKAMAPECDLVIVVGSRNSSNSVRLVEVALNAGAKASYLVDYAREVDPAWLDGVRTVGITSGASVPEILVRGVIDLLDE 307
>gi|46191029|ref|ZP_00120646.2| COG0761: Penicillin tolerance protein [Bifidobacterium longum DJO10A] >gi|189439090|ref|YP_001954171.1| 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase [Bifidobacterium longum DJO10A] >gi|189427525|gb|ACD97673.1| 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase [Bifidobacterium longum DJO10A] (330 aa)
Score = 294, Expect = 8.2e-25, Identities = 87/289 (30%), Positives = 152/289 (52%)
  Q:     3 IIKITPRGFCKGVVDAYATCKKIAKLYPNHEK----------YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSID-KSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEI---GIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           ++   PRGFC GV  A  T + I K      K          Y+   +VHNK ++++L   G     +     +EI D+     +   P+V FSAHG       +A  +G+ V D TC  V K H  +   + +GY+I YIG   H E +  +    + + LIE  +D++++    +  + + +QTT+S+ E  +    LK+K+  I+    +DIC A  +RQ AV  +  + D +++VG   S+NS +L+E+   G+ ++ +++ + +   +   WF   + + I+SG S P  L + VI  L+
  S:     5 VVLADPRGFCAGVDRAILTVQTILKAAEASGKRTREDGLPPVYVRRQIVHNKHVVEDLAGQGAVFVQE----LAEIPDAAA---QAGIPVV-FSAHGVSPVVKAEAERRGMHVVDATCPLVGKVHREVLRFVREGYEIVYIGHKGHDEAVGVVGESPEHVHLIEHESDVDSLDFAPDTKLVLLSQTTLSVDETADTIAALKAKFPWIQEPPSSDICYATSNRQAAVKLVAQQSDCVVIVGSANSSNSVRLMEVAQEGLGERGKAYRVDDASELDPAWFEGLESVGISSGASVPDELVSGVIDALQ 301
>gi|29829752|ref|NP_824386.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Streptomyces avermitilis MA-4680] >gi|50400991|sp|Q82IE8|ISPH_STRAW 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|29606861|dbj|BAC70921.1| putative 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Streptomyces avermitilis MA-4680] (338 aa)
Score = 293, Expect = 1.0e-24, Identities = 88/292 (30%), Positives = 138/292 (47%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIG-IKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           +++   PRG+C GV  A    +K      A +Y  HE      +VHNK +++ LE  G                +I ++     P   IV+FSAHG      ++A    L   D TC  VTK H        + + I  IG   H E I T     + I L++   D+  +       +   +QTT+S+ E  E  + LK K+  +     +DIC A ++RQ AV  M  E DL++VVG   S+NS +LVE+  +    +++L+     I + W      + +TSG S P  L   V+ +L ++
  S:    11 RVLLAAPRGYCAGVDRAVIAVEKALEQYGAPIYVRHE------IVHNKYVVQTLERKG----------------AIFVERTAEVPEGAIVMFSAHGVAPVVHEEAARGKLATIDATCPLVTKVHKEAVRFANEDFDILLIGHEGHEEVIGTSGEAPEHITLVDGPGDVAKVEVRDPSKVVWLSQTTLSVDETMETVDALKEKFPQLISPPSDDICYATQNRQLAVKQMGEEADLVIVVGSRNSSNSVRLVEVAKLAGARDAYLVDFADEIDEAWLEGVSTVGVTSGASVPEILVEQVLEWLSQR 292
>gi|23465922|ref|NP_696525.1| IspH protein involved in conversion of 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate into IPP and DMAPP [Bifidobacterium longum NCC2705] >gi|50401057|sp|Q8G4L8|ISPH_BIFLO 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|23326631|gb|AAN25161.1| IspH protein involved in conversion of 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate into IPP and DMAPP [Bifidobacterium longum NCC2705] (352 aa)
Score = 293, Expect = 1.1e-24, Identities = 87/289 (30%), Positives = 152/289 (52%)
  Q:     3 IIKITPRGFCKGVVDAYATCKKIAKLYPNHEK----------YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSID-KSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEI---GIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           ++   PRGFC GV  A  T + I K      K          Y+   +VHNK ++++L   G     +     +EI D+     +   P+V FSAHG       +A  +G+ V D TC  V K H  +   + +GY+I YIG   H E +  +    + + LIE  +D++++    +  + + +QTT+S+ E  +    LK+K+  I+    +DIC A  +RQ AV  +  + D +++VG   S+NS +L+E+   G+ ++ +++ + +   +   WF   + + I+SG S P  L + VI  L+
  S:    27 VVLADPRGFCAGVDRAILTVQTILKAAEASGKRTREDGLPPVYVRRQIVHNKHVVEDLAGQGAVFVQE----LAEIPDAAA---QAGIPVV-FSAHGVSPVVKAEAERRGMHVVDATCPLVGKVHREVLRFVREGYEIVYIGHKGHDEAVGVVGESPEHVHLIEHESDVDSLDFAPDTKLVLLSQTTLSVDETADTIAALKAKFPWIQEPPSSDICYATSNRQAAVKLVAQQSDCVVIVGSANSSNSVRLMEVAQEGLGERGKAYRVDDASELDPAWFEGLESVGISSGASVPDELVSGVIDALQ 323
>gi|153952263|ref|YP_001398033.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni subsp. doylei 269.97] >gi|166217156|sp|A7H3F3|ISPH_CAMJD 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|152939709|gb|ABS44450.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni subsp. doylei 269.97] (277 aa)
Score = 292, Expect = 1.3e-24, Identities = 88/282 (31%), Positives = 144/282 (51%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEE-LGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           GFC GV  A    ++I       +   IG L+HN E I  L++   ++T ++             IK  +N    I   HG  ++ +++ R+K + +FD TC +VTK   + ++  ++GY+I   G  NHPE     S ++    ++    +++NI+  S+  I V +QTT     F EI   L  K K +   N IC+A    QDA+  +  + D+++VVG   S N+K+L  I      +S+LI   + +K EWF++KK   I++G STP W+   VI  +E
  S:    10 GFCFGVKRAIKKAEQI------KDAATIGPLIHNNEEISRLQKNFNVKTLEN-------------IKSLSNETKAIIRTHGITKQDLEELRKKDIEIFDATCPFVTKPQQICEQMSKEGYEIVIFGDENHPEVKGVKSYVNTKAYVVLDKKELQNIKLPSK--IAVVSQTTKKPEHFMEIVNFLMLKAKEVRVFNTICDATFKNQDAIKELSLKSDVMVVVGGKNSANTKQLFLIAKTNCEDSYLIETEEELKKEWFLDKKHCGISAGASTPDWIIQKVIAKIE 272
>gi|58698178|ref|ZP_00373100.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Wolbachia endosymbiont of Drosophila ananassae] >gi|58535328|gb|EAL59405.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Wolbachia endosymbiont of Drosophila ananassae] (254 aa)
Score = 292, Expect = 1.3e-24, Identities = 73/219 (33%), Positives = 122/219 (55%)
  Q:    73 EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           EI+D  N  I+IFSAHG  +   D+A+ KG+ V D TC  V K H   K     G ++  IG  NHPE       ++  I L++T+ D+ +++ +    +    QTT+SI +  +I   LK ++  I   +  DIC A ++RQ+AV  +   VD++LVVG   S+NS +L+++   +   ++LI N + +   WF   + + IT+G S P  L + ++ +L+
  S:     9 EIED--NGGILIFSAHGVSKNIEDEAKRKGIQVIDATCPLVNKVHKEAKRYENSGKELILIGHENHPEVKGIRGRVNNPITLVQTLQDVYDLKVKDPDNLSYVTQTTLSIDDTRDIIAALKLRFPGITGPDLKDICYATQNRQNAVKKLAEIVDMVLVVGSKNSSNSNRLLDLCTARGKRAYLIDNYRCVNKSWFQGVEKIGITAGASAPDILVDELMDYLK 228
>gi|116671379|ref|YP_832312.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Arthrobacter sp. FB24] >gi|116611488|gb|ABK04212.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Arthrobacter sp. FB24] (359 aa)
Score = 292, Expect = 1.4e-24, Identities = 84/289 (29%), Positives = 138/289 (47%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDE-WFINKKCLAITSGCSTPTWLANYVIIFL 290
           K++   PRG+C GV  A    +K  + Y     Y+   +VHN  ++  LEE G                +I + + +  P   +VIFSAHG     +  A ++GL   D TC  VTK H       +  + I  IG + H E   T     + I +I   ++++ +     + +   +QTT+S+ E  E    LK ++  ++    +DIC A  +RQ A+  +  + DL++VVG   S+NS +LVE+ ++   ++    +  N  DE WF     + +TSG S P  L   V+  L
  S:    34 KVLLAAPRGYCAGVDRAVIAVEKALEHY-GPPVYVRKQIVHNVHVVSSLEEKG----------------AIFVDETDEVPEGALVIFSAHGVSPAVVQSAEDRGLRTIDATCPLVTKVHREAVRFAKDDFDILLIGHDGHEEVEGTAGEAPEHIQIINGPHEVDKVTVRDPEKVIWLSQTTLSVDETMETVRLLKERFPTLQDPPSDDICYATTNRQVAIKKISPQADLVIVVGSANSSNSVRLVEVALEYGAKASYRVDFANEVDEAWFEGVATVGVTSGASVPEVLVKDVLRLL 312
>gi|120405583|ref|YP_955412.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium vanbaalenii PYR-1] >gi|166217176|sp|A1TE06|ISPH_MYCVP 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|119958401|gb|ABM15406.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium vanbaalenii PYR-1] (337 aa)
Score = 292, Expect = 1.5e-24, Identities = 82/286 (28%), Positives = 137/286 (47%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRG+C GV  A  T ++      A +Y  HE      +VHN+ ++  L + G                +I ++  +  P   IV+FSAHG      ++A  + L   D TC  VTK H+  K      Y I  +G   H E + T       + +++  + ++ +       +   +QTT+S+ E  E    L+ K+  ++    +DIC A ++RQ AV  M  E +L++VVG   S+NS +LVE+ +      +HL+    +I   WF     + +TSG S P  L   V+
  S:    28 RVLLAEPRGYCAGVDRAVETVERALEKHGAPIYVRHE------IVHNRYVVDTLAKAG----------------AIFVEQTDEVPEGAIVVFSAHGVAPTVHEEAAARHLRTIDATCPLVTKVHNEAKRFARDDYDILLVGHEGHEEVVGTAGEAPDHVQVVDNPDAVDKVTVRDPNKVIWLSQTTLSVDETMETVRRLREKFPTLQDPPSDDICYATQNRQVAVKAMAPECELVIVVGSKNSSNSVRLVEVALGAGASAAHLVDYADDIDPAWFDGVTTVGVTSGASVPEILVRGVL 303
>gi|38233539|ref|NP_939306.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Corynebacterium diphtheriae NCTC 13129] >gi|50400887|sp|Q6NI36|ISPH_CORDI 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|38199799|emb|CAE49462.1| Putative penicillin tolerance protein [Corynebacterium diphtheriae] (333 aa)
Score = 292, Expect = 1.6e-24, Identities = 85/292 (29%), Positives = 142/292 (48%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRT--ESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI-ESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           +++   PRG+C GV  A  T +K  + Y     Y+   +VHN+ ++  L E G    D             E  +      ++FSAHG       +A    L   D TC  VTK H+ +K     GY I  +G   H E   T      +  L++ V  ++ +      EK I+++ QTT+S+ E   I + L  ++ +++    +DIC A ++RQ AV  + +E D+++VVG   S+NSK+LVE+ ++     S+L+     I + W      + ++SG S P  L   V+ FL+ +
  S:    23 RVLVAAPRGYCAGVDRAVETVEKALEKY-GAPVYVRKEIVHNRYVVDTLAERGAIFVD-------------ETTEAPEGAHLVFSAHGVSPAVHKEAEALSLKTLDATCPLVTKVHNEVKRFARDGYHILLVGHEGHEEVEGTAGEAPDVTHLVDGVESVDKLPEFLHDEKLIWLS-QTTLSVDETMTIVKKLHERFAHLQDPPSDDICYATQNRQVAVKAIAAESDVVIVVGSQNSSNSKRLVEVALQAGAGASYLVDYAHQIDESWLDGATTVGVSSGASVPEILVRGVLEFLDAR 305
>gi|32475807|ref|NP_868801.1| LytB protein [Rhodopirellula baltica SH 1] >gi|50400953|sp|Q7ULU1|ISPH_RHOBA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|32446350|emb|CAD76178.1| LytB protein [Rhodopirellula baltica SH 1] (319 aa)
Score = 291, Expect = 1.6e-24, Identities = 85/299 (28%), Positives = 153/299 (51%)
  Q:     1 MKIIKITPRGFCKGV---VDAY-ATCKKIAK-LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAND 299
           MKII   PRGFC GV   +D+   T +K    +Y  HE      +VHN+ ++K   E G           +  +D+I+   +    +++FSAHG   +    A+ + L   D TC  VTK H    +  + GY I  IG   H E + T+    ++I+L+E   D++ +  E    +    QTT+S+ +   +   L+ ++  I    K+DIC A ++RQ+AV  +  + D+++V+G   S+NS++L E+  ++   + L+   +++  + F +   + IT+G S P  +    I +L++    + D
  S:     4 MKIILAAPRGFCAGVNMAIDSLDLTLQKFGPPVYVYHE------IVHNQFVVKTFREKG-----------AVFVDTIDEVPEGG--VLLFSAHGVSPEIRKAAQARKLHALDATCPLVTKVHLEAIKYAKAGYTIILIGHEGHDEVLGTMGEAPEAIVLVEDEADVDRLEFEPGTQLAYLTQTTLSVDDAGRVIRRLRERFPEIHSPPKDDICYATQNRQEAVKLLREDADVIVVLGSQNSSNSQRLKELAAEQGKRAMLVDGPQDLAVDQFSDDDRVLITAGASAPESVVQSTIDWLKENFDASVD 291
>gi|15606811|ref|NP_214191.1| LytB protein [Aquifex aeolicus VF5] >gi|8928180|sp|O67625|ISPH_AQUAE 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|2984055|gb|AAC07596.1| LytB protein [Aquifex aeolicus VF5] (289 aa)
Score = 291, Expect = 1.6e-24, Identities = 82/277 (29%), Positives = 141/277 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSI----ILIETVNDI-ENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYV 286
           GFC GV  A    ++  K     + Y +G ++HN + +  L+ LG+     +           E K+ +    VI  +HG   +  +  R+KGL V D TC YV   H+ + +   +GY +  +G  NHPE I TL   ++     I++ET+ DI E ++ E    + +  QTT +   F+E+   +    K ++  N ICNA   RQ++V  +  EVD+++++G   S N+++L  I  +    ++ I   + ++ EWF   K + I++G STP W+   V
  S:    11 GFCFGVKRAVKLAEESLK-ESQGKVYTLGPIIHNPQEVNRLKNLGVFPSQGE-----------EFKEGDT---VIIRSHGIPPEKEEALRKKGLKVIDATCPYVKAVHEAVCQLTREGYFVVLVGEKNHPEVIGTLGYLRACNGKGIVVETLEDIGEALKHER---VGIVAQTTQNEEFFKEVVGEIALWVKEVKVINTICNATSLRQESVKKLAPEVDVMIIIGGKNSGNTRRLYYISKELNPNTYHIETAEELQPEWFRGVKRVGISAGASTPDWIIEQV 274
>gi|90425553|ref|YP_533923.1| hydroxymethylbutenyl pyrophosphate reductase [Rhodopseudomonas palustris BisB18] >gi|90107567|gb|ABD89604.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhodopseudomonas palustris BisB18] (320 aa)
Score = 291, Expect = 1.7e-24, Identities = 86/279 (30%), Positives = 138/279 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSI-EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           +KI+  +PRGFC GVV A  T ++   LY     Y+   +VHN+ ++  L   G           +  ++ + EI +   P  V+FSAHG  +    ++ ++     D TC  VTK H       ++G +I  IG ++HPE + TL      ++ LIET  D    + +    +    QTT+SI +   I   L+ ++ NI    K DIC A  +RQ AV  +   VD ++VVG   S+NS++L E+  ++  + + L     +I    F     L +T+G S P
  S:     7 LKILLCSPRGFCAGVVRAIDTVERALALY-GAPVYVRHEIVHNRYVVDSLRAKG-----------AIFVEELAEIPNTQAP--VVFSAHGVPKSVPAESLQRNFFSLDATCPLVTKVHREAAIHFKRGREILLIGHSHHPEVVGTLGQLPAGAVSLIETAADAAAYQPKDPDNLAFVTQTTLSIDDTAGIVAILRERFPNISGPHKEDICYATTNRQAAVKKVAPIVDAMIVVGAPNSSNSQRLREVAEREGCKIAVLAQRADDIDWTLFQGITSLGLTAGASAP 277
>gi|68067323|ref|XP_675632.1| LytB protein [Plasmodium berghei strain ANKA] >gi|56494929|emb|CAH95617.1| LytB protein, putative [Plasmodium berghei] (349 aa)
Score = 291, Expect = 1.9e-24, Identities = 94/285 (32%), Positives = 142/285 (49%)
  Q:     6 ITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP--IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFL 290
           I PRGFCKGV  A  T +K  K++  +  Y+   +VHN  + K+LE  G                +I I+D N  P   ++  AHG   +  + A++K L+  D TC  V K H  +K K ++GY+I  IG  NH E I T +       ++E V  + N+     + +F   QTT+S+ +   I   LK KY NIE      IC A  +RQ A+  + +E D+ +VVG   S+N+KKLV     +  ++ L+    ++      N K +A+TS  STP  L    +  L
  S:    33 INPRGFCKGVSRAIETVEKCLKIFKTN-IYVKHKIVHNDIVCKDLENKG----------------AIFIEDLNEVPDGSILIYAHGISPQIKELAKKKKLIEIDATCPLVNKVHVYVKIKAKEGYKIILIGYKNHVEVIGTYNEAPDCTHIVENVEQVNNLNFSENQKLFCVTQTTLSVDDCALILNKLKEKYPNIETIPSGSICYATTNRQRALNKICTECDITIVVGSQSSSNAKKLVYSSQIRNTDAILVNTINDLDFSVLKNVKNIALTSAASTPDELTQQFVKVL 305
>gi|116749245|ref|YP_845932.1| hydroxymethylbutenyl pyrophosphate reductase [Syntrophobacter fumaroxidans MPOB] >gi|116698309|gb|ABK17497.1| hydroxymethylbutenyl pyrophosphate reductase [Syntrophobacter fumaroxidans MPOB] (580 aa)
Score = 291, Expect = 1.9e-24, Identities = 83/291 (28%), Positives = 133/291 (45%)
  Q:     1 MKIIKITPRGFCKGVVDAY-ATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIE-IKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSI-ILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           MK++     GFCKGV DA   T   I            G L+HN++++  LE  GI+            ++ IE   D+     V+  AHG   +T       G  + D TC  V K H  IK    +GY    +G  +H E I  +   +   ++I  V  +  +  E E  + V  QTT +   F+EI E    KY   + KN IC++  +RQ  V  M S V+ +++VG   S N+ +L ++  + +I ++ +     +  +       + +++G STP WL   V+ FLE
  S:     1 MKVLVAKTAGFCKGVRDALEVTLGAIKNQQDGENICTFGPLIHNRQVLAMLEAKGIRE-----------VNEIEGCADRK----VVIRAHGIPPETRQTLHRLGATLLDATCKRVAKVHAAIKRHARRGYYTVIVGDADHAEVIGLMGYTEGRGVVINRVEQLNELPAEWENVLLVA-QTTQNEEVFQEIQEEFLKKYPKGKVKNTICDSTHERQTEVREMCSLVEAMVIVGGFHSGNTLRLAQVARECEIPTYHVETEAELNPQELAKYSRVGVSAGASTPNWLIRNVVRFLE 278
>gi|57239245|ref|YP_180381.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ehrlichia ruminantium str. Welgevonden] >gi|71152181|sp|Q5HB13|ISPH_EHRRW 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|57161324|emb|CAH58247.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ehrlichia ruminantium str. Welgevonden] (328 aa)
Score = 290, Expect = 2.4e-24, Identities = 89/294 (30%), Positives = 150/294 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK-YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEI-GIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKL 294
           +++I   PRGFC GV  A    K   + Y + +  Y++  +VHNK I++ L+ +G+   D             ++    +  ++I+SAHG  +     A  + L V D TC  V K H  ++   + GYQ+  IG   H E   T+  I   +I+++ +NDI+ I       +    QTT+S+ + + I + LK K+ NI+  +  DIC A ++RQ     +   VD++ ++G   S+NS +L E+ GI  Q ++ LI + K I      +   + IT+G S P  L   VI FL++ +
  S:    13 VEVILARPRGFCAGVSRAIEIVKLAIEYYKDTKTIYVLHEIVHNKYIVETLKTMGVIFID-------------KVDQAQDGSVLIYSAHGVSKSIKQLAELRDLEVIDATCPLVNKVHKEVQLYDKSGYQVILIGHKGHREVEGTVGQISTPVIIVQNLNDIDKIEIFDPDKLAYVTQTTLSVDDTKVIIDKLKKKFPNIKGPDLKDICYATQNRQTTTKRLAELVDIVFILGSKNSSNSNRLKELAGI--QTQAFLIDSYKEIDLNLLNDITKIGITAGASAPDILVQQVIDFLKQHM 296
>gi|58579207|ref|YP_197419.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Ehrlichia ruminantium str. Welgevonden] >gi|58417833|emb|CAI27037.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (EC 1.17.1.2) [Ehrlichia ruminantium str. Welgevonden] (332 aa)
Score = 289, Expect = 2.7e-24, Identities = 89/294 (30%), Positives = 150/294 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK-YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEI-GIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKL 294
           +++I   PRGFC GV  A    K   + Y + +  Y++  +VHNK I++ L+ +G+   D             ++    +  ++I+SAHG  +     A  + L V D TC  V K H  ++   + GYQ+  IG   H E   T+  I   +I+++ +NDI+ I       +    QTT+S+ + + I + LK K+ NI+  +  DIC A ++RQ     +   VD++ ++G   S+NS +L E+ GI  Q ++ LI + K I      +   + IT+G S P  L   VI FL++ +
  S:    17 VEVILARPRGFCAGVSRAIEIVKLAIEYYKDTKTIYVLHEIVHNKYIVETLKTMGVIFID-------------KVDQAQDGSVLIYSAHGVSKSIKQLAELRDLEVIDATCPLVNKVHKEVQLYDKSGYQVILIGHKGHREVEGTVGQISTPVIIVQNLNDIDKIEIFDPDKLAYVTQTTLSVDDTKVIIDKLKKKFPNIKGPDLKDICYATQNRQTTTKRLAELVDIVFILGSKNSSNSNRLKELAGI--QTQAFLIDSYKEIDLNLLNDITKIGITAGASAPDILVQQVIDFLKQHM 300
>gi|46201873|ref|ZP_00208286.1| COG0761: Penicillin tolerance protein [Magnetospirillum magnetotacticum MS-1] (309 aa)
Score = 289, Expect = 2.7e-24, Identities = 85/287 (29%), Positives = 139/287 (48%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI-ESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M ++  +PRGFC GV  A    ++      A +Y  HE      +VHN+ +++ L + G    ++ +          E+ D+     V+FSAHG  +    +A  +GL   D TC  VTK H   +     G QI  IG   HPE I T+    D +++L+ T  + E +  ++   +    QTT+S+ +   +TE L+ ++  I    + DIC A  +RQ AV  +  + + L+V+G   S+NS +LVE+  +     S L+     +          L IT+G S P  L   V+
  S:     1 MTLVLASPRGFCAGVDRAIHIVERALEKYGAPVYVRHE------IVHNRFVVESLAQKGAVFVEELD----------EVPDE---AAVVFSAHGVPKTVPAEADRRGLTSLDATCPLVTKVHREAELHHAMGRQIIMIGHAGHPEVIGTIGQVPDGTVLLVGTPEEAEKVAPKNASMLAYITQTTLSVDDAAAVTEVLQRRFPEIVGPKREDICYATTNRQAAVKTIAPKCEALMVIGSPNSSNSSRLVEVAARAGCARSVLVQRAAEVDWSLLDGVDRLGITAGASAPEILVEEVV 278
>gi|118590746|ref|ZP_01548147.1| hydroxymethylbutenyl pyrophosphate reductase [Stappia aggregata IAM 12614] >gi|118436722|gb|EAV43362.1| hydroxymethylbutenyl pyrophosphate reductase [Stappia aggregata IAM 12614] (333 aa)
Score = 289, Expect = 3.2e-24, Identities = 87/280 (31%), Positives = 142/280 (50%)
  Q:     8 PRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESH-LIWNTKNIKDEW--FINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV  A      A  K  + +Y  HE      +VHNK ++  L+ +G    ++        ++ I     + P  VIFSAHG  +   + A+ + +   D TC  V+K H   +    +  +I  IG   HPE I T+    + ++ LIET +D      ++++P+    QTT+S+ +   I   L+ ++  I    K DIC A  +RQ+AV ++  +VD ++VVG   S+NS++L E+  +    +  LI    +I  +W  F     L +T+G S P  L   +I
  S:    19 PRGFCAGVDRAIQIVELALEKYGSPVYVRHE------IVHNKFVVDGLKAMGAVFVEE--------LEEIPAGHTDRP--VIFSAHGVPKSVPEDAQSRKMFYLDATCPLVSKVHKEAEIHFRRDREILLIGHAGHPEVIGTMGQLPEGTVSLIETEDDARAFTPKTDRPLAYITQTTLSVDDTAGIVAVLQERFPQIVAPHKEDICYATTNRQEAVKHVAPKVDAMIVVGAPNSSNSQRLREVAERAGCRTAVLIQRATDI--DWLDFEGISSLGLTAGASAPETLVEEII 292
>gi|154251142|ref|YP_001411966.1| hydroxymethylbutenyl pyrophosphate reductase [Parvibaculum lavamentivorans DS-1] >gi|154155092|gb|ABS62309.1| hydroxymethylbutenyl pyrophosphate reductase [Parvibaculum lavamentivorans DS-1] (318 aa)
Score = 288, Expect = 3.7e-24, Identities = 94/287 (32%), Positives = 144/287 (50%)
  Q:     1 MKIIKITPRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPI---VIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTES-EKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           + ++  +PRGFC GV  A      A  K    +Y  HE      +VHN+ +++ELE  G                +I +++ +  P    VIFSAHG  +     A+ + L   D TC  V+K H   +    +G++I  IG   HPE I T+    + S+ LIET  D E  + +  EK  FVT QTT+S+ +   I   L+ ++  I    K DIC A  +RQ+AV  +   VD +LV+G   S+NS +LVE+  +     + L+    +I      +   + +T+G S P  L   VI
  S:    10 LTLLLASPRGFCAGVDRAIQIVELAIEKYGPPVYVRHE------IVHNRYVVEELERKG----------------AIFVEELDEVPSGAKVIFSAHGVPKAVPADAQSRELFYLDATCPLVSKVHVEAERLYSRGHEILLIGHAGHPEVIGTMGQLPEGSVRLIETAADAEAFQPQDPEKVAFVT-QTTLSVDDTAAIVAILRRRFPAIAGPRKEDICYATTNRQEAVKAIAPLVDAMLVIGAPNSSNSMRLVEVAERAGCRYAALLQRATDIDWAALGSPAIVGLTAGASAPEVLVEEVI 287
>gi|78222086|ref|YP_383833.1| LytB protein [Geobacter metallireducens GS-15] >gi|123572476|sp|Q39XB6|ISPH_GEOMG 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|78193341|gb|ABB31108.1| LytB protein [Geobacter metallireducens GS-15] (282 aa)
Score = 288, Expect = 3.9e-24, Identities = 81/287 (28%), Positives = 132/287 (45%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+II     GFC GV  A     + A+     + Y +G ++H+ +++  LEE+G++          EI D            +I  +HG   + +++A  K L V D TC +V K  + ++   E GY++  +G  +HPE    +S  K  + +   ++ E  R    K I +  QTT S    + +      K   I   N IC+A   RQ     +   VD ++V+G   S N+K+L E+  + Q  +H I   + I   WF     + +T+G STP WL + VI
  S:     1 MEIILAKRAGFCFGVKRATQMAFEAAE--KEGKTYSLGPIIHSPQVVHRLEEMGVKVLK----GLGEITDGT----------IIVRSHGVTSEELEEAVRKELEVVDATCPFVKKAQENVQNLSEAGYEVVVVGDADHPEVQGIVSYAKGKVCV-VGSEEEAARLPKMKKIGIVAQTTQSFDNLKHVVLECLRKGAEIRIFNTICDATAVRQQEATALARTVDCMIVIGGYNSANTKRLAEVCAELQPRTHQIETAQEINPAWFEGVAKVGVTAGASTPKWLIDEVI 270
>gi|145222667|ref|YP_001133345.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium gilvum PYR-GCK] >gi|189045812|sp|A4T986|ISPH_MYCGI 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|145215153|gb|ABP44557.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium gilvum PYR-GCK] (333 aa)
Score = 288, Expect = 3.9e-24, Identities = 82/286 (28%), Positives = 137/286 (47%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGI-KKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRG+C GV  A  T ++      A +Y  HE      +VHN+ ++  L + G                +I ++  +  P   IV+FSAHG       +A  + L   D TC  VTK H+  K      Y I  +G   H E + T       + +++  + ++N+       +   +QTT+S+ E  E    L+ K+  ++    +DIC A ++RQ AV  M  E +L++VVG   S+NS +LVE+ +      +HL+   ++I   W      + +TSG S P  L   V+
  S:    24 RVLLAEPRGYCAGVDRAVETVERALEKHGAPIYVRHE------IVHNRYVVDTLAKAG----------------AIFVEQTDEVPEGAIVVFSAHGVAPTVHVEAAARNLKTIDATCPLVTKVHNEAKRFARDDYDILLVGHEGHEEVVGTAGEAPDHVQVVDNPDAVDNVVVRDPNKVIWLSQTTLSVDETMETVRRLREKFPTLQDPPSDDICYATQNRQVAVKAMAPECELVIVVGSKNSSNSVRLVEVALGAGSRAAHLVDYAEDIDPAWLDGVTTVGVTSGASVPEILVRGVL 299
>gi|20807799|ref|NP_622970.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Thermoanaerobacter tengcongensis MB4] >gi|24211879|sp|Q8RA76|ISPH_THETN 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|20516356|gb|AAM24574.1| Penicillin tolerance protein [Thermoanaerobacter tengcongensis MB4] (288 aa)
Score = 287, Expect = 5.3e-24, Identities = 88/287 (30%), Positives = 148/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETIST--LSIDKSIILIETVNDIENIRTESEKPIF----VTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+I+     GFC GV  A     +      +   Y +G ++HN +++K+LEE G++           +I+  E++       +I  +HG  +K  +   +KG+ + D TC +V K  ++++E  ++GY I  +G  NHPE I       DK+ I + +V + EN+      P F      +QTT+    +E+I E LKSK K + + N ICNA + RQ+A   +  +VD++ V+G   S+N++KL +I  K    ++ I     I  E       + IT+G STP ++   VI
  S:     1 MEILIAEHAGFCFGVKRAIEIAYEELNKQKDTRLYTLGEIIHNPQVVKDLEEKGVR-----------VIEEEELEKLLKGDRLIIRSHGISKKLYEFLEQKGVEIIDVTCPFVKKVQNIVEEYYKKGYDIVIVGDKNHPEVIGVNGWCEDKAYI-VNSVEEAENL------PFFEKACAVSQTTLIEKHWEDILEVLKSKAKELVYFNTICNATQKRQEAADALSKKVDVMFVIGGKHSSNTQKLRKICEKNCKNTYHIERADEITFEMLKGHDIIGITAGASTPDYVIEEVI 275
>gi|114566869|ref|YP_754023.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114337804|gb|ABI68652.1| hydroxymethylbutenyl pyrophosphate reductase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (687 aa)
Score = 287, Expect = 5.8e-24, Identities = 80/278 (28%), Positives = 139/278 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           GFC GV  A    ++ A+     + + +G LVHN E++    + GI           E +D +E +    P  +I  +HGT  + I +A+E GL V D TC+ V K H+++     + Y I   G   HPE    L    +   ++ + +++  +    +  + + +QTT    EF+++   L +K + ++  N IC+A + RQ+A   +  +VDL+LV+GD+KS+N++ L +      + +  I     IK EW      + IT+G STP W+   V+
  S:    10 GFCAGVRKAVKIAEEAAE--EPDKWFSLGPLVHNDEVVNYFRQKGI-----------EPVDMLE-RIGEQPAGIIIRSHGTSPEVIKQAQELGLEVRDATCVLVKKIHEIVTRLRGEDYDIVVFGDARHPEVEGILGWCGQRASVVASADEVGYLPVMPK--VALISQTTRDEKEFQKVAGALSNKCRELKVFNTICSATRSRQEAARELCRKVDLMLVIGDLKSSNTRTLSKECQNTGVRTFQIQKASEIKPEWLDGVSKIGITAGASTPDWIIKEVL 272
>gi|121601859|ref|YP_988725.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bartonella bacilliformis KC583] >gi|166217149|sp|A1URX2|ISPH_BARBK 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|120614036|gb|ABM44637.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bartonella bacilliformis KC583] (349 aa)
Score = 287, Expect = 6.0e-24, Identities = 86/287 (29%), Positives = 143/287 (49%)
  Q:     7 TPRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDK-SIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIK-KQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           +PRGFC GV  A      A  K  A +Y  HE      +VHN+ +++ L++ G    ++        +D I  K +  P  V+FSAHG  +   +KA    L   D TC  V+K H         G  +  IG + HPE I T+  ++K ++ LIETV D    + E+   +    QTT+S+ +   I + L+ ++  +E      IC A  +RQ+AV       DL L+VG   S+N+++LVE+  +    +S L+    +I  +       +++++G S P  + + +I    K+
  S:    13 SPRGFCAGVDRAIQIVILALKKYGAPVYVRHE------IVHNRYVVEGLQQRGAVFVEE--------LDEIPEKHRGQP--VVFSAHGVPKSVSEKASLYNLFYLDATCPLVSKVHKQAIRHQRHGRHVILIGHSGHPEVIGTMGQLEKGAVTLIETVEDALYYQPENPNKLGFVTQTTLSVEDTAGILDVLQKRFPALESPATESICYATTNRQEAVKAAALGSDLFLIVGSSNSSNARRLVEVAERFGARQSILVQRADDIDFDRLGTLSVISLSAGASAPEIIVDEIITAFRKR 293
>gi|28210997|ref|NP_781941.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Clostridium tetani E88] >gi|50401023|sp|Q895G2|ISPH_CLOTE 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|28203436|gb|AAO35878.1| conserved protein [Clostridium tetani E88] (635 aa)
Score = 286, Expect = 6.6e-24, Identities = 89/293 (30%), Positives = 142/293 (48%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           M II     GFC GV  A  TC KI + YP+   Y +G L+HN +++  L+   I +   +N      ID+++  D     I+I  +HG   +TI K +EK L + D TC YV+      ++  ++GY I  +G  NHPE I      + S I+     +IE++     K I V +QTT     +  +   + ++ + +   N ICNA + RQ +  ++  EVD ++V+G   S+N+ KL EI       +  I N   + D        + +T+G STP W+    I  +  K
  S:     1 MSIILAKKSGFCYGVKRAVDTCLKIKQNYPDKIIYTLGPLIHNNDVVDFLKTKNIFSIGYEN------IDTLKEGD-----IIILRSHGVTLETIQKLKEKKLNIIDATCPYVSNIQKKAQKYYKEGYSILIVGDKNHPEVIGINGWCNNSAIICRKAEEIEDL----PKKICVVSQTTEKKEHWISVLSKVVNECREVVAFNTICNATEVRQLSAEDLSKEVDFMIVIGSKSSSNTTKLYEICKNNCSNTIHIENAGELPDYISNKYSKIGVTAGASTPDWIIKEAIFKMSNK 279
>gi|110601843|ref|ZP_01390009.1| hydroxymethylbutenyl pyrophosphate reductase [Geobacter sp. FRC-32] >gi|110547460|gb|EAT60720.1| hydroxymethylbutenyl pyrophosphate reductase [Geobacter sp. FRC-32] (285 aa)
Score = 285, Expect = 8.4e-24, Identities = 76/291 (26%), Positives = 137/291 (47%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           MKII     GFC GV  A     + A      + + +G ++H+ +++++LEE+G++            ++++   D+     +I  +HG     +++A  K L + D TC +V K  + +K     GY +  +G  +HPE    +S     + +    + E ++      I V  QTT S      + +    K   I   + IC+A   RQ+    + S+VD ++V+G   S N+K+L E+  + Q  +H I   + +   WF   K + IT+G STP W+ + V+  +E
  S:     4 MKIILAKQAGFCFGVKRATQIAFEAAG--KGGKTFTLGPIIHSPQVVQKLEEMGVKA-----------LENVAGMDEGT---IIIRSHGAASDELEEAVRKQLDILDATCPFVKKAQEHVKNLSNSGYDVVVVGDADHPEVQGIVSYATGKVYVVASGE-EAVKLPKMGKIGVVAQTTQSFENLRHVVDACLVKGGEIRVFHTICDATAVRQEEAKKLASQVDCMVVIGGYNSANTKRLAEVSAEIQPRTHHIEMAQQLDPAWFEGVKIVGITAGASTPKWIIDEVLEQIE 277
>gi|34558835|gb|AAQ75179.1| hydroxymethylbutenyl pyrophosphate reductase [Alvinella pompejana epibiont 7G3] (277 aa)
Score = 285, Expect = 8.4e-24, Identities = 92/287 (32%), Positives = 148/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEE---LGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDK---SIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+I   +  GFC GV  A      IA+ + N   Y  G L+HNK+ I  L+    +G+  K D            +IK+K+    V+   HG  +  +   +++   + + TC YVTK   ++++  ++ Y I   G  NHPE    +S  K   +  +I    ++E +  +S+  + V  QTT    +F EI  +L  K+K +   N ICNA  + QDA  ++    D+++V+G   S+N+K+L  I  K   +S+LI N K +K+EWF  KK   I++G STP W+   VI
  S:     1 MRIELASSYGFCYGVKRAI----NIAEKHENSITY--GPLIHNKDEINRLKSSFGIGLAHKLD------------DIKEKDT---VVIRTHGIPKNELKILKQQKNKIINATCPYVTKPQQIVEKMSQEDYSIIIFGDKNHPEIKGVVSYAKDRDNAFIILRKEELEELPLKSK--VAVVAQTTRKPADFLEIVNSLILKHKEVRVFNTICNATFENQDAAEDLAKRADIMIVIGGKHSSNTKQLHSITKKWCPDSYLIENEKELKNEWFREKKLCGISAGASTPDWIVQDVI 270
>gi|109947060|ref|YP_664288.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Helicobacter acinonychis str. Sheeba] >gi|109714281|emb|CAJ99289.1| lytB [Helicobacter acinonychis str. Sheeba] (270 aa)
Score = 285, Expect = 8.9e-24, Identities = 83/277 (29%), Positives = 140/277 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEE-LGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTES-EKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYV 286
           GFC GV  A    +K      N    + G L+HN + I  LE+   ++ ++D              KDK+    VI   HG  ++ ++  + KG+ + D TC YV K   +++   ++GYQI   G  NHPE    +S   +  L+  VN +E ++ +  ++ + + +QTT    +  +I   L  K   +   N ICNA    Q A +++  EVD+++VVG   S+N+K+L+ I  +   +S+L+ +   ++  WF +KK   IT+G STP W+   V
  S:     6 GFCFGVKRAIQIAEK------NQNSLIFGSLIHNAKEINRLEKNFNVKIEEDPKKIP---------KDKS----VIIRTHGIPKQDLEYLKNKGVKITDATCPYVIKPQQIVESMSKEGYQIVLFGDINHPEVKGVISYATNQALV--VNSLEKLQEKKLQRKVALVSQTTKQTPKLLQIASYLVEKCTEVRIFNTICNATSYNQKAALDLSKEVDIMIVVGGKTSSNTKQLLSIAKQHCKDSYLVEDENELEMAWFKDKKLCGITAGASTPDWIIENV 263
>gi|89895001|ref|YP_518488.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Desulfitobacterium hafniense Y51] >gi|89334449|dbj|BAE84044.1| hypothetical protein [Desulfitobacterium hafniense Y51] (661 aa)
Score = 285, Expect = 9.6e-24, Identities = 79/286 (27%), Positives = 138/286 (48%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYV 286
           MKII+    GFC GV  A    ++  +   +     +G L+HN+++++++E+ G++                E+K+      +I  +HG      ++AR   + V D TC +V K   L  E  + G Q+  +G   HPE    L     + I IET+ +   +    +  + V  QTT     F  I + LK+  + ++  N ICNA ++RQ     +  +VD+++VVG   S N++KL  I   ++ +++LI     ++D WF     + +T+G STP W+   V
  S:     1 MKIIRAEKAGFCFGVKRALDMAERTVQ---SSSTASLGPLIHNQQVVEKMEKQGVRVVG-------------EVKETQAGDTLIIRSHGVPPDIYEEARRCQVKVVDATCPFVQKAQRLAAESSQSG-QVVVVGDRQHPEVQGILGWAGGNAIAIETLEEARELPFYEQ--LSVLAQTTQPAANFHGIVDELKTHTQALKVHNTICNATEERQTVARELAGKVDVMIVVGGKNSANTRKLAGI-CSERTQTYLIETADELEDNWFTGVVTVGLTAGASTPDWIIEEV 267
>gi|111220888|ref|YP_711682.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase, 4Fe-4S protein (partial match) [Frankia alni ACN14a] >gi|111148420|emb|CAJ60091.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase, 4Fe-4S protein (partial match) [Frankia alni ACN14a] (597 aa)
Score = 285, Expect = 9.7e-24, Identities = 77/272 (28%), Positives = 132/272 (48%)
  Q:     8 PRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           PR FC GV  A    ++  +L+     Y+   +VHN  ++ +L   G                ++ +++ +  P    V+FSAHG      ++A  + L V D TC  V K H   +    +G  +  IG + H E   TL      I L+++  +++ +     + +    QTT+++ E EE+ + LK ++  I      DIC A  +RQ+AV  +  E  L+LVVG   S NS +LVE+  +  + SHL+ N  +++  W    + + I++G S P
  S:   271 PRAFCAGVERAIEVVERALELH-GAPVYVRKQIVHNSHVVADLAARG----------------AVFVEELDEVPAGATVVFSAHGVAPAVWNQADGRQLSVIDATCPLVEKVHAEARRFTSRGDTVLLIGHSGHEEVDGTLGEAPGRIRLVQSPEEVDALDVPDPERVTYLMQTTLAMDEAEEVVDALKERFPAIVGPGSADICYATSNRQNAVRKVAQEAQLVLVVGSANSANSVRLVEVSRRDGVASHLVENVGDVELSWLDGVETVGISAGASAP 531
>gi|118727497|ref|ZP_01576096.1| hydroxymethylbutenyl pyrophosphate reductase [Clostridium cellulolyticum H10] >gi|118663140|gb|EAV69802.1| hydroxymethylbutenyl pyrophosphate reductase [Clostridium cellulolyticum H10] (672 aa)
Score = 284, Expect = 1.2e-23, Identities = 86/287 (29%), Positives = 143/287 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+++     GFC GV +A     ++A    +H+ Y +G ++HN +++++L + G+ T D+   + +             P  V+  AHG   K I+  + +GL V D +C YV K H L+ +K ++GYQI   G   HPE I      D S  +IE   +++ +  + +K I V  QTT    ++E+I   L  +++N+   + ICNA   RQ     +   VD++LV+G   S+N+ KL +I       +  I    +I        K + IT+G STP W+   VI
  S:     1 MELVIANSAGFCFGVNNAVKIVFELAT-KSDHKIYTLGPIIHNDQVVQKLTKHGVTTIDNPEEAVA-------------PAKVVIRAHGVGPKIIEGLKNRGLEVVDASCRYVEKIHSLVNKKYKEGYQIIIAGDKTHPEIIGINGWCDNSAFIIEDEYNVDKL-PDIKKKICVVAQTTFIREKWEKIILRLNKRFENVLKFDTICNATDKRQTEAEKISKIVDMVLVIGGNNSSNTNKLYQICKTNCDNTFKIQTADDIPPVDIKKIKKIGITAGASTPDWVIKEVI 273
>gi|109645329|ref|ZP_01369249.1| hydroxymethylbutenyl pyrophosphate reductase [Desulfitobacterium hafniense DCB-2] >gi|109643278|gb|EAT52831.1| hydroxymethylbutenyl pyrophosphate reductase [Desulfitobacterium hafniense DCB-2] (661 aa)
Score = 284, Expect = 1.3e-23, Identities = 79/286 (27%), Positives = 137/286 (47%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYV 286
           MKII+    GFC GV  A    ++  +   +     +G L+HN+++++++E+ G++                E+K+      +I  +HG      ++AR   + V D TC +V K   L  E  + G Q+  +G   HPE    L     + I IET+ +   +    +  + V  QTT     F  I + LK+    ++  N ICNA ++RQ     +  +VD+++VVG   S N++KL  I   ++ +++LI     ++D WF     + +T+G STP W+   V
  S:     1 MKIIRAEKAGFCFGVKRALDMAERTVQ---SSSTASLGPLIHNQQVVEKMEKQGVRVVG-------------EVKETQAGDTLIIRSHGVPPDIYEEARRCQVKVVDATCPFVQKAQRLAAESSQSG-QVVVVGDRQHPEVQGILGWAGGNAIAIETLEEARELPFYEQ--LSVLAQTTQPAANFHGIVDELKTHTHALKVHNTICNATEERQTVARELAGKVDVMIVVGGKNSANTRKLAGI-CSERTQTYLIETADELEDNWFTGVVTVGLTAGASTPDWIIEEV 267
>gi|148263532|ref|YP_001230238.1| hydroxymethylbutenyl pyrophosphate reductase [Geobacter uraniireducens Rf4] >gi|189045809|sp|A5GE10|ISPH_GEOUR 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|146397032|gb|ABQ25665.1| hydroxymethylbutenyl pyrophosphate reductase [Geobacter uraniireducens Rf4] (282 aa)
Score = 282, Expect = 2.0e-23, Identities = 78/292 (26%), Positives = 138/292 (47%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           MK+I     GFC GV  A     + A      + Y +G ++H+ +++++LEE+G++   D             I   ++  I+I S HG     +++A  K L + D TC +V K  + ++   + GY +  +G  +HPE    +S     + +    D E  +      I V  QTT S    + + +   +K   I   + IC+A   RQ+    + S+VD ++V+G   S N+K+L E+  + Q  ++ I   + +   WF     + +T+G STP WL + V+  +EK
  S:     1 MKVILAKQAGFCFGVKRATQMAFEAAD--KGGKTYTLGPIIHSPQVVQKLEEMGVKALKD-------------ISGMDDGTIIIRS-HGVASGELEEAVRKELEIVDATCPFVKKAQEHVESLSQAGYDVVVVGDADHPEVQGIVSYASGKVYVVGSGD-EAAKLPKMAKIGVVAQTTQSFENLKNVVDACLTKGGEIRVFHTICDATAVRQEEAKELASQVDCMIVIGGYNSANTKRLAEVCTELQPRTYHIEMAQQLNPRWFEGVGKVGVTAGASTPKWLIDEVLEQIEK 275
>gi|118474670|ref|YP_892407.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter fetus subsp. fetus 82-40] >gi|166217153|sp|A0RQC4|ISPH_CAMFF 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|118413896|gb|ABK82316.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter fetus subsp. fetus 82-40] (279 aa)
Score = 282, Expect = 2.3e-23, Identities = 90/291 (30%), Positives = 148/291 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSID-KSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           MKI      GFC GV  A     KIA+   N     IG L+HN   I  L+          N +   + D  E+K++      I   HG  ++ +   + + + + D TC +VTK   ++++   +GY+I + G  NHPE    +S   K++ +I   +++E ++  S+  I V +QTT  I +F +I   L  + K +   N ICNA  + Q+AV  + S  D+++++G   S+N+K+L  I      +S+LI +   ++ +WF NKK   I++G STP W+   VI  LE
  S:     1 MKIELAKSYGFCFGVKRAI----KIAENSKNAST--IGELIHNSLEIDRLK---------NNFNVKTLKDISELKNEKK---AIIRTHGITKEGLANLKSRDVEIIDATCPFVTKPQQIVEKMSSEGYEIVFFGDINHPEVKGVMSYSSKNVYVILDESELETVKLPSK--IAVVSQTTKKIEKFTKIVSYLMQRVKEVRVFNTICNATLENQEAVRELSSRADVMVIIGGKNSSNTKQLYLISKNLCPDSYLIESENELELKWFQNKKLCGISAGASTPEWVIQNVINKLE 272
>gi|126436907|ref|YP_001072598.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium sp. JLS] >gi|166217173|sp|A3Q4N0|ISPH_MYCSJ 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|126236707|gb|ABO00108.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium sp. JLS] (333 aa)
Score = 282, Expect = 2.3e-23, Identities = 80/286 (27%), Positives = 137/286 (47%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRG+C GV  A  T ++      A +Y  HE      +VHN+ ++  L + G                ++ ++  +  P   IV+FSAHG       +A  + L   D TC  VTK H+  K      Y I  +G   H E + T       + +++  + ++ +       +   +QTT+S+ E  E    L+ K+  ++    +DIC A ++RQ AV  M  E +L++VVG   S+NS +LVE+ +    + +HL+   ++I   W      + +TSG S P  L   V+
  S:    24 RVLLAEPRGYCAGVDRAVETVERALEKHGAPVYVRHE------IVHNRYVVDTLAKAG----------------AVFVEQTDEVPEGAIVVFSAHGVAPTVHVEAAARNLKTIDATCPLVTKVHNEAKRFARDDYDILLVGHEGHEEVVGTAGEAPDHVQVVDNPDAVDKVTVRDPDKVIWLSQTTLSVDETMETVRRLREKFPTLQDPPSDDICYATQNRQVAVKAMAPECELVIVVGSKNSSNSVRLVEVALGAGSDAAHLVDYAEDIDPTWLDGVTTVGVTSGASVPEVLVRGVL 299
>gi|50955263|ref|YP_062551.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Leifsonia xyli subsp. xyli str. CTCB07] >gi|71152187|sp|Q6ADV0|ISPH_LEIXX 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|50951745|gb|AAT89446.1| penicillin-tolerance protein [Leifsonia xyli subsp. xyli str. CTCB07] (337 aa)
Score = 282, Expect = 2.3e-23, Identities = 78/286 (27%), Positives = 134/286 (46%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRG+C GV  A    +K  + Y     Y+   +VHN  ++ ELE  G    D             E+ +      ++FSAHG     +  A ++GL   D TC  VTK H          ++I  IG   H E   T     + + L+ + ++ + I  +    +   +QTT+S+ E  E    L+ ++ N++    +DIC A ++RQ A+  +    DL++VVG   S+NS +LVE+ ++   + ++ +     I+ EW      + +TSG S P  L   V+
  S:    15 RVLLAAPRGYCAGVDRAVIAVEKALERY-GAPVYVRKQIVHNIHVVSELERQGAIFVD-------------EVDEVPEGAHIVFSAHGVSPAVVAAAADRGLRAIDATCPLVTKVHREAVRFARDDFEILLIGHEGHEEVEGTAGHAPERVTLVNSPDEADTIEVKDPDRVVWLSQTTLSVDETMETVRRLRERFPNLQNPPSDDICYATQNRQVAIKKVAQSADLVIVVGSANSSNSVRLVEVALEYGAKAAYRVDYASEIRQEWLDGVATVGVTSGASVPEVLVQEVL 290
>gi|108801069|ref|YP_641266.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium sp. MCS] >gi|119870211|ref|YP_940163.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium sp. KMS] >gi|123069758|sp|Q1B4H4|ISPH_MYCSS 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|166217174|sp|A1UKL5|ISPH_MYCSK 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|108771488|gb|ABG10210.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium sp. MCS] >gi|119696300|gb|ABL93373.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium sp. KMS] (333 aa)
Score = 281, Expect = 2.3e-23, Identities = 80/286 (27%), Positives = 137/286 (47%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +++   PRG+C GV  A  T ++      A +Y  HE      +VHN+ ++  L + G                ++ ++  +  P   IV+FSAHG       +A  + L   D TC  VTK H+  K      Y I  +G   H E + T       + +++  + ++ +       +   +QTT+S+ E  E    L+ K+  ++    +DIC A ++RQ AV  M  E +L++VVG   S+NS +LVE+ +    + +HL+   ++I   W      + +TSG S P  L   V+
  S:    24 RVLLAEPRGYCAGVDRAVETVERALEKHGAPVYVRHE------IVHNRYVVDTLAKAG----------------AVFVEQTDEVPEGAIVVFSAHGVAPTVHVEAAARNLKTIDATCPLVTKVHNEAKRFARDDYDILLVGHEGHEEVVGTAGEAPDHVQVVDNPDAVDKVTVRDPDKVIWLSQTTLSVDETMETVRRLREKFPTLQDPPSDDICYATQNRQVAVKAMAPECELVIVVGSKNSSNSVRLVEVALGAGSDAAHLVDYAEDIDPTWLNGVTTVGVTSGASVPEVLVRGVL 299
>gi|39997698|ref|NP_953649.1| penicillin tolerance protein LytB [Geobacter sulfurreducens PCA] >gi|50400913|sp|Q749Y8|ISPH_GEOSL 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|39984590|gb|AAR35976.1| penicillin tolerance protein LytB [Geobacter sulfurreducens PCA] (282 aa)
Score = 281, Expect = 2.9e-23, Identities = 77/287 (26%), Positives = 134/287 (46%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+I+     GFC GV  A     + A+     E + +G ++H+ ++++ LE +G++   D             ++   N  ++I S HG     ++ A  + L V D TC +V K  + +K     GY +  +G  +HPE    +S  +  + +    + E  R  + K + V  QTT S    + + +    K   I   N IC+A   RQD    +  EVD ++V+G   S N+K+L E+  + Q  ++ I   + +   WF   + + +T+G STP WL + VI
  S:     1 MEIVLAKRAGFCFGVKRATQMAFEAAE--KEGETFTLGPIIHSPQVVQRLEGMGVKVLSD-------------LEGIGNGTVIIRS-HGVTSAELEDAVRRQLEVVDATCPFVKKAQEHVKRLSHDGYTVVVVGDADHPEVQGIVSYAEGPVHVVGSGE-EAARLPNMKKVGVVAQTTQSFETLKNVVKECLLKGGEIRVFNTICDATAVRQDEAKALAREVDCMIVIGGFNSANTKRLAEVCSELQPRTYHIETAQELDASWFQGVERVGVTAGASTPKWLIDEVI 270
>gi|62424257|ref|ZP_00379405.1| COG0761: Penicillin tolerance protein [Brevibacterium linens BL2] (352 aa)
Score = 280, Expect = 3.3e-23, Identities = 79/289 (27%), Positives = 139/289 (48%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI-ESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFL 290
           K++   PRG+C GV  A    ++  + Y     Y+   +VHN+ ++  L E G                ++ + + +  P    ++FSAHG       +A  + L   D TC  VTK H         GY+I  +G   H E   T+      I LI+   + + ++ +  + +   +QTT+S+ E  E    L+ ++ +++    +DIC A  +RQ AV  +  + DL+LVVG   S+NS +LVE+ ++    ++H I   + + + WF +   + +TSG S P  L   ++  L
  S:    23 KVLLAAPRGYCAGVDRAVIAVERALEHY-GAPVYVRKEIVHNRHVVDTLSERG----------------AVFVNETDEVPEGARLVFSAHGVSPAVHAEAAARELSTIDATCPLVTKVHREAVRFARDGYRILLVGHAGHEEVEGTMGEAPDDITLIQNPEEAKTVQIDDAESLVWLSQTTLSVDETMETVNILRERFPHLQDPPSDDICYATSNRQVAVKKIAPQSDLVLVVGSANSSNSVRLVEVALEHGAKDAHRIDFAREVDETWFHDVATVGVTSGASVPEGLVQDLLKLL 301
>gi|118464410|ref|YP_880476.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium avium 104] >gi|118165697|gb|ABK66594.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium avium 104] (296 aa)
Score = 280, Expect = 3.4e-23, Identities = 79/260 (30%), Positives = 125/260 (48%)
  Q:    28 LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEI-GIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +Y  HE      +VHN+ ++  LE+ G                ++ +++ +  P   IV+FSAHG        A E+ L   D TC  VTK H+  +      Y I  IG   H E + T       + L++ V  ++N+    E  +   +QTT+S+ E  EI E L+ ++  ++    +DIC A ++RQ AV  M  E DL++VVG   S+NS +LVE+        +HL+    +I   W      + +TSG S P  L   V+
  S:    19 VYVRHE------IVHNRHVVSTLEKAG----------------AVFVEETDEVPEGAIVVFSAHGVAPTVHAAAAERNLHTIDATCPLVTKVHNEARRFARNDYDILLIGHEGHEEVVGTAGEAPDHVQLVDGVAAVDNVTVRDEDKVVWLSQTTLSVDETMEIVERLRQRFPKLQDPPSDDICYATQNRQVAVKAMAPECDLVIVVGSRNSSNSVRLVEVALGGGAGAAHLVDWADDIDPAWLEGVTTVGVTSGASVPEVLVQGVL 263
>gi|15792224|ref|NP_282047.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|86150245|ref|ZP_01068472.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88597611|ref|ZP_01100845.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni subsp. jejuni 84-25] >gi|166217157|sp|P0C632|ISPH_CAMJE 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|85839361|gb|EAQ56623.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88190203|gb|EAQ94178.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni subsp. jejuni 84-25] >gi|112360220|emb|CAL35015.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni subsp. jejuni NCTC 11168] (277 aa)
Score = 280, Expect = 3.4e-23, Identities = 85/282 (30%), Positives = 143/282 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEE-LGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           GFC GV  A    ++I       +   IG L+HN E I  L++   ++T ++             I+  +N    I   HG  ++ +++ R+K + +FD TC +VTK   + ++  ++GY++   G  NHPE     S +     ++    +++NI+  ++  I V +QTT     F EI   L  K K +   N IC+A    QDA+  +  + D+++VVG   S N+K+L  I      +S+LI   + +K EWF++KK   I++G STP W+   VI  +E
  S:    10 GFCFGVKRAIKKAEQI------KDAATIGPLIHNNEEISRLQKNFNVKTLEN-------------IQALSNEKKAIIRTHGITKQDLEELRKKDIEIFDATCPFVTKPQQICEQMSKEGYEVVIFGDENHPEVKGVKSYVSTKAYVVLDKKELQNIKLPNK--IAVVSQTTKKPEHFMEIVNFLILKTKEVRVFNTICDATFKNQDAIKELSLKSDVMVVVGGKNSANTKQLFLIAKTNCEDSYLIETEEELKKEWFLDKKHCGISAGASTPDWIIQKVIAKIE 272
>gi|32265637|ref|NP_859669.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Helicobacter hepaticus ATCC 51449] >gi|50400966|sp|Q7VJV5|ISPH_HELHP 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|32261685|gb|AAP76735.1| penicillin tolerance protein LytB [Helicobacter hepaticus ATCC 51449] (273 aa)
Score = 280, Expect = 3.5e-23, Identities = 82/286 (28%), Positives = 139/286 (48%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYV 286
           MK+      GFC GV  A    ++      N      G L+HN    +E+E L  Q   D + SRS       +++      VI   HG  +  +   +E    + D TC +VTK   ++++  ++GYQI   G N+HPE     S    + +I  +++++++  +  K + + +QTT     F +I   L S        N IC+A  + Q AV  +  E D++++VG   S+N+K+L +I  +   +S+LI +   I + WF+ K+   IT+G STP W+ + V
  S:     1 MKVKFAKKYGFCFGVKRAIRIAER------NQHATTFGPLIHNS---REIERL--QKDFDVSLSRS-------LEEAQKFKSVIVRTHGITKDDLQVLKEHHTHIIDATCPFVTKPQQIVEKMSQEGYQIIIFGDNSHPEVKGVASYGDDVAIIANIDELKHLTLK--KKVALVSQTTKQPEHFGKIAALLVSLVNECRIFNTICSATFENQFAVDELSREADIMVIVGGKNSSNTKQLFKIAKEYCTDSYLIEDENEIDNTWFVGKELCGITAGASTPDWIISRV 266
>gi|57237723|ref|YP_178971.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni RM1221] >gi|86152095|ref|ZP_01070307.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni subsp. jejuni 260.94] >gi|86153518|ref|ZP_01071722.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni subsp. jejuni HB93-13] >gi|157415151|ref|YP_001482407.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni subsp. jejuni 81116] >gi|166217155|sp|A8FLU3|ISPH_CAMJ8 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|71152177|sp|Q5HUR4|ISPH_CAMJR 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|57166527|gb|AAW35306.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni RM1221] >gi|85840880|gb|EAQ58130.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni subsp. jejuni 260.94] >gi|85843244|gb|EAQ60455.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni subsp. jejuni HB93-13] >gi|157386115|gb|ABV52430.1| lytB-like protein [Campylobacter jejuni subsp. jejuni 81116] (277 aa)
Score = 279, Expect = 4.3e-23, Identities = 85/282 (30%), Positives = 143/282 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEE-LGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           GFC GV  A    ++I       +   IG L+HN E I  L++   ++T ++             I+  +N    I   HG  ++ +++ R+K + +FD TC +VTK   + ++  ++GY++   G  NHPE     S +     ++    +++NI+  ++  I V +QTT     F EI   L  K K +   N IC+A    QDA+  +  + D+++VVG   S N+K+L  I      +S+LI   + +K EWF++KK   I++G STP W+   VI  +E
  S:    10 GFCFGVKRAIKKAEQI------KDAATIGPLIHNNEEISRLQKNFNVKTLEN-------------IQALSNEKKAIIRTHGITKQDLEELRKKDIEIFDATCPFVTKPQQICEQMSKEGYEVVIFGDENHPEVKGVKSYVSTKAYVVLDKKELQNIKLPNK--IAVVSQTTKKPEHFMEIVNFLILKTKEVRVFNTICDATFKNQDAIKELSLKSDVMVVVGGKNSANTKQLFLIAKTNCEDSYLIETEEELKKEWFLDKKHCGISAGASTPDWIIQKVIAKIE 272
>gi|15612046|ref|NP_223698.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Helicobacter pylori J99] >gi|15645028|ref|NP_207198.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Helicobacter pylori 26695] >gi|108563417|ref|YP_627733.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Helicobacter pylori HPAG1] >gi|122386334|sp|Q1CSL3|ISPH_HELPH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|54037480|sp|P65186|ISPH_HELPJ 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|54041395|sp|P65185|ISPH_HELPY 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|2313506|gb|AAD07469.1| penicillin tolerance protein (lytB) [Helicobacter pylori 26695] >gi|4155562|gb|AAD06556.1| LYSIS TOLERANCE PROTEIN [Helicobacter pylori J99] >gi|107837190|gb|ABF85059.1| isoprenyl pyrophosphate and dimethylallyl diphosphate synthetase [Helicobacter pylori HPAG1] (274 aa)
Score = 279, Expect = 4.6e-23, Identities = 83/286 (29%), Positives = 143/286 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEE-LGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTES-EKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYV 286
           M+I      GFC GV  A    +K      N    + G L+HN + I  LE+   ++ ++D              K+K+    VI   HG  ++ ++  + KG+ + D TC YV K   +++   ++GYQI   G  NHPE    +S   +  L+  VN +E ++ +  ++ + + +QTT    +  +I   L  +   +   N ICNA    Q A +++  EVD+++VVG   S+N+K+L+ I  +   +S+L+ +   ++  WF +KK   IT+G STP W+   V
  S:     1 MEIKMAKDYGFCFGVKRAIQIAEK------NQNSLIFGSLIHNAKEINRLEKNFNVKIEEDPKKIP---------KNKS----VIIRTHGIPKQDLEYLKNKGVKITDATCPYVIKPQQIVESMSKEGYQIVLFGDINHPEVKGVISYATNQALV--VNSLEELQEKKLQRKVALVSQTTKQTPKLLQIASYLVERCTEVRIFNTICNATSYNQKAALDLSKEVDIMIVVGGKTSSNTKQLLSIAKQHCKDSYLVEDENELELAWFKDKKLCGITAGASTPDWIIENV 267
>gi|28493609|ref|NP_787770.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Tropheryma whipplei str. Twist] >gi|50400999|sp|Q83MR9|ISPH_TROWT 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|28476651|gb|AAO44739.1| IspH protein 1 [Tropheryma whipplei str. Twist] (322 aa)
Score = 278, Expect = 5.4e-23, Identities = 82/281 (29%), Positives = 140/281 (49%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP--IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINK-KCLAITSGCSTPTWL 282
           +++  +PRG+C GV  A    +K  + +     Y+   +VHN  ++  LE+ G    D         +D I       PP  + IFSAHG     +  A E+GL V D TC  VTK H  +    + GY I  IG + H E   T       ++++ + ++ + I       +   +QTT+S+ E  E  + L+ ++ +I+    +DIC A ++RQ AV  +    DL++VVG   S+NS +LVE+ ++   ++ +  +  +  D   ++K   + +TSG S P  L
  S:    13 RVLLASPRGYCAGVDRAVIAVEKALERH-GPPVYVRKQIVHNVHVVGSLEKRGAIFVDQ--------VDQI-------PPGAVTIFSAHGVSPAVVHSANERGLQVIDATCPLVTKVHREVIRFSKAGYFILLIGHSGHEEVEGTSGHAPDRVLIVNSPDEADTIDVPHTDKLVWLSQTTLSVDETLETVKRLRLRFPHIQDPPSDDICYATQNRQAAVKKIAPLSDLVIVVGSANSSNSVRLVEVALENGAKAAVRLDYADELDPALLDKVDVVGVTSGASVPEIL 283
>gi|19552247|ref|NP_600249.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Corynebacterium glutamicum ATCC 13032] >gi|62389912|ref|YP_225314.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Corynebacterium glutamicum ATCC 13032] >gi|145295167|ref|YP_001137988.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Corynebacterium glutamicum R] >gi|166217161|sp|A4QCY9|ISPH_CORGB 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|24211865|sp|Q8NRM2|ISPH_CORGL 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|21323793|dbj|BAB98419.1| Penicillin tolerance protein [Corynebacterium glutamicum ATCC 13032] >gi|41325248|emb|CAF19728.1| Penicillin tolerance protein [Corynebacterium glutamicum ATCC 13032] >gi|140845087|dbj|BAF54086.1| hypothetical protein [Corynebacterium glutamicum R] (325 aa)
Score = 278, Expect = 5.4e-23, Identities = 87/286 (30%), Positives = 144/286 (50%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPI---VIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL--SIDKSIILIETVNDIENIRT--ESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           KI+   PRG+C GV  A  T ++  + Y     Y+   +VHN+ ++  L E G                +I + + +  P    ++FSAHG      ++A  K +   D  C  VTK H  ++   +QG+ I +IG   H E   T+  S++K+  L++ V  I  +      E  +   +QTT+S+ E  EI   LK K+  ++    +DIC A ++RQ AV  +    +L++VVG   S+NS +LVE+  +   + ++L+   + I   WF   + + I+SG S P  L   VI
  S:    15 KILLAAPRGYCAGVDRAVETVERALEEY-GAPIYVRKEIVHNRYVVDTLAEKG----------------AIFVNEASEAPEGANMVFSAHGVSPMVHEEAAAKNIKAIDAACPLVTKVHKEVQRFDKQGFHILFIGHEGHEEVEGTMGHSVEKT-HLVDGVAGIATLPEFLNDEPNLIWLSQTTLSVDETMEIVRELKVKFPQLQDPPSDDICYATQNRQVAVKAIAERCELMIVVGSRNSSNSVRLVEVAKQNGADNAYLVDYAREIDPAWFEGVETIGISSGASVPEILVQGVI 292
>gi|110633105|ref|YP_673313.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mesorhizobium sp. BNC1] >gi|123353870|sp|Q11KC7|ISPH_MESSB 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|110284089|gb|ABG62148.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mesorhizobium sp. BNC1] (334 aa)
Score = 278, Expect = 6.3e-23, Identities = 86/280 (30%), Positives = 135/280 (48%)
  Q:     8 PRGFCKGV-----VDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEI----GIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV     +   A  K    +Y  HE      +VHN+ +++ L++ G    +D        +D I  + +  P  V+FSAHG  +     A+ + L   D TC  V+K H         G  +  IG   HPE I T+      ++ LIETV D  +    +   +   +QTT+S+ +  EI   L+ ++ NI       IC A  +RQ+AV       DL LVVG   S+NS++LVE+    G ++ +   L+     I  E   +   L +++G S P  + + +I
  S:    15 PRGFCAGVDRAIQIVVLALKKYGPPVYVRHE------IVHNRYVVEGLQQRGAIFIED--------LDEIPEEHRERP--VVFSAHGVPKSVPADAQARNLFYLDATCPLVSKVHKQAMRHQRLGRHVLLIGHAGHPEVIGTMGQLPHGAVTLIETVEDALHFPPPAGVELGYVSQTTLSLEDTAEIISALERRFDNIHAPAAESICYATTNRQNAVKAAAPGSDLFLVVGAPNSSNSRRLVEVAERAGARRAL---LVQRASEIPWEEIADLSVLGLSAGASAPEIIVDEII 288
>gi|57167926|ref|ZP_00367066.1| hydroxymethylbutenyl pyrophosphate reductase [Campylobacter coli RM2228] >gi|57021048|gb|EAL57712.1| hydroxymethylbutenyl pyrophosphate reductase [Campylobacter coli RM2228] (276 aa)
Score = 278, Expect = 6.6e-23, Identities = 87/289 (30%), Positives = 146/289 (50%)
  Q:     3 IIKITPR-GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPET--ISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           IIK+    GFC GV  A    ++I       +   IG L+HN E I  L+         KN +   + +   + D+      I   HG  ++ +++ ++K + +FD TC +VTK   + ++   +GY +   G  NHPE   + +    K+ ++++   D+ENI+  ++  I V +QTT     F EI   L  + K +   N IC+A    QDA+  +  + D+++VVG   S N+K+L  I      +S+LI   + ++ EWF+NK    I++G STP W+   VI  +E
  S:     2 IIKLAKNYGFCFGVKRAIKKAEQIK------DAATIGPLIHNNEEIARLQ---------KNFNVKTLENIRALSDEKK---AIIRTHGITKQDLEELKKKDIEIFDATCPFVTKPQQICEQMSAEGYDVVIFGDENHPEVKGVRSYVATKAYVVLDK-KDLENIKLPNK--IAVVSQTTKKPEHFMEIVNFLILRVKEVRVFNTICDATFKNQDAIKELSVKSDVMVVVGGKNSANTKQLFLIAKANCEDSYLIETEEELQKEWFLNKTHCGISAGASTPDWIIKKVIAKIE 272
>gi|167037581|ref|YP_001665159.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167040243|ref|YP_001663228.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Thermoanaerobacter sp. X514] >gi|166854483|gb|ABY92892.1| hydroxymethylbutenyl pyrophosphate reductase [Thermoanaerobacter sp. X514] >gi|166856415|gb|ABY94823.1| hydroxymethylbutenyl pyrophosphate reductase [Thermoanaerobacter pseudethanolicus ATCC 33223] (288 aa)
Score = 277, Expect = 6.9e-23, Identities = 84/287 (29%), Positives = 148/287 (51%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           MKI+     GFC GV  A  T  +  +     + Y +G ++HN ++I +L + G+   ++      E +D +   DK     +I  +HG  +K  D   +KG+ V D TC +V K  +++ E   +GY I  +G  NHPE I      D +  ++ ++ +   +  + EK   V  QTT+    +++I E +K K K++ F N IC+A + RQDA   +  +VD++ V+G   S+N++KL +I  K    +  I + + +  E   + + + +T+G STP ++   VI
  S:     1 MKILIAEYAGFCFGVKRAIETAYQEIEKGDGKKIYTLGEIIHNPQVISDLSKKGVNVIEE------EELDKLTEGDK-----LIIRSHGVSKKLYDFLAKKGVEVIDVTCPFVKKVQNIVYEYYHKGYSIIIVGDRNHPEVIGVNGWCDDTAYVVNSIEEAYEL-PQLEKACAVA-QTTLIEKHWKDILEVIKLKVKDLIFFNTICDATQKRQDAADELSKKVDVMFVIGGKHSSNTQKLKKICEKNCKNTFHIEDAEELTLEMVKDHEIIGVTAGASTPDYVIEDVI 275
>gi|121612663|ref|YP_001000569.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni subsp. jejuni 81-176] >gi|167005502|ref|ZP_02271260.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni subsp. jejuni 81-176] >gi|166217158|sp|A1VZM8|ISPH_CAMJJ 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|87249373|gb|EAQ72333.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter jejuni subsp. jejuni 81-176] (277 aa)
Score = 277, Expect = 7.5e-23, Identities = 84/278 (30%), Positives = 141/278 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEE-LGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           GFC GV  A    ++I       +   IG L+HN E I  L++   ++T ++             I+  +N    I   HG  ++ +++ R+K + +FD TC +VTK   + ++  ++GY++   G  NHPE     S +     ++    +++NI+  ++  I V +QTT     F EI   L  K K +   N IC+A    QDA+  +  + D+++VVG   S N+K+L  I      +S+LI   + +K EWF++KK   I++G STP W+   VI
  S:    10 GFCFGVKRAIKKAEQI------KDAATIGPLIHNNEEISRLQKNFNVKTLEN-------------IQALSNEKKAIIRTHGITKQDLEELRKKDIEIFDATCPFVTKPQQICEQMSKEGYEVVIFGDENHPEVKGVKSYVSTKAYVVLDKKELQNIKLPNK--IAVVSQTTKKPEHFMEIVNFLILKTKEVRVFNTICDATFKNQDAIKELSLKSDVMVVVGGKNSANTKQLFLIAKTNCEDSYLIETEEELKKEWFLDKKHCGISAGASTPDWIIQKVI 268
>gi|49474003|ref|YP_032045.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bartonella quintana str. Toulouse] >gi|71152175|sp|Q6G0C9|ISPH_BARQU 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|49239506|emb|CAF25860.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bartonella quintana str. Toulouse] (340 aa)
Score = 276, Expect = 9.4e-23, Identities = 85/285 (29%), Positives = 144/285 (50%)
  Q:     3 IIKI-TPRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDK-SIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIK-KQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           II++ +PRGFC GV  A      A  K  A +Y  HE      +VHN+ +++ L++ G    ++        +D I  + +N P  V+FSAHG  +   ++A    L   D TC  V+K H         G  +  IG   HPE I T+  ++K ++ LIET+ D  + + +    +    QTT+S+ +   I + L+ ++  +E      IC A  +RQ+AV       DL L+VG   S+NS++LVE+  +    +S L+     I  +       +++++G S P  + + +I
  S:     8 IIRLCSPRGFCAGVDRAIQIVLLALKKYGAPVYVRHE------IVHNRYVVEGLQQRGAIFVEE--------LDEIPEEHRNQP--VVFSAHGVPKSVPEQADRYNLFYLDATCPLVSKVHKQAMRHQRHGRHVILIGHAGHPEVIGTMGQLEKGAVTLIETIEDALHYQPDDPDKLGFVTQTTLSVEDTAGILDVLQRRFPALEPPAAESICYATTNRQNAVKAAALGSDLFLIVGAPNSSNSRRLVEVAERFGARQSILVQRADEIDFDRLGPLSVVSLSAGASAPEIIVDEII 287
>gi|2706492|emb|CAA61555.1| unnamed protein product [Campylobacter jejuni] (277 aa)
Score = 276, Expect = 1.1e-22, Identities = 85/282 (30%), Positives = 142/282 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEE-LGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           GFC GV  A    ++I       +   IG L+HN E I  L++   ++T ++             I+  +N    I   HG  ++ +++ R+K +  FD TC +VTK   + ++  ++GY++   G  NHPE     S +     ++    +++NI+  ++  I V +QTT     F EI   L  K K +   N IC+A    QDA+  +  + D+++VVG   S N+K+L  I      +S+LI   + +K EWF++KK   I++G STP W+   VI  +E
  S:    10 GFCFGVKRAIKKAEQI------KDAATIGPLIHNNEEISRLQKNFNVKTLEN-------------IQALSNEKKAIIRTHGITKQDLEELRKKDIEXFDATCPFVTKPQQICEQMSKEGYEVVIFGDENHPEVKGVKSYVSTKAYVVLDKKELQNIKLPNK--IAVVSQTTKKPEHFMEIVNFLILKTKEVRVFNTICDATFKNQDAIKELSLKSDVMVVVGGKNSANTKQLFLIAKTNCEDSYLIETEEELKKEWFLDKKHCGISAGASTPDWIIQKVIAKIE 272
>gi|189425205|ref|YP_001952382.1| hydroxymethylbutenyl pyrophosphate reductase [Geobacter lovleyi SZ] >gi|189421464|gb|ACD95862.1| hydroxymethylbutenyl pyrophosphate reductase [Geobacter lovleyi SZ] (280 aa)
Score = 276, Expect = 1.1e-22, Identities = 76/292 (26%), Positives = 134/292 (45%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           MK+I     GFC GV  A     + A    + + + +G ++H+ +++ +LEE+G+    D             +   +N  ++I S HG     +D+A +K L V D TC +V K  + ++   E GY +  +G  +HPE    +S  K  + +    D      +  K + V  QTT S    + +      +   +   N IC+A   RQ     +  +VD ++V+G   S N+++L EI  + Q  ++ I     I   WF     + +T+G STP W+ + V+  L++
  S:     1 MKVILAKRAGFCFGVKRATQMAFEAAG--KDQKTFTLGPIIHSPQVVNKLEEMGVGVVKD-------------LSGVSNGTVIIRS-HGVLASEMDEAHQKQLEVVDATCPFVKKAQEHVQYLSEAGYDVLVVGDADHPEVQGIVSYGKEKVYVVASGDQVKQLPKMGK-MGVVAQTTQSFDNLKSVVTECLRRGGEVRVYNTICDATAVRQQEATELAQQVDCMIVIGGFNSANTRRLAEICTEIQPRTYHIETAAEIDCSWFQGVDTVGVTAGASTPKWIIDEVMNRLDQ 275
>gi|28572805|ref|NP_789585.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Tropheryma whipplei TW08/27] >gi|50401001|sp|Q83NB2|ISPH_TROW8 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|28410938|emb|CAD67323.1| IspH protein [Tropheryma whipplei TW08/27] (313 aa)
Score = 275, Expect = 1.3e-22, Identities = 82/281 (29%), Positives = 140/281 (49%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP--IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINK-KCLAITSGCSTPTWL 282
           +++  +PRG+C GV  A    +K  + +     Y+   +VHN  ++  LE+ G    D         +D I       PP  + IFSAHG     +  A E+GL V D TC  VTK H  +    + GY I  IG + H E   T       ++++ + ++ + I       +   +QTT+S+ E  E  + L+ ++ +I+    +DIC A ++RQ AV  +    DL++VVG   S+NS +LVE+ ++   ++ +  +  +  D   ++K   + +TSG S P  L
  S:     4 RVLLASPRGYCAGVDRAVIAVEKALERH-GPPVYVRKQIVHNVHVVGSLEKKGAIFVDQ--------VDQI-------PPGAVTIFSAHGVSPAVVHSANERGLQVIDATCPLVTKVHREVIRFSKAGYFILLIGHSGHEEVEGTSGHAPDRVLVVNSPDEADTIDVPHTDKLVWLSQTTLSVDETLETVKRLRLRFPHIQDPPSDDICYATQNRQAAVKKIAPLSDLVIVVGSANSSNSVRLVEVALENGAKAAVRLDYADELDPALLDKVDVVGVTSGASVPEIL 274
>gi|85859633|ref|YP_461835.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Syntrophus aciditrophicus SB] >gi|85722724|gb|ABC77667.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Syntrophus aciditrophicus SB] (577 aa)
Score = 275, Expect = 1.4e-22, Identities = 73/287 (25%), Positives = 131/287 (45%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIF----VTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M +      GFC GV  A  T   IA+   + + Y  G L+HN + ++ L E GI    D        I+++   D+N    ++  AHG       K R KGL + D TC  VT    +I++   + Y I  IG  +HPE      +  +      +  ++N+    E PI     V  QTT ++ E+  I   ++ ++      N IC++ + RQ  V  + + ++ +++VG   S N+++L  +  ++   +  I     + D        + +++G STP W+ + V+
  S:     1 MSVFLAKTAGFCMGVKRAVDTVLDIARHKGSEKIYTYGPLIHNPQTVEFLRERGIIPIKD--------IEALSASDQN--AAIVIRAHGISPSERKKIRNKGLRIIDATCPKVTHVQAIIRQHAAKDYNILIIGDGDHPEV--NGLLGHAGGHGRVIGSLQNVE---ELPIMEKVCVVAQTTQNVEEYAAIVRRIRDRFPETVVFNTICDSTEQRQAEVRELAARMEAMVIVGGRNSANTRRLAALSSQQGTPTFHIETADELNDAKLAPYDRIGLSAGASTPNWIIDRVV 276
>gi|57240606|ref|ZP_00368555.1| hydroxymethylbutenyl pyrophosphate reductase [Campylobacter lari RM2100] >gi|57018947|gb|EAL55720.1| hydroxymethylbutenyl pyrophosphate reductase [Campylobacter lari RM2100] (278 aa)
Score = 274, Expect = 1.5e-22, Identities = 88/287 (30%), Positives = 146/287 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETI---STLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+I      GFC GV  A    ++I       +   IG L+HN E I  L          KN++   + D  E+  +      I   HG  ++ ++K ++K + +FD TC +VTK   + ++  ++GY++   G  NHPE     S +S    ++L E   ++ +I+  S+  I V +QTT  I +F EI   L  K K +   N IC+A    Q+A+  +  + D++++VG   S N+K+L  I      +S+LI N K I+ EWF  K+   +++G STP W+ + V+
  S:     1 MEIELAKSYGFCFGVKRAIKKAEQI------KDAATIGPLIHNNEEITRLW---------KNYNVKTLNDISELSTEQK---AIIRTHGITKQDLEKLKQKDIEIFDATCPFVTKPQKICEQMSKEGYEVVIFGDENHPEVKGVRSYVSTKAYVVLDE--KELFDIKLPSK--IAVVSQTTKKIEKFMEIVNFLMLKVKEVRVFNTICDATFKNQEAINELAKKSDVMVIVGGKNSANTKQLFLIAKNYCEDSYLIENEKEIQKEWFSGKEKCGVSAGASTPDWVIDLVL 268
>gi|49475238|ref|YP_033279.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bartonella henselae str. Houston-1] >gi|71152174|sp|Q6G4C5|ISPH_BARHE 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|49238043|emb|CAF27250.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bartonella henselae str. Houston-1] (343 aa)
Score = 274, Expect = 1.6e-22, Identities = 87/291 (29%), Positives = 144/291 (49%)
  Q:     3 IIKI-TPRGFCKGVVDA-----YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDK-SIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI-ESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           II++  PRGFC GV  A      A  K  A +Y  HE      +VHN+ +++ L++ G    ++        +D I  + +N P  V+FSAHG  +   ++A    L   D TC  V+K H            +  IG   HPE I T+  ++K  + LIETV D  + + +    +    QTT+S+ +  EI + L+ ++  +E      IC A  +RQ+AV       DL L+VG   S+NS++LVE+  +    +S L+     I  +       +++++G S P  + + +I    K+
  S:     8 IIRLCNPRGFCAGVDRAIQIVLLALKKYGAPVYVRHE------IVHNRYVVEGLQQRGAIFVEE--------LDEIPEEHRNQP--VVFSAHGVPKSVPEQADCYNLFYLDATCPLVSKVHKQAMRHQRHRRHVILIGHAGHPEVIGTMGQLEKGGVTLIETVEDALHYQPDDPDNLGFVTQTTLSVEDTAEILDVLQRRFPALEPPAAESICYATTNRQNAVKAAALGSDLFLIVGAPNSSNSRRLVEVAERSGARQSILVQRADEIDFDHLGALSVVSLSAGASAPEIIVDEIISAFRKR 293
>gi|57242235|ref|ZP_00370174.1| hydroxymethylbutenyl pyrophosphate reductase [Campylobacter upsaliensis RM3195] >gi|57016915|gb|EAL53697.1| hydroxymethylbutenyl pyrophosphate reductase [Campylobacter upsaliensis RM3195] (307 aa)
Score = 273, Expect = 2.1e-22, Identities = 86/283 (30%), Positives = 141/283 (49%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETI---STLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           GFC GV  A    ++I           IG L+HN E I  L+          N    + + SI   D +N    I   HG  ++ +   + K + ++D TC +VTK   L ++  ++GY++   G  NHPE     S +S    +IL E   ++ NI+  ++  I V +QTT  +  F +I   L  K K +   N IC+A    Q+A++ +  + D++++VG   S N+K+L  I  +    S+LI   + +K EWF +KK   +++G STP W+   V+  LE+
  S:    33 GFCFGVKRAIKKAEQIKNAAS------IGPLIHNNEEISRLQ----------NDFNVKTLQSI--NDLSNEKKAIIRTHGITKQDLTLLKRKNIEIYDATCPFVTKPQQLCEKMSDEGYEVVIFGDENHPEVKGVKSYVSTKAYVILDE--KELYNIKLPNK--IAVVSQTTKKVENFMKIVNYLMLKCKEVRVFNTICDATFKNQEAILELSQKSDVMVIVGGKNSANTKQLFLIAKQHCENSYLIETQEELKAEWFKDKKHCGVSAGASTPDWIIKKVLEKLEE 296
>gi|18310067|ref|NP_562001.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Clostridium perfringens str. 13] >gi|20138569|sp|P58675|ISPH_CLOPE 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|18144746|dbj|BAB80791.1| probable lysis tolerance protein [Clostridium perfringens str. 13] (282 aa)
Score = 273, Expect = 2.2e-22, Identities = 90/278 (32%), Positives = 140/278 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINK--KCLAITSGCSTPTWLANYVI 287
           GFC GV  A     K  K +   + Y +G L+HN +++  LE        D N    E+ D+  +K  +   +V+  +HG  +  I    +KGL+V + TC YVT     +K+  EQGY+I  +G  NHPE I      + S I+     ++ENI  +    + V +QTT     + ++   +    K I   N IC+A   RQ +V  +  E DL+ V+G   S+N+ KL EI  K+  +S+ I N K + +    ++  K + IT+G STP W+ N VI
  S:    12 GFCFGVKRAVDEAIKYQKEF-GKKIYTLGPLIHNNDVVNYLE--------DNNIFAIELSDADSLKKGD---VVLIRSHGVKESVIKDLTDKGLIVKNATCPYVTNIQLKVKKCYEQGYKIIIVGDKNHPEVIGINGWCNDSAIITNGKTELENIPAK----VCVVSQTTEKKETWNKVLNEIVRASKEIVAFNTICSATDVRQKSVQELSKEADLVFVIGGKNSSNTTKLYEICKKECPKSYHIENVKELDESLLEDESVKTIGITAGASTPDWIINEVI 276
>gi|15964665|ref|NP_385018.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Sinorhizobium meliloti 1021] >gi|20138658|sp|Q92RG2|ISPH_RHIME 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|15073843|emb|CAC45484.1| Probable 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Sinorhizobium meliloti 1021] (350 aa)
Score = 272, Expect = 3.2e-22, Identities = 87/280 (31%), Positives = 135/280 (48%)
  Q:     8 PRGFCKGV-----VDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEI----GIKK----QIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV     +   A  +  A +Y  HE      +VHN+ +++ LE  G    ++        +D I  + +  P  V+FSAHG  +     A E+ L   D TC  V+K H         G  +  IG   HPE I T+    + ++ L+ETV D +         +    QTT+S+ +   + + L  ++ N+     + IC A  +RQ+AV       DL LVVG   S+NSK+LVE+    G KK    Q  S + W+T         +   + +++G S P  + N +I
  S:    32 PRGFCAGVDRAIQIVVLALKEFGAPVYVRHE------IVHNRYVVEGLEAKGAIFVEE--------LDEIPPEHRKQP--VVFSAHGVPKSVPADADERNLFYLDATCPLVSKVHKQAMRHHRMGRHVVLIGHAGHPEVIGTMGQLPEGAVSLVETVEDADVYMPPDADNLGFVTQTTLSVDDTAGVIKRLHERFPNLTAPAADSICYATTNRQEAVKQAAPGCDLFLVVGAPNSSNSKRLVEVALRAGAKKAVLVQRASEIDWSTVG-------DISMVGLSAGASAPEVIVNEII 305
>gi|114328539|ref|YP_745696.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Granulibacter bethesdensis CGDNIH1] >gi|114316713|gb|ABI62773.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Granulibacter bethesdensis CGDNIH1] (321 aa)
Score = 271, Expect = 4.2e-22, Identities = 81/293 (27%), Positives = 143/293 (48%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPI--VIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQG----YQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINK-KCLAITSGCSTPTWLANYVIIFLEKK 293
           ++I+   PRGFC GV  A    ++  K Y     Y+   +VHN+ +++ LE+ G           +  ++ +E      PP   V+FSAHG  +     A  + L   D TC  V+K H   +     G      I  IG   HPE + T+      ++ L++   + E ++ +    +    QTT+S+ +  EI   L+ ++ +IE   + DIC A  +RQ AV  +  + DL+LV+G   S+NS++L E+  +      ++    +  D   +N   C+ I++G S P  L + ++  L ++
  S:     9 LRILLAGPRGFCAGVDRAIRVVEEALKRY-GAPVYVRHEIVHNRYVVESLEKKG-----------AIFVEELE----EVPPHAHVVFSAHGVPKSVPADAEARDLSYLDATCPLVSKVHREAERHYAGGGADSLHILMIGHAGHPEVVGTMGQLPPGAMTLVQNAEEAEAVQPQDPHKLAFITQTTLSVDDTAEIVAVLRRRFPDIEGPKREDICYATTNRQAAVKAIAEDSDLVLVIGSPNSSNSQRLREVAERAGAPRAILLPNASALDWTVLNGVNCVGISAGASAPELLVDELLDRLSER 296
>gi|110802077|ref|YP_698474.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Clostridium perfringens SM101] >gi|122956726|sp|Q0STT3|ISPH_CLOPS 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|110682578|gb|ABG85948.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Clostridium perfringens SM101] (282 aa)
Score = 271, Expect = 4.2e-22, Identities = 90/278 (32%), Positives = 141/278 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNN---PPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINK--KCLAITSGCSTPTWLANYVI 287
           GFC GV  A     K  K +   + Y +G L+HN +++  LE+                I +IE+ D N+     +V+  +HG  +  I    +KGL+V + TC YVT     +K+  EQGY+I  +G  NHPE I      + S I+     ++ENI  +    + V +QTT     + ++   +  + K I   N IC+A   RQ +V  +  E DL+ V+G   S+N+ KL EI  K+  +S+ I N K + +    ++  K + IT+G STP W+ N VI
  S:    12 GFCFGVKRAVDEAIKYQKEF-GKKIYTLGPLIHNNDVVNYLED--------------NDIFAIELSDTNSLNKGDVVLIRSHGVKESVIKDLTDKGLIVKNATCPYVTNIQLKVKKCYEQGYKIIIVGDENHPEVIGINGWCNDSAIITNGKTELENIPAK----VCVVSQTTEKKETWNKVLNEIVKESKEIVAFNTICSATDVRQKSVQELSKEADLVFVIGGKNSSNTTKLYEICKKECPKSYHIENVKELDESLLEDESVKTIGITAGASTPDWIINEVI 276
>gi|150395751|ref|YP_001326218.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Sinorhizobium medicae WSM419] >gi|150027266|gb|ABR59383.1| hydroxymethylbutenyl pyrophosphate reductase [Sinorhizobium medicae WSM419] (336 aa)
Score = 270, Expect = 4.4e-22, Identities = 82/280 (29%), Positives = 134/280 (47%)
  Q:     8 PRGFCKGV-----VDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINK-KCLAITSGCSTPTWLANYVI 287
           PRGFC GV     +   A  +  A +Y  HE      +VHN+ +++ LE  G    ++        +D I  + +  P  V+FSAHG  +     A  + L   D TC  V+K H         G  +  IG   HPE I T+    + ++ LIETV D++         +    QTT+S+ +   + + L  ++ N+     + IC A  +RQ+AV       DL LVVG   S+NSK+LVE+ ++   +  ++    +  D   I +   + +++G S P  + N +I
  S:    18 PRGFCAGVDRAIQIVVLALKEFGAPVYVRHE------IVHNRYVVEGLEAKGAIFVEE--------LDEIPPEHRKQP--VVFSAHGVPKSVPADADARNLFYLDATCPLVSKVHKQAMRHHRMGRHVVLIGHAGHPEVIGTMGQLPEGTVSLIETVEDVDVYTPPDPDNLGFVTQTTLSVDDTAGVIKRLHERFPNLTAPAADSICYATTNRQEAVKQAAPGCDLFLVVGAPNSSNSKRLVEVALRAGAKKAVLVQRASEIDWATIGEISTVGLSAGASAPEVIVNEII 291
>gi|58038661|ref|YP_190625.1| LytB protein involved in terpenoid biosynthesis [Gluconobacter oxydans 621H] >gi|71152185|sp|Q5FUH7|ISPH_GLUOX 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|58001075|gb|AAW59969.1| LytB protein involved in terpenoid biosynthesis [Gluconobacter oxydans 621H] (336 aa)
Score = 270, Expect = 4.5e-22, Identities = 84/293 (28%), Positives = 144/293 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPI---VIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQG----YQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI-ESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           ++++   PRGFC GV  A    ++      A +Y  HE      +VHN+ +++ LE  G                +I +++ +  P    V+FSAHG  +    +A+ + L+  D TC  V+K H   +     G      I  IG   HPE + T+      ++ LI    +   I+ E    +    QTT+S+ +  EI + L+S++  IE   + DIC A  +RQ+AV  +  E DL++V+G   S+NS++L E+  +     + L+   +N+        + L I++G S P  L   ++  L  K
  S:    21 LRVLLAGPRGFCAGVDRAIRVVEEALRRYGAPVYVRHE------IVHNRTVVEGLEAKG----------------AIFVEELDEVPEDGHVVFSAHGVPKAVPAEAQRRNLLYLDATCPLVSKVHREAERHFAGGGPDQRHILMIGHAGHPEVVGTMGQLPPGAVTLINDAEEARTIQPEDPTKLAFITQTTLSVDDTAEIVDILRSRFPLIEGPKREDICYATTNRQEAVKAIAPESDLVIVIGSPNSSNSQRLREVAERSGARRALLVPKLENLDWSVLEGVETLGISAGASAPESLVQEMVTALAGK 308
>gi|83309863|ref|YP_420127.1| penicillin tolerance protein [Magnetospirillum magneticum AMB-1] >gi|82944704|dbj|BAE49568.1| Penicillin tolerance protein [Magnetospirillum magneticum AMB-1] (318 aa)
Score = 270, Expect = 5.0e-22, Identities = 81/287 (28%), Positives = 135/287 (47%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI-ESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           + ++  +PRGFC GV  A    ++      A +Y  HE      +VHN+ +++ L + G    ++ N          E+ D+     V+FSAHG  +    +A  +GL   D TC  VTK H   +     G QI  IG   HPE I T+    + +++L+ T    E +       +    QTT+S+ +   + + L+ ++ ++    + DIC A  +RQ AV  +    + L+V+G   S+NS +LVE+  +     S L+     +          L IT+G S P  L   V+
  S:    10 LTLVLASPRGFCAGVDRAIHIVERALEKYGAPVYVRHE------IVHNRFVVESLAQKGAVFVEELN----------EVPDE---AAVVFSAHGVPKTVPAEADRRGLTSLDATCPLVTKVHREAELHHAMGRQIIMIGHAGHPEVIGTIGQVPEGTVLLVGTPEQAETVAPRDPSMLAYITQTTLSVDDAAAVIDVLQRRFPDMVGPKREDICYATTNRQAAVKTIAPHCEALMVIGSPNSSNSSRLVEVAARAGCARSVLVQRAAEVDWSLLDGVDRLGITAGASAPEILVEEVV 287
>gi|110799385|ref|YP_695787.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Clostridium perfringens ATCC 13124] >gi|168214962|ref|ZP_02640587.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Clostridium perfringens CPE str. F4969] >gi|170764024|ref|ZP_02900192.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Clostridium perfringens B str. ATCC 3626] >gi|122958919|sp|Q0TRF3|ISPH_CLOP1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|110674032|gb|ABG83019.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Clostridium perfringens ATCC 13124] >gi|170710009|gb|EDT22191.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Clostridium perfringens B str. ATCC 3626] >gi|170713589|gb|EDT25771.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Clostridium perfringens CPE str. F4969] (282 aa)
Score = 269, Expect = 6.0e-22, Identities = 89/278 (32%), Positives = 140/278 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINK--KCLAITSGCSTPTWLANYVI 287
           GFC GV  A     K  K +   + Y +G L+HN +++  LE        D +    E+ D+  +K  +   +V+  +HG  +  I    +KGL+V + TC YVT     +K+  EQGY+I  +G  NHPE I      + S I+     ++ENI  +    + V +QTT     + ++   +    K I   N IC+A   RQ +V  +  E DL+ V+G   S+N+ KL EI  K+  +S+ I N K + +    ++  K + IT+G STP W+ N VI
  S:    12 GFCFGVKRAVDEAIKYQKEF-GKKIYTLGPLIHNNDVVNYLE--------DNDIFAIELSDADSLKKGD---VVLIRSHGVKESVIKDLTDKGLIVKNATCPYVTNIQLKVKKCYEQGYKIIIVGDENHPEVIGINGWCNDSAIITNGKTELENIPAK----VCVVSQTTEKKETWNKVLNEIVRASKEIVAFNTICSATDVRQKSVQELSKEADLVFVIGGKNSSNTTKLYEICKKECPKSYHIENVKELDESLLEDESVKTIGITAGASTPDWIINEVI 276
>gi|42526606|ref|NP_971704.1| hydroxymethylbutenyl pyrophosphate reductase [Treponema denticola ATCC 35405] >gi|50400910|sp|Q73NQ6|ISPH_TREDE 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|41816799|gb|AAS11585.1| hydroxymethylbutenyl pyrophosphate reductase [Treponema denticola ATCC 35405] (289 aa)
Score = 268, Expect = 8.0e-22, Identities = 87/285 (30%), Positives = 141/285 (49%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEK--YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILI------ETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKL 294
           G+C GV  A  T  K+AK    ++   Y  G L+HN   +  L+++G++T D +N +  E     + KD     +++  AHG       +  + G  V D TC  V  +  L K+  E+ + I   G  NH E IS     +   LI        + D+ +  + +   + +  QTTI   E+E I   LK +  +++  N IC A  DRQ A+  +  EVD LLV+G   S N+K+L +  +  +  + LI +   I  E F +   + +T+G STP    +++I  +EKKL
  S:    10 GYCSGVRRAVDTVLKLAKENTENKSGLYTFGPLIHNPSTMLRLKQMGVRTIDTENFTEDE-----DYKDS----VIVIRAHGIPPSKKSELEKSGAKVIDATCSRVKASQALAKKHSEEAFVIL-AGDKNHGELISIAGYAEGKCLIVQNAEEAALIDLPSSLSANGSAVLIA-QTTIKESEYEAIASALKKRISDLKVFNTICPATSDRQAALKKLAYEVDALLVIGGKNSANTKRLFQTAVDTKKPAWLIEDASEIPKEIF-SYSVIGLTAGASTP----DFIIDEVEKKL 286
>gi|118443423|ref|YP_878169.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Clostridium novyi NT] >gi|118133879|gb|ABK60923.1| rpsA [Clostridium novyi NT] (634 aa)
Score = 268, Expect = 9.1e-22, Identities = 80/286 (27%), Positives = 137/286 (47%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           KI+     GFC GV  A  T    +  Y     Y +G L+HN ++++ L+   I +           I+  E++      ++I  +HG     I+  ++K L++ D TC YV   H+ +K+  E GYQI  +G  +HPE +       +  +I    D  NI +  +K + + +QTT     F ++ + +    K++   N ICNA K RQ++   +  +VD ++V+G   S+N+ KL EI  K    +  + N   I ++   N   + +T+G STP W+    I
  S:     3 KILLAEKAGFCFGVKRAVDTAINFSNEY-KKPIYTLGPLIHNNDVVEFLKSKNITS-----------IELDELESLKEGDVIIIRSHGVTPNVIELLKDKNLIIADATCPYVAHIHETVKKYYELGYQIIIVGDKSHPEVVGINGYCNNTAIIS--KDGLNIESLPDK-VCIVSQTTEKQENFNKVIDKITPLCKSLANFNTICNATKTRQESAEKLSQKVDSMVVIGGYHSSNTTKLYEICKKNCENTIHVENASEIPNDLIENSNSIGVTAGASTPDWIIKEAI 273
>gi|15895122|ref|NP_348471.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Clostridium acetobutylicum ATCC 824] >gi|50401136|sp|Q97I09|ISPH_CLOAB 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|15024823|gb|AAK79811.1|AE007693_9 penicillin tolerance LytB domain/S1 ribosomal protein fusion [Clostridium acetobutylicum ATCC 824] (642 aa)
Score = 268, Expect = 9.4e-22, Identities = 84/286 (29%), Positives = 146/286 (51%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKC-LAITSGCSTPTWLANYVI 287
           K++     GFC GV  A        K Y N + Y +G L+HN +++ +L+        D N     I D   +K+ +   +++  +HG  ++       KGL V + TC +VTK  + +K+  E GY I  +G   HPE I      D   I+ +   ++ENI +ES+  + + +QTT  +  +E++ + +K++   +   N ICNA  +RQ    ++ ++VD ++V+G  +S+N+ KL EI      E+  + N+  I +    NK C + +T+G STP W+    I
  S:     3 KVMLAEKAGFCFGVKRAVDMALLTQKEY-NKKIYTLGELIHNNDVVDKLK--------DNNVYPIGIEDIDNLKEND---VILIRSHGISEEIYKILLSKGLTVINATCPFVTKIQEKVKKYNELGYDIVIVGDKYHPEVIGINGWCDNKAIISKQGENLENITSESK--VCIVSQTTEKLENWEKVLKEVKNRAIEVISFNTICNATSERQKIAKDLSNKVDFMVVIGGKQSSNTTKLYEICKSNCNETIHVENSGEIPENILKNKNCVIGVTAGASTPDWIIEEAI 276
>gi|78777070|ref|YP_393385.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Sulfurimonas denitrificans DSM 1251] >gi|123550437|sp|Q30S81|ISPH_THIDN 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|78497610|gb|ABB44150.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Sulfurimonas denitrificans DSM 1251] (275 aa)
Score = 266, Expect = 1.4e-21, Identities = 86/287 (29%), Positives = 138/287 (48%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELE-ELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETV-NDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           MKI      GFC GV  A     KIA+   N   Y  G L+HN + I+ LE +  +   DD          S    DK      +   HG  +  + + +   + V D TC YVTK   + +E  EQGY+I   G + HPE     S       + T+ +++E+++ +    I +  QTT  + ++ EI   L  +YK +   N ICNA  + Q+AV  +  + D+++++G   S+N+K+L  I      +S+ I +  ++   WF  KK   I++G STP W+   V+
  S:     1 MKIELAESYGFCFGVKRAI----KIAEDNKNSSTY--GPLIHNSKEIERLEKDFKVGLTDDHK--------SFASGDK-----AVIRTHGIPKNELAELKANNVDVVDATCPYVTKPQQICQEMSEQGYEIIIFGDDAHPEIKGVKSYATYGARVVTMPSELEDLKLKDR--IALVAQTTRKVEDYLEIANYLIPRYKEVRVFNTICNATFENQEAVRKISKKADIMIIIGGKNSSNTKQLFSISEDNCTDSYHIEDENDLDFSWFKEKKFCGISAGASTPDWIIQNVV 268
>gi|86356607|ref|YP_468499.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhizobium etli CFN 42] >gi|86280709|gb|ABC89772.1| penicillin tolerance protein [Rhizobium etli CFN 42] (339 aa)
Score = 266, Expect = 1.5e-21, Identities = 83/280 (29%), Positives = 131/280 (46%)
  Q:     8 PRGFCKGV-----VDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEI----GIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV     +   A     A +Y  HE      +VHN+ +++ LE  G    ++        +D I  + +  P  V+FSAHG  +   + A  + L   D TC  V+K H         G  +  IG   HPE I T+    + ++ LIET+ D +         +    QTT+S+ +   +   L+ ++ N+     + IC A  +RQ+ V       DL ++VG   S+NSK+LVE+    G KK I   L+     +  E       L +++G S P  + N +I
  S:    22 PRGFCAGVDRAIQIVVLALKSYGAPVYVRHE------IVHNRYVVEGLEAKGAVFVEE--------LDEIPAEHRAQP--VVFSAHGVPKSVPEDAASRNLFYLDATCPLVSKVHKQAMRHNRLGRHVVLIGHAGHPEVIGTMGQLPEGAVSLIETIEDADAYAPADPDNLGYVTQTTLSVDDTAGVIARLQERFPNLTAPAADSICYATTNRQEVVKQAAPGCDLFIIVGAPNSSNSKRLVEVALRAGAKKSI---LVQRAAELDWEEIGAISTLGLSAGASAPEVIVNEII 295
>gi|72160875|ref|YP_288532.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Thermobifida fusca YX] >gi|71914607|gb|AAZ54509.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Thermobifida fusca YX] (333 aa)
Score = 266, Expect = 1.6e-21, Identities = 81/281 (28%), Positives = 135/281 (48%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNI--EFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWL 282
           +++   PRG+C GV  A  T +K  + Y     Y+   +VHN  +++ LEE G+                I +++ +  P    V+FSAHG   +   +A E+ L   D  C  VTK H   +    +   I  IG   H E   T     + I ++++  ++ NI+      +   +QTT+S+ E     + L+ ++ N+     +DIC A  +RQ AV  +  + DL +VVG   S+NS +LVE+        S+L+ N   +K+EW      + ++SG S P  L
  S:     8 RVLLAKPRGYCAGVDRAIHTVEKALEQY-GPPIYVRKQIVHNTHVVRTLEERGV----------------IFVEETSEVPEGATVVFSAHGVSPQVHKEAAERKLRTIDAACPLVTKVHKEAQRFAAEDLDIILIGHEGHEEVEGTSGHAPEHIQIVDSPEEVANIKVRDPNRVAWLSQTTLSVDETNATVQALRERFPNLIDPPSDDICYATSNRQAAVKAIAPQCDLFIVVGSSNSSNSVRLVEVARDAGARASYLVDNATYLKEEWLEGVTTIGVSSGASVPEIL 278
>gi|145954707|ref|ZP_01803712.1| hypothetical protein CdifQ_04002105 [Clostridium difficile QCD-32g58] (223 aa)
Score = 265, Expect = 1.7e-21, Identities = 72/219 (32%), Positives = 115/219 (52%)
  Q:    73 EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS-IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           EI    N   +I  +HG  +    +A++K L + DTTC +V K H ++ E   +GY+I  IG   HPE I      + S I+I+T+  +EN+   + K   +  QTTI+   +  I   L  K + I F + IC+A K RQ++   +  EVD ++V+G   S+N++KLV++  +  + +  I     +        K L IT+G STP W+   V+ FLE
  S:     3 EIDTIPNHENMIIRSHGVPENIYKEAKDKKLKIVDTTCPFVKKIHTVVSEYHNKGYEIIVIGDMKHPEVIGINGWCENSAIIIKTLEQMENMEFNNSKKYCLVAQTTINPELYISIVNKLSDKLEEIVFNDTICSATKTRQESAKELAKEVDCMIVIGGKHSSNTQKLVKV-CEDLVPTFAIETKDELDVNTLKKYKNLGITAGASTPNWIIEEVVTFLE 221
>gi|15888117|ref|NP_353798.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Agrobacterium tumefaciens str. C58] >gi|20138567|sp|P58673|ISPH_AGRT5 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|15155749|gb|AAK86583.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Agrobacterium tumefaciens str. C58] (348 aa)
Score = 265, Expect = 1.8e-21, Identities = 83/292 (28%), Positives = 138/292 (47%)
  Q:     8 PRGFCKGV----------VDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIE-SHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAND 299
           PRGFC GV          + AY      A +Y  HE      +VHN+ +++ LE  G    ++        +  I  + +  P  V+FSAHG  +   + A+ + L   D TC  V+K H         G  +  IG   HPE I T+    + ++ L+ETV D         + +    QTT+S+ +   +   L+ ++  I+    + IC A  +RQDAV       DL +VVG   S+NSK+LVE+ ++   + S L+     I      + + + +++G S P  + + +I   + +  T  D
  S:    17 PRGFCAGVDRAIQIVVLALKAYG-----APVYVRHE------IVHNRYVVEGLEAKGAIFVEE--------LHEIPAEHREQP--VVFSAHGVPKSVPEDAQARNLFYLDATCPLVSKVHKQAMRHQRLGRHVVLIGHAGHPEVIGTMGQLPEGTVSLVETVEDAGVYEPVDRENLGFVTQTTLSVDDTAGVIARLQERFPAIQAPAADSICYATTNRQDAVKQAAPGCDLFIVVGAPNSSNSKRLVEVALRAGAKHSVLVQRASEIDWNEIGDIRTVGLSAGASAPEVIVDEIIEAFKARFDTTLD 302
>gi|13476234|ref|NP_107804.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mesorhizobium loti MAFF303099] >gi|20138692|sp|Q985W3|ISPH_RHILO 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|14026994|dbj|BAB53590.1| penicillin tolerance protein; LytB [Mesorhizobium loti MAFF303099] (336 aa)
Score = 265, Expect = 1.8e-21, Identities = 80/280 (28%), Positives = 132/280 (47%)
  Q:     8 PRGFCKGV-----VDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKK-QIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV     +   A  K  A +Y  HE      +VHN+ +++ L+ LG    ++        +  I  + + +P  V+FSAHG  +     A+ + L   D TC  V+K H         G  +  IG   HPE I T+    + ++ L+ET  D   +     K +    QTT+S+ +   I   L+ ++ +++      IC A  +RQ+AV +     DL L+VG   S+NS++LVE+  +     S L+     I          L +++G S P  + + +I
  S:    17 PRGFCAGVDRAIQIVVLALKKYGAPVYVRHE------IVHNRYVVEGLQSLGAVFIEE--------LSEIPAEHRRSP--VVFSAHGVPKSVPADAQARNLFYLDATCPLVSKVHKQAMRHQRLGRHVLLIGHAGHPEVIGTMGQLPEGAVTLVETEADAARLVPADPKALGFVTQTTLSVEDTAGIIRALRERFPDLQAPAAESICYATTNRQEAVKDTAPGADLYLIVGAPNSSNSRRLVEVAERAGATMSLLVQRAAEIPWNDIGTISTLGLSAGASAPEIIVDEII 290
>gi|90420110|ref|ZP_01228018.1| penicillin tolerance protein LytB, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Aurantimonas sp. SI85-9A1] >gi|90335444|gb|EAS49194.1| penicillin tolerance protein LytB, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Aurantimonas sp. SI85-9A1] (354 aa)
Score = 264, Expect = 2.3e-21, Identities = 86/280 (30%), Positives = 138/280 (49%)
  Q:     8 PRGFCKGV-----VDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVND-IENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKN--DICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKK-QIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV     +   A  K  A +Y  HE      +VHN+ +++ L   G    ++        +DS+   D   P  V+FSAHG  +     A  + L+  D TC  V+K H         G  +  IG   HPE I T+    + S+ LIET  D  E +  + E   FVT QTT+S+ +   I   L++++  ++  +   IC A  +RQDAV       DL L+VG   S+NS +LVE+  +   ++  L+   +++  +       +A+++G S P  L + ++
  S:    37 PRGFCAGVDRAIQIVVLALKKYGAPVYVRHE------IVHNRYVVEGLRSKGAIFVEE--------LDSV--PDDGQP--VVFSAHGVPKSVPAAAEARDLLYLDATCPLVSKVHKQAMRHTRLGRHVLLIGHRGHPEVIGTMGQLPEGSVTLIETEADAAEYVPADPEALGFVT-QTTLSVGDTAGIIAVLQARFPQMQAPSSESICYATTNRQDAVKAAAPGADLFLIVGAPNSSNSLRLVEVAERSGAMQGALVEGPQDLPWDCVKPGGVVAMSAGASAPEILVDAIV 308
>gi|86157944|ref|YP_464729.1| hydroxymethylbutenyl pyrophosphate reductase [Anaeromyxobacter dehalogenans 2CP-C] >gi|85774455|gb|ABC81292.1| hydroxymethylbutenyl pyrophosphate reductase [Anaeromyxobacter dehalogenans 2CP-C] (300 aa)
Score = 263, Expect = 2.9e-21, Identities = 76/281 (27%), Positives = 131/281 (46%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLI--GWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSI-EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI-DKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFL 290
           GFC GV     T  K+ ++   H   ++  G ++HN + +    E G+ T           ++ I E+ D      V+   HG  ++ +++A  +GL V D TC YV     + +    +GY I  +G  NH E    +S  ++   +++    +  I+    K + V  QTT    EFE +   L  ++K +   N ICN  ++RQ     + SEVD ++VVG   S N++ L EI    Q  +  +     ++  WF   + + +++G STP W+   V  +L
  S:    32 GFCWGV---RRTVDKVMEVADQHRAPVVTLGPIIHNPQAVARFSEKGVGT-----------VNGIGEVADGTT---VVVRTHGAVREELERAEARGLEVVDGTCPYVKYPQAMAQRLSREGYHIVIVGDANHAEIKGVISYSEQPCTVVKPGGPVPEIKA---KKVAVIAQTTCIGAEFERVVGVLALRHKEVRAVNTICNDTEERQADARALASEVDAVVVVGGKNSANTRHLAEICRAIQPRTWHVETEAELEAAWFDGCRVVGLSAGASTPDWVVEGVAAWL 296
>gi|15807158|ref|NP_295887.1| lytB protein [Deinococcus radiodurans R1] >gi|20138782|sp|Q9RSG0|ISPH_DEIRA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|6459957|gb|AAF11707.1|AE002049_12 lytB protein [Deinococcus radiodurans R1] (335 aa)
Score = 262, Expect = 4.1e-21, Identities = 87/286 (30%), Positives = 140/286 (48%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDK--NNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVN-NHPETISTL-SIDKSIILIET-------VNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINK-------KCLAITSGCSTPTWLANYVI 287
           +I    PRGFC GVV A    +K A +  +    +   +VHN  +++ L E G          R   ++ ++  D   ++   VIFSAHG      ++AR  GL   D TC  VTK H   K+   +GY I  IG +  H E I T     ++ IL+         +ND   ++    + + V  QTT+S+ +  +  + LK+++  +      D+C A K+RQDAV N+   VD  LV+    S+N  +L+E+    + E    +  +   D   + +       + + ITS  STP  L   V+
  S:     4 RIYLAKPRGFCAGVVMAIQAVEK-AAVREDKPVTVYHSIVHNHTVVERLSEGG----------RVHFVEDLDAVDALPDSGDTVIFSAHGISPAVRERARSLGLSTIDATCPLVTKVHTEAKKYAREGYTILLIGDSAGHQEVIGTRGEAPENTILVGVLGKTGPGLNDPHAVQVPDPERLVVLTQTTLSVDDTRKTVDILKARFPALVVPPSEDLCYATKNRQDAVKNIAPNVDAFLVLTSTHSSNGMRLLELA---EAECGRAYRLETAADLTRLEQNGDLGGVRSVGITSAASTPDDLVQDVV 295
>gi|157164476|ref|YP_001466438.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter concisus 13826] >gi|166217151|sp|A7ZCD0|ISPH_CAMC1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|112801691|gb|EAT99035.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter concisus 13826] (274 aa)
Score = 260, Expect = 6.4e-21, Identities = 82/292 (28%), Positives = 145/292 (49%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNH-EKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDK-SIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           MKI   +  GFC GV       K+  K+  N  +   IG L+HN E I  LE         KN++   +    E+KD+      I   HG  +  + + ++  + V D TC +VTK   + ++  E+GY +   G  +HPE     S  K ++ ++   +++E I+ + +  + + +QTT  + +F +I   L    K +   N ICNA  + Q+A  N+    D+++++G   S+N+K+L  I      +S+LI + + ++  WF  K    I++G STP W+   V+  ++K
  S:     1 MKIELASSYGFCFGV-------KRAIKIAENAGDAATIGPLIHNNEEISRLE---------KNYNVKTLEGIDELKDEKK---AIIRTHGITKNDLAELKKTDIKVIDATCPFVTKPQQICEKMSEEGYDVVIFGDMHHPEVKGVKSYAKGNVYVVLEESELEGIKFKQK--VALVSQTTRKVEKFMQIANYLMLHVKELRVFNTICNATFENQEAAKNLAKRADVMIIIGGKNSSNTKQLYLISKNFCEDSYLIESEEELERSWFDGKNLCGISAGASTPDWIIQKVVDRIKK 273
>gi|95929493|ref|ZP_01312236.1| hydroxymethylbutenyl pyrophosphate reductase [Desulfuromonas acetoxidans DSM 684] >gi|95134609|gb|EAT16265.1| hydroxymethylbutenyl pyrophosphate reductase [Desulfuromonas acetoxidans DSM 684] (279 aa)
Score = 260, Expect = 6.4e-21, Identities = 80/287 (27%), Positives = 124/287 (43%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYL-IGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           M+II     GFC GV  A     + A+   N E    +G L+H+ ++++ LE  GI+ ++    S  +I+D            VI  +HG  +        KGL V D TC +V K         ++GY +  +G   HPE    +S           N  E       K + +  QTT S   F EI + L    K +   N IC+A   RQ+    +   V L++V+G   S N+ +L  I  + Q  +H I     I  +W    + + +T+G STP W+   V+
  S:     1 MEIILAKSAGFCFGVKRAVNMAYRAAE---NSEHICSLGPLIHSPQLVQRLEGKGIRVQN----SVEQIVDET----------VIIRSHGITRNEEQALERKGLPVVDATCPFVKKAQQYAALLGKEGYSVVIVGEQEHPEVQGIISYVAGSETSVVANPEEARTVTPHKKLGLVAQTTQSFDNFSEIVQELLENSKELRIFNTICDATAVRQEEARQIAGRVALMVVIGGHNSANTTRLARICSEIQPRTHHIETADEICADWLDGVEAVGVTAGASTPEWIIRDVV 271
>gi|116250803|ref|YP_766641.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhizobium leguminosarum bv. viciae 3841] >gi|189045817|sp|Q1MKH8|ISPH_RHIL3 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|115255451|emb|CAK06527.1| putative 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rhizobium leguminosarum bv. viciae 3841] (333 aa)
Score = 260, Expect = 6.7e-21, Identities = 83/280 (29%), Positives = 130/280 (46%)
  Q:     8 PRGFCKGV-----VDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLS--IDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEI----GIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GV     +   A     A +Y  HE      +VHN+ +++ LE  G    ++        +D I  + +  P  V+FSAHG  +   + A  + L   D TC  V+K H         G  +  IG   HPE I T+    + S+ LIET+ D +         +    QTT+S+ +   +   L  ++ N+     + IC A  +RQ+ V       DL ++VG   S+NSK+LVE+    G KK I   L+     +  +       L +++G S P  + N +I
  S:    16 PRGFCAGVDRAIQIVVLALKSYGAPVYVRHE------IVHNRYVVEGLEAKGAVFVEE--------LDEIPAEHRAQP--VVFSAHGVPKSVPEDAASRNLFYLDATCPLVSKVHKQAMRHNRLGRHVVLIGHAGHPEVIGTMGQLPEGSVSLIETIEDADAYVPVDPDNLGYVTQTTLSVDDTAGVITRLHERFPNLTAPAADSICYATTNRQEVVKQAAPGCDLFIIVGAPNSSNSKRLVEVALRAGAKKSI---LVQRAAELDWDEIGAISTLGLSAGASAPEVIVNEII 289
>gi|46200285|ref|YP_005952.1| lytB protein [Thermus thermophilus HB27] >gi|50400898|sp|Q72G65|ISPH_THET2 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|46197913|gb|AAS82325.1| lytB protein [Thermus thermophilus HB27] (340 aa)
Score = 258, Expect = 1.2e-20, Identities = 79/286 (27%), Positives = 136/286 (47%)
  Q:     8 PRGFCKGVVDAYATCKKIAK-LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIG-----------VNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKN--IEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKK 293
           PRGFC GVV A    ++ A+ L    E  +   +VHN+ +++ L+  G+   +D     +E+      +   +   V+FSAHG       +A E GL V D TC  VTK H   K   ++GY I  IG               PE    +++   +     + D   +     + + V  QTT+S+ +       LK ++    +  + D+C A ++RQ+AV  +  +V+  LV+    S+N  +L+E+       ++ +   + ++ EW    + L ITS  STP  L   V+  L+ +
  S:    15 PRGFCAGVVMAIEAVERWAEALKEKGELVVYHEIVHNRVVVERLQAKGVHFVED----LAEVERLRRERRLAD--TVVFSAHGHPPAVRRQAAEMGLTVLDATCPLVTKVHTEAKRYAKEGYWILLIGDSADHQEIKGTYGEAPERTILVAVHTHVGKDPRLADPRTVEVPDPERVVVLTQTTLSVDDTLATIAILKKRFPKLVVPSRKDLCYATQNRQEAVKRIAPKVEAFLVLTSPHSSNGMRLLELAQSLVGRAYRLERPEELRPEWLEGVESLGITSAASTPEDLVQGVVARLKAQ 308
>gi|154173692|ref|YP_001407857.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter curvus 525.92] >gi|166217152|sp|A7GXB5|ISPH_CAMC5 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|112803428|gb|EAU00772.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Campylobacter curvus 525.92] (274 aa)
Score = 257, Expect = 1.5e-20, Identities = 82/292 (28%), Positives = 143/292 (48%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNH-EKYLIGWLVHNKEIIKELE-ELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPET--ISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           MKI   +  GFC GV       K+  K+  N  +   IG L+HN E I  L     ++T    N          E+KD+      I   HG  +  + + ++  + V D TC +VTK   + ++    GY +   G  NHPE   + + +  K  ++++  +++E ++   +  + + +QTT  + +F +I   L  + K +   N ICNA  + Q+AV N+    D+++V+G   S+N+K+L  I      +S+LI +   ++  WF  K    I++G STP W+   V+  +EK
  S:     1 MKIELASSYGFCFGV-------KRAIKIAENAGDAATIGPLIHNNEEINRLATNFNVKTLHGIN----------ELKDEKK---AIIRTHGITKSDLAELKKTDIKVIDATCPFVTKPQQICEDMSNAGYDVVIFGDENHPEVKGVKSYASGKVYVVLDE-SELEGVKFRQK--VALVSQTTRKVEKFMQIANYLMLRVKEVRVFNTICNATFENQEAVKNLAKRADVMIVIGGKNSSNTKQLYLISKNFCEDSYLIESEHEVEKSWFEGKNLCGISAGASTPDWIIQKVVDAIEK 273
>gi|55979984|ref|YP_143281.1| LytB protein [Thermus thermophilus HB8] >gi|71152198|sp|Q5SMC8|ISPH_THET8 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|55771397|dbj|BAD69838.1| LytB protein [Thermus thermophilus HB8] (340 aa)
Score = 257, Expect = 1.6e-20, Identities = 78/280 (27%), Positives = 133/280 (47%)
  Q:     8 PRGFCKGVVDAYATCKKIAK-LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIG-----------VNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKN--IEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GVV A    ++ A+ L    E  +   +VHN+ +++ L+  G+   +D     +E+      +   +   V+FSAHG       +A E GL V D TC  VTK H   K   ++GY I  IG               PE    +++   +     + D   +     + + V  QTT+S+ +       LK ++    +  + D+C A ++RQ+AV  +  +V+  LV+    S+N  +L+E+       ++ +   + ++ EW    + L ITS  STP  L   V+
  S:    15 PRGFCAGVVMAIEAVERWAEALKEKGELVVYHEIVHNRVVVERLQAKGVHFVED----LAEVERLRRERRLAD--TVVFSAHGHPPAVRRQAAEMGLTVLDATCPLVTKVHTEAKRYAKEGYWILLIGDSADHQEIKGTYGEAPERTILVAVHTHVGKDPRLADPRTVEVPDPERVVVLTQTTLSVDDTLATIAILKKRFPKLVVPSRKDLCYATQNRQEAVKRIAPKVEAFLVLTSPHSSNGMRLLELAQSLVGRAYRLERPEELRPEWLEGVESLGITSAASTPEDLVQGVV 302
>gi|94263345|ref|ZP_01287160.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [delta proteobacterium MLMS-1] >gi|93456300|gb|EAT06430.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [delta proteobacterium MLMS-1] (361 aa)
Score = 256, Expect = 2.2e-20, Identities = 80/291 (27%), Positives = 132/291 (45%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSI-ILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           MK+I     GFC GV  A  T  ++ +          G L+HN +++  L + G++  +             E+ +++   +VI  AHG          E G VV D TC  V K   +I +   QGY    +G  +H E    +     + ++I ++ +++ +  E + P  V +QTT     F+ IT  + S++   +  N IC++   RQD V  M  +VD L+VVG   S N+K+L EI         L+     ++ E     + + +T+G STP W    V+  LE
  S:    85 MKVILAKHAGFCMGVRRAVETTLELVE-KSRGPIATFGPLIHNPQVLTMLGQKGVEVLE-------------EVPEQSQGTVVI-RAHGVPPARKQSLEESGAVVEDATCPRVVKVQAIIDKYRRQGYTTVIVGDRDHAEVEGLVGHAGEVGLVISSMEELDGL--ELKPPYIVVSQTTQDEEMFQLITAGVLSRFPGGKVFNTICDSTHKRQDEVREMCRQVDALVVVGGRNSANTKRLAEIARGLACPVFLVETEAELQFEQMRRYQSVGVTAGASTPVWSIRQVVDALE 359
>gi|94265750|ref|ZP_01289486.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [delta proteobacterium MLMS-1] >gi|93453725|gb|EAT04103.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [delta proteobacterium MLMS-1] (337 aa)
Score = 256, Expect = 2.2e-20, Identities = 80/291 (27%), Positives = 132/291 (45%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSI-ILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           MK+I     GFC GV  A  T  ++ +          G L+HN +++  L + G++  +             E+ +++   +VI  AHG          E G VV D TC  V K   +I +   QGY    +G  +H E    +     + ++I ++ +++ +  E + P  V +QTT     F+ IT  + S++   +  N IC++   RQD V  M  +VD L+VVG   S N+K+L EI         L+     ++ E     + + +T+G STP W    V+  LE
  S:    61 MKVILAKHAGFCMGVRRAVETTLELVE-KSRGPIATFGPLIHNPQVLTMLGQKGVEVLE-------------EVPEQSQGTVVI-RAHGVPPARKQSLEESGAVVEDATCPRVVKVQAIIDKYRRQGYTTVIVGDRDHAEVEGLVGHAGEVGLVISSMEELDGL--ELKPPYIVVSQTTQDEEMFQLITAGVLSRFPGGKVFNTICDSTHKRQDEVREMCRQVDALVVVGGRNSANTKRLAEIARGLACPVFLVETEAELQFEQMRRYQSVGVTAGASTPVWSIRQVVDALE 335
>gi|161361502|ref|ZP_02107335.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Burkholderia pseudomallei 1106b] (209 aa)
Score = 255, Expect = 2.8e-20, Identities = 58/174 (33%), Positives = 99/174 (56%)
  Q:   125 EQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE--FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAN 298
           ++G  I  IG   HPE   T+  +++ + L+E+V D+  +     + + +  QTT+S+ +  EI   LK+K+  I    K DIC A ++RQDAV  M  + D+++VVG   S+NS +L E+  K+ + ++++   + I   W   K+ + +T+G S P  LA  VI  L ++LG  N
  S:     9 QEGVDIVMIGHKGHPEVEGTMGQVERGMHLVESVEDVRRLELPDPERVALVTQTTLSVDDAAEIIGALKAKFPAIREPKKQDICYATQNRQDAVKFMAPQCDVVIVVGSPNSSNSSRLREVAEKRGVAAYMVDAPEQIDPAWVAGKRRIGVTAGASAPEVLAQAVIARL-RELGVTN 184
>gi|94985115|ref|YP_604479.1| hydroxymethylbutenyl pyrophosphate reductase [Deinococcus geothermalis DSM 11300] >gi|94555396|gb|ABF45310.1| hydroxymethylbutenyl pyrophosphate reductase [Deinococcus geothermalis DSM 11300] (331 aa)
Score = 254, Expect = 3.1e-20, Identities = 85/280 (30%), Positives = 135/280 (48%)
  Q:     8 PRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELE-ELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVN-NHPETISTL--SIDKSIIL------IETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKN--IEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           PRGFC GVV A    +K A+   +    +   +VHN  +++ LE E G+Q          E +D +     N    VIFSAHG      ++AR  G+   D TC  VTK H   K+   +GY I  IG +  H E I T   + +++I++       E ++D   +     + + V  QTT+S+ +     + LK+++    I    D+C A K+RQ+AV  +  +VD  LV+    S+N  +L+E+       +  +    ++          L ITS  STP  L   V+
  S:    10 PRGFCAGVVMAIQAVEKAART-EDRPVTVYHSIVHNHTVVERLEQEHGVQF--------VESLDDLTAL-PNGSETVIFSAHGISPAVRERARALGVSTIDATCPLVTKVHTEAKKYAREGYTILLIGDSARHQEVIGTRGEAPEQTIVVGVLGKTGEGLHDPHTVEVPDPERVVVLTQTTLSVDDTRRTIDILKTRFPKLVIPPSEDLCYATKNRQEAVKAIAPQVDAFLVLTSTHSSNGMRLLELARDLCGRAERLETADDLAHLDLTGVYSLGITSAASTPDDLVQKVV 291
>gi|91201335|emb|CAJ74395.1| unknown protein [Candidatus Kuenenia stuttgartiensis] (584 aa)
Score = 252, Expect = 6.3e-20, Identities = 81/287 (28%), Positives = 129/287 (44%)
  Q:     1 MKIIKITPRGFCKGVVDAY------ATCKKI-AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRT-ESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVI 287
           +K+      GFC GV  A       A  K I AK+Y +      G L+HN ++++ LE+  +   +D             + D +N  +VI  AHG       +   KG  V D TC +V +   +IK+   QGY    +G N H E +  L   +       V ++ENI        + +  QTT   + F+   + +K +Y N E    IC++   RQD V+N+   VD ++VVG   S N+ +LV I   +   +  +     I          + +T+G STP W+   V+
  S:     5 LKVFVAKTAGFCMGVRRAMDILLDAANEKNIGAKVYTD------GPLIHNPQVLEYLEKRDLHIVND-------------VTDLSNSTVVI-RAHGVTPSRRAEIESKGAKVCDATCPHVMRVQSIIKKYAAQGYSTIIVGDNGHAEVVGLLGYAEG--RGHVVENMENIELLPPMDKVCIVAQTTQDRHLFKRAIDEIKRRYPNSESFETICSSTYKRQDEVVNLCKSVDAMIVVGGRGSANTTRLVTICESQGTPTFHVETDSEIDLNKLKVFNTIGVTAGASTPNWMIKRVV 277
>gi|78355437|ref|YP_386886.1| hydroxymethylbutenyl pyrophosphate reductase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|123553378|sp|Q316F5|ISPH_DESDG 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|78217842|gb|ABB37191.1| hydroxymethylbutenyl pyrophosphate reductase [Desulfovibrio desulfuricans G20] (281 aa)
Score = 247, Expect = 2.0e-19, Identities = 67/279 (24%), Positives = 135/279 (48%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYL--IGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI-DKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKY-KNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           M + +    GFC GV  A    KK+ +   N+ K +  +G ++HN ++++  E+ G++   D   +RS                V+  AHG  ++T       G+ + D TC  V +    I  + E+G  +   G ++HPE    LS   +  ++  ++ +++N   E ++  F+  QTT   + F  + E ++ ++  ++   + IC+A ++RQD  I +   VD+++VVG   S N+++L E+   + + ++ +     +  +         +T+G STP
  S:     1 MHVKRAATAGFCMGVGLAL---KKLDRELDNNAKDIATLGPIIHNPQVLRRYEQKGVRCYTDPAEARSG-------------QRVVIRAHGIPEETESALAAAGVDLVDATCPKVKRAQLGIARQREKGRTLLLFGEHDHPEVQGLLSYAGEGAVVFGSLEELQNGPLEDDRHYFLAAQTTQDKHAFTSVIEWVRRRFGDHVPVLDTICDATRERQDEAIAIARSVDVMVVVGGFASGNTRRLAEVAQAQGVPTYHVETPDQLPLDAIRGYGAAGLTAGASTP 267
>gi|150017403|ref|YP_001309657.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Clostridium beijerinckii NCIMB 8052] >gi|149903868|gb|ABR34701.1| hydroxymethylbutenyl pyrophosphate reductase [Clostridium beijerinckii NCIMB 8052] (635 aa)
Score = 246, Expect = 3.0e-19, Identities = 84/286 (29%), Positives = 138/286 (48%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPET--ISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKC--LAITSGCSTPTWLANYVI 287
           K+I     GFC GV  A     +I K + N + Y +G L+HN +++K LEE  I +           I+  EI   N    ++  +HG  +  +D   +K L V + TC +V      +K+  ++GY I  +G  NHPE   I+    DK+II  +   D EN+       + V +QTT  +  +EE  + L    + + F N IC A   RQ +   +  + D ++V+G   S+N+ KL +I  +    +  I N K++   +  N     + +T+G STP W+   V+
  S:     3 KVILAKNSGFCFGVQRAVNEAIRIQKEH-NSKIYTLGPLIHNNDVVKYLEENNIFS-----------IEFEEIDKLNKGDTIVIRSHGVSETVLDTLEQKELKVINATCPFVANIQKKVKKYSKEGYHIVILGDKNHPEVIGINGWCDDKAIITKDGTFDEENM----PHKVCVVSQTTEKMKNWEETLKNLSYAREILAF-NTICAATDVRQRSTNKISKKTDAMIVIGGKNSSNTTKLYQIAKENCENTIHIENAKDLPISFIKNNNINKIGVTAGASTPDWIIREVL 275
>gi|158520400|ref|YP_001528270.1| hydroxymethylbutenyl pyrophosphate reductase [Desulfococcus oleovorans Hxd3] >gi|158509226|gb|ABW66193.1| hydroxymethylbutenyl pyrophosphate reductase [Desulfococcus oleovorans Hxd3] (577 aa)
Score = 244, Expect = 4.9e-19, Identities = 76/291 (26%), Positives = 126/291 (43%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI--DKSIILIETVNDIENIRT--ESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           MK+      GFC GV  A       +  Y     Y  G L+HN ++++ L E  I   +              I ++ N  IV+  AHG   +T +K    G  V D TC  V K   +I     +G  +  IG  +HPE +  L    D+ ++     + +E ++     EK I V  QTT S   F+E+     + + + +  N IC + K+RQ     +  + D ++VVG   S N+++L ++  K       +  ++ +          + IT+G STP W+   +   LE
  S:     1 MKVSIAKTSGFCMGVRRAVDMVLDASNRY-TEPIYTFGPLIHNPQVLRLLAEKKISVME-------------TIPEQGNG-IVLIRAHGVPPRTREKLEAAGFTVIDATCPRVVKVQTIISRNAAEGCAVIIIGDKDHPEVVGLLGYAGDRGVV----ADSLEALKALPAFEKAIIVA-QTTQSTRLFDEVGAWAAAHHPHYQVFNTICPSTKNRQAETEALARQTDAMVVVGGYNSGNTQRLAQVSKKSGHPVFHVETSEELDTNALAKSDHIGITAGASTPNWIIKKIYRELE 275
>gi|146296896|ref|YP_001180667.1| hydroxymethylbutenyl pyrophosphate reductase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410472|gb|ABP67476.1| hydroxymethylbutenyl pyrophosphate reductase [Caldicellulosiruptor saccharolyticus DSM 8903] (662 aa)
Score = 242, Expect = 9.2e-19, Identities = 84/297 (28%), Positives = 151/297 (50%)
  Q:     3 IIKITPR-GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPET---ISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFK--NDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAND 299
           IIK+    GFC GV  A       AK   +    + G L+HN  +I++L+EL ++  ++        I+ IE  D     IV   +HG   +   +  ++   V+D TC YV K H++++E  E G  +  +G  NHPE    I  +  D+  I+I+++   ++  ++  +   V  QTT    ++ EI E +++   N E+K  + +C A   RQ+    +  +VD++LV+GD KS+N+ KL +  +K    +  I   ++++   F   K + IT+G ST     + ++  LEK+    ++
  S:     2 IIKVAKNAGFCFGVERAVNGVIAWAKANKDKSVKVYGMLIHNSYVIEKLKELNVKVIEN--------INEIEKDD-----IVFIRSHGVSMEEFSEIEKRASKVYDFTCPYVKKIHEIVRENSENGLDVIVVGDINHPEVKGIIGHVEKDRKCIVIDSLEKAKDAISQLGRNAVVVCQTTFDNAKWCEIKEYIEN---NTEYKVFDTVCKATITRQEEAKVLALDVDVMLVIGDKKSSNTNKLYQ-AVKDIKPTFFIERPQDLEGIDFTKVKKIGITAGASTSQEQISEIVEILEKRFNQIDN 287
>gi|120603944|ref|YP_968344.1| hydroxymethylbutenyl pyrophosphate reductase [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166217162|sp|A1VHK1|ISPH_DESVV 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|120564173|gb|ABM29917.1| hydroxymethylbutenyl pyrophosphate reductase [Desulfovibrio vulgaris subsp. vulgaris DP4] (290 aa)
Score = 235, Expect = 5.3e-18, Identities = 74/291 (25%), Positives = 130/291 (44%)
  Q:     1 MKIIKITPRGFCKGVVDAYATC--------KKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI-DKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKN-IEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           M +I+    GFC GV  A            +K A+  P       G ++HN ++++    +G++            +D +E  D      V+  AHG  Q+     R +  VV D TC  V K    I+E+   G  +   G   HPE    LS   +  ++  +V+++E +  + E   F+  QTT     FE     L  +  + +     IC+A + RQ   I++  +VD ++VVG   S N+++L ++   + + +  + N   +  E       + +T+G STP  + +    FLE
  S:     1 MNVIRARTAGFCMGVSLALRKLDREVDRAEEKAAQGSPRCRIATFGPIIHNPQVLEAYAGMGVRCLRQ--------VDEVEAGDH-----VVIRAHGVPQQQEKALRSRDAVVVDATCPKVKKAQLGIEEQCRAGRTLLLFGEAEHPEVRGLLSYAGEGALVFGSVDELEGLPLQPETEYFLAAQTTQDRVAFEAARAWLHERLGHEVPVLETICDATRLRQQEAIDIARKVDAMVVVGGFDSGNTRRLADVAAAQGVFTVHVENESQLPVEQLRGCGIIGLTAGASTPKSIIDATQRFLE 288
>gi|46205583|ref|ZP_00048332.2| COG0761: Penicillin tolerance protein [Magnetospirillum magnetotacticum MS-1] (296 aa)
Score = 234, Expect = 6.6e-18, Identities = 78/278 (28%), Positives = 132/278 (47%)
  Q:     2 KIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL--SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEF--KNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQI-ESHLIWNTKNIKDEWFINKKCLAITSGCSTP 279
           +++   PRG+C GV  A    +K  + Y     Y+   +VHNK +++ L E G    D+ +          E+ +      V+FSAHG        A  + L   D TC  VTK H       +  Y I  IG   H E   T   + D   ++    +  + +  + +K ++++ QTT+S+ E  E    L+ K+  ++    +DIC A ++RQ AV  +  + D+++VVG   S+NS +LVE+ ++     S+ + + K I   W      + +TSG S P
  S:    28 RVLLAAPRGYCAGVDRAVVAVEKALEHY-GAPVYVRKEIVHNKFVVETLSERGAIFVDETD----------EVPEGAR---VVFSAHGVSPAVKAAAAARNLDTIDATCPLVTKVHKEAVRFAKDDYDILLIGHTGHEEVEGTAGEAPDHVQVVDSPDHVDDVVVRDPDKVVWIS-QTTLSVDETMETVRRLREKFPTLQDPPSDDICYATQNRQVAVKKLAPDADVVIVVGSANSSNSVRLVEVALQAGAGASYRVDHAKEIDPAWLDGATTVGVTSGASVP 295
>gi|46578472|ref|YP_009280.1| hydroxymethylbutenyl pyrophosphate reductase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|50400897|sp|Q72G08|ISPH_DESVH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|46447883|gb|AAS94539.1| hydroxymethylbutenyl pyrophosphate reductase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] (290 aa)
Score = 234, Expect = 8.3e-18, Identities = 74/291 (25%), Positives = 130/291 (44%)
  Q:     1 MKIIKITPRGFCKGVVDAYATC--------KKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI-DKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKN-IEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           M +I+    GFC GV  A            +K A+  P       G ++HN ++++    +G++            +D +E  D      V+  AHG  Q+     R +  VV D TC  V K    I+E+   G  +   G   HPE    LS   +  ++  +V+++E +  + E   F+  QTT     FE     L  +  + +     IC+A + RQ   I++  +VD ++VVG   S N+++L ++   + + +  + N   +  E       + +T+G STP  + +    FLE
  S:     1 MNVIRARTAGFCMGVSLALRKLDREVDRAEEKAAQGSPRCRIATFGPIIHNPQVLEAYAGMGVRCLRQ--------VDEVEAGDH-----VVIRAHGVPQQQEKALRSRDAVVVDATCPKVKKAQLGIEEQCRAGRTLLLFGEAEHPEVRGLLSYAGEGALVFGSVDELEGLPLQPETEYFLAAQTTQDRVAFEVARAWLHERLGHEVPVLETICDATRLRQQEAIDIARKVDAMVVVGGFDSGNTRRLADVAAAQGVFTVHVENESQLPVEQLRGCGIIGLTAGASTPKSIIDATQRFLE 288
>gi|33864121|ref|NP_895681.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Prochlorococcus marinus str. MIT 9313] >gi|50400960|sp|Q7V4T7|ISPH_PROMM 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|33635705|emb|CAE22029.1| LytB protein homolog [Prochlorococcus marinus str. MIT 9313] (398 aa)
Score = 232, Expect = 1.2e-17, Identities = 87/278 (31%), Positives = 145/278 (52%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIE----NIRTESEKPIF----------------------VTNQTTISIYEFEEI----TETLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCL------------------AITSGCSTPTWLANYVI 287
           GFC GV  A A   +  + YP+   ++   ++HN  + + L E+ +       H+   + D   + D +   +VI  A G   + ++   E+G  + DTTC +V+K    +++  +Q +     G   H ET++T S   + +++  +++ +     I  + ++  F                      V NQTT+   E EEI      T+  KY  IE        N IC+A ++RQ A+ ++  E +DLL+V+G   S+N+  L EI I + I S  I   + I D   I  K L                   ITSG STP  +  +VI
  S:    64 GFCWGVERAVAMAYETRRHYPSERIWITNEIIHNPSVNEHLREMDVLFI----HAEGGVKDFSCVNDGD---VVILPAFGATVQEMELLHERGCHIIDTTCPWVSKVWHTVEKHKKQEFTSIIHGKVKHEETLATSSFAGTYLVVLDLDEAQLVADYILGQGDRAAFMKRFAKACSANFDPDQDLQRLGVANQTTMLKSETEEIGRLFERTMLRKYGPIELNKHFLSFNTICDATEERQQAMFSLVDEPLDLLVVIGGFNSSNTTHLQEIAISRGIRSFHIDTPERIGDNNSIQHKPLGEDLFIESNFLPAGSVSVGITSGASTPDRVVEHVI 389
>gi|29347471|ref|NP_810974.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacteroides thetaiotaomicron VPI-5482] >gi|50401028|sp|Q8A625|ISPH_BACTN 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|29339371|gb|AAO77168.1| penicillin tolerance protein LytB [Bacteroides thetaiotaomicron VPI-5482] (289 aa)
Score = 224, Expect = 9.5e-17, Identities = 81/273 (29%), Positives = 125/273 (45%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIE----QGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLK---SKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWL 282
           GFC GVV A    ++  +L      Y +G +VHN   ++ L+ +G+ T           I+  E +   N   V+  AHG   +T   A +  + + D TC  V +    IK++      +  QI   G N H E +  +       I+IE+  + + +  +  K I + +QTT S+ EF+EI E +K   S     E+ + IC    +R   +    +  DL+  V   KS+N K L E  +K    SHLI N K I      N K + +    STP WL
  S:    11 GFCFGVVTAIHKAEE--ELAKGETLYCLGDIVHNSREVERLKAMGLIT-----------INRDEFRQLRNAK-VLLRAHGEPPETYQIAHKNNIEIIDATCPVVLRLQKRIKQEFRKEDFEEKQIVIYGKNGHAEVLGLVGQTGGQAIVIESAEEAKKL--DFTKSIRLFSQTTKSLDEFQEIVEYIKLHISPDATFEYYDTICRQVANRMPNLREFAATHDLIFFVSGKKSSNGKMLFEECLKVNANSHLIDNEKEIDPTLLRNVKSIGVCGATSTPKWL 275
>gi|82659765|gb|ABB88951.1| IspH [Algoriphagus sp. KK10202C] (281 aa)
Score = 224, Expect = 1.1e-16, Identities = 77/277 (27%), Positives = 125/277 (45%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTES-EKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYV 286
           GFC GVV A    + I  L  +   Y +G +VHN E +  L++ G++           IID   +K+  N  ++I  AHG    T   A E  L + D +C  V K    IK   ++G  I+  G + H E I  L   ++  ++    DI  +   +  K I + +QTT S  +F EI   LK     +   + IC    +R   + +  ++ D ++ V   KS+N K L  +  +    ++ + N+  I+  WF+  + + I    STP WL   V
  S:    13 GFCFGVVYAIEMAEDI--LNEDGVLYCLGDIVHNDEEVNRLKKKGLK-----------IIDHEILKELRNEKVLI-RAHGEPPSTYQLAIENNLELIDASCPVVLKLQHRIKNSYDKGDSIYIYGKHAHAEVIGLLGQTRNEAVV--FQDISELDLAAIPKNITLYSQTTKSTDKFYEINALLKENGITVNTNDTICRQVSNRDKELRDFSTKFDKIIFVSGTKSSNGKVLFNVCKETNPNTYFVSNSDQIESSWFMENESVGICGATSTPMWLMEEV 274
>gi|82913575|ref|XP_728698.1| (E)-4-hydroxy-3-methyl-but-2-enyl diphosphate reductase [Plasmodium yoelii yoelii str. 17XNL] >gi|23485182|gb|EAA20263.1| LytB protein [Plasmodium yoelii yoelii] (174 aa)
Score = 223, Expect = 1.4e-16, Identities = 61/181 (33%), Positives = 92/181 (50%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKI-----AKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISI 181
           M+II   PRGFC GV  A     +      A +Y  HE      +VHN+ ++  L E G    +             E+ +      VIFSAHG  ++  ++ARE+GL VFD TC  VTK H  + +   +G +I +IG   HPE   T+    +    I L+E+  D+E ++ ++   +    QTT+SI
  S:     1 MEIILANPRGFCAGVDRAIEIVDRAIEVFGAPIYVRHE------VVHNRYVVDGLRERGAVFVE-------------ELSEVPENSTVIFSAHGVSKQIQEEARERGLQVFDATCPLVTKVHIEVHQHASEGREIVFIGHAGHPEVEGTMGQYDNPAGGIYLVESPEDVEMLQVKNPDNLAYVTQTTLSI 171
>gi|121730027|ref|ZP_01682439.1| LytB protein [Vibrio cholerae V52] >gi|121628231|gb|EAX60750.1| LytB protein [Vibrio cholerae V52] (177 aa)
Score = 222, Expect = 1.8e-16, Identities = 60/183 (32%), Positives = 98/183 (53%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL----SIDKSIILIETVNDIENIRTESEKP--IFVTNQTTISIYE 183
           MKI+   PRGFC GV  A +  ++  +LY     Y+   +VHN+ +++ L++ G +  ++ N          E+ D N   IVIFSAHG  Q    +A+E+ L VFD TC  VTK H  +     +  ++  IG   HPE   T+    S    + L+E   D+ +++ + ++P  +   +QTT+S+ E
  S:     1 MKILLANPRGFCAGVDRAISIVERALELY-QPPIYVRHEVVHNRFVVEGLKQRGARFVEELN----------EVPDDN---IVIFSAHGVSQAVRQEAKERSLTVFDATCPLVTKVHMEVARASRKHMEVVLIGHAGHPEVEGTMGQYASDTGGMYLVEKPEDVVSLQAKVKEPSNLHYVSQTTLSVDE 175
>gi|88808029|ref|ZP_01123540.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus sp. WH 7805] >gi|88788068|gb|EAR19224.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus sp. WH 7805] (399 aa)
Score = 220, Expect = 2.8e-16, Identities = 84/278 (30%), Positives = 141/278 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIE----NIRTESEKPIF----------------------VTNQTTISIYEFEEI----TETLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCL------------------AITSGCSTPTWLANYVI 287
           GFC GV  A A   +  K YP    ++   ++HN  +   L E+ +Q    +   +       +     +  +VI  A G   + +    E+G  + DTTC +V+K  + +++  +Q +     G   H ET++T S   + +++  + + +     I  E ++  F                      V NQTT+   E EEI      T+ SK+   +        N IC+A ++RQDA+ ++  E +DL++V+G   S+N+  L EI I + I S  I   + I  +  I  K L                   ITSG STP  +  +VI
  S:    64 GFCWGVERAVAMAYETRKHYPGERLWITNEIIHNPSVNDHLREMNVQFIPVEQGVK-------DFSGVTSGDVVILPAFGATVQEMQLLNERGCHIVDTTCPWVSKVWNTVEKHKKQTFTSIIHGKVKHEETLATSSFAGTYLVVLDLEEAQIVADYILGEGDRDSFMARFSKACSPGFDPDQDLKRLGVANQTTMLKRETEEIGRLFERTMLSKFGPTQLNEHFLAFNTICDATQERQDAMFSLVDEPLDLMVVIGGYNSSNTTHLQEIAINRGIRSFHIDTPERISADNSIEHKPLGQELIREQNFLPGGTVTVGITSGASTPDRVVEHVI 389
>gi|113953201|ref|YP_729527.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus sp. CC9311] >gi|122945839|sp|Q0IDE5|ISPH_SYNS3 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|113880552|gb|ABI45510.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus sp. CC9311] (398 aa)
Score = 218, Expect = 5.0e-16, Identities = 90/278 (32%), Positives = 144/278 (51%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIE--IKDKNNPP---IVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIR-------------------TESEKPIF----------VTNQTTISIYEFEEI----TETLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCL------------------AITSGCSTPTWLANYVI 287
           GFC GV  A A   +  + YP    ++   ++HN  +   L E+ +            +  S+E  +KD +      +VI  A G   + +    E+G  + DTTC +V+K    +++  +Q +     G   H ET++T S   + ++   V D+E  R                   +++  P F          V NQTT+   E EEI      T+ SKY   +        N IC+A ++RQDA+ ++  E VDL++V+G   S+N+  L EI + + I S  I   + I  +  I  K L                   ITSG STP  +  +VI
  S:    64 GFCWGVERAVAMAYETRRHYPQERIWITNEIIHNPSVNDHLREMDV------------LFISVEGGVKDFSGVATGDVVILPAFGATVQEMQLLNERGCHIVDTTCPWVSKVWTTVEKHKKQSFTSIIHGKVKHEETLATSSFAGTYLV---VLDLEEARLVADYILGKGNRESFMERFSKACSPGFDPDRDLEHLGVANQTTMLKSETEEIGRLFERTMLSKYGPTDLNEHFLAFNTICDATQERQDAMFSLVDETVDLMVVIGGYNSSNTTHLQEIAVSRGIRSFHIDTPERIHTDNSIEHKPLGEELTVEELFLPSGPVTVGITSGASTPDRVVEHVI 389
>gi|73749028|ref|YP_308267.1| hydroxymethylbutenyl pyrophosphate reductase [Dehalococcoides sp. CBDB1] >gi|123619946|sp|Q3ZYL6|ISPH_DEHSC 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|73660744|emb|CAI83351.1| hydroxymethylbutenyl pyrophosphate reductase [Dehalococcoides sp. CBDB1] (284 aa)
Score = 216, Expect = 8.6e-16, Identities = 78/292 (26%), Positives = 134/292 (45%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDK----SIILIETVNDIENIRTESEKPIFVTNQTTISIYEF----EEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           MK+   +  GFC GV  A    +K A      E   +G LVHN++++  L  +G++   +        ID I  +       V  S+HG     + + + KGL + DTTC +V +     K   + G+     G  NHPE    L        + +  + ++DI ++     + I V +QTT     F    + + +    K   I   + +C+  +DRQ A + +   VDL+LV+G   S N++ L+++  K    +HLI     ++ +W      + ITSG ST     + V  +L++
  S:     1 MKVECASNIGFCFGVRRAINILEKTASERGGVET--LGALVHNQQVLNRLSGMGVRVVKN--------IDDISGR------TVAISSHGVGPAVLAELKSKGLEIVDTTCPFVKRAQVAAKRFHDAGFFTVIYGDVNHPEVKGILGWAGGNGLATLNPQGLDDIPDL----SRYIGVLSQTTQIPTGFTSFVKNVIDQALVKDAEIRIADTLCHDIRDRQAAALELAGRVDLMLVIGGHNSANTRHLLDL-CKTVSNTHLIETASELQTDWLKGVSRIGITSGASTDETTISEVCSYLDR 279
>gi|67921533|ref|ZP_00515051.1| LytB protein [Crocosphaera watsonii WH 8501] >gi|67856645|gb|EAM51886.1| LytB protein [Crocosphaera watsonii WH 8501] (402 aa)
Score = 216, Expect = 9.3e-16, Identities = 88/283 (31%), Positives = 149/283 (52%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILI--------------------ETVNDIENIRTESEKP------IFVTNQTTISIYEFEEITE----TLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNI-----------------KDEWFINKKCL-AITSGCSTPTWLANYVI--IFLEK 292
           GFC GV  A A   +  + +P  + ++   ++HN  + + L E+ +      N S+       +    N   +VI  A G     +    ++  V+ DTTC +V+K    ++   ++ Y     G   H ET++T S   + +++                    E ++  +N  +E   P      + V NQTT+   E E+I +    TL  KY   +        N IC+A ++RQDA++N+  E VDL++V+G   S+N+  L EI I++ I S+ I + + I                 ++ W    + L  +TSG STP  +   VI  IF EK
  S:    64 GFCWGVERAVAMAYETGQHFPQEKIWITNEIIHNPSVNQRLLEMNVGFIQVINGSK-------DFSVVNTGDVVILPAFGASVTEMKLLNDRNCVIVDTTCPWVSKVWSSVERHKKKEYTSIIHGKYRHEETVATSSFAGTYLVVLNLKEAQYVCDYIVHGGDKEEFLDKFKNAHSEGFDPDKDLVKLGVANQTTMLKSETEQIGKLFESTLLKKYGPTQLNQHFMSFNTICDATQERQDAMLNLVEEDVDLMVVIGGFNSSNTTHLQEISIERGILSYHIDSDQRILQGNKIEHKPLEKVIETQENWLPEGQILVGVTSGASTPDKIVEAVIERIFEEK 396
>gi|147669794|ref|YP_001214612.1| hydroxymethylbutenyl pyrophosphate reductase [Dehalococcoides sp. BAV1] >gi|189045806|sp|A5FPY7|ISPH_DEHSB 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|146270742|gb|ABQ17734.1| hydroxymethylbutenyl pyrophosphate reductase [Dehalococcoides sp. BAV1] (284 aa)
Score = 216, Expect = 9.9e-16, Identities = 78/292 (26%), Positives = 134/292 (45%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDK----SIILIETVNDIENIRTESEKPIFVTNQTTISIYEF----EEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEK 292
           MK+   +  GFC GV  A    +K A      E   +G LVHN++++  L  +G++   +        ID I  +       V  S+HG     + + + KGL + DTTC +V +     K   + G+     G  NHPE    L        + +  + ++DI ++     + I V +QTT     F    + + +    K   I   + +C+  +DRQ A + +   VDL+LV+G   S N++ L+++  K    +HLI     ++ +W      + ITSG ST     + V  +L++
  S:     1 MKVECASNIGFCFGVHRAINILEKTASERGGVET--LGALVHNQQVLNRLSGMGVRVVKN--------IDDISGR------TVAISSHGVGPAVLAELKSKGLEIVDTTCPFVKRAQVAAKRFHDAGFFTVIYGDVNHPEVKGILGWAGGNGLATLNPQGLDDIPDL----SRYIGVLSQTTQIPTGFTSFVKNVIDQALVKDAEIRIADTLCHDIRDRQAAALELAGRVDLMLVIGGHNSANTRHLLDL-CKTVSNTHLIETASELQTDWLKGVSRIGITSGASTDETTISEVCSYLDR 279
>gi|87125110|ref|ZP_01080957.1| hydroxymethylbutenyl pyrophosphate reductase [Synechococcus sp. RS9917] >gi|86167430|gb|EAQ68690.1| hydroxymethylbutenyl pyrophosphate reductase [Synechococcus sp. RS9917] (398 aa)
Score = 215, Expect = 1.3e-15, Identities = 87/278 (31%), Positives = 137/278 (49%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESE-------------------KPIF----------VTNQTTISIYEFEEI----TETLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCL------------------AITSGCSTPTWLANYVI 287
           GFC GV  A A   +  + YP+   ++   ++HN  +   L E+ ++        +       +  D  +  +VI  A G   + +    E+G  + DTTC +V+K    +++  +  +     G   H ET++T S   + ++   V D+E  R  S+                    P F          V NQTT+   E EEI      T+ SKY            N IC+A ++RQDA+ ++  E +DL++V+G   S+N+  L EI I + I S  I   + I  +  I  K L                   ITSG STP      VI
  S:    64 GFCWGVERAVAMAYETRRHYPSERLWITNEIIHNPSVNDHLREMDVRFIPVDQGVK-------DFSDVASGDVVILPAFGATVQEMQLLNERGCHIVDTTCPWVSKVWTTVEKHKKHAFTSIIHGKVKHEETLATSSFAGTYLV---VLDLEEARLVSDYILGQGDREAFMARFARACSPGFDPDRDLERLGVANQTTMLKSETEEIGRLFERTMLSKYGPTRLNEHFLAFNTICDATQERQDAMFSLVDEPLDLMVVIGGYNSSNTTHLQEIAISRGIRSFHIDTPERIDPDNSIEHKPLGGDLVHETDFLPPGPVTVGITSGASTPDRAVEQVI 389
>gi|53715032|ref|YP_101024.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacteroides fragilis YCH46] >gi|60682994|ref|YP_213138.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Bacteroides fragilis NCTC 9343] >gi|81313950|sp|Q5L9K3|ISPH_BACFN 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|71152170|sp|Q64PU1|ISPH_BACFR 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|52217897|dbj|BAD50490.1| penicillin tolerance protein LytB [Bacteroides fragilis YCH46] >gi|60494428|emb|CAH09224.1| putative isoprene biosynthesis related reductase protein [Bacteroides fragilis NCTC 9343] (290 aa)
Score = 214, Expect = 1.5e-15, Identities = 83/273 (30%), Positives = 123/273 (45%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQG----YQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYK---NIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWL 282
           GFC GVV A    ++  +L      Y +G +VHN   ++ L+E+G+ T           I+  E K  +N   V+  AHG   +T   A+E  + + D TC  V +    IK++  Q      QI   G N H E +  +       I+IE ++  E  R +  K I + +QTT S+ EF EI E +K         E+ + IC    +R   +    +  DL+  V   KS+N K L E   K    SHLI +   I D        + +    STP WL
  S:    11 GFCFGVVTAIHKAEE--ELAKGVTLYCLGDIVHNSREVERLKEMGLIT-----------INHEEFKQLHNAK-VLLRAHGEPPETYIIAKENNIEIIDATCPVVLRLQKRIKQEYMQEDLDEKQIVIYGKNGHAEVLGLVGQTTGKAIVIEKLD--EARRLDFSKSIRLYSQTTKSLDEFWEIVEYIKEHISPDVTFEYYDTICRQVANRMPNLRKFAASHDLIFFVSGKKSSNGKMLFEECKKVNPNSHLIDSADEIDDSLLPGVNSIGVCGATSTPKWL 275
>gi|21673122|ref|NP_661187.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chlorobium tepidum TLS] >gi|50401065|sp|Q8KFN9|ISPH_CHLTE 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|21646197|gb|AAM71529.1| penicillin tolerance protein LytB [Chlorobium tepidum TLS] (332 aa)
Score = 211, Expect = 3.0e-15, Identities = 87/295 (29%), Positives = 140/295 (47%)
  Q:     1 MKI-IKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETIS-TLSIDKSIILIE--TVNDIENIRT-ESEKPIFVTNQTTISIYEFEEITETLKSKY------------------KNIE---------------FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINK-----KCLAITSGCSTPTWLANYVIIFLEKKLG 295
           MKI +  T  GFC GV       ++  KL  + E Y +G +VHN+  +K LE LG++T           ID    ++  N  ++I  AHG    T + AR+  L + DTTC  V K     K   + GYQ+   G   HPE I      D   ++I+   ++D E I   +  +   + +QTT+ +  F E+   L+  +                  ++I+               FK+ IC     R   + +     D ++     KS+N + L  I       S+ I +   I+ EWF+ +     + + I    STP WL   V  +++K  G
  S:     1 MKINLDRTSSGFCIGVQGTIHVAEE--KLAQSGELYCLGDVVHNEVEVKRLEALGMET-----------IDIPAFEELRNAEVLI-RAHGEPPSTYETARKNNLAITDTTCPVVAKLQRTAKMLHQLGYQVVIYGKKVHPEVIGINGQCDDEGVVIKHPDLSDPEEIAPLDLSRKTALISQTTMDVPGFYELKRNLEKLFAEHGHRNPGTQSGEWMAVRDIDITAEKTGALAMPKLVFKDTICRQVSSRNGKLRDFALANDCIVFAAGRKSSNGQVLYSICKDANPHSYFIEDVDEIRPEWFVGENGKPVESVGICGATSTPMWLLEKVANYIDKTFG 324
>gi|33239748|ref|NP_874690.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|50400964|sp|Q7VDS2|ISPH_PROMA 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|33237273|gb|AAP99342.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Prochlorococcus marinus subsp. marinus str. CCMP1375] (405 aa)
Score = 211, Expect = 3.1e-15, Identities = 93/289 (32%), Positives = 151/289 (52%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENI------------------RTESE--------KPIFVTNQTTISIYEFEEI----TETLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIES-HL--------IWNT---KNIKDEWFINKKCL-------AITSGCSTPTWLANYVIIFL----EKKLGTAN 298
           GFC GV  A A   +  + YP    ++   ++HN  +   L  + ++    +   +     S+E  D     +VI  A G     +    E+G  + DTTC +V+K    +++  +  +     G   H ET++T S   + +++  + + + +                  R  S+        K + V NQTT+   E EEI     +T+  KY   E        N IC+A ++RQDA+ ++  E +DLL+V+G   S+N+  L EI + K I S H+        I NT   K + D+  +    L        ITSG STP  +  +VI  L    E+KL T N
  S:    64 GFCWGVERAVAMAYETRRHYPTESIWITNEIIHNPSVNDHLRNMNVRFISAEKGIKD--FSSVEEGD-----VVILPAFGATVHEMKLLHERGCHIIDTTCPWVSKVWHTVEKHKKHEFSSIIHGKVKHEETLATSSFAGTYLVVLDLKEAQYVSDYILGKGNRDDFLRRFSRASSQGFDPDRDLKRLGVANQTTMLKSETEEIGRLFEKTMLRKYGPAELNEHFLAFNTICDATEERQDAMFSLVDEPLDLLVVIGGFNSSNTTHLQEIALAKGIRSFHIDTPERIGEIENTITHKPLGDDLRVESNFLPEGKINVGITSGASTPDRIVEHVIQKLINLSERKLMTEN 405
>gi|145220322|ref|YP_001131031.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Prosthecochloris vibrioformis DSM 265] >gi|189045815|sp|A4SGC0|ISPH_PROVI 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|145206486|gb|ABP37529.1| hydroxymethylbutenyl pyrophosphate reductase [Prosthecochloris vibrioformis DSM 265] (313 aa)
Score = 211, Expect = 3.1e-15, Identities = 83/282 (29%), Positives = 131/282 (46%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDI----ENIRTESEKPIFVTNQTTISIYEFEEITETLK-------------SKYKNIE---------FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKK-----CLAITSGCSTPTWLANYVIIFLE 291
           GFC GV       ++  KL      Y +G +VHN+  +K LE LG+ T           ID+    +  N P++I  AHG    T + A    L + DTTC  V K      +  E GYQI   G + HPE I      ++  LI    D+    E +  +  K   + +QTT+ +  F E+ + L+             ++ K+I          FK+ IC    +R   + +     + ++ V   KS+N + L  I  +   ESH I + + ++ EWF   +      + +    STP WL   V   +E
  S:    11 GFCFGVQSTINVAEE--KLRKEKGLYSLGDVVHNEVEVKRLEALGLIT-----------IDTPAFNELKNAPVLI-RAHGEPPSTYETANRNNLTLTDTTCPVVAKLQRTASQLNELGYQIIIYGKHLHPEVIGINGHCQNRALIIKHADLSDPEETLPIDLSKKTALISQTTMDVSGFYELKKNLEKLFSKGGRETGPWAEVKSIGEAEPMPEFIFKDTICRQISNRNQKLQDFSRANERIIFVAGKKSSNGQVLYAICKEANPESHFIEDVEELQSEWFTTTQGKTVESIGVCGATSTPMWLLEKVANHIE 309
>gi|116075604|ref|ZP_01472863.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus sp. RS9916] >gi|116066919|gb|EAU72674.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus sp. RS9916] (398 aa)
Score = 207, Expect = 9.5e-15, Identities = 85/278 (30%), Positives = 140/278 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKD---KNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIE----NIRTESEKPIFVT----------------------NQTTISIYEFEEI----TETLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCL------------------AITSGCSTPTWLANYVI 287
           GFC GV  A A   +  K YP+   ++   ++HN  +   L E+ ++           I     +KD     +  +VI  A G   + +    E+G  + DTTC +V+K    +++  +Q       G   H ET++T S   + +++  + + +     I    ++  F+T                      NQTT+   E EEI      T+ SKY            N IC+A ++RQDA+ ++  E +DL++V+G   S+N+  L EI + + I S  I   + I  +  I  K L                   ITSG STP  +  +VI
  S:    64 GFCWGVERAVAMAYETRKHYPDERIWITNEIIHNPSVNDHLREMDVEF----------IAVDQGVKDFSGVTSGDVVILPAFGATVQEMQLLNERGCHIVDTTCPWVSKVWTTVEKHKKQTVTSIIHGKVKHEETLATSSFAGTYLVVLDLKEAQMVADYILGNGDRETFMTKFAHACSQGFDPDRDLERLGVANQTTMLKSETEEIGRLFERTMLSKYGPTALNEHFLAFNTICDATQERQDAMFSLVDEPLDLMVVIGGYNSSNTTHLQEIAVSRGIRSFHIDTPERIGADNSIEHKPLGQDLIREADFLPAGPVNVGITSGASTPDRVVEHVI 389
>gi|94987170|ref|YP_595103.1| ribosomal protein S1 [Lawsonia intracellularis PHE/MN1-00] >gi|94731419|emb|CAJ54782.1| ribosomal protein S1 [Lawsonia intracellularis PHE/MN1-00] (294 aa)
Score = 206, Expect = 1.2e-14, Identities = 81/294 (27%), Positives = 133/294 (45%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEK-----YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSII-LIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKK-CLAITSGCSTPTWLANYVIIFLEKKL 294
           M++I+    G C GV  A    +K+++   N EK      + G ++HN ++I E +  G+             +DSIE  +      VI  AHG       +  + G+ + D TC  V KT   I         +   G  NHPE    +S  +    + +T   +E+      K I + +QTT     F+EI E L  K       N IC+A   RQ  ++++  +V+ ++VVG   S N+++LVE+   K I++  I     +     +++   + +T G STP  L + V  FL   L
  S:     9 MQVIRAKTAGTCWGVDLAL---RKLSQSIENKEKANTRFVMYGLIIHNPQVIVEYKAQGVIC-----------VDSIE--EVRAGDTVIIRAHGIPIYEEQQLTDIGINLIDATCPKVKKTQLAIANATNSETILLLFGEANHPEVKGLISYSQGPFHVFDTKQFVEDFDNSQNKTIVLASQTTQDEITFKEIQEILHQKGIQPVILNTICDATYKRQRELLSITEQVNTMVVVGGFTSGNTRRLVELSKAKGIKTFHIETVDALYGNNELDQNDIIGLTGGASTPKQLIDKVEDFLSNNL 293
>gi|119512490|ref|ZP_01631570.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nodularia spumigena CCY9414] >gi|119462840|gb|EAW43797.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nodularia spumigena CCY9414] (402 aa)
Score = 205, Expect = 1.5e-14, Identities = 78/270 (28%), Positives = 140/270 (51%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQ----TKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRT--------------------------ESEKPIFVTNQTTISIYEFEEITE----TLKSKYKNIEFK------NDICNAAKDRQDAVINM-PSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKD-----------------EWFINKK-CLAITSGCSTP 279
           GFC GV  A A   +  + +P    ++   ++HN  + + ++E+ I        +K+ S  E  D           +VI  A G   + +     +G  + DTTC +V+K  + +++  +  Y     G   H ETI+T S     +++  + +   +                            +  + + + NQTT+   E E+I +    T+  KY  IE        N IC+A ++RQDA++ +   ++DL+LV+G   S+N+ +L +I  +++I S+ I   + IK                   W  N K  + +TSG STP
  S:    64 GFCWGVERAVAMAYETRQHFPTERIWITNEIIHNPSVNQRMQEMNIGFIPVEAGNKDFSVVETGD-----------VVILPAFGASVQEMQILHNQGCKIVDTTCPWVSKVWNTVEKHKKIAYTSIIHGKYKHEETIATSSFAGKYLIVLNLQEAHYVADYILNGGDRQEFLQKFAKACSAGFDPDQDLQRVGIANQTTMLKDETEQIGKLFERTMMQKYGTIELNQHFQSFNTICDATQERQDAMLELVQHDLDLMLVIGGFNSSNTAQLQQIAAEREIPSYHIDCVERIKSADAIEHRQLNGELAIAQNWLPNGKIVVGVTSGASTP 381
>gi|56751440|ref|YP_172141.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus elongatus PCC 6301] >gi|81298884|ref|YP_399092.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus elongatus PCC 7942] >gi|123557655|sp|Q31S64|ISPH_SYNP7 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|71152197|sp|Q5N249|ISPH_SYNP6 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|56686399|dbj|BAD79621.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus elongatus PCC 6301] >gi|81167765|gb|ABB56105.1| hydroxymethylbutenyl pyrophosphate reductase [Synechococcus elongatus PCC 7942] (398 aa)
Score = 205, Expect = 1.5e-14, Identities = 88/278 (31%), Positives = 144/278 (51%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQ----TKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVN-------------DIENIRTESEKP-------------IFVTNQTTISIYEFEEITE----TLKSKYK----NIEFK--NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCL------------------AITSGCSTPTWLANYVI 287
           GFC GV  A A   +  + +P    ++   ++HN  + + L E+ ++     + +K+ S         + D+ +  +VI  A G   + +    EKG  + DTTC +V+K  + +++     +     G  NH ET++T S  ++ +++  +              D +   T   K              I + NQTT+   E E I +    TL  KY     N  F   N IC+A ++RQDA+  +  E +DL++V+G   S+N+  L EI I++QI S  I   + I     I  K L                   ITSG STP  +   VI
  S:    64 GFCWGVERAVAIAYETRQHFPQERIWITNEIIHNPSVNQHLREMSVEFIPCERGEKDFS---------VVDRGD--VVILPAFGASVQEMQLLDEKGCHIVDTTCPWVSKVWNTVEKHKRGAHTSIIHGKYNHEETVATSSFAETYLVVLNLEQAQYVCDYILNGGDRDEFMTRFGKACSAGFDPDRDLERIGIANQTTMLKSETEAIGKLFERTLLKKYGPQALNDHFLAFNTICDATQERQDAMFQLVEEPLDLIVVIGGFNSSNTTHLQEIAIERQIPSFHIDAAERIGPGNRIEHKPLHTDLTTTEPWLPAGPLTIGITSGASTPDKVVEDVI 389
>gi|111118847|gb|ABH05941.1| hydroxymethylbutenyl 4-diphosphate reductase [Toxoplasma gondii] (164 aa)
Score = 205, Expect = 1.6e-14, Identities = 47/127 (37%), Positives = 66/127 (51%)
  Q:    73 EIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE 199
           EI D     + +FSAHG       +A  + L V D TC  VTK H  +K+K EQGY I  IG  NH E I T      ++ ++E+V D+E +     + +F   QTT+S+ +   I + L  KY  IE
  S:    30 EISDIPRGAVAVFSAHGVSPAVRAEAEARQLQVVDATCPLVTKVHVYVKQKAEQGYHIILIGHKNHVEVIGTQGEAPGAVTVVESVEDVEQLSFSDSQKLFYATQTTLSLDDCGAIRQALIEKYPKIE 157
>gi|115455133|ref|NP_001051167.1| Os03g0731900 [Oryza sativa (japonica cultivar-group)] >gi|50540738|gb|AAT77894.1| putative LytB protein [Oryza sativa (japonica cultivar-group)] >gi|108710907|gb|ABF98702.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, putative, expressed [Oryza sativa (japonica cultivar-group)] >gi|113549638|dbj|BAF13081.1| Os03g0731900 [Oryza sativa (japonica cultivar-group)] (459 aa)
Score = 205, Expect = 1.7e-14, Identities = 85/270 (31%), Positives = 143/270 (52%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENI----------RTESEKPIF----------------------VTNQTTISIYEFEEI---TETLKSKYKNIEFKND-------ICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNI-----------------KDEWFINKK-CLAITSGCSTP 279
           GFC GV  A     +  K +P+   +L   ++HN  + K LE++G+Q     N      I   ++ ++ +  +V+  A G   + +    EK + + DTTC +V+K  +++++  +  Y     G  +H ET++T S   + I+++ + +   +           + S K  F                      + NQTT+   E EEI    E    +   +E  ND       IC+A ++RQDA+  +  E VDL+LVVG   S+N+  L EIG    I S+ I + + I                 K+ W       + +TSG STP
  S:   113 GFCWGVERAVQIAYEARKQFPDDRIWLTNEIIHNPTVNKRLEDMGVQ-----NIPVDAGIKDFDVVEQGD--VVVLPAFGAAVEEMYTLNEKKVQIVDTTCPWVSKVWNMVEKHKKGDYTSIIHGKYSHEETVATASFAGTYIIVKNIAEASYVCDYILGGQLDGSSSTKEEFLEKFKNAVSPGFDPDVDLVKVGIANQTTMLKGETEEIGKLVEKTMMRRFGVENVNDHFIAFNTICDATQERQDAMYQLVKEKVDLILVVGGWNSSNTSHLQEIGELSGIPSYWIDSEQRIGPGNKISYKLNHGELVEKENWLPEGPITIGVTSGASTP 436
>gi|37522868|ref|NP_926245.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Gloeobacter violaceus PCC 7421] >gi|50400939|sp|Q7NG74|ISPH_GLOVI 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|35213870|dbj|BAC91240.1| glr3299 [Gloeobacter violaceus PCC 7421] (417 aa)
Score = 204, Expect = 2.2e-14, Identities = 71/273 (26%), Positives = 133/273 (48%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENI--------------------RTESEKP------IFVTNQTTISIYEFEEITE----TLKSKY------KNIEFKNDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWL 282
           GFC GV  A +   +  +++   + ++   ++HN  + + L  +GI+  D+    R    D   + +K+   +VI  A G   + +    EK  V+ DTTC +V+   + + +     +     G   H ET++T S  +  +++  + + + +                      E   P      + + NQTT+   E E I +    T+  +Y       +    + IC+A ++RQDA+  +  E +DLL+V+G   S+N+  L EI +++ + S  I     +    FI  + L   S   T  WL
  S:    54 GFCWGVDKAVSMAYETHRMFAGRQLWITNEIIHNPLVNQHLRAMGIRFLDEDESGRRVPKDFERVSEKD---VVILPAFGASTQEMQILDEKNCVIVDTTCPWVSAVWNRVGKYDRAEFTSIIHGKYQHEETVATASRARRYLVVLNLEEAQQVCDYILHGGDRRAFLAHFGMAACEGFDPDRDLVRVGIANQTTMLKGETERIGKLFERTMMRRYGPANLADHFMSHDTICDATQERQDAMFKLVEEPLDLLVVIGGYNSSNTTHLQEIAVERGLPSFHIDGADRLVSAQFIEHRDLHSKSLVRTKNWL 360
>gi|78211798|ref|YP_380577.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus sp. CC9605] >gi|123578913|sp|Q3AN10|ISPH_SYNSC 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|78196257|gb|ABB34022.1| hydroxymethylbutenyl pyrophosphate reductase [Synechococcus sp. CC9605] (399 aa)
Score = 203, Expect = 3.2e-14, Identities = 68/241 (28%), Positives = 123/241 (51%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIR----------------TESEKPIF----------VTNQTTISIYEFEEI----TETLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIES 250
           GFC GV  A A   +  K YP+   ++   ++HN  +   L E+ +Q    +   +       +     +  +VI  A G   + +    E+G  + DTTC +V+K  + +++  +  +     G   H ET++T S   + +++  + + + +                  ++  P F          V NQTT+   E EEI      T+ SKY   +        N IC+A ++RQDA+ ++  E +DL++V+G   S+N+  L EI + + I S
  S:    64 GFCWGVERAVAMAYETRKHYPSERLWITNEIIHNPSVNDHLREMDVQFIPVEQGVK-------DFSGVTSGDVVILPAFGATVQEMQLLNERGCHIVDTTCPWVSKVWNTVEKHKKHTFTSIIHGKVKHEETLATSSFAGTYLVVLDLEEAQYVADYILGNGDREDFIKRFAKACSPGFDPDRDLERLGVANQTTMLKSETEEIGRLFERTMLSKYGPTQLNDHFLAFNTICDATQERQDAMFSLVDEPLDLMVVIGGFNSSNTTHLQEIAVSRGIRS 334
>gi|194333263|ref|YP_002015123.1| hydroxymethylbutenyl pyrophosphate reductase [Prosthecochloris aestuarii DSM 271] >gi|194311081|gb|ACF45476.1| hydroxymethylbutenyl pyrophosphate reductase [Prosthecochloris aestuarii DSM 271] (325 aa)
Score = 203, Expect = 3.3e-14, Identities = 85/290 (29%), Positives = 136/290 (46%)
  Q:     7 TPRGFCKGVVDAYATCKKIAKLYPNHEK-YLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETIS-TLSIDKSIILIETVN---DIENIRTESEKPIFVTNQTTISIYEFEEITETLK---------------SKYKNIE------------------FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGC----STPTWLANYVIIFLEKKLGT 296
           T  GFC GV       ++  KL  +  K Y +G +VHN+  +K LEELG+ T           ID  E     N P++I  AHG    T   A+   L V D+TC  V K     +    +GYQI   G  NHPE I      D   I+I+  +     E    +  +   + +QTT+ +  F  + E L+               S +++I                   +K+ IC     R   + +  ++ D+++ V   KS+N + L  I       ++   + K+I+DEW +  +    ++G     STP WL   V   +E +  +
  S:     8 TSSGFCIGVQGTIHLAEE--KLREHDGKLYCLGDIVHNEVEVKRLEELGLIT-----------IDLNEYSALTNAPVLI-RAHGEPPSTYTTAKSNQLDVTDSTCPVVAKLQRSARMLHNRGYQIIIYGKKNHPEVIGINGQCDNQAIIIKHPDLSAPEETAPLDFTRRTALISQTTMDVPGFAMLKENLERLFSASAGPGERHAASHWQDIRDIDLTAEITGVRPLPKFLYKDTICRQVSSRNSKLHDFAAQNDVVIFVAGKKSSNGQVLFNICKASNPRTYFAEDEKDIQDEWLLENRQPVQSAGVCGATSTPMWLLEKVARSIESRFSS 325
>gi|159902832|ref|YP_001550176.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Prochlorococcus marinus str. MIT 9211] >gi|159888008|gb|ABX08222.1| LytB-like protein [Prochlorococcus marinus str. MIT 9211] (404 aa)
Score = 202, Expect = 3.6e-14, Identities = 86/278 (30%), Positives = 145/278 (52%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQ----TKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENI------------------RTESE--------KPIFVTNQTTISIYEFEEI----TETLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEW-----------FINKK--------CLAITSGCSTPTWLANYVI 287
           GFC GV  A A   +  + YP    ++   ++HN  +   L  + ++     K  KN S      S++  D     +VI  A G   + +    E+G  + DTTC +V+K    +++  +  +     G   H ET++T S   + +++  + + + +                  +  S+        + + V NQTT+   E EEI     +T+  KY   E        N IC+A ++RQDA+ ++  E +DLL+V+G   S+N+  L EI I + I S  I   + I D+             I +K         + ITSG STP  +  +VI
  S:    64 GFCWGVERAVAMAYETRRHYPKESIWITNEIIHNPSVNDHLRNMNVRFISAEKGIKNFS------SVQEGD-----VVILPAFGATVQEMKLLHERGCHIIDTTCPWVSKVWHTVEKHKKHEFTSIIHGKVKHEETLATSSFAGTYLVVLDLEEAQYVANYILGKGDREEFLKRFSKASSQGFDPDRDLQRLGVANQTTMLKSETEEIGRLFEKTMLRKYGPAELTEHFLAFNTICDATEERQDAMFSLVDEPLDLLVVIGGFNSSNTTHLQEIAISRGIRSFHIDTPERIGDQENTITHKPLGDDLITEKNFLPEGNISVGITSGASTPDRVVEHVI 390
>gi|57233921|ref|YP_182055.1| hydroxymethylbutenyl pyrophosphate reductase [Dehalococcoides ethenogenes 195] >gi|123618353|sp|Q3Z6U4|ISPH_DEHE1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|57224369|gb|AAW39426.1| hydroxymethylbutenyl pyrophosphate reductase [Dehalococcoides ethenogenes 195] (284 aa)
Score = 199, Expect = 7.6e-14, Identities = 77/278 (27%), Positives = 130/278 (46%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVN-----DIENIRTESEKPIFVTNQTTISIYEF----EEITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCST 278
           MK+   +  GFC GV  A    +K A      E   +G LVHN++++  L  +G++           ++ +IE  D +   + I S+HG     +D+ + KGL V DTTC +V +     K   + G+     G  NHPE    +       L  T+N     D+ ++     + I V +QTT     F    + + +    K   I   + +C+  ++RQ A + +   VDL+LV+G   S N++ L+++  K    ++LI     ++  W      + ITSG ST
  S:     1 MKVECASNIGFCFGVRRAINILEKTAAEKGGVET--LGALVHNQQVLNRLSGMGVR-----------VVKNIE--DISGRTVAI-SSHGVGPLVLDELKSKGLEVVDTTCPFVKRAQVAAKRFHDAGFFTVIYGDVNHPEVKGIMGWAGGDGL-ATLNPQGLVDVPDV----SRYIGVLSQTTQIPTGFTSFVKNVIDQALVKDAEIRIADTLCHDIRERQTAALELAGRVDLMLVIGGHNSANTRHLLDL-CKTVSNTYLIETASELQTGWLRGVNRIGITSGAST 265
>gi|110597808|ref|ZP_01386091.1| hydroxymethylbutenyl pyrophosphate reductase [Chlorobium ferrooxidans DSM 13031] >gi|110340533|gb|EAT59016.1| hydroxymethylbutenyl pyrophosphate reductase [Chlorobium ferrooxidans DSM 13031] (335 aa)
Score = 199, Expect = 8.1e-14, Identities = 81/288 (28%), Positives = 133/288 (46%)
  Q:     7 TPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETIS-TLSIDKSIILIE--TVNDIENIRT-ESEKPIFVTNQTTISIYEFEEITETLKSKY-----------KNIE---------------FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITS-----GCSTPTWLANYVIIFLEKKL 294
           T  GFC GV       ++  KL      + +G +VHN+  +K LE LG+ T           ID    ++  N  ++I  AHG    T   A    L V DTTC  V++     +   E GYQI   G   HPE I        S I+I+   ++D E  +  ++ K   + +QTT+ +  F E+   L++++           ++I+               FK+ IC     R   + +     ++++ V   KS+N + L  I       S+ I + + I+ EW ++     + S       STP WL   V  ++E   
  S:    26 TSSGFCIGVQGTIHVAEE--KLQDPQGLFSLGDVVHNEAEVKRLEALGLVT-----------IDEAAFRELKNAKVLI-RAHGEPPSTYKIAEANNLEVTDTTCPVVSRLQRTTRALHELGYQIIIYGKPTHPEVIGINGQCANSAIIIKHADLSDPEETKALDAAKKTALISQTTMDVPGFYELKRNLEARFSPDSPSEWMAIRDIDITAEMTGVRPMPRHIFKDTICRQVSSRNQKLHDFALANEVIIFVAGKKSSNGQVLYNICRDANPRSYFIEDVEEIQPEWLLSLNGSGVASAGICGATSTPMWLLEKVANYIESNF 334
>gi|86605836|ref|YP_474599.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus sp. JA-3-3Ab] >gi|86554378|gb|ABC99336.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus sp. JA-3-3Ab] (426 aa)
Score = 199, Expect = 8.9e-14, Identities = 79/279 (28%), Positives = 144/279 (51%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRT----------------ESEKPIF----------VTNQTTISIYEFEEITE----TLKSKYKNIEFK------NDICNAAKDRQDAVIN-MPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCL------------------AITSGCSTPTWLANYVII 288
           GFC GV  A     +  + +P+ + ++   ++HN  + + L+E+GI+  +     +    D  +I+ ++   +VI+ A G     ++  R +G  + DTTC +V++  + + +     +     G  NH ET++T S  +  +++  + + E +                  ++  P F          + NQTT+   E   I +    T+  KY   E        N ICNA ++RQDA+   +   +D+++V+G   S+N+  L EI + K + S+ I     I+    I  K L                   ITSG STP  +   VI+
  S:    78 GFCWGVERAVEYAYEARRRFPDRQIWITNEIIHNPLVNRHLQEMGIRFVEKGPDGKK---DFSQIRPED---VVIWPAFGASVSEMEFFRSQGNEIVDTTCPWVSRVWNQVDKHRAAQFTSVIHGKYNHEETVATSSFAQKYLVVLNLEEAEWVARYILHGGDAAEFRRRFGKATSPGFDPDRDLERIGIANQTTMLEGETRAIAKLFETTMLRKYGPQELDKHFMSFNTICNATQERQDAMFELLERPLDVVVVIGGFNSSNTTHLQEIALAKGLPSYHIDGPDCIQPPNRIRHKPLHQDPIVTEGWLPDGPVQIGITSGASTPDRVVEEVIL 405
>gi|116071531|ref|ZP_01468799.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus sp. BL107] >gi|116065154|gb|EAU70912.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus sp. BL107] (399 aa)
Score = 198, Expect = 1.2e-13, Identities = 84/278 (30%), Positives = 141/278 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQ----TKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVND----IENIRTESEKPIF----------------------VTNQTTISIYEFEEI----TETLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNI-----------------KDEWFI--NKKCLAITSGCSTPTWLANYVI 287
           GFC GV  A A   +  + YP+   ++   ++HN  +   L E+ +      K  K+ S     D           +VI  A G   + +    E+G  + DTTC +V+K  + +++  +  +     G   H ET++T S   + +++  + +    ++ I  + ++  F                      V NQTT+   E EEI      T+ SKY   +        N IC+A ++RQDA+ ++  E +DLL+V+G   S+N+  L EI + + I S  I     I                 +D+ F+      + ITSG STP      VI
  S:    64 GFCWGVERAVAMAYETRRHYPSERLWITNEIIHNPSVNDHLREMDVLFIPVEKGVKDFSGVTSGD-----------VVILPAFGATVQEMQLLNERGCHIVDTTCPWVSKVWNTVEKHKKHTFTSVIHGKVKHEETLATSSFAGTYLVVLDLEEAQIVVDYILGKGDREAFMQRFAKACSEGFDPDRDLERLGVANQTTMLKSETEEIGRMFERTMLSKYGPTDLNEHFLAYNTICDATQERQDAMFSLVDEPLDLLVVIGGFNSSNTTHLQEIAVSRGIRSFHIDTPDRIDETINSIEHKPLSEDLKRDQVFLPAGPVTVGITSGASTPDRAVEAVI 390
>gi|87301960|ref|ZP_01084794.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus sp. WH 5701] >gi|87283528|gb|EAQ75483.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus sp. WH 5701] (398 aa)
Score = 198, Expect = 1.2e-13, Identities = 69/241 (28%), Positives = 127/241 (52%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEI---IKELEELGIQTKDD-KNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENI----------------RTESEKPIF----------VTNQTTISIYEFEEI----TETLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIES 250
           GFC GV  A A   +  + YP+   ++   ++HN  +   ++++  L I+ ++  K+ S   + D           +VI  A G   + +    E+G  + DTTC +V+K  + +++  +  +     G   H ET++T S   + +++  + + + +                  ++  P F          V NQTT+   E EEI      T+  +Y   E        N IC+A ++RQDA+ ++  E +DL++V+G   S+N+  L EI I + I S
  S:    64 GFCWGVERAVAMAYETRRHYPSERIWITNEIIHNPSVNAHLRDMNVLFIRVEEGVKDFSEVGVGD-----------VVILPAFGATVQEMQLLNERGCHIVDTTCPWVSKVWNTVEKHKKHAFSSIIHGKVKHEETLATSSFAGTYLVVLDLAEAQMVCDYILGKGDREAFISHFAKASSPGFDPDRDLARVGVANQTTMLKSETEEIGRMFERTMLQRYGPAELNDHFLAFNTICDATQERQDAMFSLVDEPLDLMVVIGGYNSSNTTHLQEIAISRGIRS 334
>gi|78183857|ref|YP_376291.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus sp. CC9902] >gi|123582192|sp|Q3B080|ISPH_SYNS9 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|78168151|gb|ABB25248.1| LytB protein [Synechococcus sp. CC9902] (399 aa)
Score = 197, Expect = 1.4e-13, Identities = 83/278 (29%), Positives = 143/278 (51%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIE--IKD---KNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVND----IENIRTESEKPIF----------------------VTNQTTISIYEFEEI----TETLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNI-----------------KDEWFI--NKKCLAITSGCSTPTWLANYVI 287
           GFC GV  A A   +  + YP+   ++   ++HN  +   L E+ +            +   +E  +KD     +  +VI  A G   + +    E+G  + DTTC +V+K  + +++  +  +     G   H ET++T S   + +++  + +    ++ I  + ++  F                      V NQTT+   E EEI      T+ SKY   +        N IC+A ++RQDA+ ++  E +DLL+V+G   S+N+  L EI + + I S  I     I                 +D+ F+      + ITSG STP      VI
  S:    64 GFCWGVERAVAMAYETRRHYPSERLWITNEIIHNPSVNDHLREMDV------------LFIPVEEGVKDFSGVTSGDVVILPAFGATVQEMQLLNERGCHIVDTTCPWVSKVWNTVEKHKKHTFTSVIHGKVKHEETLATSSFAGTYLVVLDLEEAQIVVDYILGKGDREAFMQRFAKACSEGFDPDRDLERLGVANQTTMLKSETEEIGRMFERTMLSKYGPADLNEHFLAYNTICDATQERQDAMFSLVDEPLDLLVVIGGFNSSNTTHLQEIAVSRGIRSFHIDTPDRIDETTNSIEHKPLSEDLKRDQVFLPAGPVTVGITSGASTPDRAVEAVI 390
>gi|18418433|ref|NP_567965.1| CLB6 (CHLOROPLAST BIOGENESIS 6); 4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase [Arabidopsis thaliana] >gi|14596179|gb|AAK68817.1| putative protein [Arabidopsis thaliana] >gi|20148251|gb|AAM10016.1| putative protein [Arabidopsis thaliana] >gi|27368105|gb|AAN87171.1| ISPH [Arabidopsis thaliana] (466 aa)
Score = 196, Expect = 1.7e-13, Identities = 87/270 (32%), Positives = 143/270 (52%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENI----------RTESEKPIF----------------------VTNQTTISIYEFEEITETLKS----KY--KNIEFK----NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNI----------------KDEWFINKK--CLAITSGCSTP 279
           GFC GV  A     +  K +P    ++   ++HN  + K LE++ ++    ++  +    D +E  D     +VI  A G     +    +K + + DTTC +VTK  + +++  +  Y     G  NH ETI+T S     I+++ + +   +           + S K  F                      + NQTT+   E EEI   L++    KY  +N+       N IC+A ++RQDA+  +  E +DL+LVVG   S+N+  L EI   + I S+ I + K I                + E F+ K    + +TSG STP
  S:   120 GFCWGVERAVQIAYEARKQFPEERLWITNEIIHNPTVNKRLEDMDVKIIPVEDSKKQ--FDVVEKDD-----VVILPAFGAGVDEMYVLNDKKVQIVDTTCPWVTKVWNTVEKHKKGEYTSVIHGKYNHEETIATASFAGKYIIVKNMKEANYVCDYILGGQYDGSSSTKEEFMEKFKYAISKGFDPDNDLVKVGIANQTTMLKGETEEIGRLLETTMMRKYGVENVSGHFISFNTICDATQERQDAIYELVEEKIDLMLVVGGWNSSNTSHLQEISEARGIPSYWIDSEKRIGPGNKIAYKLHYGELVEKENFLPKGPITIGVTSGASTP 443
>gi|75909159|ref|YP_323455.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Anabaena variabilis ATCC 29413] >gi|123609130|sp|Q3M8X6|ISPH_ANAVT 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|75702884|gb|ABA22560.1| LytB protein [Anabaena variabilis ATCC 29413] (402 aa)
Score = 195, Expect = 2.3e-13, Identities = 80/278 (28%), Positives = 144/278 (51%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEEL--GIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENI-------RTESE-------------------KPIFVTNQTTISIYEFEEITE----TLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIK-----------------DEWF-INKKCLAITSGCSTPTWLANYVI 287
           GFC GV  A A   +  K +P    ++   ++HN  + + ++E+  G    +  N   S +          N  +VI  A G   + +    EKG  + DTTC +V+K  + +++  +  +     G   H ETI+T S     +++  + + + +       R   E                   + + + NQTT+   E E+I +    T+  KY  +E        N IC+A ++RQDA++ +  E +DL++V+G   S+N+ +L +I  ++ + S+ I   + IK                 + W    K  + +TSG STP  +   VI
  S:    64 GFCWGVERAVAMAYETRKHFPTERIWITNEIIHNPSVNQRMQEMQVGFIPVEAGNKDFSVV---------GNNDVVILPAFGASVQEMQLLSEKGCKIVDTTCPWVSKVWNTVEKHKKGDHTSIIHGKYKHEETIATSSFAGKYLIVLNLKEAQYVADYILHGRNREEFLQKFAKACSAGFDPDKDLERVGIANQTTMLKGETEQIGKLFEHTMLQKYGPVELNQHFQSFNTICDATQERQDAMLELVQENLDLMIVIGGFNSSNTTQLQQISQERGLPSYHIDVVERIKSVNSIEHRQLNGELVTTENWLPAGKIVVGVTSGASTPDKVVEDVI 389
>gi|189345888|ref|YP_001942417.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chlorobium limicola DSM 245] >gi|189340035|gb|ACD89438.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chlorobium limicola DSM 245] (324 aa)
Score = 195, Expect = 2.4e-13, Identities = 83/294 (28%), Positives = 138/294 (46%)
  Q:     1 MKI-IKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETIST---LSIDKSIILIETVNDIENIRT-ESEKPIFVTNQTTISIYEFEEITETLKSKY--------------KNIE---------------FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINK-----KCLAITSGCSTPTWLANYVIIFLEKKL 294
           MKI +  T  GFC GV       ++  KL      + +G +VHN+  +K LE LG+ T           ID    K+  N  ++I  AHG   +T   A    L + DTTC  V+K     +   + GYQ+   G + HPE I      S    II    ++D E ++T ++     + +QTT+ +  F E+   L+ ++              ++I+               FK+ IC     R   + +       ++ V   KS+N + L  I       S+ I + ++++D WF +      + + I    STP WL   V  F++ + 
  S:     1 MKINLDRTSSGFCIGVQGTIHVAEE--KLAAKETLFSLGDVVHNEVEVKRLENLGLTT-----------IDEAVFKELQNTSVLI-RAHGEPPETYATAERNKLDITDTTCPVVSKLQRTARLLCQLGYQVIIYGKHTHPEVIGINGHCSNRAVIIKHADLSDPEELKTLDTTIKTALISQTTMDVPGFYELKTNLEKRFAESDETAGKPWTAIRDIDITAAMTGIGTMPRTVFKDTICRQVSSRNKKLHDFALANSCVIFVAGRKSSNGQVLFGICRSANPRSYFIEDIEDLEDSWFRDNEGSPVESIGICGATSTPMWLLEKVAEFIDGRF 319
>gi|33864788|ref|NP_896347.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus sp. WH 8102] >gi|50400950|sp|Q7U9K4|ISPH_SYNPX 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|33632311|emb|CAE06767.1| LytB protein homolog [Synechococcus sp. WH 8102] (399 aa)
Score = 194, Expect = 2.9e-13, Identities = 69/241 (28%), Positives = 120/241 (49%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIE----NIRTESEKPIF----------------------VTNQTTISIYEFEEI----TETLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIES 250
           GFC GV  A A   +  K YP    ++   ++HN  +   L E+ +Q    +   +       +     +  +VI  A G   + +    E+G  + DTTC +V+K    +++  +        G   H ET++T S   + +++  + + +     I  + ++  F                      V NQTT+   E EEI      T+ SKY   E        N IC+A ++RQDA+ ++  E +DL++V+G   S+N+  L EI + + I S
  S:    64 GFCWGVERAVAMAYETRKHYPAERLWITNEIIHNPSVNDHLREMDVQFIPVEQGVK-------DFSGVTSGDVVILPAFGATVQEMQLLNERGCHIVDTTCPWVSKVWTTVEKHKKHTITSIIHGKVKHEETLATSSFAGTYLVVLDMEEAQIVADYILGKGDRDAFMQRFSAACSPGFDPDRDLSRLGVANQTTMLKSETEEIGRLFERTMLSKYGPAELNDHFVAFNTICDATQERQDAMFSLVDEPLDLMVVIGGFNSSNTTHLQEIALSRGIRS 334
>gi|113477878|ref|YP_723939.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Trichodesmium erythraeum IMS101] >gi|122964410|sp|Q10WA8|ISPH_TRIEI 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|110168926|gb|ABG53466.1| hydroxymethylbutenyl pyrophosphate reductase [Trichodesmium erythraeum IMS101] (401 aa)
Score = 194, Expect = 2.9e-13, Identities = 83/270 (30%), Positives = 148/270 (54%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIID-SIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI-DKSIILI-------------------ETVNDIENIRTESEKP------IFVTNQTTISIYEFEEITE----TLKSKYK----NIEFK--NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCL------------------AITSGCSTP 279
           GFC GV  + A   +  + +PN + ++   L+HN  + ++++++ I+           +ID   +     N  +VI  A G   + +   ++K   + DTTC +V+K  + I++  ++ +     G  +H ETI+T S  DK +I++                   E +   +   +E   P      + + NQTT+   E EEI +    T+  KY+    N  ++  N IC+A ++RQDA+  + +E +DL++V+G   S+N+  L E+ I+  I S+ I   + I     I  K L                   +TSG STP
  S:    64 GFCWGVERSVAMAYETRQHFPNQQIWISYELIHNPSVNQDMKDMEIKF--------IPVIDGQKDFSVAGNNDVVILPAFGASVQEMQILKDKNCQIVDTTCPWVSKVWNSIEKHKKKKFTSIIHGKYSHAETIATSSFADKYLIVLNMTQAQYVCNYILNGGNRDEFLAKFKQAYSEGFDPDLDLEQVGIANQTTMLKTETEEIGKLFERTMMKKYRPDQLNAHYQNFNTICDATQERQDAIAGLFNEKLDLMVVIGGFNSSNTTHLQEMAIENGIPSYHIDGAQRILSRNKIEHKPLGREVKISEGWLPEGPVVVGLTSGASTP 381
>gi|108805030|ref|YP_644967.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rubrobacter xylanophilus DSM 9941] >gi|108766273|gb|ABG05155.1| hydroxymethylbutenyl pyrophosphate reductase [Rubrobacter xylanophilus DSM 9941] (410 aa)
Score = 193, Expect = 3.8e-13, Identities = 80/251 (31%), Positives = 132/251 (52%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGI----QTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSID-------KSII---LIET--VNDIENIRTESEK----------PIF----------VTNQTTISIYEF----EEITETLKSKY------KNIEFKNDICNAAKDRQDAVIN-MPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIK 260
           GFC GV  A     +  + +P+   +L G ++HN  +   L E+GI    Q  D +   R E +D  ++        VI  A G   + + K RE+G ++ DTTC  V      +    ++G+     G   H ET +T S         K +I   L ET  + D    RT + +          P F          V NQTT+ + E     EEI + ++ +Y      ++ E  + IC+A +DRQDA++  +   +D++++VG   S+N+  L  I   +   S+ I N + I+
  S:    54 GFCYGVDRAVDYAFQTREKFPDRRIFLTGDMIHNASMNARLREMGIEFLSQGFDGRPDERFEDLDEEDV--------VILPAFGAPVEWVGKLRERGCIIVDTTCGSVLSVWKRVARYAQKGFTSIIHGKYYHEETRATASQTRREGGNGKYLIVRDLKETGYLTDFIRGRTSAGELKERLGHGMSPGFDPERDLVRVGVANQTTMLMTETMKVGEEIRKAMEERYGRENLAEHFELFDTICSATQDRQDALMRLLEHPLDVVVIVGGYNSSNTNNLAIIAAGRVPRSYHIANGECIR 343
>gi|17228480|ref|NP_485028.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Nostoc sp. PCC 7120] >gi|20138568|sp|P58674|ISPH_ANASP 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|17130331|dbj|BAB72942.1| all0985 [Nostoc sp. PCC 7120] (402 aa)
Score = 193, Expect = 4.0e-13, Identities = 80/278 (28%), Positives = 144/278 (51%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEEL--GIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENI---------RTE-----------------SEKPIFVTNQTTISIYEFEEITE----TLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIK-----------------DEWF-INKKCLAITSGCSTPTWLANYVI 287
           GFC GV  A A   +  K +P    ++   ++HN  + + ++E+  G    +  N   S +          N  +VI  A G   + +    EKG  + DTTC +V+K  + +++  +  +     G   H ETI+T S     +++  + + + +         R E                   + + + NQTT+   E E+I +    T+  KY  +E        N IC+A ++RQDA++ +  E +DL++V+G   S+N+ +L +I  ++ + S+ I   + IK                 + W    K  + +TSG STP  +   VI
  S:    64 GFCWGVERAVAMAYETRKHFPTERIWITNEIIHNPSVNQRMQEMQVGFIPVEAGNKDFSVV---------GNNDVVILPAFGASVQEMQLLSEKGCKIVDTTCPWVSKVWNTVEKHKKGDHTSIIHGKYKHEETIATSSFAGKYLIVLNLKEAQYVADYILHGGNREEFLQKFAKACSAGFDPDRDLERVGIANQTTMLKGETEQIGKLFEHTMLQKYGPVELNQHFQSFNTICDATQERQDAMLELVQENLDLMIVIGGFNSSNTTQLQQISQERGLPSYHIDVVERIKSINSIEHRQLNGELVTTENWLPAGKIVVGVTSGASTPDKVVEDVI 389
>gi|86610071|ref|YP_478833.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86558613|gb|ABD03570.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechococcus sp. JA-2-3B'a(2-13)] (419 aa)
Score = 193, Expect = 4.1e-13, Identities = 79/278 (28%), Positives = 142/278 (51%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRT----------------ESEKPIF----------VTNQTTISIYEFEEITE----TLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCL------------------AITSGCSTPTWLANYVI 287
           GFC GV  A     +  + +P+ + ++   ++HN  + + L+E+GI+  +     +    D  +I+ ++   +VI+ A G     +   R +G  + DTTC +V++  + + +     +     G  NH ET++T S  +  +++  + + E +                  ++  P F          + NQTT+   E   I +    T+  KY   E        N ICNA ++RQDA+  +  + +D+++V+G   S+N+  L EI + K + S  I     I+    I  K L                   ITSG STP  +   VI
  S:    78 GFCWGVERAVEYAYEARRRFPDRQLWITNEIIHNPLVNQHLKEMGIRFVEKGPDGKK---DFSQIRPQD---VVIWPAFGASASEMAFFRSQGNEIVDTTCPWVSRVWNQVDKHRAAQFTSVIHGKYNHEETVATSSFAEKYLVVLNLEEAEWVARYILQGGDAAEFRRRFGKATSPGFDPDRDLERIGIANQTTMLEGETRAIAKLFETTMLRKYGPQELDNHFMSFNTICNATQERQDAMFELLEQPLDVVVVIGGFNSSNTTHLQEIALAKGLPSFHIDGPDCIQPNNRIRHKPLHQDPTVTEGWLPDGPVQIGITSGASTPDRVVEEVI 404
>gi|150021498|ref|YP_001306852.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Thermosipho melanesiensis BI429] >gi|149794019|gb|ABR31467.1| hydroxymethylbutenyl pyrophosphate reductase [Thermosipho melanesiensis BI429] (810 aa)
Score = 193, Expect = 4.7e-13, Identities = 89/295 (30%), Positives = 140/295 (47%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGW----LVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFE----EITETLKSKYKNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLEKKLG 295
           M+I+     GFC GV +A +  K++ K      K L  W    +VHNK ++KEL ++G+                     K    + +  AHG  +  +D  +++   V D TC  V      + E  ++GY+I   G   HPE    +   KS     T+ DI      + K I + +QTT+S  +FE    +ITE   SK+ +I+  N ICN   +R+     +   VDL++VVG   S+N+ KL +I  K     H+    + I+    + K  + + SG STP  +   VI+ L K+LG
  S:     1 MQIVVAEGIGFCFGVENAVSKAKELLK------KGLSVWTDDDIVHNKSVMKELYDMGLS--------------------KEKGDVFLVRAHGLPKDVLDDLKKR-YKVEDLTCSIVKNLFKTVAEIEKKGYKIVVFGKKEHPE----MKALKSYCENATITDIP--LPINAKRIAIASQTTMSYTDFEFFVNKITEM--SKFDDIKIINSICNITYNREKEAEKISKIVDLMVVVGGKHSSNTTKLYKISSKYTKSMHIELPEELIELPKGVKK--IGVISGTSTPKNIVEKVILRL-KELG 265
>gi|110636514|ref|YP_676721.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Cytophaga hutchinsonii ATCC 33406] >gi|123059075|sp|Q11YY5|ISPH_CYTH3 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|110279195|gb|ABG57381.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Cytophaga hutchinsonii ATCC 33406] (293 aa)
Score = 193, Expect = 4.7e-13, Identities = 75/291 (25%), Positives = 137/291 (47%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIE----QGYQIFYIGVNNHPETISTL--SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKY--------KNIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITSGCSTPTWLANYVIIFLE 291
           M +I     G+C GV   +A      ++      + +G +VHN   ++ L + G++           IID  E+K  ++  ++I  AHG   +T   A E  + + D +C  V K  + +K   +    +  QI   G   H E I     + DK+I+ I T  D++ I  + EKP+ + +QTT S   F ++ + ++++         +N E+ + IC    +R+  +     E D+++ V   KS+N K L  +  ++   S+ + N   I+  W      + I    STP WL   V  +++
  S:     1 MDVIIDKNSGYCFGV--EFAIQMAEDEMATGEPLFCLGDIVHNSMEVERLAKKGLK-----------IIDREELKKLSDCKVLI-RAHGEPPETYQLALENNIELVDASCPVVLKLQNRVKASFDAIDSKDGQIVIYGQEGHAEVIGIAGQTGDKAIV-ITTEKDLDKI--DFEKPVTLYSQTTKSTQGFYKMKDLIEARVAEAGKNVDENFEYNDSICRQVSNREPQLRKFSKEFDVVIFVSGKKSSNGKALYGVCKQENERSYFVENETEIEPSWIRATDNVGICGATSTPMWLMEKVQNYIQ 288
>gi|78778651|ref|YP_396763.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Prochlorococcus marinus str. MIT 9312] >gi|123554687|sp|Q31CR8|ISPH_PROM9 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|78712150|gb|ABB49327.1| hydroxymethylbutenyl pyrophosphate reductase [Prochlorococcus marinus str. MIT 9312] (398 aa)
Score = 193, Expect = 4.8e-13, Identities = 77/253 (30%), Positives = 127/253 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILI--------------------ETVNDIENIRTESEKP------IFVTNQTTISIYEFEEI----TETLKSKYK----NIEFK--NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDE 262
           GFC GV  A A   +  + YPN   ++   ++HN  +   L ++ ++    KN  +   + S       N  +VI  A G   + +    EKG  + DTTC +V+K    +++  +  +     G   H ET++T S     +++                    E +N      ++   P      + V NQTT+   E EEI     +T+  K+     N  F   N IC+A ++RQDA+ ++  E +D+L+V+G   S+N+  L EI I K I S  I   + I  E
  S:    64 GFCWGVERAVAMAYETRRHYPNENIWITNEIIHNPSVNDHLRKMNVKFISAKNGIKDFSLVS-------NGDVVILPAFGATVQEMKLLHEKGCHIIDTTCPWVSKVWHTVEKHKKHVFTSIIHGKFKHEETLATSSFAGKYLVVLDLEEANYISEYILGRGNRNEFMNKFAKACSDGFDPDKDLDRVGVANQTTMLKSETEEIGKVFEKTMLKKFGPENLNSHFLAFNTICDATEERQDAMFSLVDEDLDILVVIGGFNSSNTTHLQEIAITKNITSFHIDTPERISVE 346
>gi|119486460|ref|ZP_01620518.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Lyngbya sp. PCC 8106] >gi|119456362|gb|EAW37493.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Lyngbya sp. PCC 8106] (402 aa)
Score = 192, Expect = 5.6e-13, Identities = 80/270 (29%), Positives = 146/270 (54%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQ----TKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI-DKSIILI-------------------ETVNDIENIRTESEKP------IFVTNQTTISIYEFEEITE----TLKSKY------KNIEFKNDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTK-----------------NIKDEWFINKK-CLAITSGCSTP 279
           GFC GV  A A   +  + +P    ++   ++HN  + + L ++ ++       +K+ S   I D           +VI  A G   + +    +KG  + DTTC +V+K  + +++  ++ Y     G   H ET++T S  DK ++++                   E     ++  +E   P      + + NQTT+   E E+I +    T+  KY      ++ +  N IC+A ++RQDA++ +  E +DL++V+G   S+N+  L E+ I++ I S+ I + +                  I + W    K  + ITSG STP
  S:    64 GFCWGVERAVAMAYETRQHFPTERIWITNEIIHNPSVNQHLLDMKVEFIPVIDGEKDFSGIGIGD-----------VVILPAFGASVQEMQILNDKGCKIVDTTCPWVSKVWNTVEKHKKKSYTSIIHGKYKHEETVATSSFADKYLVVLNLAQAEYVCNYILNGGNRQEFFAKFKHAHSEGFDPDKDLECVGIANQTTMLKSETEQIGKLFERTVMQKYGPDQLTEHFQSFNTICDATQERQDAMLGLVEEKLDLMIVIGGFNSSNTTHLQEMSIERGISSYHIDSPERIISGDCIEHKPLEKDIEIAENWLPEGKIVVGITSGASTP 381
>gi|91255003|gb|ABB88836.2| IPP/DMAPP synthase [Stevia rebaudiana] (458 aa)
Score = 192, Expect = 5.7e-13, Identities = 85/270 (31%), Positives = 144/270 (53%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENI----------RTESEKPIF----------------------VTNQTTISIYEFEEITE----TLKSKY-------KNIEFKNDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNI-----------------KDEWFINKK-CLAITSGCSTP 279
           GFC GV  A     +  K +P+ + ++   ++HN  + K LEE+ ++    K+  +       ++ DK +  +VI  A G     +    +K + + DTTC +V+K    +++  +  Y     G  +H ET++T S     ++++ +++   +           + S K  F                      V NQTT+   E EEI +    T+ SKY         I F N IC+A ++RQDA+  +  E +DL+LVVG   S+N+  L EI  ++ I S+ I   + +                 K+ W       + ITSG STP
  S:   112 GFCWGVERAVQIAYEARKQFPDEKIWITNEIIHNPTVNKRLEEMEVKDIPVKDGEKQ-----FDVIDKGD--VVILPAFGAAVNEMLTLSDKQVQIVDTTCPWVSKVWTSVEKHKKGAYTSIIHGKYSHEETVATASFAGKYVIVKNMDEATYVCDYILGGKLNGSSSTKEAFLEKFKYAVSNGFDPDTDLVKTGVANQTTMLKGETEEIGKLVERTMMSKYGVENATEHFISF-NTICDATQERQDAMYKLVDEKMDLMLVVGGWNSSNTSHLQEIPEERGIPSYWIDTVERVGPGNRIAYKTMHGELVEKENWLPKGPLTIGITSGASTP 435
>gi|141005|sp|P21864|ISPH_PSEFL 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|151350|gb|AAA25886.1| ORF316 (180 aa)
Score = 191, Expect = 7.4e-13, Identities = 56/181 (30%), Positives = 86/181 (47%)
  Q:     1 MKIIKITPRGFCKGVVDAYATCKKIAK-----LYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTL-----SIDKSIILIETVNDIENIRTESEKPIFVTNQTTISI 181
           M+I    PRGFC GV  A     +  +     +Y  HE      +VHNK ++++L   G    ++ +  + ++I             VIFSAHG  Q    +A  +GL VFD TC  VTK H  +      G +   IG   HP    T+     S   +I L+E   D+ N++  + + +    QTT+S+
  S:     1 MQIKLANPRGFCAGVDRAIEIVNRALEVFGPPIYVRHE------VVHNKFVVEDLRARGAIFVEELDQVKDDVI-------------VIFSAHGVSQAVRTEAAGRGLKVFDATCPLVTKVHIEVARYSRDGRECILIGHAGHPXVEGTMGQYDASNGGAIYLVEDEKDVANLQVHNPERLAFVTQTTLSM 172
>gi|22298585|ref|NP_681832.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Thermosynechococcus elongatus BP-1] >gi|50401049|sp|Q8DK29|ISPH_SYNEL 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|22294765|dbj|BAC08594.1| tlr1041 [Thermosynechococcus elongatus BP-1] (402 aa)
Score = 191, Expect = 8.0e-13, Identities = 81/289 (28%), Positives = 150/289 (51%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNP-PIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENI----------------RTESEKPIF----------VTNQTTISIYEFEEITE----TLKSKYK----NIEFK--NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNI-----------------KDEWFINKK-CLAITSGCSTPTWLANYVI--IFLEKKLGTAN 298
           GFC GV  A A   +    +P    ++   ++HN  + + L ++ ++           +++ ++      P  +VI  A G   + +    E+G  + DTTC +V+K    +++  +  +     G  NH ETI+T S   + +++  + +   +                  ++  P F          + NQTT+   E E+I +    T+  KY     N  F   N IC+A ++RQDA++++  E +DL++V+G   S+N+  L EI I+  I S+ I +   I                  + W  ++   + ITSG STP  +   V+  IF  + + T +
  S:    64 GFCWGVERAVALAYETRTHFPTERIWITNEIIHNPSVNERLRQMAVEF--------IPVVNGVKDFSGVRPGDVVILPAFGASVQEMQLLNERGCTIVDTTCPWVSKVWHSVEKHKKVSFTSIIHGKYNHEETIATSSFAGTYLIVLNLEEARYVCDYILHGGDRAAFMAKFAKACSPGFDPDRDLVRVGIANQTTMLKGETEQIGKLFERTMIQKYGPDRLNEHFMSFNTICDATQERQDAMLSLVKEPLDLMVVIGGYNSSNTTHLQEIAIEHGIPSYHIDSADRIGPGNRIEHKPLHQNPTVAENWLPDRPITIGITSGASTPDKVVEEVLNKIFALRSVATVS 402
>gi|91070606|gb|ABE11505.1| LytB protein-like [uncultured Prochlorococcus marinus clone HOT0M-8G12] (398 aa)
Score = 190, Expect = 8.2e-13, Identities = 87/270 (32%), Positives = 140/270 (51%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILI---ETVNDI-ENIRTESEKPIF----------------------VTNQTTISIYEFEEI----TETLKSKYK----NIEFK--NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNI--KDEWFINKKC-----------------LAITSGCSTP 279
           GFC GV  A A   +  + YPN   ++   ++HN  +   L ++ ++    KN  +   + S       N  +VI  A G   + +    EKG  + DTTC +V+K    +++  +  +     G   H ET++T S     +++   E  N + E I  +  +  F                      V NQTT+   E EEI     +T+  K+     N  F   N IC+A ++RQDA+ ++  E +D+L+V+G   S+N+  L EI I K I S  I   + I  +D   ++K                   + ITSG STP
  S:    64 GFCWGVERAVAMAYETRRHYPNENIWITNEIIHNPSVNDHLRKMNVKFISAKNGIKDFSLVS-------NGDVVILPAFGATVQEMKLLHEKGCHIIDTTCPWVSKVWHTVEKHKKHVFTSIIHGKFKHEETLATSSFAGKYLVVLDLEEANYVSEYILGKGNRNKFMNKFAKACSDGFDPDKDLDRVGVANQTTMLKSETEEIGKVFEKTMLKKFGPENLNSHFLAFNTICDATEERQDAMFSLVDEDLDILVVIGGFNSSNTTHLQEIAITKNITSFHIDTPERISVEDNSILHKPLGSDLELKNNFLPSGKINVGITSGASTP 382
>gi|33860822|ref|NP_892383.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|50400958|sp|Q7V329|ISPH_PROMP 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|33633764|emb|CAE18723.1| LytB protein homolog [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (398 aa)
Score = 190, Expect = 1.0e-12, Identities = 93/278 (33%), Positives = 145/278 (52%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSI-DKSIIL--IETVNDI-ENIRTESEKPIF----------------------VTNQTTISIYEFEEI----TETLKSKYK----NIEFK--NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNI------------KDEWFINKKCL-------AITSGCSTPTWLANYVI 287
           GFC GV  A A   +  + YP+   ++   ++HN  +   L ++ ++    KN     I D   + D +   +VI  A G   + +    EKG  + DTTC +V+K    +++  +  +     G   H ET++T S  DK +++  +E  N + E I     K  F                      V NQTT+   E EEI     +T+  K+     N  F   N IC+A ++RQDA+ ++  E +D+L+V+G   S+N+  L EI I K I S  I   + I            K E  + K  +        ITSG STP  +   VI
  S:    64 GFCWGVERAVAMAYETRRHYPDENIWITNEIIHNPSVNDHLRKMNVKFISAKNG----IKDFSLVSDGD---VVILPAFGATVQEMKLLHEKGCHIIDTTCPWVSKVWHTVEKHKKHTFTSIIHGKFKHEETLATSSFADKYLVVLNLEEANYVSEYILGRGNKNHFLNKFAQAFSNGFDPDKDLDRVGVANQTTMLKSETEEIGKVFEKTMLHKFGPEKLNSHFLAFNTICDATEERQDAMFSLVDEDLDILVVIGGYNSSNTTHLQEIAINKNISSFHIDTPERISVKENSILHKPLKSEMVLKKNFIPDGEIKVGITSGASTPDKIVADVI 390
>gi|78187590|ref|YP_375633.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pelodictyon luteolum DSM 273] >gi|123757165|sp|Q3B241|ISPH_PELLD 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|78167492|gb|ABB24590.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Pelodictyon luteolum DSM 273] (320 aa)
Score = 189, Expect = 1.1e-12, Identities = 76/282 (26%), Positives = 128/282 (45%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPET--ISTLSIDKSIIL--IETVNDIENIRTESEKPIFVTNQTTISIYEFEEITETLKSKYKNIE-----------------------------FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKK-----CLAITSGCSTPTWLANYVIIFLE 291
           GFC GV       ++  KL      Y +G +VHN+  +K LE LG+ T DD+             ++  + P++I  AHG    T + AR   L V DTTC  V K     ++    GYQ+   G   HPE   I+  + + ++I+   +  +  E    +  +   + +QTT+ +  F ++ E L++ ++N                               +K+ IC     R   + +     D ++ V   KS+N + L  I       S+ I +T ++ + W           + I    STP WL   V   +E
  S:    11 GFCIGVQGTIHVAEE--KLRAEIGLYSLGDVVHNEVEVKRLESLGLVTIDDQ-----------AFRELRDAPVLI-RAHGEPPSTYETARANNLEVTDTTCPVVAKLQRTARQLHLLGYQVIIYGKPVHPEVIGINGHAANSAVIIKHADLSDPAETAPLDLSRKTALISQTTMDVPGFYQLKENLETLFRNAGNPQEGPWTEVRDIDITLGLTGMQPTAPHVYKDTICRQVSSRNSKLHDFALSNDCIIFVAGKKSSNGQVLYNICRDANPRSYFIEDTGDLDEGWLKEANGSPVGSVGICGATSTPMWLLEKVARHIE 316
>gi|186683473|ref|YP_001866669.1| hydroxymethylbutenyl pyrophosphate reductase [Nostoc punctiforme PCC 73102] >gi|186465925|gb|ACC81726.1| hydroxymethylbutenyl pyrophosphate reductase [Nostoc punctiforme PCC 73102] (402 aa)
Score = 189, Expect = 1.1e-12, Identities = 79/278 (28%), Positives = 146/278 (52%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKN-----NPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDI-------------ENIRTESEKP-------------IFVTNQTTISIYEFEEITE----TLKSKYKNIEFK------NDICNAAKDRQDAVINM-PSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIK-----------------DEWFINKK-CLAITSGCSTPTWLANYVI 287
           GFC GV  A A   +  + +P    ++   ++HN  + + ++E+ ++               IE K+K+        +VI  A G   + +    +KG  + DTTC +V+K  + +++  +  Y     G   H ET++T S     +++  + +              E   T+  K              + + NQTT+   E E+I +    T+  KY  IE        N IC+A ++RQDA++ +    ++L++V+G   S+N+ +L +I  +++I S+ I   + IK                 + W  + +  + ITSG STP  +   VI
  S:    64 GFCWGVERAVAMAYETRQHFPTEHIWITNEIIHNPSVNQRMQEMEVE------------FIPIEGKNKDFSVVGTGDVVILPAFGASVQEMQILHDKGCKIVDTTCPWVSKVWNTVEKHKKIDYTSIIHGKYKHEETVATSSFAGKYLIVLNLQEAQYVADYIINGGNREEFLTKFAKACSAGFDPDRDLERVGIANQTTMLKDETEQIGKLFERTMLQKYSPIELNQHFQSFNTICDATQERQDAMLELVEHNLNLMVVIGGFNSSNTTQLQQIAFERRIPSYHIDTVERIKSGDSIEHRQLNGQLITTENWLPDGEIVVGITSGASTPDKVVEDVI 389
>gi|85813153|gb|ABC84344.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase [Ginkgo biloba] (474 aa)
Score = 187, Expect = 2.3e-12, Identities = 81/270 (30%), Positives = 144/270 (53%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQ-TKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVND--------------------------IENIRTESEKP------IFVTNQTTISIYEFEEI----TETLKSKYKNIEFKND-------ICNAAKDRQDAVINM-PSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNI-----------------KDEWFINKK-CLAITSGCSTP 279
           GFC GV  A     +  K +P    ++   ++HN  + K +EE+ +Q    D+   R +++D  ++        VI  A G     +    EK + + DTTC +V+K  + +++  +  Y     G   H ET++T S   + I+++T+++                           +N  ++   P      + + NQTT+   E E+I     +T+  K+  +E  ND       IC+A ++RQDA+  +   ++DL+LV+G   S+N+  L EI     I S+ I + + I                 K+ W       + +TSG STP
  S:   128 GFCWGVERAVQIAYEARKQFPEERIWMTNEIIHNPTVNKRIEEMKVQYIPVDEEGKRFDVVDKGDV--------VILPAFGAAVHEMQYLSEKNVQIVDTTCPWVSKVWNTVEKHKQGDYTSIIHGKYAHEETVATASFAGTYIIVKTIDEAAYVCDYILDGKLNGSSGTKAEFLQKFKNAVSKGFDPHVALVKVGIANQTTMLKGETEDIGKLVEKTMMHKF-GVENINDHFISFNTICDATQERQDAMHQLVKDKLDLILVIGGWNSSNTSHLQEIAELNGIPSYWIDSEERIGPGNMIAYKLNHGELVEKENWLPEGPITIGVTSGASTP 451
>gi|78188557|ref|YP_378895.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chlorobium chlorochromatii CaD3] >gi|123580225|sp|Q3AT23|ISPH_CHLCH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|78170756|gb|ABB27852.1| penicillin tolerance protein LytB [Chlorobium chlorochromatii CaD3] (328 aa)
Score = 186, Expect = 2.8e-12, Identities = 86/286 (30%), Positives = 128/286 (44%)
  Q:     1 MKI-IKITPRGFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETIS-TLSIDKSIILIETVNDIENIRTESEKPIFVT---NQTTISIYEFEEITETLKSKYKNIE-----------------------------FKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINKKCLAITS-----GCSTPTW----LANYV 286
           MKI +  T  GFC GV       +   KL    + Y  G +VHN+  +K LE LG+ T DD              K  +N  ++I  AHG    T   A E  L + DTTC  V++     +   + GYQI   G   HPE I      D   ++I+  +  +    E  +P   T   +QTT+ I  F E+   L++    +                              FK+ IC     R   + +     D+++ V   KS+N + L  I       +  I + + I  EWF   +  A+ S       STP W    +ANY+
  S:     1 MKIHLDRTSSGFCIGVQGTINVAED--KLQELGQLYSYGDVVHNEVEVKRLEALGLVTVDDAG-----------FKQLSNTSVLI-RAHGEPPATYTIAAENNLAITDTTCPVVSRLQRTTRLLFQLGYQIIIYGKRVHPEVIGLNGQCDNCALIIKHADLSDPKELEGFEPSAKTALISQTTMDIPGFYELKANLEAYVARVNGSAVEPWMAIRDIDITADMSKVRTMPRYVFKDTICRQVSSRNQKLHDFSLANDVVVFVAGKKSSNGQVLFNICKAANPRTFFIEDIEEINPEWFAAHEGKAVESVGICGATSTPMWHLEKVANYI 315
>gi|116059146|emb|CAL54853.1| putative LytB protein (ISS) [Ostreococcus tauri] (456 aa)
Score = 185, Expect = 4.0e-12, Identities = 73/278 (26%), Positives = 140/278 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILIETVNDIENIR--------------------TESEKP------IFVTNQTTISIYEFEEI----TETLKSKY------KNIEFKNDICNAAKDRQDAVINM-PSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNI------------------KDEWF-INKKCLAITSGCSTPTWLANYVI 287
           GFC GV  A     +  K +P  + ++   ++HN  + + L ++G+   ++  + +       +     +  +VI  A G     +    ++G  + DTTC +V+K  + +     + +     G  +H ET++T S   + ++++ + + E +R                    +E   P      + + NQTT+   E E I     +T+  K+      ++    + IC+A ++RQDA+  +   + D++LVVG   S+N+  L EI   K I S+ +   + +                   D W   +   + ITSG STP  +   VI
  S:   114 GFCWGVERAVQMAYEARKQFPESKLWITNEIIHNPTVNERLSDMGVNFIEESENGK-------DFSGVQSGEVVILPAFGASVHEMKFLADRGANIVDTTCPWVSKVWNAVDTHKRKEFTSIIHGKYSHEETVATASFATTYLIVKDMTEAEYVRDYIMNGGDKAEFMEKFKNAMSEGFDPDEDLNGVGIANQTTMLKGETEAIGKLFQQTMMEKFGVENADQHFVVMDTICDATQERQDAMYKLVDDKPDIMLVVGGFNSSNTSHLQEIAEDKSIPSYWVDTAERLDPSKNSITHKLAHGELVTTDAWLPASDVVIGITSGASTPDKVVEDVI 440
>gi|16331361|ref|NP_442089.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Synechocystis sp. PCC 6803] >gi|1001532|dbj|BAA10159.1| slr0348 [Synechocystis sp. PCC 6803] (406 aa)
Score = 185, Expect = 4.0e-12, Identities = 75/270 (27%), Positives = 135/270 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILI--------------------ETVNDIENIRTESEKP------IFVTNQTTISIYEFEEI----TETLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIK-----------------KQIESHLIWNTKNIKDEWF-INKKCLAITSGCSTP 279
           GFC GV  A A   +  + +P    ++   ++HN  + + L E+ +   D  N  +       +        +VI  A G   + +    ++   + DTTC +V+K  + +++  ++ +     G  NH ETI+T S   + +++                    E ++   N  +    P      + V NQTT+   E E I     +TL  KY  IE        N IC+A ++RQDA+ ++  E + L++V+G   S+N+  L EI ++                  ++E   +     + + W    K  + +TSG STP
  S:    64 GFCWGVERAVAMAYETRQHFPGDRLWITNEIIHNPSVNQRLREMEVNFIDVVNGEK-------DFSGVAKGDVVILPAFGASVEEMQLLNDRECTIVDTTCPWVSKVWNSVEKHKKKEHTSIIHGKYNHEETIATSSFAGTYLIVLNMAEAQKVCDYILHGGDRQEFLDYFANAHSAGFDPDQDLVRLGVANQTTMLKSETEMIGKLFEKTLLQKYGPIELNNHFMSFNTICDATQERQDAMFDLVEEDLSLMVVIGGFNSSNTTHLQEIAVEHGIPSVHIDSGDRIGPGNRVEHKPLGKDLEVLEPWLPAGKITVGVTSGASTP 381
>gi|8928192|sp|Q55643|ISPH_SYNY3 4-hydroxy-3-methylbut-2-enyl diphosphate reductase >gi|1256595|gb|AAB72119.1| LytB [Synechocystis sp. PCC 6803] (379 aa)
Score = 184, Expect = 4.8e-12, Identities = 75/270 (27%), Positives = 135/270 (50%)
  Q:    10 GFCKGVVDAYATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPETISTLSIDKSIILI--------------------ETVNDIENIRTESEKP------IFVTNQTTISIYEFEEI----TETLKSKYKNIEFK------NDICNAAKDRQDAVINMPSE-VDLLLVVGDIKSNNSKKLVEIGIK-----------------KQIESHLIWNTKNIKDEWF-INKKCLAITSGCSTP 279
           GFC GV  A A   +  + +P    ++   ++HN  + + L E+ +   D  N  +       +        +VI  A G   + +    ++   + DTTC +V+K  + +++  ++ +     G  NH ETI+T S   + +++                    E ++   N  +    P      + V NQTT+   E E I     +TL  KY  IE        N IC+A ++RQDA+ ++  E + L++V+G   S+N+  L EI ++                  ++E   +     + + W    K  + +TSG STP
  S:    37 GFCWGVERAVAMAYETRQHFPGDRLWITNEIIHNPSVNQRLREMEVNFIDVVNGEK-------DFSGVAKGDVVILPAFGASVEEMQLLNDRECTIVDTTCPWVSKVWNSVEKHKKKEHTSIIHGKYNHEETIATSSFAGTYLIVLNMAEAQKVCDYILHGGDRQEFLDYFANAHSAGFDPDQDLVRLGVANQTTMLKSETEMIGKLFEKTLLQKYGPIELNNHFMSFNTICDATQERQDAMFDLVEEDLSLMVVIGGFNSSNTTHLQEIAVEHGIPSVHIDSGDRIGPGNRVEHKPLGKDLEVLEPWLPAGKITVGVTSGASTP 354
>gi|189499431|ref|YP_001958901.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chlorobium phaeobacteroides BS1] >gi|189494872|gb|ACE03420.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chlorobium phaeobacteroides BS1] (325 aa)
Score = 184, Expect = 5.1e-12, Identities = 78/286 (27%), Positives = 139/286 (48%)
  Q:     7 TPRGFCKGVVDA-YATCKKIAKLYPNHEKYLIGWLVHNKEIIKELEELGIQTKDDKNHSRSEIIDSIEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCIYVTKTHDLIKEKIEQGYQIFYIGVNNHPET--ISTLSIDKSIILIETVNDIENIRTESEKPIFVT------NQTTISIYEFEEITETLKSKYK---------------------------------NIEFKNDICNAAKDRQDAVINMPSEVDLLLVVGDIKSNNSKKLVEIGIKKQIESHLIWNTKNIKDEWFINK----KCLAITSGCSTPTWLANYVIIFLEK 292
           T  GFC GV    +   +K+ +L  + + Y +G +VHN+  +K LE+LG+ T D++ +++        +K  +    V+  AHG    T  +A    L + D+TC  V+K     +   E G+QI   G   HPE   I+    D+++I+      +     E   PI  T      +QTT+ +  F  + + L+S +                                  ++ +K+ IC     R   + +  +  D+++ V   KS+N + L  I  +    S+ I +   ++DEWF +       + +    STP WL   V   +E+
  S:     8 TSSGFCIGVQGTIHLAEEKLEEL--DSKLYCLGDIVHNEVEVKRLEDLGLITIDNEEYNK--------LKHAH----VLVRAHGEPPSTYKRADSNELSITDSTCPVVSKLQRTARLLFELGFQIIIYGKKTHPEVIGINGQCADQAVIIKHADLSV----PEETDPIDFTRQTALISQTTMDVPGFYILKKNLESLFADRTDAAEQKSTHSWKTIRDIDITAEMTGICPLPDLVYKDTICRQVSSRNAKLHDFAAANDIIIFVAGKKSSNGQVLFNICRESNPRSYFIADQTGLQDEWFYDNGRPVGSVGVCGATSTPMWLLENVAHSIEQ 321