>gi|26553588|ref|NP_757522.1| PTS system glucose-specific enzyme IIABC component [Mycoplasma penetrans HF-2] >gi|26453594|dbj|BAC43926.1| PTS system glucose-specific enzyme IIABC component [Mycoplasma penetrans HF-2] (890 aa)
Score = 4366, Expect = 0.0e+00, Identities = 890/890 (100%), Positives = 890/890 (100%)
  Q:     1 MNYSMSGNLQTSLKTYFSKLKFNSLFKKQGAGKEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFEVLPKKN 890
           MNYSMSGNLQTSLKTYFSKLKFNSLFKKQGAGKEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFEVLPKKN
  S:     1 MNYSMSGNLQTSLKTYFSKLKFNSLFKKQGAGKEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFEVLPKKN 890
>gi|31544338|ref|NP_852916.1| hypothetical protein MGA_0855 [Mycoplasma gallisepticum R] >gi|31541182|gb|AAP56484.1| PtsG [Mycoplasma gallisepticum R] (892 aa)
Score = 1461, Expect = 1.7e-159, Identities = 376/858 (43%), Positives = 530/858 (61%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNA--GGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALG---QAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDG-KAYAVLATS--------------------------TATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTY---SAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGAN---------------GFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYG--SNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNK---QNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPE--KEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKP--FAPNVKTGDTVKVGQEIGTVKLADLKHAK----STITPIIVLNESLEGREIKFLKKSGE-IKKGMPLFEVLPKKN 890
           K   G+ KE + KLS G+M+PIA+LPIAG+ LG+ +A+  N     + G+     F +    AVFG LP LFAIAIA+AFT  +G AAL+ F+G+LIF + Q AL     ++      + +L+Y            ++P++     +G+  L +SVFGG +VG + A L+NKF  I+L  ++GFFNG RFVPI+T L + PV ++ LMIWP +GI L  LGQ+LG   +    NSFIFG++ERALVPFGLHHAFY+PLW+T AGGSI    N I+ Q G  A A L  +                          TA +   W +++ +LNPN+QI  +S +GDQ +W  IN+  + KSV+L   S  +T+   S  + T ++ S+       IQS+     + SG Q L  I  +                F GVN GQY QGK+ FMI GLPAA AAM+MAAPK+ RK A SI +SA FTS LTGITEPIE+TFLFLAP+LFWG HA  CA++F L + +G             +IG +FSGG+ID  IYG I    G  +N+W   + GL Y P+Y+F FYFLI K NI+TPGRG  TRL+TK DY+ K   +N    N  S +    ++ +  ++ A+GG DNI  V+AC TKLR+ +K +  V+  ++  LG+ GT   S   V+AV+G +ADIIK  ++ ++     S    S  EK++ +     +  E+ P   K   + D +L  + V V SP  G +  LA +PD +F+  +MG G++++P  G  YSP+DGKL L ++TGHAY F+   G +ILIH+GID+++L   +        F    K+GD V   +    V  A+L+  K    ST +PI+ L E+L   ++K + K G+ +  G  LF+ L KKN
  S:    20 KRFSGHFKEVVGKLSAGIMIPIALLPIAGLLLGIFAAVQNNVSQATHPGVFAMAAFFKNGAEAVFGNLPTLFAIAIAVAFTNQSGVAALSAFVGWLIFNATQTALIFPNANSQT----FTILYYN-----------SVPATALAMNVGLRSLSTSVFGGVIVGAITALLFNKFHTIQLPKVVGFFNGNRFVPIITLLTMLPVALVALMIWPAIGIGLNALGQSLGVLSRNGNFNSFIFGYVERALVPFGLHHAFYAPLWFTSAGGSI---ANIIVNQAGSNAIAPLIVTDENGQRVIRSIVGVAANKDAVKPAGFTAQNWMYWGQVVTALNPNTQINTDSLSGDQRLWFTINSLFVNKSVYLSGSSDPYTFTFKSFADSTLNHPSL-------IQSITRNGTVISGAQLLTMIKESSTGSVVLQANDTLNFAFPGVNPGQYEQGKHAFMIFGLPAAGAAMIMAAPKDQRKYASSIIISAAFTSFLTGITEPIEFTFLFLAPYLFWGFHAVFCAISFWLTSLLG------------GNIGQTFSGGIIDLTIYGFIPDALGAKTNSWLPLVIGLFYIPLYYFTFYFLITKRNIETPGRGAGTRLYTKADYQAKVASKNAASTNDGSANFKPIEITSYKLIKAFGGRDNISAVNACATKLRVSVKTKEKVNFGEIGALGSLGTYAVSDTLVHAVYGGDADIIKSYMQKMINKDYDS----SAIEKVIGD----PATKEIDPSMPKATPEVDHKLY-DVVDVYSPVKGTVTDLADLPDPSFAGKIMGDGVSIEPEDGMFYSPVDGKLELAYNTGHAYFFDV-NGAKILIHIGIDTVSLNSNNSDSNNLVGFKMFAKSGDNVSFKKS--PVVQANLEMIKKKELSTNSPILALKETLANYDLKVVVKPGDKVNVGDLLFK-LTKKN 891
>gi|15828488|ref|NP_325848.1| PTS system, glucose-specific IIABC component (EIIABC-glc) (glucose-permease IIABC component) (phosphotransferase enzyme II, ABC component)(EII-glc/EIII-glc) [Mycoplasma pulmonis UAB CTIP] >gi|14089430|emb|CAC13190.1| PTS SYSTEM, GLUCOSE-SPECIFIC IIABC COMPONENT (EIIABC-GLC) (GLUCOSE-PERMEASE IIABC COMPONENT) (PHOSPHOTRANSFERASE ENZYME II, ABC COMPONENT)(EII-GLC/EIII-GLC) [Mycoplasma pulmonis] (791 aa)
Score = 1388, Expect = 5.5e-151, Identities = 347/871 (39%), Positives = 492/871 (56%)
  Q:    15 TYFSKLKFNSLFKKQGAGKEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSL---YGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTT----GKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFEV 885
           T   KL F     ++       G  K+ ++K+S   MLPIA++ IAGIFLGVG+AI T +G NEGL++FG F+Q  G+ +F +LPLLFA A  IAFT +AG A  A  I YL+F +LQ AL + + D+   +IGY +LF        SAG    P SL    G+ +G   LQ+SVFGG  VG + ++LYNKF  I+ HP   FF G RFVP+V  LA+ P+++ FL+ WP VG  L+  G ALG+   GI SFIFGFIER+L+PFGLHH FY+PLWY+ AGG                        AT+L+ W++  N    ++  T   AA  Q +   I  N      W+ + S+GW   A+N    N ++ S        V T   L    Q  G         + +G++LQGKYVFM +GLPAAA AMVMAAPKENRK+A +    A FT  LTGITEP+E+TFL L+P+LFWG HA +CALAF LMN +G             HIGM+FSGG ID++IYG I IQ G++A+W ++    YAPIYFF+FYF IK  N+ TPGRG+N +LFTK+D++NK         +++L + QV A  VV   GG+DNI   + C ++LR  + D S +D  ++   GA    +     +  + G+ A+        L + + +S     E +   ++S+D +S S+   E      + +   + + V S F G   S+ ++ D  FS+ M+G G+ V+P       K+Y+P+ GKL  +F+T HAY   T +G +IL+H+G+D++NLK +       F  N+  G  VK+G  +  V    L          IV+  ++E  +I  LK+ G +     LF++
  S:     2 TILKKLNFRKEKSEKSKINNNSGKLKKLLSKISGAFMLPIAIMSIAGIFLGVGAAIATGSGANEGLKLFGLFIQNMGDPIFSSLPLLFAAAFVIAFTEEAGAAVFAAIIAYLVFSALQAALIEPLRDSAQKIIGYKVLFE-------SAGRD--PESLIRLVGSSVGFTTLQTSVFGGISVGLITSYLYNKFHKIQFHPAFSFFAGKRFVPLVAILAMVPLSLTFLLFWPWVGKGLSVFGTALGKVPYGIESFIFGFIERSLIPFGLHHVFYAPLWYSNAGGD----------------------AATALSQWQQAGNQFVESAGFT---AANIQELIDSITKN---ADKWVGD-STGW--QAVNSL--NFNVVSFRKQGSSEVQTLRVLDFFAQEFG---------IKLGRFLQGKYVFMSMGLPAAAFAMVMAAPKENRKVAFASLAPAAFTCFLTGITEPLEFTFLLLSPFLFWGFHAFMCALAFLLMNVLG------------AHIGMTFSGGFIDYVIYGLIPIQKGTHAYWVYVVAPFYAPIYFFVFYFWIKFKNLDTPGRGQNIKLFTKKDFRNKNK-------NKNLVDPQVRA--VVLGLGGWDNITKYENCASRLRYDVVDFSKIDENRIKSAGATAIRRVGSNHIQIIVGSIAE-------QLNQRVKASIGQSLEKDSKQSDSNDKNSTSKANLE------NPKTQNKNLSVYSVFEGNSHSIVELNDGVFSEKMLGDGVFVEPNEFKGLQKVYAPVSGKLLTLFETKHAYGITTNEGIEILVHIGVDTVNLKGQG------FKTNLVQGQDVKIGDVLAEVDYDFLSKQNLPSMSTIVVITNMEQSKITNLKQ-GPVALNQKLFDL 788
>gi|13507946|ref|NP_109895.1| PTS system, glucose-specific IIABC component [Mycoplasma pneumoniae M129] >gi|2499997|sp|P75569|PTG3C_MYCPN PTS system glucose-specific EIICBA component (EIICBA-Glc) (EII-Glc/EIII-Glc) [Includes: Glucose permease IIC component (PTS system glucose-specific EIIC component); Glucose-specific phosphotransferase enzyme IIB component (PTS system glucose-specific EIIB component); Glucose-specific phosphotransferase enzyme IIA component (PTS system glucose-specific EIIA component)] >gi|1674328|gb|AAB96272.1| PTS system, glucose-specific IIABC component [Mycoplasma pneumoniae M129] (940 aa)
Score = 1381, Expect = 2.9e-150, Identities = 350/855 (40%), Positives = 520/855 (60%)
  Q:    36 KGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDAL-------SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALG----QAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIY-----------------------------------QDGK------------AYAVLATSTATSLTSWRELINSL----NPNSQITVNSAAGDQTMWAFINAN-LLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTW---SNLTSGQQALGTIG-------------ANGFK----GVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQ--IQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDY---KNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDG--KLSLVFDTGHAYSFETEKGTQILIHVGIDS--INLKDKSGKELKPFAPNVKTGDTVKVGQE-IGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFEVLPKKN 890
           +G+ ++++ KLS GLM+PIA+LPIAGIFLGVG AI  NAG   GLR FG F++  G+ VF  LP+LFAIAIAI F+ DAG A  + F+ +        +L        + +TDT+  + G+ +L+           N ++P       +G+  L +SVFGG +VG L + LY KF  I+L  +IGFF+G RFVPI+ F+   PV ++ LMIWP V I L  +G  LG    +  G NS IFG+IER+L+PFG+HHAFY+PLWYT AGGS+    N  ++                                   Q+G             A +   +  +T+  +W++L++ L    N +         G   +W  +N + +LGK + L   S G  Y+    T+ N +  + S GA Q+VL     S + +   AL                  N F+     +N  QY QGK+ FM+ G+PAA  AM++AAPK+ RK A SI  SA FTS LTGITEP E+TFLFLAPWLF+GVHA L A++F LMN +G             ++G +FSG  ID+I+YGA+    ++ +N++   I GL  A IYF  FYFLIK FN+ TPGRG   +L TK++Y   K       ++G +E+    Q+ A  ++ AYGG +NI  + ACITKLR+ +K+  +V    + +LGA G ++ +P    AVFG  A + K  ++ +++   +   L    +K++N         E  P KEV+     + ++++V+ SP  G + SL +VPDETF + ++G G+A+ P+ G   +P +   K  L F  GHAY F+ + G ++++H+GID+  IN K + G+ L+ F    K G+  K   E +  V L  L    + ITP +V+ ESLE  ++  +++ GEIK G P+F+++ KK+
  S:    29 RGSFRQWVGKLSNGLMIPIAVLPIAGIFLGVGDAIAGNAGDLTGLRYFGLFIKNGGDVVFANLPILFAIAIAITFSQDAGVAGFSAFVFWAAMNGFMSSLILPFDKAGKIITDTSTPIAGFKVLY-----------NKSVPVHAIATTLGLRTLSTSVFGGIIVGALTSVLYKKFYAIRLPDVIGFFSGTRFVPIICFVVAIPVALILLMIWPAVSIGLNAIGTGLGFLGGKGYGANSLIFGYIERSLIPFGVHHAFYAPLWYTSAGGSLQEIVNQQVWIRPDFHLSDNYVARVIGWVDPNNSSMYIIPGALNGQNGSSTGNTMSKDLNGALSAYMSKESTAFLTWKDLVDGLTFKGNFDKMAENGLLDGSNKIWLGLNGSGILGKKLLL---SDGNVYTITFKTFANTTPIAWSKGA-QAVLPLNASSTIVNNPTALAAATQSNNNTNNIKLYPVNSFRVAVESLNPAQYSQGKFPFMLFGIPAAGVAMILAAPKDRRKEAASIVGSAAFTSFLTGITEPFEFTFLFLAPWLFYGVHAVLAAVSFWLMNILG------------ANVGQTFSGSFIDFILYGALPDGRRWLANSYLVPIIGLFLAAIYFPTFYFLIKHFNLATPGRG--GKLITKKEYLASKAAAKAEGVSGVAENFTQTQIEAGILLQAYGGKENIVELGACITKLRVTVKNPELVKEEPIKELGAAGVMRTTPTFFVAVFGTRAAVYKSAMQDIIQGKVNWEAL----QKVINTDQLAVEPKETTPPKEVMP----VVQDEIVILSPVNGTLKSLNQVPDETFKQKLVGEGVAIVPSDGHFKAPGEAGVKTELAFPGGHAYIFDID-GIKVMLHIGIDTVQINAKKQPGEPLEVFDIKTKQGEYTKEKSESVVEVDLKKLSKKYNPITPFVVMKESLENFKLVPIRQRGEIKVGQPIFKLVYKKS 938
>gi|12044921|ref|NP_072731.1| PTS system, glucose-specific IIABC component [Mycoplasma genitalium G37] >gi|1346893|sp|P47315|PTG3C_MYCGE PTS system glucose-specific EIICBA component (EIICBA-Glc) (EII-Glc/EIII-Glc) [Includes: Glucose permease IIC component (PTS system glucose-specific EIIC component); Glucose-specific phosphotransferase enzyme IIB component (PTS system glucose-specific EIIB component); Glucose-specific phosphotransferase enzyme IIA component (PTS system glucose-specific EIIA component)] >gi|1045745|gb|AAC71287.1| PTS system, glucose-specific IIABC component [Mycoplasma genitalium G37] >gi|166078760|gb|ABY79378.1| PTS system, glucose-specific IIABC component [synthetic Mycoplasma genitalium JCVI-1.0] (908 aa)
Score = 1371, Expect = 4.4e-149, Identities = 359/865 (41%), Positives = 525/865 (60%)
  Q:    24 SLFKKQGAGKEK-KGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGI----NSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSID--LTQNAIIYQDGKAY-------------------AVLATSTA-------------------------TSLTSWRELINSLNPN---SQITVNSAA-GDQTMWAFIN-ANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVL----TWSNLTSGQQALGTIGANGFK---------GVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYG--SNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSES-LNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPID--GKLSLVFDTGHAYSFETEKGTQILIHVGIDS--INLKDKSGKELKPFAPNVKTGDTVKVGQE-IGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFEVLPK 888
           SL K +   K++ +G+ ++++ KLS GLM+PIA+LP+AGIFLG+G AI +N+ G  G++ FG F++  GN VF  LP+LFA+AIAI F+ DAG A  + F+ +    +   +L   V D      GYN+L+++           A+P S   + +G+N L +SVFGG +VG L A+LYNKF  I+L  +IGFF+G RFVPI+      PV +L LM+WP V I L  +G  LG   G     NS IFG+IERAL+PFG+HHAFY+PLWYT AGGS+     Q   I   G  Y                   A LA  T+                         T+  SW+EL++ L       ++  N    G   +W  +N + +LGK V L   S G  Y+    T+ N +    S+GA  ++L    T S +T+G    GT  +  +           +N  QY QGK+ FM++G+PAA  AM++AAPK  RK A SI  SA FTS LTGITEP E+TFLFLAPWLF+G+HA L A++F LMN             L+ ++G +FSG  ID+I+YGA+    G  +N++   I G+  A IYF  FYFL  +FN+ TPGRG   +L TK++Y   +   + + ++ +  N  Q+ A  ++ AYGG +NI  + ACITKLR+ +K+  +V+   +  LGA G ++ +P    AVFG  A +     K+ M++I       +E +K+++ +  T    E+KP   V+K   E     +V+ SP  G +  L +VPD+TF   ++G GIA+ P+ G   +P D   K  L F TGHA+ F+ + G ++++H+GID+  IN   K G++L+ F    K G+  K+  E +  V L  LK     ITP IV+ ESL+  ++  +++ GEIK G PLF+++ K
  S:     4 SLVKIRNKFKQRNRGSFRQWVGKLSNGLMIPIAVLPLAGIFLGIGDAISSNSSGIVGVKFFGEFIKQGGNVVFANLPILFAVAIAITFSQDAGVAGFSAFVFWATMNAFMSSLIIPV-DANNTASGYNILYWK-----------AVPQSAIASTLGLNSLSTSVFGGIIVGALTAYLYNKFYAIRLPDVIGFFSGTRFVPIICMTIAIPVALLLLMVWPGVSILLNLIGTGLGILGGRGYGANSLIFGYIERALIPFGVHHAFYAPLWYTSAGGSLQEIANQQVWIRAPGSDYVTRVIGWEDFNTPGKWVIPAALANGTSGMMNGATTTGQDSTSALSKYMSKESTNFLSWKELVDGLTRKGNFDELAKNGLLDGSNKIWIGLNQSGILGKKVLL---SDGKDYTITFKTFANTTPTFWSHGA-HALLPISGTPSAITNGVTVNGTANSKTYNVSQFTVAVPSLNPAQYSQGKFPFMLIGIPAAGLAMILAAPKGRRKEASSIIGSAAFTSFLTGITEPFEFTFLFLAPWLFYGIHAVLAAVSFWLMNL------------LSANVGQTFSGSFIDFILYGALPDGRGWLANSYLVPIIGIFLALIYFPTFYFLTIRFNLATPGRG--GKLITKKEYLAAKAAQKTDQTTNTNFNQTQIEAGMLLRAYGGSENIAELGACITKLRVTVKNPELVNETIIKDLGAAGVMRTTPTFFVAVFGTRAAV----YKSAMQDIIQGKVNWTELQKVLDKNDSTVEKPEIKP-TPVLKVQDE-----IVILSPVNGTLKPLTQVPDDTFKNRLVGDGIAILPSDGHFKAPGDVGVKTELAFPTGHAFIFDVD-GVKVMLHIGIDTVKINADKKPGEQLEVFDVKTKQGEYTKLKSESVVEVDLKKLKRKYDPITPFIVMQESLDNFKLVPIRQRGEIKVGQPLFKLIYK 904
>gi|71894170|ref|YP_278278.1| PTS system, glucose-specific IIABC component [Mycoplasma synoviae 53] >gi|71850958|gb|AAZ43567.1| PTS system, glucose-specific IIABC component [Mycoplasma synoviae 53] (860 aa)
Score = 1238, Expect = 1.2e-133, Identities = 333/841 (39%), Positives = 468/841 (55%)
  Q:    21 KFNSLF---KKQGAGKEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGA---VIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQ-----DGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFK---------------GVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVK---PTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNES 861
           K  S F   K++ +     GN ++ ++KLS   MLPI+++ IAG+FLGVG+ +   A G   ++  G  L++ G+ VFGALPLLFA A  IAFT +AG A  A  IGYL+F ++Q      VT T      + GY +LF QG   G SA +      L G+ +GI  LQ+SVFGG VVG +V +LYNKF  I+L  +I FF G RFV +VT  A+  +  +FL+ WP VGIAL FLG+AL +  VG+NS IFG+IER+L+PFGLHH FY+P+WYT AGG ++    A +       D         + A  ++        L  +     N   GD T             + LK L  G T +  + T   A    SS   I + L+W   T  Q    T+    +                 + +GQYL GK+  M+L LPAAAAAM+ AAPKENRK+A    + A FTSL+TG+TEPIE+TFLFL+P LFWG H+ + A +F   N + +            HI M+FSGG++D++IYG I  Q G+  W+  + G AY P+YFF+FYF IK  N++TPGRG NT+LFT++DY+ K++         S       A  VV AYGG +NI   + C ++LR  +KD   V+   L   GA             +FG  A+ +   IK+  + I++    +        + +       VK E  V KT  E   + V + +P  G++  L  + D  FS   MG G  V+      G +YSP+DG ++LVF T HAY  ET++G ++L+H+GID++NL   +G+  + F   VK G  VK G ++  V L  LK H   +    +VL ES
  S:     5 KLGSFFRSKKEKNSDNSGSGNARKILSKLSGAFMLPISVMAIAGLFLGVGATVAEKAAGVAAVQKIGELLKILGDPVFGALPLLFAAAFVIAFTDEAGVAVFAAIIGYLVFSAVQGVFITPVTSTVDGKEVIDGYVVLFEQG---GRSAKSL---KQLVGSTLGIRSLQTSVFGGIVVGLVVQYLYNKFHTIQLPRVISFFGGKRFVSLVTIPAMAVLAFVFLLFWPWVGIALNFLGEALNKTPVGVNSLIFGYIERSLIPFGLHHVFYAPVWYTPAGGDLNAALQAFVSTNSLPLDLSLEGAEGAAAAAGVSEGYANFVKLFQDVAKEPNGFQGDST-------------ISLKLLGYGNTVALFSPTELVALKNPSS--TIPTTLSWVGKTISQPV--TVAGKTYYLYSNVPLFAFVQYALNIKIGQYLDGKFGVMMLALPAAAAAMIFAAPKENRKVAAGTVVPAAFTSLITGVTEPIEFTFLFLSPLLFWGFHSIMAAFSFMFANLLNV------------HIPMAFSGGILDFVIYGVIPFQKGTQFWFPLLTGAAYMPVYFFVFYFWIKYKNLETPGRGGNTKLFTRKDYEAKKDAKHSAEGMTSAKTVDPQAYAVVQAYGGTENITAYNNCASRLRYDVKDVRKVNPEALKAAGAVAVKFEGSNHAQGIFGPVAEQLNSKIKSQRDLIAAKEAEEKASSVRKLDQAPVVEKEVVKKETPVRKTTVEQLTKPVSLYTPARGDLKPLEYLNDGVFSNKTMGDGFVVRFVSEKVGNVYSPVDGVVTLVFPTKHAYGIETKEGVKLLVHIGIDTVNL---NGQGFESF---VKLGQKVKAGDQLAKVDLPFLKRHKVKSDVITLVLPES 835
>gi|26553626|ref|NP_757560.1| PTS system glucose-specific IIABC component [Mycoplasma penetrans HF-2] >gi|26453632|dbj|BAC43964.1| PTS system glucose-specific IIABC component [Mycoplasma penetrans HF-2] (781 aa)
Score = 1083, Expect = 1.2e-115, Identities = 301/880 (34%), Positives = 457/880 (51%)
  Q:     9 LQTSLKTYFSKLKFNSLFKKQGAGKEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNV--GQYLQGKYVFM--ILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELA-PHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENT-RLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLME-NISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVV---VNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPID-GKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGE-IKKGMPLFEVLPK 888
           LQ S  T+F+   F     K+G  K  KG  K+F ++LS+GLMLPIA+LPIAG+ LG+G AI  N      L++  N  +     VF +LP+LF +AI I F+ D G AA +  + YL+F S+Q    Q      G ++  +++++  N+         +  S+   + G   LQ+S+FGG +VGFL +F+YNK   IKL   + FF+G+R VPIV    +  + +LFL+ WP VG  ++ +GQ +  A  G    ++G + R+L+PFGLHH      + T  GG        ++Y+     A++    +T  T + + IN+  P + I      GDQ +W F                       IN    N+    +++G    +  W                  K +NV  G+Y Q    +M   +G+     A+++ + KENRK   S+  SA   + LTGITEP+EYTFLF A  L++ ++  L  +++ LM             EL+  H+G+ F+ G ID IIYGAI +  GSN +W+F   +    I  F FYFLIKKFN  TPGR EN   L TK  YK  +N   +  SS++ N        ++ A GG DNI+NV AC T+LR+ +    +V       +G++G      +++  +FG EA I+   I  ++E N+S   +LK+E                     ++ K ++++  +K++   V +P  G+I  L  V D+ F   +MG G+A+ PT+ K+YS +  GKL  +FDT H Y+FE+E  T+IL H+GIDS++L         PF P  K    V     I  + L  LK AKS  +P IVL E LE +E+K L K+ + IK+G P+ E++ K
  S:     7 LQKSNSTFFNMFHF-----KKGETK-NKGKVKDFFSQLSRGLMLPIAILPIAGLLLGIGGAIGANIPQTSDLQILANIFKAMSQVVFDSLPILFCVAITITFSKDRGTAAFSSLLAYLVFCSIQVPFIQK---ENGQIV--SIMWFHTNL--------NVVRSITTTLFGFTNLQTSIFGGILVGFLTSFIYNKVSKIKLPTALDFFSGIRLVPIVLIPVISLLAVLFLIFWPWVGYVISIIGQNIQLAPYGTGGLLYGILGRSLMPFGLHHIPIILAYQTDFGG--------VLYKQDLLNALVNNGVSTDSTIY-QAINNAFPGTSIV-----GDQNIWNF-----------------------INSLSFNS--LPNADGTQTPIFQWF----------------VKNLNVYAGKYTQDYPTYMGACMGI---GVALILVSKKENRKRVASVVGSAMAVAFLTGITEPLEYTFLFCAAPLYYLIYVPLSGISYMLM-------------ELSQAHVGVGFARGFIDLIIYGAIPVVKGSNFYWAFPIAIGEGLITGFSFYFLIKKFNFSTPGRNENNFELITKSKYKEMKN---MASSSKNKNEAPERIAKLIYALGGLDNIENVTACATRLRVSLNSSELVKVNDFKSMGSKGEFLKD-KAIQVIFGGEASILSDQINDVIEGNLSLPKDLKTE-------------------NTDLNKQENKVENKKIIPFKVFAPVNGKIQYLENVDDDVFKNKLMGNGVAILPTSNKVYSILSKGKLVDIFDTKHCYTFESEDKTKILFHIGIDSVSLSS------NPFKPVCKKDSDVSKKSLISEIDLNLLKKAKSIASP-IVLPELLENQEVKILVKNNQVIKQGDPILEIIEK 779
>gi|146744067|gb|ABQ43185.1| PTS system glucose-specific IIBC component [Mycoplasma mycoides subsp. mycoides LC] (746 aa)
Score = 995, Expect = 1.9e-105, Identities = 263/717 (36%), Positives = 380/717 (52%)
  Q:    15 TYFSKLKFNSLFKKQGAGKEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDAL-SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ-AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATST----ATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGS----NAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGEN--TRLFTKEDYKNKQNKVQINGSSESLNNDQ------VLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEK 731
           T  +K  F    K  GA      N    ++KLSK  +LPIA+LPIAG+FLGVG+AI  N      L   G  +   G+  FG LP+LF I++A+A+T D+G AA+   +G+L+F  +Q  L       T   V  Y LL+Y+            + +SL G+ +GI  L + V GG  VG + A  YNKF   +L   I FF+G + VPI+TF+A+ P++ +F+M WP++G+ L   GQ  G    G +S IF  +ER+LVPFGLHH FY+PLW+T AGGSI    N +  Q      V   S      T  T  +E+I+ +  N ++    A GDQ     I+  ++G                                     L   N T  ++           G+N+G++  GK+ FM+LGLP+AA AM +AAPKENR+    I  SA FT  LTGITEPIEYTFLF+APWLF+GVH  L ++AF    W      ATG   L  HI  + SGG+ID+I++G I    G+    +A+      +  APIYF  FYFLIK FN++TPGR  N   +L+TK D+K  +  + ++GS  S + D         A  ++   GG +NI +VD+C ++LR+ + D    D   +  LG          ++  V+G E + IK  ++ L+E        +   EK+M++S   S   E+K E   +  +S+ + +K
  S:     3 TQTNKSSFKDKLKAFGA------NIMPTLSKLSKAFLLPIALLPIAGVFLGVGAAIAANTTPQSALWFIGKVMGNMGDVCFGNLPVLFCISVALAYTKDSGVAAITAVVGFLVFNGVQAPLFIAPAAKTNDKVFEYGLLWYK-----------HVSNSLTGSNMGILSLNTGVLGGIFVGAIAAKCYNKFHQTQLPTAISFFSGTKLVPIITFVAVIPLSFIFMMAWPVIGLGLNKFGQVSGTLPYGTDSLIFEIVERSLVPFGLHHVFYAPLWWTSAGGSIAEGFNNLSKQSEAIQKVFVVSYNSLHGTHHTKLQEIIDIVQKNKELW--GAVGDQ----IISQRVIGH------------------------------------LNILNFTDVEKL----------GINLGRFQSGKFGFMLLGLPSAALAMWLAAPKENRQQVFGIYFSAAFTCFLTGITEPIEYTFLFVAPWLFYGVHMPLASIAF----W------ATG--ALQTHITQTVSGGIIDYIVFGIIPFISGAMKPISAFGVLGVAVVLAPIYFCAFYFLIKLFNVKTPGRDGNAEAKLYTKADFKASKG-LNVDGSKMSSSTDDKEQARLAKAAAIIEYLGGEENIVDVDSCASRLRLTVVDAKKADIDGIKSLGGTTGALVKGNNIQIVYGGEQEAIKPRMQKLLE--------QQRQEKMMSHSEMKS--EEMKSENMGMTCESDQACDK 645
>gi|42561379|ref|NP_975830.1| PTS system, glucose-specific IIBC component [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492877|emb|CAE77472.1| PTS system, glucose-specific IIBC component [Mycoplasma mycoides subsp. mycoides SC str. PG1] (676 aa)
Score = 986, Expect = 2.0e-104, Identities = 255/710 (35%), Positives = 378/710 (53%)
  Q:    22 FNSLFKKQGAGKEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDAL-SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ-AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGS----NAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGEN--TRLFTKEDYKNKQNKVQINGSSESLNNDQ------VLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEK 731
           F S FK +   K    N    ++KLSK  +LPIA+LPIAG+FLGVG+AI  N      L   G  +   G+  FG LP+LF I++A+A+T D+G AA+   +G+L+F  +Q  L     T T   V  Y+LL+Y+            + +SL G+ +GI  L + V GG  VG + A  YNKF   +L   I FF+G + VPI+TF+A+ P++ +F+M WP++G+ L   GQ  G    G +S IF  +ER+LVPFGLHH FY+PLW+T AGGSI    N +  Q  +            + S+ +L  + + N +  ++       +W  +   ++ + V                                  L   N T  ++           G+N+G++  GK+ FM+LGLP+AA AM +AAPKENR+    I  SA FT  LTGITEPIEYTFLF+APWLF+GVH  L ++AF    W      ATG   L  HI  + SGG+ID+I++G I    G+    +A+      +  APIYF  FYFLIK FN++TPGR  N   +L+TK D+K  +  + ++GS  S + D         A  ++   GG +NI +VD+C ++LR+ + D    D   +  LG          ++  V+G E + IK  ++ L+E        +  +EK+M++S   S   E+K E   +  +S  + +K
  S:     2 FKSSFKDKL--KAFAANIMPTLSKLSKAFLLPIALLPIAGVFLGVGAAIAANTPEQSTLWFIGKVMGNMGDVCFGNLPVLFCISVALAYTKDSGVAAITAVVGFLVFNGVQAPLFIAPATKTNDKVFEYSLLWYK-----------HVSNSLTGSNMGILSLNTGVLGGIFVGAIAAKCYNKFHQTQLPTAISFFSGTKLVPIITFVAVIPLSFIFMMAWPVIGLGLNKFGQVSGTLPYGTDSLIFEIVERSLVPFGLHHVFYAPLWWTSAGGSIAEGFNTLNTQSEEVKKAF-------VDSYNKLHGTNHNNLKAIIDIVKAKDALWGAVGDQIISQRVI-------------------------------GHLNILNFTDVEKL----------GINLGRFQSGKFGFMLLGLPSAALAMWLAAPKENRQQVFGIYFSAAFTCFLTGITEPIEYTFLFVAPWLFYGVHMPLASIAF----W------ATG--ALQTHITQTVSGGIIDYIVFGIIPFISGAMKPISAFGVLGVAVVLAPIYFCAFYFLIKLFNVKTPGRDGNAEAKLYTKADFKASKG-LNVDGSKMSSSADDKEQARLAKAAAIIEYLGGEENIVDVDSCASRLRLTVVDAKKADIDGIKSLGGTTGALVKGNNIQIVYGGEQEAIKPRMQKLLE--------QQRHEKMMSHSEMKS--EEMKSENMGMTCESNQACDK 641
>gi|42561392|ref|NP_975843.1| PTS system, glucose-specific, IIBC component [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492890|emb|CAE77485.1| PTS system, glucose-specific, IIBC component [Mycoplasma mycoides subsp. mycoides SC str. PG1] (676 aa)
Score = 982, Expect = 6.4e-104, Identities = 254/710 (35%), Positives = 377/710 (53%)
  Q:    22 FNSLFKKQGAGKEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDAL-SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ-AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGS----NAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGEN--TRLFTKEDYKNKQNKVQINGSSESLNNDQ------VLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEK 731
           F S FK +   K    N    ++KLSK  +LPIA+LPI G+FLGVG+AI  N      L   G  +   G+  FG LP+LF I++A+A+T D+G AA+   +G+L+F  +Q  L     T T   V  Y+LL+Y+            + +SL G+ +GI  L + V GG  VG + A  YNKF   +L   I FF+G + VPI+TF+A+ P++ +F+M WP++G+ L   GQ  G    G +S IF  +ER+LVPFGLHH FY+PLW+T AGGSI    N +  Q  +            + S+ +L  + + N +  ++       +W  +   ++ + V                                  L   N T  ++           G+N+G++  GK+ FM+LGLP+AA AM +AAPKENR+    I  SA FT  LTGITEPIEYTFLF+APWLF+GVH  L ++AF    W      ATG   L  HI  + SGG+ID+I++G I    G+    +A+      +  APIYF  FYFLIK FN++TPGR  N   +L+TK D+K  +  + ++GS  S + D         A  ++   GG +NI +VD+C ++LR+ + D    D   +  LG          ++  V+G E + IK  ++ L+E        +  +EK+M++S   S   E+K E   +  +S  + +K
  S:     2 FKSSFKDKL--KAFAANIMPTLSKLSKAFLLPIALLPIVGVFLGVGAAIAANTPEQSTLWFIGKVMGNMGDVCFGNLPVLFCISVALAYTKDSGVAAITAVVGFLVFNGVQAPLFIAPATKTNDKVFEYSLLWYK-----------HVSNSLTGSNMGILSLNTGVLGGIFVGAIAAKCYNKFHQTQLPTAISFFSGTKLVPIITFVAVIPLSFIFMMAWPVIGLGLNKFGQVSGTLPYGTDSLIFEIVERSLVPFGLHHVFYAPLWWTSAGGSIAEGFNTLNTQSEEVKKAF-------VDSYNKLHGTNHNNLKAIIDIVKAKDALWGAVGDQIISQRVI-------------------------------GHLNILNFTDVEKL----------GINLGRFQSGKFGFMLLGLPSAALAMWLAAPKENRQQVFGIYFSAAFTCFLTGITEPIEYTFLFVAPWLFYGVHMPLASIAF----W------ATG--ALQTHITQTVSGGIIDYIVFGIIPFISGAMKPISAFGVLGVAVVLAPIYFCAFYFLIKLFNVKTPGRDGNAEAKLYTKADFKASKG-LNVDGSKMSSSADDKEQARLAKAAAIIEYLGGEENIVDVDSCASRLRLTVVDAKKADIDGIKSLGGTTGALVKGNNIQIVYGGEQEAIKPRMQKLLE--------QQRHEKMMSHSEMKS--EEMKSENMGMTCESNQACDK 641
>gi|83319967|ref|YP_424088.1| PTS system, glucose-specific IIABC component [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283853|gb|ABC01785.1| PTS system, glucose-specific IIABC component [Mycoplasma capricolum subsp. capricolum ATCC 27343] (737 aa)
Score = 937, Expect = 1.1e-98, Identities = 260/701 (37%), Positives = 383/701 (54%)
  Q:    15 TYFSKLKFNSLFKKQGAGKEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ-AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNP----NSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGS----NAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGEN--TRLFTKEDYKNKQNKVQINGS--SESLNNDQ-----VLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN------ISSSPNLKSEYEKIMNNSSDTSSASEVK 715
           T  +K  F    K  GA      N    ++KLSK  +LPIA+LPIAG+FLGVG+AI  N      L   G  ++  G   FG LP+LF I++A+A+T D+G AA+   +G+L+F  +Q  L       +  V  Y+LL+Y+            + +SL G+ +GI  L + V GG  VG + A  YNKF   +L   I FF+G + VPI+TF+A+ P++ +F+ +WP++G+ L   GQ  G    G +S IF  +ER+LVPFGLHH FY+PLW+T AGGSI            + +  L   + T  T++    N+L+     N +  ++   G+  +W  +   L+ ++V                      IA+         L   N T  ++           G+N+G++  GK+ FM+LGLPAAA AM +AAPKENR+    I  SA FT  LTGITEPIEYTFLF+APWLF+GVH  L ++AF    WI      TG   L  HI  + SGG+ID+I++G I    G+    +A+   I  +  APIYFF FYFLIK FN++TPGR  N   +L+TK DYK  +  + ++GS  S S  +++       A  ++   GG +NI +VD+C ++LR+ + D    +   +  LG          ++  V+G E + IK  ++ L+E       ++ S  +KS+    M+ S D   A E K
  S:     3 TQTNKSNFKDKLKAFGA------NIMPTLSKLSKAFLLPIALLPIAGVFLGVGAAIAANTAEKSTLWFIGAVMKTMGEVCFGNLPVLFCISLALAYTKDSGVAAITAVVGFLVFNGIQAPLFVQGVIKSEKVSEYSLLWYK-----------HVSNSLTGSNMGILSLNTGVLGGIFVGAIAAKCYNKFHQTQLPTAISFFSGTKLVPIITFVAVIPLSFIFMAVWPVIGLGLNKFGQVSGTLPYGTDSLIFEIVERSLVPFGLHHVFYAPLWWTSAGGSI-----------AEGFENLQKQSDTVKTAFVNAYNALHSTNHENLEKIISVIKGNDKLWGAVGDQLISQAV----------------------IAN---------LKILNFTDVEKL----------GINLGRFQSGKFGFMLLGLPAAALAMWLAAPKENRQQVFGIYFSAAFTCFLTGITEPIEYTFLFVAPWLFYGVHMPLASIAF----WI------TG--ALQTHITQTVSGGIIDYIVFGVIPFIGGAMKPLSAFGVLIVAVGLAPIYFFAFYFLIKLFNVKTPGRDGNAEAKLYTKADYKASKG-LNVDGSKMSSSTTDEKEQARLAKAAAIIEYLGGEENIVDVDSCASRLRLTVVDSKKANIDGIKSLGGTTGALVKGNNIQIVYGGEQEAIKPRMQKLLEQQRNEKMMTHSEEMKSDE---MSMSCDAQEACEKK 642
>gi|188159068|ref|ZP_02512091.2| PTS system, glucose-specific IIBC component [Mycoplasma mycoides subsp. mycoides LC str. GM12] (745 aa)
Score = 927, Expect = 1.2e-97, Identities = 263/717 (36%), Positives = 379/717 (52%)
  Q:    15 TYFSKLKFNSLFKKQGAGKEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ-AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATST----ATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGS----NAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGEN--TRLFTKEDYKNKQNKVQINGSSESLNNDQ------VLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEK 731
           T  +K  F    K  GA      N    ++KLSK  +LPIA+LPIAG+FLGVG+AI  N      L   G  +   G+  FG LP+LF I++A+A+T D+G AA+   +G+L+F  +Q  L       +  V  Y+LL+Y+            + +SL G+ +GI  L + V GG  VG + A  YNKF   +L   I FF+G + VPI+TF+A+ P++ +F+M WP++G+ L   GQ  G    G +S IF  +ER+LVPFGLHH FY+PLW+T AGGSI    N +  Q      V   S      T  T  +E+I+ +  N ++    A GDQ     I+  ++G                                     L   N T  ++           G+N+G++  GK+ FM+LGLPAAA AM +AAPKENR+    I  SA FT  LTGITEPIEYTFLF+APWLF+GVH  L ++AF    W      ATG   L  HI  + SGG+ID+I++G I    G+    +A+      +  APIYF  FYFLIK FN++TPGR  N   +L+TK D+K  +  + ++GS  S + D         A  ++   GG +NI +VD+C ++LR+ + D    D   +  LG          ++  V+G E + IK  ++ L+E        +   EK+M +S   S   E+K E   +  +S  + +K
  S:     3 TQTNKSSFKDKLKAFGA------NIMPTLSKLSKAFLLPIALLPIAGVFLGVGAAIAANTPEQSALWFIGKVMGNMGDVCFGNLPVLFCISVALAYTKDSGVAAITAVVGFLVFNGVQAPLFTQGQVQSDKVSEYSLLWYK-----------HVSNSLTGSNMGILSLNTGVLGGIFVGAIAAKCYNKFHQTQLPTAISFFSGTKLVPIITFVAVIPLSFIFMMAWPVIGLGLNKFGQVSGTLPYGTDSLIFEIVERSLVPFGLHHVFYAPLWWTSAGGSIAEGFNNLSKQSEAIQKVFVDSYNSLHGTHHTKLQEIIDIVQKNKELW--GAVGDQ----IISQRVIGH------------------------------------LNILNFTDVEKL----------GINLGRFQSGKFGFMLLGLPAAALAMWLAAPKENRQQVFGIYFSAAFTCFLTGITEPIEYTFLFVAPWLFYGVHMPLASIAF----W------ATG--ALQTHITQTVSGGIIDYIVFGIIPFISGAMKPISAFGVLGVAVVLAPIYFCAFYFLIKLFNVKTPGRDGNAEAKLYTKADFKASKG-LNVDGSKMSSSTDDKEQARLAKAAAIIEYLGGEENIVDVDSCASRLRLTVVDAKKADIDGIKSLGGTTGALVKGNNIQIVYGGEQEAIKPRMQKLLE--------QQRQEKMMGHSEMKS--EEMKSENMSMTCESNQACDK 644
>gi|50365030|ref|YP_053455.1| glucose-specific PTS system IIABC component [Mesoplasma florum L1] >gi|50363586|gb|AAT75571.1| glucose-specific PTS system IIABC component [Mesoplasma florum L1] (709 aa)
Score = 842, Expect = 9.6e-88, Identities = 251/654 (38%), Positives = 368/654 (56%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDAL--------------SQSVTDTTGAVI----------------------GYNLLFYQGNIFGLSAGNAAL----------PSSLYGAVIGINQLQ----------SSVFGGFVVGFLV----AFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAV-GINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWS----FIFGL--AYAPIYFFLFYFLIKKFNIQTPGR--GENTRLFTKEDYKNKQ------NKVQINGSSESLNNDQV------LALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLME 686
           K+  GN    ++KLSK  +LPIA+LPIAG+FLGVGSAI +N+         G+ L   G+  FG LP+LF I++A+A+T D+G AA+   +G+L+   +Q AL               Q+  D  G  +                        NL        G S  N  +            S+Y +++ IN++           +S+  G   G  V    A  YNKF   +L   I FF+G + VPIVTF+A+ P++ +F+ IWP VG+ L   GQA G+   G++SFI+   ER+LVPFGLHH FY+PLW+T AGGSI    N    +    +  + ++  + L     L+N ++   +         QT+   I+++     +W         YS I               A  +VL +++L    +AL         G+N+G++  GK+ FM+LGLP A  AM +  PKENRK  M I  SA FT  LTGITEPIEYTFLFLAPWLF+GVH  L A++F    + GL  +         H+ M+ SGG ID+I++G I   +GS A  +     I G+  A AP YFF FYF +K  N+  PGR    N +L TK +YK  +      +K++   S+++   D V       A  ++   GG  NI +VDAC ++LR+ +KD S+VD   ++ LG          +V  V+G E + IK  +  +++
  S:    21 KKGCGNIMPTLSKLSKAFLLPIALLPIAGVFLGVGSAIASNSVDGTFGYFLGSLLNKMGDVCFGNLPVLFCISVALAYTKDSGIAAITAVVGFLVMNGMQAALLHTQQLNIDTTNLWVQTSIDENGKAVWEHFTSVVVDANGKGKINWADSSINLQNIMAWGIGSSEDNLRMVNSNFELIDGAGSVYYSLLWINKIPNGLITSNIGVNSLNTGVFAGIFVGAIAAKCYNKFHQTQLPSAISFFSGTKLVPIVTFVAVIPLSFIFMFIWPYVGMGLAAFGQASGKLPGGLDSFIYEVAERSLVPFGLHHVFYAPLWWTNAGGSIAEAFNKATPEQQAEFVKIWSANHSVLA--ETLLNGVSEGLKF--------QTIRNMISSDY--PDLWKSMGDQTMAYSVI---------------AKINVLNFTDL----EAL---------GLNIGRFQSGKFGFMLLGLPMAGLAMWLNVPKENRKEVMGIYFSAAFTCFLTGITEPIEYTFLFLAPWLFYGVHMPLAAISF---LFAGLFKT---------HVSMTVSGGFIDYIVFGVIPY-FGSKAMSAKSAFAILGVSAAMAPAYFFGFYFAVKYGNVMVPGRDGSTNVQLATKAEYKASKGLNVDGSKIEEGKSTKASAKDAVEEARIQKATKIIEFLGGEANIVDVDACASRLRLTVKDGSLVDKDGIISLGGATGALIRGTNVQVVYGGEQEAIKPRMIKILD 702
>gi|34396188|gb|AAP55652.1| PTS enzyme II glucose-specific IICB component [Spiroplasma citri] >gi|110005242|emb|CAK99568.1| pts enzyme II glucose-specific IIcb component transmembrane protein [Spiroplasma citri] (693 aa)
Score = 840, Expect = 1.8e-87, Identities = 213/549 (38%), Positives = 305/549 (55%)
  Q:   149 YNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ-AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSI-DLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPN---SQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQI--QYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQ--NKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTL---MENISSSPNLKSE 697
           +NLLFY G  +       A+ + L  + +GIN L + VFGG  VG + AF YN+F   +L   + FF+G + VPI+TF+A+ P+  +F+ IWPL+G  L + G   G+  +G++S IF   ER+LVPFGLHH FYSPLW+TQAGGS+ DL  N  + +D  +Y          L   +EL N ++ N   + ITV +A    T W             + EL++    +  + T     IA          +T++ +                G+N+G++  GK+ FM+ GLPAAAA M  + PKENRK  M I  SA FT  LTGITEPIE+TFLF+APWLF+GVH  LCA++F LM   GL         L  H  M+ SGG ID+I++G I      G+N +W    G+ Y  IYF  FYF IK   +Q PGR   T+L+TK D+K K+  N+   +G ++     +  A  ++   GG DNI  VD+C ++LRI + D  +V+   +  LG    +    QSV  ++G E ++IK  ++ L   M N   +P L S+
  S:   193 FNLLFYTGQTW-------AVQNKLLTSNLGINSLNTGVFGGIFVGAIAAFAYNRFHKTQLPSALIFFSGTKLVPIITFMAVIPLAFIFMFIWPLIGTGLAWFGNNSGKLPIGLDSLIFEIFERSLVPFGLHHVFYSPLWWTQAGGSMADLIAN--VSKDSLSYMAF-------LKDLQEL-NYIDANIDLNTITVGAAQAAITRW-------------VSELNASTIAAVGDQTIMYKVIADPK-------ITFTMVQH-------------MGLNLGRFQTGKFPFMMFGLPAAAAGMYFSVPKENRKPVMGIYFSAAFTCFLTGITEPIEFTFLFVAPWLFYGVHMPLCAISFMLM---GL---------LHVHTSMTVSGGFIDFIVFGIIPFVGGKGTNFYWILAVGIPYIGIYFSAFYFAIKYGEVQIPGRDGATKLYTKADFKAKKGTNETTSSGPAKGDATKREKARKIIDFLGGADNITAVDSCASRLRITVVDSKLVNQDGIQALGGSAGMLIRGQSVQIIYGGEQEVIKPYMRELLAEMRNNKETPKLNSK 691
Score = 234, Expect = 2.9e-17, Identities = 50/110 (45%), Positives = 70/110 (63%)
  Q:    26 FKKQGAGKEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDAL 135
           F  +   K+    T   ++KLSK  +LPIA+LPIAGIFLGVG+ I +          FGNFL   G+  FG LP+LF I++A+A+T DAG AAL   +G+L+F ++Q +L
  S:    10 FMSKAWWKQSNQRTMGTLSKLSKAFLLPIALLPIAGIFLGVGATISSKVDPASAAWYFGNFLNKMGDIAFGNLPVLFCISVAMAYTEDAGVAALTSVVGFLVFNAIQLSL 119
>gi|15828835|ref|NP_326195.1| PTS system, glucose-specific IIABC component (EIIABC-glc) (glucose-permease IIABC component) (phosphotransferase enzyme II, ABC component) (EII-glc/EIII-glc) [Mycoplasma pulmonis UAB CTIP] >gi|14089778|emb|CAC13537.1| PTS SYSTEM, GLUCOSE-SPECIFIC IIABC COMPONENT (EIIABC-GLC) (GLUCOSE-PERMEASE IIABC COMPONENT) (PHOSPHOTRANSFERASE ENZYME II, ABC COMPONENT) (EII-GLC/EIII-GLC) [Mycoplasma pulmonis] (602 aa)
Score = 734, Expect = 3.1e-75, Identities = 203/649 (31%), Positives = 333/649 (51%)
  Q:    36 KGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFI-GYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLG-QALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGE---------------NTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTL 684
           K  ++  + KLS+  MLPI++LPIAG+ LG+G AI  N+  +  + +F NF +   + +F  L +LF  ++ I+FT          FI GYLIF S+Q        D    +   ++ F+  N       NA +     G  +GIN LQ+S+FGG +V   V F+ N++  I+L   +GFF+G++ VP +       + I FL++WP +GIA+ ++G QA     G++  ++G + RAL+P GLHH   +  W T+ GG + L +          +  +A+S     T   E+ + +     + V S  GDQ +W FIN   + K                        +  +++GA + +  W  L S              GV+ G++ Q  Y   +  +     AM++A+ K+NRK   +I  S+ F + LTGITEP+E++FLF+AP  ++  +  +   A+  M                 H+G+ F+ G ID++IYG +  Q G+N +W+    + +  I F +F+F+IKKF+I+TPGR E               N +   KE  +N+  +       E   NDQ++   ++ AYGG +NI++V+AC T+LR+++ D S+VD      LGA+G IK    S  A++G +A I+   I  +
  S:    13 KNKSRTTLVKLSQAFMLPISILPIAGLLLGIGGAIGANSSTSVAI-IFANFFKGASDIIFANLAMLFGASVVISFTNKNRIYGTFMFIIGYLIFLSIQSVFIH-FNDKNEFL---DIFFFHTN-----PDNAFI----VGKTLGINTLQTSIFGGIIVATFVVFIMNRWSEIELPYYLGFFSGIKLVPFILLPFSVLLAIAFLILWPFIGIAIAWIGKQASYAPGGVDGLVYGMLARALMPLGLHHIVIAIAWQTKLGGELSLNE----------FKNVASSLGVLDTF--EIQSVIKAFDDLKVPSIDGDQNIWNFINKLPVNK------------------------LPINNSGASEPIFQW--LASRV------------GVHAGRFTQ-DYPIYLGAIQGIGLAMILASYKKNRKKVAAIVGSSMFVAFLTGITEPLEFSFLFVAPSFYYLFYVPISGFAYMFMKI------------FKAHVGVGFARGFIDYVIYGIVPYQKGTNFYWAIPISIVFLIISFIVFFFVIKKFDIKTPGRLEEEIVLINKKAFLELKNQKSTNKEKTQNQNIEFSEQNKKEISENDQLIQ-ELIKAYGGLENIESVNACATRLRVEVFDISLVDENAFKNLGAKGFIKKG-NSTQAIYGGKAQILSSKINDI 599
>gi|152976460|ref|YP_001375977.1| PTS system, glucose-specific IIABC component [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152025212|gb|ABS22982.1| PTS system, glucose-specific IIBC subunit [Bacillus cereus subsp. cytotoxis NVH 391-98] (687 aa)
Score = 702, Expect = 1.5e-71, Identities = 181/462 (39%), Positives = 267/462 (57%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G +  GKY FM+ GLPAAA AM   A  EN+KLA  I  SA  TS LTGITEP+E++FLF+AP LF G+HA    L+F  M+ +G+             IGM+FSGG+ID++++G +  +  +  WW  I GLA A IY+F F F I+K+N++TPGR   T                 NG+ ++   +  L   V++A GG +NI ++DACIT+LR+Q+ DQ  V+  +L +LGA G ++    ++ A+FG ++D +K  I  +M     +P+++ E                 K E+ V K+D+    E +V  SP  G+I+ + +VPD+ FS  MMG G A++PT G + SP+DG++  VF T HA   ++E G +ILIH GID++ L  +       F   V  GD VK GQ +  V LA +K +A STITP++  N   +G+++  LKK G +KKG
  S:   279 LTAGTFTTGKYPFMMFGLPAAALAMYHEARPENKKLAAGILGSAALTSFLTGITEPLEFSFLFVAPVLF-GIHAVFAGLSFMTMHILGV------------KIGMTFSGGLIDFLLFGVLPGR--TPWWWVIIVGLALAVIYYFGFRFAIRKWNLKTPGREVTT---------------DTNGAGKTEAGE--LPREVLTALGGKENIASLDACITRLRVQVNDQKNVNKDRLKELGAAGVLEVG-NNIQAIFGPKSDTLKSQIHDIMS--GRTPHVEKE--------------EPAKVEEVVQKSDT---NETLV--SPMEGKILPITEVPDQVFSGKMMGDGFAIEPTEGVVVSPVDGEIVNVFPTKHAIGIQSEGGKEILIHFGIDTVKLNGEG------FEALVAQGDKVKQGQPLLKVDLAFVKENAPSTITPVVFTNLQ-QGQQV-ILKKEGTVKKG 679
Score = 416, Expect = 2.7e-38, Identities = 104/252 (41%), Positives = 138/252 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI----VTN---AGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+A+LP AGI LG G+A     +TN   A   +   +    ++  G+ +F  L LLFA+ +AI   G  G A LA F+GYLI             + T +V      F +    G            Y  V+GI  LQ+ VFGG +VG L A+ YNK+ NI+L P +GFF G RFVPI T      + IL   +WP +   L TF  Q +     + +FIFG IER+L+PFGLHH FYSP W     YT A G +
  S:     9 LQKVGKALMLPVAILPAAGILLGFGNAFQNEQLTNLIPALKADWFVMVAKIMEQSGDIIFANLALLFAVGVAIGLAGGDGVAGLAAFVGYLIM------------NKTMSVFLEVDKFVKVTSTGTDPVKIGFADPAYANVLGIPTLQTGVFGGIIVGILAAYCYNKYFNIELPPYLGFFAGKRFVPIATATFSLILGILMCFVWPYIQTVLNTFSHQMIDANKTLAAFIFGLIERSLIPFGLHHIFYSPFWFEFGQYTNAAGEL 261
>gi|1072419|emb|CAA63743.1| glcB [Staphylococcus carnosus] >gi|1588954|prf||2209412B glcB gene (692 aa)
Score = 699, Expect = 3.5e-71, Identities = 180/487 (36%), Positives = 268/487 (55%)
  Q:   399 NLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFEV 885
           NL  G Q +             G +  GKY FM+ GLPAAA A+   A  E RK+   + +SA  TS LTGITEP+E++FLF+AP L+   H  L   +F +M+ + +             IGM+FSGG ID+I+YG +     SNA      G+AYA IY+FLF FLIKK N++TPGR         ED + +   V ++           L   V+ A G  DNIK++DACIT+LR++++D+ +VD  KL QLGA G ++    ++ A+FG ++D IK +++ +M+   +SP                  A     E   V+T   +++   V+ +P TGE V L++VPD+ FS  MMG GIA+KP TG++ +P DGK+ ++F T HA   E++ G ++LIH G++++ L D  G E+      VK  D + +GQ +  V L  +K HA  TITPII+ N      E+     +G++++G  L  V
  S:   264 NLVRGDQRIWMAQYQDGVPFTAGAFTTGKYPFMMFGLPAAAFAIYPQAKPERRKVVGGLMLSAALTSFLTGITEPLEFSFLFVAPILYVA-HVILAGTSFLIMHLLHV------------QIGMTFSGGFIDYILYGLLSWDR-SNALLVIPVGIAYALIYYFLFTFLIKKLNLKTPGR---------EDKEVESKDVSVSE----------LPFEVLEAMGNKDNIKHLDACITRLRVEVRDKGLVDVEKLKQLGASGVLEVG-NNMQAIFGPKSDQIKHDMQQIMDGKITSP------------------AETTVTEDGDVETAEIVAEGGAVIYAPITGEAVDLSEVPDKVFSAKMMGDGIAIKPETGEVVAPFDGKVKMIFPTKHAIGLESKDGIELLIHFGLETVKL-DGEGFEIL-----VKENDNIVLGQPLMKVDLNYIKEHADDTITPIIITNAGSANIEV---LHTGKVEQGEKLLLV 690
Score = 413, Expect = 5.2e-38, Identities = 108/275 (39%), Positives = 152/275 (55%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQ------------VPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSL----YGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQ-ALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAI---------IYQDGKAYAVLATSTA 317
           + ++ K LMLP+A+LP AGI L  G     NA  NE +  F  ++Q              G  +F  LPLLFA+  A+   G  G A +A  +GYLI  +           T G + G  +     +IF  + G   L  S     +  V+GI  LQ+ VFGG ++G L A+ YNKF NI+L   +GFF G RFVPI+T L      I+   +WP V   L  L    LG+ + + +FIFG IER+L+PFGLHH FY+P W+ + G  ++ + N +          YQDG  +   A +T 
  S:    12 LQRIGKALMLPVAILPAAGILLTFG-----NAMHNEQILHFAPWMQHHYIQLISQIMEASGQVIFDNLPLLFAMGTALGLAGGDGVAGIAALVGYLIMSA-----------TMGKIAGITI----DDIFSYADGAKTLGQSAKDPAHALVLGIPTLQTGVFGGIIIGALAAWCYNKFYNIQLPQFLGFFAGKRFVPIITSLVAIVTGIVLSFVWPPVQDGLNNLSNFLLGKNLALTTFIFGIIERSLIPFGLHHIFYAPFWF-EFGHYVNESGNLVRGDQRIWMAQYQDGVPFTAGAFTTG 291
>gi|15613407|ref|NP_241710.1| PTS system, glucose-specific enzyme II, A component [Bacillus halodurans C-125] >gi|10173459|dbj|BAB04563.1| PTS system, glucose-specific enzyme II, A component [Bacillus halodurans C-125] (675 aa)
Score = 698, Expect = 5.3e-71, Identities = 179/460 (38%), Positives = 260/460 (56%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVLNESLEGREIKFLKKSGEIK 877
           +  G ++ GK+ FM+ GLPAAA A+   A  EN+K+   I  SA  TS LTGITEPIE++FLF+AP LF  VH     L+F +M+ + +             IGM+FSGG+ID+I+YG +       AWW  I  GL ++ IY+F F F IKKFN+ TPGR E T    +ED           G+   ++ +  L  NV+ A GG +N+ N+DACIT+LR+ +KD   VD  +L +LGA G ++    S+ A+FG  +D IK  I+ +++    +P +  E       + D + A+ V  +              +    P  G+++ L+ VPDE FSK MMG G A++PT G +Y+P DGK+S +F T HA    T+ G ++LIH+GID++NLK +       F  +V+  D V+ GQ++ +  L  + + AKS ITPII  N + EG  I  L  SGE K
  S:   267 LTAGTFMAGKFPFMMFGLPAAALAIYHCARPENKKVVAGIMASAALTSFLTGITEPIEFSFLFVAPLLF-AVHTIFAGLSFMIMHILDI------------KIGMTFSGGVIDFILYGVLP---NRTAWWLVIPIGLVFSVIYYFGFRFAIKKFNLMTPGREEPT----EED-----------GAGAEVDKNS-LPFNVLEALGGKENLTNLDACITRLRVNVKDAKNVDKNRLKKLGASGVMEVG-NSIQAIFGPRSDQIKTQIQDILD--GKTPVVTEE-------TPDEAQAAPVAGD--------------ISFAMPIEGKLLDLSDVPDEVFSKKMMGDGFAIEPTEGIVYAPFDGKVSTIFPTKHAIGLTTDTGKEVLIHIGIDTVNLKGEG------FTAHVEQDDIVQQGQKLMSFDLDVINEKAKSAITPIIFTNLA-EGEHIT-LHTSGEQK 664
Score = 395, Expect = 6.7e-36, Identities = 109/274 (39%), Positives = 145/274 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEG--------LRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVT-FLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSIDLTQNAIIYQDGKAYAVLATST 316
           + ++ K LMLP+A+LP AGI L  G A+  N    E         + +    +Q  G+ VF  L LLFA+ +AI  +   G A LA  IGYLI             + T +VIG+      G+            S  Y +V+GI  LQ+ VFGG + G L A++Y K+ NI+L   +GFF G RFVPI T F +LF V +L   IWP V   L      + ++   + +FIFG IERAL+PFGLHH FYSP W     YT A G I      I +   +  A L   T
  S:     9 LQRVGKALMLPVALLPAAGILLAFGDAL-QNPDMTERFPFLTADWIVIIAELMQNAGDIVFANLALLFAVGVAIGLSNGDGVAGLAALIGYLII------------NVTMSVIGHVTPEMVGD------------SPAYASVLGIPTLQTGVFGGIIAGLLGAYMYKKYFNIELPSYLGFFAGKRFVPIATAFFSLF-VGVLLHFIWPTVQDGLNAFSYYMTESNRTVAAFIFGVIERALIPFGLHHIFYSPFWFEFGQYTNAAGEIVRGDQRIFFAQIRDGAELTAGT 271
>gi|171324381|ref|ZP_02912896.1| PTS system, glucose-specific IIBC subunit [Geobacillus sp. WCH70] >gi|171089714|gb|EDT36037.1| PTS system, glucose-specific IIBC subunit [Geobacillus sp. WCH70] (675 aa)
Score = 695, Expect = 9.8e-71, Identities = 178/463 (38%), Positives = 259/463 (55%)
  Q:   417 GVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
            +  G ++ GK+ FM+ GLPAAA A+   A  EN+K+   I  SA  TS LTGITEPIE++FLF+AP LF  +H     L+F +M+ + +             IGM+FSGG+ID++++G +       AWW  I  GL +A IY+F F F I+K+++ TPGR + T           + +  +N  ++ L         V++A GG +NI ++DACIT+LR+ + D   VD  +L  LGA G ++    +V A+FG ++DI+KG IK +ME   +   +K E                  P+K  V+   E S +   + SP +GEIV L++VPD+ FS+ MMG G A+ PT G + SP+DGK+  VF T HA   E+  G +ILIH GID++ L  +       F  +V  GD VK GQ I +V L  +K +A S +TPII  N  L+  E   +KK G + KG
  S:   265 ALTAGTFMTGKFPFMMFGLPAAALAIYHEARPENKKVVAGIMGSAALTSFLTGITEPIEFSFLFVAPALF-AIHTIFAGLSFMVMHLLNV------------KIGMTFSGGVIDFLLFGVLP---NRTAWWLVIPVGLVFAVIYYFGFRFAIRKWDLATPGREKTT-----------EEESTVNAEADDL------PYEVLAALGGKENIAHLDACITRLRVSVNDIKQVDKDRLKALGAAGVLEVG-NNVQAIFGPKSDILKGQIKDIMEG-RAPARVKEE------------------PQKTAVQETKE-SAQVEAIASPLSGEIVPLSEVPDQVFSQKMMGDGFAIMPTDGTVVSPVDGKIVNVFPTKHAIGIESVGGHEILIHFGIDTVKLNGQG------FEAHVNQGDEVKKGQPILSVDLEYVKNNAPSIVTPIIFTN--LQPNESIHVKKQGAVTKG 667
Score = 382, Expect = 2.4e-34, Identities = 91/245 (37%), Positives = 129/245 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGN-------EGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + K+ K LMLP+A+LP AGI L  G+A+   A  +       + + +  N ++  G  VF  L LLFA+ +AI   G  G A LA  IGYLI       +     D  G                         +  +  ++GI  LQ+ VFGG +VG L A++YNK+ NI+L   +GFF G RFVPI+T  +   + I+   +WP +   L      +  A   + +FIFG IERAL+PFGLHH FY+P W+
  S:     8 LQKVGKALMLPVAILPAAGILLAFGNALKNPALTDRIPALKADWVVLVSNVMEQAGGIVFSNLSLLFAVGVAIGLAGGDGVAGLAAIIGYLIMNITMSVILGVTPDMVG------------------------DNPAFANILGIPTLQTGVFGGIIVGILAAYMYNKYFNIELPQYLGFFAGKRFVPIITAASAVLLGIVMTWVWPPIQHGLNAFSHNMIDANKTLAAFIFGVIERALIPFGLHHIFYAPFWF 236
>gi|42560614|ref|NP_975065.1| PTS system, glucose-specific IIABC component [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492110|emb|CAE76707.1| PTS system, glucose-specific IIABC component [Mycoplasma mycoides subsp. mycoides SC str. PG1] (580 aa)
Score = 688, Expect = 6.7e-70, Identities = 220/669 (32%), Positives = 343/669 (51%)
  Q:    17 FSKLKFNSLFKKQGAGKEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTN-AGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAV-GINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQ--DGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTW--SNLTSGQQALGTIGANGFKGVNVGQYLQG--KYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGR-GENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           F+K K N    KQ + K     T   + K  +GLMLPI++LP  G+ LG+G  I  N +  N    +    L+     VF  L +LF I+I I FTG++G AA    +GYL+F S Q A            I YN      ++F +  G      S+ G+ +GI+ LQ+S+FG  VVG +V  +YNKFK IKL   + FF+G+RF+PI+   ++F + ++FL+IWP VG+ +  +G +L +   G++ FI+G + RAL+PFGLHH   + L Y  A G I L  + +I++  + K           S  S+ +       N+QI V    GDQ +W FIN+  + K               I  T                +  W  +NL                 +N G++ Q    Y+   +G+     A ++ + KEN+K   S+ MSA   S LTGITEP+E+TFLF+ P L++ V+     L++  MN +              H+G+ F+ G ID ++YGA+ +  G+  +W+F+F L      F +FYF I K ++ TPGR G    L +K+DY   +NK          +N +     ++ A G  +NIK+V AC T+LR+ + ++S++ T +L++LG+ G I  +  ++ A+FG EA II   I  ++
  S:     3 FNKFKINKDNFKQFSSK-----TTAILQKFGRGLMLPISILPFVGLLLGIGGVIGANISTTNHTGLIVSKSLKAMSEIVFANLAILFTISIVITFTGESGSAAFLAILGYLVFNSTQSAF-----------IHYNDKVLV-DVFYIHKGEWL--KSIVGSNLGISSLQTSLFGSIVVGVIVVKIYNKFKYIKLPSALNFFSGIRFLPILIIPSMFLLGLIFLLIWPYVGLLINQIGISLSKTPRGVDGFIYGVLGRALMPFGLHHILIT-LAYQSAFGEI-LEYDKLIFKLIESKVDQETIYKIEQSFKSFTK------SNTQIIV----GDQNIWNFINSIPVNK---------------IQQT---------------PIFLWFENNLN----------------INAGKFTQDYPTYLGTCMGI---GLAFILTSSKENKKQTASVIMSAMGVSFLTGITEPLEFTFLFVTPVLYYVVYVPFSGLSYLFMNLVN------------AHVGVGFARGFIDLLVYGALPVLKGTRFYWAFVFSLIQGVAIFVIFYFWIIKKDLPTPGRKGNELGLISKKDYFELKNK----------DNSEKRIKEIIKALGSKENIKSVSACATRLRVVVNNESLIKTEELIKLGSVGNIIKN-NNIQAIFGGEATIISEKINNIL 577
>gi|163941791|ref|YP_001646675.1| PTS system, glucose-specific IIBC subunit [Bacillus weihenstephanensis KBAB4] >gi|163863988|gb|ABY45047.1| PTS system, glucose-specific IIBC subunit [Bacillus weihenstephanensis KBAB4] (687 aa)
Score = 680, Expect = 5.7e-69, Identities = 179/462 (38%), Positives = 261/462 (56%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G +  GKY FM+ GLPAAA AM   A  EN+KLA  I  SA  TS LTGITEP+E++FLF+AP LF G+HA    L+F  M  +G+             IGM+FSGG+ID+I++G +    G  AWW   I GL  A IY+F F F I+K+N++TPGR                N  +  G +E+      L   V+ A GG +NI ++DACIT+LR+Q+ +Q  V+  +L +LGA G ++    ++ A+FG ++D +K  I  +M     +P+++ E              + VK E+   + D     E   + SP  G+I+ + +VPD+ FS  MMG G A++PT G + SP++G++  VF T HA   ++E G +ILIH GID++ L  +       F   V  GD VK GQ +  V LA +K +A S ITPI+  N   +G++++ LKK G +KKG
  S:   279 LTAGTFTTGKYPFMMFGLPAAALAMYHEARPENKKLAAGILGSAALTSFLTGITEPLEFSFLFVAPVLF-GIHAVFAGLSFMTMQILGV------------KIGMTFSGGLIDFILFGVLP---GRTAWWWVIIVGLVLAVIYYFGFRFAIRKWNLKTPGR-------------EVANANEGAGKTEAGE----LPREVLVALGGKENIASLDACITRLRVQVNEQKNVNKDRLKELGAAGVLEVG-NNIQAIFGPKSDTLKSQIHDIMS--GRTPHVEKE--------------APVKVEEAPQQVD-----ENETIVSPIEGKILPITEVPDQVFSGKMMGDGFAIEPTEGTVVSPVNGEIVNVFPTKHAIGIQSEGGKEILIHFGIDTVKLNGEG------FEALVAQGDKVKQGQPLLKVDLAFVKENAPSIITPIVFTNLQ-QGQQVE-LKKDGNVKKG 679
Score = 407, Expect = 3.1e-37, Identities = 104/252 (41%), Positives = 138/252 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLI-------FGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+A+LP AGI LG G+A        V  A   +   +    ++  G+ +F  L LLFA+ +AI   G  G A LA F+GYLI       F  +   +  + T T    IG++                      Y  V+GI  LQ+ VFGG +VG + A+ YNK+ NI+L   +GFF G RFVPI T      V I+   IWP +   L TF  Q +     I +FIFG IER+L+PFGLHH FYSP W     YT A G +
  S:     9 LQKVGKALMLPVAILPAAGILLGFGNAFQNPQLTNVIPALKADWFVMVAKIMEQSGDIIFANLALLFAVGVAIGLAGGDGVAGLAAFVGYLIMNKTMSVFLEVDKLVKVTSTGTDPVKIGFS-------------------DPAYANVLGIPTLQTGVFGGIIVGIVAAYCYNKYFNIELPSYLGFFAGKRFVPIATATFSLVVGIIMCFIWPYIQGGLNTFSHQMIDANRTIAAFIFGLIERSLIPFGLHHIFYSPFWFEFGQYTNAAGEL 261
>gi|30022137|ref|NP_833768.1| PTS system, glucose-specific IIABC component [Bacillus cereus ATCC 14579] >gi|29897694|gb|AAP10969.1| PTS system, glucose-specific IIABC component [Bacillus cereus ATCC 14579] (687 aa)
Score = 678, Expect = 1.0e-68, Identities = 179/462 (38%), Positives = 261/462 (56%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G +  GKY FM+ GLPAAA AM   A  EN+KLA  I  SA  TS LTGITEP+E++FLF+AP LF G+HA    L+F  M  +G+             IGM+FSGG+ID++++G +    G  AWW   I GL  A IY+F F F I+K+N++TPGR          +  N  +     G +E+      L   V+ A GG +NI ++DACIT+LR+Q+ +Q  V+  +L +LGA G ++    ++ A+FG ++D +K  I  +M     +P+++ E                VK E+   K D     E   + SP  G+I+ + +VPD+ FS  MMG G A++PT G + SP++G++  VF T HA   ++E G +ILIH GID++ L  +       F   V  GD VK GQ +  V LA +K +A S ITPI+  N   +G++++ LKK G +KKG
  S:   279 LTAGTFTTGKYPFMMFGLPAAALAMYHEARPENKKLAAGILGSAALTSFLTGITEPLEFSFLFVAPVLF-GIHAVFAGLSFMTMQILGV------------KIGMTFSGGLIDFLLFGVLP---GRTAWWWVIIVGLVLAVIYYFGFRFAIRKWNLKTPGR----------EVANANDGA---GKAEAGE----LPREVLVALGGKENIASLDACITRLRVQVNEQKNVNKDRLKELGAAGVLEVG-NNIQAIFGPKSDTLKSQIHDIMS--GRTPHVEKE--------------DPVKVEETPQKVD-----ENETIVSPIEGKILPITEVPDQVFSGKMMGDGFAIEPTEGTVVSPVNGEIVNVFPTKHAIGIQSEGGKEILIHFGIDTVKLNGEG------FEALVAQGDKVKQGQPLLKVDLAFVKENAPSIITPIVFTNLQ-QGQQVE-LKKDGNVKKG 679
Score = 401, Expect = 1.4e-36, Identities = 100/252 (39%), Positives = 133/252 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQ--SVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+A+LP AGI LG G+A        V  A   +   +    ++  G+ +F  L LLFA+ +AI   G  G A LA F+GYLI         +   +   T +              G            Y  V+GI  LQ+ VFGG +VG + A+ YNK+ NI+L   +GFF G RFVPI T      V I+   +WP +   L TF  Q +     I +FIFG IER+L+PFGLHH FYSP W     YT A G +
  S:     9 LQKVGKALMLPVAILPAAGILLGFGNAFQNPQLTNVIPALKADWFVMVAKIMEQSGDIIFANLALLFAVGVAIGLAGGDGVAGLAAFVGYLIMNKTMSVFLEVDKLVKVTSS--------------GADPVKIGFADPAYANVLGIPTLQTGVFGGIIVGIVAAYCYNKYFNIELPSYLGFFAGKRFVPIATATFSLIVGIIMCFVWPYIQGGLNTFSHQMIDANRTIAAFIFGLIERSLIPFGLHHIFYSPFWFEFGQYTNAAGEL 261
>gi|192811906|ref|ZP_03040575.1| PTS system, glucose-specific IIBC subunit [Geobacillus sp. Y412MC10] >gi|192799053|gb|EDV75564.1| PTS system, glucose-specific IIBC subunit [Geobacillus sp. Y412MC10] (693 aa)
Score = 677, Expect = 1.5e-68, Identities = 174/459 (37%), Positives = 260/459 (56%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWS-FIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           G ++ GKY FM+ GLPAAA A+   A  EN+K    I  SA  TS LTGITEP+E++FLF+AP LF  VHA    L+F  M+ +G              IGM+FSGG+ID++I+G I        WW+  I G   A IY+F F F+I+KFN++TPGR E +    + D            +     ND  L  N+++A GG  NI ++DACIT+LR+++KD+  VD A+L QLGA G ++    ++ A+FG  +D IK  I+ +M  I+ +   ++   + M  + +         E++  +    L KE++V  SP  GE++ ++ VPD  F++ M G G A+ P  G I SP++G +  VF + HA    ++ G ++L+H+G++++ LK +       F   V+ GD V  GQ I  V L  +K +AKS I+PII  N   EG  +K L K+GE+K G
  S:   270 GTFMTGKYPFMMFGLPAAALAIYHEARPENKKFVAGIMGSAALTSFLTGITEPLEFSFLFVAPILF-AVHALFAGLSFMTMHILG------------TKIGMTFSGGLIDYMIFGVIP---NRTPWWNVLIVGAIMAVIYYFGFRFVIRKFNLRTPGREEASTTEPESD---------TGAAGGGSKND--LPSNILTALGGQPNIAHLDACITRLRVEVKDKGHVDKARLKQLGASGVLEVG-NNIQAIFGTRSDTIKSQIQDIMSGITPTTAPQAAALETMPTAQE---------EQQAGQDGETLVKEEIV--SPADGELMDISHVPDPVFAERMTGDGFAIVPHNGTIVSPVNGTVFNVFPSKHAVGIMSDGGKEVLVHIGVNTVKLKGQG------FEVLVQEGDLVSTGQPIMQVDLDYVKENAKSIISPIIFSNLP-EGASVK-LNKTGEVKSG 683
Score = 341, Expect = 1.1e-29, Identities = 97/262 (37%), Positives = 140/262 (53%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEG-------LRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQ-ALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY------TQAGGSIDLTQNAIIYQ 304
           + ++ K LMLP+A+LP AG+ LG+G+ +V               ++     +   G  VF  L LLFA+ +A+   G  G A LA  IGYL+     +    SV   T A++G N   Y+                 Y +V+GI  L + VFGG +VG L A +Y +F  I+L   +GFF G RFVPI+T      + +L + IWP +  AL       L Q + +++F+FG +ER L+PFGLHH FYSP W+       QAG  +   QN  + Q
  S:     9 LQRVGKALMLPVAILPAAGLLLGLGNMLVNPDFLQYAPWLDAAWVQAAATVMMNAGQIVFTNLSLLFAVGVAVGLAGGEGVAGLAAIIGYLVM----NVTMGSVIGVTPAMVGTN---YE-----------------YASVLGIPTLATGVFGGIIVGILAASMYRRFFKIELPSYLGFFAGKRFVPIMTAATSVLLGLLMVFIWPPIQSALNTASHFMLEQNLTLSAFVFGVVERGLIPFGLHHIFYSPFWFEFGEYLNQAGQLVRGDQNIFMAQ 260
>gi|168162903|ref|ZP_02598136.1| PTS system, glucose-specific IIABC component [Bacillus cereus H3081.97] (687 aa)
Score = 675, Expect = 2.5e-68, Identities = 178/462 (38%), Positives = 260/462 (56%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G +  GKY FM+ GLPAAA AM   A  EN+KLA  I  SA  TS LTGITEP+E++FLF+AP LF G+HA    L+F  M  +G+             IGM+FSGG+ID++++G +    G  AWW   I GL  A IY+F F F I+K++++TPGR                N  +  G +E+      L   V+ A GG +NI ++DACIT+LR+Q+ +Q  V+  +L +LGA G ++    ++ A+FG ++D +K  I  +M     +P+++               A  VK E+   K D     E   + SP  G+I+ + +VPD+ FS  MMG G A++PT G + SP++G++  VF T HA   ++E G +ILIH GID++ L  +       F   V  GD VK GQ +  V LA +K +A S ITPI+  N   +G++++ LKK G +KKG
  S:   279 LTAGTFTTGKYPFMMFGLPAAALAMYHEARPENKKLAAGILGSAALTSFLTGITEPLEFSFLFVAPVLF-GIHAVFAGLSFMTMQILGV------------KIGMTFSGGLIDFLLFGVLP---GRTAWWWVIIVGLVLAVIYYFGFRFAIRKWDLKTPGR-------------EVANANEGAGKAEAGE----LPREVLVALGGKENIASLDACITRLRVQVNEQKNVNKDRLKELGAAGVLEVG-NNIQAIFGPKSDTLKSQIHDIMS--GRTPHVEK--------------AEPVKVEEAPQKVD-----ENETIVSPIEGKILPITEVPDQVFSGKMMGDGFAIEPTEGTVVSPVNGEIVNVFPTKHAIGIQSEGGKEILIHFGIDTVKLNGEG------FEALVAQGDKVKQGQPLLKVDLAFVKENAPSIITPIVFTNLQ-QGQQVE-LKKDGNVKKG 679
Score = 398, Expect = 3.0e-36, Identities = 99/252 (39%), Positives = 133/252 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQ--SVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+A+LP AGI LG G+A        V  A   +   +    ++  G+ +F  L LLFA+ +AI   G  G A LA F+GYLI         +   +   T +              G            Y  V+GI  LQ+ VFGG +VG + A+ YNK+ NI+L   +GFF G RFVPI T      V I+   +WP +   L TF  Q +     + +FIFG IER+L+PFGLHH FYSP W     YT A G +
  S:     9 LQKVGKALMLPVAILPAAGILLGFGNAFQNPQLTNVIPALKADWFVMVAKIMEQSGDIIFANLALLFAVGVAIGLAGGDGVAGLAAFVGYLIMNKTMSVFLEVDKLVKVTSS--------------GADPVKIGFTDPAYANVLGIPTLQTGVFGGIIVGIVAAYCYNKYFNIELPSYLGFFAGKRFVPIATATFSLIVGIIMCFVWPYIQGGLNTFSHQMIDANRTLAAFIFGLIERSLIPFGLHHIFYSPFWFEFGQYTNAAGEL 261
>gi|157692060|ref|YP_001486522.1| PTS family glucose/glucoside (glc) porter component IIABC [Bacillus pumilus SAFR-032] >gi|157680818|gb|ABV61962.1| PTS family glucose/glucoside (glc) porter component IIABC [Bacillus pumilus SAFR-032] (699 aa)
Score = 675, Expect = 2.6e-68, Identities = 173/462 (37%), Positives = 260/462 (56%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPE-KEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G ++ GKY FM+ GLPAAA A+   A  +N+KL   I  SA  TS LTGITEP+E++FLF+AP LF  +H     L+F +M+ + +             IGM+FSGG+ID+ ++G   I     AWW  I  GL  A IY+F F F I+KFN++TPGR               +++   + SS        L   ++ A G  +NIK++DACIT+LR+ + DQ  VD  +L +LGA G ++    ++ A+FG  +D    N+KT M++I +         +    + D S+  EV  + +EV+    +  + + +  SP TGE+  +  VPD+ FS  MMG G A+ PT G + SP+ GK+  VF T HA   +++ G +ILIH GID+++LK +       F   V+ GD V++GQ++  V +  +K    S +TPI+  N S EG+ I  L+K+GEIK G
  S:   278 LTAGTFMTGKYPFMMFGLPAAALAIYHEAKPKNKKLVAGIMGSAALTSFLTGITEPLEFSFLFVAPVLF-AIHCVFAGLSFMIMDILNV------------KIGMTFSGGLIDFFLFG---ILPNRTAWWLVIPVGLVLAAIYYFGFRFAIRKFNLKTPGR---------------EDEADDDASSAKSEKGNDLPYEILEAMGDQENIKHLDACITRLRVTVNDQKKVDKDRLKKLGASGVLEVG-NNIQAIFGPRSD----NLKTQMQDIIAG--------RTPRPAKDPSAKEEVSQQVEEVIAKPLQNEQGEEIFASPITGELHPITDVPDQVFSGKMMGDGFAILPTDGTVVSPVKGKILNVFPTKHAIGLQSDGGLEILIHFGIDTVSLKGEG------FEAFVQEGDQVEIGQKLLVVDIDKIKSEVPSLMTPIVFTNLS-EGQFID-LQKTGEIKAG 690
Score = 405, Expect = 4.6e-37, Identities = 94/245 (38%), Positives = 140/245 (57%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + K+ + LMLP+A+LP AGI L +G+A+       V     N+ +++  + ++  GN VF  LPLLFA+ +AI      G A +A  IGYL+      A+  +        I     F + +           P+  Y  ++GI  L + VFGG +VG L A+++NKF  I+L   +GFF G RFVPIVT ++   + +L L+IWP +  AL +F    L     + +F+FG IER+L+PFGLHH FY+P WY
  S:     9 LQKIGRALMLPVAILPAAGILLALGNAMQNPQLIDVAQFLSNDTIQLVASVMENAGNIVFSNLPLLFAVGVAIGLANGDGVAGIAAIIGYLVMNVTMSAVLMANGSIPSDSIKLAKFFKESH-----------PA--YVNMLGIPTLSTGVFGGIIVGVLAAYMFNKFYKIELPQYLGFFAGKRFVPIVTSISALILGLLMLVIWPPIQGALNSFSTGLLAANEPLAAFVFGVIERSLIPFGLHHIFYAPFWY 248
>gi|1072418|emb|CAA63742.1| glcA [Staphylococcus carnosus] >gi|1588953|prf||2209412A glcA gene (675 aa)
Score = 671, Expect = 7.3e-68, Identities = 174/462 (37%), Positives = 267/462 (57%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G+++QG++  M+ GLPAAA A+   A KEN+K+   + +S   TS LTGITEP+E++FLF+AP LF+ +HA L  L+F ++              L  H+G +FSGG ID+ + G +        WW  I  GL YA IY+ +F FLI KFN +TPGR         ED + K + V    +SE       L   V+ A GG  NIK++DACIT+LR+++ D++ VD  +L  LGA G ++    ++ A+FG ++D IK +++ +M+   +SP   +  E+    +++ ++A                     VV +P  GE+V +++VPD+ FS+ MMG GIA+KP TG++ +P DG + +VF T HA   E++ G ++LIH G++++ L      E K F   VK  D + +GQ +  V L  +K HA STITPI+V N  L GR ++ L+  GE+K+G
  S:   268 LTAGKFMQGEFPVMMFGLPAAALAIYQTAKKENKKVVAGLMLSGALTSFLTGITEPLEFSFLFVAPLLFF-IHAVLDGLSFLILY------------LLDLHLGYTFSGGFIDFFLLGILP---NKTQWWLVIPVGLVYAAIYYIIFRFLIVKFNFKTPGR---------EDKEVKSSNV---AASE-------LPFKVLDAMGGKANIKHLDACITRLRVEVNDKAKVDVQELKDLGASGVLEVG-NNMQAIFGPKSDQIKHDMQQIMDGKITSPEETTVTEEGDKETAEIAAAG------------------GGVVYAPIKGEVVDISEVPDKVFSEKMMGDGIAIKPETGEVVAPFDGVVKMVFPTKHAIGLESKDGIELLIHFGLETVKL------EGKGFDILVKENDNIVLGQPLMKVDLDYIKEHADSTITPIVVTN--LNGRTMEVLQH-GEVKQG 668
Score = 321, Expect = 2.6e-27, Identities = 78/232 (33%), Positives = 118/232 (50%)
  Q:    78 EGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIV----TFLALFPVTILFLMIWPLVGIALTFLGQA-LGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAY 309
           EG +     ++  G  +F  L ++FA+ +AI      G AA+A F+G+++                            G   G++   AA  ++ +  V+GI  LQ+ VFGG ++G L A+ YNKF NI L   +GFF G RFVPI+    +F+  FP+ I    IWP +   L    +  L    G+  F+FGFI+R L+PFGLHH F++P W+    GS       II+ D + +
  S:    51 EGFQNVAKMMEGAGGIIFDNLAIIFALGVAIGLASGDGVAAIAAFVGFIVLNKTM-----------------------GMFLGVTPEKAADAATGFANVLGIPTLQTGVFGGIIIGALAAWCYNKFYNISLPSYLGFFAGKRFVPIMMATCSFILAFPMAI----IWPSIQGGLNAFSEGLLASNTGLAVFLFGFIKRLLIPFGLHHIFHAPFWF--EFGSYKNAAGQIIHGDQRIF 258
>gi|83319451|ref|YP_424786.1| PTS system glucose-specific IIBC component [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283337|gb|ABC01269.1| PTS system glucose-specific IIBC component [Mycoplasma capricolum subsp. capricolum ATCC 27343] (580 aa)
Score = 670, Expect = 8.3e-68, Identities = 216/653 (33%), Positives = 339/653 (51%)
  Q:    33 KEKKGNTKEFIAKLS-------KGLMLPIAMLPIAGIFLGVGSAIVTN-AGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQG--KYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGR-GENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           K  K N K+F +K++       +GLMLPI++LP AG+ LG+G AI  N +  N+   V    L+     VF  L +LF I+I I FTG++G AA    +GYL+F S Q A      D T   + Y    ++G              S+ G+ +GI+ LQ+S+FG  +VG ++  +YNKFK IKL   + FF+G+RF+PI+   ++F + ++FL+IWP VG+ +  +G +L +   G++ FI+G + RAL+PFGLHH   +  + +  GG ++  +      + K           ++   +E   S   N+  T+    GDQ +W FIN                             SI  +    I   L + N  +               +N G++ Q    Y+   +G+     A ++ + KENRK   S+ +SA   S LTGITEP+E+TFLF+ P L++ V+     L++  MN    +VSA        H+G+ F+ G ID ++YGA+ +  G+  +W FIF L      F +FYF I K ++ TPGR G    L +K+DY   +NK          +N +     ++ A G  +NIK+V AC T+LR+ + DQS+V T +L++LG+ G I  +  ++ A+FG EA II   I  ++
  S:     7 KVNKNNFKQFSSKITAILQKFGRGLMLPISILPFAGLLLGIGGAIGANISTTNQIGLVVSESLKAMSQIVFANLAILFTISIVITFTGESGSAAFLAVLGYLVFNSTQSAFIH-YNDKTLVDVFY---IHKGEWL----------KSIVGSNLGISSLQTSLFGSIIVGIVIVKIYNKFKYIKLPSALNFFSGIRFLPILIIPSMFLLGLIFLLIWPYVGLLINKIGISLSKTPKGVDGFIYGALGRALMPFGLHHILITLAYQSAFGGVLEYDKLVFKLTELKV-------DQETINKIQEAFKSFTKNNAQTI---IGDQNIWNFIN-----------------------------SIPINRIEQIPIFLWFENNLN---------------INAGRFTQDYPTYLGTCMGI---GLAFILTSNKENRKQTASVILSAMGVSFLTGITEPLEFTFLFVTPILYYAVYVPFSGLSYLFMN----LVSA--------HVGVGFARGFIDLLVYGALPVLKGTRFYWVFIFSLIQGVAIFIIFYFWIIKKDLPTPGRKGNELGLISKKDYFELKNK----------DNSEKRIHEIIKALGSKENIKSVSACATRLRVVVNDQSLVKTEELIKLGSLGNIIKN-NNIQAIFGGEATIISEKINNIL 577
>gi|194014218|ref|ZP_03052835.1| pts system, glucose-specific iibc component [Bacillus pumilus ATCC 7061] >gi|194013244|gb|EDW22809.1| pts system, glucose-specific iibc component [Bacillus pumilus ATCC 7061] (699 aa)
Score = 665, Expect = 3.0e-67, Identities = 174/462 (37%), Positives = 259/462 (56%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVV---KTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G ++ GKY FM+ GLPAAA A+   A  +N+KL   I  SA  TS LTGITEP+E++FLF+AP LF  +H     L+F +M+ + +             IGM+FSGG+ID+ ++G +       AWW  I  GLA A IY+F F F I+KFN++TPGR               +++      S        L   ++ A G  +NIK++DACIT+LR+ + DQ  VD  +L +LGA G ++    ++ A+FG  +D    N+KT M++I +         +    + D S+  EV  + E V      +EL +E  +  SP TGE+  +  VPD+ FS  MMG G A+ PT G + SP+ GK+  VF T HA   +++ G +ILIH GID+++LK +       F   V+ GD V++GQ++  V +  +K    S +TPI+  N S EG+ I  L+++GEIK G
  S:   278 LTAGTFMTGKYPFMMFGLPAAALAIYHEAKPKNKKLVAGIMGSAALTSFLTGITEPLEFSFLFVAPVLF-AIHCVFAGLSFMIMDILNV------------KIGMTFSGGLIDFFLFGILP---NRTAWWLVIPVGLALAAIYYFGFRFAIRKFNLKTPGR---------------EDEAADGADSAKSEKGNDLPYEILEAMGDQENIKHLDACITRLRVTVNDQKKVDKDRLKKLGASGVLEVG-NNIQAIFGPRSD----NLKTQMQDIIAG--------RTPRPAKDPSAKEEVSQQVEEVIAKPLQNELGEE--IFASPITGELHPITDVPDQVFSGKMMGDGFAILPTDGTVVSPVKGKILNVFPTKHAIGLQSDGGLEILIHFGIDTVSLKGEG------FEAFVQEGDQVEIGQKLLEVDIDKIKSEVPSLMTPIVFTNLS-EGQFID-LQEAGEIKAG 690
Score = 405, Expect = 5.1e-37, Identities = 94/245 (38%), Positives = 140/245 (57%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + K+ + LMLP+A+LP AGI L +G+A+       V     N+ +++  + ++  GN VF  LPLLFA+ +AI      G A +A  IGYL+      A+  +        I     F + +           P+  Y  ++GI  L + VFGG +VG L A+++NKF  I+L   +GFF G RFVPIVT ++   + +L L+IWP +  AL +F    L     + +F+FG IER+L+PFGLHH FY+P WY
  S:     9 LQKIGRALMLPVAILPAAGILLALGNAMQNPQLIDVAQFLSNDTIQLVASVMENAGNIVFSNLPLLFAVGVAIGLANGDGVAGIAAIIGYLVMNVTMSAVLMANGSIPSDSIKLAKFFKESH-----------PA--YVNMLGIPTLSTGVFGGIIVGVLAAYMFNKFYKIELPQYLGFFAGKRFVPIVTSISALILGLLMLVIWPPIQGALNSFSTGLLAANEPLAAFVFGVIERSLIPFGLHHIFYAPFWY 248
>gi|138894548|ref|YP_001125001.1| PTS system, glucose-specific IIABC component [Geobacillus thermodenitrificans NG80-2] >gi|196247846|ref|ZP_03146548.1| PTS system, glucose-specific IIBC subunit [Geobacillus sp. G11MC16] >gi|134266061|gb|ABO66256.1| PTS system, glucose-specific IIABC component [Geobacillus thermodenitrificans NG80-2] >gi|196212630|gb|EDY07387.1| PTS system, glucose-specific IIBC subunit [Geobacillus sp. G11MC16] (671 aa)
Score = 664, Expect = 4.1e-67, Identities = 174/462 (37%), Positives = 256/462 (55%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G ++ GK+ FM+ GLPAAA A+   A  EN+K+   I  SA  TS LTGITEPIE++FLF+AP LF  +H     L+F +M+ + +             IGM+FSGG+ID++++G +       AWW  I  GLA+A IY+F F F I+K+N+ TPGR         E   ++  K      +E+   D  L   V++A GG +NI+++DACIT+LR+ ++D   V+  +L +LGA G ++    +V A+FG ++DI+KG I  +M+                         ++VK E    K ++  + +   + SP  GEIV LA VPD+ FS+ MMG G AV PT G + SP+DG +  VF T HA   ++  G +ILIH GID++ L  +       F   VK GD VK GQ I  V L  +K +A S +TP+I  N  L+  +   +KK G + +G
  S:   266 LTAGTFMTGKFPFMMFGLPAAALAIYHEARPENKKIVAGIMGSAALTSFLTGITEPIEFSFLFVAPALF-AIHCVFAGLSFMIMHLLNI------------KIGMTFSGGVIDFLLFGVLP---NRTAWWLVIPIGLAFAVIYYFGFRFAIRKWNLATPGR---------EKTGDETPK------AEAATGD--LPYEVLAALGGKENIEHLDACITRLRVSVRDIGQVNKDRLKELGAAGVLEVG-NNVQAIFGPKSDILKGQIHDIMQG---------------------KVPTKVKEEP---KEETPATTQAEAIASPLAGEIVPLADVPDQVFSQKMMGDGFAVMPTDGTVVSPVDGNIINVFPTKHAIGIKSAGGHEILIHFGIDTVKLNGEG------FEALVKEGDEVKKGQPILRVDLDYVKNNAPSIVTPVIFTN--LQAGQAVHIKKQGAVSQG 663
Score = 391, Expect = 2.0e-35, Identities = 95/245 (38%), Positives = 135/245 (55%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGN-------EGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + ++ K LMLP+A+LP AGI L +G+A+   A  +       + + +  N ++  G  VF  L LLFA+ +AI   G  G A LA  IGYLI     +     V +    ++G +                  PS  +  ++GI  LQ+ VFGG +VG L A++YNK+ NI+L   +GFF G RFVPIVT  +   + I+   IWP +   L  F    +     + +FIFG IERAL+PFGLHH FYSP W+
  S:     8 LQRVGKALMLPVAILPAAGILLAIGNALKNPALTDKIPALKADWVVLISNVMEQAGGIVFSNLSLLFAVGVAIGLAGGEGVAGLAAIIGYLIM----NVTMSVVLNVNADMVGND------------------PS--FANILGIPTLQTGVFGGIIVGILAAYMYNKYFNIELPQYLGFFAGKRFVPIVTAASAVVLGIIMTFIWPPIQHGLNAFSHNMIDTNKTVAAFIFGVIERALIPFGLHHIFYSPFWF 236
>gi|168140025|ref|ZP_02583254.1| PTS system, glucose-specific IIABC component [Bacillus cereus G9842] (687 aa)
Score = 664, Expect = 4.7e-67, Identities = 176/462 (38%), Positives = 255/462 (55%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G +  GKY FM+ GLPAAA AM   A  EN+KLA  I  SA  TS LTGITEP+E++FLF+AP LF G+HA    L+F  M  +G+             IGM+FSGG+ID++++G +    G  AWW   I GL  A IY+F F F I+K+N++TPGR E              N     G +E+      L   V+ A GG +NI ++DACIT+LR+Q+ +Q  V+  +L +LGA G ++    ++ A+FG ++D +K  I  +M              +  +   +     E  P+K           E   + SP  G+I+ + +VPD+ FS  MMG G A++PT G + SP++G++  VF T HA   ++E G +ILIH GID++ L  +       F   V  GD VK GQ +  V LA +K +A S ITPI+  N   +G++++ LKK G +KKG
  S:   279 LTAGTFTTGKYPFMMFGLPAAALAMYHEARPENKKLAAGILGSAALTSFLTGITEPLEFSFLFVAPVLF-GIHAVFAGLSFMTMQILGV------------KIGMTFSGGLIDFLLFGVLP---GRTAWWWVIIVGLVLAVIYYFGFRFAIRKWNLKTPGREE-------------ANANDGAGKAEAGE----LPREVLVALGGKENIASLDACITRLRVQVNEQKNVNKDRLKELGAAGVLEVG-NNIQAIFGPKSDTLKSQIHDIMSG------------RTPHVEKEEPVKVEETPQK---------VDENETIVSPIEGKILPITEVPDQVFSGKMMGDGFAIEPTEGTVVSPVNGEIVNVFPTKHAIGIQSEGGKEILIHFGIDTVKLNGEG------FEALVAQGDKVKQGQPLLKVDLAFVKENAPSIITPIVFTNLQ-QGQQVE-LKKDGNVKKG 679
Score = 400, Expect = 1.7e-36, Identities = 100/252 (39%), Positives = 133/252 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQ--SVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+A+LP AGI LG G+A        V  A   +   +    ++  G+ +F  L LLFA+ +AI   G  G A LA F+GYLI         +   +   T +              G            Y  V+GI  LQ+ VFGG +VG + A+ YNK+ NI+L   +GFF G RFVPI T      V I+   +WP +   L TF  Q +     I +FIFG IER+L+PFGLHH FYSP W     YT A G +
  S:     9 LQKVGKALMLPVAILPAAGILLGFGNAFQNPQLTNVIPALKADWFVMVAKIMEQSGDIIFANLALLFAVGVAIGLAGGDGVAGLAAFVGYLIMNKTMSVFLEVDKLVKVTSS--------------GADPVKIGFADPAYANVLGIPTLQTGVFGGIIVGIVAAYCYNKYFNIELPSYLGFFAGKRFVPIATATFSLIVGIIMCFVWPYIQGGLNTFSHQMIDANRTIAAFIFGLIERSLIPFGLHHIFYSPFWFEFGQYTNAAGEL 261
>gi|42783164|ref|NP_980411.1| PTS system, glucose-specific IIABC component [Bacillus cereus ATCC 10987] >gi|42739092|gb|AAS43019.1| PTS system, glucose-specific IIABC component [Bacillus cereus ATCC 10987] (687 aa)
Score = 658, Expect = 2.4e-66, Identities = 173/462 (37%), Positives = 255/462 (55%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQV--LALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G +  GKY FM+ GLPAAA AM   A  EN+KLA  I  SA  TS LTGITEP+E++FLF+AP LF G+HA    L+F  M  +G+             IGM+FSGG+ID++++G +    G  AWW   I GL  A IY+F F F I+K++++TPGR                   ++  S+E     +   L   V+ A GG +NI ++DACIT+LR+Q+ +Q  V+  +L +LGA G ++    ++ A+FG ++D +K  I  +M              +  +   +     E  P+K           E   + SP  G+I+ + +VPD+ FS  MMG G A++PT G + SP++G++  VF T HA   ++E G +ILIH GID++ L  +       F   V  GD VK GQ +  V LA +K +A S ITPI+  N   +G++++ LKK G +KKG
  S:   279 LTAGTFTTGKYPFMMFGLPAAALAMYHEARPENKKLAAGILGSAALTSFLTGITEPLEFSFLFVAPVLF-GIHAVFAGLSFMTMQILGV------------KIGMTFSGGLIDFLLFGVLP---GRTAWWWVIIVGLVLAVIYYFGFRFAIRKWDLKTPGR-------------------EVANSNEGAGKAEAGELPREVLVALGGKENIASLDACITRLRVQVNEQKNVNKDRLKELGAAGVLEVG-NNIQAIFGPKSDTLKSQIHDIMSG------------RTPHVEKEEPVKVEEAPQK---------VDENETIVSPIEGKILPITEVPDQVFSGKMMGDGFAIEPTEGTVVSPVNGEIVNVFPTKHAIGIQSEGGKEILIHFGIDTVKLNGEG------FEALVAQGDKVKQGQPLLKVDLAFVKENAPSIITPIVFTNLQ-QGQQVE-LKKDGNVKKG 679
Score = 398, Expect = 3.2e-36, Identities = 99/252 (39%), Positives = 133/252 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQ--SVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+A+LP AGI LG G+A        V  A   +   +    ++  G+ +F  L LLFA+ +AI   G  G A LA F+GYLI         +   +   T +              G            Y  V+GI  LQ+ VFGG +VG + A+ YNK+ NI+L   +GFF G RFVPI T      V I+   +WP +   L TF  Q +     + +FIFG IER+L+PFGLHH FYSP W     YT A G +
  S:     9 LQKVGKALMLPVAILPAAGILLGFGNAFQNPQLTNVIPALKADWFVMVAKIMEQSGDIIFANLALLFAVGVAIGLAGGDGVAGLAAFVGYLIMNKTMSVFLEVDKLVKVTSS--------------GADPVKIGFADPAYANVLGIPTLQTGVFGGIIVGIVAAYCYNKYFNIELPSYLGFFAGKRFVPIATATFSLIVGIIMCFVWPYIQGGLNTFSHQMIDANRTLAAFIFGLIERSLIPFGLHHIFYSPFWFEFGQYTNAAGEL 261
>gi|168136707|ref|ZP_02579936.1| PTS system, glucose-specific IIABC component [Bacillus cereus B4264] (687 aa)
Score = 657, Expect = 2.7e-66, Identities = 176/462 (38%), Positives = 261/462 (56%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G +  GKY FM+ GLPAAA AM   A  EN+KLA  I  SA  TS LTGITEP+E++FLF+AP LF G+HA    L+F  M  +G+             IGM+FSGG+ID++++G +    G  AWW   I GL  A IY+F F F I+K+N++TPGR          +  N  +     G +E+      L   V+ A GG +NI ++DACIT+LR+Q+ +Q  V+  +L +LGA G ++    ++ A+FG ++D +K  I  +M                    S  +   E +   +V +T  ++ + + +V SP  G+I+ + +VPD+ FS  MMG G A++PT G + SP++G++  VF T HA   ++E G +ILIH GID++ L  +       F   V  GD VK GQ +  V LA +K +A S ITPI+  N   +G++++ LKK G +KKG
  S:   279 LTAGTFTTGKYPFMMFGLPAAALAMYHEARPENKKLAAGILGSAALTSFLTGITEPLEFSFLFVAPVLF-GIHAVFAGLSFMTMQILGV------------KIGMTFSGGLIDFLLFGVLP---GRTAWWWVIIVGLVLAVIYYFGFRFAIRKWNLKTPGR----------EVANANDGA---GKAEAGE----LPREVLVALGGKENIASLDACITRLRVQVNEQKNVNKDRLKELGAAGVLEVG-NNIQAIFGPKSDTLKSQIHDIM--------------------SGRTPHVEKEEPVKVEETPQKIDENETIV-SPIEGKILPITEVPDQVFSGKMMGDGFAIEPTEGTVVSPVNGEIVNVFPTKHAIGIQSEGGKEILIHFGIDTVKLNGEG------FEALVAQGDKVKQGQPLLKVDLAFVKENAPSIITPIVFTNLQ-QGQQVE-LKKDGNVKKG 679
Score = 400, Expect = 2.0e-36, Identities = 100/252 (39%), Positives = 133/252 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQ--SVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+A+LP AGI LG G+A        V  A   +   +    ++  G+ +F  L LLFA+ +AI   G  G A LA F+GYLI         +   +   T +              G            Y  V+GI  LQ+ VFGG +VG + A+ YNK+ NI+L   +GFF G RFVPI T      V I+   +WP +   L TF  Q +     I +FIFG IER+L+PFGLHH FYSP W     YT A G +
  S:     9 LQKVGKALMLPVAILPAAGILLGFGNAFQNPQLTNVIPALKADWFVMVAKIMEQSGDIIFANLALLFAVGVAIGLAGGDGVAGLAAFVGYLIMNKTMSVFLEVDKLVKVTSS--------------GADPVKIGFADPAYANVLGIPTLQTGVFGGIIVGIVAAYCYNKYFNIELPSYLGFFAGKRFVPIATATFSLIVGIIMCFVWPYIQGGLNTFSHQMIDANRTIAAFIFGLIERSLIPFGLHHIFYSPFWFEFGQYTNAAGEL 261
>gi|118479254|ref|YP_896405.1| PTS system, glucose-specific IIABC component [Bacillus thuringiensis str. Al Hakam] >gi|118418479|gb|ABK86898.1| PTS system, glucose-specific IIABC component [Bacillus thuringiensis str. Al Hakam] (706 aa)
Score = 657, Expect = 2.8e-66, Identities = 174/462 (37%), Positives = 256/462 (55%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G +  GKY FM+ GLPAAA AM   A  EN+KLA  I  SA  TS LTGITEP+E++FLF+AP LF G+HA    L+F  M  +G+             IGM+FSGG+ID++++G +    G  AWW   + GL  A IY+F F F I+K+N++TPGR          +  N  +     G +E+      L   V+ A GG +NI ++DACIT+LR+Q+ +Q  V+  +L +LGA G ++    ++ A+FG ++D +K  I  +M              +  +   +     E  P+K           E   + SP  G+I+ + +VPD+ FS  MMG G A++PT G + SP++G++  VF T HA   ++E G +ILIH GID++ L  +       F   V  GD VK GQ +  V LA +K +A S ITPI+  N   +G++++ LKK G +KKG
  S:   298 LTAGTFTTGKYPFMMFGLPAAALAMYHEARPENKKLAAGILGSAALTSFLTGITEPLEFSFLFVAPVLF-GIHAVFAGLSFMTMQILGV------------KIGMTFSGGLIDFMLFGVLP---GRTAWWWVIVVGLVLAVIYYFGFRFAIRKWNLKTPGR----------EVANANDGA---GKAEAGE----LPREVLVALGGKENIASLDACITRLRVQVNEQKNVNKDRLKELGAAGVLEVG-NNIQAIFGPKSDTLKSQIHDIMSG------------RTPHVEKEEPVKVEEAPQK---------VDENETIVSPIEGKILPITEVPDQVFSGKMMGDGFAIEPTEGTVVSPVNGEIVNVFPTKHAIGIQSEGGKEILIHFGIDTVKLNGEG------FEALVAQGDKVKQGQPLLKVDLAFVKENAPSIITPIVFTNLQ-QGQQVE-LKKDGNVKKG 698
Score = 402, Expect = 1.1e-36, Identities = 103/266 (38%), Positives = 140/266 (52%)
  Q:    29 QGAGKEKKGNTKEF------IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQ--SVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           +G   +K+G    F      + K+ K LMLP+A+LP AGI LG G+A        V  A   +   +    ++  G+ +F  L LLFA+ +AI   G  G A LA F+GYLI         +   +   T +              G            Y  V+GI  LQ+ VFGG +VG + A+ YNK+ NI+L   +GFF G RFVPI T      V I+   +WP +   L TF  Q +     + +FIFG IER+L+PFGLHH FYSP W     YT A G +
  S:     8 EGINIDKRGRVSMFKKIFGVLQKVGKALMLPVAILPAAGILLGFGNAFQNPQLTNVIPALKADWFVMVAKIMEQSGDIIFANLALLFAVGVAIGLAGGDGVAGLAAFVGYLIMNKTMSVFLEVDKLVKVTSS--------------GADPVKIGFTDPAYANVLGIPTLQTGVFGGIIVGIVAAYCYNKYFNIELPSYLGFFAGKRFVPIATATFSLVVGIIMCFVWPYIQGGLNTFSHQMIDANRTLAAFIFGLIERSLIPFGLHHIFYSPFWFEFGQYTNAAGEL 280
>gi|15923179|ref|NP_370713.1| PTS enzyme II [Staphylococcus aureus subsp. aureus Mu50] >gi|15925893|ref|NP_373426.1| hypothetical protein SA0183 [Staphylococcus aureus subsp. aureus N315] >gi|148266614|ref|YP_001245557.1| PTS system, glucose-specific IIBC subunit [Staphylococcus aureus subsp. aureus JH9] >gi|150392653|ref|YP_001315328.1| PTS system, glucose-specific IIBC subunit [Staphylococcus aureus subsp. aureus JH1] >gi|156978519|ref|YP_001440778.1| PTS enzyme II [Staphylococcus aureus subsp. aureus Mu3] >gi|13700105|dbj|BAB41404.1| glcA [Staphylococcus aureus subsp. aureus N315] >gi|14245956|dbj|BAB56351.1| PTS enzyme II [Staphylococcus aureus subsp. aureus Mu50] >gi|147739683|gb|ABQ47981.1| PTS system, glucose-specific IIBC subunit [Staphylococcus aureus subsp. aureus JH9] >gi|149945105|gb|ABR51041.1| PTS system, glucose-specific IIBC subunit [Staphylococcus aureus subsp. aureus JH1] >gi|156720654|dbj|BAF77071.1| PTS enzyme II [Staphylococcus aureus subsp. aureus Mu3] (681 aa)
Score = 657, Expect = 3.1e-66, Identities = 167/467 (35%), Positives = 261/467 (55%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNS--SDTSSASEVKPEKEVVKTDSELSKE-KVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFE 884
           +  G+++QG++  M+ GLPAAA A+   A  EN+K+   +  SA  TS LTGITEP+E++FLF+AP LF+ +HA L  L+F  +  + +            H+G +FSGG ID+++ G +        WW  I  GL YA IY+F+F FLI K   +TPGR            ++KQ++     ++E       L   V+ A GG  NIK++DACIT+LR+++ D+S VD   L  LGA G ++    ++ A+FG ++D                  +K E ++IMN     + ++  + K E  VV  D   + E   +V++P TGE+  L++VPD+ FS+ MMG GIA+KP+ G++ +P +GK+ ++F T HA    ++ G ++LIH+G+D++ L  +       F  +V+ G  VK G  +    L  ++ HAKS ITPIIV   ++   + K   + G I  G  LFE
  S:   268 LTAGKFMQGEFPVMMFGLPAAALAIYHTAKPENKKVVAGLMGSAALTSFLTGITEPLEFSFLFVAPLLFF-IHAVLDGLSFLTLYLLDV------------HLGYTFSGGFIDYVLLGVLP---NKTQWWLVIPVGLVYAVIYYFVFRFLIVKLKYKTPGR------------EDKQSQAVTASATE-------LPYAVLEAMGGKANIKHLDACITRLRVEVNDKSKVDVPGLKDLGASGVLEVG-NNMQAIFGPKSD-----------------QIKHEMQQIMNGQVVENPTTMEDDKDETVVVAEDKSATSELSHIVHAPLTGEVTPLSEVPDQVFSEKMMGDGIAIKPSQGEVRAPFNGKIQMIFPTKHAIGLVSDSGLELLIHIGLDTVKLNGEG------FTLHVEEGQEVKQGDLLINFDLDYIRNHAKSDITPIIVTQGNITNLDFK-QGEHGNISFGDQLFE 679
Score = 412, Expect = 7.7e-38, Identities = 90/245 (36%), Positives = 133/245 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGG-------NEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + ++ K LMLP+A+LP AG+ L +G+AI   A         N G++     +   G+ +F  LP++FA+ +AI   G  G AA+A F+GY+I                            G+   ++  N   P+S Y +++GI  LQ+ VFGG ++G L A+ YNKF NI L   +GFF G RFVPI+     F +     +IWP +   L  F    L    G+  F+FGFI+R L+PFGLHH F++P W+
  S:     9 LQRIGKALMLPVAILPAAGLLLAIGTAIQGEALQHYLPFIQNGGVQNVAKLMTAAGSIIFENLPMIFALGVAIGLAGGDGVAAIAAFVGYIIMNKTM-----------------------GDFLQVTPKNVTDPASGYASILGIPTLQTGVFGGIIIGALAAWCYNKFYNINLPSYLGFFAGKRFVPIMMATTSFILAFPMALIWPTIQSGLNAFSTGLLDSNTGVAVFLFGFIKRLLIPFGLHHIFHAPFWF 238
>gi|196045935|ref|ZP_03113164.1| PTS system, glucose-specific IIABC component [Bacillus cereus 03BB108] >gi|196023375|gb|EDX62053.1| PTS system, glucose-specific IIABC component [Bacillus cereus 03BB108] (687 aa)
Score = 657, Expect = 3.1e-66, Identities = 174/462 (37%), Positives = 256/462 (55%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G +  GKY FM+ GLPAAA AM   A  EN+KLA  I  SA  TS LTGITEP+E++FLF+AP LF G+HA    L+F  M  +G+             IGM+FSGG+ID++++G +    G  AWW   + GL  A IY+F F F I+K+N++TPGR          +  N  +     G +E+      L   V+ A GG +NI ++DACIT+LR+Q+ +Q  V+  +L +LGA G ++    ++ A+FG ++D +K  I  +M              +  +   +     E  P+K           E   + SP  G+I+ + +VPD+ FS  MMG G A++PT G + SP++G++  VF T HA   ++E G +ILIH GID++ L  +       F   V  GD VK GQ +  V LA +K +A S ITPI+  N   +G++++ LKK G +KKG
  S:   279 LTAGTFTTGKYPFMMFGLPAAALAMYHEARPENKKLAAGILGSAALTSFLTGITEPLEFSFLFVAPVLF-GIHAVFAGLSFMTMQILGV------------KIGMTFSGGLIDFMLFGVLP---GRTAWWWVIVVGLVLAVIYYFGFRFAIRKWNLKTPGR----------EVANANDGA---GKAEAGE----LPREVLVALGGKENIASLDACITRLRVQVNEQKNVNKDRLKELGAAGVLEVG-NNIQAIFGPKSDTLKSQIHDIMSG------------RTPHVEKEEPVKVEEAPQK---------VDENETIVSPIEGKILPITEVPDQVFSGKMMGDGFAIEPTEGTVVSPVNGEIVNVFPTKHAIGIQSEGGKEILIHFGIDTVKLNGEG------FEALVAQGDKVKQGQPLLKVDLAFVKENAPSIITPIVFTNLQ-QGQQVE-LKKDGNVKKG 679
Score = 398, Expect = 3.2e-36, Identities = 99/252 (39%), Positives = 133/252 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQ--SVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+A+LP AGI LG G+A        V  A   +   +    ++  G+ +F  L LLFA+ +AI   G  G A LA F+GYLI         +   +   T +              G            Y  V+GI  LQ+ VFGG +VG + A+ YNK+ NI+L   +GFF G RFVPI T      V I+   +WP +   L TF  Q +     + +FIFG IER+L+PFGLHH FYSP W     YT A G +
  S:     9 LQKVGKALMLPVAILPAAGILLGFGNAFQNPQLTNVIPALKADWFVMVAKIMEQSGDIIFANLALLFAVGVAIGLAGGDGVAGLAAFVGYLIMNKTMSVFLEVDKLVKVTSS--------------GADPVKIGFTDPAYANVLGIPTLQTGVFGGIIVGIVAAYCYNKYFNIELPSYLGFFAGKRFVPIATATFSLVVGIIMCFVWPYIQGGLNTFSHQMIDANRTLAAFIFGLIERSLIPFGLHHIFYSPFWFEFGQYTNAAGEL 261
>gi|49481777|ref|YP_038110.1| PTS system, glucose-specific IIABC component [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52141443|ref|YP_085387.1| PTS system, glucose-specific IIABC component [Bacillus cereus E33L] >gi|166995620|ref|ZP_02262080.1| PTS system, glucose-specific IIABC component [Bacillus cereus AH820] >gi|196034966|ref|ZP_03102373.1| PTS system, glucose-specific IIABC component [Bacillus cereus W] >gi|49333333|gb|AAT63979.1| PTS system, glucose-specific IIABC component [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51974912|gb|AAU16462.1| PTS system, glucose-specific IIABC component [Bacillus cereus E33L] >gi|195992505|gb|EDX56466.1| PTS system, glucose-specific IIABC component [Bacillus cereus W] (687 aa)
Score = 657, Expect = 3.2e-66, Identities = 174/462 (37%), Positives = 259/462 (56%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G +  GKY FM+ GLPAAA AM   A  EN+KLA  I  SA  TS LTGITEP+E++FLF+AP LF G+HA    L+F  M  +G+             IGM+FSGG+ID++++G +    G  AWW   + GL  A IY+F F F I+K+N++TPGR          +  N  +     G +E+      L   V+ A GG +NI ++DACIT+LR+Q+ +Q  V+  +L +LGA G ++    ++ A+FG ++D +K  I  +M     +P+++ E    +  +     A+E                    + SP  G+I+ + +VPD+ FS  MMG G A++PT G + SP++G++  VF T HA   ++E G +ILIH GID++ L  +       F   V  GD VK GQ +  V LA +K +A S ITPI+  N   +G++++ LKK G +KKG
  S:   279 LTAGTFTTGKYPFMMFGLPAAALAMYHEARPENKKLAAGILGSAALTSFLTGITEPLEFSFLFVAPVLF-GIHAVFAGLSFMTMQILGV------------KIGMTFSGGLIDFMLFGVLP---GRTAWWWVIVVGLVLAVIYYFGFRFAIRKWNLKTPGR----------EVANANDGA---GKAEAGE----LPREVLVALGGKENIASLDACITRLRVQVNEQKNVNKDRLKELGAAGVLEVG-NNIQAIFGPKSDTLKSQIHDIMS--GRTPHVEKEEPVKVEEAPQKVDANET-------------------IVSPIEGKILPITEVPDQVFSGKMMGDGFAIEPTEGTVVSPVNGEIVNVFPTKHAIGIQSEGGKEILIHFGIDTVKLNGEG------FEALVAQGDKVKQGQPLLKVDLAFVKENAPSIITPIVFTNLQ-QGQQVE-LKKDGNVKKG 679
Score = 397, Expect = 3.8e-36, Identities = 99/252 (39%), Positives = 133/252 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQ--SVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+A+LP AGI LG G+A        V  A   +   +    ++  G+ +F  L LLFA+ +AI   G  G A LA F+GYLI         +   +   T +              G            Y  V+GI  LQ+ VFGG +VG + A+ YNK+ NI+L   +GFF G RFVPI T      V I+   +WP +   L TF  Q +     + +FIFG IER+L+PFGLHH FYSP W     YT A G +
  S:     9 LQKVGKALMLPVAILPAAGILLGFGNAFQNPQLTNVIPALKADWFVMVAKIMEQSGDIIFANLALLFAVGVAIGLAGGDGVAGLAAFVGYLIMNKTMSVFLEVDKLVKVTSS--------------GADPVKIGFTDPAYANVLGIPTLQTGVFGGIIVGIVAAYCYNKYFNIELPSYLGFFAGKRFVPIATATFSLVVGIIMCFVWPYIQGGLNTFSHQMIDANRTLAAFIFGLIERSLIPFGLHHIFYSPFWFEFGQYTNAAGEL 261
>gi|196038609|ref|ZP_03105917.1| PTS system, glucose-specific IIABC component [Bacillus cereus NVH0597-99] >gi|196030332|gb|EDX68931.1| PTS system, glucose-specific IIABC component [Bacillus cereus NVH0597-99] (687 aa)
Score = 656, Expect = 3.5e-66, Identities = 174/462 (37%), Positives = 259/462 (56%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G +  GKY FM+ GLPAAA AM   A  EN+KLA  I  SA  TS LTGITEP+E++FLF+AP LF G+HA    L+F  M  +G+             IGM+FSGG+ID++++G +    G  AWW   + GL  A IY+F F F I+K+N++TPGR          +  N  +     G +E+      L   V+ A GG +NI ++DACIT+LR+Q+ +Q  V+  +L +LGA G ++    ++ A+FG ++D +K  I  +M     +P+++ E    +  +     A+E                    + SP  G+I+ + +VPD+ FS  MMG G A++PT G + SP++G++  VF T HA   ++E G +ILIH GID++ L  +       F   V  GD VK GQ +  V LA +K +A S ITPI+  N   +G++++ LKK G +KKG
  S:   279 LTAGTFTTGKYPFMMFGLPAAALAMYHEARPENKKLAAGILGSAALTSFLTGITEPLEFSFLFVAPVLF-GIHAVFAGLSFMTMQILGV------------KIGMTFSGGLIDFMLFGVLP---GRTAWWWVIVVGLVLAVIYYFGFRFAIRKWNLKTPGR----------EVANANDGA---GKAEAGE----LPREVLVALGGKENIASLDACITRLRVQVNEQKNVNKDRLKELGAAGVLEVG-NNIQAIFGPKSDTLKSQIHDIMS--GRTPHVEKEEPVKVEEAPQKVDANET-------------------IVSPIEGKILPITEVPDQVFSGKMMGDGFAIEPTEGTVVSPVNGEIVNVFPTKHAIGIQSEGGKEILIHFGIDTVKLNGEG------FEALVAQGDKVKQGQPLLKVNLAFVKENAPSIITPIVFTNLQ-QGQQVE-LKKDGNVKKG 679
Score = 397, Expect = 4.2e-36, Identities = 99/252 (39%), Positives = 133/252 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQ--SVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+A+LP AGI LG G+A        V  A   +   +    ++  G+ +F  L LLFA+ +AI   G  G A LA F+GYLI         +   +   T +              G            Y  V+GI  LQ+ VFGG +VG + A+ YNK+ NI+L   +GFF G RFVPI T      V I+   +WP +   L TF  Q +     + +FIFG IER+L+PFGLHH FYSP W     YT A G +
  S:     9 LQKVGKALMLPVAILPAAGILLGFGNAFQNPQLTNVIPALKADWFVMVAKIMEQSGDIIFANLALLFAVGVAIGLAGGDGVAGLAAFVGYLIMNKTMSVFLEVDKLVKVTSS--------------GADPVKIGFTDPAYANVLGIPTLQTGVFGGIIVGIVAAYCYNKYFNIELPSYLGFFAGKRFVPIATATFSLVVGIIMCFVWPYIQGGLNTFSHQMIDANRTLAAFIFGLIERSLIPFGLHHIFYSPFWFEFGQYTNAAGEL 261
>gi|47565932|ref|ZP_00236971.1| PTS system glucose-specific IIABC component [Bacillus cereus G9241] >gi|47557212|gb|EAL15541.1| PTS system glucose-specific IIABC component [Bacillus cereus G9241] (687 aa)
Score = 656, Expect = 3.8e-66, Identities = 174/462 (37%), Positives = 255/462 (55%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G +  GKY FM+ GLPAAA AM   A  EN+KLA  I  SA  TS LTGITEP+E++FLF+AP LF G+HA    L+F  M  +G+             IGM+FSGG+ID++++G +    G  AWW   I GL  A IY+F F F I+K++++TPGR                N  +  G +E+      L   V+ A GG +NI ++DACIT+LR+Q+ +Q  V+  +L +LGA G ++    ++ A+FG ++D +K  I  +M              +  +   +     E  P+K           E   + SP  G+I+ + +VPD+ FS  MMG G A++PT G + SP++G++  VF T HA   ++E G +ILIH GID++ L  +       F   V  GD VK GQ +  V LA +K +A S ITPI+  N   +G++++ LKK G +KKG
  S:   279 LTAGTFTTGKYPFMMFGLPAAALAMYHEARPENKKLAAGILGSAALTSFLTGITEPLEFSFLFVAPVLF-GIHAVFAGLSFMTMQILGV------------KIGMTFSGGLIDFLLFGVLP---GRTAWWWVIIVGLVLAVIYYFGFRFAIRKWDLKTPGR-------------EVANANEGAGKAEAGE----LPREVLVALGGKENIASLDACITRLRVQVNEQKNVNKDRLKELGAAGVLEVG-NNIQAIFGPKSDTLKSQIHDIMSG------------RTPHVEKEEPVKVEEAPQK---------VDENETIVSPIEGKILPITEVPDQVFSGKMMGDGFAIEPTEGTVVSPVNGEIVNVFPTKHAIGIQSEGGKEILIHFGIDTVKLNGEG------FEALVAQGDKVKQGQPLLKVDLAFVKENAPSIITPIVFTNLQ-QGQQVE-LKKDGNVKKG 679
Score = 400, Expect = 1.8e-36, Identities = 100/252 (39%), Positives = 133/252 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQ--SVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+A+LP AGI LG G+A        V  A   +   +    ++  G+ +F  L LLFA+ +AI   G  G A LA F+GYLI         +   +   T +              G            Y  V+GI  LQ+ VFGG +VG + A+ YNK+ NI+L   +GFF G RFVPI T      V I+   +WP +   L TF  Q +     I +FIFG IER+L+PFGLHH FYSP W     YT A G +
  S:     9 LQKVGKALMLPVAILPAAGILLGFGNAFQNPQLTNVIPALKADWFVMVAKIMEQSGDIIFANLALLFAVGVAIGLAGGDGVAGLAAFVGYLIMNKTMSVFLEVDKLVKVTSS--------------GADPVKIGFTDPAYANVLGIPTLQTGVFGGIIVGIVAAYCYNKYFNIELPSYLGFFAGKRFVPIATATFSLIVGIIMCFVWPYIQGGLNTFSHQMIDANRTIAAFIFGLIERSLIPFGLHHIFYSPFWFEFGQYTNAAGEL 261
>gi|30264126|ref|NP_846503.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. Ames] >gi|47529562|ref|YP_020911.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. 'Ames Ancestor'] >gi|49186958|ref|YP_030210.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. Sterne] >gi|165871228|ref|ZP_02215878.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. A0488] >gi|167633618|ref|ZP_02391942.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. A0442] >gi|167639579|ref|ZP_02397850.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. A0193] >gi|170687148|ref|ZP_02878366.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. A0465] >gi|170705803|ref|ZP_02896266.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. A0389] >gi|177652640|ref|ZP_02935056.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. A0174] >gi|190566136|ref|ZP_03019055.1| PTS system, glucose-specific IIABC component [Bacillus anthracis Tsiankovskii-I] >gi|30258771|gb|AAP27989.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. Ames] >gi|47504710|gb|AAT33386.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. 'Ames Ancestor'] >gi|49180885|gb|AAT56261.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. Sterne] >gi|164713147|gb|EDR18674.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. A0488] >gi|167512638|gb|EDR88013.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. A0193] >gi|167531024|gb|EDR93711.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. A0442] >gi|170129343|gb|EDS98207.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. A0389] >gi|170668765|gb|EDT19510.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. A0465] >gi|172081975|gb|EDT67043.1| PTS system, glucose-specific IIABC component [Bacillus anthracis str. A0174] >gi|190563055|gb|EDV17021.1| PTS system, glucose-specific IIABC component [Bacillus anthracis Tsiankovskii-I] (687 aa)
Score = 655, Expect = 4.9e-66, Identities = 172/462 (37%), Positives = 257/462 (55%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G +  GKY FM+ GLPAAA AM   A  EN+KLA  I  SA  TS LTGITEP+E++FLF+AP LF G+HA    L+F  M  +G+             IGM+FSGG+ID++++G +    G  AWW   + GL  A IY+F F F I+K+N++TPGR          +  N  +     G +E+      L   V+ A GG +NI ++DACIT+LR+Q+ +Q  V+  +L +LGA G ++    ++ A+FG ++D +K  I  +M         ++ + +         +  +V   + +V              SP  G+I+ + +VPD+ FS  MMG G A++PT G + SP++G++  VF T HA   ++E G +ILIH GID++ L  +       F   V  GD VK GQ +  V LA +K +A S ITPI+  N   +G++++ LKK G +KKG
  S:   279 LTAGTFTTGKYPFMMFGLPAAALAMYHEARPENKKLAAGILGSAALTSFLTGITEPLEFSFLFVAPVLF-GIHAVFAGLSFMTMQILGV------------KIGMTFSGGLIDFMLFGVLP---GRTAWWWVIVVGLVLAVIYYFGFRFAIRKWNLKTPGR----------EVANANDGA---GKAEAGE----LPREVLVALGGKENIASLDACITRLRVQVNEQKNVNKDRLKELGAAGVLEVG-NNIQAIFGPKSDTLKSQIHDIMSG-------RTPHVEKEEPVKVEEALQKVDANETIV--------------SPIEGKILPITEVPDQVFSGKMMGDGFAIEPTEGTVVSPVNGEIVNVFPTKHAIGIQSEGGKEILIHFGIDTVKLNGEG------FEALVAQGDKVKQGQPLLKVDLAFVKENAPSIITPIVFTNLQ-QGQQVE-LKKDGNVKKG 679
Score = 397, Expect = 3.8e-36, Identities = 99/252 (39%), Positives = 133/252 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQ--SVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+A+LP AGI LG G+A        V  A   +   +    ++  G+ +F  L LLFA+ +AI   G  G A LA F+GYLI         +   +   T +              G            Y  V+GI  LQ+ VFGG +VG + A+ YNK+ NI+L   +GFF G RFVPI T      V I+   +WP +   L TF  Q +     + +FIFG IER+L+PFGLHH FYSP W     YT A G +
  S:     9 LQKVGKALMLPVAILPAAGILLGFGNAFQNPQLTNVIPALKADWFVMVAKIMEQSGDIIFANLALLFAVGVAIGLAGGDGVAGLAAFVGYLIMNKTMSVFLEVDKLVKVTSS--------------GADPVKIGFTDPAYANVLGIPTLQTGVFGGIIVGIVAAYCYNKYFNIELPSYLGFFAGKRFVPIATATFSLVVGIIMCFVWPYIQGGLNTFSHQMIDANRTLAAFIFGLIERSLIPFGLHHIFYSPFWFEFGQYTNAAGEL 261
>gi|154504494|ref|ZP_02041232.1| hypothetical protein RUMGNA_01998 [Ruminococcus gnavus ATCC 29149] >gi|153795269|gb|EDN77689.1| hypothetical protein RUMGNA_01998 [Ruminococcus gnavus ATCC 29149] (773 aa)
Score = 654, Expect = 6.0e-66, Identities = 169/464 (36%), Positives = 263/464 (56%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGEN---TRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSP---------NLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFEV 885
           +Y  G+++FMI GLP AA AM   A  E +K A  + +SA    +LTGITEP+E++FLF+AP LF  V   L   A+ + + + + V            G++FSGG +D+ ++G +Q    ++       G+ Y  +Y+ +F FLIKKF+ +TPGR ++   T+L+TK D   ++   +   +  +   D V A+ +    GG  NI +VD C T+LRI +KD   V    L Q G+RG +K   Q V  ++G    +IK N++  +E     P            SE E++      T+S+ E   EK+V        KE V+++SP TG  V L++VPDE F+  MMG G AV PT G I +P DG++  VF+T HA  F+T+    +L+H+GID++ L   +G+  + F   V+ G  VK G+ +  + ++ LK HA S  +P++   E  + ++++ LK+ GEIK G PLF V
  S:   330 RYFSGEFIFMIFGLPGAALAMYRCAKSEKKKAAGGLLLSAALACMLTGITEPLEFSFLFVAPALF-AVQVVLAGSAYMIAHMLNIAV------------GLTFSGGFLDFFLFGILQGNEKTSWMRVIPVGIIYFILYYVIFTFLIKKFDFKTPGREDDDTATKLYTKADVNARKESSKKGDAGAAA--DPVSAM-ITEGLGGKSNISDVDCCATRLRITVKDAGKVKDEILKQTGSRGIVKKG-QGVQVIYGPHVTVIKANLEDYLETAEDMPLGETTAFVEEAASEPEEV-----QTTSSKEQDSEKKV--------KETVIISSPITGNAVELSEVPDEGFAGKMMGDGAAVIPTDGMILAPEDGEVVFVFETKHALGFQTDSQMALLLHIGIDTVAL---NGQGFEVF---VENGQKVKKGEPLMKIDISYLKEHAPSLCSPVLC-TELGDNQKVRLLKE-GEIKAGEPLFAV 768
Score = 362, Expect = 4.4e-32, Identities = 99/305 (32%), Positives = 150/305 (49%)
  Q:    11 TSLKTYFSKLKFNSLFKKQGAGKEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNA-----------GGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFG-SLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATS 315
           T +K+    +K   +  ++    + K      + ++ +  MLPIA+LP+AG+ LG+GS+                G    L      +   G+AVF  LPL+FA+ +AI     +   +AL+  I Y +   ++   L  +   T    I  N+L  +G +                +V GI  LQ  VFGG +VG  VA L+N+F  I L   + FF G RFVPI++ +    V I    IWP V   +  LG  +  +  + + IFG I+RAL+PFGLHH FY P W T  GGS+++    +       +A LA S
  S:    18 TGMKSEILSIKIKCIKNREKEKWKMKDKIFGVLQRIGRSFMLPIAILPVAGLLLGIGSSFTNETTIATYGFQKILGDGTVLHALLTIMNKVGSAVFDNLPLIFAVGVAIGMAKKEKEVSALSALIAYFVMNVAINGMLVVNGEITADGEIAKNVL--EGTV---------------ASVCGIQSLQMGVFGGIIVGLGVAALHNRFHKIVLPNALSFFGGSRFVPIISTIVYMFVGIGMYFIWPPVQNGIYALGGLVTGSGYVGTLIFGIIKRALIPFGLHHVFYMPFWQTAVGGSMEVAGQMVQGGQNIFFAQLADS 318
>gi|27469020|ref|NP_765657.1| PTS enzyme II glucose-specific factor IIABC component [Staphylococcus epidermidis ATCC 12228] >gi|57865545|ref|YP_189670.1| PTS system, IIABC components [Staphylococcus epidermidis RP62A] >gi|17227118|gb|AAL38016.1|AF443793_1 EII-glucose permease GlcA [Staphylococcus epidermidis] >gi|27316569|gb|AAO05744.1|AE016751_39 PTS enzyme II glucose-specific factor IIABC component [Staphylococcus epidermidis ATCC 12228] >gi|57636203|gb|AAW52991.1| PTS system, IIABC components [Staphylococcus epidermidis RP62A] (675 aa)
Score = 654, Expect = 6.3e-66, Identities = 164/452 (36%), Positives = 260/452 (57%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVV---VNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKK 872
           G+++QG++  M+ GLPAAA A+   A  EN+K+   + +SA  TS LTGITEP+E++FLF+AP+LF  +HA L  L+F  +  + +            H+G +FSGG ID+++ G   I     AWW  I  G+ YA IY+F+F FLI KFN +TPGR            ++K++ V    +S+       L  +V+ A GG +NIK++DACIT+LR+++ ++S VD A L  LGA G ++    ++ A+FG ++D IK ++  ++                   S + +  SE   ++EV  +D  +  E +V   + +P  GEI+ L++VPD+ FS+ MMG GI   P +G+I +P DG +  +F T HA   E++ G ++LIH+GID++ L  +  + L      V T + V  GQ +  + L  LK HA S ITP+I+ N+  +   I+ +K+
  S:   271 GKFMQGEFPVMMFGLPAAALAIYQTAKPENKKVVAGLMISAALTSFLTGITEPLEFSFLFVAPFLFV-IHAVLDGLSFLTLYLLNV------------HLGYTFSGGFIDYVLLG---ILPNKTAWWLVIPVGIIYAVIYYFVFRFLIVKFNYKTPGR------------EDKKSSVTTTSASQ-------LPFDVLKAMGGKENIKHLDACITRLRVEVNEKSKVDVAGLKSLGASGVLEVG-NNMQAIFGPKSDQIKHDMAKII-------------------SGEITKPSETTIDEEV--SDDPVHVEDIVETEIYAPGHGEIIPLSEVPDKVFSEKMMGDGIGFVPDSGEIVAPFDGTVKTIFPTKHAIGLESDSGVEVLIHIGIDTVKLNGEGFESL------VNTDEPVTQGQPLMKIDLEYLKEHAPSIITPVIITNQEDKTLTIEDVKQ 664
Score = 389, Expect = 3.3e-35, Identities = 91/245 (37%), Positives = 133/245 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAG-------GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIV----TFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + ++ K LMLP+A+LP AG+ L +G+A    A         N+ ++   N L   G  +F  LP++FA+ +AI   G  G AA+A F+G++I      A      D                           P++ Y  V+GI  LQ+ VFGG ++G L A+ YNKF NI L   +GFF G RFVPI+    +F+  FP+ I    IWP +   L    + L  +  G+  F+FGFI+R L+PFGLHH F++P W+
  S:     9 MQRIGKALMLPVAILPAAGLLLAIGTAFQGEALQHYLPFIKNDIVQQIANMLTGAGGIIFDNLPIIFALGVAIGLAGGDGVAAIAAFVGFIILNKTMGAFLHVTPDKLSD-----------------------PTNGYANVLGIPTLQTGVFGGIIIGALAAWCYNKFYNITLPSYLGFFAGKRFVPIMMATTSFILAFPMAI----IWPTIQNGLNAFSEGLLDSNTGLAVFLFGFIKRLLIPFGLHHIFHAPFWF 238
>gi|150015637|ref|YP_001307891.1| PTS system, glucose subfamily, IIA subunit [Clostridium beijerinckii NCIMB 8052] >gi|149902102|gb|ABR32935.1| PTS system, glucose subfamily, IIA subunit [Clostridium beijerinckii NCIMB 8052] (712 aa)
Score = 654, Expect = 7.1e-66, Identities = 167/479 (34%), Positives = 263/479 (54%)
  Q:   407 LGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGEN--TRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSS--DTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFEV 885
           LGT G   F  V+  +++ GK+  MI GLP AA AM   A  E RK    + +SA  TS+LTGITEPIE+TFLF+AP L+ G+H  L  LA+ LM+ +G+             +GM+FSGG ID  ++G +Q    ++     I G+ Y  +Y+ LF FLIKK +++TPGR ++   +L+T+ D + K+N        ++ N D++ A+ +    GG +NI +VD C+T+LR  + +  +V+   L Q GA G        V  ++G    +IK N++   + + ++P+ +     I+   S  DT    E K + +V+ T        V++NSP TGE   L++VPDE F+  +MG G  V P+ G + +P DG +S VF + HA    T  G ++LIH+GID++ L  K+      F   V+ GD V+ G +I +  L  +K+   +I    +       ++++ L K+G+IK G  L  V
  S:   267 LGTPGITHFS-VSATRFMSGKFPLMIFGLPGAALAMYKCAKPEKRKAVGGLLLSAALTSMLTGITEPIEFTFLFVAPVLY-GIHCVLAGLAYMLMHMLGV------------GVGMTFSGGFIDLFLFGILQGNAKTSWILIVIVGIVYFVVYYLLFTFLIKKLDLKTPGREDSGEVKLYTRSDLEAKKN-------DQNENADELSAM-ICRGLGGKNNISDVDCCVTRLRCTVHNSELVNEGLLKQTGASGIFHKG-VGVQIMYGPRVTVIKSNLE---DYLVTAPDKEDTGYAIIKKESEKDTEKGIEKKVQGKVIST--------VILNSPLTGEAKDLSEVPDEVFASRIMGDGAVVVPSDGNVIAPADGVISFVFPSKHALGLTTTDGLELLIHIGIDTVKLDKKA------FETYVEEGDKVQAGDKILSFDLEFIKNNAPSIASPCICTALNSNQKVRLL-KTGDIKAGEALIAV 708
Score = 368, Expect = 9.1e-33, Identities = 99/279 (35%), Positives = 143/279 (51%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVT----NAGGNEGLRVFGNFLQV-------PGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLT 321
           + ++ +  MLPIA+LP+AG+FLG+G +       +  G  GL   G F+          GN VF  LPL+FAI +AI  +  +   AALA  I +LI  +           + GA+I             +  G  AL S     V+GI  LQ  VFGG +VG   A L+N++  I+L  ++ FF G RFVPI+  +    V IL   IWP V  A+  +G  +  +    ++++G +ER L+PFGLHH FY P W T  GG+  +    I       +A L T   T  +
  S:     9 LQRVGRSFMLPIAILPVAGLFLGIGESFTNKTMLDTYGITGLIGPGTFVNALLSVMNDAGNIVFENLPLIFAIGVAIGMSKKEREVAALAAGIAFLIMHA-----------SIGAMIK------------IHGGTEALLSGASTEVLGIISLQMGVFGGIIVGLGTAALHNRYYKIELPQVLSFFGGTRFVPIICSIVYLIVGILMFYIWPPVQGAIYKVGNIVLASSYAGTWVYGLMERLLIPFGLHHVFYLPFWQTAVGGTAQVGDKVIEGAQNIFFAELGTPGITHFS 276
>gi|164687231|ref|ZP_02211259.1| hypothetical protein CLOBAR_00872 [Clostridium bartlettii DSM 16795] >gi|164603655|gb|EDQ97120.1| hypothetical protein CLOBAR_00872 [Clostridium bartlettii DSM 16795] (715 aa)
Score = 653, Expect = 7.7e-66, Identities = 165/468 (35%), Positives = 260/468 (55%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIF-GLAYAPIYFFLFYFLIKKFNIQTPGRGEN----TRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAK-STITPIIVLNESLEGREIKFLKKSGEIKKGMPLFEV 885
           V   +++ GK+  MI GLP AA AM   A  E RK    + +SA  TS+LTGITEP+E+TFLF+AP L+  +H      A+ LM+ + +             +GM+FSGG+ID  ++G +Q      +W + +F G+AY  +Y+FLF FLIKKF+ +TPGR +N     +L+T+ D   K++     G++   N D  L+  ++   GG +N+ ++D CIT+LR+ +KD S V+   L   GA G IK     V  V+G +  +IK N    +EN  +S        K      + +  ++VK E+   +   ++  E  V+ +P  G  + L++V D  FS+ M+G GI ++P  G+  SP++G +S+VFDT HA    ++ G ++LIHVG+D++ L  +       +  +VK GD VKVG  +       ++ A   T+TPII+ N   E + +K L K GEI +   +  V
  S:   277 VEATRFMSGKFPLMIFGLPGAALAMYKCAKPEKRKAVGGLLLSAALTSMLTGITEPLEFTFLFVAPVLYV-IHCVFAGAAYMLMHMLNV------------GVGMTFSGGLIDLFLFGILQGN-AKTSWINIVFVGIAYFAVYYFLFSFLIKKFDFKTPGREDNDDAEVKLYTRADVNAKKDG---QGAASGTNADDELSALILQGLGGSENLTDLDCCITRLRLTVKDPSKVNEGMLKASGAAGVIKKG-NGVQVVYGPKVTVIKSN----LENFIAS-------GKAATVKVNETPQADVKKEEAKSEVKRDVKVENDVLYAPIKGRAIELSEVNDGVFSEGMLGKGIGIEPEEGRAVSPVNGTVSVVFDTKHAIGITSDDGVEVLIHVGLDTVQLNGQY------YTTHVKVGDKVKVGDLLVEFDKDKIQEAGYRTVTPIIISNTD-EFKNVKVLAK-GEINEKAEMISV 713
Score = 350, Expect = 1.1e-30, Identities = 89/279 (31%), Positives = 140/279 (50%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVT----NAGGNEGLRVFGNF-------LQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLT 321
           + ++ +  MLPIA+LP+AG+FLG+G +       N  G  G+   G F       L   GN VF  LP++FA+ +AI          +A   G L F  +  A+S  +                     +  G  ++ +     V+G+  LQ  VFGG +VG  V+ L+N+F  I+L  ++ FF G RFVPI++ L    V I     WP +   +  +G  +  +    ++++G +ERAL+PFGLHH FY P W T  GGS+++    I       +A L+  + T  +
  S:     9 LQRVGRSFMLPIAILPVAGLFLGIGGSFTNETMLNTYGLMGVMGPGTFIYSILTVLNAAGNVVFTNLPIIFAMGVAIGMAKQE--KEVAALSGALAFFIMHAAVSAMI--------------------AVHGGAESMLNGSTTDVLGMTSLQMGVFGGIIVGLGVSALHNRFYKIELPQVLSFFGGTRFVPIISALVYLVVGIAMFYAWPPIQNVIYSVGDVVRGSGYAGTWLYGVMERALIPFGLHHVFYLPFWQTGVGGSMEVAGKVIEGAQNIFFAQLSDPSVTHFS 276
>gi|154484729|ref|ZP_02027177.1| hypothetical protein EUBVEN_02446 [Eubacterium ventriosum ATCC 27560] >gi|149734577|gb|EDM50494.1| hypothetical protein EUBVEN_02446 [Eubacterium ventriosum ATCC 27560] (718 aa)
Score = 652, Expect = 1.0e-65, Identities = 161/469 (34%), Positives = 257/469 (54%)
  Q:   417 GVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGR--GENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLK-----SEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFEV 885
            V+  +++ GK+  MI GLP AA AM   A  E +K    + +SA  TS++TGITEP+E+TFLF+AP L +G+H     LA+ LM+     V   G       +GM+FSGG+ID  ++G +Q    +N  W  I G+ Y  +Y+FLF FLIKK +++TPGR   E  +L+ + D + K+N    NG +  ++    L+  + +  GG  NI +VD C T+LR  +    +V+   L   GA G +      V  ++G +  +IK N++  +E   ++PN++     S+ +++ N + D ++  E   E ++VK+        ++++SP TG    L   PDE F+  MMG G  V PT   + +P DG++  VFDT HA  F TE G  ++IHVGID++ L  +       F   V+ G  VK G  I  + L  L     ++   ++  E  + ++I+ LK+ G+I+ G  LF +
  S:   276 AVSATRFMSGKFPLMIFGLPGAALAMYRTANPEKKKAVAGLLLSAALTSMITGITEPLEFTFLFVAP-LLYGIHCVFAGLAYMLMH-----VFKVG-------VGMTFSGGLIDMFLFGIMQGNGKTNWIWIVIVGIVYFIVYYFLFSFLIKKLDLKTPGRDDSEEVKLYRRSDVEAKKNGKSENGENSDVDE---LSEMITNGLGGKKNISDVDCCATRLRCTVFKAELVNDGMLKATGASGVVHKG-NGVQVIYGPKVTVIKSNLEDYLE---TAPNIEYNGSNSQSDEVENKTEDGNNQKE--QETKIVKS--------IIISSPITGIAADLGTAPDEAFASRMMGDGAVVTPTDSVVKAPADGEIVFVFDTKHAVGFTTEDGISMIIHVGIDTVKLNGEG------FDVMVEAGQKVKKGDPIMKLDLDYLSANAPSLASPVMCTELSDNQKIRLLKE-GDIQAGESLFAI 714
Score = 348, Expect = 1.9e-30, Identities = 93/278 (33%), Positives = 137/278 (49%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVT----NAGGNEGL----RVFGNFLQV---PGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSL 320
           + ++ +  MLPIA+LP+AG+ LG+GS+        A G  G+     VF    QV    GN VF  LP++FA+ +AI                  +           +  + GA+I  N             G   +       V+GI  LQ  VFGG +VG  VA L+NKF  I+L  ++ FF G RFVPI+  L    V IL   IWP++   +  +G  +  +    ++++GF+ER L+PFGLHH FY P W T  GG++++    I       +A LA  + T  
  S:     9 LQRVGRSFMLPIAILPVAGLLLGLGSSFTNETMLKAYGLLGIMGPGTVFNAIFQVMSDAGNIVFTNLPIIFAMGVAIGMAKKEKE----------VAALAAAIAFFIMHASIGAMITIN------------GGAEKMLEGATTDVVGITSLQMGVFGGIIVGLGVAALHNKFYKIELPQVLSFFGGTRFVPIICSLVFTLVGILMFFIWPVIQSGIYSVGDLVLNSGYAGTWVYGFMERLLIPFGLHHVFYLPFWQTGVGGTMEVGGQLIEGAQNIFFAQLADPSVTKF 275
>gi|56961976|ref|YP_173698.1| PTS system, glucose-specific enzyme II, ABC component [Bacillus clausii KSM-K16] >gi|56908210|dbj|BAD62737.1| ABC component PTS system glucose-specific enzyme II [Bacillus clausii KSM-K16] (681 aa)
Score = 652, Expect = 1.0e-65, Identities = 160/442 (36%), Positives = 243/442 (54%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           +  G ++ G++   + GLPAAA AM   A  E +KL   +  SA  TS LTGITEPIE+TFLF+AP LF  +HA L  L+F LM    +            H+G +FSGG ID+ ++G   I      WW + + GL +A IY+ +F F I+KFN+ TPGR  +T      DYK K    ++ G              V+ A GG DNI ++DACIT+LR+ + D   V+  +L  LGA G ++    ++ A+FG  ++ +KG I+ +M   +  P LK            T+   EV  + E ++ D+ +++   +  +P  G ++ LA+VPD+ FS+ MMG G A+ P  G +YSP++GK++ VF T HA    T  G ++LIH+GID++ L+ +       F   V+ GD +  G ++    L  ++ HA STITP++  N
  S:   266 LTAGHFMAGEFPIFMFGLPAAALAMYHCAKPEKKKLVAGLFASAALTSFLTGITEPIEFTFLFIAPVLFV-LHAILDGLSFVLMTLFDV------------HVGFTFSGGAIDFFLFG---ILPNEEQWWITILIGLVFAAIYYVVFRFAIQKFNLMTPGRENDT----ANDYKGKGKTGELAG-------------QVLQAMGGKDNIAHLDACITRLRVSVNDIKAVNKDELKALGAAGVLEVG-NNIQAIFGPRSETLKGQIQDVMAGKTPRP-LK------------TNQQEEVSEQLEEIQPDALMNEGAFL--APMAGTLMPLAEVPDQVFSEKMMGDGFAIDPEDGMVYSPVEGKVTTVFPTKHAIGLTTSTGMEVLIHIGIDTVKLQGEG------FDVLVEEGDQISEGDKLAEFDLDYIRNHAASTITPVVFTN 654
Score = 348, Expect = 1.8e-30, Identities = 93/252 (36%), Positives = 140/252 (55%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNE-------GLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+AMLP+AG+ LG+G+A+      N         ++     ++  G  +F  L L+FA+ +AI   GD   A  A              +   V +T             G   G+SA   A   S +  ++GI+ LQ+ VFGG +VG + A+ YN+F +I++   +GFF G RFVPI+T +A F + +L L++WP +   L +F    LG ++ +  F+FGFI R L+PFGLHH F++P W     YT A G I
  S:     9 LQKIGKALMLPVAMLPVAGLLLGIGAALQMENTLNYMPFLEAGWIQHTAGVMEAAGGVIFDNLSLIFAVGVAIGLAGDGAAALAA-------------LVGYLVMNTV-----------MGQWLGVSAEMVAEDPS-FANILGIDTLQTGVFGGIIVGLIAAYCYNRFYDIEMPAFLGFFAGKRFVPIITAVATFLMALLLLVVWPPIQHGLNSFSEFLLGSSLYVAVFLFGFIRRLLIPFGLHHIFHAPFWYEFGSYTNAAGEI 248
>gi|239421|gb|AAA06088.1| glucose permease [Bacillus subtilis] (451 aa)
Score = 651, Expect = 1.4e-65, Identities = 172/461 (37%), Positives = 253/461 (54%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTD---SELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKK 878
           +  G ++ GKY FM+ GLPAAA A+   A  +N+KL   I  SA  TS LTGITEP+E++FLF+AP LF  +H     L+F +M  + +             IGM+FSGG+ID+ ++G +       AWW  I  GL  A IY+F F F I+KFN++TPGR         ED   +       G +  L         ++ A G  +NIK++DACIT+LR+ + DQ  VD  +L QLGA G ++    ++ A+FG  +D     +KT M++I +    + E          TS+  EV  + E V  +   +E+ +E  V  SP TGEI  +  VPD+ FS  MMG G A+ P+ G + SP+ GK+  VF T HA   +++ G +ILIH GID+++LK +       F   V  GD V+ GQ++  V L  +K +  S +TPI+  N + EG  +  +K SG + +
  S:    30 LTAGTFMTGKYPFMMFGLPAAALAIYHEAKPQNKKLVAGIMGSAALTSFLTGITEPLEFSFLFVAPVLF-AIHCLFAGLSFMVMQLLNV------------KIGMTFSGGLIDYFLFGILP---NRTAWWLVIPVGLGLAVIYYFGFRFAIRKFNLKTPGR---------EDAAEETAAPGKTGEAGDL------PYEILQAMGDQENIKHLDACITRLRVTVNDQKKVDKDRLKQLGASGVLEVG-NNIQAIFGPRSD----GLKTQMQDIIAGRKPRPE--------PKTSAQEEVGQQVEEVIAEPLQNEIGEEVFV--SPITGEIHPITDVPDQVFSGKMMGDGFAILPSEGIVVSPVRGKILNVFPTKHAIGLQSDGGREILIHFGIDTVSLKGEG------FTSFVSEGDRVEPGQKLLEVDLDAVKPNVPSLMTPIVFTNLA-EGETVS-IKASGSVNR 441
>gi|170759087|ref|YP_001786717.1| PTS system, glucose-specific, IIABC component [Clostridium botulinum A3 str. Loch Maree] >gi|169406076|gb|ACA54487.1| PTS system, glucose-specific, IIABC component [Clostridium botulinum A3 str. Loch Maree] (676 aa)
Score = 648, Expect = 2.8e-65, Identities = 176/480 (36%), Positives = 261/480 (54%)
  Q:   400 LTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLN--NDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           + +G QA+          +  G ++ GK+ FM+ GLPAAA A+   A  E +KL   I  SA  TS LTGITEPIE++FLF+AP LF G+H     L+F +M  + +             IGM+FSGG+ID++I+G +        WW  I  GLA++ IY+F F F I+K+N++TPGR         ED          +  SES+N  ++  LA  V+ A GG +N+ N+DACIT+LR+ +     V+  +L  LGA G +     ++ A+FG ++D +K  IK ++     + ++K E                 +P+KE VK  S   K+K V  +P  G+I+S+  VPDE FS+ MMG G A++P  G + SP+DG ++ VF T HA     E G ++LIH GID++NLK +  + L      VK GD +    E+   K+ D     S ITPII  N + E +E++ +K    +K G
  S:   250 VINGDQAIFFQQIKDHAPLTAGTFMTGKFPFMMFGLPAAALAIYQEAKPEKKKLVGGIMASAALTSFLTGITEPIEFSFLFVAPVLF-GIHCIFAGLSFMVMQILNI------------KIGMTFSGGVIDFLIFGVVP---NRTKWWLVIPVGLAFSVIYYFGFRFAIRKWNLKTPGR---------ED----------DAGSESVNYSSEGSLAAKVLEALGGKENLANLDACITRLRVSVNSIDKVNKEELKSLGASGVMVVG-NNIQAIFGPKSDQLKEQIKDVISGKIITKDVKIE-----------------EPKKETVKVSS---KDKFV--APIEGKILSITDVPDEVFSQKMMGDGFAIEPKNGTVVSPVDGVITTVFPTKHAIGITAENGLELLIHFGIDTVNLKGEGLEALVEQDAKVKAGDPI---LEVDIDKIKD--KVPSIITPIIFTNLT-EDQELEIVKLGDHVKAG 668
Score = 408, Expect = 2.2e-37, Identities = 103/274 (37%), Positives = 150/274 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY------TQAGGSIDLTQNAIIYQDGKAYAVLATST 316
           + ++ K LMLP+A+LP AGI L  G+         +  A G+ G + F   ++  GN +F  L LLFA+ +A+      G AALA  +G+LI  +           T G V+G            ++ G        + +V+GI  LQ+ VFGG ++G + A LY K+ NI+L   +GFF G RFVPI+T      V ++ ++IWP +   L +F    +     + +FIFG IERAL+PFGLHH FY+P WY       +AG  I+  Q AI +Q  K +A L   T
  S:     9 LQQVGKALMLPVALLPAAGILLAFGNMFQNPDFLKLAPAFGSTGFQAFARVMEQSGNIIFANLALLFAVGVAVGLAAGEGVAALAAIVGFLIMNT-----------TMGLVVG------------VTPGLIGRSHPEFASVLGIPTLQTGVFGGIIMGIIAASLYKKYYNIELPSYLGFFAGKRFVPIITAAVAIIVGLIMVVIWPPIQHGLNSFSHNMIDANRTLAAFIFGVIERALIPFGLHHIFYNPFWYQFGEYINKAGQVINGDQ-AIFFQQIKDHAPLTAGT 272
>gi|154685799|ref|YP_001420960.1| hypothetical protein RBAM_013660 [Bacillus amyloliquefaciens FZB42] >gi|154351650|gb|ABS73729.1| PtsG [Bacillus amyloliquefaciens FZB42] (698 aa)
Score = 645, Expect = 7.2e-65, Identities = 171/461 (37%), Positives = 250/461 (54%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKE-KVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKK 878
           +  G ++ GKY FM+ GLPAAA A+   A  E +KL   I  SA  TS LTGITEP+E++FLF+AP LF  +H     L+F +M  + +             IGM+FSGG+ID+ ++G +       AWW  I  GL  A IY+F F F I+KFN++TPGR E             +   +  G+S    +   L   ++ A G  +NIK++DACIT+LR+ + DQ  VD A+L QLGA G ++    ++ A+FG  +D +K  ++ ++   +  P  K             S+  EV  + E V  D   +++ + V  SP TGEI  +  VPD+ FS  MMG G A+ P  G + SP+ GK+  VF T HA   +++ G +ILIH GID+++LK +       F   V  GD V+ GQ++  V L  +K H  S +TPI+  N + EG  I  L   G +K+
  S:   278 LTAGTFMTGKYPFMMFGLPAAALAIYHEAKPEKKKLVAGIMGSAALTSFLTGITEPLEFSFLFVAPILF-AIHCVFAGLSFMVMQLLHV------------KIGMTFSGGLIDYFLFGILP---NRTAWWLVIPVGLGLAVIYYFGFRFAIRKFNLKTPGREE-------------EAADEGAGASGEAGD---LPYEILQAMGDQENIKHLDACITRLRVTVNDQKKVDKARLKQLGASGVLEVG-NNIQAIFGPRSDGLKTQMQDIIAGRTPRPEPK------------VSAQEEVSQQVEEVIADPLRNEQGEEVFASPITGEIHPITDVPDQVFSGKMMGDGFAILPEEGIVVSPVRGKVLNVFPTKHAIGLQSDGGREILIHFGIDTVSLKGEG------FTSFVSEGDRVEPGQKLLEVDLEAVKPHVPSLMTPIVFTNLA-EGEAIS-LSAEGTVKR 688
Score = 403, Expect = 8.2e-37, Identities = 94/245 (38%), Positives = 138/245 (56%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + K+ + LMLP+A+LP AGI L +G+A+       V +   N+ +++  N ++  G  VF  LPLLFA+ +AI      G A +A  IGYL+      A+  +        I     F + +           P+  Y  ++GI  L + VFGG +VG L A L+NKF  I+L   +GFF G RFVPI+T ++   + ++ L+IWP +   L      L +A   + +FIFG IER+L+PFGLHH FYSP WY
  S:     9 LQKIGRALMLPVAILPAAGILLALGNAMQNKDMIQVMHFLSNDNVQLVANVMESAGQIVFDNLPLLFAVGVAIGLANGDGVAGIAAIIGYLVMNVSMSAVLMANGSIPSDKIERAKFFAENH-----------PA--YINMLGIPTLATGVFGGIIVGVLAALLFNKFYKIELPQYLGFFAGKRFVPIITSISALILGLIMLVIWPPIQHGLNSFSTGLVEANPTLAAFIFGMIERSLIPFGLHHIFYSPFWY 248
>gi|125718608|ref|YP_001035741.1| PTS system glucose-specific EIIC BA component (EIICBA-Glc) (EII- Glc/EIII-Glc), putative [Streptococcus sanguinis SK36] >gi|125498525|gb|ABN45191.1| PTS system glucose-specific EIIC BA component (EIICBA-Glc) (EII- Glc/EIII-Glc), putative [Streptococcus sanguinis SK36] (730 aa)
Score = 644, Expect = 8.1e-65, Identities = 236/821 (28%), Positives = 377/821 (45%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGY--NLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLG----QALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGM-IDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQL-GARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEV--KPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNES 861
           EF  K  K LM+ +A++P AG+ + +G +I         L   G  L+  G  V G L +LFA+AI  ++  +    A A  + +++   +           TG + G   ++L  +  +     G +   S  + +V+    L   VF G + GF+ A  YNK+ N  KL   + FFNG RFVP V  L    V I+   +WP+V   +   G     +   A  +  FI+G +ER L+PFGLHH    P+ YT+ GG                Y V+  S A +                    + AG   +W     +L+G            T SA   TY                         Q  L T+    FK   VGQ +     F IL   AAA    + A K+++   M I  +    + LTG+TEPIEY F+F+A  L+  ++A +   AF + + + L V + G  E      M+ + G+ +D I +           W + +FG+    + + +  F+IKKFN  TPGR  N   +   D  ++ +  +  G   +   +   A+NV++  GG  NI +VDAC+T+LR+ +KD   V T +  +  GA G +    Q V A++G +AD++K +I+ L+++    P       + + +    S+A+EV  K   E V+T ++             G+++ LA V D  FS+ MMG G AV+P  GKIYSP+ G ++ VF + HA    T+ G ++L+H+G+++++L      E KPF  +V  G  V  G  + T  L  +K A    + I+V   +
  S:    13 EFWQKFGKALMVVVAVMPAAGLMISIGKSIPMINPNLGVLVTIGGVLEQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLSFILINRI-----------TGVMFGVTSDMLSDKAAVVKTMFGASIKVSDYFISVLESPALNMGVFVGIIAGFVGATAYNKYYNFRKLPDALSFFNGKRFVPFVVILRSVIVAIVLSFVWPVVQSGINSFGIWIANSQDTAPVLAPFIYGTLERLLLPFGLHHMLTIPMNYTELGG---------------VYHVITGSGAGT--------------------TVAGQDPLWLAWVTDLVG------------TKSADPSTY-------------------------QHLLDTVHPARFK---VGQMIGS---FGILMGVAAAIYHNVDADKKHKYKGMMI--ATALATFLTGVTEPIEYMFMFVATPLYI-IYAFVQGAAFAMADIVNLRVHSFGSIEFLTRTPMAINAGLGMDIINF----------IWVTILFGV----VMYLISNFMIKKFNYATPGRNGN---YETADGSDEASSSESTGGKVA---EASQAVNVINLLGGRANIVDVDACMTRLRVTVKDAEKVGTEEQWKAEGAMGLVMKG-QGVQAIYGPKADVLKSDIQDLLDSGEVIP-------ETLPSQKAESAAAEVTYKGVTEEVETVAD-------------GQVIDLADVKDPVFSQKMMGDGFAVEPENGKIYSPVAGTVTSVFPSKHAIGLVTDNGLEVLVHIGLETVSL------EGKPFEVHVSEGQKVAAGDLLVTADLEAIKEAGRETSTIVVFTNA 705
>gi|160895403|ref|ZP_02076173.1| hypothetical protein CLOL250_02961 [Clostridium sp. L2-50] >gi|156862974|gb|EDO56405.1| hypothetical protein CLOL250_02961 [Clostridium sp. L2-50] (734 aa)
Score = 644, Expect = 1.0e-64, Identities = 164/469 (34%), Positives = 253/469 (53%)
  Q:   417 GVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGEN--TRLFTKEDYKNKQNKVQINGSSESLNNDQVLALN------------VVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFEV 885
            V+  +++ GK+  MI GLP AA AM   A  E RK A  + +SA  T+++TGITEP+E+TFLF+AP L+ G+H  L   A+ LM+     V   G       +GM+FSGG+ID  ++G +Q    +N  W  I G+ Y  +Y+ LFY LI++F+++TPGR  N   +L+ + D   +++    N   +  +ND+ + +             +    GG  NI +VD C T+LR  + D ++V    L   GA G +K     V  ++G +  +IK N++  +E       +  E         D  +  E        +    +    V + SP TGE+  L+ VPDE FS  MMG GIAV PT  +I +P+ G ++ VFDT HA    TE+G  ++IH+GID++ L  K       F   V+TG  V  GQ +  + L  L KHA S I+P+I+  E  +G +++ + K+G++K    L  V
  S:   276 AVSATRFMSGKFPLMIFGLPGAALAMYKTAAPEKRKAAGGLLLSAALTAMITGITEPLEFTFLFVAPALY-GIHCILAGFAYMLMH-----VFEVG-------VGMTFSGGLIDLTLFGIMQGNAKTNWIWIVIVGIGYFIVYYVLFYHLIRRFDLKTPGRDNNDEVKLYRRSDMDARKHGE--NAGEQGSDNDRNMDVFRNHSPQMETSRLICEGLGGKANISDVDCCATRLRCTVYDAALVKEDVLRASGASGVVKKG-YGVQVIYGPKVSVIKSNLEDYLEGYDEKVVIADEGRP----REDVIAGKEKNGRNARNRQKKHMDDNTVSILSPVTGEVFELSSVPDEAFSSGMMGDGIAVLPTDPEITAPVAGTIAFVFDTKHAIGLVTEQGIGVMIHIGIDTVKLNGKG------FDVLVETGQIVSAGQPVMRLDLPYLKKHAPSLISPVII-TELPDGYKLRPV-KTGKVKNDEELLVV 731
Score = 374, Expect = 1.8e-33, Identities = 94/276 (34%), Positives = 145/276 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEG---LRVFG---------NFLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTAT 318
           + ++ +  MLPIA+LP+AG+ LG+GS+  TN    E    +R+ G           +   GN VF  LP+LFA+ +AI     +   AAL+  I + I  +  +AL                         ++ G  A+ +    +V GI  LQ  VFGG +VG  VA L+N+F  I+L  ++ FF G RFVPI++ L    V IL   IWP +   +  +G  +  +    ++++GF+ER L+PFGLHH FY P W T  GG++++    +       +A LA  + T
  S:     9 LQRVGRSFMLPIAILPVAGLLLGIGSSF-TNETMLETYGLMRILGPGTIFAAVFEVMSEAGNVVFANLPILFAMGVAIGMAKKEKEVAALSAAIAFFIMHASINAL-----------------------ITINGGTEAMLAGAVTSVCGITSLQMGVFGGILVGLGVAALHNRFYKIELPQVLSFFGGSRFVPIISALVYTGVGILMFFIWPAIQKGIYTIGDLVLNSGYAGTWVYGFMERLLIPFGLHHVFYLPFWQTAVGGTLEVGGRVVEGAQNIFFAQLADPSVT 273
>gi|89101234|ref|ZP_01174059.1| PtsG [Bacillus sp. NRRL B-14911] >gi|89084049|gb|EAR63225.1| PtsG [Bacillus sp. NRRL B-14911] (702 aa)
Score = 643, Expect = 1.1e-64, Identities = 170/459 (37%), Positives = 250/459 (54%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEI 876
           ++ G ++ GK+ FM+ GLPAAA A+   A  E + +   +  SA  TS LTGITEP+E++FLF+AP LF G+HA    L+F  M+ + +             IGM+FSGG+ID+I++G I  Q  +NAW     G+ +A IY+F F F I+KFN++TPGR              +  + +     E+   D  L   ++ A GG +NI ++DACIT+LR+ + D   VD  +L +LGA G ++    ++ A+FG  ++ IKG +K +M      P  K+  + +           EV PE       +E   E V V SP  GEI  + +VPD  FS  MMG G A+ P+ G I SP+DGK+  +F T HA    ++ G +ILIHVGID++NLK +       F   VK  D V+ GQ +  V L  +K +A S +TPI+  N  L   E   + K+G +
  S:   282 LSAGTFMTGKFPFMMFGLPAAALAIYHEARPERKAIVGGLMASAALTSFLTGITEPLEFSFLFVAPVLF-GIHAIFAGLSFMTMHLLDV------------KIGMTFSGGLIDYILFGLINPQ--TNAWIVIPVGIVFAVIYYFGFRFAIRKFNLKTPGR--------------EDVEEEDVAEGENKGGD--LPYQILEAMGGQENISHLDACITRLRVSVNDIKDVDKNRLKKLGASGVLEVG-NNIQAIFGPRSETIKGQMKDIMTGKKPRPAEKAPEKGV------EQQIEEVNPEA----LQTEHKGEDVFV-SPIKGEIKPITEVPDAVFSGKMMGDGFAIVPSEGTIVSPVDGKIVNLFPTKHALGLLSDSGREILIHVGIDTVNLKGQG------FETLVKENDRVEKGQPLLKVDLDFVKENAPSIMTPIVFTN--LAEGEAVVINKTGSV 690
Score = 426, Expect = 1.8e-39, Identities = 106/253 (41%), Positives = 142/253 (56%)
  Q:    35 KKGNTKEF------IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAG-------GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           KKG    F      + K+ K LMLP+A+LP AGI L  G+A+   A         N G+ +  + ++  GN VF  L LLFA+ +A+   G  G AALA  IGYLI              T G V+G      +G             S  Y  V+GI  LQ+ VFGG +VG L A +YNKF  I+L   +GFF G RFVPI T  +   + +L ++IWP +  AL    Q +  A + +++F+FG IER+L+PFGLHH FYSP WY
  S:     9 KKGGIHMFKKAFGVLQKVGKALMLPVALLPAAGILLAFGNALQNPALLDLAPFLENGGVEMVASVMENAGNIVFSNLALLFAVGVAVGLAGGEGVAALAAIIGYLIMNV-----------TMGTVLGIEAKDLEG-------------SMEYANVLGIPTLQTGVFGGIIVGILAASMYNKFFEIELPSYLGFFAGKRFVPIATAASAVVLGLLMIIIWPPIQSALNAFSQNMVHANLTLSAFVFGVIERSLIPFGLHHIFYSPFWY 251
>gi|73661645|ref|YP_300426.1| glucose-specific PTS transporter protein IIABC component [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72494160|dbj|BAE17481.1| glucose-specific PTS transporter protein IIABC component [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (662 aa)
Score = 642, Expect = 1.4e-64, Identities = 161/450 (35%), Positives = 255/450 (56%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREI 867
           +  G+++QG++  M+ GLPAAA A+   A  EN+K+   +  SA  TS LTGITEP+E++FLF+AP LF+ VHA L  L+F ++  + +            H+G +FSGG ID+++ G +        WW  I  G+ YA IY+F+F FLI KF  +TPGR            ++KQ +   + +SE       L  NV+ A GG +NIK++DACIT+LR+++K++  VD A L  LGA G ++    ++ A+FG ++D IK ++  +M+   + P   +  E+          ASEV                   + +P  G+++ L++VPD+ F++ MMG G+   P  GKI +P DG +  +F T HA   E+++G ++LIH+GID++ L   +G+  + F   V+T D V  GQ +  + L  +  HA ST+TP+I+ N  LE R++
  S:   252 LTAGKFMQGEFPVMMFGLPAAALAIYHTAKPENKKVVAGLMGSAALTSFLTGITEPLEFSFLFVAPVLFF-VHAILDGLSFLILYLLNV------------HLGYTFSGGFIDYVLLGVLP---NKTQWWLVIPVGVVYAFIYYFVFRFLILKFKYKTPGR------------EDKQAQFTNSSASE-------LPFNVLKAMGGEENIKHLDACITRLRVEVKEKGKVDVAGLKALGASGVLEVG-NNMQAIFGPKSDQIKHDMSLIMKGEITKPQETTVTEEESEEVVHIERASEVN------------------IYAPGNGQVIPLSEVPDQVFAQKMMGDGVGFIPADGKIVAPFDGTVKTIFPTKHAIGLESDQGLELLIHIGIDTVKL---NGEGFESF---VETDDRVHKGQVLMQIDLDYITAHAPSTVTPLIITN--LEDRQL 641
Score = 373, Expect = 2.2e-33, Identities = 87/237 (36%), Positives = 128/237 (54%)
  Q:    51 MLPIAMLPIAGIFLGVGSAIVTNAGG-------NEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           MLP+A+LP AG+ L +G+A+   +         N G++     +   G  +F  LP++FA+ +AI      G AA+A F+GYL+           +  T GA +             +S  N    +S Y +V+GI  LQ+ VFGG ++G L A+ YNKF NI L   +GFF G RFVPI+     F +      IWP +   L    + L  +  G+  F+FGFI+R L+PFGLHH F++P W+
  S:     1 MLPVAILPAAGLLLAIGTAMQGESLQHYLPFIQNGGIQSVAEMMTGAGGIIFDNLPMIFAMGVAIGLASGDGVAAIAAFVGYLV-----------MNKTMGAFLH------------VSPDNVNDAASGYASVLGIPTLQTGVFGGIIIGALAAWCYNKFYNISLPSYLGFFAGKRFVPIMMATTSFILAFPMAWIWPSIQTGLNAFSEGLLDSNTGLAVFLFGFIKRLLIPFGLHHIFHAPFWF 222
>gi|82749899|ref|YP_415640.1| phosphotransferase system enzyme II glucose-specific factor IIA [Staphylococcus aureus RF122] >gi|82655430|emb|CAI79817.1| phosphotransferase system enzyme II glucose-specific factor IIA [Staphylococcus aureus RF122] (681 aa)
Score = 639, Expect = 3.6e-64, Identities = 170/467 (36%), Positives = 259/467 (55%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNS--SDTSSASEVKPEKEVVKTDSELSKE-KVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFE 884
           +  G+++QG++  M+ GLPAAA A+   A  EN+K+   +  SA  TS LTGITEP+E++FLF+AP LF+ +HA L  L+F  +              L  H+G +FSGG ID+ + G   I      WW  I  GL YA IY+F+F FLI K   +TPGR            ++KQ++     ++E       L   V+ A GG  NIK++DACIT+LR+++ D+S VD   L  LGA G ++    ++ A+FG ++D                  +K E ++IMN     + ++  + K E  VV  D   + E   +V++P TGE+  L++VPD+ FS+ MMG GIA+KP+ G++ +P +GK+ ++F T HA    ++ G ++LIH+G+D++ L  +       F  +V+ G  VK G  +    L  + KHAKS ITPIIV   ++   + K   + G I  G  LFE
  S:   268 LTAGKFMQGEFPVMMFGLPAAALAIYHTAKPENKKVVAGLMGSAALTSFLTGITEPLEFSFLFVAPLLFF-IHAVLDGLSFLTLY------------LLDLHLGYTFSGGFIDYFLLG---ILPNKTQWWLVIPVGLVYAVIYYFVFRFLIVKLKYKTPGR------------EDKQSQAATASATE-------LPYAVLEAMGGKANIKHLDACITRLRVEVNDKSKVDVPGLKDLGASGVLEVG-NNMQAIFGPKSD-----------------QIKHEMQQIMNGQVVENPTTMEDDKDETVVVAEDKSATSELSHIVHAPLTGEVTPLSEVPDQVFSEKMMGDGIAIKPSQGEVRAPFNGKVQMIFPTKHAIGLVSDSGLELLIHIGLDTVKLNGEG------FTLHVEEGQEVKQGDLLINFDLDYIRKHAKSDITPIIVTQGNITNLDFK-QGEHGNISFGDQLFE 679
Score = 406, Expect = 3.6e-37, Identities = 89/245 (36%), Positives = 132/245 (53%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGG-------NEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + ++ K LMLP+A+LP AG+ L +G+A+   A         N G++     +   G  +F  LP++FA+ +AI   G  G AA+A F+GY+I                            G+   ++  N   P+S Y +++GI  LQ+ VFGG ++G L A+ YNKF NI L   +GFF G RFVPI+     F +     +IWP +   L  F    L    G+  F+FGFI+R L+PFGLHH F++P W+
  S:     9 LQRIGKALMLPVAILPAAGLLLAIGTAMQGEALQHYLPFIQNGGVQTVAKLMTGAGGIIFDNLPMIFALGVAIGLAGGDGVAAIAAFVGYIIMNKTM-----------------------GDFLQVTPKNIGDPASGYASILGIPTLQTGVFGGIIIGALAAWCYNKFYNINLPSYLGFFAGKRFVPIMMATTSFILAFPMALIWPTIQSGLNAFSTGLLDSNTGVAVFLFGFIKRLLIPFGLHHIFHAPFWF 238
>gi|148379306|ref|YP_001253847.1| PTS system, glucose-specific, IIABC component [Clostridium botulinum A str. ATCC 3502] >gi|153931892|ref|YP_001383681.1| PTS system, glucose-specific, IIABC component [Clostridium botulinum A str. ATCC 19397] >gi|153937032|ref|YP_001387229.1| PTS system, glucose-specific, IIABC component [Clostridium botulinum A str. Hall] >gi|148288790|emb|CAL82874.1| PTS system, glucose-specific IIABC component [Clostridium botulinum A str. ATCC 3502] >gi|152927936|gb|ABS33436.1| PTS system, glucose-specific, IIABC component [Clostridium botulinum A str. ATCC 19397] >gi|152932946|gb|ABS38445.1| PTS system, glucose-specific, IIABC component [Clostridium botulinum A str. Hall] (676 aa)
Score = 639, Expect = 3.7e-64, Identities = 173/480 (36%), Positives = 261/480 (54%)
  Q:   400 LTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLN--NDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           + +G QA+          +  G ++ GK+ FM+ GLPAAA A+   A  E +KL   I  SA  TS LTGITEPIE++FLF+AP LF G+H     L+F +M  + +             IGM+FSGG+ID++I+G +        WW  I  GLA++ IY+F F F I+K+N++TPGR         ED          +  SES+N  ++  LA  V+ A GG +N+ N+DACIT+LR+ +     V+  +L  LGA G +     ++ A+FG ++D +K  IK ++     + ++K E                 +P+KE VK  S   K+K V  +P  G+I+S+  VPDE FS+ MMG G A++P  G + SP+DG ++ VF T HA     E G ++LIH GID++NLK +  + L      VK GD +    ++   K+ D     S ITPII  N + + ++++ +K    +K G
  S:   250 VINGDQAIFFQQIKDHAPLTAGTFMTGKFPFMMFGLPAAALAIYQEAKPEKKKLVGGIMASAALTSFLTGITEPIEFSFLFVAPVLF-GIHCIFAGLSFMVMQILNI------------KIGMTFSGGVIDFLIFGVVP---NRTKWWLVIPVGLAFSAIYYFGFRFAIRKWNLKTPGR---------ED----------DAGSESVNYSSEVSLAAKVLEALGGKENLANLDACITRLRVSVNSIDKVNKEELKSLGASGVMVVG-NNIQAIFGPKSDQLKEQIKDVISGKIITKDVKIE-----------------EPKKETVKVSS---KDKFV--APIEGKILSITDVPDEVFSQKMMGDGFAIEPKNGTVVSPVDGVITTVFPTKHAIGITAENGLELLIHFGIDTVNLKGEGLEALVEQDAKVKAGDPI---LKVDIDKIKD--EVPSIITPIIFTNLT-DDQKLEIVKLGSHVKAG 668
Score = 407, Expect = 2.5e-37, Identities = 103/274 (37%), Positives = 150/274 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY------TQAGGSIDLTQNAIIYQDGKAYAVLATST 316
           + ++ K LMLP+A+LP AGI L  G+         +  A G+ G + F   ++  GN +F  L LLFA+ +A+      G AALA  +G+LI  +           T G V+G            ++ G        + +V+GI  LQ+ VFGG ++G + A LY K+ NI+L   +GFF G RFVPI+T      V ++ ++IWP +   L +F    +     + +FIFG IERAL+PFGLHH FY+P WY       +AG  I+  Q AI +Q  K +A L   T
  S:     9 LQQVGKALMLPVALLPAAGILLAFGNMFQNPDFLKLAPAFGSTGFQAFARVMEQSGNIIFANLALLFAVGVAVGLAAGEGVAALAAIVGFLIMNT-----------TMGLVVG------------VTPGLIGKSHPEFASVLGIPTLQTGVFGGIIMGIIAASLYKKYYNIELPSYLGFFAGKRFVPIITAAVAILVGLIMVVIWPPIQHGLNSFSHNMIDANRTLAAFIFGVIERALIPFGLHHIFYNPFWYQFGEYINKAGQVINGDQ-AIFFQQIKDHAPLTAGT 272
>gi|52785361|ref|YP_091190.1| hypothetical protein BLi01598 [Bacillus licheniformis ATCC 14580] >gi|163119401|ref|YP_078777.2| phosphotransferase system (PTS) glucose-specific enzyme IICBA component [Bacillus licheniformis ATCC 14580] >gi|52347863|gb|AAU40497.1| PtsG [Bacillus licheniformis DSM 13] >gi|145902907|gb|AAU23139.2| phosphotransferase system (PTS) glucose-specific enzyme IICBA component [Bacillus licheniformis ATCC 14580] (698 aa)
Score = 639, Expect = 3.9e-64, Identities = 165/442 (37%), Positives = 243/442 (54%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           +  G ++ GKY FM+ GLPAAA A+   A  +N+KL   I  SA  TS LTGITEPIE++FLF+AP LF  +H     L+F +M+ + +             IGM+FSGG+ID+ ++G   I     AWW  I  GL  A IY+F F F I+KFN++TPGR         ED   +        + E       L   ++ A G  +NIK++DACIT+LR+ + DQ  VD  +L +LGA G ++    ++ A+FG  +D +K  ++ +M   +  P      EK  N + +     E + E+ +V+     S E+V V SP  GE+  +A VPD+ FS  MMG G A+ P  G + SP+ GK+  VF T HA   +++ G +ILIH GID+++LK +       F   V  GD V+ GQ++  V +  +K +  S +TPI+  N
  S:   278 LTAGTFMTGKYPFMMFGLPAAALAIYHEAKPQNKKLVAGIMGSAALTSFLTGITEPIEFSFLFVAPILF-AIHCVFAGLSFMMMDILNV------------KIGMTFSGGLIDYFLFG---ILPNRTAWWLVIPVGLVLAVIYYFGFRFAIRKFNLKTPGR---------EDAAAEP-------ADEGKEAAGDLPYQILEAMGDQENIKHLDACITRLRVTVNDQKKVDKERLKKLGASGVLEVG-NNIQAIFGPRSDNLKSQMQDIMSGRTPRP------EKAPNAAEEV----EQQIEEAMVEPLQNESGEEVFV-SPLAGELHPIADVPDQVFSGKMMGDGFAILPAEGTVVSPVRGKVLNVFPTKHAIGLQSDGGREILIHFGIDTVSLKGEG------FTSFVSEGDRVEPGQKLLEVDIEKVKDNVPSLMTPIVFTN 671
Score = 387, Expect = 6.0e-35, Identities = 92/245 (37%), Positives = 131/245 (53%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + K+ + LMLP+A+LP AGI L +G+A+       V     N  +++    ++  G+ VF  L LLFA+ +AI      G A +A  IGYL+      A+           +     F Q +           P   Y  ++GI  L + VFGG +VG L A +YN+F  I+L   +GFF G RFVPI+T +    + ++ L IWP +  AL +F    L     + + IFG IERAL+PFGLHH FYSP WY
  S:     9 LQKIGRALMLPVAILPAAGILLALGNAMQNPQMTKVAPFLTNSTVQLVAKVMESSGDVVFTNLALLFAVGVAIGLANGDGVAGIAAIIGYLVMNVTMSAVLLQNGSIPSDAVERAQFFTQNH-----------PE--YTTMLGIPTLATGVFGGIIVGVLAAAMYNRFYTIELPQYLGFFAGKRFVPIITSICALLLGLVMLFIWPPIQGALNSFSTNLLAANEAVAALIFGMIERALIPFGLHHIFYSPFWY 248
>gi|148268971|ref|YP_001247914.1| PTS system, glucose-specific IIBC subunit [Staphylococcus aureus subsp. aureus JH9] >gi|150395049|ref|YP_001317724.1| PTS system, glucose-specific IIBC subunit [Staphylococcus aureus subsp. aureus JH1] >gi|147742040|gb|ABQ50338.1| PTS system, glucose-specific IIBC subunit [Staphylococcus aureus subsp. aureus JH9] >gi|149947501|gb|ABR53437.1| PTS system, glucose-specific IIBC subunit [Staphylococcus aureus subsp. aureus JH1] (688 aa)
Score = 638, Expect = 4.7e-64, Identities = 161/447 (36%), Positives = 249/447 (55%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREI 867
           G +  GKY FM+ GLPAAA A+   A  E +K+   + +SAG T+ LTGITEP+E++FLF+AP L+ G+H  L   +F +M+ +G+             IGM+FSGG ID+I+YG +     S+A      G+ YA +Y+FLF F I+KF ++TPGR              +  + +I  SS +      L  +V+ A GG +NIK++DACIT+LR+++ D+S VD A +  LGA G ++    ++ A+FG ++D IK ++  +M    + P             S+T+   E+  E   V+           + +P  G+I+ L++VPD+ F+  MMG GI   P  G+I +P DG +  +F T HA   E+E G ++LIH+GID++ L  +  + L      +   + V  GQ +  V LA LK HA S +TP+I+ N  LE +E+
  S:   283 GAFTTGKYPFMMFGLPAAAFAIYKNARPERKKVVGGLMLSAGLTAFLTGITEPLEFSFLFVAPVLY-GIHVLLAGTSFLVMHLLGV------------KIGMTFSGGFIDYILYGLLNWDR-SHALLVIPVGIVYAIVYYFLFDFAIRKFKLKTPGR--------------EDEETEIRNSSVA-----KLPFDVLDAMGGKENIKHLDACITRLRVEVVDKSKVDVAGIKALGASGVLEVG-NNMQAIFGPKSDQIKHDMAKIMSGEITKP-------------SETTVTEEMSDEPVHVEALGTTD-----IYAPGVGQIIPLSEVPDQVFAGKMMGDGIGFIPEKGEIVAPFDGTVKTIFPTKHAIGLESESGVEVLIHIGIDTVKLNGEGFESL------INVDEKVTQGQPLMKVNLAYLKAHAPSIVTPMIITN--LENKEL 670
Score = 415, Expect = 3.0e-38, Identities = 98/245 (40%), Positives = 138/245 (56%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSL----YGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQ-ALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + ++ K LMLP+A+LP AGI L  G+A+       +     N+ + +  + ++  G  VF  LPLLFA+  A+   G  G AALA  +GYLI  +           T G V+   +     +IF  + G   L  +     +  V+GI  LQ+ VFGG ++G L A+ YNKF NI L P +GFF G RFVPIVT +      +L    WP +   L  L    L + + + +FIFG IER+L+PFGLHH FYSP W+
  S:     9 LQRIGKALMLPVAILPAAGILLAFGNAMHNEQLVEIAPWLKNDIIVMISSVMEAAGQVVFDNLPLLFAVGTALGLAGGDGVAALAALVGYLIMNA-----------TMGKVLHITI----DDIFSYAKGAKELSQAAKEPAHALVLGIPTLQTGVFGGIIMGALAAWCYNKFYNITLPPFLGFFAGKRFVPIVTSVVAIATGVLLSFAWPPIQDGLNSLSNFLLNKNLTLTTFIFGIIERSLIPFGLHHIFYSPFWF 250
>gi|168184151|ref|ZP_02618815.1| PTS system, glucose-specific, IIABC component [Clostridium botulinum Bf] >gi|182672695|gb|EDT84656.1| PTS system, glucose-specific, IIABC component [Clostridium botulinum Bf] (676 aa)
Score = 638, Expect = 4.8e-64, Identities = 172/458 (37%), Positives = 255/458 (55%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLN--NDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLN----ESLEGREIKFLKKSGE 875
           +  G ++ GK+ FM+ GLPAAA A+   A  E +KL   I  SA  TS LTGITEPIE++FLF+AP LF G+H     L+F +M  + +             IGM+FSGG+ID++I+G +        WW  I  GLA++ IY+F F F I+K+N++TPGR         ED          +  SES+N  ++  LA  V+ A GG +N+ N+DACIT+LR+ +     V+  +L  LGA G +     ++ A+FG ++D +K  IK ++     + ++K E                 +P+KE VK  S   K+K V  +P  G+I+S+  VPDE FS+ MMG G A++P  G + SP+DG ++ VF T HA     E G ++LIH GID++NLK +  + L      +K GD +    ++   K+ D     STITPII  N    + LE  ++  + K+GE
  S:   268 LTAGTFMTGKFPFMMFGLPAAALAIYQEAKPEKKKLVGGIMASAALTSFLTGITEPIEFSFLFVAPVLF-GIHCIFAGLSFMVMQILNI------------KIGMTFSGGVIDFLIFGVVP---NRTKWWLVIPVGLAFSVIYYFGFRFAIRKWNLKTPGR---------ED----------DAGSESVNYSSEGSLAAKVLEALGGKENLANLDACITRLRVSVNSIDKVNKEELKSLGASGVMVVG-NNIQAIFGPKSDQLKEQIKDVISGKIITKDIKIE-----------------EPKKETVKVSS---KDKFV--APIEGKILSITDVPDEVFSQKMMGDGFAIEPKNGTVVSPVDGVITTVFPTKHAIGITAENGLELLIHFGIDTVNLKGEGLEALVEQDAKIKAGDPI---LKVDIDKIKD--KVPSTITPIIFTNLTDDQKLEIVKLGKIVKAGE 669
Score = 395, Expect = 6.1e-36, Identities = 103/274 (37%), Positives = 150/274 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY------TQAGGSIDLTQNAIIYQDGKAYAVLATST 316
           + ++ K LMLP+A+LP AGI L  G+         +  A G+ G + F   ++  GN +F  L LLFA+ +A+      G AALA  +G+LI  +           T G V+G            ++ G        + +V+GI  LQ+ VFGG ++G + A LY K+ NI+L   +GFF G RFVPI+T      V ++ ++IWP +   L +F    +     + +FIFG IERAL+PFGLHH FY+P WY       +AG  I+  Q AI +Q  K +A L   T
  S:     9 LQQVGKALMLPVALLPAAGILLAFGNMFQNPDFLNLAPAFGSTGFQAFARVMEQSGNIIFANLALLFAVGVAVGLAAGEGVAALAAIVGFLIMNT-----------TMGLVVG------------VTPGLIGQSHPEFASVLGIPTLQTGVFGGIIMGIIAASLYKKYYNIELPSYLGFFAGKRFVPIITAAIAIIVGLIMVVIWPPIQHGLNSFSHNMIDTNRTLAAFIFGVIERALIPFGLHHIFYNPFWYQFGEYINKAGQVINGDQ-AIFFQQIKDHAPLTAGT 272
>gi|16078453|ref|NP_389272.1| phosphotransferase system (PTS) glucose-specific enzyme IICBA component [Bacillus subtilis subsp. subtilis str. 168] >gi|131493|sp|P20166|PTG3C_BACSU PTS system glucose-specific EIICBA component (EIICBA-Glc) (EII-Glc/EIII-Glc) [Includes: Glucose permease IIC component (PTS system glucose-specific EIIC component); Glucose-specific phosphotransferase enzyme IIB component (PTS system glucose-specific EIIB component); Glucose-specific phosphotransferase enzyme IIA component (PTS system glucose-specific EIIA component)] >gi|39956|emb|CAA77803.1| IIGlc [Bacillus subtilis] >gi|2633760|emb|CAB13262.1| phosphotransferase system (PTS) glucose-specific enzyme IICBA component [Bacillus subtilis subsp. subtilis str. 168] (699 aa)
Score = 637, Expect = 5.4e-64, Identities = 173/461 (37%), Positives = 253/461 (54%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTD---SELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKK 878
           +  G ++ GKY FM+ GLPAAA A+   A  +N+KL   I  SA  TS LTGITEP+E++FLF+AP LF  +H     L+F +M  + +             IGM+FSGG+ID+ ++G   I     AWW  I  GL  A IY+F F F I+KFN++TPGR         ED   +       G +  L         ++ A G  +NIK++DACIT+LR+ + DQ  VD  +L QLGA G ++    ++ A+FG  +D     +KT M++I +    + E          TS+  EV  + E V  +   +E+ +E  V  SP TGEI  +  VPD+ FS  MMG G A+ P+ G + SP+ GK+  VF T HA   +++ G +ILIH GID+++LK +       F   V  GD V+ GQ++  V L  +K +  S +TPI+  N + EG  +  +K SG + +
  S:   278 LTAGTFMTGKYPFMMFGLPAAALAIYHEAKPQNKKLVAGIMGSAALTSFLTGITEPLEFSFLFVAPVLF-AIHCLFAGLSFMVMQLLNV------------KIGMTFSGGLIDYFLFG---ILPNRTAWWLVIPVGLGLAVIYYFGFRFAIRKFNLKTPGR---------EDAAEETAAPGKTGEAGDL------PYEILQAMGDQENIKHLDACITRLRVTVNDQKKVDKDRLKQLGASGVLEVG-NNIQAIFGPRSD----GLKTQMQDIIAGRKPRPE--------PKTSAQEEVGQQVEEVIAEPLQNEIGEEVFV--SPITGEIHPITDVPDQVFSGKMMGDGFAILPSEGIVVSPVRGKILNVFPTKHAIGLQSDGGREILIHFGIDTVSLKGEG------FTSFVSEGDRVEPGQKLLEVDLDAVKPNVPSLMTPIVFTNLA-EGETVS-IKASGSVNR 689
Score = 397, Expect = 4.3e-36, Identities = 95/245 (38%), Positives = 136/245 (55%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSS---LYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + K+ + LMLP+A+LP AGI L +G+A+       V +   N+ +++    ++  G  VF  LPLLFA+ +AI      G A +A  IGYL+      A+                L   G I   S   A   +     Y  ++GI  L + VFGG +VG L A L+N+F  I+L   +GFF G RFVPIVT ++   + ++ L+IWP +   L      L +A   + +FIFG IER+L+PFGLHH FYSP WY
  S:     9 LQKIGRALMLPVAILPAAGILLAIGNAMQNKDMIQVLHFLSNDNVQLVAGVMESAGQIVFDNLPLLFAVGVAIGLANGDGVAGIAAIIGYLVMNVSMSAV----------------LLANGTIPSDSVERAKFFTENHPAYVNMLGIPTLATGVFGGIIVGVLAALLFNRFYTIELPQYLGFFAGKRFVPIVTSISALILGLIMLVIWPPIQHGLNAFSTGLVEANPTLAAFIFGVIERSLIPFGLHHIFYSPFWY 248
>gi|49484739|ref|YP_041963.1| PTS system, glucose-specific IIABC component [Staphylococcus aureus subsp. aureus MRSA252] >gi|49242868|emb|CAG41597.1| PTS system, glucose-specific IIABC component [Staphylococcus aureus subsp. aureus MRSA252] (688 aa)
Score = 637, Expect = 5.8e-64, Identities = 160/447 (35%), Positives = 249/447 (55%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREI 867
           G +  GKY FM+ GLPAAA A+   A  E +K+   + +SAG T+ LTGITEP+E++FLF+AP L+ G+H  L   +F +M+ +G+             IGM+FSGG ID+I+YG +     S+A      G+ YA +Y+FLF F I+KF ++TPGR              +  + +I  SS +      L  +V+ A GG +NIK++DACIT+LR+++ D+S VD A +  LGA G ++    ++ A+FG ++D IK ++  +M    + P             S+T+   E+  E   V+           + +P  G+I+ L++VPD+ F+  MMG G+   P  G+I +P DG +  +F T HA   E+E G ++LIH+GID++ L  +  + L      +   + V  GQ +  V LA LK HA S +TP+I+ N  LE +E+
  S:   283 GAFTTGKYPFMMFGLPAAAFAIYKNARPERKKIVGGLMLSAGLTAFLTGITEPLEFSFLFVAPVLY-GIHVLLAGTSFLVMHLLGV------------KIGMTFSGGFIDYILYGLLNWDR-SHALLVIPVGIVYAIVYYFLFDFAIRKFKLKTPGR--------------EDEETEIRNSSVA-----KLPFDVLDAMGGKENIKHLDACITRLRVEVVDKSKVDVAGIKALGASGVLEVG-NNMQAIFGPKSDQIKHDMAKIMSGEITKP-------------SETTVTEEMSDEPVHVEALGTTD-----IYAPGVGQIIPLSEVPDQVFAGKMMGDGVGFIPEKGEIVAPFDGTVKTIFPTKHAIGLESESGVEVLIHIGIDTVKLNGEGFESL------INVDEKVTQGQPLMKVNLAYLKAHAPSIVTPMIITN--LENKEL 670
Score = 412, Expect = 7.1e-38, Identities = 97/245 (39%), Positives = 138/245 (56%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSL----YGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQ-ALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + ++ K LMLP+A+LP AGI L  G+A+       +     N+ + +  + ++  G  VF  LPLLFA+  A+   G  G AALA  +GYLI  +           T G V+   +     +IF  + G   L  +     +  V+GI  LQ+ VFGG ++G L A+ YNKF NI L P +GFF G RFVPIVT +      ++    WP +   L  L    L + + + +FIFG IER+L+PFGLHH FYSP W+
  S:     9 LQRIGKALMLPVAILPAAGILLAFGNAMHNEQLVEIAPWLKNDIIVMISSVMEAAGQVVFDNLPLLFAVGTALGLAGGDGVAALAALVGYLIMNA-----------TMGKVLHITI----DDIFSYAKGAKELSQAAKEPAHALVLGIPTLQTGVFGGIIMGALAAWCYNKFYNITLPPFLGFFAGKRFVPIVTSVVAIATGVVLSFAWPPIQDGLNSLSNFLLNKNLTLTTFIFGIIERSLIPFGLHHIFYSPFWF 250
>gi|49482431|ref|YP_039655.1| glucose-specific PTS transporter protein, IIABC component [Staphylococcus aureus subsp. aureus MRSA252] >gi|49240560|emb|CAG39217.1| glucose-specific PTS transporter protein, IIABC component [Staphylococcus aureus subsp. aureus MRSA252] (681 aa)
Score = 636, Expect = 6.8e-64, Identities = 169/467 (36%), Positives = 259/467 (55%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNS--SDTSSASEVKPEKEVVKTDSELSKE-KVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFE 884
           +  G+++QG++  M+ GLPAAA A+   A  EN+K+   +  SA  TS LTGITEP+E++FLF+AP LF+ +HA L  L+F  +              L  H+G +FSGG ID+ + G   I      WW  I  GL YA IY+F+F FLI K   +TPGR            ++KQ++     ++E       L   V+ A GG  NIK++DACIT+LR+++ D+S VD   L  LGA G ++    ++ A+FG ++D                  +K E ++IMN     + ++  + K E  VV  D   + E   +V++P TGE+  L++VPD+ FS+ MMG GIA+KP+ G++ +P +GK+ ++F T HA    ++ G ++LIH+G+D++ L  +       F  +V+ G  VK G  +    L  ++ HAKS ITPIIV   ++   + K   + G I  G  LFE
  S:   268 LTAGKFMQGEFPVMMFGLPAAALAIYHTAKPENKKVVAGLMGSAALTSFLTGITEPLEFSFLFVAPLLFF-IHAVLDGLSFLTLY------------LLDLHLGYTFSGGFIDYFLLG---ILPNKTQWWLVIPVGLVYAVIYYFVFRFLIVKLKYKTPGR------------EDKQSQAATASATE-------LPYAVLEAMGGKANIKHLDACITRLRVEVNDKSKVDVPGLKDLGASGVLEVG-NNMQAIFGPKSD-----------------QIKHEMQQIMNGQVVENPTTMEDDKDETVVVAEDKSATSELSHIVHAPLTGEVTPLSEVPDQVFSEKMMGDGIAIKPSQGEVRAPFNGKVQMIFPTKHAIGLVSDSGLELLIHIGLDTVKLNGEG------FTLHVEEGQEVKQGDLLINFDLDYIRNHAKSDITPIIVTQGNITNLDFK-QGEHGNISFGDQLFE 679
Score = 408, Expect = 2.3e-37, Identities = 89/245 (36%), Positives = 132/245 (53%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGG-------NEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + ++ K LMLP+A+LP AG+ L +G+A+   A         N G++     +   G  +F  LP++FA+ +AI   G  G AA+A F+GY+I                            G+   ++  N   P+S Y +++GI  LQ+ VFGG ++G L A+ YNKF NI L   +GFF G RFVPI+     F +     +IWP +   L  F    L    G+  F+FGFI+R L+PFGLHH F++P W+
  S:     9 LQRIGKALMLPVAILPAAGLLLAIGTAMQGEALQHYLPFIQNGGVQTVAKLMTGAGGIIFDNLPMIFALGVAIGLAGGDGVAAIAAFVGYIIMNKTM-----------------------GDFLQVTPKNIGDPASGYASILGIPTLQTGVFGGIIIGALAAWCYNKFYNINLPSYLGFFAGKRFVPIMMATTSFILAFPMALIWPTIQTGLNAFSTGLLDSNTGVAVFLFGFIKRLLIPFGLHHIFHAPFWF 238
>gi|161508454|ref|YP_001574113.1| PTS family glucose/glucoside (glc) porter component IIABC [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|160367263|gb|ABX28234.1| PTS family glucose/glucoside (glc) porter component IIABC [Staphylococcus aureus subsp. aureus USA300_TCH1516] (686 aa)
Score = 636, Expect = 6.8e-64, Identities = 169/467 (36%), Positives = 259/467 (55%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNS--SDTSSASEVKPEKEVVKTDSELSKE-KVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFE 884
           +  G+++QG++  M+ GLPAAA A+   A  EN+K+   +  SA  TS LTGITEP+E++FLF+AP LF+ +HA L  L+F  +              L  H+G +FSGG ID+ + G   I      WW  I  GL YA IY+F+F FLI K   +TPGR            ++KQ++     ++E       L   V+ A GG  NIK++DACIT+LR+++ D+S VD   L  LGA G ++    ++ A+FG ++D                  +K E ++IMN     + ++  + K E  VV  D   + E   +V++P TGE+  L++VPD+ FS+ MMG GIA+KP+ G++ +P +GK+ ++F T HA    ++ G ++LIH+G+D++ L  +       F  +V+ G  VK G  +    L  ++ HAKS ITPIIV   ++   + K   + G I  G  LFE
  S:   273 LTAGKFMQGEFPVMMFGLPAAALAIYHTAKPENKKVVAGLMGSAALTSFLTGITEPLEFSFLFVAPLLFF-IHAVLDGLSFLTLY------------LLDLHLGYTFSGGFIDYFLLG---ILPNKTQWWLVIPVGLVYAVIYYFVFRFLIVKLKYKTPGR------------EDKQSQAATASATE-------LPYAVLEAMGGKANIKHLDACITRLRVEVNDKSKVDVPGLKDLGASGVLEVG-NNMQAIFGPKSD-----------------QIKHEMQQIMNGQVVENPTTMEDDKDETVVVAEDKSATSELSHIVHAPLTGEVTPLSEVPDQVFSEKMMGDGIAIKPSQGEVRAPFNGKVQMIFPTKHAIGLVSDSGLELLIHIGLDTVKLNGEG------FTLHVEEGQEVKQGDLLINFDLDYIRNHAKSDITPIIVTQGNITNLDFK-QGEHGNISFGDQLFE 684
Score = 403, Expect = 7.6e-37, Identities = 88/245 (35%), Positives = 132/245 (53%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGG-------NEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + ++ K LMLP+A+LP AG+ L +G+A+   +         N G++     +   G  +F  LP++FA+ +AI   G  G AA+A F+GY+I                            G+   ++  N   P+S Y +++GI  LQ+ VFGG ++G L A+ YNKF NI L   +GFF G RFVPI+     F +     +IWP +   L  F    L    G+  F+FGFI+R L+PFGLHH F++P W+
  S:    14 LQRIGKALMLPVAILPAAGLLLAIGTAMQGESLQHYLPFIQNGGVQTVAKLMTGAGGIIFDNLPMIFALGVAIGLAGGDGVAAIAAFVGYIIMNKTM-----------------------GDFLQVTPKNIGDPASGYASILGIPTLQTGVFGGIIIGALAAWCYNKFYNINLPSYLGFFAGKRFVPIMMATTSFILAFPMALIWPTIQSGLNAFSTGLLDSNTGVAVFLFGFIKRLLIPFGLHHIFHAPFWF 243
>gi|21281892|ref|NP_644978.1| hypothetical protein MW0163 [Staphylococcus aureus subsp. aureus MW2] >gi|49485065|ref|YP_042286.1| glucose-specific PTS transporter protein, IIABC component [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651191|ref|YP_185074.1| PTS system, IIABC components [Staphylococcus aureus subsp. aureus COL] >gi|87160101|ref|YP_492905.1| PTS system glucose-specific IIBC subunit [Staphylococcus aureus subsp. aureus USA300] >gi|151220345|ref|YP_001331168.1| glucose-specific PTS transporter protein IIABC component [Staphylococcus aureus subsp. aureus str. Newman] >gi|21203327|dbj|BAB94028.1| glcA [Staphylococcus aureus subsp. aureus MW2] >gi|49243508|emb|CAG41932.1| glucose-specific PTS transporter protein, IIABC component [Staphylococcus aureus subsp. aureus MSSA476] >gi|57285377|gb|AAW37471.1| PTS system, IIABC components [Staphylococcus aureus subsp. aureus COL] >gi|87126075|gb|ABD20589.1| PTS system, glucose-specific IIBC component domain protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|150373145|dbj|BAF66405.1| glucose-specific PTS transporter protein IIABC component [Staphylococcus aureus subsp. aureus str. Newman] (681 aa)
Score = 636, Expect = 7.4e-64, Identities = 169/467 (36%), Positives = 259/467 (55%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNS--SDTSSASEVKPEKEVVKTDSELSKE-KVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFE 884
           +  G+++QG++  M+ GLPAAA A+   A  EN+K+   +  SA  TS LTGITEP+E++FLF+AP LF+ +HA L  L+F  +              L  H+G +FSGG ID+ + G   I      WW  I  GL YA IY+F+F FLI K   +TPGR            ++KQ++     ++E       L   V+ A GG  NIK++DACIT+LR+++ D+S VD   L  LGA G ++    ++ A+FG ++D                  +K E ++IMN     + ++  + K E  VV  D   + E   +V++P TGE+  L++VPD+ FS+ MMG GIA+KP+ G++ +P +GK+ ++F T HA    ++ G ++LIH+G+D++ L  +       F  +V+ G  VK G  +    L  ++ HAKS ITPIIV   ++   + K   + G I  G  LFE
  S:   268 LTAGKFMQGEFPVMMFGLPAAALAIYHTAKPENKKVVAGLMGSAALTSFLTGITEPLEFSFLFVAPLLFF-IHAVLDGLSFLTLY------------LLDLHLGYTFSGGFIDYFLLG---ILPNKTQWWLVIPVGLVYAVIYYFVFRFLIVKLKYKTPGR------------EDKQSQAATASATE-------LPYAVLEAMGGKANIKHLDACITRLRVEVNDKSKVDVPGLKDLGASGVLEVG-NNMQAIFGPKSD-----------------QIKHEMQQIMNGQVVENPTTMEDDKDETVVVAEDKSATSELSHIVHAPLTGEVTPLSEVPDQVFSEKMMGDGIAIKPSQGEVRAPFNGKVQMIFPTKHAIGLVSDSGLELLIHIGLDTVKLNGEG------FTLHVEEGQEVKQGDLLINFDLDYIRNHAKSDITPIIVTQGNITNLDFK-QGEHGNISFGDQLFE 679
Score = 403, Expect = 8.1e-37, Identities = 88/245 (35%), Positives = 132/245 (53%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGG-------NEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + ++ K LMLP+A+LP AG+ L +G+A+   +         N G++     +   G  +F  LP++FA+ +AI   G  G AA+A F+GY+I                            G+   ++  N   P+S Y +++GI  LQ+ VFGG ++G L A+ YNKF NI L   +GFF G RFVPI+     F +     +IWP +   L  F    L    G+  F+FGFI+R L+PFGLHH F++P W+
  S:     9 LQRIGKALMLPVAILPAAGLLLAIGTAMQGESLQHYLPFIQNGGVQTVAKLMTGAGGIIFDNLPMIFALGVAIGLAGGDGVAAIAAFVGYIIMNKTM-----------------------GDFLQVTPKNIGDPASGYASILGIPTLQTGVFGGIIIGALAAWCYNKFYNINLPSYLGFFAGKRFVPIMMATTSFILAFPMALIWPTIQSGLNAFSTGLLDSNTGVAVFLFGFIKRLLIPFGLHHIFHAPFWF 238
>gi|161510736|ref|YP_001576395.1| PTS family glucose/glucoside (glc) porter component IIABC [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|160369545|gb|ABX30516.1| PTS family glucose/glucoside (glc) porter component IIABC [Staphylococcus aureus subsp. aureus USA300_TCH1516] (699 aa)
Score = 636, Expect = 8.1e-64, Identities = 160/447 (35%), Positives = 249/447 (55%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREI 867
           G +  GKY FM+ GLPAAA A+   A  E +K+   + +SAG T+ LTGITEP+E++FLF+AP L+ G+H  L   +F +M+ +G+             IGM+FSGG ID+I+YG +     S+A      G+ YA +Y+FLF F I+KF ++TPGR              +  + +I  SS +      L  +V+ A GG +NIK++DACIT+LR+++ D+S VD A +  LGA G ++    ++ A+FG ++D IK ++  +M    + P             S+T+   E+  E   V+           + +P  G+I+ L++VPD+ F+  MMG G+   P  G+I +P DG +  +F T HA   E+E G ++LIH+GID++ L  +  + L      +   + V  GQ +  V LA LK HA S +TP+I+ N  LE +E+
  S:   294 GAFTTGKYPFMMFGLPAAAFAIYKNARPERKKVVGGLMLSAGLTAFLTGITEPLEFSFLFVAPVLY-GIHVLLAGTSFLVMHLLGV------------KIGMTFSGGFIDYILYGLLNWDR-SHALLVIPVGIVYAIVYYFLFDFAIRKFKLKTPGR--------------EDEETEIRNSSVA-----KLPFDVLDAMGGKENIKHLDACITRLRVEVVDKSKVDVAGIKALGASGVLEVG-NNMQAIFGPKSDQIKHDMAKIMSGEITKP-------------SETTVTEEMSDEPVHVEALGTTD-----IYAPGIGQIIPLSEVPDQVFAGKMMGDGVGFIPEKGEIVAPFDGTVKTIFPTKHAIGLESESGVEVLIHIGIDTVKLNGEGFESL------INVDEKVTQGQPLMKVNLAYLKAHAPSIVTPMIITN--LENKEL 681
Score = 416, Expect = 2.8e-38, Identities = 98/245 (40%), Positives = 138/245 (56%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSL----YGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQ-ALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + ++ K LMLP+A+LP AGI L  G+A+       +     N+ + +  + ++  G  VF  LPLLFA+  A+   G  G AALA  +GYLI  +           T G V+   +     +IF  + G   L  +     +  V+GI  LQ+ VFGG ++G L A+ YNKF NI L P +GFF G RFVPIVT +      +L    WP +   L  L    L + + + +FIFG IER+L+PFGLHH FYSP W+
  S:    20 LQRIGKALMLPVAILPAAGILLAFGNAMHNEQLVEIAPWLKNDIIVMISSVMEAAGQVVFDNLPLLFAVGTALGLAGGDGVAALAALVGYLIMNA-----------TMGKVLHITI----DDIFSYAKGAKELSQAAKEPAHALVLGIPTLQTGVFGGIIMGALAAWCYNKFYNITLPPFLGFFAGKRFVPIVTSVVAIATGVLLSFAWPPIQDGLNSLSNFLLNKNLTLTTFIFGIIERSLIPFGLHHIFYSPFWF 261
>gi|88193967|ref|YP_498754.1| PTS system, glucose-specific component [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|87201525|gb|ABD29335.1| PTS system, glucose-specific component [Staphylococcus aureus subsp. aureus NCTC 8325] (665 aa)
Score = 636, Expect = 8.3e-64, Identities = 169/467 (36%), Positives = 259/467 (55%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNS--SDTSSASEVKPEKEVVKTDSELSKE-KVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFE 884
           +  G+++QG++  M+ GLPAAA A+   A  EN+K+   +  SA  TS LTGITEP+E++FLF+AP LF+ +HA L  L+F  +              L  H+G +FSGG ID+ + G   I      WW  I  GL YA IY+F+F FLI K   +TPGR            ++KQ++     ++E       L   V+ A GG  NIK++DACIT+LR+++ D+S VD   L  LGA G ++    ++ A+FG ++D                  +K E ++IMN     + ++  + K E  VV  D   + E   +V++P TGE+  L++VPD+ FS+ MMG GIA+KP+ G++ +P +GK+ ++F T HA    ++ G ++LIH+G+D++ L  +       F  +V+ G  VK G  +    L  ++ HAKS ITPIIV   ++   + K   + G I  G  LFE
  S:   252 LTAGKFMQGEFPVMMFGLPAAALAIYHTAKPENKKVVAGLMGSAALTSFLTGITEPLEFSFLFVAPLLFF-IHAVLDGLSFLTLY------------LLDLHLGYTFSGGFIDYFLLG---ILPNKTQWWLVIPVGLVYAVIYYFVFRFLIVKLKYKTPGR------------EDKQSQAATASATE-------LPYAVLEAMGGKANIKHLDACITRLRVEVNDKSKVDVPGLKDLGASGVLEVG-NNMQAIFGPKSD-----------------QIKHEMQQIMNGQVVENPTTMEDDKDETVVVAEDKSATSELSHIVHAPLTGEVTPLSEVPDQVFSEKMMGDGIAIKPSQGEVRAPFNGKVQMIFPTKHAIGLVSDSGLELLIHIGLDTVKLNGEG------FTLHVEEGQEVKQGDLLINFDLDYIRNHAKSDITPIIVTQGNITNLDFK-QGEHGNISFGDQLFE 663
Score = 390, Expect = 2.5e-35, Identities = 86/237 (36%), Positives = 127/237 (53%)
  Q:    51 MLPIAMLPIAGIFLGVGSAIVTNAGG-------NEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           MLP+A+LP AG+ L +G+A+   +         N G++     +   G  +F  LP++FA+ +AI   G  G AA+A F+GY+I                            G+   ++  N   P+S Y +++GI  LQ+ VFGG ++G L A+ YNKF NI L   +GFF G RFVPI+     F +     +IWP +   L  F    L    G+  F+FGFI+R L+PFGLHH F++P W+
  S:     1 MLPVAILPAAGLLLAIGTAMQGESLQHYLPFIQNGGVQTVAKLMTGAGGIIFDNLPMIFALGVAIGLAGGDGVAAIAAFVGYIIMNKTM-----------------------GDFLQVTPKNIGDPASGYASILGIPTLQTGVFGGIIIGALAAWCYNKFYNINLPSYLGFFAGKRFVPIMMATTSFILAFPMALIWPTIQSGLNAFSTGLLDSNTGVAVFLFGFIKRLLIPFGLHHIFHAPFWF 222
>gi|21284188|ref|NP_647276.1| PTS system glucose-specific IIABC component [Staphylococcus aureus subsp. aureus MW2] >gi|49487317|ref|YP_044538.1| PTS system, glucose-specific IIABC component [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651048|ref|YP_187344.1| PTS system, IIABC components [Staphylococcus aureus subsp. aureus COL] >gi|87160871|ref|YP_495110.1| phosphotransferase system, glucose-specific IIABC component [Staphylococcus aureus subsp. aureus USA300] >gi|88196480|ref|YP_501305.1| PTS system glucose-specific IIABC component [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151222649|ref|YP_001333471.1| PTS system, glucose-specific IIABC component [Staphylococcus aureus subsp. aureus str. Newman] >gi|168727263|ref|ZP_02759540.1| PTS family glucose/glucoside (glc) porter component IIABC [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|21205631|dbj|BAB96324.1| PTS system glucose-specific IIABC component [Staphylococcus aureus subsp. aureus MW2] >gi|49245760|emb|CAG44240.1| PTS system, glucose-specific IIABC component [Staphylococcus aureus subsp. aureus MSSA476] >gi|57285234|gb|AAW37328.1| PTS system, IIABC components [Staphylococcus aureus subsp. aureus COL] >gi|87126845|gb|ABD21359.1| phosphotransferase system, glucose-specific IIABC component [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87204038|gb|ABD31848.1| PTS system glucose-specific IIABC component [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150375449|dbj|BAF68709.1| PTS system, glucose-specific IIABC component [Staphylococcus aureus subsp. aureus str. Newman] (688 aa)
Score = 636, Expect = 8.5e-64, Identities = 160/447 (35%), Positives = 249/447 (55%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREI 867
           G +  GKY FM+ GLPAAA A+   A  E +K+   + +SAG T+ LTGITEP+E++FLF+AP L+ G+H  L   +F +M+ +G+             IGM+FSGG ID+I+YG +     S+A      G+ YA +Y+FLF F I+KF ++TPGR              +  + +I  SS +      L  +V+ A GG +NIK++DACIT+LR+++ D+S VD A +  LGA G ++    ++ A+FG ++D IK ++  +M    + P             S+T+   E+  E   V+           + +P  G+I+ L++VPD+ F+  MMG G+   P  G+I +P DG +  +F T HA   E+E G ++LIH+GID++ L  +  + L      +   + V  GQ +  V LA LK HA S +TP+I+ N  LE +E+
  S:   283 GAFTTGKYPFMMFGLPAAAFAIYKNARPERKKVVGGLMLSAGLTAFLTGITEPLEFSFLFVAPVLY-GIHVLLAGTSFLVMHLLGV------------KIGMTFSGGFIDYILYGLLNWDR-SHALLVIPVGIVYAIVYYFLFDFAIRKFKLKTPGR--------------EDEETEIRNSSVA-----KLPFDVLDAMGGKENIKHLDACITRLRVEVVDKSKVDVAGIKALGASGVLEVG-NNMQAIFGPKSDQIKHDMAKIMSGEITKP-------------SETTVTEEMSDEPVHVEALGTTD-----IYAPGIGQIIPLSEVPDQVFAGKMMGDGVGFIPEKGEIVAPFDGTVKTIFPTKHAIGLESESGVEVLIHIGIDTVKLNGEGFESL------INVDEKVTQGQPLMKVNLAYLKAHAPSIVTPMIITN--LENKEL 670
Score = 415, Expect = 3.0e-38, Identities = 98/245 (40%), Positives = 138/245 (56%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSL----YGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQ-ALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + ++ K LMLP+A+LP AGI L  G+A+       +     N+ + +  + ++  G  VF  LPLLFA+  A+   G  G AALA  +GYLI  +           T G V+   +     +IF  + G   L  +     +  V+GI  LQ+ VFGG ++G L A+ YNKF NI L P +GFF G RFVPIVT +      +L    WP +   L  L    L + + + +FIFG IER+L+PFGLHH FYSP W+
  S:     9 LQRIGKALMLPVAILPAAGILLAFGNAMHNEQLVEIAPWLKNDIIVMISSVMEAAGQVVFDNLPLLFAVGTALGLAGGDGVAALAALVGYLIMNA-----------TMGKVLHITI----DDIFSYAKGAKELSQAAKEPAHALVLGIPTLQTGVFGGIIMGALAAWCYNKFYNITLPPFLGFFAGKRFVPIVTSVVAIATGVLLSFAWPPIQDGLNSLSNFLLNKNLTLTTFIFGIIERSLIPFGLHHIFYSPFWF 250
>gi|168179990|ref|ZP_02614654.1| PTS system, glucose-specific, IIABC component [Clostridium botulinum NCTC 2916] >gi|182668936|gb|EDT80912.1| PTS system, glucose-specific, IIABC component [Clostridium botulinum NCTC 2916] (676 aa)
Score = 635, Expect = 9.9e-64, Identities = 174/480 (36%), Positives = 261/480 (54%)
  Q:   400 LTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLN--NDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           + +G QA+          +  G ++ GK+ FM+ GLPAAA A+   A  E +KL   I  SA  TS LTGITEPIE++FLF+AP LF G+H     L+F +M  + +             IGM+FSGG+ID++I+G +        WW  I  GLA++ IY+F F F I+K+N++TPGR         ED          +  SES+N  ++  LA  V+ A GG +N+ N+DACIT+LR+ +     V+  +L  LGA G +     ++ A+FG ++D +K  IK ++     + ++K E                 +P+KE VK  S   K+K V  +P  G+I+S+  VPDE FS+ MMG G A++P  G + SP+DG ++ VF T HA     E G ++LIH GID++NLK +  + L      V+    VK G  I  V +  +K    S ITPII  N + + ++++ +K    +K G
  S:   250 VINGDQAIFFQQIKDHAPLTAGTFMTGKFPFMMFGLPAAALAIYQEAKPEKKKLVGGIMASAALTSFLTGITEPIEFSFLFVAPVLF-GIHCIFAGLSFMVMQILNI------------KIGMTFSGGVIDFLIFGVVP---NRTKWWLVIPVGLAFSVIYYFGFRFAIRKWNLKTPGR---------ED----------DAGSESVNYSSEGSLAAKVLEALGGKENLANLDACITRLRVSVNSIDKVNKEELKSLGASGVMVVG-NNIQAIFGPKSDQLKEQIKDVISGKIITKDVKIE-----------------EPKKETVKVSS---KDKFV--APIEGKILSITDVPDEVFSQKMMGDGFAIEPKNGTVVSPVDGVITTVFPTKHAIGITAENGLELLIHFGIDTVNLKGEGLEAL------VEQDTKVKAGDPILKVDIDKIKDEVPSIITPIIFTNLT-DDQKLEIVKLGKTVKAG 668
Score = 407, Expect = 2.6e-37, Identities = 103/274 (37%), Positives = 150/274 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY------TQAGGSIDLTQNAIIYQDGKAYAVLATST 316
           + ++ K LMLP+A+LP AGI L  G+         +  A G+ G + F   ++  GN +F  L LLFA+ +A+      G AALA  +G+LI  +           T G V+G            ++ G        + +V+GI  LQ+ VFGG ++G + A LY K+ NI+L   +GFF G RFVPI+T      V ++ ++IWP +   L +F    +     + +FIFG IERAL+PFGLHH FY+P WY       +AG  I+  Q AI +Q  K +A L   T
  S:     9 LQQVGKALMLPVALLPAAGILLAFGNMFQNPDFLKLAPAFGSTGFQAFARVMEQSGNIIFANLALLFAVGVAVGLAAGEGVAALAAIVGFLIMNT-----------TMGLVVG------------VTPGLIGRSHPEFASVLGIPTLQTGVFGGIIMGIIAASLYKKYYNIELPSYLGFFAGKRFVPIITAAVAIIVGLIMVVIWPPIQHGLNSFSHNMIDANRTLAAFIFGVIERALIPFGLHHIFYNPFWYQFGEYINKAGQVINGDQ-AIFFQQIKDHAPLTAGT 272
>gi|187780038|ref|ZP_02996511.1| hypothetical protein CLOSPO_03634 [Clostridium sporogenes ATCC 15579] >gi|187773663|gb|EDU37465.1| hypothetical protein CLOSPO_03634 [Clostridium sporogenes ATCC 15579] (676 aa)
Score = 635, Expect = 1.1e-63, Identities = 170/459 (37%), Positives = 253/459 (55%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           G ++ GK+ FM+ GLPAAA A+   A  E +KL   I  SA  T+ LTGITEPIE++FLF+AP LF  +H     L+F  M+ + +             IGM+FSGG+ID+I++G +        WW  I  GLA++ IY+F F F I+K+N++TPGR         ED  N +N   ++ SSE       LA  V+ A GG +N+ N+DACIT+LR+ +     V+  +L  LGA G +     ++ A+FG ++D +K  IK ++   + + ++K E                 +P+KE VK  S   K+K V  SP  G+I+S+  VPDE FS+ MMG G A++P  G + SP+DG ++ VF T HA     E G ++LIH GID++NLK +  + L      VK GD +    ++   K+ D     S ITPII  N + + ++++  K    +K G
  S:   271 GTFMTGKFPFMMFGLPAAALAIYQEAKPEKKKLVGGIMASAALTAFLTGITEPIEFSFLFVAPALF-AIHCLFAGLSFMTMHILNI------------KIGMTFSGGVIDFILFGVVP---NRTKWWLVIPVGLAFSVIYYFGFRFAIRKWNLKTPGR---------EDDTNTEN---VSHSSEG-----SLAAKVLEALGGKENLANLDACITRLRVSVNSIDKVNKEELKSLGASGVMVVG-NNIQAIFGPKSDQLKEQIKDVISGKTVTKDVKIE-----------------EPKKETVKVSS---KDKFV--SPIEGKILSITDVPDEVFSQKMMGDGFAIEPKNGTVLSPVDGIITTVFPTKHAIGITAENGLELLIHFGIDTVNLKGEGLEALVEQDAKVKAGDPI---LKVDIDKIKD--KVPSIITPIIFTNLT-DDQKLEIAKLGNHVKAG 668
Score = 376, Expect = 9.8e-34, Identities = 92/245 (37%), Positives = 132/245 (53%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + ++ K LMLP+A+LP AGI L  G+         +  A  +   + F   ++  GN VF  L LLFA+ +A+   G  G A LA  +G+LI          +VT               G + G++ G        + +V+GI  LQ+ VFGG ++G + A LY K+ NI+L   +GFF G RFVPIVT      V ++ + IWP +   L TF    +     + +F+FG IERAL+PFGLHH FY+P WY
  S:     9 LQQVGKALMLPVALLPAAGILLAFGNMFQNEAFLKLAPALNSPVFQGFAKVMEQSGNIVFANLALLFAVGVAVGLAGGEGVAGLAAIVGFLIM---------NVT--------------MGVVTGITPGLIGKSHPEFASVLGIPTLQTGVFGGIIMGIIAAQLYKKYYNIELPSYLGFFAGKRFVPIVTATFAIFVGLIMVFIWPPIQSGLNTFSHNMIDANKTLAAFVFGVIERALIPFGLHHIFYNPFWY 238
>gi|153940665|ref|YP_001390686.1| PTS system, glucose-specific, IIABC component [Clostridium botulinum F str. Langeland] >gi|170755505|ref|YP_001780960.1| PTS system, glucose-specific, IIABC component [Clostridium botulinum B1 str. Okra] >gi|152936561|gb|ABS42059.1| PTS system, glucose-specific, IIABC component [Clostridium botulinum F str. Langeland] >gi|169120717|gb|ACA44553.1| PTS system, glucose-specific, IIABC component [Clostridium botulinum B1 str. Okra] (676 aa)
Score = 635, Expect = 1.1e-63, Identities = 173/480 (36%), Positives = 261/480 (54%)
  Q:   400 LTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLN--NDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           + +G QA+          +  G ++ GK+ FM+ GLPAAA A+   A  E +KL   I  SA  TS LTGITEPIE++FLF+AP LF G+H     L+F +M  + +             IGM+FSGG+ID++I+G +        WW  I  GLA++ IY+F F F I+K+N++TPGR         ED          +  SES+N  ++  LA  V+ A GG +N+ N+DACIT+LR+ +     V+  +L  LGA G +     ++ A+FG ++D +K  IK ++     + ++K E                 +P+KE VK  S   K+K V  +P  G+I+S+  VPDE FS+ MMG G A++P  G + SP+DG ++ VF T HA     E G ++LIH GID++NLK +  + L      VK GD +    ++   K+ D     S ITPII  N + + ++++ +K    +K G
  S:   250 VINGDQAIFFQQIKDHAPLTAGTFMTGKFPFMMFGLPAAALAIYQEAKPEKKKLVGGIMASAALTSFLTGITEPIEFSFLFVAPVLF-GIHCIFAGLSFMVMQILNI------------KIGMTFSGGVIDFLIFGVVP---NRTKWWLVIPVGLAFSVIYYFGFRFAIRKWNLKTPGR---------ED----------DAGSESVNYSSEGSLAAKVLEALGGKENLANLDACITRLRVSVNSIDKVNKEELKSLGASGVMVVG-NNIQAIFGPKSDQLKEQIKDVISGKIITKDVKIE-----------------EPKKETVKVSS---KDKFV--APIEGKILSITDVPDEVFSQKMMGDGFAIEPKNGTVVSPVDGVITTVFPTKHAIGITAENGLELLIHFGIDTVNLKGEGLEALVEQDAKVKAGDPI---LKVDIDKIKD--EVPSIITPIIFTNLT-DDQKLEIVKLGKTVKAG 668
Score = 407, Expect = 2.6e-37, Identities = 103/274 (37%), Positives = 150/274 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY------TQAGGSIDLTQNAIIYQDGKAYAVLATST 316
           + ++ K LMLP+A+LP AGI L  G+         +  A G+ G + F   ++  GN +F  L LLFA+ +A+      G AALA  +G+LI  +           T G V+G            ++ G        + +V+GI  LQ+ VFGG ++G + A LY K+ NI+L   +GFF G RFVPI+T      V ++ ++IWP +   L +F    +     + +FIFG IERAL+PFGLHH FY+P WY       +AG  I+  Q AI +Q  K +A L   T
  S:     9 LQQVGKALMLPVALLPAAGILLAFGNMFQNPDFLKLAPAFGSTGFQAFARVMEQSGNIIFANLALLFAVGVAVGLAAGEGVAALAAIVGFLIMNT-----------TMGLVVG------------VTPGLIGRSHPEFASVLGIPTLQTGVFGGIIMGIIAASLYKKYYNIELPSYLGFFAGKRFVPIITAAVAIIVGLIMVVIWPPIQHGLNSFSHNMIDANRTLAAFIFGVIERALIPFGLHHIFYNPFWYQFGEYINKAGQVINGDQ-AIFFQQIKDHAPLTAGT 272
>gi|196247959|ref|ZP_03146661.1| PTS system, glucose-specific IIBC subunit [Geobacillus sp. G11MC16] >gi|196212743|gb|EDY07500.1| PTS system, glucose-specific IIBC subunit [Geobacillus sp. G11MC16] (664 aa)
Score = 635, Expect = 1.1e-63, Identities = 156/441 (35%), Positives = 253/441 (57%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGE--NTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVL 858
           +  G+++ GK+ F++ GLPA A AM   A  +N+K    + ++A  T+ LTGITEP+E+TFLF+AP L +  H  +  L+F LM  + +            ++G +   G+ID+I++G I    G   W+  I GLA A +Y+ +F + IKK+++ TPGRG+  + RL+T++DY+ K N+     S ES+ N +  A  V++A GG +NI N+DACIT+LR+ +K++  V+  KL  LGA G ++     V A+FG  +D +K  I  +M                                    +T+    +  + + +P +G +V+L KVPDE FS+ MMG GIA++PT+G +YSP+DG++  VF T HA +  +++G ++LIH+G++++NLK + G E+K     V   D +K G  I    +  + +   +TITPII+L
  S:   275 ITAGRFMAGKFPFVLFGLPAVALAMYHTAKPKNKKAVAGLLLTAAGTAFLTGITEPLEFTFLFVAP-LLYVFHTLMAGLSFMLMYVLDV------------NVGYAGGSGIIDFILFG-ILPGVGEPWWYVIIVGLAMAVVYYVVFRWAIKKWDLLTPGRGDEDSNRLYTRKDYEEKTNR----KSDESVVNQK--AYEVLAALGGKENINNLDACITRLRVGVKNKGAVNKEKLKALGASGVLEVG-NGVQAIFGPTSDTLKNQILDIMNQ----------------------------------ETNEHKEESTIGLVAPLSGNVVALKKVPDEVFSQKMMGDGIAIQPTSGDVYSPVDGEIVNVFPTKHAITLRSDEGAELLIHLGLETVNLKGE-GFEIK-----VSPKDKIKKGDLIAQFAINQIGEKGYNTITPIILL 657
Score = 303, Expect = 3.4e-25, Identities = 86/269 (31%), Positives = 144/269 (53%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTN------AGGNEGL-RVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALG--QAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAY 309
           +F  ++ K  M+ I++LP AG+ +G+G+ + +          + G  +   + ++  G A+FG L +LFAI IA ++TG    A+L+  +GYL+  +               VIG         + G++  N + P  +    +GI  LQ  VFGG ++GF+ A LY K+ + K+  ++ FF G RFVPI+T      + ++   +WP V   +  LG AL       +  FI+G +ERAL+PFGLHH FY P+ +++ GG+      +++  D   Y
  S:     8 DFFQRIGKTFMVIISLLPAAGLLMGIGTTLQSPYLIEYLPFLDSGFWKTISDLMKGAGKAIFGNLGVLFAIGIAGSWTGGKAAASLSALVGYLVMHT---------------VIGI--------VLGITPENVSEPGRVLE--LGIPTLQIGVFGGIIIGFVAAVLYKKYHDFKMPEMLSFFGGSRFVPIITAGYSIIIALILAFVWPHVQDGIYALGTALSGENTPPLYMFIYGVVERALIPFGLHHIFYIPIRFSEVGGTYTTLAGSVVSGDTAMY 260
>gi|15925528|ref|NP_373062.1| PTS system, glucose-specific II ABC component [Staphylococcus aureus subsp. aureus Mu50] >gi|15928117|ref|NP_375650.1| PTS system, glucose-specific IIABC component [Staphylococcus aureus subsp. aureus N315] >gi|156980853|ref|YP_001443112.1| PTS system, glucose-specific II ABC component [Staphylococcus aureus subsp. aureus Mu3] >gi|13702488|dbj|BAB43629.1| PTS system, glucose-specific IIABC component [Staphylococcus aureus subsp. aureus N315] >gi|14248312|dbj|BAB58700.1| PTS system, glucose-specific II ABC component [Staphylococcus aureus subsp. aureus Mu50] >gi|156722988|dbj|BAF79405.1| PTS system, glucose-specific II ABC component [Staphylococcus aureus subsp. aureus Mu3] (688 aa)
Score = 632, Expect = 2.1e-63, Identities = 160/447 (35%), Positives = 248/447 (55%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREI 867
           G +  GKY FM+ GLPAAA A+   A  E +K+   + +SAG T+ LTGITEP+E++FLF+AP L+ G+H  L   +F +M+ +G+             IGM+FSGG ID+I+YG +     S+A      G+ YA +Y+FLF F I+KF ++TPGR              +  + +I  SS +      L  +V+ A GG +NIK++DACIT+LR+++ D+S VD A +  LGA G ++    ++ A+FG ++D IK ++  +M    + P             S+T+   E+  E   V+           + +P  G+I+ L++VPD+ F+  MMG GI   P  G+I +P DG +  +F T HA   E+E G ++LIH+GID++ L  +  + L      +   + V   Q +  V LA LK HA S +TP+I+ N  LE +E+
  S:   283 GAFTTGKYPFMMFGLPAAAFAIYKNARPERKKVVGGLMLSAGLTAFLTGITEPLEFSFLFVAPVLY-GIHVLLAGTSFLVMHLLGV------------KIGMTFSGGFIDYILYGLLNWDR-SHALLVIPVGIVYAIVYYFLFDFAIRKFKLKTPGR--------------EDEETEIRNSSVA-----KLPFDVLDAMGGKENIKHLDACITRLRVEVVDKSKVDVAGIKALGASGVLEVG-NNMQAIFGPKSDQIKHDMAKIMSGEITKP-------------SETTVTEEMSDEPVHVEALGTTD-----IYAPGVGQIIPLSEVPDQVFAGKMMGDGIGFIPEKGEIVAPFDGTVKTIFPTKHAIGLESESGVEVLIHIGIDTVKLNGEGFESL------INVDEKVTQAQPLMKVNLAYLKAHAPSIVTPMIITN--LENKEL 670
Score = 415, Expect = 3.0e-38, Identities = 98/245 (40%), Positives = 138/245 (56%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSL----YGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQ-ALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + ++ K LMLP+A+LP AGI L  G+A+       +     N+ + +  + ++  G  VF  LPLLFA+  A+   G  G AALA  +GYLI  +           T G V+   +     +IF  + G   L  +     +  V+GI  LQ+ VFGG ++G L A+ YNKF NI L P +GFF G RFVPIVT +      +L    WP +   L  L    L + + + +FIFG IER+L+PFGLHH FYSP W+
  S:     9 LQRIGKALMLPVAILPAAGILLAFGNAMHNEQLVEIAPWLKNDIIVMISSVMEAAGQVVFDNLPLLFAVGTALGLAGGDGVAALAALVGYLIMNA-----------TMGKVLHITI----DDIFSYAKGAKELSQAAKEPAHALVLGIPTLQTGVFGGIIMGALAAWCYNKFYNITLPPFLGFFAGKRFVPIVTSVVAIATGVLLSFAWPPIQDGLNSLSNFLLNKNLTLTTFIFGIIERSLIPFGLHHIFYSPFWF 250
>gi|56419526|ref|YP_146844.1| PTS system, glucose-specific enzyme II, A component [Geobacillus kaustophilus HTA426] >gi|56379368|dbj|BAD75276.1| PTS system, glucose-specific enzyme II, A component [Geobacillus kaustophilus HTA426] (672 aa)
Score = 631, Expect = 2.9e-63, Identities = 169/462 (36%), Positives = 254/462 (54%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           +  G ++ GK+ FM+ GLPAAA A+   A  EN+K+   I  SA  TS LTGITEPIE++FLF+AP LF  +H     L+F +M+ + +             IGM+FSGG+ID++++G +       AWW  I  GL +A IY+F F F I+K+++ TPGR +      K +     +                L   V++A GG +NI+++DACIT+LR+ + D   VD  +L  LGA G ++    +V A+FG ++D++KG I+ +M+    +P   +  E+    ++  ++ SE                    + SP +GE+V LA+VPD+ FS+ MMG G AV PT G + SP+DGK+  VF T HA   ++  G ++LIHVGID++ L  +       F   VK GD VK GQ I  V L  +K +A S +TP+I  N  L+  E   + K G + +G
  S:   266 LTAGTFMTGKFPFMMFGLPAAALAIYHEARPENKKVVAGIMGSAALTSFLTGITEPIEFSFLFVAPALF-AIHCVFAGLSFMIMHLLNV------------KIGMTFSGGVIDFLLFGVLP---NRTAWWLVIPVGLVFAVIYYFGFRFAIRKWDLATPGREKTVEEAPKAEAAAAGD----------------LPYEVLAALGGKENIEHLDACITRLRVSVHDIGQVDKDRLKALGAAGVLEVG-NNVQAIFGPKSDMLKGQIQDIMQ--GKAP---ARAEEKPKAAAPEAAKSET-------------------IASPMSGEVVPLAEVPDQVFSQKMMGDGFAVMPTDGTVVSPVDGKIINVFPTKHAIGIQSAGGHEMLIHVGIDTVKLNGQG------FEALVKEGDEVKKGQPILRVDLDYVKQNAPSIVTPVIFTN--LKAGETVHVNKQGPVARG 664
Score = 400, Expect = 2.0e-36, Identities = 97/245 (39%), Positives = 133/245 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGN-------EGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + K+ K LMLP+A+LP AGI L +G+A+   A  +       + + +  N ++  G  VF  L LLFA+ +AI   G  G A LA  IGYLI       +    +D  GA                       PS  Y  ++GI  LQ+ VFGG +VG L A++YNK+ NI+L   +GFF G RFVPIVT  +   + IL   +WP +   L      +  A   + +FIFG IERAL+PFGLHH FY+P W+
  S:     8 LQKVGKALMLPVAILPAAGILLALGNALKNPALTDKIPALKADWVVLISNVMEQAGGIVFSNLSLLFAVGVAIGLAGGDGVAGLAAIIGYLIMNVTMSVILGVTSDMIGAD----------------------PS--YANILGIPTLQTGVFGGIIVGILAAYMYNKYFNIELPQYLGFFAGKRFVPIVTAASAVVLGILMTFVWPPIQHGLNAFSHNMIDANKTLAAFIFGVIERALIPFGLHHIFYAPFWF 236
>gi|172058316|ref|YP_001814776.1| PTS system, glucose-specific IIBC subunit [Exiguobacterium sibiricum 255-15] >gi|171990837|gb|ACB61759.1| PTS system, glucose-specific IIBC subunit [Exiguobacterium sibiricum 255-15] (701 aa)
Score = 630, Expect = 4.1e-63, Identities = 165/461 (35%), Positives = 248/461 (53%)
  Q:   399 NLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKE--VVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKH-AKSTITPIIVLN 859
           NL +G Q +             G Y+ GKY FM+ GLPAA  AM     K+ RK    +  SA  TS LTGITEP+E++F+F+AP LF  VHA    L+F +M+ + +             IGM+FSGG+ID+ ++G   I     +WW  I  GL +A IY+F F F+I+KF+++ PGR                  +Q   ++      + L   ++ A+GG  NIK++DACIT+LRI + D+S V+  +L QLGA G ++    +V A+FG ++D IK  +  +M + +  P +K E + I    +   + +E + +    +  TD      +  V SP +G I SL  VPD+ FS  MMG G A++PT G + SP+ G+++  F T HA     + G +ILIH+GID+++L+ K       F    K GD V+ G  +  V L  ++    S +TPIIV N
  S:   253 NLVNGDQRIFFAQLKDGVPFTAGTYMTGKYPFMMFGLPAACLAMYHTVAKDRRKAVEGLYFSAALTSFLTGITEPVEFSFVFVAPLLF-AVHAVFAGLSFMIMDILNV------------KIGMTFSGGLIDYTLFG---ILPNRTSWWLVIPVGLVFAVIYYFGFRFVIQKFDLKIPGR----------------EAIQEGAATAGATAGE-LPYEILQAFGGPSNIKHLDACITRLRITVNDKSGVNKERLKQLGAAGVLEVG-DNVQAIFGPKSDGIKTEMAEIMNDPNYQPPVKPEADPIPQVPTGAEARTENRTDDRSGLAGTDGAYVPSEGYV-SPLSGVIRSLDDVPDQVFSGRMMGDGYAIEPTEGYVVSPVSGEITTFFPTKHAIGILADNGDEILIHIGIDTVSLEGKG------FEALAKAGDRVEPGSPLLNVDLEQIRPLVPSLLTPIIVTN 676
Score = 358, Expect = 1.4e-31, Identities = 96/259 (37%), Positives = 133/259 (51%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGG-------NEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSL-YGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLM--IWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAI 301
           + ++ K LMLP+A+LP AG+ L  G+A              N+ L V    +Q  G+ +F  L LLFA+ +AI      G A LA  +G+LI   +  +  Q   +                        A   S L Y  V+GI  LQ  VFGG + G + A+ YNKF  IKL   +GFF G RFVPI T  ALF +   F +  IWP +G  + TF    +     +++FIFG +ER+L+PFGLHH +YS  W+ Q G   D   N +
  S:     9 LQRIGKALMLPVAILPAAGLLLAFGTAFQNPNLTQYLPFLENDALVVIWRVMQDAGDIIFANLGLLFAVGVAIGLANGEGVAGLAAIVGFLIMNKVISSFLQITPEKI--------------------TEAQKSSDLSYATVLGIPTLQMGVFGGIIAGLIAAYSYNKFFKIKLPDFLGFFAGKRFVPIAT--ALFSLVAGFALSYIWPPIGTGINTFSKTIIESNETLSAFIFGLVERSLIPFGLHHIWYSSFWF-QFGEYTDKAGNLV 255
>gi|82752121|ref|YP_417862.1| PTS system glucose-specific IIABC component [Staphylococcus aureus RF122] >gi|82657652|emb|CAI82100.1| PTS system glucose-specific IIABC component [Staphylococcus aureus RF122] (688 aa)
Score = 629, Expect = 4.9e-63, Identities = 159/447 (35%), Positives = 248/447 (55%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREI 867
           G +  GKY FM+ GLPAAA A+   A  E +K+   + +SAG T+ LTGITEP+E++FLF+AP L+ G+H  L   +F +M+ +G+             IGM+FSGG ID+I+YG +     S+A      G+ YA +Y+FLF F I+KF ++TPGR              +  + +I  SS +      L  +V+ A GG +NIK++DACIT+LR+++ D+S VD A +  LGA G ++    ++ A+FG ++D IK ++  +M    + P             S+T+   E+  E   V+           + +P  G+I+ L++VPD+ F+  MMG G+   P  G+I +P DG +  +F T HA   E+  G ++LIH+GID++ L  +  + L      +   + V  GQ +  V LA LK HA S +TP+I+ N  LE +E+
  S:   283 GAFTTGKYPFMMFGLPAAAFAIYKNARPERKKVVGGLMLSAGLTAFLTGITEPLEFSFLFVAPVLY-GIHVLLAGTSFLVMHLLGV------------KIGMTFSGGFIDYILYGLLNWDR-SHALLVIPVGIVYAIVYYFLFDFAIRKFKLKTPGR--------------EDEETEIRNSSVA-----KLPFDVLDAMGGKENIKHLDACITRLRVEVVDKSKVDVAGIKALGASGVLEVG-NNMQAIFGPKSDQIKHDMAKIMSGEITKP-------------SETTVTEEMSDEPVHVEALGTTD-----IYAPGVGQIIPLSEVPDQVFAGKMMGDGVGFIPEKGEIVAPFDGTVKTIFPTKHAIGLESGSGVEVLIHIGIDTVKLNGEGFESL------INVDEKVTQGQPLMKVNLAYLKAHAPSIVTPMIITN--LENKEL 670
Score = 412, Expect = 7.1e-38, Identities = 97/245 (39%), Positives = 138/245 (56%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSL----YGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQ-ALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + ++ K LMLP+A+LP AGI L  G+A+       +     N+ + +  + ++  G  VF  LPLLFA+  A+   G  G AALA  +GYLI  +           T G V+   +     +IF  + G   L  +     +  V+GI  LQ+ VFGG ++G L A+ YNKF NI L P +GFF G RFVPIVT +      ++    WP +   L  L    L + + + +FIFG IER+L+PFGLHH FYSP W+
  S:     9 LQRIGKALMLPVAILPAAGILLAFGNAMHNEQLVEIAPWLKNDIIVMISSVMEASGQVVFDNLPLLFAVGTALGLAGGDGVAALAALVGYLIMNA-----------TMGKVLHITI----DDIFSYAKGAKELSQAAKEPAHALVLGIPTLQTGVFGGIIMGALAAWCYNKFYNITLPPFLGFFAGKRFVPIVTSVVAIATGVVLSFAWPPIQDGLNSLSNFLLNKNLTLTTFIFGIIERSLIPFGLHHIFYSPFWF 250
>gi|163764631|ref|ZP_02171686.1| DNA repair protein RadC [Bacillus selenitireducens MLS10] >gi|160354812|gb|EDP81470.1| DNA repair protein RadC [Bacillus selenitireducens MLS10] (673 aa)
Score = 628, Expect = 5.8e-63, Identities = 162/442 (36%), Positives = 236/442 (53%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKH-AKSTITPIIVLN 859
           V  G Y+ GK+ FM+ GLPAAA A+   A  EN+K+   I  SA  TS LTGITEPIE++FLF+AP LF  +H     L+F  M+ + +             IGM+FSGG+ID+ +YG   I  G   WW  I  GL +A IY+F F F I KFN+ TPGR E                   + S++  + +  L   V+ A GG DNI  +DACIT+LR+ + D   VD  +L QLGA G +    +++ A+FG  ++ IKG ++ ++     +P     YE       D ++A  V P +     D  +         P  GE++ LA VPD  F++ MMG G A++P+ G + SP++G++  +F T HA     + GT++L+H+G+D++N+K         F   V  GD V VG E+    L  +K  AK+  TP+I  N
  S:   266 VTAGAYMTGKFPFMMFGLPAAALAIYHCARPENKKVVAGIMSSAALTSFLTGITEPIEFSFLFVAPLLF-AIHTIFAGLSFMTMHLLDV------------QIGMTFSGGVIDFFLYG---ILPGRTEWWLVIPVGLVFAVIYYFGFRFAITKFNLMTPGREEANG----------------DASAKKSSGNTELPYEVLKAMGGKDNITYLDACITRLRMAVHDTEQVDKERLKQLGASGVMTID-KNIQAIFGPRSETIKGQMRDIIN--GKAP---EAYE-------DPNAA--VAPSQVASTIDLAM---------PLEGELIDLANVPDNMFAEKMMGDGFAIEPSDGLVVSPVNGEVVNLFPTMHAIGLLADDGTEVLVHIGVDTVNMKGDG------FEAFVSQGDRVAVGDELIRFDLELVKQKAKAATTPVIFTN 647
Score = 408, Expect = 2.0e-37, Identities = 105/257 (40%), Positives = 142/257 (55%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAG-------GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N    + K+ + LMLP+A+LP AGI L  G A+             +E + +    +Q  G+ VFG LPLLFA+ +AI  +   G A LA  IGYLI             + T +VIG           G+ A +A   S     V+GI  LQ+ VFGG + G L A++YN+F NI+L   +GFF G RFVPIVT  +   + +   M+WP     L  L   + +A   +++FIFG +ERAL+PFGLHH FYSP W     YT A G I
  S:     3 NAFGILQKVGRSLMLPVALLPAAGILLAFGDAMQNPDMIARFAFLDSEIIALIAEMMQASGDIVFGNLPLLFAVGVAIGLSDGDGVAGLAAIIGYLIM------------NVTMSVIG-----------GIDA-SALEGSPDLANVLGIPTLQTGVFGGIIAGLLGAYMYNRFFNIELPSYLGFFAGKRFVPIVTAASAILLGVAMHMLWPFAQDGLNSLAYFMTEANRTLSTFIFGVVERALIPFGLHHIFYSPFWFEFGSYTNAAGEI 248
>gi|70725522|ref|YP_252436.1| phosphotransferase system enzyme II [Staphylococcus haemolyticus JCSC1435] >gi|68446246|dbj|BAE03830.1| phosphotransferase system enzyme II [Staphylococcus haemolyticus JCSC1435] (675 aa)
Score = 623, Expect = 2.2e-62, Identities = 162/440 (36%), Positives = 247/440 (56%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNE 860
           G+++QG++  M+ GLPAAA A+   A  EN+K+   + +SA  TS LTGITEP+E++FLF+AP LF+ +HA L  L+F  +              L  H+G +FSGG ID+++ G +        WW  I  GL YA IY+ +F FLI KFN +TPGR            ++KQ  V    +S+       L  +V+ A GG +NIK++DACIT+LR+++ D+S VD   L  LGA G ++    ++ A+FG ++D IK ++  +M    + P+  +    +  ++SD     E     EV +TD         + +P TG I+ L++VPD+ FS+ MMG GI   P  G I +P DG +  +F T HA   E++ G ++LIH+GID++ L  +  + L      V   + V  GQ +  + LA LK HA S +TP+I+ N+
  S:   271 GKFMQGEFPVMMFGLPAAALAIYQTAKPENKKVVGGLMLSAALTSFLTGITEPLEFSFLFVAPLLFF-IHAVLDGLSFLTLY------------LLNLHLGYTFSGGFIDFVLLGILP---NKTPWWLVIPVGLVYAVIYYVVFRFLIVKFNFKTPGR------------EDKQASVANTSASK-------LPFDVLDAMGGKENIKHLDACITRLRVEVNDKSKVDVEGLKALGASGVLEVG-NNMQAIFGPKSDQIKHDMARIMNGDITKPSETT----VTEDTSDEPVQLE-----EVKETD---------IYAPGTGHIIPLSEVPDKVFSEKMMGDGIGFVPEKGGIVAPFDGTVKTIFPTKHAIGLESDTGIEVLIHIGIDTVKLNGEGFESL------VDVNEPVTQGQPLMKINLAYLKEHAPSVVTPVIITNQ 652
Score = 377, Expect = 7.7e-34, Identities = 89/245 (36%), Positives = 130/245 (53%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAG-------GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + ++ K LMLP+A+LP AG+ L +G+A    A         N  ++   N +   G  +F  LP++FA+ +AI   G  G AA+A F+G++I           +  T GA +             ++      PS  +  V+GI  LQ+ VFGG ++G L A+ YNKF NI L   +GFF G RFVPI+     F +      IWP +   L  F    L    G+  F+FGFI+R L+PFGLHH F++P W+
  S:     9 LQRIGKALMLPVAILPAAGLLLAIGTAFQGEALQQYLPFIKNGVIQNIANMMTGAGGIIFDNLPIIFALGVAIGLAGGDGVAAIAAFVGFII-----------MNKTMGAFLN------------VTPAQLEDPSKGFANVLGIPTLQTGVFGGIIIGALAAWCYNKFYNISLPSYLGFFAGKRFVPIMMATTSFILAFPMAWIWPFIQNGLNAFSTGLLDSNTGLAVFLFGFIKRLLIPFGLHHIFHAPFWF 238
>gi|28210041|ref|NP_780985.1| PTS system, glucose-specific IIABC component [Clostridium tetani E88] >gi|28202476|gb|AAO34922.1| PTS system, glucose-specific IIABC component [Clostridium tetani E88] (669 aa)
Score = 622, Expect = 3.3e-62, Identities = 170/449 (37%), Positives = 250/449 (55%)
  Q:   419 NVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKH-AKSTITPIIVLN-ESLEGREI 867
           + G ++  +Y  ++ GLP AA AMV+ A KENRK    +  SA   + +TGITEPIE++F+F+AP LF  V   L A   GL+  I           L   +G +FS   ID+I+      ++  NA   +  G+A+  +YF +FYF+IKKFNI+TPGR +N    +KE +  K  K           +D+  A  V+ A GG +NIK +DAC+T+LR+ + D S VD   L  LG+ G ++ +  SV  +FG +A+ IK +IK ++ N S  P  + E      +  D    + +K E               ++ +P  GE+V L KVPDE FSK M+G G AV+    K+Y+PI+G++S++F T HA +  T  G +ILIHVGID++ L+ +       F  +VK GDTVK G  + TV    +K+  KS +TP+IV N E +E  EI
  S:   257 SAGIFMASEYPNIMFGLPGAALAMVLTAKKENRKAVAGMMASAALVAFVTGITEPIEFSFIFVAPMLF--VFHVLAAFIGGLVTKI-----------LDIRLGYTFSASAIDYIL----GFKFTGNALLIWPVGIAFFILYFVVFYFVIKKFNIKTPGREDNKA--SKEQFIIKDLK----------RDDR--AFKVLEALGGKNNIKELDACMTRLRLNLVDTSKVDKNTLKALGSAGVME-AGNSVQVIFGTDAERIKDDIKNVINN-SYEPLEEKENYNEKEDFKDDLKKNNIKEE---------------IILTPIEGEVVELEKVPDEVFSKKMLGDGFAVEIKGDKVYAPIEGEISVIFPTKHAIAITTNNGLEILIHVGIDTVELQGEG------FISHVKQGDTVKKGDLLLTVDKEFIKNKGKSLMTPVIVTNMEKVESIEI 653
Score = 321, Expect = 2.4e-27, Identities = 84/245 (34%), Positives = 125/245 (51%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + K+ K LMLP+++LP AGI L +G   + N            +L   G+A+F  LP++FA+ +AI F+G  G AALA  +G  I       + +   D    +    +   QG  F +   +A      Y  ++ +NQ+   VFGG ++G   A LYNK+ NIKL   +GFF G RFVPIVT +A   + I+ + +WP +   +  F   A     G   +  G  +R L+P GLHH +Y P  Y
  S:     8 LQKIGKSLMLPVSVLPAAGILLRLGQPDLLNM----------PYLATAGDAIFTNLPMIFAVGVAIGFSGGEGTAALAAVVGQFIL----QGIIKVAGDNFAQIAAEQIAKAQGMAFDIFKNSAE-----YTEIVRLNQINMGVFGGIIIGLTAAILYNKYHNIKLPQALGFFAGKRFVPIVTSIASLIIAIIGVKVWPELQKGIDVFARWASTSPYGPALYASG--KRLLIPVGLHHMYYPPFLY 232
>gi|76788605|ref|YP_330514.1| PTS system, glucose-specific IIABC component, putative [Streptococcus agalactiae A909] >gi|77405082|ref|ZP_00782182.1| PTS system, IIABC components [Streptococcus agalactiae H36B] >gi|76563662|gb|ABA46246.1| PTS system, glucose-specific IIABC component, putative [Streptococcus agalactiae A909] >gi|77176376|gb|EAO79145.1| PTS system, IIABC components [Streptococcus agalactiae H36B] (727 aa)
Score = 621, Expect = 4.8e-62, Identities = 239/838 (28%), Positives = 377/838 (44%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFT----GDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKS-VWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKD-QSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKK 878
           EF  K  K LM+ IA++P AG+ + +G++I      N  L    N +   G  V G L +LFA+AI  ++     G A  A L+  +  LI G+     +  + D+   V           +FG +       S  +  V+G   L   VF G + GF+ A  +NK+ N  KL   + FFNG RFVP V       V ++  + WP+V   +   G+ +      A  +  F++G +ER L+PFGLHH    P+ YTQ                G  Y VL  +T                                    A +LG+  +WL      W    IN                   L  SN +     L ++    FK   VGQ +    + M L     + AM     K+ +    S+ +SA   + LTG+TEPIEY F+F A  L+  V+A +   AF + + + L V + G+ E    + M    G+             G + +      L +A + +F+  F+IKKFN+ T GR  N   +  E+  N  +    +GS+++  N QV+   V++  GG DNI++VDAC+T+LR+ +KD  SV   A   + GA G +      V A++G +AD++K +I+ L+++ +  P +  E       +    +A++V   K +         E++V  S   G++ +L  V D  FS+ MMG G AV+PT G IY P+ G ++ VF T HA+   TE G ++L+H+G+D++ L        +PF   + +G  V  G       L  +K A    + IIV     + + +K  K   +I K
  S:    12 EFWQKFGKALMVVIAVMPAAGLMVSIGNSISLLDPSNVLLGRIANVIAQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLSFILINLITGNFFGVKTDMLADSKATV---------QTVFGATI----RVSDYFVNVLGQPALNMGVFVGIISGFVGATAFNKYYNYRKLPDALTFFNGKRFVPFVVIYRSVIVALILSVFWPVVQSGINGFGKWIASSQDSAPILAPFVYGTLERLLLPFGLHHMLTIPMNYTQL---------------GGTYTVLTGATK----------------------------------GAQVLGQDPLWL-----AWVGDLIN-------------------LKGSNSSQYHHLLTSVTPARFK---VGQMIGASGILMGL-----SYAMYRNVDKDKKLKYKSMFISAAAATFLTGVTEPIEYMFMFAAMPLYL-VYAVVQGCAFAMADIVNLRVHSFGNIEFLTRVPMGIKAGL-------------GGDIFNFVWVTLLFAVLMYFIANFMIKKFNLATAGRNGN---YDNEEVDNAPSTA--SGSADA--NSQVV--QVINLLGGRDNIEDVDACMTRLRVTVKDGNSVGSEAAWKKAGAMGLVLKG-NGVQAIYGPKADVLKSDIQDLLDSGTVIPIVDLE-------TGQPVAAAQVTTYKGIT--------EEIV--SVANGQVEALDVVKDPVFSQKMMGDGFAVEPTDGNIYVPVSGTVTSVFPTKHAFGLLTESGLEVLVHIGLDTVALDG------QPFEVKISSGQKVVAGDLAVVADLEAIKAAGKETSVIIVFTNVSDIKTVKLEKSGPQIAK 719
>gi|77407881|ref|ZP_00784633.1| PTS system, IIABC components [Streptococcus agalactiae COH1] >gi|77173526|gb|EAO76643.1| PTS system, IIABC components [Streptococcus agalactiae COH1] (727 aa)
Score = 620, Expect = 5.2e-62, Identities = 239/838 (28%), Positives = 379/838 (45%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLS----AGNAALPSSLYGA----------VIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKS-VWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKD-QSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKK 878
           EF  K  K LM+ IA++P AG+ + +G++I      N  L    N +   G  V G L +LFA+AI  ++  +    A A  + +++                      NL+   GN FG+     A + A   +++GA          V+G   L   VF G + GF+ A  +NK+ N  KL   + FFNG RFVP V       V ++  + WP+V   +   G+ +      A  +  F++G +ER L+PFGLHH    P+ YTQ                G  Y VL  +T                                    A +LG+  +WL      W    IN                   L  SN +     L ++    FK   VGQ +    + M L     + AM     K+ +    S+ +SA   + LTG+TEPIEY F+F A  L+  V+A +   AF + + + L V + G+ E    + M    G+             G + +      L +A + +F+  F+IKKFN+ T GR  N   +  E+  N  +    +GS+++  N QV+   V++  GG DNI++VDAC+T+LR+ +KD  SV   A   + GA G +      V A++G +AD++K +I+ L+++ +  P +  E       +    +A++V   K +         E++V  S   G++ +L  V D  FS+ MMG G AV+PT G IY P+ G ++ VF T HA+   TE G ++L+H+G+D++ L        +PF   + +G  V  G       L  +K A    + IIV     + + +K  K   +I K
  S:    12 EFWQKFGKALMVVIAVMPAAGLMVSIGNSIRLLDPSNVLLGRIANVIAQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLSFILI---------------------NLI--TGNFFGVKTDMLANSKATVQTVFGATIRVSDYFVNVLGQPALNMGVFVGIISGFVGATAFNKYYNYRKLPDALTFFNGKRFVPFVVIYRSVIVALILSVFWPVVQSGINGFGKWIASSQDSAPILAPFVYGTLERLLLPFGLHHMLTIPMNYTQL---------------GGTYTVLTGATK----------------------------------GAQVLGQDPLWL-----AWVGDLIN-------------------LKGSNSSQYHHLLTSVTPARFK---VGQMIGASGILMGL-----SYAMYRNVDKDKKLKYKSMFISAAAATFLTGVTEPIEYMFMFAAMPLYL-VYAVVQGCAFAMADIVNLRVHSFGNIEFLTRVPMGIKAGL-------------GGDIFNFVWVTLLFAVLMYFIANFMIKKFNLATAGRNGN---YDNEEVDNAPSTA--SGSADA--NSQVV--QVINLLGGRDNIEDVDACMTRLRVTVKDGNSVGSEAAWKKAGAMGLVLKG-NGVQAIYGPKADVLKSDIQDLLDSGTVIPIVDLE-------TGQPVAATQVTTYKGIT--------EEIV--SVANGQVEALDVVKDPVFSQKMMGDGFAVEPTDGNIYVPVSGTVTSVFPTKHAFGLLTESGLEVLVHIGLDTVALDG------QPFEVKISSGQKVVAGDLAVVADLEAIKAAGKETSVIIVFTNVSDIKTVKLEKSGPQIAK 719
>gi|22538095|ref|NP_688946.1| PTS system, IIABC components [Streptococcus agalactiae 2603V/R] >gi|25011984|ref|NP_736379.1| hypothetical protein gbs1946 [Streptococcus agalactiae NEM316] >gi|76797949|ref|ZP_00780210.1| PTS glucose-specific enzyme IIABC component ptsG [Streptococcus agalactiae 18RS21] >gi|77412884|ref|ZP_00789088.1| PTS system, IIABC components [Streptococcus agalactiae 515] >gi|22535001|gb|AAN00819.1|AE014280_11 PTS system, IIABC components [Streptococcus agalactiae 2603V/R] >gi|24413527|emb|CAD47605.1| Unknown [Streptococcus agalactiae NEM316] >gi|76586723|gb|EAO63220.1| PTS glucose-specific enzyme IIABC component ptsG [Streptococcus agalactiae 18RS21] >gi|77161024|gb|EAO72131.1| PTS system, IIABC components [Streptococcus agalactiae 515] (727 aa)
Score = 619, Expect = 7.7e-62, Identities = 240/838 (28%), Positives = 375/838 (44%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFT----GDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKS-VWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKD-QSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKK 878
           EF  K  K LM+ IA++P AG+ + +G++I      N  L    N +   G  V G L +LFA+AI  ++     G A  A L+  +  LI G+     +  + D+   V           +FG +       S  +  V+G   L   VF G + GF+ A  +NK+ N  KL   + FFNG RFVP V       V ++  + WP+V   +   G+ +      A  +  F++G +ER L+PFGLHH    P+ YTQ                G  Y VL  +T                                    A +LG+  +WL      W    IN                   L  SN +     L ++    FK   VGQ +    + M L     + AM     K+ +    S+ +SA   + LTG+TEPIEY F+F A  L+  V+A +   AF + + + L V + G+ E    + M    G+             G + +      L +A + +F+  F+IKKFN+ T GR  N   +  E+  N  +    +GS+++  N QV+   V++  GG DNI++VDAC+T+LR+ +KD  SV   A   + GA G +      V A++G +AD++K +I+ L+++ +  P +  E          T       P    V T   +++E V V +   G++ +L  V D  FS+ MMG G AV+PT G IY P+ G ++ VF T HA+   TE G ++L+H+G+D++ L        +PF   + +G  V  G       L  +K A    + IIV     + + +K  K   +I K
  S:    12 EFWQKFGKALMVVIAVMPAAGLMVSIGNSISLLDPSNVLLGRIANVIAQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLSFILINLITGNFFGVKTDMLADSKATV---------QTVFGATI----RVSDYFVNVLGQPALNMGVFVGIISGFVGATAFNKYYNYRKLPDALTFFNGKRFVPFVVIYRSVIVALILSVFWPVVQSGINGFGKWIASSQDSAPILAPFVYGTLERLLLPFGLHHMLTIPMNYTQL---------------GGTYTVLTGATK----------------------------------GAQVLGQDPLWL-----AWVGDLIN-------------------LKGSNSSQYHHLLTSVTPARFK---VGQMIGASGILMGL-----SYAMYRNVDKDKKLKYKSMFISAAAATFLTGVTEPIEYMFMFAAMPLYL-VYAVVQGCAFAMADIVNLRVHSFGNIEFLTRVPMGIKAGL-------------GGDIFNFVWVTLLFAVLMYFIANFMIKKFNLATAGRNGN---YDNEEVDNAPSTA--SGSADA--NSQVV--QVINLLGGRDNIEDVDACMTRLRVTVKDGNSVGSEAAWKKAGAMGLVLKG-NGVQAIYGPKADVLKSDIQDLLDSGTVIPIVDLE----------TGQPVAAAP----VTTYKGITEEIVSVAN---GQVEALDVVKDPVFSQKMMGDGFAVEPTDGNIYVPVSGTVTSVFPTKHAFGLLTESGLEVLVHIGLDTVALDG------QPFEVKISSGQKVVAGDLAVVADLEAIKAAGKETSVIIVFTNVSDIKTVKLEKSGPQIAK 719
>gi|187605888|ref|ZP_02992071.1| PTS system, glucose-specific IIBC subunit [Exiguobacterium sp. AT1b] >gi|187482054|gb|EDU20075.1| PTS system, glucose-specific IIBC subunit [Exiguobacterium sp. AT1b] (680 aa)
Score = 618, Expect = 1.0e-61, Identities = 157/439 (35%), Positives = 233/439 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           G Y+ GK+ FM+ GLPAA  AM    PKE RK    +  SA  TS LTGITEP+E++F+F+AP LF G+HA    L+F  M+ + +             IGM+FSGG+ID++++G +       AWW  I  GL +A IY+F F F I KF+++ PGR   T                  G    + +D  L   V+   GG +NIK++DACIT+LR+ + D   VD   L  LGA G ++    ++ A+FG ++D +K  I T++E     P  K E   I      T  A+E    + +               +P +G ++SL  VPD+ FS  MMG G A++P++G++ SP+ G+++  F T HA     + G ++LIHVG+D++NLK +       F   V+ G  V+ G  +  V L+ ++    S ITPII  N
  S:   271 GTYMTGKFPFMMFGLPAACLAMFHTVPKERRKDVEGLYFSAALTSFLTGITEPVEFSFVFVAPLLF-GIHAVFAGLSFMTMHLLNV------------KIGMTFSGGLIDYLLFGVLP---NRTAWWLVIPVGLVFAVIYYFGFRFAITKFDLKIPGRDVQT---------------GTKGDKAGIGDD--LPYEVLVGLGGPENIKHLDACITRLRVTVNDVKQVDKDLLKDLGAAGVLEVG-DNIQAIFGPKSDTLKSQIATIIEGGEYKPKEKVEKAVI------TPEAAEQADHRFL---------------APMSGVLLSLDDVPDQVFSGRMMGEGFAIEPSSGQVVSPVTGQITTFFPTKHAIGILADDGRELLIHVGLDTVNLKGEG------FTAKVEEGARVEAGDVLLEVDLSAIRDKVPSLITPIIWTN 650
Score = 376, Expect = 1.2e-33, Identities = 90/245 (36%), Positives = 128/245 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + ++ K LMLP+A+LP AG+ L  G+A        +     N+ L +    +   G+ VF  L LLFA+ +AI      G A LA  +GYLI   +                      + G    ++ G+       Y  V+GI  LQ  VFGG + G + A+ YNK+ NIKL   +GFF G RFVPI T      + I    IWP +G A+ TF    +   V +++FIFG +ER+L+PFGLHH +YSP W+
  S:    10 LQRVGKALMLPVAILPAAGLLLAFGTAFQNPDLVELLPFLANDSLVLIWQVMTDAGDIVFANLGLLFAVGVAIGLANGDGVAGLAAIVGYLIMNKVIST-------------------WNGITAEIAQGDPQ-----YATVLGIPTLQMGVFGGIIAGLVAAYAYNKYFNIKLPDFLGFFAGKRFVPIATAAFSLIIGIALAYIWPPIGNAINTFSSTVIEANVALSAFIFGLVERSLIPFGLHHIWYSPFWF 238
>gi|153810035|ref|ZP_01962703.1| hypothetical protein RUMOBE_00416 [Ruminococcus obeum ATCC 29174] >gi|149834213|gb|EDM89293.1| hypothetical protein RUMOBE_00416 [Ruminococcus obeum ATCC 29174] (722 aa)
Score = 617, Expect = 1.2e-61, Identities = 165/464 (35%), Positives = 255/464 (54%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGEN---TRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPE--KEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFEV 885
           +Y  G+++FMI GLP AA AM   A  E +K A  + +SA    + TGITEP+E++FLF+AP LF  V   L   A+ + + + + V            G++FSGG +D+ ++G +Q      +W   I  G+ Y  +Y+F+F F+IKKF+ +TPGR ++   T+L+TK D  N + + Q NG+ E+ ++D V +  +    GG  NI +VD C T+LR  +KD S+V+   L   GA G +      V  ++G    +IK N++  +E    +    +E       S +T   SE K +  ++VV        +++V++SP TG    L+  PDE F++ MMG G  V P    + +P DG+++ VFDT HA  F TE G  +LIHVGID++ L  +       F   V++G  VK G  +  + L  L K+A S ++P  VL   LE  +   L   G++K G PLFE+
  S:   289 RYFSGEFIFMIFGLPGAALAMYQCAKPEKKKQAGGLLLSAALACMATGITEPLEFSFLFVAPALF-AVQVVLAGSAYMIAHMLNIAV------------GLTFSGGFLDFFLFGILQGN-AKTSWMRVIPVGIIYFFLYYFIFKFMIKKFDFKTPGREDDDVETKLYTKADV-NARKEAQ-NGAVEAGSSDPV-SEAITRGLGGKKNISDVDCCATRLRCTVKDASLVNDGILKATGASGVVHKG-LGVQVIYGPNVTVIKSNLEDYLETAPDTLETPAE-------SVETPEVSEQKEDAGQKVV--------DRIVISSPITGVAAELSTAPDEAFAQKMMGDGAVVTPEDPYVRAPEDGEVAFVFDTKHAIGFVTESGISLLIHVGIDTVKLNGEG------FEALVESGQEVKKGDPMLKLDLDYLSKNAPSIVSP--VLCTELEDNQRIHLLNEGQVKAGEPLFEI 718
Score = 375, Expect = 1.6e-33, Identities = 98/273 (35%), Positives = 146/273 (53%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNE--GL-RVFGN---------FLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATS 315
           + ++ +  MLPIA+LP+AG+ LG+GS+  TNA   E  GL ++ G+          +   G+AVF  LPL+FA+ +AI     +   AAL+  I + +  +  +A+                L   G I        ++      +V GI  LQ  VFGG +VG  VA L+NKF  I+L   + FF G RFVPI++ +    V IL   +WP+V   +  LG  +     + + IFG I+RAL+PFGLHH FY P W T  GG++++    +       +A LA S
  S:     9 LQRVGRSFMLPIAILPVAGLLLGIGSSF-TNATTIETYGLTKILGDGTLLHSLMVIMNSVGSAVFNNLPLIFAVGVAIGMAKKEKEVAALSAVIAFFVMNTAINAM----------------LTVTGQILANGEIAESVLEGTITSVCGIQSLQMGVFGGIIVGLGVAALHNKFYRIQLPNALSFFGGTRFVPIISTIVYMFVGILLYFVWPVVQNGIYALGGLVTGTGYVGTLIFGLIKRALIPFGLHHVFYMPFWQTAVGGTMEVAGQMVQGGQNIFFAQLADS 277
>gi|167748849|ref|ZP_02420976.1| hypothetical protein ANACAC_03623 [Anaerostipes caccae DSM 14662] >gi|167651819|gb|EDR95948.1| hypothetical protein ANACAC_03623 [Anaerostipes caccae DSM 14662] (701 aa)
Score = 605, Expect = 2.9e-60, Identities = 157/463 (33%), Positives = 248/463 (53%)
  Q:   417 GVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGR---GENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
            V+  +++ GK+  MI GLP AA AM   A  E RK    + +SA  TS+LTGITEP+E+TFLF+AP L+  +H      A+ LM+ + + V            G++FSGG+ID  ++G +Q Q  +N W  FI  GL Y  +Y+F+F FLI+K +++TPGR    +  +L+T+ D   +  K       E  +   + AL + +  GG +NIK+VD C+T+LR  I D S V+   L + G+RG +K     V  ++G    +IK N++  +                   SS +  A+E  P   V +   E++ E V +  P  GE V L +V DE F++ M+G G AV+P+ G + SP+DG ++ VF+T HA    +  G ++L+H+GID++ L  K       +   V++G  V+ G  I    L  +K     +T  +V++ S E   I  ++ +GE+  G
  S:   276 AVSATRFMTGKFPLMIFGLPGAAFAMYRCAEPEKRKAVGGLLISAALTSMLTGITEPLEFTFLFVAPGLYV-IHCVFAGAAYMLMHILNVCV------------GLTFSGGIIDMFLFGVLQGQAKTN-WLMFIPVGLIYFTVYYFMFSFLIRKLDLKTPGREKEDKEIKLYTRADMAAEHQK-----EGEETDGSDLSAL-IAAGLGGKENIKDVDCCVTRLRCTIADPSKVNDRMLQKSGSRGIVKKG-DGVQIIYGPMVTVIKSNLEDYLA------------------SSLSDRAAEA-PRAPVAEEMPEVAAETVCM--PVNGEAVELDEVEDEVFAEGMLGQGFAVRPSDGNVISPVDGTVTTVFNTKHAICITSGGGAEVLVHMGIDTVKLAGKY------YHVKVESGMKVRKGDRIAEFDLEKIKQEGFFVTTPVVVSNSEEYTSIT-IENTGELDAG 693
Score = 381, Expect = 3.2e-34, Identities = 99/276 (35%), Positives = 148/276 (53%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVT----NAGGNEG-----------LRVFGNFLQVPGNAVFGALPLLFAIAIAIAFT-GDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTAT 318
           + ++ +  MLPIA+LP+AG+ LG+G ++      +A G  G           L+V G+     GNAVFG LPL+FAI +A+     +   AALA  I + I   +  A+S  ++                    ++ G AA+      +V+GI  LQ  VFGG +VG  VA L+NKF  I+L   + FF G RFVP+++ +    V I+   IWP +   +   G  +  +    +FI+G +ERAL+PFGLHH FY P W T  GG++++    I       +A LA    T
  S:     9 LQRVGRSFMLPIAILPVAGLLLGIGQSLTNETMLSAYGLLGVMGPDTIPYAVLKVCGDC----GNAVFGNLPLIFAIGVAVGMARAEKEVAALAGAIAFFI---MHTAISAMIS--------------------INGGAAAMREGATTSVLGITSLQMGVFGGIIVGLGVAALHNKFYKIRLPEALSFFGGTRFVPVISTVVFVFVGIIMYFIWPPIQDVMYAAGGLVSASGYFGTFIYGVMERALIPFGLHHVFYLPFWQTSLGGTMEIGGRMIDGAQNIFFAQLADPGTT 273
>gi|153855096|ref|ZP_01996290.1| hypothetical protein DORLON_02303 [Dorea longicatena DSM 13814] >gi|149752411|gb|EDM62342.1| hypothetical protein DORLON_02303 [Dorea longicatena DSM 13814] (730 aa)
Score = 604, Expect = 4.3e-60, Identities = 154/464 (33%), Positives = 247/464 (53%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGR---GENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSP-NLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFEV 885
           +Y  G+++FMI GLP AA AM   A  E +K A  + +SA  T +LTGITEP+E++FLF+AP LF  V   L   A+ + + + + V            G++FSGG +D +++G +Q      +W   I  G+ Y  +Y+F+F FLIKK +++TPGR    E T+L+TK D   ++      G++    ++  L+  +    GG  NI++VD C T+LR  + +  +V+   L   GA G +    Q V  ++G    +IK +++  +E+        + + E    N+S+ ++  +   EK+VV T        +V++SP TG    L+  PDE F+  MMG G  V P    + +P DG++  VFDT HA  F TE G  +LIHVGID++ L  K       F   V+ G  V+ G  +  + L  L+    ++   ++  E  + ++I+ L + GEIK G  LF +
  S:   289 RYFSGEFIFMIFGLPGAALAMYRTAKPEKKKAAGGLLLSAALTCMLTGITEPLEFSFLFVAPVLF-AVQVVLAGSAYMIAHILNIAV------------GLTFSGGFLDLLLFGILQGN-AKTSWIRIIPVGIIYFFLYYFIFSFLIKKLDLKTPGREDDDEETKLYTKADVNARKAGNTEAGATAG--SEDSLSAEITRGLGGSANIEDVDCCATRLRCTVSNPDLVNDGILKATGASGVVHRG-QGVQVIYGPSVTVIKADLEDYLEHAPKELYEPQKDTESTGQNASEDATIEDKAGEKKVVDT--------IVISSPITGLAADLSTTPDEAFAGRMMGDGAVVTPEDAIVRAPEDGEVCFVFDTKHAIGFMTESGVSLLIHVGIDTVKLDGKG------FECFVENGQAVRKGDPMLKLDLDYLRENAPSVASPVLCTELEDNQKIRLLNE-GEIKAGDELFAI 725
Score = 367, Expect = 1.3e-32, Identities = 101/273 (36%), Positives = 144/273 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAG-----GNEGLRVFGNFLQV-------PGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFG-SLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATS 315
           + ++ +  MLPIA+LP+AG+ LG+GS+  TNA      G +G+   G  L          G+A+F  LPL+FA+ +AI     +   AAL+  I Y +   S+   L  S        I  N+L  +G I                +V GIN LQ  VFGG +VG  VA L+N+F  I L   + FF G RFVPI++ +    V I    +WP+V   +  LG  +       + IFG ++RAL+PFGLHH FY P W T  GG++++    I       +A LA S
  S:     9 LQRVGRSFMLPIAILPVAGLLLGLGSSF-TNATTIATYGLQGILGEGTLLHSLLIIMNKVGSAIFDNLPLIFAVGVAIGMAKKEKEVAALSALIAYFVMHISINSMLEISGKIAADGTISKNVL--EGTI---------------ASVCGINTLQMGVFGGIIVGLGVAALHNRFHKIVLPNALSFFGGSRFVPIISTITYMFVGIAMYFVWPIVQNGIYALGGLVTGTGYFGTLIFGIVKRALIPFGLHHVFYLPFWQTAVGGTMEVGGKLIQGGQNIFFAQLADS 277
>gi|168715970|ref|ZP_02748247.1| PTS system, glucose-specific IIbc component [Clostridium difficile QCD-63q42] (690 aa)
Score = 603, Expect = 5.1e-60, Identities = 156/443 (35%), Positives = 253/443 (57%)
  Q:   417 GVN--VGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEK-GTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVLN 859
           GVN   G ++ G + FM+ GLPAAA AMV  A  E +K    I  SA  TS LTGITEPIE+ FLF+AP LF  +H     L++ +M  +G+             IG +FSGG+ID++++G +        W+ + + G+ +A +Y+ +F F+I+KFN++TPGR               +++ + N     ++ ++ LA  ++ A G  DN+K++DACIT+LR+ + D + VD  KL  LGA G +     +V A+FG ++D IK +IK ++E  +          K+ +  +     ++VK   EV   ++ L ++   ++S   GEI+ + +VPD  FS  +MG G A+K + G IYSP+DG + ++F T HA   +++K G +ILIH+GI+++NL+         F   V  GD VK G+++  + L  + K+  STI+P++  N
  S:   262 GVNFTAGTFMTGAFPFMMFGLPAAALAMVHEAKPEKKKFVAGIMASAALTSFLTGITEPIEFAFLFVAPVLF-AIHCLFSGLSYAIMQLLGV------------KIGFTFSGGLIDFLLFGVLP---NRTPWYLAILVGIGFAVLYYSVFRFMIRKFNLKTPGR---------------EDESETNAEVIEMSKNE-LASEILIALGNKDNLKSLDACITRLRLVVNDINKVDKEKLKSLGAAGVMVIG-NNVQAIFGPKSDSIKSDIKDIIEGKT----------KVESTVTKNVDKNKVKKNMEVANMENALVEK---IDSLTNGEILDIEEVPDSVFSSKLMGDGFAIKSSDGLIYSPVDGTIGVIFPTKHAIIIKSQKSGVEILIHLGIETVNLEGNG------FEVFVNVGDEVKAGEKLVKMDLEYIEKNGLSTISPVVFTN 657
Score = 337, Expect = 3.2e-29, Identities = 86/245 (35%), Positives = 133/245 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAG-------GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIA-LTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + K+ K LMLP+A+LP AGI LGV +A+  +A         N   ++  + ++  G  +F  LPL+FA+ +A+  T   G AALA  +G+LI  +    ++    D                          + +S+Y  ++GI  +Q+ VFGG ++G + A+LY KF  I+L   +GFF G RFVPIVT L    + I+   IWP +    L+F    +     + +F+ G +ER L+PFGLHH F++P WY
  S:     8 LQKVGKSLMLPVALLPAAGILLGVSNALAGDALLAHFPALANPTFQLIISIMESSGQIIFNNLPLIFAVGVAVGLTEGEGVAALAAIVGFLILNTSMGVMAGVTEDM-------------------------VDNSMYANIVGIPTIQTGVFGGIIIGIVAAYLYKKFYKIELPQYLGFFAGKRFVPIVTSLVAIAIGIILSFIWPPIQEGLLSFSKNVIEANQTLAAFMEGSLERLLIPFGLHHVFHNPFWY 235
>gi|75765157|ref|ZP_00744424.1| PTS system, glucose-specific IIABC component [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74487355|gb|EAO51304.1| PTS system, glucose-specific IIABC component [Bacillus thuringiensis serovar israelensis ATCC 35646] (411 aa)
Score = 603, Expect = 5.8e-60, Identities = 150/401 (37%), Positives = 218/401 (54%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKEL 818
           +  G +  GKY FM+ GLPAAA AM   A  EN+KLA  I  SA  TS LTGITEP+E++FLF+AP LF G+HA    L+F  M  +G+             IGM+FSGG+ID++++G +    G  AWW   I GL  A IY+F F F I+K+N++TPGR E              N     G +E+      L   V+ A GG +NI ++DACIT+LR+Q+ +Q  V+  +L +LGA G ++    ++ A+FG ++D +K  I  +M              +  +   +     E  P+K           E   + SP  G+I+ + +VPD+ FS  MMG G A++PT G + SP++G++  VF T HA   ++E G  ILIH GID++    +  K L
  S:    65 LTAGTFTTGKYPFMMFGLPAAALAMYHEARPENKKLAAGILGSAALTSFLTGITEPLEFSFLFVAPVLF-GIHAVFAGLSFMTMQILGV------------KIGMTFSGGLIDFLLFGVLP---GRTAWWWVIIVGLVLAVIYYFGFRFAIRKWNLKTPGREE-------------ANANDGAGKAEAGE----LPREVLVALGGKENIASLDACITRLRVQVNEQKNVNKDRLKELGAAGVLEVG-NNIQAIFGPKSDTLKSQIHDIMSG------------RTPHVEKEEPVKVEETPQK---------VDENETIVSPIEGKILPITEVPDQVFSGKMMGDGFAIEPTEGTVVSPVNGEIVNVFPTKHAIGIQSECGKDILIHFGIDTVQSNGEGSKPL 411
Score = 130, Expect = 3.7e-05, Identities = 24/35 (68%), Positives = 28/35 (80%)
  Q:   260 INSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           I +FIFG IER+L+PFGLHH FYSP W     YT A G +
  S:     8 IAAFIFGLIERSLIPFGLHHIFYSPFWFEFGQYTNAAGEL 47
>gi|196161617|ref|ZP_03122178.1| PTS system, glucose-specific IIBC component [Clostridium difficile CIP 107932] (690 aa)
Score = 600, Expect = 1.1e-59, Identities = 157/443 (35%), Positives = 253/443 (57%)
  Q:   417 GVN--VGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEK-GTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVLN 859
           GVN   G ++ G + FM+ GLPAAA AMV  A  E +K    I  SA  TS LTGITEPIE+ FLF+AP LF  +H     L++ +M  +G+             IG +FSGG+ID++++G +        W+ + + G+ +A +Y+ +F F+I+KFN++TPGR               +++ + N     ++ ++ LA  ++ A G  DN+K++DACIT+LR+ + D + VD  KL  LGA G +     +V A+FG ++D IK +IK ++E  +          K+ +  +     ++VK   EV   ++ L ++   ++S   GEI+ + +VPD  FS  +MG G A+K + G IYSP+DG + ++F T HA   +++K G +ILIH+GI+++NL      E   F   V  GD VK G+++  + L  + K+  STI+P++  N
  S:   262 GVNFTAGTFMTGAFPFMMFGLPAAALAMVHEAKPEKKKFVAGIMASAALTSFLTGITEPIEFAFLFVAPVLF-AIHCLFSGLSYAIMQLLGV------------KIGFTFSGGLIDFLLFGVLP---NRTPWYLAILVGIGFAVLYYSVFRFMIRKFNLKTPGR---------------EDESETNAEVIEMSKNE-LASEILIALGNKDNLKSLDACITRLRLVVNDINKVDKEKLKLLGAAGVMVIG-NNVQAIFGPKSDSIKSDIKDIIEGKT----------KVESTVTKNVDKNKVKKNMEVANMENALVEK---IDSLTNGEILDIEEVPDSVFSSKLMGDGFAIKSSDGLIYSPVDGTIGVIFPTKHAIIIKSKKSGVEILIHLGIETVNL------EGNGFEVFVNVGDEVKAGEKLVKMDLEYIEKNCLSTISPVVFTN 657
Score = 334, Expect = 7.1e-29, Identities = 85/245 (34%), Positives = 133/245 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAG-------GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIA-LTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + K+ K LMLP+A+LP AGI LGV +A+  +A             ++  + ++  G  +F  LPL+FA+ +A+  T   G AALA  +G+LI  +    ++    D                          + +S+Y +++GI  +Q+ VFGG ++G + A+LY KF  I+L   +GFF G RFVPIVT L    + I+   IWP +    L+F    +     + +F+ G +ER L+PFGLHH F++P WY
  S:     8 LQKVGKSLMLPVALLPAAGILLGVSNALAGDALLSHFPALATPTFQLIISIMESSGQIIFNNLPLIFAVGVAVGLTEGEGVAALAAIVGFLILNTSMGVMAGVTEDM-------------------------VDNSMYASIVGIPTIQTGVFGGIIIGIVAAYLYKKFYKIELPQYLGFFAGKRFVPIVTSLVAIAIGIILSFIWPPIQEGLLSFSKNVIEANQTLAAFMEGSLERLLIPFGLHHVFHNPFWY 235
>gi|168695912|ref|ZP_02728189.1| PTS system, glucose-specific IIbc component [Clostridium difficile QCD-37x79] >gi|168722826|ref|ZP_02755103.1| PTS system, glucose-specific IIbc component [Clostridium difficile QCD-76w55] >gi|168732941|ref|ZP_02765218.1| PTS system, glucose-specific IIbc component [Clostridium difficile QCD-97b34] (690 aa)
Score = 600, Expect = 1.1e-59, Identities = 157/443 (35%), Positives = 253/443 (57%)
  Q:   417 GVN--VGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEK-GTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVLN 859
           GVN   G ++ G + FM+ GLPAAA AMV  A  E +K    I  SA  TS LTGITEPIE+ FLF+AP LF  +H     L++ +M  +G+             IG +FSGG+ID++++G +        W+ + + G+ +A +Y+ +F F+I+KFN++TPGR               +++ + N     ++ ++ LA  ++ A G  DN+K++DACIT+LR+ + D + VD  KL  LGA G +     +V A+FG ++D IK +IK ++E  +          K+ +  +     ++VK   EV   ++ L ++   ++S   GEI+ + +VPD  FS  +MG G A+K + G IYSP+DG + ++F T HA   +++K G +ILIH+GI+++NL      E   F   V  GD VK G+++  + L  + K+  STI+P++  N
  S:   262 GVNFTAGTFMTGAFPFMMFGLPAAALAMVHEAKPEKKKFVAGIMASAALTSFLTGITEPIEFAFLFVAPVLF-AIHCLFSGLSYAIMQLLGV------------KIGFTFSGGLIDFLLFGVLP---NRTPWYLAILVGIGFAVLYYSVFRFMIRKFNLKTPGR---------------EDESETNAEVIEMSKNE-LASEILIALGNKDNLKSLDACITRLRLVVNDINKVDKEKLKLLGAAGVMVIG-NNVQAIFGPKSDSIKSDIKDIIEGKT----------KVESTVTKNVDKNKVKKNMEVANMENALVEK---IDSLTNGEILDIEEVPDSVFSSKLMGDGFAIKSSDGLIYSPVDGTIGVIFPTKHAIIIKSKKSGVEILIHLGIETVNL------EGNGFEVFVNVGDEVKAGEKLVKMDLEYIEKNCLSTISPVVFTN 657
Score = 340, Expect = 1.5e-29, Identities = 86/245 (35%), Positives = 134/245 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAG-------GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIA-LTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + K+ K LMLP+A+LP AGI LGV +A+  +A         N   ++  + ++  G  +F  LPL+FA+ +A+  T   G AALA  +G+LI  +    ++    D                          + +S+Y +++GI  +Q+ VFGG ++G + A+LY KF  I+L   +GFF G RFVPIVT L    + I+   IWP +    L+F    +     + +F+ G +ER L+PFGLHH F++P WY
  S:     8 LQKVGKSLMLPVALLPAAGILLGVSNALAGDALLSHFPALANPTFQLIISIMESSGQIIFNNLPLIFAVGVAVGLTEGEGVAALAAIVGFLILNTSMGVMAGVTEDM-------------------------VDNSMYASIVGIPTIQTGVFGGIIIGIVAAYLYKKFYKIELPQYLGFFAGKRFVPIVTSLVAIAIGIILSFIWPPIQEGLLSFSKNVIEANQTLAAFMEGSLERLLIPFGLHHVFHNPFWY 235
>gi|23099337|ref|NP_692803.1| PTS system, glucose-specific enzyme II, A component [Oceanobacillus iheyensis HTE831] >gi|22777566|dbj|BAC13838.1| PTS system, glucose-specific enzyme II, A component [Oceanobacillus iheyensis HTE831] (675 aa)
Score = 600, Expect = 1.2e-59, Identities = 164/439 (37%), Positives = 242/439 (55%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVLN 859
           G ++ G++  M+ GLPAAA AM  AA  E +KL   + +S   TS LTGITEP+E++F+FL+P LF  +HA L  L+F LM +  +            +IG +FSGG ID++++G   I  G   WW + I GL +A IY+FLF + IKKFN+ TPGR E+      +D+K        + SSE  +    LA +VV A GG  NI ++DACIT+LR+ +     V+  +L ++GA G +     +V A+FG  ++ IKG I+ ++  +   P L  E+E                    VV+    ++ E +V  SP TG+++ +  V D  FS  +MG G A+ P  G I SP+DG++  +F T HA   ++E+GT+ILIH G+D++NL  K       F   V     VK GQ +  V L  L K   ST+TP++  N
  S:   269 GHFMAGEFPIMMFGLPAAALAMYHAAKPEKKKLVAGLLVSGALTSFLTGITEPLEFSFMFLSPILFL-IHALLDGLSFVLMTYFHV------------NIGFTFSGGAIDFVLFG---ILPGQEPWWITIILGLFFAIIYYFLFRYFIKKFNLLTPGREES------DDHK-------YSPSSEKSD----LAFDVVEAIGGLQNITHLDACITRLRVSVDSIQKVNKVRLKKIGASGVLVVG-NNVQAIFGPRSETIKGQIQDII--LGKVPRLGQEFEY------------------PVVEEPISVNDEIIV--SPLTGQMIPITDVSDPVFSGKLMGEGFAIIPEDGTIVSPVDGEIIHIFPTNHAIGVQSEEGTEILIHAGLDTVNLNGKG------FNIFVDENQFVKAGQALLKVDLDYLEKQGFSTVTPVVFTN 647
Score = 395, Expect = 6.9e-36, Identities = 92/246 (37%), Positives = 137/246 (55%)
  Q:    42 FIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGN-------EGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQAL-GQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
            + K+ K LMLP+A+LP+AG+ LG+G+A+  N           E +++    ++  G  +F  LPL+FAI ++I    D G A LA  +GYL+   +            G+ IG      + +           PS  + +V+GI  LQ+ VFGG +VG + AF YN+F +I++   +GFF G RFVPI T    F + IL + IWP V  A+      L  +   +  F+FGFI+R L+PFGLHH F++P WY
  S:     8 LLQKIGKALMLPVALLPVAGLLLGLGNAVQQNTVLEYLPFLHMEWIQLIATVMEDAGGIIFDNLPLIFAIGVSIGLASD-GAAGLAALVGYLVLNQVM-----------GSWIGVTSKMIESD-----------PS--FASVLGIPTLQTGVFGGIIVGLIAAFCYNRFHDIEMPSFLGFFAGKRFVPIATAGCSFVIGILLMFIWPPVQDAMNSASYWLIEEGTYVAVFLFGFIKRLLIPFGLHHIFHAPFWY 236
>gi|15893860|ref|NP_347209.1| PTS enzyme II, ABC component [Clostridium acetobutylicum ATCC 824] >gi|15023438|gb|AAK78549.1|AE007572_4 PTS enzyme II, ABC component [Clostridium acetobutylicum ATCC 824] (665 aa)
Score = 594, Expect = 5.6e-59, Identities = 162/444 (36%), Positives = 242/444 (54%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEG 864
           G ++  +Y  ++ GLP AA AM+ AA KE RK    + +SA F + +TGITEPIE++F+F+AP LF  V   L A A GL+              L   +G +FS   ID+++      +Y  +    ++ G+ +  +YF +FYF IK  NI+TPGR        ++D      K+ + G ++        A  V+ A GG DNIK +DACIT+LR+ + D S+VD A L  LGA G +  +  SV  VFG EA+ IK +IK +++N     +             D+    EV+ +K++ K   EL        SP  GE+V +  VPD TF++ M+G G AV P+  +++SP DG++S++F T HA++  TE G ++LIHVGID++ L  +       F  +VK GD VK G  I T+    +K   K+ ITP+IV N  + G
  S:   260 GNFMAAEYPILMFGLPGAALAMIAAAKKEKRKEMAGMMISAAFVAFVTGITEPIEFSFIFVAPVLF--VFHVLAAFASGLIT-----------SYLHIRLGYTFSASFIDYVL----GFKYAGHPLLIWLVGIGFFVLYFVVFYFTIKAMNIKTPGR--------EDDDAEGVKKINVKGKAK--------AAKVLEAIGGKDNIKVLDACITRLRLNLNDPSLVDKATLKALGAAGVMT-AEDSVQVVFGTEAERIKDDIKAIIQNGGYVED-------------DSDKEEEVQEDKQISKGAHELL-------SPADGEVVGIESVPDSTFAEKMLGDGFAVIPSGNEVHSPADGEVSVLFPTKHAFAITTEGGLELLIHVGIDTVALNGEG------FTAHVKQGDKVKKGDLILTLDTEFIKSKGKNLITPVIVTNMDVVG 644
Score = 318, Expect = 6.3e-27, Identities = 83/249 (33%), Positives = 126/249 (50%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           + K+ K LMLP+++LP AGI L +G   + N            ++Q  GNA+F  LPL+FA+ +AI F+G  G AALA  IG LI     +A+ ++  DT  A +                  A   +  Y  ++    +   VFGG ++G   A LYNKF +IK+  ++GFF G RFVPI+T ++   +  + + IW  +   +  L  A      I   ++   +R L+P GLHH +Y PL+  Q G
  S:     9 LQKIGKSLMLPVSVLPAAGILLRLGQPDLLNM----------PYVQAAGNAIFNNLPLIFAVGVAIGFSGGEGVAALAAVIGELIL----EAVEKTAGDTAAAALAKTAAASHHMTLA-----AFQKTQEYSNIVTKTTISMGVFGGIIIGLTAAILYNKFHDIKMPQVLGFFGGKRFVPIITSISALIIATIGVNIWLPIQAGINSLA-AFATTSPIGPAMYAGGKRLLIPLGLHHIYY-PLFLYQFG 236
>gi|16759629|ref|NP_455246.1| N-acetyl glucosamine specific PTS system components IIABC [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29142598|ref|NP_805940.1| N-acetyl glucosamine specific PTS system components IIABC [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|25287949|pir||AB0585 pts system, N-acetylglucosamine-specific IIABC component STY0723 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16501921|emb|CAD05148.1| pts system, N-acetylglucosamine-specific IIABC component [Salmonella enterica subsp. enterica serovar Typhi] >gi|29138229|gb|AAO69800.1| N-acetylglucosamine-specific IIABC component of PTS system [Salmonella enterica subsp. enterica serovar Typhi Ty2] (650 aa)
Score = 593, Expect = 7.0e-59, Identities = 169/542 (31%), Positives = 279/542 (51%)
  Q:   347 MWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTI---GANGFKGVN--VGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENT-RLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEVLPK 888
           +W  +   +     W+  +S+G   S I G  +   I +  +  + ++  W  +     A GT+     N F   +   G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLAP L+  +HA L  ++  +   +G+            H G SFS G ID+++   +     +N W   + G+ +  IYF LF  +I+ FN++TPGR +    + T+E   N         + E L     LA + ++A GG DN+K VDACIT+LR+ + D + V+ A   +LGA G +K + Q++  + GA+A+ I   +K +   ++  P   +  +     +   ++  +  P    +   +EL        SP TGE+V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L  +  K L      V+ G  V  GQ +  + L  L  +A+S I+P++  N   +      +K  G +  G  PL+E+  K
  S:   151 VWPPVQHGIHAGGEWI--VSAGALGSGIFGFINRLLIPTGLHQVLNTI-AWFQIGEFTNAAGTVFHGDINRFYAGDGTAGMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAITAFLTGVTEPLEFLFMFLAPLLYL-LHAILTGISLFVATLLGI------------HAGFSFSAGAIDYVLMYNLPAA-SNNVWMLLVMGVVFFIIYFLLFSAVIRMFNLKTPGREDKVDEMVTEEANSN---------TEEGLTQ---LATSYIAAVGGTDNLKAVDACITRLRLTVNDSARVNDAACKRLGASGVVKLNKQTIQVIVGAKAESIGDEMKKV---VARGPVAAASADAAHVATPAPAAKPQAVPNAVTI---AELV-------SPITGEVVALDQVPDEAFASKAVGDGVAVKPTDKTVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALNGQGFKRL------VEEGAEVTAGQPVLELDLDFLNANARSKISPVVCSNS--DDFSALVIKADGHVVAGQTPLYEIKSK 650
Score = 189, Expect = 5.4e-12, Identities = 74/257 (28%), Positives = 112/257 (43%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPI +LP+A + L  G   + N            F+   G ++F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +   +YN++  IKL   + FF G RFVPI T      +  +F  +WP V   +   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIVVLPVAALLLRFGQPDLLNM----------PFIAQAGGSIFDNLALVFAIGVASSWSKDSAGAAALAGAVGYFVM--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAVYNRWSGIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHGIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|168230567|ref|ZP_02655625.1| hypothetical protein Sententerica_06296 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|194472816|ref|ZP_03078800.1| pts system, N-acetylglucosamine-specific iibc component [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194459180|gb|EDX48019.1| pts system, N-acetylglucosamine-specific iibc component [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (650 aa)
Score = 592, Expect = 1.0e-58, Identities = 154/468 (32%), Positives = 250/468 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENT-RLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG-MPLFEVLPK 888
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLAP L+  +HA L  ++  +   +G+            H G SFS G ID+++   +     +N W   + G+ +  IYF LF  +I+ FN++TPGR +    + T+E   N         + E L     LA + ++A GG DN+K +DACIT+LR+ + D + V+ A   +LGA G +K + Q++  + GA+A+ I   +K +   ++  P   +  +     +   ++  +  P    +   +EL        SP TGE+V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L  +  K L      V+ G  V  GQ +  + L  L  +A+S I+P++  N   +      +K  G +  G  PL+E+  K
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAITAFLTGVTEPLEFLFMFLAPLLYL-LHAILTGISLFVATLLGI------------HAGFSFSAGAIDYVLMYNLPAA-SNNVWMLLVMGVVFFIIYFLLFSAVIRMFNLKTPGREDKVDEMVTEEANSN---------TEEGLTQ---LATSYIAAVGGTDNLKAIDACITRLRLTVNDSARVNDAACKRLGASGVVKLNKQTIQVIVGAKAESIGDEMKKV---VARGPVAAASADAAHVATPAPAAKPQAVPNAVTI---AELV-------SPITGEVVALEQVPDEAFASKAVGDGVAVKPTDKTVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALNGQGFKRL------VEEGAEVTAGQPVLELDLDFLNANARSMISPVVCSNS--DDFSALVIKADGHVVAGKTPLYEIKSK 650
Score = 193, Expect = 2.0e-12, Identities = 75/257 (29%), Positives = 113/257 (43%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G ++F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +   +YN++  IKL   + FF G RFVPI T      +  +F  +WP V   +   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNM----------PFIAQAGGSIFDNLALVFAIGVASSWSKDSAGAAALAGAVGYFVM--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAVYNRWSGIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHGIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|167558957|ref|ZP_02351966.1| hypothetical protein Sententeri_19204 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|168224022|ref|ZP_02649254.1| hypothetical protein Senterenterica_26795 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168236670|ref|ZP_02661728.1| hypothetical protein Senteenterica_10801 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168467766|ref|ZP_02701603.1| pts system, N-acetylglucosamine-specific iibc component [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168820194|ref|ZP_02832194.1| hypothetical protein Salentericaenterica_12471 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194736511|ref|YP_002113790.1| pts system, N-acetylglucosamine-specific iibc component [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|194712013|gb|ACF91234.1| pts system, N-acetylglucosamine-specific iibc component [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195629169|gb|EDX48537.1| pts system, N-acetylglucosamine-specific iibc component [Salmonella enterica subsp. enterica serovar Newport str. SL317] (650 aa)
Score = 592, Expect = 1.1e-58, Identities = 154/468 (32%), Positives = 250/468 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENT-RLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEVLPK 888
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLAP L+  +HA L  ++  +   +G+            H G SFS G ID+++   +     +N W   + G+ +  IYF LF  +I+ FN++TPGR +    + T+E   N         + E L     LA + ++A GG DN+K +DACIT+LR+ + D + V+ A   +LGA G +K + Q++  + GA+A+ I   +K +   ++  P   +  +     +   ++  +  P    +   +EL        SP TGE+V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L  +  K L      V+ G  V  GQ +  + L  L  +A+S I+P++  N   +      +K  G +  G  PL+E+  K
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAITAFLTGVTEPLEFLFMFLAPLLYL-LHAILTGISLFVATLLGI------------HAGFSFSAGAIDYVLMYNLPAA-SNNVWMLLVMGVVFFIIYFLLFSAVIRMFNLKTPGREDKVDEMVTEEANSN---------TEEGLTQ---LATSYIAAVGGTDNLKAIDACITRLRLTVNDSARVNDAACKRLGASGVVKLNKQTIQVIVGAKAESIGDEMKKV---VARGPVAAASADAAHVATPAPAAKPQAVPNAVTI---AELV-------SPITGEVVALDQVPDEAFASKAVGDGVAVKPTDKTVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALNGQGFKRL------VEEGAEVTAGQPVLELDLDFLNANARSMISPVVCSNS--DDFSALVIKADGHVVAGQTPLYEIKSK 650
Score = 193, Expect = 1.9e-12, Identities = 75/257 (29%), Positives = 113/257 (43%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G ++F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +   +YN++  IKL   + FF G RFVPI T      +  +F  +WP V   +   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNM----------PFIAQAGGSIFDNLALVFAIGVASSWSKDSAGAAALAGAVGYFVM--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAVYNRWSGIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHGIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|194681842|emb|CAR41135.1| N-acetylglucosamine-specific PTS system, EIICBA component [Proteus mirabilis HI4320] (681 aa)
Score = 591, Expect = 1.1e-58, Identities = 158/461 (34%), Positives = 249/461 (54%)
  Q:   399 NLTSGQQALGTIGANGFKGVNV-GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGL---MNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIF-GLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           N  +GQQA+      G   V V G+Y  G +  M+ GLP AA A+   A KE++     I M+  F +  TGITEP+E++F+F+AP L+  +HA L A++  +   M WI                G  FS G++D  +     +   +  W+  I  G+A+  IY+ +F F I KFN++TPGR +        D  ++  K     S E++  +   A   ++A GG DN+  +DACIT+LR+ +KD SVV+ A    LGA G I+ + QSV  + G  A+I+   ++ ++         +          +D + ++E   EK+    D+++  E V   +PF GE+V+L  VPDE FS  ++G G+A+KPT+  + +P  G +  +FDT HA+  ET+ G +I++H+GID++ L  K  K L      V+ G  VK+GQ I  + L  L  +AKS I+P+I+ N
  S:   232 NFLAGQQAIDA----GLATVGVTGRYQAGFFPVMMFGLPGAALAIYHCARKEHKAKVAGIMMAGAFAAFFTGITEPLEFSFMFVAPVLYV-IHAFLMAISVYIAASMEWIS---------------GFGFSAGLVDMFLSSRNPL---AVKWYMLIVQGIAFFFIYYGIFRFTITKFNLKTPGREDEVAGDETADGYDEDIKAVPTNSKEAVQQE---ARQYIAAVGGSDNLTGIDACITRLRLNVKDASVVNDAYAKHLGASGVIRLNKQSVQVIVGTRAEIVASAMRDVLA--------QGPVAAYAGRHTDNAVSTEKTSEKQT-NNDAKVILEMV---APFDGEVVALKDVPDEAFSSGVVGDGLAIKPTSNIVMAPAAGTVVKIFDTNHAFCIETDNGVEIIVHMGIDTVALGGKGFKRL------VEEGTEVKLGQPILELDLEYLNTNAKSMISPVIISN 654
Score = 283, Expect = 6.4e-23, Identities = 78/254 (30%), Positives = 125/254 (49%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           N   ++ K+ + LM+P+A LP A I +G+G  I     GN+        L   G A+   + +LFAI +A   + D  G AAL  F+G+L+  +L    + S+                  I GL    A +P + +G +       ++ F G +VG L A LYN+F +++L   + FF+G R VPI+T   +  V  + + IWP++   L   G+++     + + I+ F  R L+P GLHHA  S  W+  AG
  S:     2 NILSYLQKIGRALMVPVATLPAAAILMGIGYWIDPVGWGNDN--ALAALLIKSGAAIIDNMSVLFAIGVAYGMSKDKDGAAALTGFVGFLVVTTLCSPAAVSM------------------IKGLPL--AEVPVA-FGKI-------NNQFVGILVGVLSAELYNRFSSVELPRALSFFSGRRLVPILTSFLMIIVAFILMYIWPVIYGGLVSFGESIKDMGALGAGIYAFFNRLLIPVGLHHALNSVFWFDVAG 226
>gi|16764055|ref|NP_459670.1| N-acetyl glucosamine specific PTS system components IIABC [Salmonella typhimurium LT2] >gi|56414195|ref|YP_151270.1| N-acetyl glucosamine specific PTS system components IIABC [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62179276|ref|YP_215693.1| N-acetyl glucosamine specific PTS system components IIABC [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161615097|ref|YP_001589062.1| N-acetyl glucosamine specific PTS system components IIABC [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167546499|ref|ZP_02342063.1| hypothetical protein Sentent_24621 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167992953|ref|ZP_02574048.1| hypothetical protein Sententer_01000019_0100015974 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168240529|ref|ZP_02665461.1| hypothetical protein Senterienterica_02780 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168477827|ref|ZP_02706850.1| hypothetical protein Salmoentericaenterica_24494 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|194444609|ref|YP_002039922.1| pts system, N-acetylglucosamine-specific iibc component [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194451768|ref|YP_002044714.1| pts system, N-acetylglucosamine-specific iibc component [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|16419192|gb|AAL19629.1| Sugar Specific PTS family, n-acetylglucosamine-specific enzyme IIABC [Salmonella typhimurium LT2] >gi|56128452|gb|AAV77958.1| pts system, N-acetylglucosamine-specific IIABC component [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62126909|gb|AAX64612.1| Sugar Specific PTS family, n-acetylglucosamine-specific enzyme IIABC [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161364461|gb|ABX68229.1| hypothetical protein SPAB_02857 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194403272|gb|ACF63494.1| pts system, N-acetylglucosamine-specific iibc component [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194410072|gb|ACF70291.1| pts system, N-acetylglucosamine-specific iibc component [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (650 aa)
Score = 591, Expect = 1.1e-58, Identities = 154/468 (32%), Positives = 250/468 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENT-RLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG-MPLFEVLPK 888
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLAP L+  +HA L  ++  +   +G+            H G SFS G ID+++   +     +N W   + G+ +  IYF LF  +I+ FN++TPGR +    + T+E   N         + E L     LA + ++A GG DN+K +DACIT+LR+ + D + V+ A   +LGA G +K + Q++  + GA+A+ I   +K +   ++  P   +  +     +   ++  +  P    +   +EL        SP TGE+V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L  +  K L      V+ G  V  GQ +  + L  L  +A+S I+P++  N   +      +K  G +  G  PL+E+  K
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAITAFLTGVTEPLEFLFMFLAPLLYL-LHAILTGISLFVATLLGI------------HAGFSFSAGAIDYVLMYNLPAA-SNNVWMLLVMGVVFFIIYFLLFSAVIRMFNLKTPGREDKVDEMVTEEANSN---------TEEGLTQ---LATSYIAAVGGTDNLKAIDACITRLRLTVNDSARVNDAACKRLGASGVVKLNKQTIQVIVGAKAESIGDEMKKV---VARGPVAAASADAAHVATPAPAAKPQAVPNAVTI---AELV-------SPITGEVVALDQVPDEAFASKAVGDGVAVKPTDKTVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALNGQGFKRL------VEEGAEVTAGQPVLELDLDFLNANARSMISPVVCSNS--DDFSALVIKADGHVVAGKTPLYEIKSK 650
Score = 193, Expect = 1.9e-12, Identities = 75/257 (29%), Positives = 113/257 (43%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G ++F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +   +YN++  IKL   + FF G RFVPI T      +  +F  +WP V   +   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNM----------PFIAQAGGSIFDNLALVFAIGVASSWSKDSAGAAALAGAVGYFVM--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAVYNRWSGIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHGIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|118443787|ref|YP_877931.1| PTS enzyme II, ABC component [Clostridium novyi NT] >gi|118134243|gb|ABK61287.1| PTS enzyme II, ABC component [Clostridium novyi NT] (655 aa)
Score = 591, Expect = 1.3e-58, Identities = 163/459 (35%), Positives = 257/459 (55%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLF-WGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN-ESLEGREIKFLKKSGEIKKG 879
           G ++  +Y  ++ GLP AA A++ AA KENRK    I +SA F + LTGITEPIE+TF+F+AP LF + V A+ C+         G+I S      L   +G +FS   ID+++      ++    W  ++ G+ +  +YF +FYF IK FNI+TPGR + +  F   D K K+    + GS +        A  V++A GG DNI+ +DACIT+LR+ +KD S VD   L  LGA G ++ +  +V A+FG EA+ IK ++K ++E    +  +    E+      DT   S+             LSK+ + + +P  GEI+ + KVPDE FS   +G G A+ P   ++ SPIDG+++++F T HA + + + G ++L+H+GID++NL  +       F  +V  GD VK G  +       ++  AKS+ITP+++ N + +E  +I +    GE +KG
  S:   241 GFFMASEYPVVMFGLPGAAIAIIAAAKKENRKKVSGIMVSAAFVAFLTGITEPIEFTFIFVAPILFAFHVIAAFCS---------GIITSL-----LKIRLGYTFSASFIDYLL----GFKFAGRPWLIWLVGIVFFALYFVVFYFAIKTFNIKTPGREDESEYF---DPKLKE----VKGSEK--------AKRVLNAIGGKDNIEVLDACITRLRLTLKDPSRVDKGALKALGAAGVLE-AGNNVQAIFGTEAEKIKDSMKAIIERGEDTVIVDDLEEEKEEIVEDTKEDSKA------------LSKQTLEILNPLKGEIIDITKVPDEVFSSKALGDGFAINPLGNEVVSPIDGEIAVLFPTKHAVAIKGDNGLEMLVHIGIDTVNLNGEG------FTAHVSQGDKVKQGDLLVEFDKEIIESKAKSSITPVVITNMDFVESLDISY----GEKEKG 646
Score = 252, Expect = 2.7e-19, Identities = 84/252 (33%), Positives = 120/252 (47%)
  Q:    36 KGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIW-PLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           KG     + K+ K LMLP+++LP AGI L +G     +  G  G+ +F N L   G+A+F  LPL+FA+ +AI F+G    A+LA  IG LI  ++                    L   G  FG+                    +   VFGG ++G + A LYNK+ +IKL  ++GFF G RFVPI+T  A     ++   IW P+  +   F   A     G   +  G  +R L+P GLHH +Y P  Y
  S:     8 KGKVFATLQKIGKSLMLPVSVLPAAGILLRIGQ---DDLLGRYGV-IFKN-LATAGDAIFTNLPLIFAVGVAIGFSGGEAVASLAAVIGQLILQAV--------------------LLEMGKRFGVP-------------------INMGVFGGIIIGLIAAILYNKYHDIKLPQVLGFFGGKRFVPIITSFASLIFAVIGATIWQPIQNVINIFAKWASTSIFGPAFYAAG--KRLLIPLGLHHMYYPPFLY 214
>gi|168264385|ref|ZP_02686358.1| hypothetical protein Salmentericaenterica_25176 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] (650 aa)
Score = 591, Expect = 1.4e-58, Identities = 154/468 (32%), Positives = 250/468 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENT-RLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG-MPLFEVLPK 888
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLAP L+  +HA L  ++  +   +G+            H G SFS G ID+++   +     +N W   + G+ +  IYF LF  +I+ FN++TPGR +    + T+E   N         + E L     LA + ++A GG DN+K +DACIT+LR+ + D + V+ A   +LGA G +K + Q++  + GA+A+ I   +K +   ++  P   +  +     +   ++  +  P    +   +EL        SP TGE+V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L  +  K L      V+ G  V  GQ +  + L  L  +A+S I+P++  N   +      +K  G +  G  PL+E+  K
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAITAFLTGVTEPLEFLFMFLAPLLYL-LHAILTGISLFVATLLGI------------HAGFSFSAGAIDYVLMYNLPAA-SNNVWMLLVMGVVFFIIYFLLFSAVIRMFNLKTPGREDKVDEMVTEEANSN---------TEEGLTQ---LATSYIAAVGGTDNLKAIDACITRLRLTVNDSARVNDAACKRLGASGVVKLNKQTIQVIVGAKAESIGDEMKKV---VARGPVAAASADAAHVATPAPAAKPQAVPNAVTI---AELV-------SPITGEVVALDQVPDEAFASKAVGDGVAVKPTDKTVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALSGQGFKRL------VEEGAEVTAGQPVLELDLDFLNANARSMISPVVCSNS--DDFSALVIKADGHVVAGKTPLYEIKSK 650
Score = 193, Expect = 2.0e-12, Identities = 75/257 (29%), Positives = 113/257 (43%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G ++F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +   +YN++  IKL   + FF G RFVPI T      +  +F  +WP V   +   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNM----------PFIAQAGGSIFDNLALVFAIGVASSWSKDSAGAAALAGAVGYFVM--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAVYNRWSGIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHGIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|168187197|ref|ZP_02621832.1| pts system glucose-specific eiicba component [Clostridium botulinum C str. Eklund] >gi|169294834|gb|EDS76967.1| pts system glucose-specific eiicba component [Clostridium botulinum C str. Eklund] (655 aa)
Score = 590, Expect = 1.5e-58, Identities = 182/465 (39%), Positives = 273/465 (58%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM---ENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL--KHAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFEV 885
           G ++  +Y  ++ GLPAAA AM++AA KENRK    + +SA F + LTGITEPIE++F+F+AP LF   H +   L+       GLI S      L   +G +FS   ID+++      ++    W  +I GLA+  +YF +FYF IK  NI TPGR ++  L   + ++N      I GS +        A +++ A GG DNI+ +DACIT+LR+ +KD SV+D + L  LGA G  + +  +V A+FG EA+ IK  IK+++   E+ISSS +L    +K+ N  S          E +   T+++      +++SP +G+I+ L++VPDETF+  +MG GIA++PT+G I SP+DG +  +F T HA    T  G ++LIHVGID++ ++   G+  K F   V  GD VK G ++  V L DL  K AKS +TPII+ N S + + I+ L K G IK    L ++
  S:   238 GFFMAAEYPILMFGLPAAALAMILAAKKENRKKISGMMISAAFVAFLTGITEPIEFSFIFVAPILFV-FHVAAAFLS-------GLITSF-----LKIRLGYTFSASFIDYVL----GFKFAGRPWLIWIVGLAFFVLYFVVFYFTIKFLNIHTPGR-DDEDLVANKKFEN------IKGSEK--------AKSILLAIGGKDNIEVLDACITRLRLTLKDPSVIDKSTLKALGAAGVFE-NGNNVQAIFGTEAERIKDEIKSIIASGEDISSSKDL----DKLTNYDSSE--------EDKNNFTNNQNINNSQILSSPLSGKILDLSEVPDETFASKLMGDGIAIEPTSGVITSPVDGTVVQLFWTNHALGIITNSGIELLIHVGIDTVKME---GRGFKAF---VSQGDKVKSGDKLLEVDL-DLIKKEAKSIVTPIIITNSS-QFKSIEKL-KDGNIKNEENLLKI 653
Score = 287, Expect = 2.3e-23, Identities = 84/268 (31%), Positives = 121/268 (45%)
  Q:    36 KGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQ---VPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIY 303
           KG     + K+ K LMLP+++LP AG+ L  G         N+ L  FG   Q     G+A+F  L  +FA+ +AI F+G    AALA  IG LI         Q+V   TG  +G +                               +   VFGG ++G + A LY KF +IKL  ++GFF G RFVPI+T +      ++   IWP +   +         ++ +    +   +R L+P GLHH +Y P  Y Q G   + T N I Y
  S:     5 KGKIFSVLQKIGKSLMLPVSVLPAAGLLLRFGQ--------NDLLGRFGPIFQNLATAGDAIFANLSFIFAVGVAIGFSGGEAVAALAAVIGQLIL--------QAVLVATGQRLGIS-------------------------------IDMGVFGGIMIGLIAAILYKKFHDIKLPQVLGFFGGKRFVPIITSVFSLIFAVVGASIWPFIQTKINIFAHWASSSI-LGPAFYAAGKRLLIPLGLHHMYYPPFLY-QFG---EFTSNGIKY 223
>gi|50915044|ref|YP_061016.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes MGAS10394] >gi|50904118|gb|AAT87833.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes MGAS10394] (728 aa)
Score = 590, Expect = 1.6e-58, Identities = 230/827 (27%), Positives = 370/827 (44%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYN---LLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALG----QAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANG-FKGVNVGQY----LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTA-KLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREI 867
           EF  K  K LM+ IA++P AG+ + +G++I      +  L   GN +   G AV   L LLFA+AI  ++  +    A A  + +++   +           TGA  G +   L   +  I  L  G   +    + +V+    L + VF G + GF+ A  YNK+ N  KL  ++ FFNG RFVP V  L    V ++ +++WP++   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+               Y V+  + A +                       G   +W            W+ +L            +   S AS+ +  + SV T +    GQ     IGA G   GV +  Y       KY + ++ + AAAA  +                        TG+TEP+EY F+F A  L+  V+A +   +F + + + L V + G+ EL     M+   G+      G   I +    W S +F    A I +F+   +IKK ++ T GR  N       D   +    Q+  S     N QV  + +++  GG  NI +VDAC+T+LR+ +KD + V       + GA G I+     V AV+G +ADI+K +I+ L+++ +  P +        N S  TS  +  K  K V +           V S   G ++ +  V D+ F+  MMG G AV+PT G IY+P+ G ++ VF T HA+   T+ G ++L+HVG+D++ L         PF+  V  G  V  G  +    LA ++ A+   T ++    + E +++
  S:    12 EFWQKFGKCLMVVIAVMPAAGLMISIGNSIPMINHDSAFLVSLGNIIAQIGWAVIVNLHLLFALAIGGSWAKERAGGAFASGLAFVLINRI-----------TGAFYGVSSAMLADPEAKITSL-LGTQMIVKDYFTSVLESPALNTGVFVGIIAGFVGATAYNKYYNYRKLPEVLTFFNGKRFVPFVVILRSIFVALILVVVWPVIQSGINSFGMWIASSQDSAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGT---------------YEVMTGAAAGT--------------------KVFGQDPLWL----------AWVTDL-----------VHLKGSDASAYSHLMDSV-TPARFKVGQM----IGATGTLMGVALAMYRNVDADKKYTYKMMFISAAAAVFL------------------------TGVTEPLEYLFMFAAMPLYI-VYALVQGASFAMADLVNLRVHSFGNIELLTRTPMALKAGL------GMDVINF---VWVSILF----AVIMYFIADMMIKKMHLATAGRLGNYDADILGDRNTQVTPTQVADS-----NSQV--VQIINLLGGAGNIDDVDACMTRLRVTVKDPAKVGAEDDWKKAGAMGLIQKG-NGVQAVYGPKADILKSDIQDLLDSGAVIPKV--------NMSQLTSKPTLAKDFKHVTEE----------VLSVADGMVLPITGVKDQVFAAKMMGDGFAVEPTNGNIYAPVAGLVTSVFPTKHAFGLLTDNGLEVLVHVGLDTVALNG------VPFSVKVSEGQRVHAGDLLVVADLAAIQTAERETTIVVAFTNTAEIQDV 709
>gi|157369471|ref|YP_001477460.1| N-acetyl glucosamine specific PTS system components IIABC [Serratia proteamaculans 568] >gi|157321235|gb|ABV40332.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Serratia proteamaculans 568] (648 aa)
Score = 590, Expect = 1.7e-58, Identities = 153/439 (34%), Positives = 240/439 (54%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEV--VKTDSELSKEKVVVNS---PFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLAP L+  VHA L  ++  +   +G+            H G SFS G ID+++   +      N W   + GL    +YF LF  +I+ FN++TPGR         ED  +  + V    +S +    + L+ + + A GG DN+  +DACIT+LR+ +KD S V  A   +LGA G +K + Q+V  + G++A+ I   ++ +   I++ P                  A+EV P   V  VK+ +  +  KV   S   P TGE+V+L +VPDE F+   +G G+A++PT   + +P DG +  +F+T HA+  ET+KG +I++H+GID++ L  +  K L      V+ G  VK GQ I  + L  L  +A+S I+P++V N
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVALTAFLTGVTEPLEFLFMFLAPLLYL-VHAILTGISLFVATLLGI------------HAGFSFSAGAIDYVLMYNLPAA-SKNVWMLVLMGLVAFAVYFVLFSVIIRAFNLKTPGR---------EDASD--DVVAPEANSNTDEGLRALSRSYIGAIGGSDNLTGIDACITRLRLTVKDSSKVLDASCKRLGASGVVKLNKQTVQVIVGSKAEAIADGMRAV---IAAGP----------------VPAAEVAPAPGVAAVKSQAVPNTPKVAFESLVAPVTGEVVALDQVPDEAFASKAVGDGLAIRPTDKTVVAPADGTIVKIFNTNHAFCLETDKGAEIVVHMGIDTVALNGQGFKRL------VEEGAEVKAGQPILELDLEFLNANARSMISPVVVSN 621
Score = 239, Expect = 7.6e-18, Identities = 78/257 (30%), Positives = 112/257 (43%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGD-AGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGIN-QLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N           +F+   G ++F  L L+FAI +A  ++ D AG AALA  +GY I                                            L  A++ IN  +   V  G + G +   +YN++  IKL   + FF G RFVPI T      +  +F  IWP V  A+   G+ +     I S IFGF+ R L+P GLH    +  W     +T A G+I
  S:     2 NILGFFQRLGRSLQLPIAVLPVAALLLRFGQPDLLNI----------SFIAQAGGSIFDNLALIFAIGVAATWSKDNAGSAALAGAVGYFI--------------------------------------------LTKAMVTINPAINMGVLAGIITGLVGGAVYNRWSGIKLPEFLSFFGGKRFVPIATGFFCLILAAIFGYIWPPVQNAIHAGGEWIVSMGAIGSGIFGFVNRLLIPTGLHQVLNTIAWFQIGEFTNAAGTI 211
>gi|161504157|ref|YP_001571269.1| N-acetyl glucosamine specific PTS system components IIABC [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160865504|gb|ABX22127.1| hypothetical protein SARI_02256 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (650 aa)
Score = 589, Expect = 2.3e-58, Identities = 167/542 (30%), Positives = 280/542 (51%)
  Q:   347 MWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTI---GANGFKGVN--VGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN-ESLEGREIKFLKKSGEIKKGM-PLFEVLPK 888
           +W  +   +     W+  +S+G   S I G  +   I +  +  + ++  W  +     A GT+     N F   +   G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLAP L+  +HA L  ++  +   +G+            H G SFS G ID+ +   +     +N W   + G+ +  IYF LF  +I+ FN++TPGR +       E+  +         + E L     LA + ++A GG DN++ +DACIT+LR+ + D + V+ A   +LGA G +K + Q++  + GA+A+ I   +K +   ++  P        +   S+D +  +   P  +     + ++  ++V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L  +  K L      V+ G  V  GQ +  + L  L  +A+S I+P++  N +   G  I   K  G +  G  PL+E+  K
  S:   151 VWPPVQHGIHAGGEWI--VSAGALGSGIFGFINRLLIPTGLHQVLNTI-AWFQIGEFTNAAGTVFHGDINRFYAGDGTAGMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAITAFLTGVTEPLEFLFMFLAPLLYL-LHAILTGISLFVATLLGI------------HAGFSFSAGAIDYALMYNLPAA-SNNVWMLLVMGVVFFIIYFLLFSAVIRMFNLKTPGREDKVDDMVTEEANSN--------TEEGLTQ---LATSYIAAVGGTDNLQAIDACITRLRLTVNDSARVNDAACKRLGASGVVKLNKQTIQVIVGAKAESIGDEMKKV---VARGP--------VAAVSADAAHVATPAPAVKPQAAPNAVTIAELV--SPVTGDVVALDQVPDEAFASKAVGDGVAVKPTDKTVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALNGQGFKRL------VEEGAEVTAGQPVLELDLDFLNANARSMISPVVCSNIDDFSGLVI---KADGHVVAGQTPLYEIKSK 650
Score = 193, Expect = 1.6e-12, Identities = 75/257 (29%), Positives = 113/257 (43%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G ++F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +   +YN++  IKL   + FF G RFVPI T      +  +F  +WP V   +   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNM----------PFIAQAGGSIFDNLALVFAIGVASSWSKDSAGAAALAGAVGYFVM--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAVYNRWSGIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHGIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|157146719|ref|YP_001454038.1| N-acetyl glucosamine specific PTS system components IIABC [Citrobacter koseri ATCC BAA-895] >gi|157083924|gb|ABV13602.1| hypothetical protein CKO_02485 [Citrobacter koseri ATCC BAA-895] (649 aa)
Score = 587, Expect = 3.5e-58, Identities = 156/465 (33%), Positives = 252/465 (54%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN-ESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM  AAPK  R +   + +S   T+ LTG+TEP+E+ F+FLAP L+  +HA L  ++  +   +G+            H G SFS G ID+++  ++      N W   + G  +  IYF LF  +I+ FN++TPGR +      K+D     + V    +S +      LA N ++A GG DN+K +DACIT+LR+ + D + V  A   +LGA G +K + Q++  + GA+A+ I   +K +   ++  P   +       +S+  ++A   KP+       + ++   +V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L  +  K L      V+ G  V  GQ I  + L  L  +A+S I+P++  N +   G  I   K  G++  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKARRPMVGGMLLSVAITAFLTGVTEPLEFLFMFLAPLLYL-LHAILTGISLFIATLLGI------------HAGFSFSAGAIDYVLMYSLPAA-SKNVWMLLVMGAVFFVIYFLLFSAVIRVFNLKTPGRED------KDD-----DIVTDEANSNTEEGMTQLATNYIAAVGGTDNLKAIDACITRLRLTVADAARVSDAMCKRLGASGVVKLNKQTIQVIVGAKAESIGDEMKKV---VARGPVAAAS-----ADSAPVTAAPAAKPQA----VPNAVTIATLV--SPVTGDVVALEQVPDEAFASKAVGDGVAVKPTDKTVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALNGQGFKRL------VEEGAEVVAGQPILEMDLEFLNANARSMISPVVCSNIDDFSGLVI---KAEGQVVAGQTPLYEI 646
Score = 190, Expect = 4.2e-12, Identities = 70/250 (28%), Positives = 102/250 (40%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGIN-QLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+F  AI +A                          S    D+ GA      + Y                 L  A++ IN ++   V  G + G +   +YN++  IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W+
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIF--AIGVA--------------------------SSWSKDSAGAAALAGAVGY---------------FVLTKAMVTINPEINMGVLAGIITGLVGGAVYNRWSGIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVGAGALGSGIFGFINRLLIPTGLHQVLNTIAWF 199
>gi|168228990|ref|ZP_02654221.1| hypothetical protein Sententeric_24683 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] (650 aa)
Score = 587, Expect = 3.6e-58, Identities = 153/468 (32%), Positives = 249/468 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENT-RLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG-MPLFEVLPK 888
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLAP L+  +HA L  ++  +   +G+            H G SFS G ID+++   +     +N W   + G+ +  IYF LF  +I+ FN++TPGR +    + T+E   N         + E L     LA + ++A GG DN+K +DACIT+LR+ + D + V+     +LGA G +K + Q++  + GA+A+ I   +K +   ++  P   +  +     +   ++  +  P    +   +EL        SP TGE+V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L  +  K L      V+ G  V  GQ +  + L  L  +A+S I+P++  N   +      +K  G +  G  PL+E+  K
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAITAFLTGVTEPLEFLFMFLAPLLYL-LHAILTGISLFVATLLGI------------HAGFSFSAGAIDYVLMYNLPAA-SNNVWMLLVMGVVFFIIYFLLFSAVIRMFNLKTPGREDKVDEMVTEEANSN---------TEEGLTQ---LATSYIAAVGGTDNLKAIDACITRLRLTVNDSARVNDVACKRLGASGVVKLNKQTIQVIVGAKAESIGDEMKKV---VARGPVAAASADAAHVATPAPAAKPQAVPNAVTI---AELV-------SPITGEVVALDQVPDEAFASKAVGDGVAVKPTDKTVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALNGQGFKRL------VEEGAEVTAGQPVLELDLDFLNANARSMISPVVCSNS--DDFSALVIKADGHVVAGKTPLYEIKSK 650
Score = 193, Expect = 1.9e-12, Identities = 75/257 (29%), Positives = 113/257 (43%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G ++F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +   +YN++  IKL   + FF G RFVPI T      +  +F  +WP V   +   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNM----------PFIAQAGGSIFDNLALVFAIGVASSWSKDSAGAAALAGAVGYFVM--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAVYNRWSGIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHGIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|121533350|ref|ZP_01665178.1| PTS system, glucose-specific IIBC subunit [Thermosinus carboxydivorans Nor1] >gi|121307909|gb|EAX48823.1| PTS system, glucose-specific IIBC subunit [Thermosinus carboxydivorans Nor1] (679 aa)
Score = 586, Expect = 4.4e-58, Identities = 159/439 (36%), Positives = 235/439 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           G ++ GK+ FM+ GLPAAA A+   A  E +     I  SA  TS LTGITEPIE++FLF+AP LF G+H     L+F  M+ + +             IGM+FSGG+ID++++G I       AWW  I  GL ++ IY+F F F I+ ++++TPGR         ED     N    N S         LA  V+ A GG +N+ +VDACIT+LR+ +K+   VD  KL +LGA G +     ++  VFG ++D    +IKT + +I +   L+      +  ++  ++A ++K   E                +P  G+++SL  VPD+ FS+ +MG G A++P  G++ SP+DG +S+V  + HA       G +++IH GID++NLK +       F   V  GD VK GQ I  V L  +K    S ITPII  N
  S:   271 GTFMTGKFPFMMFGLPAAALAIYHEAKPEKKASVAGIMASAALTSFLTGITEPIEFSFLFVAPVLF-GIHTIFAGLSFMFMHILNV------------KIGMTFSGGVIDYLLFGVIP---NRTAWWLVIPVGLVFSVIYYFGFRFAIRTWDLKTPGR---------EDEAENINSAATNAS---------LAAEVLQALGGKENLVDVDACITRLRVSVKNIGSVDQDKLKKLGAAGVMVIG-DNLQVVFGPKSD----SIKTQIIDIINGQTLQVADNARVAMTNTEAAAPQIKRVYEGFV-------------APVDGKLLSLNNVPDQVFSQKVMGDGFAIEPVNGEVVSPVDGTVSVVHSSKHAVGITANNGLELIIHFGIDTVNLKGEG------FTTLVNVGDKVKAGQPILKVDLELVKGKVASVITPIIFTN 653
Score = 377, Expect = 8.2e-34, Identities = 91/245 (37%), Positives = 132/245 (53%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + ++ K LMLP+A+LP AGI L  G+A+       +  A  N+ +  F   ++  G  +F  L LLFA+ +A+  +G  G A LA  +G+LI          +VT               G + G++       +  Y  V+GI  LQ+ VFGG +VG + A +Y +F NI++   +GFF G RFVPIVT  A   + I    +WP +   L +F    +       +FIFG IERAL+PFGLHH FY+P WY
  S:     9 LQQVGKSLMLPVALLPAAGILLACGNALQNPAMINILPALDNQVIHAFAKVMEQAGGIIFANLSLLFAVGVAVGLSGGEGVAGLAAIVGFLIM---------NVT--------------MGLVTGITPDMVTGKNPAYSNVLGIPTLQTGVFGGIIVGIMAAQIYKRFYNIEMPSYLGFFAGKRFVPIVTAAAALMLGIAMTFVWPPIQEGLNSFSRNMIDTNKTAAAFIFGVIERALIPFGLHHIFYNPFWY 238
>gi|16077304|ref|NP_388117.1| phosphotransferase system (PTS) glucosamine-specific enzyme IICBA component [Bacillus subtilis subsp. subtilis str. 168] >gi|3334500|sp|P39816|PTW3C_BACSU Putative PTS system glucosamine-specific EIICBA component [Includes: Glucosamine permease IIC component (PTS system glucosamine-specific EIIC component); Glucosamine-specific phosphotransferase enzyme IIB component (PTS system glucosamine-specific EIIB component); Glucosamine-specific phosphotransferase enzyme IIA component (PTS system glucosamine-specific EIIA component)] >gi|2632521|emb|CAB12029.1| phosphotransferase system (PTS) glucosamine-specific enzyme IICBA component [Bacillus subtilis subsp. subtilis str. 168] >gi|3599657|dbj|BAA33132.1| ybfS [Bacillus subtilis] (631 aa)
Score = 586, Expect = 4.4e-58, Identities = 160/443 (36%), Positives = 244/443 (55%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHI--GMSFSGGMIDWII-YGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLE 863
           G+++ G + +MI  LPA A A++  A  E +K+   + +SA  TS+LTGITEP+E++FLF+AP L+  +++ L  + F + +                H+  G +FSGG ID+++ YG       +N W     G+ +A IY++LF F I K+N++TPGR       T ED +N++           +  DQ LA +V+ A GG  NI N+DACIT+LR+ +   S V   +L +LGA G ++ +  +  A+FG ++D +K +IKT+M      P   +        + DT +   +KP+          S E  +   P  GE VSL  VPD+ FS+ MMG G A+ P+ GK+ +P DG++  +F T HA  F +  GT+ILIHVGID++ L  +       F  +V +G  VK G+ + T  L  +K HA S ITP+I  N S E
  S:   241 GRFMMGDFPYMIFCLPAVALAIIHTARPEKKKMISGVMISAALTSMLTGITEPVEFSFLFVAPVLYL-INSILAGVIFVVCDLF--------------HVRHGYTFSGGGIDYVLNYG-----LSTNGWVVIPVGIVFAFIYYYLFRFAILKWNLKTPGRE------TDEDGQNEEKA--------PVAKDQ-LAFHVLQALGGQQNIANLDACITRLRVTVHQPSQVCKDELKRLGAVGVLEVN-NNFQAIFGTKSDALKDDIKTIMA--GGVPATAA--------ALDTVTDKPLKPD----------SDETFIY--PIKGETVSLGDVPDQVFSEKMMGEGFAIIPSEGKVVAPADGEIVSIFPTKHAIGFMSAGGTEILIHVGIDTVKLNGEG------FEAHVTSGQAVKQGELLLTFDLNYIKQHAASAITPVIFTNTSEE 623
Score = 337, Expect = 3.8e-29, Identities = 81/247 (32%), Positives = 125/247 (50%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVT-DTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + + +L + LM P+A+LP AG+ L  G   + N             ++  G  VF  LPL+FA+ +AI   G  G A LA  IGYLI          +VT D  G ++G     Y+G    +  G                     VFGG ++G L A+LY +F +I+LHP++GFF+G RFVPI+T ++   + ++F  +WPL+   +      +  +  +  F +  I R L+PFGLHH FY+P ++
  S:     7 QILQQLGRALMTPVAVLPAAGLLLRFGDKDLLNI----------PIIKDAGGVVFDNLPLIFAVGVAIGLAGGEGVAGLAAVIGYLIL---------TVTLDNMGKLLGLQPP-YEGAEHLIDMG---------------------VFGGIIIGLLAAYLYKRFSSIELHPVLGFFSGKRFVPIITSVSSLVIGVIFSFVWPLIQNGINAASSLIADST-VGLFFYATIYRLLIPFGLHHIFYTPFYF 212
>gi|167553954|ref|ZP_02347697.1| hypothetical protein Sentente_25903 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] (650 aa)
Score = 586, Expect = 4.6e-58, Identities = 153/468 (32%), Positives = 249/468 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENT-RLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEVLPK 888
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLAP L+  +HA L  ++  +   +G+            H G SFS G ID+++   +     +N W   + G+ +  IYF LF  +I+ FN++TPGR +    + T+E   N         + E L     LA + ++A GG DN+K +DACIT+LR+ + D + V+ A   +LGA G +K + Q++  + GA+A+ I   +K +   ++  P   +  +     +   ++  +  P    +   +EL        SP TGE+V+L +VPDE F+   +G G+AV PT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L  +  K L      V+ G  V  GQ +  + L  L  +A+S I+P++  N   +      +K  G +  G  PL+E+  K
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAITAFLTGVTEPLEFLFMFLAPLLYL-LHAILTGISLFVATLLGI------------HAGFSFSAGAIDYVLMYNLPAA-SNNVWMLLVMGVVFFIIYFLLFSAVIRMFNLKTPGREDKVDEMVTEEANSN---------TEEGLTQ---LATSYIAAVGGTDNLKAIDACITRLRLTVNDSARVNDAACKRLGASGVVKLNKQTIQVIVGAKAESIGDEMKKV---VARGPVAAASADAAHVATPAPAAKPQAVPNAVTI---AELV-------SPITGEVVALDQVPDEAFASKAVGDGVAVNPTDKTVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALNGQGFKRL------VEEGAEVTAGQPVLELDLDFLNANARSMISPVVCSNS--DDFSALVIKADGHVVAGQTPLYEIKSK 650
Score = 193, Expect = 2.0e-12, Identities = 75/257 (29%), Positives = 113/257 (43%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G ++F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +   +YN++  IKL   + FF G RFVPI T      +  +F  +WP V   +   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNM----------PFIAQAGGSIFDNLALVFAIGVASSWSKDSAGAAALAGAVGYFVM--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAVYNRWSGIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHGIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|65321443|ref|ZP_00394402.1| COG1263: Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific [Bacillus anthracis str. A2012] (609 aa)
Score = 586, Expect = 4.7e-58, Identities = 145/393 (36%), Positives = 219/393 (55%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINL 810
           +  G +  GKY FM+ GLPAAA AM   A  EN+KLA  I  SA  TS LTGITEP+E++FLF+AP LF G+HA    L+F  M  +G+             IGM+FSGG+ID++++G +    G  AWW   + GL  A IY+F F F I+K+N++TPGR          +  N  +     G +E+      L   V+ A GG +NI ++DACIT+LR+Q+ +Q  V+  +L +LGA G ++    ++ A+FG ++D +K  I  +M         ++ + +         +  +V   + +V              SP  G+I+ + +VPD+ FS  MMG G A++PT G + SP++G++  VF T HA   ++E G +ILIH GID++ L
  S:   263 LTAGTFTTGKYPFMMFGLPAAALAMYHEARPENKKLAAGILGSAALTSFLTGITEPLEFSFLFVAPVLF-GIHAVFAGLSFMTMQILGV------------KIGMTFSGGLIDFMLFGVLP---GRTAWWWVIVVGLVLAVIYYFGFRFAIRKWNLKTPGR----------EVANANDGA---GKAEAGE----LPREVLVALGGKENIASLDACITRLRVQVNEQKNVNKDRLKELGAAGVLEVG-NNIQAIFGPKSDTLKSQIHDIMSG-------RTPHVEKEEPVKVEEALQKVDANETIV--------------SPIEGKILPITEVPDQVFSGKMMGDGFAIEPTEGTVVSPVNGEIVNVFPTKHAIGIQSEGGKEILIHFGIDTVKL 601
Score = 381, Expect = 2.7e-34, Identities = 96/244 (39%), Positives = 128/244 (52%)
  Q:    51 MLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQ--SVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           MLP+A+LP AGI LG G+A        V  A   +   +    ++  G+ +F  L LLFA+ +AI   G  G A LA F+GYLI         +   +   T +              G            Y  V+GI  LQ+ VFGG +VG + A+ YNK+ NI+L   +GFF G RFVPI T      V I+   +WP +   L TF  Q +     + +FIFG IER+L+PFGLHH FYSP W     YT A G +
  S:     1 MLPVAILPAAGILLGFGNAFQNPQLTNVIPALKADWFVMVAKIMEQSGDIIFANLALLFAVGVAIGLAGGDGVAGLAAFVGYLIMNKTMSVFLEVDKLVKVTSS--------------GADPVKIGFTDPAYANVLGIPTLQTGVFGGIIVGIVAAYCYNKYFNIELPSYLGFFAGKRFVPIATATFSLVVGIIMCFVWPYIQGGLNTFSHQMIDANRTLAAFIFGLIERSLIPFGLHHIFYSPFWFEFGQYTNAAGEL 245
>gi|167765680|ref|ZP_02437733.1| hypothetical protein CLOSS21_00168 [Clostridium sp. SS2/1] >gi|167712655|gb|EDS23234.1| hypothetical protein CLOSS21_00168 [Clostridium sp. SS2/1] (696 aa)
Score = 586, Expect = 5.4e-58, Identities = 151/462 (32%), Positives = 241/462 (52%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           V   +++ GK+  MI GLP AA A+   A  E RK+   + +SA  TS+LTGITEP+E+TFLF+AP L+ G+H     LA+ +M+ + + V            G++FSGG+ID   +G +Q Q  +N       G+ Y  +Y+FLF+FLI KF+I+TPGR E                 +        +  + L   + +  GG  NI ++D C+T+LR  +KD S+VD A + + G+RG +K    S+  ++G    ++K      +E+   +   K E ++++               KE   +  ++ +E +    P  G ++ L +V DE FS  M+G G AVKP  GK+Y+P+DG ++ VF T HA + E++ G ++LIH+G+D++    K G   K F   V+ G  VK G+ I    L D++     +T  +V++ + E   I  LK  GE   G
  S:   279 VEATRFMAGKFPLMIFGLPGAAFAIYRCARPEQRKVVGGLMISAALTSMLTGITEPLEFTFLFIAPGLY-GIHCVFAGLAYMMMHVLKITV------------GLTFSGGLIDLFFFGIMQGQEKTNWMMVIPLGIVYFIVYYFLFHFLILKFDIKTPGREEEPAQEY----------EEEPEYEYREDFSEELLAKIAAGLGGKKNIGDIDCCVTRLRCGLKDISLVDDAMIKETGSRGILKRG-NSIQIIYGPYVTVLKSE----LEDYLRTRRAKKEIKQLL---------------KENTHSKDKMQQESIAC--PIKGCVIELEEVGDEAFSGGMLGEGFAVKPEEGKLYAPVDGIIAAVFRTKHALAMESKDGAEVLIHLGLDTV----KRGG--KGFYMKVEAGQKVKKGELICEFDLEDMRVDGYVMTTPVVISNNAEYASIS-LKHIGECNVG 688
Score = 331, Expect = 1.7e-28, Identities = 91/285 (31%), Positives = 149/285 (52%)
  Q:    34 EKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIV--TNAGGNEGLRVFG------NFLQVP---GNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTAT 318
           ++ G     + ++ +  MLPIA+LP+AG+ LG+G ++   T       +++ G        ++V    G+ +FG LPL+FA+ ++I         A+A   G L F  + +A+S             ++L   G+ + + AG           ++GI  LQ  VFGG +VG  V +L+N+F  IKL  ++ FF G R VP++  +    V IL   IWP +   +  +G  +  +  + +FI+G +ERAL+PFGLHH FY P W T  GG++++    I       +A LA    T
  S:     2 KETGKVFGVLQRVGRAFMLPIAVLPVAGLLLGIGRSLTNETMLRAYHLMKIMGPGTILYGVIKVGSDCGSIIFGNLPLIFAMGVSIGMA--KAEKAVAALSGALSFFVMHEAIS-------------SMLSLYGDTYTMHAGAT-------DQILGITSLQLGVFGGILVGLGVGYLHNRFYKIKLPEVLSFFGGTRAVPVICTIVYVGVGILMFFIWPPIQNLMYSIGGIVRASGYLGTFIYGVMERALIPFGLHHVFYLPFWQTSLGGTMEVAGKMIDGAQNIFFAQLADPATT 275
>gi|167766136|ref|ZP_02438189.1| hypothetical protein CLOSS21_00629 [Clostridium sp. SS2/1] >gi|167712216|gb|EDS22795.1| hypothetical protein CLOSS21_00629 [Clostridium sp. SS2/1] (721 aa)
Score = 584, Expect = 8.5e-58, Identities = 150/421 (35%), Positives = 237/421 (56%)
  Q:   417 GVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGL--AYAPIYFFLFYFLIKKFNIQTPGRG---ENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKE----KVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLS-LVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEI 837
            V   +++ GKY FM+ GLP AA AM   A  E RK+   +  SA  TS LTGITEPIE+TFLF+AP LF  +H  L  L+F LM+ + +             IG +FS G+ID+++YG +Q Q  SN  W  I  +   YA +Y+F+F F+I+KF++ TPGR    E  +L+TK DY+ K+       + ++   +  ++  ++   GG  NI+++D C T+LRI + D++ V    L Q G++G IK     +  ++G +  +IK N +  +E  +              + +D S   EV P   +V +  E  KE    K+V  +  TG+++++ +  DE F+   MG G+ ++P  G + +P DGK++ L+  + HA   ET++G  +LIH+GID++ L    GK  K F   VK+G  VK G ++
  S:   287 AVEACRFMTGKYSFMMAGLPGAAYAMYRCAKPEKRKIVGGLLFSAALTSFLTGITEPIEFTFLFIAPGLFI-LHCGLAGLSFALMHILKIC------------IGTTFSCGLIDFMLYGVLQGQTKSN--WMMILPVFAVYAVLYYFVFKFVIEKFDLPTPGRDDDEEEVKLYTKADYQAKKGA----ANEDTDAPEDPISFMILKGLGGIKNIEDIDCCATRLRITVTDETKVTDQYLKQSGSKGIIKKG-TGIQIIYGPQVSVIKSNFEEYVEYYA-------------QHGTDPSKEEEVTP---IVSSKEEEKKEIRHGKLVAVA--TGKVLAMTQAKDEAFATCAMGDGVVIEPEKGVVVAPADGKITALMKPSLHAIGIETKEGLNLLIHIGIDTVKL---DGKGFKSF---VKSGQEVKAGDKL 673
Score = 382, Expect = 2.4e-34, Identities = 92/265 (34%), Positives = 142/265 (53%)
  Q:    32 GKEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNA------------GGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFT-GDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDL 296
            K+KK +    + ++ K   LP+++LPIAGI LG+GS+  TNA            G    L      +   GN +FG LPL+FA+A+A+     +   A L+  I + +  S  +A+                L   G I        ++ +    +V GI+ LQ  VF G +VG + A L+N+F   +L   + FF+GVRFVPI++ +A   V I+   +WP +   +  LG  +  +    + IFGF+ERAL+PFGLHH FY P W T  GG++++
  S:     2 AKKKKSSAFAVVQQIGKSFFLPVSVLPIAGILLGLGSSF-TNADTIAAYHLQGIMGEGTILNALLTIMSQVGNTIFGNLPLIFALAVALGMAKNEKAVAVLSAGISFFVMNSTINAM----------------LKLSGKILADGTYAKSVLNGQITSVCGIDSLQMGVFAGVIVGLVTAALHNRFYKQQLPAALAFFSGVRFVPIISVIAHIGVGIICFFVWPTIQSGIFALGNLVMHSGYFGTAIFGFLERALIPFGLHHVFYLPFWQTSLGGTMEV 262
>gi|116630242|ref|YP_815414.1| N-acetylglucosamine and glucose PTS, EIICBA [Lactobacillus gasseri ATCC 33323] >gi|116095824|gb|ABJ60976.1| N-acetylglucosamine and glucose PTS, EIICBA [Lactobacillus gasseri ATCC 33323] (691 aa)
Score = 582, Expect = 1.3e-57, Identities = 161/506 (31%), Positives = 263/506 (51%)
  Q:   371 YSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHA-KSTITPIIVLNESLEGREIKFLKKSGEI 876
           Y+A+ GT D   +A  +    Q++            L T G          ++  G++  M+ GLP AA AM +  PK NRK +  + +S G TS LTGITEPIEYTFLF+APWL+  +HA L   +F + + + +             IG SFSGG+ID++++G +Q +  +N     I G+ +  +YFF+F F IKKF++  PG      +  +++    Q       + + L N+   +  ++SA GG DNI+ V AC T+LR+ +KD ++V+      LGA G +K +   V A+FG +AD+    I  ++ +    P    + +KI N S+ T             K ++    EKV+  +P  G+   + +V DE FS+ MMG G A++P  GKIYSP+D  +  +F T HA   +T+ G ++++H+GID++ L+       KPF   V  GD V    ++  + L  +K A K  +   ++ N +    +++ +  SG++
  S:   227 YTALGGTAD---VAGKTVVGAQNIFFAQLADPNHHGLFTYGT---------RFFAGRFATMMFGLPGAALAMYLCLPKRNRKTSGGLYLSGGLTSFLTGITEPIEYTFLFVAPWLYV-IHAFLDGCSFYVADIMNI------------RIGNSFSGGLIDYLLFGVLQGRDKTNWPNVLIMGVIWFFLYFFVFTFCIKKFHVGIPG------MVVEDNQAADQIMAAGPKTDDKLYNE---SCEIISALGGLDNIETVSACATRLRVSLKDNNLVNDDVFKMLGAPGVLKVA-GGVQAIFGGKADLYSQEINDIITHPDMQPVSNPQVDKI-NKSTST-------------KIETVHKSEKVIFKAPVKGKFEDITQVKDEVFSQKMMGEGFAIEPENGKIYSPVDATVISIFKTKHAIGLKTKSGLEVMLHLGIDTVELQG------KPFTMKVNEGDQVTPETQLIEMDLEQVKDAGKDPVVMTLITNSNDRVSQVEDIVTSGQL 678
Score = 304, Expect = 2.6e-25, Identities = 84/280 (30%), Positives = 135/280 (48%)
  Q:    34 EKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAG-------GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFT-GDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLA 313
           +K  +  +  ++L +  MLPIA+LP+AG+ LG+G A+   A          E L+     +   G+AVF  L L+F+I +A+    GD G A LA  + YL++ +    L Q  +                                       N + + V G  V+G +VA+L+N ++ ++L   +GFF G RF+PI++ LA   +  +F +IWP +   LT  G A+ +     SF++GF+ R     GLHH  Y   WYT  GG+ D+    ++      +A LA
  S:     3 KKFSHVGQAFSQLGQAFMLPIAILPVAGLLLGLGGALTNKAAVGAYPWLNQEWLQTILKVMNFAGSAVFNNLALIFSIGLAVGLAKGDKGTAGLAGGVAYLVYTATISGLLQMFSPK-------------------------------------NTIDTGVLGAIVIGCVVAYLHNHYRKVELPQFLGFFGGSRFIPIISSLAAIVIGAIFFIIWPPIQSGLTSAGYAIAKMGSFGSFLYGFLLRLTGAVGLHHTIYPMFWYTALGGTADVAGKTVVGAQNIFFAQLA 253
>gi|196162833|ref|ZP_03123364.1| PTS system, glucose-specific IIBC component [Clostridium difficile QCD-23m63] (690 aa)
Score = 582, Expect = 1.5e-57, Identities = 155/443 (34%), Positives = 250/443 (56%)
  Q:   417 GVN--VGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEK-GTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVLN 859
           GVN   G ++ G + FM+ GLPAAA AMV  A  E +K    I  SA  TS LTGITEPIE+ FLF+AP LF  +H     L++ +M  +G+             IG +FSGG+ID++++G +        W+ + + G+ +A +Y+ +F F+I+KFN++TPGR +++           +  V++   S++      LA  ++ A G  +N+K++DACIT+LR+ + D + VD  KL  LGA G +     +V  +FG ++D IK +IK ++E  +          KI +     +  +++K   EV   ++ L +    + S   GEI+ + +VPD  FS  +MG G A+K   G IYSP+DG + ++F T HA   +++K G +ILIH+GI+++NL+         F   V  GD VK G+++  + L  + K+  STI+P++  N
  S:   262 GVNFTAGTFMTGAFPFMMFGLPAAALAMVHEAKPEKKKFVAGIMASAALTSFLTGITEPIEFAFLFVAPVLF-AIHCLFSGLSYAVMQLLGV------------KIGFTFSGGLIDFLLFGVLP---NRTPWYLAILVGIGFAVLYYSVFRFMIRKFNLKTPGREDDS-----------ETNVEVIDMSKN-----ELASEILVALGNKENLKSLDACITRLRLIVNDINKVDKEKLKSLGAAGVMVIG-NNVQVIFGPKSDSIKSDIKDIIEGKT----------KIESAVIKNNDKNKMKKNMEVANMENALVEN---IYSLTNGEILDIEEVPDSVFSSKLMGDGFAIKSNDGLIYSPVDGTIGVIFPTKHAIIIKSKKSGVEILIHLGIETVNLEGNG------FEVFVNVGDEVKAGEKLVKMDLEYIEKNGLSTISPVVFTN 657
Score = 341, Expect = 1.3e-29, Identities = 86/245 (35%), Positives = 134/245 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAG-------GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIA-LTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + K+ K LMLP+A+LP AGI LGV +A+  +A         N   ++  + ++  G  +F  LPL+FA+ +A+  T   G AALA  +G+LI  +    ++    D                          + +S+Y +++GI  +Q+ VFGG ++G + A+LY KF  I+L   +GFF G RFVPIVT L    + I+   IWP +    L+F    +     + +F+ G +ER L+PFGLHH F++P WY
  S:     8 LQKVGKSLMLPVALLPAAGILLGVSNALAGDALLAHFPALANPTFQLIISIMESSGQIIFNNLPLIFAVGVAVGLTEGEGVAALAAIVGFLILNTSMGVMAGVTEDM-------------------------IDNSMYASIVGIPTIQTGVFGGIIIGIVAAYLYKKFYKIELPQYLGFFAGKRFVPIVTSLVAIAIGIILSFIWPPIQEGLLSFSKNVIEANQTLAAFMEGSLERLLIPFGLHHVFHNPFWY 235
>gi|77979058|ref|ZP_00834480.1| COG1263: Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific [Yersinia intermedia ATCC 29909] (668 aa)
Score = 580, Expect = 2.7e-57, Identities = 162/490 (33%), Positives = 262/490 (53%)
  Q:   399 NLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGL---MNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYK-NKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN-ESLEGREIKFLKKSGEIKKGMPLFEVLPK 888
           N   GQQ++ +       G+  G+Y  G +  M+ GLP AA A+   A  ENR     I ++  F +  TGITEP+E++F+F+AP L++ +HA L  ++  +   M+WI                G  FS G++D ++     +   +  W+  I  GL +  IY+ +F F I+KFN+ TPGR        ++ Y  N  N   +N S   +N    LA   + A GG DN+  +DACIT+LR+ +KD + V+ +   +LGA G I+ + QSV  + G  A++I   ++T++   S            +  +S + + ++VKP+  +  T +      +V+ SP TG++V+L +VPDE F+   +G G+A++PT   + SP +G +  +F+T HA+  ETE G +I++H+GID++ L  +       FA  V  G TV  GQ I  + LA L  +A+S I+P++V N +   G  I  L  S  +    PLFE+  K
  S:   223 NFLGGQQSIDS--GKAIVGIT-GRYQAGFFPIMMFGLPGAALAIYHCARPENRAKVAGIMLAGAFAAFFTGITEPLEFSFMFVAPVLYF-LHAVLTGISVFIAASMHWIA---------------GFGFSAGLVDMVLSSRNPL---ATHWYMLIPQGLVFFAIYYVVFRFTIQKFNLLTPGRELAVEGSEEDGYDVNVDNTPAVNESE--ING---LARRYIGAIGGSDNLTAIDACITRLRLNVKDSAQVNDSVAKRLGASGVIRLNKQSVQIIVGTRAELIASAMRTVLAGGS------------VPAASSSVAPADVKPQAVINTTKTA----SLVLVSPITGDVVALDQVPDEAFASKAVGEGVAIRPTDKMVVSPANGTIVKIFNTDHAFCLETETGAEIVVHIGIDTVKLNGQG------FARLVDEGATVVAGQPILELDLAYLNANARSMISPVVVSNIDDYAG--ISVLAGSSVVAGQSPLFEIRGK 668
Score = 270, Expect = 2.0e-21, Identities = 76/246 (30%), Positives = 118/246 (47%)
  Q:    46 LSKGLMLPIAMLPIAGIFLGVGSAI-VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           + + LM+P+A LP A I +GVG  I   + GG+  L     F++  G A+   + +LFAI +A   + D  G AAL  F+G+L+  +L    + S+                            +P     A  G    Q   F G +VG + A LYN+F +++L   + FF+G R VPI+T   +  V  + + +WPL+  AL   G+ +     + + I+ F  R L+P GLHHA  S  W+  AG
  S:     1 MGRALMVPVATLPAAAILMGVGYWIDPVSWGGDNALAAL--FIK-SGAAIIDNMSVLFAIGVAYGMSKDKDGAAALTGFVGFLVLTTLCSPAAVSMIQK-------------------------IPVDQVPAAFGKINNQ---FVGILVGIISAELYNRFSSVELPKALSFFSGRRLVPILTSFLMIVVAFILMYVWPLIYNALVTFGEYIKDMGSVGAGIYAFFNRLLIPVGLHHALNSVFWFDVAG 217
>gi|154495794|ref|ZP_02034490.1| hypothetical protein BACCAP_00073 [Bacteroides capillosus ATCC 29799] >gi|150274992|gb|EDN02040.1| hypothetical protein BACCAP_00073 [Bacteroides capillosus ATCC 29799] (711 aa)
Score = 578, Expect = 3.6e-57, Identities = 154/458 (33%), Positives = 239/458 (52%)
  Q:   426 GKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGE---NTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLF 883
           G++V  I G P AA AM   A  E +K    + +SA  TS+LTGITEP+E++FLF+AP LF  + +    LA+ L + + + V            G++FSGG ID  ++G +Q    ++       G+ +  +Y+FLF FLIKKFN +TPGR E    T+L+TK DY  ++       + ES ++   ++ ++    GG  NIK+VD C T+LR  + D S VD   L   GA G I+   Q V  V+G + +IIK N++  + +         +    +  +   +SA E      +VKT        +V+ SPF GE   +   PD  F++ MMG G  V P  G + +P D  +S VFDT HA   E E G ++LIHVGI+++ LK +       F   V+ GD VK G  +    L  ++   ++++  ++     + +E++ L K+G +K G  L 
  S:   285 GEFVLYIFGFPGAALAMYRCAKPERKKQVGGLLLSAALTSILTGITEPLEFSFLFVAPVLFI-ISSVFAGLAYMLCHILNITV------------GLTFSGGFIDLALFGILQGNEKTSWLLIIPLGIVFFLVYYFLFSFLIKKFNFKTPGREEGDQETKLYTKADYNARK-------AGESADSGDQVSASIAQGLGGAANIKDVDCCATRLRCTVIDSSKVDQTILKSTGAHGVIQKG-QGVQVVYGPQVNIIKANLEDYLRS-----GAAQQAAPAVEAAPAEASAPEAHTHGALVKT--------IVIGSPFHGESAPVTASPDPAFAEKMMGDGATVIPCEGVVTAPCDATISFVFDTNHAIGLELEDGVEMLIHVGINTVALKGEG------FHALVQEGDQVKKGDRLLEFDLDFIRENAASVSSPVLFTSMEDNQELRLL-KAGHVKPGEDLL 704
Score = 363, Expect = 3.5e-32, Identities = 95/280 (33%), Positives = 145/280 (51%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIV--TNAGGNEGLRVFG---------NFLQVPGNAVFGALPLLFAIAIAIAFT-GDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTS 322
           + ++ +  MLPIA+LP+AG+ LG+GS+    T       L V G         + L   G  +F  LPL+FAI +AI     +   AALA  + +L+   +  A+S  +T T             G +  L  G+         +V+GI  LQ   FGG +VG  VA L+N+F  ++L  ++ FF G RFVPI++ L    V IL   +W  +   +  LG  +  +    +F+FG I+R L+PFGLHH FY P W T  GG++++    +       +A LA  T T  ++
  S:     9 LQRVGRSFMLPIAILPVAGLLLGLGSSFTNETTLATYNLLGVMGPGTVPYFIFSVLSKCGGVIFDNLPLIFAIGVAIGMARQEKEVAALAAAVSFLV---MHSAISAMITLT-------------GGVENLLEGSTT-------SVLGITSLQMGAFGGIIVGLGVAALHNRFYKVQLPQVLSFFGGTRFVPIISTLVFALVGILMFFVWQPIQEGINALGVLVYSSGYFGTFLFGMIKRLLIPFGLHHVFYLPFWQTAVGGTMEVAGTVVAGAQNIFFAQLADPTVTHFST 277
>gi|188025740|ref|ZP_02959637.2| hypothetical protein PROSTU_01519 [Providencia stuartii ATCC 25827] >gi|188020307|gb|EDU58347.1| hypothetical protein PROSTU_01519 [Providencia stuartii ATCC 25827] (661 aa)
Score = 572, Expect = 1.8e-56, Identities = 158/447 (35%), Positives = 242/447 (54%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAF---GLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIF-GLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNND-QVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEK--EVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN-ESLEGREI 867
           G+Y  G +  M+ GLP AA A+   A  EN+     I ++  F +  TGITEP+E++F+F+AP L+  +HA L  ++      M WI                G  FS G++D ++     +      WW  I  GL +  IY+ +F F+I KF + TPGR  +    T + Y    +      S++S ++D Q  A   V+A GG DNI  +DACIT+LR+ +KD S+V+ A   +LGA G I+ + QSV  + G  A+++   +K   E I+  P   S            +SA+E +  K  E VKT  E     V   +P +GE+ SL  VPDE FS  ++G GIA+KPT+ ++ +P  G +  +F+T HA+  ETE G ++++H+GID++ LK +    L      V+ G  VK G  I  + +A L+ +AKS I+P+I+ N +   G EI
  S:   237 GRYQAGFFPIMMFGLPGAALAIYHCARPENKAKVAGIMLAGAFAAFFTGITEPLEFSFMFVAPVLYV-IHALLTGISIYISATMEWIS---------------GFGFSAGLVDMLLQSRNPLAL---QWWMLIVQGLVFFCIYYVVFRFMITKFKLLTPGREVSAGDETIDGYDENLS------SADSTDSDIQKEARQYVAAVGGSDNITGIDACITRLRLNVKDSSIVNDAMAKRLGASGVIRLNKQSVQVIVGTRAELVASAMK---EVIAKGPIAAS------------ASATETEKAKIAEPVKTKGETILSLV---APVSGEVYSLDDVPDEAFSSRIVGDGIAIKPTSDEVLAPASGTVVKIFETNHAFCLETENGVELIVHMGIDTVALKGEGCARL------VEEGSEVKAGTPILKLDIAFLEANAKSMISPVIISNIDDFAGVEI 643
Score = 260, Expect = 2.9e-20, Identities = 73/241 (30%), Positives = 117/241 (48%)
  Q:    51 MLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           M+P+A+LP A I +G+G  I  +  G          L   G A+   + +LFAI IA   + D  G AAL  F+G+L+  +L    S S+                  I  +   N  +P++        N++ +  F G +VG L A LYN++  ++L   + FF+G R VPI+T   +  +  + + +WP+V  AL   G+++     + + I+ F  R L+P GLHHA  S  W+  AG
  S:     1 MVPVAVLPAAAILMGIGYWIDPDGWGANS--AIAALLIKSGAAIIDNMSVLFAIGIAYGMSKDKDGAAALTGFVGFLVVTTLCSPASYSM------------------IMNVPLEN--VPAAF-------NKINNQ-FVGILVGVLSAELYNRYSGVELPKALSFFSGRRLVPILTSFLMIILAFILMYVWPVVYNALVSFGESIKDLGSVGAGIYAFFNRLLIPVGLHHALNSVFWFDVAG 212
>gi|77411852|ref|ZP_00788185.1| PTS system, IIABC components [Streptococcus agalactiae CJB111] >gi|77162073|gb|EAO73051.1| PTS system, IIABC components [Streptococcus agalactiae CJB111] (671 aa)
Score = 569, Expect = 4.0e-56, Identities = 224/788 (28%), Positives = 352/788 (44%)
  Q:    91 GNAVFGALPLLFAIAIAIAFT----GDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKS-VWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKD-QSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKK 878
           G  V G L +LFA+AI  ++     G A  A L+  +  LI G+     +  + D+   V           +FG +       S  +  V+G   L   VF G + GF+ A  +NK+ N  KL   + FFNG RFVP V       V ++  + WP+V   +   G+ +      A  +  F++G IER L+PFGLHH    P+ YTQ                G  Y VL  +T                                    A +LG+  +WL      W    IN                   L  SN +     L ++    FK   VGQ +    + M L     + AM     K+ +    S+ +SA   + LTG+TEPIEY F+F A  L+  V+A +   AF + + + L V + G+ E    + M    G+             G + +      L +A + +F+  F+IKKFN+ T GR  N   +  E+  N  +    +GS+++  N QV+   V++  GG DNI++VDAC+T+LR+ +KD  SV   A   + GA G +      V A++G +AD++K +I+ L+++ +  P +  E       +    +A++V   K +         E++V  S   G++ +L  V D  FS+ MMG G AV+PT G IY P+ G ++ VF T HA+   TE G ++L+H+G+D++ L        +PF   + +G  V  G       L  +K A    + IIV     + + +K  K   +I K
  S:     6 GWGVIGNLHILFALAIGGSWAKERAGGAFAAGLSFILINLITGNFFGVKTDMLADSKATV---------QTVFGATI----RVSDYFVNVLGQPALNMGVFVGIISGFVGATAFNKYYNYRKLPDALTFFNGKRFVPFVVIYRSVIVALILSVFWPVVQSGINGFGKWIASSQDSAPILAPFVYGTIERLLLPFGLHHMLTIPMNYTQL---------------GGTYTVLTGATK----------------------------------GAQVLGQDPLWL-----AWVGDLIN-------------------LKGSNSSQYHHLLTSVTPARFK---VGQMIGASGILMGL-----SYAMYRNVDKDKKLKYKSMFISAAAATFLTGVTEPIEYMFMFAAMPLYL-VYAVVQGCAFAMADIVNLRVHSFGNIEFLTRVPMGIKAGL-------------GGDIFNFVWVTLLFAVLMYFIANFMIKKFNLATAGRNGN---YDNEEVDNAPSTA--SGSADA--NSQVV--QVINLLGGRDNIEDVDACMTRLRVTVKDGNSVGSEAAWKKAGAMGLVLKG-NGVQAIYGPKADVLKSDIQDLLDSGTVIPIVDLE-------TGQPVAAAQVTTYKGIT--------EEIV--SVANGQVEALDVVKDPVFSQKMMGDGFAVEPTDGNIYVPVSGTVTSVFPTKHAFGLLTESGLEVLVHIGLDTVALDG------QPFEVKISSGQKVVAGDLAVVADLEAIKAAGKETSVIIVFTNVSDIKTVKLEKSGPQIAK 663
>gi|42519715|ref|NP_965645.1| phosphoenolpyruvate-dependent sugar phosphotransferase system EIIABC, glucose specific [Lactobacillus johnsonii NCC 533] >gi|41584004|gb|AAS09611.1| phosphoenolpyruvate-dependent sugar phosphotransferase system EIIABC, glucose specific [Lactobacillus johnsonii NCC 533] (688 aa)
Score = 568, Expect = 6.1e-56, Identities = 158/506 (31%), Positives = 261/506 (51%)
  Q:   371 YSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPI-IVLNESLEGREIKFLKKSGEI 876
           Y+A+ GT D   +A  +    Q++            L T G          ++  G++  M+ GLP AA AM +  PK NRK    + +S G TS LTGITEPIEYTFLF+APWL+  +HA L   +F + + + +             IG SFSGG+ID++++G +Q +  +N     I G+ +  +YFF+F F IKKF++  PG      +  +E+   ++       + + L N+   +  +++A GG +NI+ V AC T+LR+ +KD S+V+      LGA G +K +   V A+FG +AD+    I  ++ +    P    + +K  N  S++   SE                 +V+  +P  G    +++V DE FS+ MMG G A+KP  GKIYSP++  +  +F T HA   +T+ G ++++H+GID++ L      E KPF   V  G+ V    ++  + L  ++ AK   T + ++ N S    +++ +  SG++
  S:   227 YTALGGTAD---VAGKTVVGAQNIFFAQLADPNHHGLFTYGT---------RFFAGRFATMMFGLPGAALAMYLCLPKRNRKTNGGLYLSGGLTSFLTGITEPIEYTFLFVAPWLYV-IHAFLDGCSFYVADIMNI------------RIGNSFSGGLIDYLLFGVLQGKDKTNWPNVLIMGVIWFFLYFFIFTFCIKKFHVGIPG------MVVEENQDAEKIMSNSPKTDDKLYNE---SCEIITALGGLENIETVSACATRLRVSLKDNSLVNDDVFKMLGAPGVLKVA-GGVQAIFGGKADLYSQEINDIIAHPDMQPANNPQVDKTSNFQSNSVHKSE-----------------EVIFKAPVKGTFEDISQVNDEVFSQKMMGEGFAIKPENGKIYSPVNATVVSIFKTKHAVGLKTDSGLEVMLHLGIDTVEL------EGKPFTLKVNEGEQVTPETQLIEMDLKQIETAKKDPTVMTLITNSSERVEQVEDIATSGQL 675
Score = 302, Expect = 3.9e-25, Identities = 85/270 (31%), Positives = 133/270 (49%)
  Q:    44 AKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAG-------GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFT-GDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLA 313
           ++L +  MLPIA+LP+AG+ LG+G A+   A          E L+     +   G+AVF  L L+F+I +A+    GD G A LA  + YL++              T  + G   LF   N                        + + V G  V+G +VA+L+N ++ ++L   +GFF G RF+PI++ LA   +  +F +IWP +   LT  G A+ +   + SF++GF+ R     GLHH  Y   WYT  GG+ D+    ++      +A LA
  S:    13 SQLGQAFMLPIAILPVAGLLLGLGGALTNKAAVTSYPWLNQEWLQTILKIMNFAGSAVFNNLALIFSIGLAVGLAKGDKGTAGLAGGVAYLVY--------------TATISGLLQLFSPKN-----------------------TIDTGVLGAIVIGSVVAYLHNHYRKVELPQFLGFFGGSRFIPIISSLAAIVIGAIFFIIWPPIQSDLTSAGYAIAKMGSLGSFLYGFLLRLTGAVGLHHTIYPMFWYTALGGTADVAGKTVVGAQNIFFAQLA 253
>gi|85058837|ref|YP_454539.1| PTS system N-acetylglucosamine-specific IIABC component [Sodalis glossinidius str. 'morsitans'] >gi|84779357|dbj|BAE74134.1| PTS system N-acetylglucosamine-specific IIABC component [Sodalis glossinidius str. 'morsitans'] (678 aa)
Score = 568, Expect = 6.4e-56, Identities = 155/457 (33%), Positives = 242/457 (52%)
  Q:   403 GQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGL---MNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           GQQ++      G  G+  G+Y  G +  M+ GLP AA A+   A  ENR     I ++A F S  TGITEP+E++F+F+AP L++ +HA L  L+  +   M+WI                G  FS G++D ++     +   +  W+  I  GL +  +Y+ +F F I++FN+ TPGR         + Y      V I+   E  +  Q LA   +S  GG DN+  +DACIT+LR+ +KD S+V+ A    LGA+G I+ + +S+  + G  A+II   ++T++ N   SP             +   S + V      V+T S      V + SP TG++V L +VPDE F+   +G GIA++PT   + SP +G L  VF+T HA+  ET+ G ++++H+GID++ L  +       F   V+ G  V  GQ I  + LA L  +A+S I+P++V N
  S:   236 GQQSIE--AGTGIVGIT-GRYQAGFFPIMMFGLPGAALAIYHCARPENRSKIAGIMLAAAFASFFTGITEPLEFSFMFVAPVLYF-LHAILTGLSVFIAASMHWIA---------------GFGFSAGLVDMVLSSRNPL---AVHWYMLIPQGLVFFVLYYLVFRFTIRRFNLLTPGRELQMAGDETDGYD-----VNIDAGGEG-DETQKLARRYISVIGGSDNLTGIDACITRLRLSVKDTSLVNDAVAKNLGAQGVIRLNKESLQIIVGTRAEIIASAMRTVLANGPVSP-------------ARAVSPTPVATPAPRVETPSAGKPVVVSLISPMTGDVVLLEQVPDEAFATRAVGEGIAIRPTDKLVLSPANGTLVKVFNTHHAFCLETDGGAEVVVHIGIDTVALNGQG------FTCLVEEGSKVTQGQPILELDLAYLNANARSMISPVVVSN 650
Score = 283, Expect = 6.5e-23, Identities = 76/254 (29%), Positives = 119/254 (46%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           N   ++ K+ + LM+P+A LP A I +GVG  I  +  G  G      F    G+A+   + +LFAI +A   + D  G AAL  F+G+L+  +L    S ++                            +P     A  G    Q   F G +VG + A LYN+F +++L   + FF+G R VPI+    +  +  + + IWP++  AL   G+ + Q   + + I+ F  R L+P GLHHA  S  W+  AG
  S:     2 NILSYLQKIGRALMVPVATLPAAAILMGVGYWI--DPVGWGGSNALAAFFIKSGSAIIENMSVLFAIGVAYGMSKDKDGAAALTGFVGFLVVTTLCAPASVAMIQK-------------------------IPVDQVPAAFGKINNQ---FVGILVGIISAELYNRFSHVELTKALSFFSGRRLVPILVSFVMIFIAFILMYIWPVIFNALVAFGEHIQQLGSVGAGIYAFFNRLLIPVGLHHALNSVFWFDVAG 226
>gi|118444901|ref|YP_878830.1| PTS enzyme II, ABC component [Clostridium novyi NT] >gi|118135357|gb|ABK62401.1| PTS enzyme II, ABC component [Clostridium novyi NT] (659 aa)
Score = 567, Expect = 7.0e-56, Identities = 171/439 (38%), Positives = 253/439 (57%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKE-KVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL--KHAKSTITPIIVLN 859
           G ++  +Y  ++ GLPAAA AM++AA KENRK   S+ +SA F + LTGITEPIE++F+F+AP LF   H +   L+       GL+ S      L   +G +FS   ID+++      ++    W  +I GL +  +YF +FYF IK  NI TPGR E+    T + ++N      I G  +S          V+ A GG DNI+ +DACIT+LR+ +KD S+VD + L  LGA G  + S  +V AVFG EA+ IK  IK+++ +   S    S  E + + + D S      PEK     ++  +      + SP +G+I+ L++VPD+ F+  +MG GIA++PT+G + SP+DG ++ +F T HA    T+ G +ILIHVGID++ ++   G+  K F   V  GD VK G ++  V L DL  K A+S ITPII+ N
  S:   238 GFFMAAEYPILMFGLPAAALAMILAAKKENRKKISSMMISAAFVAFLTGITEPIEFSFIFVAPILFV-FHVAAAFLS-------GLLTSF-----LKIRLGYTFSASFIDYVL----GFKFAGRPWLIWIVGLGFFILYFVVFYFTIKLLNIHTPGR-EDDDPSTNKKFEN------IKGMEKSKA--------VLLAIGGKDNIEVLDACITRLRLTLKDPSMVDKSTLKALGAAGVFE-SGNNVQAVFGTEAERIKDEIKSIIASGIVSTEDVSSCENLDDLTKDDS------PEKNSDNFNNNQNINNSQTLKSPISGKILDLSEVPDKIFASKLMGDGIAIEPTSGIVTSPVDGTVAQLFWTNHAIGIVTDSGIEILIHVGIDTVKME---GRGFKAF---VSQGDKVKTGDKLLEVDL-DLVKKEAESIITPIIITN 633
Score = 292, Expect = 5.6e-24, Identities = 83/268 (30%), Positives = 121/268 (45%)
  Q:    36 KGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQ---VPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIY 303
           KG     + K+ K LMLP+++LP AG+ L  G         N+ L  FG   Q     G+A+F  L L+FA+ +AI F+G    AALA  IG LI         Q+V   TG  +G                                 +   VFGG ++G + A LY KF +IKL  ++GFF G RF+PI+T +      ++   IWP +   +         ++ +    +   +R L+P GLHH +Y P  Y Q G   + T N + Y
  S:     5 KGKIFSILQKIGKSLMLPVSVLPAAGLLLRFGQ--------NDLLGRFGPIFQNLGTAGDAIFNNLALIFAVGVAIGFSGGESVAALAAVIGQLIL--------QAVLAATGQRLG-------------------------------TSIDMGVFGGIMIGLIAAILYKKFHDIKLPQVLGFFGGKRFIPIITSVFSLIFAVIGASIWPFIQTKINIFAHWASSSI-LGPAFYAAGKRLLIPLGLHHMYYPPFLY-QFG---EFTSNGVKY 223
>gi|94972088|ref|YP_594128.1| phosphotransferase system, glucose-specific IIBC component [Deinococcus geothermalis DSM 11300] >gi|94554139|gb|ABF44054.1| Phosphotransferase system, glucose-specific IIBC component [Deinococcus geothermalis DSM 11300] (709 aa)
Score = 566, Expect = 9.2e-56, Identities = 148/463 (31%), Positives = 238/463 (51%)
  Q:   397 WSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNI-KTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSP---------FTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           ++N  +GQ   G +        + G ++ G +  M+  LPAAA AMV  A  E R++   I  SA  TS LTGITEPIE+ F+F+AP L +  HA++  L+F +MN +G             H G +FSGG ID+ +     +   +  W   + GL +A IY+ +F   I++FN+ TPGR       T ED            +      D+ LAL ++ A GG  NI+N+DACIT+LR+ + D+  V+   L  LGA G ++    SV AVFG  +D +K  + + + E + ++ +   E   + + +  + +          V++ S          +P           G ++ L++VPD  FS  +MG G A+ P +G++ SP+ G++  +F TGHA     + G ++L+H+GID++ L  +       F P V+ G+ V  GQ +  V L  ++    S ITP++  N
  S:   255 YTNPQTGQVVHGDLTRYIAGDRSAGIFMTGFFPIMMFALPAAALAMVQEARPERRRVIAGIMASAALTSFLTGITEPIEFAFMFVAP-LLYVFHAAMTGLSFVVMNLLG------------SHNGFTFSGGAIDYFLL----MPKSTRPWLVPVVGLVFAAIYYVVFRAAIRRFNLLTPGR----EAVTTED--------TATATVLPRGGDRPLALGILRALGGPSNIQNLDACITRLRVTVHDKGQVNKGTLQTLGAAGVLEVG-NSVQAVFGTRSDQLKEEMQRVIAEGVYTASDEPDEAAALTSRADASPAPVPPPVAPATVRSASPALIPDPASAAPGLPADFTLPLAGRVLPLSEVPDPVFSGKIMGDGFAIDPVSGEVRSPVSGEVITLFPTGHAVGLRADNGLEVLVHIGIDTVGLNGEG------FTPLVRQGEHVTAGQPLIRVNLEAIRGRVPSLITPVVFTN 692
Score = 350, Expect = 9.8e-31, Identities = 103/281 (36%), Positives = 148/281 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-----VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGI-NSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSW 323
           + ++ K LMLP+A+LP AG+ LG GSA        +A     L+  G  +    NA+FG LP++FA+ +AI     AG AALA  +G+L+  +           T  A +G       G+    +  + A P + Y  V+GI  LQ+ VFGG ++G L AFLYN++K+I+L   +GFF G RFVPIVT  A   + I+   +WP V   L        Q   +  S IFGFI R L+PFGLHH +Y P W+  AG   +     +++ D   Y     S    +T +
  S:    18 LQEIGKALMLPVAVLPAAGLLLGFGSAFNDPSYTWHASIPHWLQFVGTLMVGASNAIFGNLPIIFALGVAIGLAAGAGVAALAALVGFLVMNA-----------TMSAYLGL------GDAAKFADLSRAQPGA-YATVLGIPTLQTGVFGGILMGLLSAFLYNRYKDIRLPAFLGFFAGRRFVPIVTAAAAIVLGIVLTYLWPPVQHGLNVFSNVATQGAPVAASGIFGFINRLLIPFGLHHIWYQPFWFI-AGDYTNPQTGQVVHGDLTRYIAGDRSAGIFMTGF 285
>gi|168187512|ref|ZP_02622147.1| pts system glucose-specific eiicba component [Clostridium botulinum C str. Eklund] >gi|169294592|gb|EDS76725.1| pts system glucose-specific eiicba component [Clostridium botulinum C str. Eklund] (655 aa)
Score = 566, Expect = 1.1e-55, Identities = 154/449 (34%), Positives = 249/449 (55%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN-ESLEGREIKF 869
           G ++  +Y  ++ GLP AA A++ AA KENRK    I +SA F + LTGITEPIE+TF+F+AP LF             + + I    S      L   +G +FS   ID+++      ++    W  ++ G+A+  +YF +FYF+IK  +I+TPGR + +  F   D K K+    + GS +        A  V++A GG +NI+ +DACIT+LR+ +KD S V+   L  LGA G ++ +  +V A+FG EA+ IK ++K +++  S    +  +  KI  N  +     E +P K +       SK+ + + +P  GEI+ + KVPDE FS   +G G A+ P   ++ SPI G+++++F T HA + + + G +IL+H+GID++NL  +       F  +V  GD VK G  +       ++  AKS ITP+++ N +S+E  +I +
  S:   241 GFFMASEYPIVMFGLPGAAIAIIAAAKKENRKKVAGIMVSAAFVAFLTGITEPIEFTFIFVAPMLF-------------IFHVIAAFFSGIITSLLKIRLGYTFSASFIDYVL----GFKFAGRPWLIWLVGIAFFALYFVVFYFVIKILDIKTPGREDESEYF---DPKLKE----VKGSEK--------AKRVINAIGGKENIEVLDACITRLRLTLKDPSKVNKGALKALGAAGVLE-AGNNVQAIFGTEAEKIKDSMKAIIQ--SGEDTIVVDDSKIDENEYN---GGEKEPNKVI-------SKKTLEIINPLKGEIIEITKVPDEVFSSKALGDGFAINPLGNQVVSPIGGEIAVLFPTKHAVAIKGDNGLEILVHIGIDTVNLNGEG------FTSHVSQGDKVKQGDLLVEFDKDTVESKAKSLITPVVITNMDSIESIDIYY 640
Score = 260, Expect = 3.1e-20, Identities = 87/254 (34%), Positives = 122/254 (48%)
  Q:    34 EKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIW-PLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           ++KG     + K+ K LMLP+++LP AGI L +G   +    G     +F N L   G+A+F  LPL+FA+ +AI F+G    A+LA  IG LI         Q+V   TG  +G                            + IN     VFGG ++G + A LYNK+ +IKL  ++GFF G RFVPI+T  A     ++   IW P+  I   F   A     G   +  G  +R L+P GLHH +Y P  Y
  S:     6 KRKGKVFAVLQKIGKSLMLPVSVLPAAGILLRIGQDDLLGRYG----AIFKN-LATAGDAIFTNLPLIFAVGVAIGFSGGEAVASLAAVIGQLIL--------QAVLLETGKRVG----------------------------VPINM---GVFGGIIIGLIAAILYNKYHDIKLSQVLGFFGGKRFVPIITSFASLIFAVIGAAIWQPIQNIINIFAKWASTSIFGPAFYAAG--KRLLIPLGLHHIYYPPFLY 214
>gi|167468408|ref|ZP_02333112.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pestis FV-1] (618 aa)
Score = 564, Expect = 1.7e-55, Identities = 162/513 (31%), Positives = 271/513 (52%)
  Q:   347 MWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWS--------NLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGL---MNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           +W  I   L+    ++K+L S    + I   ++   I    + A+ SV  +         N   GQ+++      G  G+  G+Y  G +  M+ GLP AA A+   A  EN+     I M+  F +  TGITEP+E++F+F+AP L++ +HA L  ++  +   M+WI                G  FS G++D ++     +   +  W+  I  GL +  IY+ +F F I+KFN+ TPGR        ++ Y    +K      SE +N+   LA   + A GG DN+  +DACIT+LR+ +KD ++V+ +   +LGA G I+ + QSV  + G  A++I   ++T++   +  P         +  +S  ++ +  +P+  V+ T    S   +V+ SP TG++V LA+VPDE F+   +G G+A++PT   + SP  G +  +F+T HA+  ETE G +I++H+GID++ L  +       F   V+ G TV  GQ +  + LA L  +A S I+P++V N
  S:   115 IWPLIYNALVTFGEYIKDLGS--VGAGIYAFFNRLLIPVGLHHALNSVFWFDVAGINDIPNFLGGQESINK--GTGIVGIT-GRYQAGFFPIMMFGLPGAALAIYHCARPENKAKVAGIMMAGAFAAFFTGITEPLEFSFMFVAPVLYF-LHAVLTGISVFIAASMHWIA---------------GFGFSAGLVDMVLSSRNPL---ATQWYMLIPQGLIFFVIYYLVFRFTIQKFNLLTPGRELAVEGSEEDGYDVNVDKTPAVNESE-INS---LARRYIGAIGGSDNLTAIDACITRLRLNVKDSALVNDSVAKRLGASGVIRLNKQSVQIIVGTRAELIAAAMRTVL---AGGP---------IPAASSNAAPTGARPQA-VINTAKTAS---LVLVSPITGDVVPLAQVPDEAFASKAVGEGVAIRPTDKIVVSPASGTIVKIFNTDHAFCLETETGAEIVVHIGIDTVKLNGQG------FTRLVEEGTTVVAGQPVLELDLAYLNANAHSMISPVVVSN 590
Score = 205, Expect = 7.4e-14, Identities = 40/105 (38%), Positives = 59/105 (56%)
  Q:   187 FGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           F G +VG + A LYN+F  ++L   + FF+G R VPI+T   +  V  + + IWPL+  AL   G+ +     + + I+ F  R L+P GLHHA  S  W+  AG
  S:    63 FVGILVGIISAELYNRFSGVELPKALSFFSGRRLVPILTSFLMIAVAFMLMYIWPLIYNALVTFGEYIKDLGSVGAGIYAFFNRLLIPVGLHHALNSVFWFDVAG 167
>gi|187730563|ref|YP_001879323.1| PTS system, N-acetylglucosamine-specific IICBA component [Shigella boydii CDC 3083-94] >gi|187427555|gb|ACD06829.1| PTS system, N-acetylglucosamine-specific IICBA component [Shigella boydii CDC 3083-94] (648 aa)
Score = 563, Expect = 2.4e-55, Identities = 157/465 (33%), Positives = 252/465 (54%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLA          L  L   L+  I L V+      L  H G SFS G ID+ +   +      N W   + G+ +  IYF +F  +I+ FN++TPGR         ED +++    + N ++E   N   LA N ++A GG DN+K +DACIT+LR+ + D + V+     +LGA G +K + Q++  + GA+A+ I   +K +   ++  P   +  E+     + +++A   KP+       + +S  ++V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L+ K  K L      V+ G  V  GQ I  + L  L  +A+S I+P++  N  ++      +K  G +  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLA---------PLLYLLHALLTGISLFVATL----LGIHAGFSFSAGAIDYALMYNLPAA-SQNVWMLLVMGVVFFAIYFVVFSLVIRMFNLKTPGR---------EDKEDEIVTEEANSNTEEGLNQ--LATNYIAAVGGTDNLKAIDACITRLRLTVADSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKV---VARGPVAAASAEE-----TPSTAAPVAKPQA----VPNAVSIAELV--SPITGDVVALDQVPDEAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRL------VEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSN--IDDFSGLIIKAQGHVVAGQTPLYEI 646
Score = 203, Expect = 1.2e-13, Identities = 77/257 (29%), Positives = 114/257 (44%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +    YN++ +IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVL--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|82543114|ref|YP_407061.1| N-acetyl glucosamine specific PTS system components IIABC [Shigella boydii Sb227] >gi|81244525|gb|ABB65233.1| PTS system N-acetylglucosamine-specific enzyme IIABC [Shigella boydii Sb227] (648 aa)
Score = 562, Expect = 2.7e-55, Identities = 157/465 (33%), Positives = 252/465 (54%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLA          L  L   L+  I L V+      L  H G SFS G ID+ +   +      N W   + G+ +  IYF +F  +I+ FN++TPGR         ED +++    + N ++E   N   LA N ++A GG DN+K +DACIT+LR+ + D + V+     +LGA G +K + Q++  + GA+A+ I   +K +   ++  P   +  E     ++ +++A   KP+       + +S  ++V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L+ K  K L      V+ G  V  GQ I  + L  L  +A+S I+P++  N  ++      +K  G +  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLA---------PLLYLLHALLTGISLFVATL----LGIHAGFSFSAGAIDYALMYNLPAA-SQNVWMLLVMGVVFFAIYFVVFSLVIRMFNLKTPGR---------EDKEDEIVTEEANSNTEEGLNQ--LATNYIAAVGGTDNLKAIDACITRLRLTVADSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKV---VARGPVAAASAE-----ATPSTAAPVAKPQA----VPNAVSIAELV--SPITGDVVALDQVPDEAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRL------VEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSN--IDDFSGLIIKAQGHVVAGQTPLYEI 646
Score = 203, Expect = 1.2e-13, Identities = 77/257 (29%), Positives = 114/257 (44%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +    YN++ +IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVL--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|16122841|ref|NP_406154.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia pestis CO92] >gi|22125106|ref|NP_668529.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia pestis KIM] >gi|45440916|ref|NP_992455.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia pestis biovar Microtus str. 91001] >gi|108808463|ref|YP_652379.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia pestis Antiqua] >gi|108811277|ref|YP_647044.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia pestis Nepal516] >gi|145599888|ref|YP_001163964.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia pestis Pestoides F] >gi|149365471|ref|ZP_01887506.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia pestis CA88-4125] >gi|162419497|ref|YP_001604947.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia pestis Angola] >gi|165925244|ref|ZP_02221076.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pestis biovar Orientalis str. F1991016] >gi|165937607|ref|ZP_02226169.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pestis biovar Orientalis str. IP275] >gi|166008192|ref|ZP_02229090.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pestis biovar Antiqua str. E1979001] >gi|166212259|ref|ZP_02238294.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pestis biovar Antiqua str. B42003004] >gi|167398391|ref|ZP_02303915.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167422558|ref|ZP_02314311.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423543|ref|ZP_02315296.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|21957962|gb|AAM84780.1|AE013723_8 PTS system, N-acetylglucosamine-specific enzyme IIABC [Yersinia pestis KIM] >gi|45435775|gb|AAS61332.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia pestis biovar Microtus str. 91001] >gi|108774925|gb|ABG17444.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia pestis Nepal516] >gi|108780376|gb|ABG14434.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia pestis Antiqua] >gi|115348320|emb|CAL21251.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia pestis CO92] >gi|145211584|gb|ABP40991.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia pestis Pestoides F] >gi|149291884|gb|EDM41958.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia pestis CA88-4125] >gi|162352312|gb|ABX86260.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pestis Angola] >gi|165914357|gb|EDR32972.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pestis biovar Orientalis str. IP275] >gi|165922851|gb|EDR40002.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pestis biovar Orientalis str. F1991016] >gi|165992574|gb|EDR44875.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pestis biovar Antiqua str. E1979001] >gi|166206190|gb|EDR50670.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pestis biovar Antiqua str. B42003004] >gi|166958572|gb|EDR55593.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167050895|gb|EDR62303.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057713|gb|EDR67459.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pestis biovar Mediaevalis str. K1973002] (677 aa)
Score = 559, Expect = 6.1e-55, Identities = 162/513 (31%), Positives = 271/513 (52%)
  Q:   347 MWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWS--------NLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGL---MNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           +W  I   L+    ++K+L S    + I   ++   I    + A+ SV  +         N   GQ+++      G  G+  G+Y  G +  M+ GLP AA A+   A  EN+     I M+  F +  TGITEP+E++F+F+AP L++ +HA L  ++  +   M+WI                G  FS G++D ++     +   +  W+  I  GL +  IY+ +F F I+KFN+ TPGR        ++ Y    +K      SE +N+   LA   + A GG DN+  +DACIT+LR+ +KD ++V+ +   +LGA G I+ + QSV  + G  A++I   ++T++   +  P         +  +S  ++ +  +P+  V+ T    S   +V+ SP TG++V LA+VPDE F+   +G G+A++PT   + SP  G +  +F+T HA+  ETE G +I++H+GID++ L  +       F   V+ G TV  GQ +  + LA L  +A S I+P++V N
  S:   174 IWPLIYNALVTFGEYIKDLGS--VGAGIYAFFNRLLIPVGLHHALNSVFWFDVAGINDIPNFLGGQESINK--GTGIVGIT-GRYQAGFFPIMMFGLPGAALAIYHCARPENKAKVAGIMMAGAFAAFFTGITEPLEFSFMFVAPVLYF-LHAVLTGISVFIAASMHWIA---------------GFGFSAGLVDMVLSSRNPL---ATQWYMLIPQGLIFFVIYYLVFRFTIQKFNLLTPGRELAVEGSEEDGYDVNVDKTPAVNESE-INS---LARRYIGAIGGSDNLTAIDACITRLRLNVKDSALVNDSVAKRLGASGVIRLNKQSVQIIVGTRAELIAAAMRTVL---AGGP---------IPAASSNAAPTGARPQA-VINTAKTAS---LVLVSPITGDVVPLAQVPDEAFASKAVGEGVAIRPTDKIVVSPASGTIVKIFNTDHAFCLETETGAEIVVHIGIDTVKLNGQG------FTRLVEEGTTVVAGQPVLELDLAYLNANAHSMISPVVVSN 649
Score = 273, Expect = 1.1e-21, Identities = 75/250 (30%), Positives = 115/250 (46%)
  Q:    42 FIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           ++ K+ + LM+P+A LP A I +GVG  I     G +            G A+   + +LFAI +A   + D  G AAL  F+G+L+  +L    + S+                            +P     A  G  + Q   F G +VG + A LYN+F  ++L   + FF+G R VPI+T   +  V  + + IWPL+  AL   G+ +     + + I+ F  R L+P GLHHA  S  W+  AG
  S:     6 YLQKVGRALMVPVATLPAAAILMGVGYWIDPVGWGAD--NALAALFIKSGAAIIENMSVLFAIGVAYGMSKDKDGAAALTGFVGFLVLTTLCSPAAVSMIKQ-------------------------IPLDQVPAAFGKIENQ---FVGILVGIISAELYNRFSGVELPKALSFFSGRRLVPILTSFLMIAVAFMLMYIWPLIYNALVTFGEYIKDLGSVGAGIYAFFNRLLIPVGLHHALNSVFWFDVAG 226
>gi|188534457|ref|YP_001908254.1| PTS system, glucose-specific IIBC component [Erwinia tasmaniensis] >gi|188029499|emb|CAO97376.1| PTS system, glucose-specific IIBC component [Erwinia tasmaniensis] (646 aa)
Score = 558, Expect = 8.3e-55, Identities = 139/439 (31%), Positives = 227/439 (51%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVLN 859
           G ++ G +  M+ GLP AA AM +AAPK  R +   + +S   T+ LTG+TEP+E+ F+FLAP L+         L   L+  + L V+      L  H G SFS G ID+ +   +      N W   + GL    +YF LF  +I+ FN++TPGR          D  ++Q   Q   +S +      L+   + A GG DN+  +DACIT+LR+ +KD + VD A   +LGA G +K + Q++  + GA+A+                 ++  E +K +   +  ++  +V          +       V+ +P +G +V++ +VPDE F+   +G G+A++PT+  + +P  G L  +F+T HA+  ETE G ++++H+G+D++ LK +       F    + G  V  GQ I  + LA L +HA+S I+PI+V N
  S:   227 GMFMSGFFPIMMFGLPGAALAMYLAAPKARRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLAPVLY---------LLHALLTGVSLFVATA----LGIHAGFSFSAGAIDYALMYKLPAA-SHNVWLLLVMGLIAFAVYFVLFSTVIRIFNLKTPGR----------DDASEQQVNQKGANSNTEEGLSQLSRQYIGAIGGSDNLNVIDACITRLRLSVKDAARVDDAACKKLGASGVVKLNKQTIQVIVGAKAE-----------------SIAEEMKKQIAQGAVAATGGDVSARSTPQAVPNSTKGIVGVLVAPVSGTVVAIDRVPDEAFASRAVGDGLAIQPTSSTVVAPASGTLVKIFNTNHAFCLETENGVEVVVHMGLDTVALKGQG------FTRLAEEGAEVVAGQPILEMDLAFLNEHARSMISPIVVSN 619
Score = 203, Expect = 1.4e-13, Identities = 73/257 (28%), Positives = 109/257 (42%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGD-AGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N           +F+   G A+F  LPL+FAI +A  ++ D AG AALA  +GY I       +S +V                                              V  G + G +    YN++ +IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +     + + IFG + R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRSLQLPIAVLPVAALMLRFGQPDLLNM----------SFIAQGGGAIFDNLPLIFAIGVASTWSKDNAGAAALAGAVGYFIMTKAMVTISPTV-------------------------------------------NMGVLAGIITGLIAGMTYNRWADIKLPDFLSFFGGKRFVPIATGFFCLVLAAVFGYVWPPVQAAIHAGGEWIVSEGALGAGIFGLVNRLLIPTGLHQVLNTIAWFQIGEFTNAAGAV 211
>gi|51595467|ref|YP_069658.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia pseudotuberculosis IP 32953] >gi|186894498|ref|YP_001871610.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Yersinia pseudotuberculosis PB1/+] >gi|51588749|emb|CAH20360.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia pseudotuberculosis IP 32953] >gi|186697524|gb|ACC88153.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Yersinia pseudotuberculosis PB1/+] (677 aa)
Score = 557, Expect = 9.8e-55, Identities = 162/513 (31%), Positives = 270/513 (52%)
  Q:   347 MWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWS--------NLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGL---MNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           +W  I   L+    ++K+L S    + I   ++   I    + A+ SV  +         N   GQ+++      G  G+  G+Y  G +  M+ GLP AA A+   A  EN+     I M+  F +  TGITEP+E++F+F+AP L++ +HA L  ++  +   M+WI                G  FS G++D ++     +   +  W+  I  GL +  IY+ +F F I+KFN+ TPGR        ++ Y    +K      SE +N    LA   + A GG DN+  +DACIT+LR+ +KD ++V+ +   +LGA G I+ + QSV  + G  A++I   ++T++   +  P         +  +S  ++ +  +P+  V+ T    S   +V+ SP TG++V LA+VPDE F+   +G G+A++PT   + SP  G +  +F+T HA+  ETE G +I++H+GID++ L  +       F   V+ G TV  GQ +  + LA L  +A S I+P++V N
  S:   174 IWPLIYNALVTFGEYIKDLGS--VGAGIYAFFNRLLIPVGLHHALNSVFWFDVAGINDIPNFLGGQESINK--GTGIVGIT-GRYQAGFFPIMMFGLPGAALAIYHCARPENKAKVAGIMMAGAFAAFFTGITEPLEFSFMFVAPVLYF-LHAVLTGISVFIAASMHWIA---------------GFGFSAGLVDMVLSSRNPL---ATQWYMLIPQGLIFFVIYYLVFRFTIQKFNLLTPGRELAVEGSEEDGYDVNVDKTPAVNESE-ING---LARRYIGAIGGSDNLTAIDACITRLRLNVKDSALVNDSVAKRLGASGVIRLNKQSVQIIVGTRAELIAAAMRTVL---AGGP---------IPAASSNAAPTGARPQA-VINTAKTAS---LVLVSPITGDVVPLAQVPDEAFASKAVGEGVAIRPTDKIVVSPASGTIVKIFNTDHAFCLETETGAEIVVHIGIDTVKLNGQG------FTRLVEEGTTVVAGQPVLELDLAYLNANAHSMISPVVVSN 649
Score = 272, Expect = 1.1e-21, Identities = 75/250 (30%), Positives = 115/250 (46%)
  Q:    42 FIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           ++ K+ + LM+P+A LP A I +GVG  I     G +            G A+   + +LFAI +A   + D  G AAL  F+G+L+  +L    + S+                            +P     A  G  + Q   F G +VG + A LYN+F  ++L   + FF+G R VPI+T   +  V  + + IWPL+  AL   G+ +     + + I+ F  R L+P GLHHA  S  W+  AG
  S:     6 YLQKVGRALMVPVATLPAAAILMGVGYWIDPVGWGAD--NALAALFIKSGAAIIENMSVLFAIGVAYGMSKDKDGAAALTGFVGFLVLTTLCSPAAVSMIKQ-------------------------IPLDQVPAAFGKIENQ---FVGILVGIISAELYNRFSGVELPKALSFFSGRRLVPILTSFLMIAVAFMLMYIWPLIYNALVTFGEYIKDLGSVGAGIYAFFNRLLIPVGLHHALNSVFWFDVAG 226
>gi|153950138|ref|YP_001401870.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pseudotuberculosis IP 31758] >gi|152961633|gb|ABS49094.1| PTS system, N-acetylglucosamine-specific IIBC component [Yersinia pseudotuberculosis IP 31758] (677 aa)
Score = 557, Expect = 1.1e-54, Identities = 159/513 (30%), Positives = 268/513 (52%)
  Q:   347 MWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWS--------NLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGL---MNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           +W  I   L+    ++K+L S    + I   ++   I    + A+ SV  +         N   GQ+++      G  G+  G+Y  G +  M+ GLP AA A+   A  EN+     I M+  F +  TGITEP+E++F+F+AP L++ +HA L  ++  +   M+WI                G  FS G++D ++     +   +  W+  I  GL +  IY+ +F F I+KFN+ TPGR        ++ Y    +K      SE +N    LA   + A GG DN+  +DACIT+LR+ +KD ++V+ +   +LGA G I+ + QSV  + G  A++I   ++T++   +  P         +  +S  ++ +  +P+  +    +      +V+ SP TG++V LA+VPDE F+   +G G+A++PT   + SP  G +  +F+T HA+  ETE G +I++H+GID++ L  +       F   V+ G TV  GQ +  + LA L  +A S I+P++V N
  S:   174 IWPLIYNALVTFGEYIKDLGS--VGAGIYAFFNRLLIPVGLHHALNSVFWFDVAGINDIPNFLGGQESINK--GTGIVGIT-GRYQAGFFPIMMFGLPGAALAIYHCARPENKAKVAGIMMAGAFAAFFTGITEPLEFSFMFVAPVLYF-LHAVLTGISVFIAASMHWIA---------------GFGFSAGLVDMVLSSRNPL---ATQWYMLIPQGLIFFVIYYLVFRFTIQKFNLLTPGRELAVEGSEEDGYDVNVDKTPAVNESE-ING---LARRYIGAIGGSDNLTAIDACITRLRLNVKDSALVNDSVAKRLGASGVIRLNKQSVQIIVGTRAELIAAAMRTVL---AGGP---------IPAASSNAAPTSARPQAVI----NSAKTASLVLVSPITGDVVPLAQVPDEAFASKAVGEGVAIRPTDKIVVSPASGTIVKIFNTDHAFCLETETGAEIVVHIGIDTVKLNGQG------FTRLVEEGTTVVAGQPVLELDLAYLNANAHSMISPVVVSN 649
Score = 272, Expect = 1.1e-21, Identities = 75/250 (30%), Positives = 115/250 (46%)
  Q:    42 FIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           ++ K+ + LM+P+A LP A I +GVG  I     G +            G A+   + +LFAI +A   + D  G AAL  F+G+L+  +L    + S+                            +P     A  G  + Q   F G +VG + A LYN+F  ++L   + FF+G R VPI+T   +  V  + + IWPL+  AL   G+ +     + + I+ F  R L+P GLHHA  S  W+  AG
  S:     6 YLQKVGRALMVPVATLPAAAILMGVGYWIDPVGWGAD--NALAALFIKSGAAIIENMSVLFAIGVAYGMSKDKDGAAALTGFVGFLVLTTLCSPAAVSMIKQ-------------------------IPLDQVPAAFGKIENQ---FVGILVGIISAELYNRFSGVELPKALSFFSGRRLVPILTSFLMIAVAFMLMYIWPLIYNALVTFGEYIKDLGSVGAGIYAFFNRLLIPVGLHHALNSVFWFDVAG 226
>gi|169827878|ref|YP_001698036.1| PTS system N-acetylglucosamine-specific EIICBA component (EIICBA-Nag) (EII-Nag) [Lysinibacillus sphaericus C3-41] >gi|168992366|gb|ACA39906.1| PTS system N-acetylglucosamine-specific EIICBA component (EIICBA-Nag) (EII-Nag) [Lysinibacillus sphaericus C3-41] (649 aa)
Score = 556, Expect = 1.4e-54, Identities = 143/453 (31%), Positives = 233/453 (51%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNND-QVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKS 873
           G +  G +  M+ GLPAA  AM   A KE R +   + +S   T+ LTG+TEPIE++F+FL+P L+ G+HA L  ++  +   +G               G  FS G+ID+++   +  +          FG     IYF +FYFLIKK +++TPGR ++     +              S+ ++++D  V A   + A GG +NI+ VD C T+LR+ ++D SVVD   L Q GARG ++ S  +V  + G   + +   +K  ++  + +P        +   +    + +EVK +      D E+         P TG+++ L++VPDE FS  +MG G  ++PT G +Y+P DG++ ++F T HA   ++E G ++LIHVG+D++ L  +       F   V  G T+K G+ +    +  +K    S ITP++    SL G+EI   K S
  S:   235 GHFQAGFFPIMMFGLPAACLAMYFTAKKEKRPIVGGMFVSIALTAFLTGVTEPIEFSFMFLSPVLY-GIHAVLTGISLAVAYMVGF------------RDGFGFSAGLIDYLLNLGLADKPLMLLPLGLGFG----AIYFVVFYFLIKKLDLKTPGREDDEEEDGE--------------SNSAISDDIDVRAYYTIEALGGKENIQQVDYCTTRLRMSVQDASVVDEKTLKQTGARGVMRISKTNVQVIIGTSVEFLAEAMKERLQKGNPAP------ANVQLLTEQPVATAEVKSDATTTFHDFEM---------PMTGDLLPLSEVPDEAFSAGLMGPGFGIRPTDGTVYAPFDGQVVMIFPTKHAIGLKSETGVELLIHVGLDTVTLNGEG------FDMLVSDGQTIKRGEALLKADITKIKEQVPSIITPVVF--TSLMGQEITLEKSS 635
Score = 215, Expect = 4.5e-15, Identities = 69/253 (27%), Positives = 110/253 (43%)
  Q:    42 FIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALAC-----FIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           F+ K+ K LM PIA LP A + L +GS  +  A  NE ++   + +   GNA+ G LP++FAI IA+    D+   A         +   + G++ + L+  V                                               FGG + G     LYNK+ N+K    + FF G RFVPI+T + +  +  +  + W  +   +  +G  +  A  +   ++GF  R L+P GLHH   + +W     +T A G I
  S:     4 FLQKIGKSLMFPIATLPAAALLLRLGSGDMLGAVPNEAIQYIASIMAASGNAILGNLPIIFAIGIAMGLAHDSSGGAALAGAIAHLVLVAVLGTVNEELNMGV-----------------------------------------------FGGIIAGITAGLLYNKYYNVKFPEWLSFFGGRRFVPIITSITMAILGSILAIAWGPIQGGIDAVGNWMIGAGSLGVGMYGFFNRLLIPVGLHHVINTVIWFDFGEFTNAAGEI 219
>gi|170025218|ref|YP_001721723.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Yersinia pseudotuberculosis YPIII] >gi|169751752|gb|ACA69270.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Yersinia pseudotuberculosis YPIII] (677 aa)
Score = 555, Expect = 1.9e-54, Identities = 159/513 (30%), Positives = 268/513 (52%)
  Q:   347 MWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWS--------NLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGL---MNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           +W  I   L+    ++K+L S    + I   ++   I    + A+ SV  +         N   GQ+++      G  G+  G+Y  G +  M+ GLP AA A+   A  EN+     I M+  F +  TGITEP+E++F+F+AP L++ +HA L  ++  +   M+WI                G  FS G++D ++     +   +  W+  I  GL +  IY+ +F F I+KFN+ TPGR        ++ Y    +K      SE +N    LA   + A GG DN+  +DACIT+LR+ +KD ++V+ +   +LGA G I+ + QSV  + G  A++I   ++T++   +  P         +  +S  ++ +  +P+  +    +      +V+ SP TG++V LA+VPDE F+   +G G+A++PT   + SP  G +  +F+T HA+  ETE G +I++H+GID++ L  +       F   V+ G TV  GQ +  + LA L  +A S I+P++V N
  S:   174 IWPLIYNALVTFGEYIKDLGS--VGAGIYAFFNRLLIPVGLHHALNSVFWFDVAGINDIPNFLGGQESINK--GTGIVGIT-GRYQAGFFPIMMFGLPGAALAIYHCARPENKAKVAGIMMAGAFAAFFTGITEPLEFSFMFVAPVLYF-LHAVLTGISVFIAASMHWIA---------------GFGFSAGLVDMVLSSRNPL---ATQWYMLIPQGLIFFVIYYLVFRFTIQKFNLLTPGRELAVEGSEEDGYDVNVDKTPAVNESE-ING---LARRYIGAIGGSDNLTAIDACITRLRLNVKDSALVNDSVAKRLGASGVIRLNKQSVQIIVGTRAELIAAAMRTVL---AGGP---------IPAASSNAAPTGARPQAVI----NSAKTASLVLVSPITGDVVPLAQVPDEAFASKAVGEGVAIRPTDKIVVSPASGTIVKIFNTDHAFCLETETGAEIVVHIGIDTVKLNGQG------FTRLVEEGTTVVAGQPVLELDLAYLNANAHSMISPVVVSN 649
Score = 272, Expect = 1.2e-21, Identities = 75/250 (30%), Positives = 115/250 (46%)
  Q:    42 FIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           ++ K+ + LM+P+A LP A I +GVG  I     G +            G A+   + +LFAI +A   + D  G AAL  F+G+L+  +L    + S+                            +P     A  G  + Q   F G +VG + A LYN+F  ++L   + FF+G R VPI+T   +  V  + + IWPL+  AL   G+ +     + + I+ F  R L+P GLHHA  S  W+  AG
  S:     6 YLQKVGRALMVPVATLPAAAILMGVGYWIDPVGWGAD--NALAALFIKSGAAIIENMSVLFAIGVAYGMSKDKDGAAALTGFVGFLVLTALCSPAAVSMIKQ-------------------------IPLDQVPAAFGKIENQ---FVGILVGIISAELYNRFSGVELPKALSFFSGRRLVPILTSFLMIAVAFMLMYIWPLIYNALVTFGEYIKDLGSVGAGIYAFFNRLLIPVGLHHALNSVFWFDVAG 226
>gi|77973056|ref|ZP_00828609.1| COG1263: Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific [Yersinia frederiksenii ATCC 33641] (663 aa)
Score = 555, Expect = 2.0e-54, Identities = 164/490 (33%), Positives = 265/490 (54%)
  Q:   399 NLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGL---MNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDY-----KNKQ-NKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN-ESLEGREIKFLKKSGEIKKGMPLFEVLPK 888
           N   GQQ++ +       G+  G+Y  G +  M+ GLP AA A+   A  EN+     I ++  F +  TGITEP+E++F+F+AP L++ +HA L  ++  +   M+WI                G  FS G++D ++     +   +  W+  I  GL +  IY+ +F F I+KFN+ TPGR        ++ Y     KN + N+ +ING          LA   + A GG DN+  +DACIT+LR+ +KD + V+ +   +LGA G I+ + QSV  + G  A++I   ++ ++   +  P         +  +S T++A+  KP+  VV T    S   +V+ SP TG++V+L +VPDE F+   +G G+A++PT   + SP +G +  +F+T HA+  ETE G +I++H+GID++ L  +       FA  V+ G TV  GQ +  + LA L  +A+S I+P++V N +   G  I  L     +    PLFEV  K
  S:   218 NFLGGQQSIDS--GKAIVGIT-GRYQAGFFPIMMFGLPGAALAIYHCARPENKAKVAGIMLAGAFAAFFTGITEPLEFSFMFVAPVLYF-IHAVLTGISVFIAASMHWIA---------------GFGFSAGLVDMVLSSRNPL---ATHWYMLIPQGLVFFAIYYVVFRFTIQKFNLLTPGRELAVEGSEEDGYDVNVDKNPEVNESEING----------LARRYIGAIGGSDNLTGIDACITRLRLNVKDSAQVNDSVAKRLGASGVIRLNKQSVQIIVGTRAELIASAMRNVL---AGGP---------VPAASSTAAAAAAKPQA-VVNTAKTAS---LVLVSPITGDVVALDQVPDEAFASKAVGEGVAIRPTDKTVVSPANGTIVKIFNTDHAFCLETETGAEIVVHIGIDTVKLNGQG------FARLVEEGATVVAGQPVLELDLAYLNANARSMISPVVVSNIDDYAG--ISVLAGGSVVAGQSPLFEVRGK 663
Score = 262, Expect = 1.7e-20, Identities = 75/241 (31%), Positives = 115/241 (47%)
  Q:    51 MLPIAMLPIAGIFLGVGSAI-VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           M+P+A LP A I +GVG  I   + GG+  L     F++  G A+   + +LFAI +A   + D  G AAL  F+G+L+  +L    + S+                            +P     A  G    Q   F G +VG + A LYN+F +++L   + FF+G R VPI+T   +  V  + + +WPL+  AL   G+ +     + + I+ F  R L+P GLHHA  S  W+  AG
  S:     1 MVPVATLPAAAILMGVGYWIDPVSWGGDNALAAL--FIK-SGAAIIDNMSVLFAIGVAYGMSKDKDGAAALTGFVGFLVLTTLCSPAAVSMIQK-------------------------IPVDQVPAAFGKINNQ---FVGILVGIISAELYNRFSSVELPKALSFFSGRRLVPILTSFLMIVVAFILMYVWPLIYNALVTFGEYIKDMGSVGAGIYAFFNRLLIPVGLHHALNSVFWFDVAG 212
>gi|123443193|ref|YP_001007167.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122090154|emb|CAL13017.1| pts system, N-acetylglucosamine-specific IIABC component [Yersinia enterocolitica subsp. enterocolitica 8081] (677 aa)
Score = 555, Expect = 2.1e-54, Identities = 154/461 (33%), Positives = 249/461 (54%)
  Q:   399 NLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGL---MNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGR------GENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           N   GQQ++ +       G+  G+Y  G +  M+ GLP AA A+   A  ENR     I ++  F +  TGITEP+E++F+F+AP L++ +HA L  ++  +   M+WI                G  FS G++D ++     +   +  W+  I  GL +  IY+ +F F IKKFN+ TPGR       E        D   + N+ +ING          LA   + A GG DN+  +DACIT+LR+ +KD ++V+     +LGA G I+ + QSV  + G  A++I     + M N+ +S          +  +S + + +  KP+  V+ T    S   +++ SP TG++V+L +VPDE F+   +G GIA++PT   + +P +G +  +F+T HA+  ETE G +I++H+GID++ L  +       FA  V+ G TV  GQ +  + LA L  +A+S I+P++V N
  S:   232 NFLGGQQSIDS--GKAVVGIT-GRYQAGFFPIMMFGLPGAALAIYHCARPENRAKVAGIMLAGAFAAFFTGITEPLEFSFMFVAPVLYF-IHAVLTGISVFIAASMHWIA---------------GFGFSAGLVDMVLSSRNPL---ATHWYMLIPQGLVFFAIYYVVFRFTIKKFNLLTPGRELAVEGSEEDGYDVNVDKTPEINESEING----------LARRYIGAIGGSDNLTGIDACITRLRLNVKDSALVNDGVAKRLGASGVIRLNKQSVQVIVGTRAELIA----SAMRNVLAS--------GPVPAASSSVAPAAAKPQA-VINTAKTAS---LILVSPITGDVVALEEVPDEAFASKAVGEGIAIRPTDKTVVAPANGTIVKIFNTDHAFCLETETGAEIVVHIGIDTVKLNGQG------FARLVEEGATVVAGQPVLELDLAYLNANARSMISPVVVSN 649
Score = 279, Expect = 2.1e-22, Identities = 78/254 (30%), Positives = 121/254 (47%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAI-VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           N   ++ K+ + LM+P+A LP A I +GVG  I   + GG+  L     F++  G A+   + +LFAI +A   + D  G AAL  F+G+L+  +L    + S+                            +P     A  G    Q   F G +VG + A LYN+F  ++L   + FF+G R VPI+T   +  V  + + +WPL+  AL   G+ +     + + I+ F  R L+P GLHHA  S  W+  AG
  S:     2 NILSYLQKVGRALMVPVATLPAAAILMGVGYWIDPVSWGGDNALAAL--FIK-SGAAIIDNMSVLFAIGVAYGMSKDKDGAAALTGFVGFLVLTTLCSPAAVSMIQK-------------------------IPVDQVPAAFGKINNQ---FVGILVGIISAELYNRFSGVELPKALSFFSGRRLVPILTSFLMIVVAFILMYVWPLIYNALVTFGEYIKDMGSVGAGIYAFFNRLLIPVGLHHALNSVFWFDVAG 226
>gi|15800381|ref|NP_286393.1| N-acetyl glucosamine specific PTS system components IIABC [Escherichia coli O157:H7 EDL933] >gi|12513580|gb|AAG55001.1|AE005246_1 PTS system, N-acetylglucosamine-specific enzyme IIABC [Escherichia coli O157:H7 EDL933] (648 aa)
Score = 550, Expect = 6.3e-54, Identities = 155/465 (33%), Positives = 248/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLA          L  L   L+  I L V+      L  H G SFS G ID+ +   +      N W   + G+ +  IYF +F  +I+ FN++TPGR         ED +++    + N ++E   N   LA N ++A GG DN+K +DACIT+LR+ + D + V+     +LGA G +K + Q++  + GA+A+ I   +K ++         +         ++  ++A   KP+       + +S  ++V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L+ K  K L      V+ G  V  GQ I  + L  L  +A+S I+P++  N  ++      +K  G +  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLA---------PLLYLLHALLTGISLFVATL----LGIHAGFSFSAGAIDYXLMYNLPAA-SQNVWMLLVMGVVFFAIYFVVFSLVIRMFNLKTPGR---------EDKEDEIVTEEANSNTEEXLNQ--LATNYIAAVGGTDNLKAIDACITRLRLTVADSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKVVA--------RGPVAAASAEATPATAAPVAKPQA----VPNAVSIAELV--SPITGDVVALDQVPDEAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRL------VEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSN--IDDFSGLIIKAQGHVVAGQTPLYEI 646
Score = 195, Expect = 1.1e-12, Identities = 73/257 (28%), Positives = 107/257 (41%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGIN-QLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+F  AI +A                          S    D+ GA      + Y                 L  A++ IN ++   V  G + G +    YN++ +IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIF--AIGVA--------------------------SSWSKDSAGAAALAGAVGY---------------FVLTKAMVTINPEINMGVLAGIITGLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|26246645|ref|NP_752685.1| N-acetyl glucosamine specific PTS system components IIABC [Escherichia coli CFT073] >gi|91209712|ref|YP_539698.1| N-acetyl glucosamine specific PTS system components IIABC [Escherichia coli UTI89] >gi|117622879|ref|YP_851792.1| N-acetyl glucosamine specific PTS system components IIABC [Escherichia coli APEC O1] >gi|26107044|gb|AAN79228.1|AE016757_132 PTS system, N-acetylglucosamine-specific IIABC component [Escherichia coli CFT073] >gi|91071286|gb|ABE06167.1| N-acetylglucosamine PTS permease [Escherichia coli UTI89] >gi|115512003|gb|ABJ00078.1| fused N-acetyl glucosamine specific PTS enzyme: IIC, IIB , and IIA components [Escherichia coli APEC O1] (648 aa)
Score = 549, Expect = 9.3e-54, Identities = 156/465 (33%), Positives = 249/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLA          L  L   L+  I L V+      L  H G SFS G ID+ +   +      N W   + G+ +  IYF +F  +I+ FN++TPGR         ED +++    + N ++E   N   LA N ++A GG DN+K +DACIT+LR+ + D + V+ A   +LGA G +K + Q++  + GA+A+ I   +K ++         +         ++  ++A   KP+       + +S  ++V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L+ K  K L      V+ G  V  GQ I  + L  L  +A+S I+P++  N  ++      +K  G +  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLA---------PLLYLLHALLTGISLFVATL----LGIHAGFSFSAGAIDYALMYNLPAA-SQNVWMLLVMGVVFFAIYFVVFSLVIRMFNLKTPGR---------EDKEDEIVTEEANSNTEEGLNQ--LATNYIAAVGGTDNLKAIDACITRLRLTVVDSARVNDAMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKVVA--------RGPVAAASAEATPATAAPVAKPQA----VPNAVSIAELV--SPITGDVVALDQVPDEAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRL------VEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSN--IDDFSGLIIKAQGHVVAGQTPLYEI 646
Score = 204, Expect = 9.8e-14, Identities = 77/257 (29%), Positives = 114/257 (44%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +    YN++ +IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVL--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|188159792|ref|ZP_02998893.1| PTS system, IIBC component, putative [Mycoplasma mycoides subsp. mycoides LC str. GM12] (621 aa)
Score = 549, Expect = 9.6e-54, Identities = 190/654 (29%), Positives = 303/654 (46%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGN--EGLRVF---GNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGIN---SFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMW-AFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWI-IYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLME 686
           K K+ N  EF +K +K ++  +A+LP AG+ + +G  I     G      +VF   G  ++  G A F  + LLFA+AI   ++ +    + A    Y I  ++  ++  + T   G +   N +           G        + +  G+  ++    GG ++GF+ A +YNK+ N  KL   + FFNG RFVP +  + + P+++   +IWPL    +  LG    +   +     F++G  ER L+PFGLHH    P+ Y+Q GGS+D T          + +  + +T  +     E  NSL  N +       G + +W ++I A        L  + SGW         D A+  ++ NG            + QQA   +       V   ++  G+ +     L  A   M  A PKE R    SI  S     LLTG+TEPIE+ F+F AP L + +HA L  +AFG+ ++I + + A G  E        F    I  I + G + IQ      W  +  +A+  IYF +FYF  KKF    PG   +    ++     +    +    S    +DQ +   +V+  GG DN+ +VDAC+T+LR+++KD++ VD       GA G +     S+  V+G +ADI KG I  L+E
  S:     9 KAKESNLHEFFSKFAKSILTFVALLPAAGLTIILGKIIGPLGLGQIKASAKVFNQIGGVIETVGWAAFSHMGLLFAVAIGGTWSKNRYGGSFAAAFSYFILLAVGSSMFITRTTEAGEIQFLNYIL----------GRWEKHELFFSSQEGVMSIRYDAIGGIIMGFVGATIYNKYYNFNKLPQALSFFNGARFVPFMVIIIVLPISVGIGLIWPLFQTVINHLGNFFAKEQKLKFLAPFLYGTSERLLLPFGLHHMITIPMNYSQLGGSVDFT----------SASQFSNTTNENAKVIAEFFNSLENNKEAL--KPQGQEKIWLSWITA--------LGNVKSGWA--------DYAAKHNNVNG-----------LTMQQAYEIV----LDSVVPVRFKVGQMITSSGSLVGAGLGMAFAIPKEKRAKYSSIYFSGLAACLLTGVTEPIEFIFMFSAP-LLYVLHAILTGIAFGISDFIPMRIHAFGGIETLIKYLFVFGPTSISGIGLKGILWIQ----GLWLLLVTIAFGGIYFAVFYFFTKKFKPAIPGFTNDETSASEITTIKEDQPTKKQTKSTKTKSDQTIN-TIVNLLGGLDNLDDVDACMTRLRVKVKDKAKVDNKFKELTGAVGVLNKG-SSLQIVYGPKADIYKGEILELLE 613
>gi|170681159|ref|YP_001742789.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli SMS-3-5] >gi|170518877|gb|ACB17055.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli SMS-3-5] (648 aa)
Score = 548, Expect = 1.2e-53, Identities = 155/465 (33%), Positives = 249/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLA          L  L   L+  I L V+      L  H G SFS G ID+ +   +      N W   + G+ +  IYF +F  +I+ FN++TPGR         ED +++    + N ++E   N   LA N ++A GG DN+K +DACIT+LR+ + D + V+     +LGA G +K + Q++  + GA+A+ I   +K ++         +         ++  ++A   KP+       + +S  ++V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L+ K  K L      V+ G  V  GQ I  + L  L ++A+S I+P++  N  ++      +K  G +  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLA---------PLLYLLHALLTGISLFVATL----LGIHAGFSFSAGAIDYALMYNLPAA-SQNVWMLLVMGVVFFAIYFVVFSLVIRMFNLKTPGR---------EDKEDEIVTEEANSNTEEGLNQ--LATNYIAAVGGTDNLKAIDACITRLRLTVADSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKVVA--------RGPVAAASAETAPATAAPVAKPQA----VPNAVSIAELV--SPITGDVVALDQVPDEAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRL------VEEGAQVSAGQPILEMDLDYLNENARSMISPVVCSN--IDDFSGLIIKAQGHVVAGQTPLYEI 646
Score = 204, Expect = 9.0e-14, Identities = 77/257 (29%), Positives = 114/257 (44%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +    YN++ +IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVL--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|160879911|ref|YP_001558879.1| PTS system, glucose subfamily, IIA subunit [Clostridium phytofermentans ISDg] >gi|160428577|gb|ABX42140.1| PTS system, glucose subfamily, IIA subunit [Clostridium phytofermentans ISDg] (751 aa)
Score = 548, Expect = 1.3e-53, Identities = 148/451 (32%), Positives = 247/451 (54%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGR---GENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLK-------SEYEKIMNNSSDTSSASE--------VKPEKEVVKTDSELSKE--------------KVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAK-STITPIIVLNESLEGREIKFLKK 872
           ++  G+++  I G P AA AM   A +E +K    + +SA  TS++TGITEPIE++FLF+AP LF G+ A +  LA+ +   + + V            G++FSGG ID  ++G +Q    ++       G+ Y  +Y+++F F IKK N++TPGR    E ++L+T+ DY+ K+N   ++   +  + D+ L+  +    GG  NI +VD C T+LR+ + D + V+   L   GA G I      V  ++G    +IK N+   +   S     K       +E +   NN S  +SA +         + +++ V   S + K+              + ++ +P +G+++ L  V D  FS+ M+G G A++P+ GK+ +P D K+  VFDT HA         ++LIH+GID++ L  K G ++K     +  GD +K G  IG   +  +  A    +TP+IV N   +   I+ LKK
  S:   281 RFFSGEFIIYIFGFPGAALAMYRCARQEKKKEVYGLLLSAALTSIMTGITEPIEFSFLFVAPVLF-GISAVMAGLAYAIAQALNIAV------------GLTFSGGFIDLFLFGILQGNRKTSWLLIIPVGIVYFLVYYYIFSFFIKKMNLKTPGREADNEESKLYTRADYEKKKN---VSKDEKGSDVDE-LSAAITEGLGGKANISDVDCCATRLRVTVFDGNKVEDNILKSTGASGVIHKG-TGVQVIYGPRVTVIKSNLDDYLATTSDVAEKKDFAKAANTENKNYENNVSKVNSADKQNSADKQSSEDKQDTVDKQSTVDKQSSANKQSNADKQGKETIIFAPLSGKVIELTDVNDGVFSEGMLGKGFAIEPSEGKVVAPCDCKVETVFDTKHAIGLSC-GNVELLIHIGIDTVELNGK-GYDIK-----IHDGDVLKKGDVIGYFDINLITEAGYRVVTPVIVTNTD-DFESIEILKK 738
Score = 369, Expect = 7.9e-33, Identities = 97/280 (34%), Positives = 145/280 (51%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIV--TNAGGNEGLRVFG------NFLQVP---GNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTS 322
           + ++ +  MLPIA+LP+AG+ LG+GS+    T       L + G      N L +    G+ +F  LPL+FA+ +AI     +   AAL+  I + +   +  A+S  V+                 I+G   G  A  S   G V+G+  LQ   FGG +VG  VA L+N+F  I+L     FF G RF+PI++ +    V IL   IW  + I +  LG  +     I +FIFG I+R L+PFGLHH FY P W T  GG++++    II      +A LA  +    ++
  S:     9 LQRVGRSFMLPIAVLPVAGLLLGLGSSFTNETTLATYNLLGIMGPGTAIYNILTIMSKCGSVIFDNLPLIFAVGVAIGMAKKEKEVAALSAMIAFFV---MHSAISGMVS-----------------IYG---GPEAFISGATGTVLGMTSLQMGAFGGIIVGLGVAALHNRFYKIELPAAFAFFQGTRFIPIISTVVFTFVGILMFYIWQPIQIGINGLGGVVQSTGIIGTFIFGLIKRLLIPFGLHHVFYLPFWQTAIGGTMEIAGKTIIGAQNIFFAQLADPSTVHFST 277
>gi|170767650|ref|ZP_02902103.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia albertii TW07627] >gi|170123138|gb|EDS92069.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia albertii TW07627] (648 aa)
Score = 547, Expect = 1.5e-53, Identities = 156/465 (33%), Positives = 248/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLA          L  L   L+  I L V+      L  H G SFS G ID+ +   +      N W   + G+ +  IYF +F  +I+ FN++TPGR         ED +++    + N ++E       LA N ++A GG DN+K +DACIT+LR+ + D + V+ A   +LGA G +K + Q++  + GA+A+ I   +K ++         +         +   ++A  VKP+       + +S  ++V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L+ K  K L      V+ G  V  GQ I  + L  L  +A+S I+P++  N  ++      +K  G +  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAITAFLTGVTEPLEFLFMFLA---------PLLYLLHALLTGISLFVATL----LGIHAGFSFSAGAIDYALMYNLPAA-SQNVWMLLVMGVVFFAIYFVVFSVVIRMFNLKTPGR---------EDKEDEIVTEEANSNTEE--GLTQLATNYIAAVGGTDNLKAIDACITRLRLAVNDSARVNDAMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKVVA--------RGPVAAASAEAVTATAAPVVKPQA----VPNAVSVAELV--SPITGDVVALEQVPDEAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRL------VEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSN--IDDFSGLIIKAQGHVVAGQTPLYEI 646
Score = 207, Expect = 3.9e-14, Identities = 78/257 (30%), Positives = 114/257 (44%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +    YN++ NIKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVL--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAAYNRWSNIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|15829963|ref|NP_308736.1| N-acetyl glucosamine specific PTS system components IIABC [Escherichia coli O157:H7 str. Sakai] >gi|157160157|ref|YP_001457475.1| N-acetyl glucosamine specific PTS system components IIABC [Escherichia coli HS] >gi|168706368|ref|ZP_02738645.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli O157:H7 str. EC4045] >gi|168735668|ref|ZP_02767945.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli O157:H7 str. EC4115] >gi|168758314|ref|ZP_02783321.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli O157:H7 str. EC4401] >gi|168767118|ref|ZP_02792125.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli O157:H7 str. EC4486] >gi|168777918|ref|ZP_02802925.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli O157:H7 str. EC4196] >gi|168779162|ref|ZP_02804169.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli O157:H7 str. EC4076] >gi|170020975|ref|YP_001725929.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Escherichia coli ATCC 8739] >gi|191169351|ref|ZP_03031096.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli B7A] >gi|193071727|ref|ZP_03052626.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli E110019] >gi|194429749|ref|ZP_03062265.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli B171] >gi|195939404|ref|ZP_03084786.1| N-acetyl glucosamine specific PTS system components IIABC [Escherichia coli O157:H7 str. EC4024] >gi|13360167|dbj|BAB34132.1| PTS system, N-acetylglucosamine-specific enzyme IIABC [Escherichia coli O157:H7 str. Sakai] >gi|157065837|gb|ABV05092.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli HS] >gi|169755903|gb|ACA78602.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Escherichia coli ATCC 8739] >gi|187766950|gb|EDU30794.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli O157:H7 str. EC4196] >gi|189002836|gb|EDU71822.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli O157:H7 str. EC4076] >gi|189354866|gb|EDU73285.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli O157:H7 str. EC4401] >gi|189363563|gb|EDU81982.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli O157:H7 str. EC4486] >gi|190900602|gb|EDV60406.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli B7A] >gi|192954958|gb|EDV85462.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli E110019] >gi|194412230|gb|EDX28536.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli B171] (648 aa)
Score = 546, Expect = 2.0e-53, Identities = 155/465 (33%), Positives = 248/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLA          L  L   L+  I L V+      L  H G SFS G ID+ +   +      N W   + G+ +  IYF +F  +I+ FN++TPGR         ED +++    + N ++E   N   LA N ++A GG DN+K +DACIT+LR+ + D + V+     +LGA G +K + Q++  + GA+A+ I   +K ++         +         ++  ++A   KP+       + +S  ++V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L+ K  K L      V+ G  V  GQ I  + L  L  +A+S I+P++  N  ++      +K  G +  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLA---------PLLYLLHALLTGISLFVATL----LGIHAGFSFSAGAIDYALMYNLPAA-SQNVWMLLVMGVVFFAIYFVVFSLVIRMFNLKTPGR---------EDKEDEIVTEEANSNTEEGLNQ--LATNYIAAVGGTDNLKAIDACITRLRLTVADSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKVVA--------RGPVAAASAEATPATAAPVAKPQA----VPNAVSIAELV--SPITGDVVALDQVPDEAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRL------VEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSN--IDDFSGLIIKAQGHVVAGQTPLYEI 646
Score = 204, Expect = 1.0e-13, Identities = 77/257 (29%), Positives = 114/257 (44%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +    YN++ +IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVL--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|126650796|ref|ZP_01723012.1| fused N-acetyl glucosamine specific PTS enzyme: IIC, IIB , and IIA components [Bacillus sp. B14905] >gi|126592461|gb|EAZ86479.1| fused N-acetyl glucosamine specific PTS enzyme: IIC, IIB , and IIA components [Bacillus sp. B14905] (649 aa)
Score = 546, Expect = 2.0e-53, Identities = 148/459 (32%), Positives = 238/459 (51%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQV--LALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSP---NLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           G +  G +  M+ GLPAA  AM   A KE R +   + +S   T+ LTG+TEPIE++F+FL+P L+ G+HA L  ++  +   +G               G  FS G+ID+++     +    N       GL +  IYF +FYFLIKK +++TPGR               ++    +G S +  +D +   A   + A GG DNI+ VD C T+LR+ ++D SVVD   L Q GARG ++ S  +V  + G   + +   +K  ++  + +P    L +E            + ++VK E      D E+         P TG+++ L++VPDE FS  +MG G  ++PT G +Y+P DG++ ++F T HA   +++ G ++LIHVG+D++ L  +    L   +  +K GD + +  +I  +K    +   S ITP++    SL G+EI  L KSG  + G
  S:   235 GHFQAGFFPIMMFGLPAACLAMYFTARKEKRPIVGGMFVSIALTAFLTGVTEPIEFSFMFLSPVLY-GIHAVLTGISLAVAYVVGF------------RDGFGFSAGLIDYLL----NLGLADNPLLLLPLGLGFGAIYFVVFYFLIKKLDLKTPGR---------------EDDDDEDGESHTAISDDIDLRAYYTIEALGGKDNIQQVDYCTTRLRMSVQDASVVDEKTLKQTGARGVMRISKTNVQVIIGTSVEFLAEAMKDRLQKGNPAPANAQLPTEL---------PVATAQVKSEATTTFHDFEM---------PMTGDLLPLSEVPDEAFSAGLMGPGFGIRPTDGTVYAPFDGQVVMIFPTKHAIGLKSDTGLELLIHVGLDTVTLNGEGFDMLVSDSQTIKRGDAL-LKADITKIK----EQVPSIITPVVF--TSLMGQEIT-LGKSGYQRAG 640
Score = 221, Expect = 1.0e-15, Identities = 69/253 (27%), Positives = 111/253 (43%)
  Q:    42 FIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALAC-----FIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           F+ K+ K LM PIA LP A + L +GS  +  A  NE ++   + +   GNA+ G LP++FAI IA+    D+   A         +   + G++ + L+  V                                               FGG + G     LYNK+ N+K    + FF G RFVPI+T + +  +  +  ++W  +   +  +G  +  A  +   ++GF  R L+P GLHH   + +W     +T A G I
  S:     4 FLQKIGKSLMFPIATLPAAALLLRLGSGDMLGAVPNEAIQYIASIMAASGNAILGNLPIIFAIGIAMGLAHDSSGGAALAGAIAHLVLIAVLGTVNEELNMGV-----------------------------------------------FGGIIAGITAGLLYNKYYNVKFPEWLSFFGGRRFVPIITSITMAILASILAIVWGPIQGGIDAVGNWMIGAGSLGVGMYGFFNRLLIPVGLHHVINTVIWFDFGEFTNAAGEI 219
>gi|194434457|ref|ZP_03066718.1| PTS system, N-acetylglucosamine-specific IICBA component [Shigella dysenteriae 1012] >gi|194417308|gb|EDX33416.1| PTS system, N-acetylglucosamine-specific IICBA component [Shigella dysenteriae 1012] (648 aa)
Score = 545, Expect = 2.6e-53, Identities = 155/465 (33%), Positives = 248/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLA          L  L   L+  I L V+      L  H G SFS G ID+ +   +      N W   + G+ +  IYF +F  +I+ FN++TPGR         ED +++    + N ++E       LA N ++A GG DN+K +DACIT+LR+ + D + V+ A   +LGA G +K + Q++  + GA+A+ I   +K ++         +         ++  ++A   KP+       + +S  ++V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L+ K  K L      V+ G  V  GQ I  + L  L  +A+S I+P++  N  ++      +K  G +  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLA---------PLLYLLHALLTGISLFVATL----LGIHAGFSFSAGAIDYALMYNLPAA-SQNVWMLLVMGVVFFAIYFVVFSLVIRMFNLKTPGR---------EDKEDEIVTEEANSNTEE--GLTQLATNYIAAVGGTDNLKAIDACITRLRLTVADSARVNDAMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKVVA--------RGPVAAASAEATPATAAPVAKPQA----VPNAVSIAELV--SPITGDVVALDQVPDEAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRL------VEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSN--IDDFSGLIIKAQGHVVAGQTPLYEI 646
Score = 204, Expect = 9.9e-14, Identities = 77/257 (29%), Positives = 114/257 (44%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +    YN++ +IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVL--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLVAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|157155109|ref|YP_001461840.1| N-acetyl glucosamine specific PTS system components IIABC [Escherichia coli E24377A] >gi|157077139|gb|ABV16847.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli E24377A] (648 aa)
Score = 545, Expect = 2.6e-53, Identities = 155/465 (33%), Positives = 248/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLA          L  L   L+  I L V+      L  H G SFS G ID+ +   +      N W   + G+ +  IYF +F  +I+ FN++TPGR         ED +++    + N ++E   N   LA N ++A GG DN+K +DACIT+LR+ + D + V+     +LGA G +K + Q++  + GA+A+ I   +K ++         +         ++  ++A   KP+       + +S  ++V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L+ K  K L      V+ G  V  GQ I  + L  L  +A+S I+P++  N  ++      +K  G +  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLA---------PLLYLLHALLTGISLFVATL----LGIHAGFSFSAGAIDYALMYNLPAA-SQNVWMLLVMGVVFFAIYFVVFSLVIRMFNLKTPGR---------EDKEDEIVTEEANSNTEEGLNQ--LATNYIAAVGGTDNLKAIDACITRLRLTVADSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKVVA--------RGPVAAASAEATPATAAPVAKPQA----VPNAVSIAELV--SPITGDVVALDQVPDEAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRL------VEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSN--IDDFSGLIIKAQGHVVVGQTPLYEI 646
Score = 204, Expect = 9.8e-14, Identities = 77/257 (29%), Positives = 114/257 (44%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +    YN++ +IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVL--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|188493904|ref|ZP_03001174.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli 53638] >gi|188489103|gb|EDU64206.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli 53638] (648 aa)
Score = 545, Expect = 2.7e-53, Identities = 155/465 (33%), Positives = 248/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLA          L  L   L+  I L V+      L  H G SFS G ID+ +   +      N W   + G+ +  IYF +F  +I+ FN++TPGR         ED +++    + N ++E   N   LA N ++A GG DN+K +DACIT+LR+ + D + V+     +LGA G +K + Q++  + GA+A+ I   +K ++         +         ++  ++A   KP+       + +S  ++V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L+ K  K L      V+ G  V  GQ I  + L  L  +A+S I+P++  N  ++      +K  G +  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLA---------PLLYLLHALLTGISLFVATL----LGIHAGFSFSAGAIDYALMYNLPAA-SQNVWMLLVMGVVFFAIYFVVFSLVIRMFNLKTPGR---------EDKEDEIVTEEANSNTEEGLNQ--LATNYIAAVGGTDNLKAIDACITRLRLTVADSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKVVA--------RGPVAAASAEATPATAAPVAKPQA----VPNAVSIAELV--SPITGDVVALDQVPDEAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRL------VEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSN--IDDFSGLIIKAQGHVVAGQTPLYEI 646
Score = 198, Expect = 4.1e-13, Identities = 77/257 (29%), Positives = 113/257 (43%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +    YN + +IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVL--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAAYNLWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|110640890|ref|YP_668618.1| N-acetyl glucosamine specific PTS system components IIABC [Escherichia coli 536] >gi|191173978|ref|ZP_03035496.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli F11] >gi|110342482|gb|ABG68719.1| PTS system, N-acetylglucosamine-specific IIABC component [Escherichia coli 536] >gi|190905754|gb|EDV65375.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli F11] (648 aa)
Score = 545, Expect = 3.0e-53, Identities = 155/465 (33%), Positives = 248/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLA          L  L   L+  I L V+      L  H G SFS G ID+ +   +      N W   + G+ +  IYF +F  +I+ FN++TPGR         ED +++    + N ++E       LA N ++A GG DN+K +DACIT+LR+ + D + V+ A   +LGA G +K + Q++  + GA+A+ I   +K ++         +         ++  ++A   KP+       + +S  ++V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L+ K  K L      V+ G  V  GQ I  + L  L  +A+S I+P++  N  ++      +K  G +  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLA---------PLLYLLHALLTGISLFVATL----LGIHAGFSFSAGAIDYALMYNLPAA-SQNVWMLLVMGVVFFAIYFVVFSLVIRMFNLKTPGR---------EDKEDEIVTEEANSNTEE--GLTQLATNYIAAVGGSDNLKAIDACITRLRLTVADSARVNDAMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKVVA--------RGPVAAASAEATPATAAPVAKPQA----VPNAVSIAELV--SPITGDVVALDQVPDEAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRL------VEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSN--IDDFSGLIIKAQGHVVAGQTPLYEI 646
Score = 204, Expect = 1.0e-13, Identities = 77/257 (29%), Positives = 114/257 (44%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +    YN++ +IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVL--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|24112035|ref|NP_706545.1| N-acetyl glucosamine specific PTS system components IIABC [Shigella flexneri 2a str. 301] >gi|24050856|gb|AAN42252.1| N-acetylglucosamine-specific enzyme IIABC [Shigella flexneri 2a str. 301] (648 aa)
Score = 544, Expect = 3.3e-53, Identities = 154/465 (33%), Positives = 248/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLA          L  L   L+  I L V+      L  H G SFS G ID+ +   +      N W   + G+ +  IYF +F  +I+ FN++TPGR         ED +++    + N +++S      LA N ++A GG DN+K +DACIT+LR+ + D + V+     +LGA G +K + Q++  + GA+A+ I   +K ++         +         ++  ++A   KP+       + +S  ++V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L+ K  K L      V+ G  V  GQ I  + L  L  +A+S I+P++  N  ++      +K  G +  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLA---------PLLYLLHALLTGISLFVATL----LGIHAGFSFSAGAIDYALMYNLPAA-SQNVWMLLVMGVIFFAIYFVVFSLVIRMFNLKTPGR---------EDKEDEIVTEEANSNTDSCLTQ--LATNYIAAVGGTDNLKAIDACITRLRLTVADSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKVVA--------RGPVAAASAEATPATAAPVAKPQA----VPNAVSIAELV--SPITGDVVALDQVPDEAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRL------VEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSN--IDDFSGLLIKAQGHVVAGQTPLYEI 646
Score = 195, Expect = 9.9e-13, Identities = 73/257 (28%), Positives = 107/257 (41%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGIN-QLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+F  AI +A                          S    D+ GA      + Y                 L  A++ IN ++   V  G + G +    YN++ +IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIF--AIGVA--------------------------SSWSKDSAGAAALAGAVGY---------------FVLTKAMVTINPEINMGVLAGIITGLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|193063318|ref|ZP_03044408.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli E22] >gi|192930902|gb|EDV83506.1| PTS system, N-acetylglucosamine-specific IICBA component [Escherichia coli E22] (648 aa)
Score = 544, Expect = 4.1e-53, Identities = 156/465 (33%), Positives = 247/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLA          L  L   L+  I L V+      L  H G SFS G ID+ +   +      N W   + G+ +  IYF +F  +I+ FN++TPGR         ED +++    + N ++E   N   LA N ++A GG DN+K +DACIT+LR+ + D + V+     +LGA G +K + Q++  + GA+A+ I   +K ++         +         ++  ++A   KP+       + +S  ++V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L+ K  K L      V+ G  V  GQ I  + L  L  +A+S I+P++  N       I  +K  G +  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLA---------PLLYLLHALLTGISLFVATL----LGIHAGFSFSAGAIDYALMYNLPAA-SQNVWMLLVMGVVFFAIYFVVFSLVIRMFNLKTPGR---------EDKEDEIVTEEANSNTEEGLNQ--LATNYIAAVGGTDNLKAIDACITRLRLTVADSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKVVA--------RGPVAAASAEATPATAAPVAKPQA----VPNAVSIAELV--SPITGDVVALDQVPDEAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRL------VEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSNIDYFSGLI--IKAQGHVVAGQTPLYEI 646
Score = 203, Expect = 1.1e-13, Identities = 77/257 (29%), Positives = 114/257 (44%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +    YN++ +IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVL--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|83319654|ref|YP_424146.1| PTS system, IIBC component, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283540|gb|ABC01472.1| PTS system, IIBC component, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (613 aa)
Score = 543, Expect = 4.6e-53, Identities = 187/654 (28%), Positives = 305/654 (46%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGN--EGLRVF---GNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGIN---SFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMW-AFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWI-IYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLME 686
           K K+ N  EF +K +K ++  +A+LP AG+ + +G  I     G      +VF   G  ++  G A F  + LLFA+AI   ++ +    + A    Y I  ++  ++  + TD     + +              G        + +  G+  ++    GG ++GF+ A +YNK+ N  KL   + FFNG RFVP +  + + P+++   +IWPL    + +LG    +   +     F++G  ER L+PFGLHH    P+ Y+Q GG++D T ++      +  A +     +SL++   L              A G + +W ++I A        L  + SGWT        D A+  S+ +G            S QQA   +       V   ++  G+ +     L  A   M  A PKE R    SI  S     LLTG+TEPIE+ F+F AP L + +HA L  +AFG+ ++I + + A G  E        F    I  I I G + IQ      W  +  + +  IYF +FYF  KK     PG   N  L T  + K +  +       +++  D+ +   ++   GG DN++++DAC+T+LR+++KD++ V+       GA G +     S+  V+G +ADI KG I  L+E
  S:     9 KAKESNLHEFFSKFAKSILTFVALLPAAGLTIILGKIIGPLGLGQIKASAKVFNQIGGVIETVGWAAFSHMGLLFAVAIGGTWSKNRYGGSFAAAFAYFILLAVGSSMFITRTDPNTKELQF---------LNYILGRWEKHELFFSSQEGVMSIRYDAIGGIIMGFVGATIYNKYYNFNKLPQALSFFNGARFVPFMVIIIVLPISVGIGLIWPLFQTVINYLGNFFAKEQKLKFLAPFLYGTSERLLLPFGLHHMITIPMNYSQLGGNVDFTNSSQFTNTNEQNAKIIADFFSSLSNKEAL-------------KAQGQEKIWLSWITA--------LGNVKSGWT--------DYAANHSNVSG-----------LSMQQAYEIV----LDSVVPVRFKVGQMITSSGSLVGAGLGMAFAIPKEKRAKYSSIYFSGLAACLLTGVTEPIEFIFMFSAP-LLYVLHAVLTGIAFGISDFIPMRIHAFGGIETLVKYLFVFGPTSITGIGIKGILWIQ----GLWLLLVTIGFGGIYFVVFYFFTKKTKPAIPGF-TNDELITDVEAKQEVKE-------KTIKTDKTVKA-IIDLLGGLDNLEDIDACMTRLRVKVKDKTKVENKFKELTGAVGVLNKG-SSLQIVYGPKADIYKGEILELLE 605
>gi|146310852|ref|YP_001175926.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Enterobacter sp. 638] >gi|145317728|gb|ABP59875.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Enterobacter sp. 638] (673 aa)
Score = 542, Expect = 5.6e-53, Identities = 155/465 (33%), Positives = 248/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGL---MNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN-ESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G+Y  G +  M+ GLP AA A+   A  EN+   + I M+  F +  TGITEP+E++F+F+AP L++ +HA L  ++  +   M+WI                G  FS G++D ++     +   +  WW  I  GL +  IY+ +F F I KFN+ TPGR     L       + Q+   +N S+ +  +   LA   ++A GG DN+  +DACIT+LR+ +KD S+V+ A   +LGA G I+ +  SV  + G  A+ I   +KT      + P   SE     + S+  ++ +  KP+   V   + ++     + SP TGE+V++ +VPDE F+   +G G+AV PT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L  K       F   V+ G  V  G+ I  + L  L  HA+S I+P++  N +   G  I   +  G++  G  PL+E+
  S:   251 GRYQAGFFPIMMFGLPGAALAIYHCARPENKAKVLGIMMAGAFAAFFTGITEPLEFSFMFVAPVLYF-IHAVLTGISVFIAASMHWIA---------------GFGFSAGLVDMVLSSRNPL---ATHWWMLIPQGLVFFAIYYVVFRFTITKFNLMTPGR----ELAVAGSEADGQD---VNVSANADQDVAGLARQYIAAVGGSDNLTGIDACITRLRLNVKDSSLVNEALAKRLGASGVIRLNKTSVQIIVGFVAEKIANAMKT------TGPVAASE-----SASAPVAAPTAAKPQ--AVPNATTIA----ALVSPVTGEVVAIEQVPDEAFASKAVGDGVAVVPTEKLVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALGGKG------FTRLVEEGAEVVAGEPILEMDLDYLNAHARSMISPVVCSNIDDFSGLVI---QAKGQVVAGQTPLYEI 670
Score = 269, Expect = 3.1e-21, Identities = 75/250 (30%), Positives = 125/250 (50%)
  Q:    42 FIAKLSKGLMLPIAMLPIAGIFLGVGSAI-VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           ++ K+ + LM+P+A LP A I +GVG  I   + GG+  L     F++  G A+   + +LFAI +A   + D  G AAL  F+G+L+  +L    + ++     A                      +P++ +G +       S+ F G +VG + A LYN+F +++L   + FF+G R VPI+T   +  V  + + IWPL+   L   G+ + +     + ++ F  R L+P GLHHA  S  W+  AG
  S:     6 YLQKVGRALMVPVATLPAAAILMGVGYWIDPVSWGGDNALAAL--FIK-SGAAIIDNMSVLFAIGVAYGMSKDKDGAAALTGFVGFLVLTTLCSPAAVAMIQKIPA--------------------DQVPAA-FGKI-------SNQFVGILVGIISAELYNRFSSVELPKALSFFSGRRLVPILTSFVMIFVAFIMMYIWPLIFDGLVNFGEHIQKLGSAGAGVYAFFNRLLIPVGLHHALNSVFWFDVAG 226
>gi|82775948|ref|YP_402295.1| N-acetyl glucosamine specific PTS system components IIABC [Shigella dysenteriae Sd197] >gi|81240096|gb|ABB60806.1| PTS system, N-acetylglucosamine-specific enzyme IIABC [Shigella dysenteriae Sd197] (648 aa)
Score = 542, Expect = 6.6e-53, Identities = 154/465 (33%), Positives = 248/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA A+  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLA          L  L   L+  I L V+      L  H G SFS G ID+ +   +      N W   + G+ +  IYF +F  +I+ FN++TPGR         ED +++    + N ++E   N   LA N ++A GG DN+K +DACIT+LR+ + D + V+     +LGA G +K + Q++  + GA+A+ I   +K ++         +         ++  ++A   KP+       + +S  ++V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L+ K  K L      V+ G  V  GQ I  + L  L  +A+S I+P++  N  ++      +K  G +  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAIYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLA---------PLLYLLHALLTGISLFVATL----LGIHAGFSFSAGAIDYALMYNLPAA-SQNVWMLLVMGVVFFAIYFVVFSLVIRMFNLKTPGR---------EDKEDEIVTEEANSNTEEGLNQ--LATNYIAAVGGTDNLKAIDACITRLRLTVADSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKVVA--------RGPVAAASAEATPATAAPVAKPQA----VPNAVSIAELV--SPITGDVVALDQVPDEAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRL------VEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSN--IDDFSGLIIKAQGHVVAGQTPLYEI 646
Score = 204, Expect = 1.0e-13, Identities = 77/257 (29%), Positives = 114/257 (44%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +    YN++ +IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVL--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|16128655|ref|NP_415205.1| fused N-acetyl glucosamine specific PTS enzyme: IIC, IIB , and IIA components [Escherichia coli str. K-12 substr. MG1655] >gi|89107537|ref|AP_001317.1| fused N-acetyl glucosamine specific PTS enzyme IICBA components [Escherichia coli W3110] >gi|170080348|ref|YP_001729668.1| fused N-acetyl glucosamine specific PTS enzyme: IIC, IIB, and IIA components [Escherichia coli str. K12 substr. DH10B] >gi|131500|sp|P09323|PTW3C_ECOLI PTS system N-acetylglucosamine-specific EIICBA component (EIICBA-Nag) (EII-Nag) [Includes: N-acetylglucosamine permease IIC component (PTS system N-acetylglucosamine-specific EIIC component); N-acetylglucosamine-specific phosphotransferase enzyme IIB component (PTS system N-acetylglucosamine-specific EIIB component); N-acetylglucosamine-specific phosphotransferase enzyme IIA component (PTS system N-acetylglucosamine-specific EIIA component)] >gi|146913|gb|AAA24192.1| N-acetylglucosamine transport protein >gi|1651288|dbj|BAA35327.1| fused N-acetyl glucosamine specific PTS enzyme IICBA components [Escherichia coli W3110] >gi|1786894|gb|AAC73773.1| fused N-acetyl glucosamine specific PTS enzyme: IIC, IIB , and IIA components [Escherichia coli str. K-12 substr. MG1655] >gi|169888183|gb|ACB01890.1| fused N-acetyl glucosamine specific PTS enzyme: IIC, IIB , and IIA components [Escherichia coli str. K12 substr. DH10B] (648 aa)
Score = 541, Expect = 7.9e-53, Identities = 155/465 (33%), Positives = 247/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLA          L  L   L+  I L V+      L  H G SFS G ID+ +   +      N W   + G+ +  IYF +F  +I+ FN++TPGR         ED +++    + N ++E       LA N ++A GG DN+K +DACIT+LR+ + D + V+     +LGA G +K + Q++  + GA+A+ I   +K ++         +         ++  ++A   KP+       + +S  ++V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L+ K  K L      V+ G  V  GQ I  + L  L  +A+S I+P++  N  ++      +K  G I  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLA---------PLLYLLHALLTGISLFVATL----LGIHAGFSFSAGAIDYALMYNLPAA-SQNVWMLLVMGVIFFAIYFVVFSLVIRMFNLKTPGR---------EDKEDEIVTEEANSNTEE--GLTQLATNYIAAVGGTDNLKAIDACITRLRLTVADSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKVVA--------RGPVAAASAEATPATAAPVAKPQA----VPNAVSIAELV--SPITGDVVALDQVPDEAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRL------VEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSN--IDDFSGLIIKAQGHIVAGQTPLYEI 646
Score = 204, Expect = 1.0e-13, Identities = 77/257 (29%), Positives = 114/257 (44%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +    YN++ +IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVL--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|30062146|ref|NP_836317.1| N-acetyl glucosamine specific PTS system components IIABC [Shigella flexneri 2a str. 2457T] >gi|110804684|ref|YP_688204.1| N-acetyl glucosamine specific PTS system components IIABC [Shigella flexneri 5 str. 8401] >gi|30040391|gb|AAP16123.1| N-acetylglucosamine-specific enzyme IIABC [Shigella flexneri 2a str. 2457T] >gi|110614232|gb|ABF02899.1| PTS system, N-acetylglucosamine-specific enzyme IIABC [Shigella flexneri 5 str. 8401] (648 aa)
Score = 540, Expect = 9.6e-53, Identities = 154/465 (33%), Positives = 247/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLA          L  L   L+  I L V+      L  H G SFS G ID+ +   +      N W   + G+ +  IYF +F  +I+ FN++TPGR         ED +++    + N ++E       LA N ++A GG DN+K +DACIT+LR+ + D + V+     +LGA G +K + Q++  + GA+A+ I   +K ++         +         ++  ++A   KP+       + +S  ++V  SP TG++V+L +VPDE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L+ K  K L      V+ G  V  GQ I  + L  L  +A+S I+P++  N  ++      +K  G +  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLA---------PLLYLLHALLTGISLFVATL----LGIHAGFSFSAGAIDYALMYNLPAA-SQNVWMLLVMGVIFFAIYFVVFSLVIRMFNLKTPGR---------EDKEDEIVTEEANSNTEE--GLTQLATNYIAAVGGTDNLKAIDACITRLRLTVADSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKVVA--------RGPVAAASAEATPATAAPVAKPQA----VPNAVSIAELV--SPITGDVVALDQVPDEAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRL------VEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSN--IDDFSGLLIKAQGHVVAGQTPLYEI 646
Score = 204, Expect = 1.0e-13, Identities = 77/257 (29%), Positives = 114/257 (44%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+FAI +A +++ D+ G AALA  +GY +               T A++  N                  P    G + GI           + G +    YN++ +IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVL--------------TKAMVTIN------------------PEINMGVLAGI-----------ITGLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|134298209|ref|YP_001111705.1| PTS system, glucose subfamily, IIA subunit [Desulfotomaculum reducens MI-1] >gi|134050909|gb|ABO48880.1| PTS system, glucose subfamily, IIA subunit [Desulfotomaculum reducens MI-1] (622 aa)
Score = 540, Expect = 1.2e-52, Identities = 145/443 (32%), Positives = 237/443 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAK-STITPIIVL-NESLE 863
           G ++  ++  M+ GLPAAA A+   A  E +K    +  SA FTS LTGITEPIE++F+F+AP LF   H  +  ++  + N + +            H+G +FS   ID+++      +YG N    +  GL    +YF +F   IK  N++TPGR            +++   V+  G+   L      A  V+ A GG +NI+ +DACIT+LR+ +KD  +V       LGA G ++   +++  +FG ++D +K  I++LM N  S+                  +A   KP  E+      +S  K ++ +P +G+++ L +VPDETF + ++G G+A++P  G   +P+ G +  VF T HA + +TE G +IL+HVGI++++LK +  K L      V  G  V VGQ++  V L  ++ A  STITP+I++ +E +E
  S:   226 GTFMASEFPIMMFGLPAAAFAIYRNARPERKKAIAGLMASAAFTSFLTGITEPIEFSFIFVAPVLFV-FHVLMAGVSGFVTNLLDI------------HLGFTFSASFIDYLL----SYKYGHNQLLLWPVGLVVGGLYFVVFNTAIKMLNLKTPGR------------EDEITAVENQGTGSDL------AHKVLDALGGANNIEILDACITRLRVTVKDPDMVKKDVFKALGASGVMEMG-KNLQIIFGTQSDSLKEEIRSLMTNTVSA------------------TAEGAKPLPEL-----NVSASKTMIKAPASGKVIPLEQVPDETFKQKLLGNGVAIEPVEGTFIAPVAGTVVQVFPTNHALTIKTENGIEILLHVGINTVSLKGQGFKAL------VSEGQKVTVGQKLLEVDLKQIEKAGLSTITPVIIIGSEDME 605
Score = 251, Expect = 3.5e-19, Identities = 71/247 (28%), Positives = 112/247 (45%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQ-ALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           +++  + + LMLP+++LP AG+ L  G   + N             ++  G A+F  LPL+FA+ +AI F+G    AALA  +G LI  ++  A+  S+                                              VF G ++G   A LY +F  IKL   +GFF G RFVPI+T +A   + ++  ++WP +   +  +GQ A+  + G   F  G  +R L+P GLHH +Y    Y
  S:     6 KYLQMVGQSLMLPVSVLPAAGLLLRFGEKDLLNMPA----------MKEAGLAIFANLPLIFAVGVAIGFSGGQSVAALAAVVGQLILLAVLKAVDPSI-------------------------------------------NMGVFSGIIMGITAALLYKRFYQIKLPQYLGFFAGKRFVPIITAVAGVVIALISAVVWPSIQNVIDAVGQVAVSSSFGPALFAAG--KRLLIPVGLHHVYYPSFLY 198
>gi|153940810|ref|YP_001392032.1| PTS system, glucose family, IIABC component [Clostridium botulinum F str. Langeland] >gi|152936706|gb|ABS42204.1| PTS system, glucose family, IIABC component [Clostridium botulinum F str. Langeland] (651 aa)
Score = 539, Expect = 1.3e-52, Identities = 153/457 (33%), Positives = 241/457 (52%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLF-WGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVLNESLEGREIKFLKKSGEIK 877
           G ++  ++  ++ GLP AA AM+ AA K+NRK A+SI +SA   S  TGITEPIE+ F+F+AP LF + V A+  A         G++ S          +G +FS   ID+I+      ++  N    F  G+ Y  +YF +FY+LI K +I+T GR     +  KE+ + K N+                A  ++ A GG  NI N+D CIT+LR+ +KD+  +D A L ++   G ++ + +    + G EA+ IK +I+ +++             K MN              KE+++ +  L      + +P  GEIV+L +VPDE FS+ ++G G A+KP   K+YSP+DG +  +F + HA + ETE+G +ILIH+GID++NL  +       F   +K  + VK GQ + +     L + AKS I+PI++ N          LK+S E+K
  S:   260 GVFMASEFPILMFGLPGAAVAMICAAEKQNRKKALSIMLSAALVSFFTGITEPIEFAFIFVAPILFIFHVAAAFTA---------GIVTSI-----FNIKLGYTFSASFIDYIL----GYKFSQNGLLIFPIGIFYFLLYFIVFYYLIIKKDIKTLGR---EGIILKENKEIKSNEK---------------AALILEALGGEKNIINLDCCITRLRVALKDEKKLDRAYLEKINLLGIVQ-TGKVAQIILGTEAENIKYSIEQIIK-------------KGMN-------------PKEIIEYERALK-----LMNPMEGEIVALEEVPDEVFSEKLLGDGFAIKPYKNKVYSPVDGIIKFLFPSNHALAIETEEGLEILIHIGIDTVNLNGEG------FKVYIKEKEKVKKGQLLVSYDKEFLGREAKSLISPIVITN----------LKESSEVK 634
Score = 261, Expect = 2.5e-20, Identities = 83/258 (32%), Positives = 128/258 (49%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSID 295
           N    + ++ K LMLP+++LP A I L +G   + N            ++   G+A+F  LPL+FAI +++ F+   G AALA  +G L+   + +  S          +       Q N+       A + S  Y  ++    +   VFGG ++G + A +YNK+KNIKL   IGFF G RFV I+T +  F   ++ ++IWP V   + TF   A    +G   +  G  +R L+P GLHH +Y P  Y Q G  +D
  S:     3 NILTILQRVGKSLMLPVSVLPAAAILLRLGYPDLLN----------NMYMLKAGDAIFSNLPLIFAIGVSVGFSDGEGIAALAAIVGQLMLQGILNVGSSKAAKEAAIKVAA-----QKNM----TLEAFMNSKFYDDILRSTNIDLGVFGGIIIGIIAAIIYNKYKNIKLPSTIGFFGGKRFVLILTAIISFMFGMINVVIWPEVQKNIDTFARFATTSPLGPAFYAAG--KRLLIPLGLHHIYYPPFLY-QFGSYVD 239
>gi|148380712|ref|YP_001255253.1| PTS system, glucose family, IIABC component [Clostridium botulinum A str. ATCC 3502] >gi|153934253|ref|YP_001384996.1| PTS system, glucose family, IIABC component [Clostridium botulinum A str. ATCC 19397] >gi|153935022|ref|YP_001388466.1| PTS system, glucose family, IIABC component [Clostridium botulinum A str. Hall] >gi|148290196|emb|CAL84315.1| putative PTS system, glucose-specific IIABC component [Clostridium botulinum A str. ATCC 3502] >gi|152930297|gb|ABS35797.1| PTS system, glucose family, IIABC component [Clostridium botulinum A str. ATCC 19397] >gi|152930936|gb|ABS36435.1| PTS system, glucose family, IIABC component [Clostridium botulinum A str. Hall] (651 aa)
Score = 538, Expect = 1.8e-52, Identities = 153/457 (33%), Positives = 241/457 (52%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLF-WGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVLNESLEGREIKFLKKSGEIK 877
           G ++  ++  ++ GLP AA AM+ AA K+NRK A+SI +SA   S  TGITEPIE+ F+F+AP LF + V A+  A         G++ S          +G +FS   ID+I+      ++  N    F  G+ Y  +YF +FY+LI K +I+T GR     +  KE+ + K N+                A  ++ A GG  NI N+D CIT+LR+ +KD+  +D A L ++   G ++ + +    + G EA+ IK +I+ +++             K MN              KE+++ +  L      + +P  GEIV+L +VPDE FS+ ++G G A+KP   K+YSP+DG +  +F + HA + ETE+G +ILIH+GID++NL  +       F   +K  + VK GQ + +     L + AKS I+PI++ N          LK+S E+K
  S:   260 GVFMASEFPILMFGLPGAAIAMICAAEKQNRKKALSIMLSAALVSFFTGITEPIEFAFIFVAPILFIFHVAAAFTA---------GIVTSI-----FNIKLGYTFSASFIDYIL----GYKFSQNGLLIFPIGIFYFLLYFIVFYYLIIKKDIKTLGR---EGIILKENKEIKSNEK---------------AALILEALGGEKNIINLDCCITRLRVALKDEKKLDRAYLEKINLLGIVQ-TGKVAQIILGTEAENIKYSIEQIIK-------------KGMN-------------PKEIIEYERALK-----LMNPMEGEIVALEEVPDEVFSEKLLGDGFAIKPYKNKVYSPVDGIIKFLFPSNHALAIETEEGLEILIHIGIDTVNLNGEG------FKVYIKEKEKVKKGQLLVSYDKEFLGREAKSLISPIVITN----------LKESSEVK 634
Score = 255, Expect = 1.2e-19, Identities = 82/258 (31%), Positives = 127/258 (49%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSID 295
           N    + ++ K LMLP+++LP A I L +G   + N            ++   G+A+F  LPL+FAI +++  +   G AALA  +G L+   + +  S          +       Q N+       A + S  Y  ++    +   VFGG ++G + A +YNK+KNIKL   IGFF G RFV I+T +  F   ++ ++IWP V   + TF   A    +G   +  G  +R L+P GLHH +Y P  Y Q G  +D
  S:     3 NILTILQRVGKSLMLPVSVLPAAAILLRLGYPDLLN----------NMYMLKAGDAIFSNLPLIFAIGVSVGLSDGEGIAALAAIVGQLMLQGILNVGSSKAAKEAAIKVAA-----QKNM----TLEAFMNSKFYDDILRSTNIDLGVFGGIIIGIIAAIIYNKYKNIKLPSTIGFFGGKRFVLILTAIISFMFGMINVVIWPEVQKNIDTFARFATTSPLGPAFYAAG--KRLLIPLGLHHIYYPPFLY-QFGSYVD 239
>gi|170756387|ref|YP_001782360.1| PTS system, glucose family, IIABC component [Clostridium botulinum B1 str. Okra] >gi|169121599|gb|ACA45435.1| PTS system, glucose family, IIABC component [Clostridium botulinum B1 str. Okra] (651 aa)
Score = 537, Expect = 2.1e-52, Identities = 153/457 (33%), Positives = 242/457 (52%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLF-WGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVLNESLEGREIKFLKKSGEIK 877
           G ++  ++  ++ GLP AA AM+ AA K+NRK A+SI +SA   S  TGITEPIE+ F+F+AP LF + V A+  A         G++ S          +G +FS   ID+I+      ++  N    F  G+ Y  +YF +FY+LI K +I+T GR     +  KE+ + K N+                A  ++ A GG  NI N+D CIT+LR+ +KD+  +D A L ++   G ++ + + V  + G EA+ IK +I+ +++             K MN              KE+++ +  L      + +P  GEIV+L +VPDE FS+ ++G G A+KP   K+YSP+DG +  +F + HA + ETE+G +ILIH+GID++NL  +       F   ++  + VK GQ + +     L + AKS I+PI++ N          LK+S E+K
  S:   260 GVFMASEFPILMFGLPGAAIAMICAAEKQNRKKALSIMLSAALVSFFTGITEPIEFAFIFVAPILFIFHVAAAFTA---------GIVTSI-----FNIKLGYTFSASFIDYIL----GYKFSQNGLLIFPIGIFYFLLYFIVFYYLIIKKDIKTLGR---EGIILKENKEIKSNEK---------------AALILEALGGEKNIINLDCCITRLRVALKDERKLDRAYLEKINLLGIVQ-TGKVVQIILGTEAENIKYSIEQIIK-------------KGMN-------------PKEIIEYERALK-----LMNPMEGEIVALEEVPDEVFSEKLLGDGFAIKPYRNKVYSPVDGIIKFLFPSNHALAIETEEGLEILIHIGIDTVNLNGEG------FKVYIEEKEKVKKGQLLVSYDKKFLGREAKSLISPIVITN----------LKESSEVK 634
Score = 255, Expect = 1.1e-19, Identities = 82/258 (31%), Positives = 127/258 (49%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSID 295
           N    + ++ K LMLP+++LP A I L +G   + N            ++   G+A+F  LPL+FAI +++  +   G AALA  +G L+   + +  S          +       Q N+       A + S  Y  ++    +   VFGG ++G + A +YNK+KNIKL   IGFF G RFV I+T +  F   ++ ++IWP V   + TF   A    +G   +  G  +R L+P GLHH +Y P  Y Q G  +D
  S:     3 NILTILQRVGKSLMLPVSVLPAAAILLRLGYPDLLN----------NMYMLKAGDAIFSNLPLIFAIGVSVGLSDGEGIAALAAIVGQLMLQGILNVGSSKAAKEAAIKVAT-----QKNM----TLEAFMNSKFYDDILRSTNIDLGVFGGIIIGIIAAIIYNKYKNIKLPSTIGFFGGKRFVLILTAIISFMFGMINVVIWPEVQKNIDTFARFATTSPLGPAFYAAG--KRLLIPLGLHHIYYPPFLY-QFGSYVD 239
>gi|156934820|ref|YP_001438736.1| hypothetical protein ESA_02660 [Enterobacter sakazakii ATCC BAA-894] >gi|156533074|gb|ABU77900.1| hypothetical protein ESA_02660 [Enterobacter sakazakii ATCC BAA-894] (660 aa)
Score = 537, Expect = 2.2e-52, Identities = 147/439 (33%), Positives = 230/439 (52%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAF---GLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEV-VKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           G+Y  G +  M+ GLP AA A+   A  EN+   + I M+  F +  TGITEP+E++F+F+AP L+  +HA L  ++      M+WI                G  FS G++D ++     +   +  W+  I  GL +  IY+ +F F I KFN+ TPGR             ++ + V +N S E   +   LA   ++A GG DN+  +DACIT+LR+ +KD ++VD A   +LGA G I+ +  SV  + G  A+ I   +KT     +S+P  ++              A  VKP+    VKT + L        SP TGE+V+L  VPDE F+   +G G+A+KPT   + +P  G +  +F+T HA+  ETE G +I++H+GID++ L  +  K L      V+ G  V  GQ +  + L  L  +A+S ++P++  N
  S:   237 GRYQAGFFPIMMFGLPGAALAIYHCARPENKAKVLGIMMAGAFAAFFTGITEPLEFSFMFVAPVLYV-IHAVLTGISVFIAATMHWIA---------------GFGFSAGLVDMVLSSRNPL---ATHWYMLIPQGLVFFVIYYVVFRFTITKFNLMTPGRELAVA-------GSEADGVDVNVSDEKDLDAAGLARQYIAAVGGSDNLTGIDACITRLRLNVKDSALVDEAMAKRLGATGVIRLNKTSVQIIVGFVAEKIANAMKTTGHVDASAPKAQTA----------APVAPAVKPQAVANVKTIAALV-------SPVTGEVVALDAVPDEAFASKAVGDGVAIKPTDKLVVAPAAGTIVKIFNTNHAFCLETENGAEIVVHMGIDTVALNGQGFKRL------VEEGAQVTAGQPVLELDLDYLNANARSMVSPVVCSN 632
Score = 269, Expect = 3.0e-21, Identities = 75/241 (31%), Positives = 118/241 (48%)
  Q:    51 MLPIAMLPIAGIFLGVGSAI-VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           M+P+A LP A I +GVG  +  T  GG   L  F  F+Q  G+A+   + +LFA+ +A   + D  G AALA F+G+L+  +L    + ++                            +P+    A  G  + Q   F G +VG + A LYN+F  ++L   + FF+G R VPI+T   +  V  + + IWP+V   L   G+ + +   + + ++ F  R L+P GLHHA  S  W+  AG
  S:     1 MVPVATLPAAAILMGVGYWLDPTGWGGGNALAAF--FIQ-SGSAIIDNMGVLFAVGVAYGMSKDKDGAAALAGFVGFLVLTTLCSPAAVAMI-------------------------MKIPADQVPAAFGKIKNQ---FVGIMVGIIAAELYNRFSAVELPKALSFFSGRRLVPILTSFVMIVVAFIMMYIWPVVFGGLVDFGEQIQKLGSVGAGVYAFFNRLLIPVGLHHALNSVFWFDVAG 212
>gi|170760854|ref|YP_001788070.1| PTS system, glucose family, IIABC component [Clostridium botulinum A3 str. Loch Maree] >gi|169407843|gb|ACA56254.1| PTS system, glucose family, IIABC component [Clostridium botulinum A3 str. Loch Maree] (651 aa)
Score = 536, Expect = 3.1e-52, Identities = 151/457 (33%), Positives = 237/457 (51%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLF-WGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVLNESLEGREIKFLKKSGEIK 877
           G ++  ++  ++ GLP AA AM+ A  K+NRK A+SI +SA   S  TGITEPIE+ F+F+AP LF + V A+  A         G++ S          +G +FS   ID+I+      ++  N    F  G+ Y  +YF +FY+LI K +I+T GR     +  KE+ + K N+                A  ++ A GG  NI N+D CIT+LR+ +KD+  +D A L ++   G ++ + + V  + G EA+ IK +I+ +++    +P    EYE+ +                               + +P  GEIV+L +VPDE FS+ ++G G A+KP   K+YSP+DG +  +F + HA + ETE+G +ILIH+GID++NL  +       F   +K  + VK GQ +       L + AKS I+PI++ N          LK+S E+K
  S:   260 GVFMASEFPILMFGLPGAAIAMICATEKQNRKKALSIMLSAALVSFFTGITEPIEFAFIFVAPILFIFHVAAAFTA---------GIVTSI-----FNIKLGYTFSASFIDYIL----GYKFSQNGLLIFPIGIFYFLLYFIVFYYLIIKKDIKTLGR---EGIILKENKEIKSNEK---------------AALILEALGGEKNIINLDCCITRLRVALKDEKKLDRAYLEKINLLGIVQ-TGKVVQIILGTEAENIKYSIEQIIKR-GMNPKEIIEYERALK------------------------------LMNPMEGEIVALEEVPDEVFSEKLLGDGFAIKPYKNKVYSPVDGIIKFLFPSNHALAIETEEGLEILIHIGIDTVNLNGEG------FKVYIKEKEKVKKGQLLVNYDKEFLGREAKSLISPIVITN----------LKESSEVK 634
Score = 252, Expect = 2.9e-19, Identities = 86/258 (33%), Positives = 130/258 (50%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSID 295
           N    + ++ K LMLP+++LP A I L +G   + N            ++   G+A+F  LPL+FAI +++  +   G AALA  +G LI   LQ  L+  V  +  A      +  Q N+       A + S  Y  ++    +   VFGG ++G + A +YNK+KNIKL   IGFF G RFV I+T +  F   ++ + IWP +   + TF   A    +G   +  G  +R L+P GLHH +Y P  Y Q G  +D
  S:     3 NILTILQRVGKSLMLPVSVLPAAAILLRLGYPDLLN----------NMYMLKAGDAIFSNLPLIFAIGVSVGLSDGEGIAALAAIVGQLI---LQGILN--VGSSKAAKEAAIKIAAQRNM----TLEAFMNSKFYDDILRSTNIDLGVFGGIIIGIIAAIIYNKYKNIKLPSTIGFFGGKRFVLILTAIISFMFGMINVAIWPEIQKNIDTFARFATTSPLGPAFYAAG--KRLLIPLGLHHIYYPPFLY-QFGSYVD 239
>gi|77961549|ref|ZP_00825384.1| COG1263: Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific [Yersinia mollaretii ATCC 43969] (663 aa)
Score = 536, Expect = 3.4e-52, Identities = 148/461 (32%), Positives = 238/461 (51%)
  Q:   399 NLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGL---MNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           N   GQQ++         G+  G+Y  G +  M+ GLP AA A+   A  ENR     I ++  F +  TGITEP+E++F+F+AP L++ +HA L  ++  +   M+WI                G  FS G++D ++     +   +  W+  I  GL +  IY+ +F F I+KFN+ TPGR        ++ Y    N       SE +N    LA   + A GG DN+  +DACIT+LR+ +KD ++V+     +LGA G I+ + QSV  + G  A++I   ++ ++          +         +  +SA          KT S      +V+ SP TG++V+L +VPDE F+   +G G+A++PT   + SP +G +  +F+T HA+  ETE G +I++H+GID++ L  +       F   V+ G TV  GQ +  + LA L  +A S I+P++V N
  S:   218 NFLGGQQSID--AGKAVVGIT-GRYQAGFFPIMMFGLPGAALAIYHCARPENRAKVAGIMLAGAFAAFFTGITEPLEFSFMFVAPVLYF-IHAVLTGISVFIAASMHWIA---------------GFGFSAGLVDMVLSSRNPL---ATHWYMLIPQGLVFFAIYYVVFRFTIQKFNLLTPGRELAVEGSEEDGYDVNVNNTPAVNESE-ING---LARRYIGAIGGSDNLTGIDACITRLRLNVKDSALVNDNVAKRLGASGVIRLNKQSVQVIVGTRAELIASAMRAVLAGGPVPAASTTAAPAAAQPQAVINSA----------KTAS------LVLVSPITGDVVALEQVPDEAFASKAVGEGVAIRPTDKTVVSPANGTIVKIFNTDHAFCLETETGAEIVVHIGIDTVKLNGQG------FTRLVEEGATVVAGQPVLELDLAYLNANAHSMISPVVVSN 635
Score = 262, Expect = 1.7e-20, Identities = 75/241 (31%), Positives = 115/241 (47%)
  Q:    51 MLPIAMLPIAGIFLGVGSAI-VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           M+P+A LP A I +GVG  I   + GG+  L     F++  G A+   + +LFAI +A   + D  G AAL  F+G+L+  +L    + S+                            +P     A  G    Q   F G +VG + A LYN+F +++L   + FF+G R VPI+T   +  V  + + +WPL+  AL   G+ +     + + I+ F  R L+P GLHHA  S  W+  AG
  S:     1 MVPVATLPAAAILMGVGYWIDPVSWGGDNALAAL--FIK-SGAAIIDNMSVLFAIGVAYGMSKDKDGAAALTGFVGFLVLTTLCSPAAVSMIQK-------------------------IPVDQVPAAFGKINNQ---FVGILVGIISAELYNRFSSVELPKALSFFSGRRLVPILTSFLMIVVAFILMYVWPLIYNALVTFGEYIKDMGSVGAGIYAFFNRLLIPVGLHHALNSVFWFDVAG 212
>gi|74311207|ref|YP_309626.1| N-acetyl glucosamine specific PTS system components IIABC [Shigella sonnei Ss046] >gi|73854684|gb|AAZ87391.1| PTS system, N-acetylglucosamine-specific enzyme IIABC [Shigella sonnei Ss046] (648 aa)
Score = 535, Expect = 4.3e-52, Identities = 154/465 (33%), Positives = 247/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM  AAPKE R +   + +S   T+ LTG+TEP+E+ F+FLA          L  L   L+  I L V+      L  H G SFS G ID+ +   +      N W   + G+ +  IYF +F  +I+ FN++TPGR         ED +++    + N ++E       LA N ++A GG DN+K +DACIT+LR+ + D + V+ A   +LGA G +K + Q++  + GA+A+ I   +K ++         +         ++  ++A   KP+       + +S  ++V  SP TG++V+L +V DE F+   +G G+AVKPT   + SP  G +  +F+T HA+  ETEKG +I++H+GID++ L+ K  K L      V+ G  V  GQ I  + L  L  +A+S I+P++  N  ++      +K  G +  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLA---------PLLYLLHALLTGISLFVATL----LGIHAGFSFSAGAIDYALMYNLPAA-SQNVWMLLVMGVVFFAIYFVVFSLVIRMFNLKTPGR---------EDKEDEIVTEEANSNTEE--GLTQLATNYIAAVGGTDNLKAIDACITRLRLTVADSARVNDAMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKVVA--------RGPVAAASAEATPATAAPVAKPQA----VPNAVSIAELV--SPITGDVVALDQVSDEAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRL------VEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSN--IDDFSGLIIKAQGNVVAGQTPLYEI 646
Score = 194, Expect = 1.5e-12, Identities = 73/257 (28%), Positives = 107/257 (41%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGIN-QLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+F  AI +A                          S    D+ GA      + Y                 L  A++ IN ++   V  G + G +    YN++ +IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVA----------FIAQAGGAIFDNLALIF--AIGVA--------------------------SSWSKDSAGAAALAGAVGY---------------FVLTKAMVTINPEINMGVLAGIITGLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|116493542|ref|YP_805277.1| N-acetylglucosamine and glucose PTS, EIICBA [Pediococcus pentosaceus ATCC 25745] >gi|116103692|gb|ABJ68835.1| N-acetylglucosamine and glucose PTS, EIICBA [Pediococcus pentosaceus ATCC 25745] (659 aa)
Score = 532, Expect = 9.7e-52, Identities = 152/505 (30%), Positives = 261/505 (51%)
  Q:   365 LSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGL---MNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEG-REIKF 869
           L+ GW  + + G ++   I +  + A+ SV  W ++         + + G KGV  G Y  G +  M+ GLPA A A+   A  EN+    S+ ++A F S  TG+TEP+E++F+F+A W  + +HA    L+      M+W                 G +FS G++D+++  +++    +   W  + GL  A IY+F F F IKKF++ TPGR E       ED     + V+   +++S +   V A  + +A GG DN++ VD C T+LR+++ D   ++   + + GA G  K    ++  + G E   +   +  L    +   ++K+        + +T+S  E   +   +K D  +++E   V +   G+ + + +VPD+TF++ M+G G A+ PT G I +P+DG ++ VF T HA  F+T+ G +IL+H+GID++ L         PF   V+ G TVK G  +  V L  +K+A    TP+IV+  +++  R +KF
  S:   185 LNLGWVGAGLYGFFNRLLIPTGLHQALNSVF-WFDVAGINDIGKFLASQGTKGVT-GMYQAGFFPIMMFGLPAGAYAIYKNARPENKATTASLMLAAAFASFFTGVTEPLEFSFMFVA-WPLYVLHAIFTGLSLAFAAFMHWTA---------------GFAFSAGLVDYVL--SLKNPIANQPLWLIVQGLVMAVIYYFGFDFAIKKFHLMTPGREE-----LAED-----DGVEEVATNDSDDKYTVQAKKIYAALGGSDNLQVVDNCTTRLRLKLNDTDNINENAIKRSGAAGLNKIDKNNLQIIIGTEVQFVSDALAKLENAKAPISSVKT--------ADETASTEETVADG--IKRD--VTEEFYSVAN---GQYMDIEEVPDDTFAQKMLGDGYAINPTDGTITAPVDGTITSVFPTKHAIGFKTDAGLEILLHMGIDTVELNG------APFDVKVEDGQTVKHGDVVAKVDLDAIKNAGKQ-TPMIVIVTNMDAVRVMKF 641
Score = 229, Expect = 1.1e-16, Identities = 74/252 (29%), Positives = 121/252 (48%)
  Q:    40 KEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           K ++ ++ + L LP+A+LP A + +G+G     N   +    V  +FLQ  GNAV G LPLLFA+ +A+                     S+  + + ++       +  N+L  +     ++    A+ +S   A IG      +VF G + G + A LYN+F   KL   + FF+G R VPI+  L +  V+++ L +WP V  AL    + +     + + ++GF  R L+P GLH A  S  W+  AG
  S:     2 KAYLQRMGRSLQLPVAVLPAAALLVGIG-----NWWASYSNDVVAHFLQAGGNAVLGQLPLLFAVGLALGM-------------------SVDQSGAAALAGLVAFELPVNVLKPESVATLMNIKPTAVDASF--AQIG------NVFIGIIAGLIAAALYNRFHETKLPMALSFFSGKRLVPIMAALVMLLVSVVLLFVWPPVYGALVAFAKFILNLGWVGAGLYGFFNRLLIPTGLHQALNSVFWFDVAG 221
>gi|168180840|ref|ZP_02615504.1| PTS system, glucose family, IIABC component [Clostridium botulinum NCTC 2916] >gi|182668250|gb|EDT80229.1| PTS system, glucose family, IIABC component [Clostridium botulinum NCTC 2916] (651 aa)
Score = 528, Expect = 2.5e-51, Identities = 154/457 (33%), Positives = 238/457 (52%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLF-WGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVLNESLEGREIKFLKKSGEIK 877
           G ++  ++  ++ GLP AA AM+ AA K+NRK A+SI +SA   S  TGITEPIE+ F+F+AP LF + V A+  A         G++ S          +G +FS   ID+I+      ++  N    F  G  Y  +YF +FY+LI K +I+T GR     +  KE+ + K N+                A  ++ A GG  NI N+D CIT+LR  +KDQ  +D A L ++   G ++ + + V  + G EA+ IK +I+ +++             K MN              KE+++ +  L      + +P  GEIV L +VPDE FS+ ++G G A+KP   K+YSP+DG +  +F + HA + ET +G +ILIH+GID++NL  +       F   +K  + VK GQ + +     L + AKS I+PI++ N          LK+S E+K
  S:   260 GVFMASEFPILMFGLPGAAIAMICAAEKQNRKKALSIMLSAALVSFFTGITEPIEFAFIFVAPILFIFHVAAAFTA---------GIVTSI-----FNIKLGYTFSASFIDYIL----GYKFSQNGLLIFPIGTFYFLLYFIVFYYLIIKKDIKTLGR---EGIILKENKEIKSNEK---------------AALILEALGGEKNIINLDCCITRLRAALKDQKKLDRAYLEKINLLGIVQ-TGKLVQIILGTEAENIKYSIEQIIK-------------KGMN-------------PKEIIEYERALK-----LMNPMEGEIVPLEEVPDEVFSEKLLGDGFAIKPYRNKVYSPVDGIIKFLFPSNHALAIETGEGLEILIHIGIDTVNLNGEG------FKVYIKEKEKVKKGQLLVSYDKEFLGREAKSLISPIVITN----------LKESSEVK 634
Score = 258, Expect = 4.6e-20, Identities = 88/258 (34%), Positives = 132/258 (51%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSID 295
           N    + ++ K LMLP+++LP A I L +G   + N            ++   G+A+F  LPL+FAI ++I  +   G AALA  +G L+   LQ  L+  V  + GA      +  Q N+       A + S  Y  ++    +   VFGG ++G + A +YNK+KNIKL   IGFF G RFV I+T +  F   ++ ++IWP V   + TF   A    +G   +  G  +R L+P GLHH +Y P  Y Q G  +D
  S:     3 NILTILQRVGKSLMLPVSVLPAAAILLRLGYPDLLN----------NMYMLKAGDAIFSNLPLIFAIGVSIGLSDGEGIAALAAIVGQLM---LQGILN--VGSSKGAKEAAIKVAAQKNM----TLEAFMNSKFYDDILRSTNIDLGVFGGIIIGIIAAIIYNKYKNIKLPSTIGFFGGKRFVLILTAIISFMFGMINVVIWPEVQKNIDTFARFATTSPLGPAFYAAG--KRLLIPLGLHHIYYPPFLY-QFGSYVD 239
>gi|145953129|ref|ZP_01802137.1| hypothetical protein CdifQ_04003108 [Clostridium difficile QCD-32g58] (603 aa)
Score = 526, Expect = 4.6e-51, Identities = 133/379 (35%), Positives = 215/379 (56%)
  Q:   417 GVN--VGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEK 795
           GVN   G ++ G + FM+ GLPAAA AMV  A  E +K    I  SA  TS LTGITEPIE+ FLF+AP LF  +H     L++ +M  +G+             IG +FSGG+ID++++G +        W+ + + G+ +A +Y+ +F F+I+KFN++TPGR               +++ + N     ++ ++ LA  ++ A G  DN+K++DACIT+LR+ + D + VD  KL  LGA G +     +V A+FG ++D IK +IK ++E  +          K+ +  +     ++VK   EV   ++ L ++   ++S   GEI+ + +VPD  FS  +MG G A+K + G IYSP+DG + ++F T HA   +++K
  S:   247 GVNFTAGTFMTGAFPFMMFGLPAAALAMVHEAKPEKKKFVAGIMASAALTSFLTGITEPIEFAFLFVAPVLF-AIHCLFSGLSYAIMQLLGV------------KIGFTFSGGLIDFLLFGVLP---NRTPWYLAILVGIGFAVLYYSVFRFMIRKFNLKTPGR---------------EDESETNAEVIEMSKNE-LASEILIALGNKDNLKSLDACITRLRLVVNDINKVDKEKLKLLGAAGVMVIG-NNVQAIFGPKSDSIKSDIKDIIEGKT----------KVESTVTKNVDKNKVKKNMEVANMENALVEK---IDSLTNGEILDIEEVPDSVFSSKLMGDGFAIKSSDGLIYSPVDGTIGVIFPTKHAIIIKSKK 582
Score = 326, Expect = 6.4e-28, Identities = 83/237 (35%), Positives = 129/237 (54%)
  Q:    51 MLPIAMLPIAGIFLGVGSAIVTNAG-------GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIA-LTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           MLP+A+LP AGI LGV +A+  +A         N   ++  + ++  G  +F  LPL+FA+ +A+  T   G AALA  +G+LI  +    ++    D                          + +S+Y +++GI  +Q+ VFGG ++G + A+LY KF  I+L   +GFF G RFVPIVT L    + I+   IWP +    L+F    +     + +F+ G +ER L+PFGLHH F++P WY
  S:     1 MLPVALLPAAGILLGVSNALAGDALLSHFPALANPTFQLIISIMESSGQIIFNNLPLIFAVGVAVGLTEGEGVAALAAIVGFLILNTSMGVMAGVTEDM-------------------------VDNSMYASIVGIPTIQTGVFGGIIIGIVAAYLYKKFYKIELPQYLGFFAGKRFVPIVTSLVAIAIGIILSFIWPPIQEGLLSFSKNVIEANQTLAAFMEGSLERLLIPFGLHHVFHNPFWY 220
>gi|187778672|ref|ZP_02995145.1| hypothetical protein CLOSPO_02267 [Clostridium sporogenes ATCC 15579] >gi|187772297|gb|EDU36099.1| hypothetical protein CLOSPO_02267 [Clostridium sporogenes ATCC 15579] (651 aa)
Score = 526, Expect = 5.0e-51, Identities = 156/456 (34%), Positives = 240/456 (52%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKF---LKKSGEI 876
           G ++  ++  ++ GLP AA AM+ AA K NRK  +SI +SA   S  TGITEPIE+ F+F+AP LF  +   L A   G++  I  I            +G +FS   ID+I+      ++  N    F  G+ Y  +YF +FY+LI K +I+T GR E T L        K+NK         + +++  AL ++ A GG  NI N+D CIT+LR+ +KD+  +D   L ++   G ++ + + V  + G EA+ IK +I+ +++             K MN              KE+++ +  L      + +P  GEIV L +VPDE FS+ ++G G A+KP   K+YSPIDG +  +F + HA + ET++G +ILIH+GID++ L  +       F   +K  + VK GQ + +     L+   KS I+PI++ N   E  EIK     KK  EI
  S:   260 GVFMASEFPILMFGLPGAAIAMICAAEKNNRKKVLSIMLSAALVSFFTGITEPIEFAFIFVAPILF--IFHVLAAFTSGIVTSIFNI-----------RLGYTFSASFIDYIL----GYKFSGNGLLIFPIGIFYFLLYFIVFYYLIVKKDIKTLGR-EGTVL--------KENK--------EIKSNEKAAL-ILEALGGEKNITNLDCCITRLRVALKDEKKLDRVYLEKINLLGIVQ-TGKVVQIILGTEAENIKYSIEQIIK-------------KGMN-------------PKEIIEYERSLK-----LMNPMEGEIVLLEQVPDEVFSEKLLGDGFAIKPYRNKVYSPIDGTIKFLFPSNHALAIETKEGLEILIHIGIDTVKLNGEG------FKVYIKEKEKVKKGQLLVSYDKEFLEGKVKSLISPIVITNLK-EDSEIKIEYGYKKEKEI 645
Score = 220, Expect = 1.3e-15, Identities = 86/258 (33%), Positives = 128/258 (49%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSID 295
           N    + ++ K LMLP+++LP A + L +G   + N            ++   G+A+F  LPL+FAI +AI  +   G AALA  +G LI   + D     V  +  A      +  Q N+   +  N    S  Y  ++    +   VFGG ++G + A +YNK+KNIKL   IGFF G RFV I+T +  F   ++ + IWP V   + TF   A    +G   +  G  +R L+P GLHH +Y P  Y Q G  +D
  S:     3 NILAVLQRVGKSLMLPVSVLPAAALLLRLGYPDLLN----------NIYMLKAGDAIFSNLPLIFAIGVAIGLSEGEGIAALAAIVGQLILQGILD-----VGSSKAAKEAAIKIAAQRNMTLENFMN----SKFYDDILRSTNIDLGVFGGIIIGIIAAIIYNKYKNIKLPSTIGFFGGKRFVLILTAIISFMFGMINVAIWPEVQKNIDTFARFASTSPLGPGFYAAG--KRLLIPLGLHHIYYPPFLY-QFGSYVD 239
>gi|167755016|ref|ZP_02427143.1| hypothetical protein CLORAM_00520 [Clostridium ramosum DSM 1402] >gi|167705066|gb|EDS19645.1| hypothetical protein CLORAM_00520 [Clostridium ramosum DSM 1402] (701 aa)
Score = 525, Expect = 5.3e-51, Identities = 150/464 (32%), Positives = 241/464 (51%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRG-ENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAK-STITPIIVLNESLEGREIKFLKKSGEIKKGMPLFEV 885
           +Y  G+++FMI GLP AA AM   A  EN+K   S+  SA  TS+LTGITEPIE+TFLF AP LF GV   L   A+ + +   + V            G++FSGG+ D+I++G +Q      +W   I  G+ Y  +Y+F F +LIKKF+++TPGR  +N +L   ++ K    K+ +N   E     Q+    +V   GG DN  ++D CIT+LR  + D  +V+   L Q GA   +      V  ++G +A  IK  +   + NI   P+   +Y+                 EKE   T+ EL     +V+    GE++ + + PD+ FS  ++G G+ +KP  G I +P DG++++++ T HA   + + G ++LIH G D++NL     + L      V+ GD +           ADL++ K + +   I+L  +    ++K  K+ G+IK G  + ++
  S:   288 KYFTGEFIFMIFGLPGAALAMYQTAKPENKKAIGSLLFSAALTSILTGITEPIEFTFLFAAPLLF-GVQVILAGSAYMVAHIFNIAV------------GLTFSGGLFDFIVFGVLQGN-SKTSWVLLIPIGIIYFMLYYFSFKYLIKKFDLKTPGREIDNMKLSIFKNPKASHRKL-LNKGIEIDKQSQL----IVRGLGGRDNFTDLDCCITRLRATVSDNQLVNEGLLKQSGAAAVVMQG-NGVQIIYGPKASSIKSKLDEYLINI---PDELDDYQL----------------EKETDHTNLELGN---IVD----GEVLPIEQAPDQIFSHKLLGDGVMIKPFHGLIVAPCDGEITMIYPTKHAIGMKLDNGYELLIHFGTDTVNLNGTGFEILVKLNQRVQKGDLIWN---------ADLEYIKENALDESILLIFTNLSNDLKIEKEYGKIKSGSTIMKI 699
Score = 359, Expect = 9.3e-32, Identities = 90/261 (34%), Positives = 137/261 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNA-----------GGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAA-LACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIY 303
           + ++ +  MLPIA+LPIAG+FLG+GS++               G    L  F   L   G+ +F  LPL+FA A+A+     A   A L+  I + +            T  +G      +L   G+I      N  +      AV GI  L+  VFGG +VG  V++++N+F  I+L   + FF G RF+PI++ +    V I+   +WP     +  LG+ +  +    +F++G I+R LVPFGLHH FY P W T  GGS+ +   A+IY
  S:     9 LQRIGRSFMLPIAVLPIAGLFLGIGSSLTNETTISSLHLEGVLGNGTFLHDFLIILTKVGSGLFNNLPLIFAAAVALGMAKKAKEVAVLSSIIAFFVMH----------TTISG------MLSLNGSILDNQIINPDVLDGTITAVCGIMSLEMGVFGGIIVGLGVSYIHNRFYQIELPRALSFFEGERFIPIISTITFLFVGIVMFYVWPFFQNGIYELGKLISTSGYFGTFVYGVIKRLLVPFGLHHVFYLPFWQTAIGGSM-VVNGAVIY 264
>gi|152969264|ref|YP_001334373.1| N-acetyl glucosamine specific PTS system components IIABC [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150954113|gb|ABR76143.1| PTS family enzyme IIC/enzyme IIB/enzyme IIC [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (651 aa)
Score = 525, Expect = 6.4e-51, Identities = 149/465 (32%), Positives = 249/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM +AAPK  R +   + +S   T+ LTG+TEP+E+ F+FLAP L+  +HA L  ++  +   +G+            H G SFS G ID+++  ++      N W   + G+ +  +YF LF  +I+ FN++TPGR +       E+  +         + E L     LA + ++A GG DN+K +DACIT+LR+ + D + V+ A   +LGA G +K + Q++  + GA+A+ I   +K ++     +              +  ++A   KP+       +  + E +V  SP TG++V+L +VPDE F+   +G GIAVKPT+  + +P  G +  +F+T HA+  ET  G +I++H+GID++ L+ K  K L      V+ G  VK G+ I  + L  L  +A+S I+P++  N   +      +  SG++  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYLAAPKARRPMVGGMLLSVAITAFLTGVTEPLEFLFMFLAPLLYL-LHAVLTGISLFIATALGI------------HAGFSFSAGAIDYVLMYSLPAA-SKNVWMLLVMGVVFFFVYFLLFSAVIRMFNLKTPGREDKAADVVTEEANSN--------TEEGLTQ---LATSYIAAVGGTDNLKAIDACITRLRLTVGDSAKVNDAACKRLGASGVVKLNKQTIQVIVGAKAESIGDEMKKVVTRGPVA------AAAAAPAGNVATAAPAAKPQA----VANAKTVESLV--SPITGDVVALEQVPDEAFASKAVGDGIAVKPTSNIVVAPAAGTVVKIFNTNHAFCLETNNGAEIVVHMGIDTVALEGKGFKRL------VEEGTDVKAGEPILEMDLDFLNANARSMISPVVCSNS--DDYSALVILASGKVVAGQTPLYEI 648
Score = 244, Expect = 2.0e-18, Identities = 76/257 (29%), Positives = 114/257 (44%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGD-AGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGIN-QLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+FAI +A +++ D AG AALA  +GY +                                            +  A++ IN ++   V  G + G +   +YN++  IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNV----------PFIAQAGGAIFDNLALIFAIGVASSWSKDNAGSAALAGAVGYFV--------------------------------------------MTKAMVTINPEINMGVLAGIITGLVAGAVYNRWAGIKLPDFLSFFGGKRFVPIATGFFCLILAAIFGYVWPPVQHAIHSGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGAV 211
>gi|171778869|ref|ZP_02919931.1| hypothetical protein STRINF_00790 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282515|gb|EDT47939.1| hypothetical protein STRINF_00790 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (726 aa)
Score = 522, Expect = 1.2e-50, Identities = 228/851 (26%), Positives = 371/851 (43%)
  Q:    35 KKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGD----AGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHA-------FYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVV-DTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKKGMPLFEV 885
           KK  + EF  K  K LM+ IA++P AG+ + +G+++      +  L   GN +   G  +   L +LFA+AI  ++  +    A  A +A  +  LI G +       + D+   V  +N+L           G   L S  +  V+G   L   VF G + GF+ A  YNK+ N  KL  ++ FFNG RFV         P  +++  +  LVG+ +              S ++  I+  +  FG+  A       F +P  Y         T   ++   G  + +      TSL    E++      +++      G   +W                    W    IN                   L  SN +     + T+    FK   VGQ +      M L L     AM      + +K   ++ +S    + LTG+TEPIEY F+F+A  L+  V+A +  + F L + + L + + G+ EL     M+   G+      G   I +        I  +    + +F+  F+IKKFN  TPGR  N       D  +    V   G++ S N+  V  +N++   GG DNI++VDAC+T+LR+ +KD + V D     + GA G I      V AV+G +ADI+K +I+ L+++ +  P               T   +EVK   +V K   +   E V+  S   GE+  +  V D  FS  MMG G AV+P  G +Y+P+ G ++ VF T HA+   T+ G ++L+H+G+D++ L         PF+  V  G  V+ G  +    LA +  A    T I+    + E + +  L ++G++    P+ +V
  S:     6 KKLTSFEFWQKFGKCLMVVIAVMPAAGLMVSIGNSLSLINADSAVLATVGNVIAQIGWGIINNLHILFALAIGGSWAKERAGGAFAAGIAFILINLITGHIYGVSLDMIADSKSVV--HNVL-----------GGKMLVSDYFVNVLGQPALNMGVFVGIISGFVGATAYNKYYNYRKLPDVLSFFNGKRFV---------PFVVIYRSV--LVGLFM--------------SLVWPIIQSGINGFGMWIASSQDSAPFLAPFLYG--------TLERLLLPFGLHHMITIPMNYTSLGGTYEILTGAQKGTEVF-----GQDPLWL------------------AWVTDLIN-------------------LKGSNPSDYHHLMATVTPARFK---VGQMIGATGTLMGLSL-----AMYRNVDPDKKKKYTAMFISTAAATFLTGVTEPIEYMFMFVAMPLYV-VYALVQGVTFALSDLVNLRLHSFGNIELLTRTPMALKAGL------GGDLINF-------VICSILSGVVMYFIADFMIKKFNFATPGRNGNY------DDMDDDTAVSTTGATVSANSQIVQIINLL---GGRDNIEDVDACMTRLRVTVKDVARVGDEETWKKAGAMGLIIKG-SGVQAVYGPKADILKSDIQDLLDSGAEIP---------------TIDLAEVK-GNDVTKVSYKGVTEDVL--SIADGEVKPITAVKDPVFSSKMMGDGFAVEPENGNVYAPVSGIVTSVFPTKHAFGLLTDSGLEVLVHIGLDTVALNG------VPFSVKVAEGQRVQEGDLLVVADLAAISSAGRETTIIVAFTNTAEIKAVN-LTQTGKVSAKTPVAKV 724
>gi|168183182|ref|ZP_02617846.1| PTS system, glucose family, IIABC component [Clostridium botulinum Bf] >gi|182673589|gb|EDT85550.1| PTS system, glucose family, IIABC component [Clostridium botulinum Bf] (651 aa)
Score = 520, Expect = 2.3e-50, Identities = 150/457 (32%), Positives = 237/457 (51%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLF-WGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIK 877
           G ++  ++  ++ GLP AA AM+ AA K+NRK A+SI +SA   S  TGITEPIE+ F+F+AP LF + V A+  A         G++ S          +G +FS   ID+I+      ++  N    F  G+ Y  +YF +FY+LI K +I+T GR     +  KE+ + K N+                A  ++ A GG  NI N+D CIT+LR+ +KD+  +D A L ++   G ++ + +    + G EA+ IK +I+ +++             K MN              KE+++ +  L      + +P  GEIV+L +VPDE FS+ ++G G A+KP   K+YSP+DG +  +F + HA + ETE+G +ILIH+GID++NL  +  K        +K G  +     +   K    + AKS I+PI++ N          LK+S E+K
  S:   260 GVFMASEFPILMFGLPGAAIAMICAAEKQNRKKALSIMLSAALVSFFTGITEPIEFAFIFVAPILFIFHVAAAFTA---------GIVTSI-----FNIKLGYTFSASFIDYIL----GYKFSQNGLLIFPIGIFYFLLYFIVFYYLIIKKDIKTLGR---EGIILKENKEIKSNEK---------------AALILEALGGEKNIINLDCCITRLRVALKDEKKLDRAYLEKINLLGIVQ-TGKVAQIILGTEAENIKYSIEQIIK-------------KGMN-------------PKEIIEYERALK-----LMNPMEGEIVALEEVPDEVFSEKLLGDGFAIKPYKNKVYSPVDGAIKFLFPSNHALAIETEEGLEILIHIGIDTVNLNGEGFKVYIKEKEKIKKGQLL-----VSYDKEFLGREAKSLISPIVITN----------LKESSEVK 634
Score = 248, Expect = 8.2e-19, Identities = 85/258 (32%), Positives = 129/258 (50%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSID 295
           N    + ++ K LMLP+++LP A I L +G   + N            ++   G+A+F  LPL+FAI +++  +   G AALA  +G L+   LQ  L+  V  +  A      +  Q N+       A + S  Y  ++    +   VFGG ++G + A +YNK+KNIKL   IGFF G RFV I+T +  F   ++ + IWP V   + TF        +G   +  G  +R L+P GLHH +Y P  Y Q G  +D
  S:     3 NILTILQRVGKSLMLPVSVLPAAAILLRLGYPDLLN----------NMYMLKAGDAIFSNLPLIFAIGVSVGLSDGEGIAALAAIVGQLM---LQGILN--VGSSKAAKEAAIKIAAQRNM----TSEAFMNSKFYDDILRSTNIDLGVFGGIIIGIIAAIIYNKYKNIKLPSTIGFFGGKRFVLILTAIISFMFGMINVAIWPGVQKNIDTFARFETTSPLGPAFYAAG--KRLLIPLGLHHIYYPPFLY-QFGSYVD 239
>gi|29376082|ref|NP_815236.1| PTS system, IIABC components [Enterococcus faecalis V583] >gi|29343544|gb|AAO81306.1| PTS system, IIABC components [Enterococcus faecalis V583] (665 aa)
Score = 518, Expect = 3.9e-50, Identities = 144/493 (29%), Positives = 243/493 (49%)
  Q:   366 SSGWTYSAINGTYDNASIASSSNGAIQSVLTWS--------NLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLC--ALAFG-LMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVL 858
           S G+  + + G ++   I +  + A+ SV  +         N  +GQQAL T       G   G Y  G +  M+ GLPA A A+   A  E +K+  S+ ++AGF +  TG+TEP+E++F+F+A W  + +HA     +LAF   M+W                 G +FS G +D+ +  +++    ++     + GL +A IY+F F F I KFN+ TPGR E     T +              +E  N    LA  +    G   N+ ++D C T+LR+ +KD   VD AK+   G  G       ++  + G E   +                   E +++ N+ +  +   E    + VV+  + +S ++  + S   G+++ +++VPD+ FS  MMG G AV PT G++ +P+ GK++ +F T HA   +T+ G ++L+H+G+D++ L+        PF  +V+ G  VK G +I T+ LA L+ A      I+V 
  S:   189 SLGFVGAGLYGFFNRLLIPTGLHHALNSVFWFDVAGINDIGNFLAGQQALDT--GKAIVG-QTGMYQAGFFPVMMFGLPAGAFAIYQCARPEKKKVTASLMLAAGFAAFFTGVTEPLEFSFMFVA-WPLYVLHAVFTGISLAFAAFMHWTA---------------GFAFSAGFVDFFL--SLKNPVANHPMMLVVQGLVFAAIYYFGFRFAITKFNLMTPGREEGDGEETPD-------------VAEGDNKFASLARRIYDGLGADANVTSIDNCTTRLRLTVKDTGKVDQAKIKATGVPGVKVIDDTNIQVIVGTEVQFVA-----------------DEMQRLYNHQAPATPVKETPVSQSVVEEKAPVSTKETELYSVANGKVIPISEVPDDVFSAKMMGDGFAVVPTDGEVSTPVAGKITSIFPTKHALGIQTDSGIEVLLHMGLDTVELQG------GPFTLHVEEGQVVKQGDKIATIDLAALEQAGKKSDLIVVF 635
Score = 267, Expect = 4.4e-21, Identities = 74/252 (29%), Positives = 125/252 (49%)
  Q:    40 KEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           K ++ ++ + LMLP+A+LP A + +G+ + IV   G +        FL   G A+   L LLFA+ +A+  + D  G AALA  + YL+  ++    S        A+ G+           ++  N A            N + ++VF G V G + A +YN+F  +KL   + FF+G R VPI++ +++  ++ +    WP+V   L   G+ +     + + ++GF  R L+P GLHHA  S  W+  AG
  S:     2 KAYMQRMGRSLMLPVAVLPAASLLVGIANWIVGTIGASPAT----TFLMNGGLAILNNLALLFAVGLALGMSKDKDGSAALAGLVAYLVPKTVLAPAS------IQAIKGFK---------DIAEVNPAF-----------NSMDNNVFVGIVAGLVAAAMYNRFSGVKLPMALSFFSGKRLVPIMSAISMLAISAVLFFFWPVVYNGLVAFGKGISSLGFVGAGLYGFFNRLLIPTGLHHALNSVFWFDVAG 224
>gi|187779733|ref|ZP_02996206.1| hypothetical protein CLOSPO_03329 [Clostridium sporogenes ATCC 15579] >gi|187773358|gb|EDU37160.1| hypothetical protein CLOSPO_03329 [Clostridium sporogenes ATCC 15579] (552 aa)
Score = 517, Expect = 5.3e-50, Identities = 188/653 (28%), Positives = 289/653 (44%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSA--GNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAK-LMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           K  K  + +F  K  K L++ +A++P AG+ + +G  I   A     L+     ++  G A+ G L +LFA+AI  ++  +    A A  + +++   +           TGA+ G     +      +++  G   +    +  ++G   L   VF G + GFL A+LYNK+ N  KL   + FFNG RFVP V  L      I+  MIWP +  AL   G+ +      A  +  FIFG +ER L+PFGLHH    PL YT  GG+               Y +L   TA ++                     AG   +W                    W    IN                  +    N+T     L T+    FK   VGQ +          L   A AM     K+ R    ++ +SA     LTG+TEPIE+ F+F++P L+ GV+A +   AF L + I L V   G  E      M    G+   ++  A             I  + Y  + + +F FLIKKFNI TPGR  N  +  + +  NK+ KV    + +  N D  L + ++S  G  +NI +VDAC+T+LR+ +KD+S+V   K   +LGA G I    + V A++G +AD++K +I+ ++
  S:     2 KRNKLISFDFWQKFGKTLLVVVAVMPAAGLMICIGKLIGMQASMGL-LQSVARVIEDIGWAIIGNLHILFAVAIGGSWAKERAGGAFAGLLTFILTNRI-----------TGAIFGVKPDMFSDEAAKVTSMFGRQLVVKDYFTTILGAPALNMGVFIGIISGFLGAYLYNKYYNFNKLPKSLAFFNGKRFVPFVVILGSVVTAIILSMIWPSIQGALNAFGKWIATSKDTAPIVAPFIFGSLERILLPFGLHHMLTVPLNYTSLGGT---------------YKILTGPTAGTIV--------------------AGQDPLWL------------------AWANDLIN------------------LKAAGNMTEYNNLLTTVIPARFK---VGQVITSS-----ASLLGVAFAMYKNVDKDKRDKYKTVFLSAALAVFLTGVTEPIEFMFMFISPILY-GVYAVITGTAFALADLINLRVHCFGFVEFIARTPMMIKAGITKDMLNFA-------------IVSVIYFVLTYLIFNFLIKKFNIPTPGRAGNY-IEMEGEQDNKEEKV----TGKEANKDS-LPVKIISLLGEKENIIDVDACMTRLRVTVKDKSLVAEEKEWKRLGALGLIVKD-KGVQAIYGPKADVLKSDIQDIL 550
>gi|28379073|ref|NP_785965.1| N-acetylglucosamine and glucose PTS, EIICBA [Lactobacillus plantarum WCFS1] >gi|28271911|emb|CAD64816.1| N-acetylglucosamine and glucose PTS, EIICBA [Lactobacillus plantarum WCFS1] (662 aa)
Score = 516, Expect = 6.2e-50, Identities = 147/512 (28%), Positives = 265/512 (51%)
  Q:   347 MWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGAN-GFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFG---LMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVL--ALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLME-NISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVL 858
           +W F+   ++  +  + +L  G+  + + G ++   I +  + A+ SV  W N+ +G   +G   A+ G KG+  G Y  G +  M+ GLPA A A+   A  E +K   S+ ++  F S  TG+TEP+E++F+F+A W  + +HA    L+ G   LM+W                   SFSGG++D+++  + ++   +  +   + GL  A IY+F F F IK+FN++TPGR          D  +          + +  +D+ +  A  + +A GG DNI  ++ C T+LR+Q+KD   VD   +M  G  G       +++ V G E   +   ++ L    ++++P            +SD  S + V+P+   V T++ ++    ++ +P TG+++ ++ V DETF+  ++G G AV+P  G++ +P+ G ++ VF T HA   +T  G ++L+H+GI+++ +         PF  +V TGD +  G  + TV LA +K A    T ++V+
  S:   168 VWPFVYDAIVLFATGISKL--GFVGAGLYGFFNRLLIPTGLHHALNSVF-WYNV-AGINDIGNFWASHGVKGIT-GMYEAGFFPIMMFGLPAGAYAIYRNARPERKKEVGSLMLAGAFASFFTGVTEPLEFSFMFVA-WPLYLLHAVFMGLSLGFAALMHWTA---------------SFSFSGGLVDYLL--SFRMPLANQPYMLLVQGLVMAVIYYFGFDFAIKRFNLKTPGRE-----VVSADV-DGVGAPASPAVAVAATDDKYMRQAKQIYAAIGGHDNISVINNCTTRLRLQLKDTEKVDQPAVMAAGVPGLNVLDVHNIHIVIGTEVQFVAEALQKLFSGQVATTP------------ASDAESKAPVEPQTATV-TEAPVT---TILRAPATGQLMPISTVADETFAGKLLGDGYAVEPEDGEVVAPVSGTVTSVFPTKHAIGLKTTSGLEVLLHMGINTVEMNG------TPFKLHVATGDEIAAGTAVATVDLAAIKSAGKATTMMVVI 635
Score = 251, Expect = 3.7e-19, Identities = 77/252 (30%), Positives = 112/252 (44%)
  Q:    40 KEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGIN----QLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           K +  K+ + LMLPIA LP A I +G+G+ +           +F N+L   GN V   L LLFA+ +AI                             SV     A I   + F    +  +    A L + L   V  IN     L ++V  G   G + A LYN+F  +KL   + FF+G R VPI+    +  VT +  ++WP V  A+      + +   + + ++GF  R L+P GLHHA  S  WY  AG
  S:     2 KTYFQKIGQSLMLPIATLPAAAILVGIGNYLPKQW-------LFANYLIQGGNVVLNNLALLFAVGLAIGM---------------------------SVNKDGAAAIAGLIAF---EVPVMVLKPATLATMLNVKVSQINPAFSALDNNVLIGISAGLIAAALYNRFHEVKLPMALSFFSGKRLVPIMAAFVMLIVTAVLYLVWPFVYDAIVLFATGISKLGFVGAGLYGFFNRLLIPTGLHHALNSVFWYNVAG 220
>gi|1172714|sp|P42015|PTG3C_BACST PTS system glucose-specific EIICBA component (EIICBA-Glc) (EII-Glc/EIII-Glc) [Includes: Glucose permease IIC component (PTS system glucose-specific EIIC component); Glucose-specific phosphotransferase enzyme IIB component (PTS system glucose-specific EIIB component); Glucose-specific phosphotransferase enzyme IIA component (PTS system glucose-specific EIIA component)] >gi|529001|gb|AAA86047.1| PTS glucose-specific permease (324 aa)
Score = 514, Expect = 1.2e-49, Identities = 132/360 (36%), Positives = 195/360 (54%)
  Q:   520 IGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           IGM+FSGG+ID++++G +       AWW  I  GL +A IY+F F F I+K+++ TPGR +      K +     +                L   V++A GG +NI+++DACIT+LR+ + D   VD  +L  LGA G ++    +V A+FG ++D++KG I+ +M+                       + +E KP     KT +  + E   + SP +GEIV LA+VPD+ FS+ MMG G AV PT G + SP+DGK+  VF T HA   ++  G +ILIHVGID++ L  +       F   VK GD VK GQ I  V L  +K +A S +TP+I  N  L+  E   + K G + +G
  S:     7 IGMTFSGGVIDFLLFGVLP---NRTAWWLVIPVGLVFAVIYYFGFRFAIRKWDLATPGREKTVEEAPKAEAAAAGD----------------LPYEVLAALGGKENIEHLDACITRLRVSVHDIGRVDKDRLKALGAAGVLEVG-NNVQAIFGPKSDMLKGQIQDIMQ-------------------GKAPARAEEKP-----KTAASEAAESETIASPMSGEIVPLAEVPDQVFSQKMMGDGFAVMPTDGTVVSPVDGKIINVFPTKHAIGIQSAGGHEILIHVGIDTVKLNGQG------FEALVKEGDEVKKGQPILRVDLDYVKQNAPSIVTPVIFTN--LQAGETVHVNKQGPVARG 316
>gi|182419369|ref|ZP_02950621.1| pts system, iibc component [Clostridium butyricum 5521] >gi|182376700|gb|EDT74272.1| pts system, iibc component [Clostridium butyricum 5521] (551 aa)
Score = 511, Expect = 2.5e-49, Identities = 196/649 (30%), Positives = 299/649 (46%)
  Q:    37 GNTK------EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYL--------IFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMI----DWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAK-LMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           GN+K      EF  K  K LM+ +A++P AG+ + +G  ++   G    L+   N ++  G  + G L +LFA+AI  ++  +    A A  I ++        IFG   D LS     T  ++ G NL+   GN F    GN AL                 VF G + GFL A LYNK+ N  KL   + FFNG RFVP V         I+  ++WP     L   G  L +    A  I+ FI+G +ER L+PFGLHH    P+ YT+ GG                Y V+  +   S+ S                    G   +W            W+ +L +      + G  D A              T++NL      L T+    FK         G+ +     L  AA AM     ++ +K   S+ +SAG    LTG+TEP+E+ F+F++P L+ G++A +  + F + + I + + A G  E    I M    G+I    +++I   I             FGL Y     F+F FLIKK N+ TPGR  N      E+   K+  V     ++   ND  LA+ ++S  G  DNI +VDAC+T+LR+ +KD+++V   K   Q GA G +    + + A++G +AD++K +I+ ++
  S:     2 GNSKGKLFSFEFWQKFGKALMVVVAVMPAAGLMICIGK-LIGMCGDLSLLKTVANVVEQLGWGIIGNLHVLFAVAIGGSWAKERAGGAFAALIAFILINLTTGSIFGVTSDMLSDP-NATVTSLFGQNLIV--GNYFTSILGNPAL--------------NMGVFVGIISGFLGASLYNKYYNFNKLPNALSFFNGKRFVPFVVIAGSVVTAIILAIVWPFAQSGLNAFGMWLAKSKDTAPIISPFIYGCLERLLLPFGLHHMLTIPVNYTELGG---------------VYTVMTGANTGSIIS--------------------GQDPLW----------YAWISDLIN------LKGAGDTA--------------TYNNL------LATVTPARFKF--------GQVILSSASLIGAALAMYRNVDEDKKKKYKSMFLSAGLAVFLTGVTEPLEFMFMFVSPILY-GIYAVIAGIGFAVADLINVRIQAFGFVEFLTRIPMFAKAGIIMDVVNFVICAVI------------FFGLNY-----FVFNFLIKKLNLATPGRRGN--YIEDEEETGKEAAV-----TKVSGND--LAVKIISLLGEKDNIVDVDACMTRLRVTVKDKALVAGEKEWKQNGAMGLVVKD-KGIQAIYGPKADVLKSDIQDIL 549
>gi|156973633|ref|YP_001444540.1| PTS system, N-acetylglucosamine-specific IIABC component [Vibrio harveyi ATCC BAA-1116] >gi|156525227|gb|ABU70313.1| hypothetical protein VIBHAR_01336 [Vibrio harveyi ATCC BAA-1116] (524 aa)
Score = 503, Expect = 1.8e-48, Identities = 182/647 (28%), Positives = 281/647 (43%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWII-YGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTL 684
           N   +  KL K LMLPIA LP+A + L +G   + +            F+   GNA+F  LPLLF + IAI  + D   AA                                        F L+A  A + +S+            S FGG + G +    YN F   +L   + FF+G R VPI+  L       +  ++WP +   L  L  A+  +  I  F++G + RAL+P GLHH   S  W+      +   Q  ++          AT+   +L + ++L   ++P    T+   AG    + F N+     +  +KE++                  +  +G +           G ++ G    NGF            +  M+ GLP AA AM +AAP E R        S  F S LTGITEP+E+ F+FLAP L+  +HA    L+  + N +G     T H       G  FS G+ID+++ YG       +     F  GL +  +YFF F F I+ FN+++PGR            ++  N+     + ++   D  LA   + A GG DN+ ++DACIT+LR+ +KD+SV D A L +LGA+G +K    ++  + G  A+I+ G +K +
  S:     2 NILGYAQKLGKALMLPIATLPVAALLLRLGQPDLLDIA----------FMASAGNAIFSQLPLLFGLGIAIGLSKDGQGAAGL--------------------------------AGAVAYFVLTATAATIDASV----------NMSFFGGIIAGIIAGHSYNAFHATRLPEWLAFFSGKRLVPIMAGLFSLVAGAIAGVVWPTIQGGLDALAHAVSTSGAIGQFVYGTLNRALIPVGLHHVLNSYFWF-----GMGTCQEVLVSG--------ATAAGQALPALQQL--CVDPALAKTL--VAGQTHTFEFANSVTPEITATVKEVTE-----------------TLKSGDLHRFF------GGDKSAGVF-MNGF------------FPVMMFGLPGAALAMYLAAPVEKRSQVGGALFSVAFCSFLTGITEPLEFMFVFLAPALY-AIHAVFTGLSLVIANMLG-----TLH-------GFGFSAGLIDFVLNYG-----LATKPLVLFAVGLGFGALYFFTFSFAIRAFNLKSPGR------------EDDDNETAAAPAGDAAKGD--LARQYLKALGGHDNLTSIDACITRLRLTLKDRSVADEAVLKKLGAKGVVKLGENNLQVILGPLAEIVAGEMKAI 512
>gi|153834087|ref|ZP_01986754.1| pts system, N-acetylglucosamine-specific iibc component [Vibrio harveyi HY01] >gi|148869552|gb|EDL68547.1| pts system, N-acetylglucosamine-specific iibc component [Vibrio harveyi HY01] (524 aa)
Score = 503, Expect = 2.0e-48, Identities = 182/647 (28%), Positives = 281/647 (43%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWII-YGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTL 684
           N   +  KL K LMLPIA LP+A + L +G   + +            F+   GNA+F  LPLLF + IAI  + D   AA                                        F L+A  A + +S+            S FGG + G +    YN F   +L   + FF+G R VPI+  L       +  ++WP +   L  L  A+  +  I  F++G + RAL+P GLHH   S  W+      +   Q  ++          AT+   +L + ++L   ++P    T+   AG    + F N+     +  +KE++                  +  +G +           G ++ G    NGF            +  M+ GLP AA AM +AAP E R        S  F S LTGITEP+E+ F+FLAP L+  +HA    L+  + N +G     T H       G  FS G+ID+++ YG       +     F  GL +  +YFF F F I+ FN+++PGR            ++  N+     + ++   D  LA   + A GG DN+ ++DACIT+LR+ +KD+SV D A L +LGA+G +K    ++  + G  A+I+ G +K +
  S:     2 NILGYAQKLGKALMLPIATLPVAALLLRLGQPDLLDIA----------FMASAGNAIFSQLPLLFGLGIAIGLSKDGQGAAGL--------------------------------AGAVAYFVLTATAATIDASV----------NMSFFGGIIAGIIAGHSYNAFHATRLPEWLAFFSGKRLVPIMAGLFSLVAGAIAGVVWPTIQGGLDALAHAVSTSGAIGQFVYGTLNRALIPVGLHHVLNSYFWF-----GMGTCQEVLVSG--------ATAAGQALPALQQL--CVDPALAKTL--VAGQTHTFEFANSVTPEITATVKEVTE-----------------TLKSGDLHRFF------GGDKSAGVF-MNGF------------FPVMMFGLPGAALAMYLAAPVEKRSQVGGALFSVAFCSFLTGITEPLEFMFVFLAPALY-AIHAVFTGLSLVIANMLG-----TLH-------GFGFSAGLIDFVLNYG-----LATKPLVLFAVGLGFGALYFFTFSFAIRAFNLKSPGR------------EDDDNEAAAAPAGDAAKGD--LARQYLKALGGHDNLTSIDACITRLRLTLKDRSVADEAVLKKLGAKGVVKLGENNLQVILGPLAEIVAGEMKAI 512
>gi|90577900|ref|ZP_01233711.1| PTS system, glucose-specific IIBC component [Vibrio angustum S14] >gi|90440986|gb|EAS66166.1| PTS system, glucose-specific IIBC component [Vibrio angustum S14] (540 aa)
Score = 501, Expect = 3.4e-48, Identities = 181/641 (28%), Positives = 280/641 (43%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNL-LFYQGNIFGLSAGNAALP-SSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALT----FLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVV-DTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNI 681
           +F  +  K L++ IA++P AGI + +G  +   AGG   L   G+ ++  G  +   L LLFA+AI  ++  +    A A  I +++           +  TTG + G N  +    N    S     LP +  +  ++G   L   VF G + G+L A LYN++ +  +L   + FFNG RFVP V       +  +  +IWPLV  AL     ++  +   A  I  F++G +ER L+PFGLHH    P+ YT+                G AY +L                   PN+  +V    G   +W            W+ +L++                           L  ++    QQ L T+    FK   VGQ +      + +GL     AM  +   + R     + +SA    LLTG+TEPIE+ F+F+AP L+   HA    +AF L ++I L + A G  EL   + M  S G+             GS+     I  + +  + + LF  LI KFN+ TPGR  N                 I+  S++++ D  L + ++   GG DNI  +DAC+T+LRI +KD S+V D       GA G +    Q V A++G   D+IK  +
  S:     8 DFWQRFGKSLIVVIAVMPAAGIMISLGKVLAMYAGGLGALETLGHIMENIGWGIIVNLHLLFAVAIGGSWAKERAGGAFAALIAFIL-----------INRTTGVIFGVNTSMMTDPNAIVTSLFGTDLPVTQFFTTILGAPALNMGVFIGIISGYLGANLYNRYYDYSRLPEALAFFNGKRFVPFVVIFYSVIIAFVLAVIWPLVQGALNDFGLWIASSKDSAPIIAPFVYGTLERLLLPFGLHHTLTIPMNYTEL---------------GGAYQLLT-----------------GPNAGTSV---YGQDPLWL----------AWVSDLNN---------------------------LKLTDPAMYQQLLDTVHPARFK---VGQVIIATSSLIGIGL-----AMYHSVDHDKRLQYKPMFLSACLAVLLTGVTEPIEFMFMFIAPVLYVA-HALFTGIAFALADFIDLRIHAFGLIELLTRVPMMISAGI-------------GSDLISFIIVCIVFFAVNYGLFRLLIVKFNLPTPGRAGN----------------YIDEKSDTMSQDDKLEI-IIQNLGGRDNISEIDACMTRLRITVKDPSLVADYTLWKSTGAMGLVVKE-QGVQAIYGPGVDVIKSGL 533
>gi|28897605|ref|NP_797210.1| PTS system, N-acetylglucosamine-specific IIABC component [Vibrio parahaemolyticus RIMD 2210633] >gi|153838386|ref|ZP_01991053.1| pts system, N-acetylglucosamine-specific iibc component [Vibrio parahaemolyticus AQ3810] >gi|28805817|dbj|BAC59094.1| PTS system, N-acetylglucosamine-specific IIABC component [Vibrio parahaemolyticus RIMD 2210633] >gi|149748245|gb|EDM59104.1| pts system, N-acetylglucosamine-specific iibc component [Vibrio parahaemolyticus AQ3810] (523 aa)
Score = 491, Expect = 5.5e-47, Identities = 182/650 (28%), Positives = 280/650 (43%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIG-YLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWII-YGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           N   +  KL K LMLPIA LPIAG+ L +G   V +            F+   GN++F  LPLLF + IAI  + D   AA       Y +  +    +  SV          N+ F+ G I G+ AG++                                 YN F   +L   + FF+G R VPI+  L       +  ++WP +   L  L   +  +  I  F++G + RAL+P GLHH   S  W+        L                AT+   +L + ++L   ++P    T+   AG    + F N+     +  +KE++                  +  +G +           G ++ G    NGF            +  M+ GLP AA AM +AAP E R        S  F S LTGITEP+E+ F+FLAP L+  +HA    L+  + N +G     T H       G +FS G+ID+++ YG       +        GL +  +YFF F F I+ FN+++PGR ++             +      + E+ + D  LA   + A GG DN+ ++DACIT+LR+ +KD+SV D   L +LGA+G +K    ++  + G  A+I+ G +K +  N
  S:     2 NILGYAQKLGKALMLPIATLPIAGLLLRLGQPDVFDIA----------FMAQAGNSIFSNLPLLFGLGIAIGLSKDGQGAAGLAGAVAYFVLTATASTIDASV----------NMSFFGGIIAGIIAGHS---------------------------------YNAFHATRLPEWLAFFSGKRLVPIMAGLFALVAGAVSGIVWPTIQGGLDALAHGISTSGAIGQFVYGTLNRALIPVGLHHVLNSFFWFGMGSCQEVLVSG-------------ATAAGQALPALQQL--CVDPALAKTL--VAGQTHTFEFANSVTPEITATVKEVTE-----------------TVKSGDLHRFF------GGDKSAGVF-MNGF------------FPVMMFGLPGAALAMYLAAPVEKRSQVGGALFSVAFCSFLTGITEPLEFMFVFLAPALY-AIHAVFTGLSLVVANMLG-----TLH-------GFTFSAGLIDYLLNYG-----LATKPLLLGAVGLGFGALYFFTFSFAIRAFNLKSPGREDD-------------DSQAAAPAGEAKSGD--LARQYLKALGGHDNLTSIDACITRLRLTLKDRSVADEEVLKKLGAKGVVKLGENNLQVILGPLAEIVAGEMKAIGAN 514
>gi|69245514|ref|ZP_00603478.1| Sugar-specific permease, EIIA 1 domain:PTS system, N-acetylglucosamine-specific IIBC component:PTS system, glucose-like IIB component [Enterococcus faecium DO] >gi|68195765|gb|EAN10202.1| Sugar-specific permease, EIIA 1 domain:PTS system, N-acetylglucosamine-specific IIBC component:PTS system, glucose-like IIB component [Enterococcus faecium DO] (652 aa)
Score = 488, Expect = 1.0e-46, Identities = 150/512 (29%), Positives = 246/512 (48%)
  Q:   365 LSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEK---EVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLN-----ESLE---GREIKFLKKSGEI 876
           LS GW  + + G ++   I +  + A+ SV  W ++         + + G KGV  G Y  G +  M+ GLPA A A+   A  EN+    S+ ++A F S  TG+TEP+E++F+F+A W  + +HA        +   I L VSA  H       G +FS G +D+ +  +++    +      + GL  A IY+F F F IKKF++ TPGR E           N  NK     S             + +A GG DN+ ++D C T+LR+Q+KD  ++D  K+   G  G      ++   + G E   +   +  L    ++ P                 + + VK E    E ++ D         + +   G+++ + +V D+ F++ MMG G AV P  G+I+SPI G ++ +F T HA   +T+ G ++L+H+GI++++LK       +PF   V+ G  V  GQ I  V LA ++ A      ++V       +SLE    R++K   K G +
  S:   185 LSLGWGGAGLYGFFNRLLIPTGLHQAMNSVF-WFDVAGINDIGKFLASEGTKGVT-GMYQAGFFPIMMFGLPAGAYAIYRNARPENKAKTASLMLAAAFASFFTGVTEPLEFSFMFVA-WPLYVLHA--------IFTGISLAVSAFFHWT----AGFAFSAGFVDYFL--SLKNPIANQPLMLIVQGLVTAVIYYFGFNFAIKKFHLMTPGREEADLSDDDTATTNSDNKYAAQAS------------KIYAALGGADNVTSIDNCTTRLRLQVKDTGLIDQNKIKATGVPGMKIIDGKNAQVIVGTEVQFVADEMAKLHGGAAARP---------------AQTNTVVKTETFAGETIEQD---------IYAIANGKLIPITEVSDDVFAEKMMGDGYAVLPENGEIFSPIAGTITNIFPTKHAVGIQTDAGIEVLLHMGINTVDLKG------EPFTLYVEEGQKVARGQLIALVDLAAIQSAGKNTDMVVVFTNGDKVQSLEIEPARDVKANDKIGSV 648
Score = 251, Expect = 3.4e-19, Identities = 72/252 (28%), Positives = 118/252 (46%)
  Q:    40 KEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           K ++ ++ + L LP+A+LP A + +G+G     N   +    +  +FLQ  GNAV G LPLLFA+ +A+  + D   AA           + +  ++   TD+   ++                     P S+  +   I    S+VF G + G + A LYN+F   KL   + FF+G R VPI+    +  ++ + L++WP V  AL    + +       + ++GF  R L+P GLH A  S  W+  AG
  S:     2 KAYLQRMGRSLQLPVAVLPAAALLVGIG-----NWWASYSNDIVAHFLQAGGNAVLGQLPLLFAVGLALGMSVDKSGAAAL-----AGLVAFEVPVNVLKTDSVATLLNIK------------------PESVDPSFAQI----SNVFIGIIAGLIAAALYNRFHEAKLPMALSFFSGKRLVPILAAFVMLLISAVLLLVWPPVYSALVSFAKFILSLGWGGAGLYGFFNRLLIPTGLHQAMNSVFWFDVAG 221
>gi|169351424|ref|ZP_02868362.1| hypothetical protein CLOSPI_02204 [Clostridium spiroforme DSM 1552] >gi|169291646|gb|EDS73779.1| hypothetical protein CLOSPI_02204 [Clostridium spiroforme DSM 1552] (700 aa)
Score = 484, Expect = 3.6e-46, Identities = 145/462 (31%), Positives = 232/462 (50%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRG---ENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKG 879
           V   +Y  G+++FMI GLP AA AM   A  +N+K    + +SA  TS+ TGITEPIE++F+F+AP LF GV   L   A+ + + + + V            G++FSGG+ID+I++G +Q Q  +N       G+ Y  +Y+ +F +LI K+N++T GR    E T     E  K++ N V +             ++ V+   GG  N K +D C+T+LR  I D + +D   L Q GA G +  S + +  ++G  A IIK  ++  +E                NN  D   +S V         D+ + +   +VN    G +  L+   DE  +K ++G G+ + P    I SP  GK++++F T HA     E   ++LIH GI+++ L   +GK  + F   V+    V  G  +  V L  +K +A S    IIV+N S   ++ +F+K  G  ++G
  S:   288 VEATRYFTGEFIFMIFGLPGAALAMYQCADSKNKKACGGLLLSAALTSMFTGITEPIEFSFIFVAPILF-GVQVLLAGSAYMVAHILNITV------------GLTFSGGLIDFIMFGVLQGQSKTNWMMIIPVGIVYFLLYYIIFKYLIIKYNLKTLGRDGYQEITVFKNSEKSKDENNTVDLQ------------SVYVIKGLGGRSNFKELDCCVTRLRATILDMNKIDEGLLKQSGAAGVV-CSGEVIQVIYGPRASIIKAKLEEYLE----------------NNRDDDIESSIV---------DNNIYELNSIVN----GVVKELSDSKDEMVAKKLLGDGLIILPEDNIIRSPCKGKITMIFPTKHAIGITLENNLELLIHFGINTVAL---NGKGFELF---VENNQDVMPGDILWKVDLDYIKANAVSEEIMIIVINAS---KDTEFVKLYGYKEQG 689
Score = 340, Expect = 1.7e-29, Identities = 80/252 (31%), Positives = 130/252 (51%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNA-----------GGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSI 294
           + ++ K  MLPIA+LPIAG+  G+  A+   +           G    +  F   L+   +A+F  LPL+FA  +++     + G A L+  I + +  +  +++                L   G +      ++ +      ++ GI  L+   FGG +VG  V+FL+N++  I+   +  FF G RFVPI++ L    V I+   IWP++  ++  LG  +     I +FIFG I+R LVPFGLHH FY P W T  GG++
  S:    13 MQRIGKSFMLPIAILPIAGLLQGIAMALTNQSMIEAYQLESVLGEGTLIYSFMLILKNVASAIFDDLPLIFAAGVSLGMAKKEKGVAVLSAVIAFFVMHTTINSM----------------LMIDGQLLSDGTVSSDVIQGTITSMCGIQTLEMGAFGGILVGLGVSFLHNRYYKIEFPDVFSFFGGTRFVPIISTLVFIIVGIIMFYIWPIIQNSIYSLGHFITGTGYIGTFIFGIIKRCLVPFGLHHLFYLPFWQTAVGGTM 260
>gi|168180261|ref|ZP_02614925.1| PTS system, glucose/glucoside family, IIBC component [Clostridium botulinum NCTC 2916] >gi|182668665|gb|EDT80643.1| PTS system, glucose/glucoside family, IIBC component [Clostridium botulinum NCTC 2916] (552 aa)
Score = 483, Expect = 4.7e-46, Identities = 186/653 (28%), Positives = 287/653 (43%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGL-RVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSA--GNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMI-DWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAK-LMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           K  K  + +F  K  K L++ +A++P AG+ + +G  I   A  + GL +     ++  G A+ G L +LFA+AI  ++  +    A A  + +++   +           TGA+ G     +      +++  G   +    +  ++G   L   VF G + GFL A+LYNK+ N  KL   + FFNG RFVP V  L      I+  MIWP +  AL   G+ +      A  +  FIFG +ER L+PFGLHH    PL YT  GG+               Y +L   TA ++                     AG   +W                    W    IN                  +    N+T     L T+    FK   VGQ +          L   A AM     K+ R    ++ +SA     LTG+TEPIE+ F+F++P L+ GV+A +   AF L + I L V   G  E      M    G+  D + +  + + Y         F L Y      +F FLIKKFNI TPGR  N      E+ K ++   + +   +S      L + ++   G  +NI +VDAC+T+LR+ +KD+ +V   K   +LGA G I    + V A++G +AD++K +I+ ++
  S:     2 KRNKLVSFDFWQKFGKTLLVVVAVMPAAGLMICIGKLIGMQA--SMGLVQSVARVVEDIGWAIIGNLHILFAVAIGGSWAKERAGGAFAGLLTFILTNRI-----------TGAIFGVKPDMFSDEAAKVTSMFGRQLVVKDYFTTILGAPALNMGVFIGIISGFLGAYLYNKYYNFNKLPKSLAFFNGKRFVPFVVILGSVVTAIILSMIWPSIQGALNAFGKWIATSKDTAPIVAPFIFGSLERILLPFGLHHMLTVPLNYTSLGGT---------------YKILTGPTAGTIV--------------------AGQDPLWL------------------AWANDLIN------------------LKAAGNMTEYNNLLATVIPARFK---VGQVITSS-----ASLLGVAFAMYKNVDKDKRDKYKTVFLSAALAVFLTGVTEPIEFMFMFISPILY-GVYAVITGTAFALADLINLRVHCFGFVEFIARTPMMIKAGITRDMLNFAIVSVIY---------FVLTY-----LIFNFLIKKFNIPTPGRAGNYIEMEGEEDKKEEKISEKDIDRDS------LPVKIIGLLGEKENIVDVDACMTRLRVTVKDKGLVAEEKEWKKLGALGLIVKD-KGVQAIYGPKADVLKSDIQDIL 550
>gi|153939016|ref|YP_001390945.1| PTS system, glucose/glucoside family, IIBC component [Clostridium botulinum F str. Langeland] >gi|168182539|ref|ZP_02617203.1| PTS system, glucose/glucoside family, IIBC component [Clostridium botulinum Bf] >gi|152934912|gb|ABS40410.1| PTS system, glucose/glucoside family, IIBC component [Clostridium botulinum F str. Langeland] >gi|182674382|gb|EDT86343.1| PTS system, glucose/glucoside family, IIBC component [Clostridium botulinum Bf] (552 aa)
Score = 482, Expect = 5.2e-46, Identities = 186/653 (28%), Positives = 287/653 (43%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGL-RVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSA--GNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMI-DWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAK-LMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           K  K  + +F  K  K L++ +A++P AG+ + +G  I   A  + GL +     ++  G A+ G L +LFA+AI  ++  +    A A  + +++   +           TGA+ G     +      +++  G   +    +  ++G   L   VF G + GFL A+LYNK+ N  KL   + FFNG RFVP V  L      I+  MIWP +  AL   G+ +      A  +  FIFG +ER L+PFGLHH    PL YT  GG+               Y +L   TA ++                     AG   +W                    W    IN                  +    N+T     L T+    FK   VGQ +          L   A AM     K+ R    ++ +SA     LTG+TEPIE+ F+F++P L+ GV+A +   AF L + I L V   G  E      M    G+  D + +  + + Y         F L Y      +F FLIKKFNI TPGR  N      E+ K ++   + +   +S      L + ++   G  +NI +VDAC+T+LR+ +KD+ +V   K   +LGA G I    + V A++G +AD++K +I+ ++
  S:     2 KRNKLISFDFWQKFGKTLLVVVAVMPAAGLMICIGKLIGMQA--SMGLVQSVARVVEDIGWAIIGNLHILFAVAIGGSWAKERAGGAFAGLLTFILTNRI-----------TGAIFGVKPDMFSDEAAKVTSMFGRQLVVKDYFTTILGAPALNMGVFIGIISGFLGAYLYNKYYNFNKLPKSLAFFNGKRFVPFVVILGSVVTAIILSMIWPSIQGALNAFGKWIATSKDTAPIVAPFIFGSLERILLPFGLHHMLTVPLNYTSLGGT---------------YKILTGPTAGTIV--------------------AGQDPLWL------------------AWANDLIN------------------LKAAGNMTEYNNLLATVIPARFK---VGQVITSS-----ASLLGVAFAMYKNVDKDKRDKYKTVFLSAALAVFLTGVTEPIEFMFMFISPILY-GVYAVITGTAFALADLINLRVHCFGFVEFIARTPMMIKAGITRDMLNFAIVSVIY---------FVLTY-----LIFNFLIKKFNIPTPGRAGNYIEMEGEEDKKEEKISEKDIDRDS------LPVKIIGLLGEKENIVDVDACMTRLRVTVKDKGLVAEEKEWKKLGALGLIVKD-KGVQAIYGPKADVLKSDIQDIL 550
>gi|170757563|ref|YP_001781239.1| PTS system, glucose/glucoside family, IIBC component [Clostridium botulinum B1 str. Okra] >gi|169122775|gb|ACA46611.1| PTS system, glucose/glucoside family, IIBC component [Clostridium botulinum B1 str. Okra] (552 aa)
Score = 482, Expect = 5.4e-46, Identities = 186/653 (28%), Positives = 287/653 (43%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGL-RVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSA--GNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMI-DWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAK-LMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           K  K  + +F  K  K L++ +A++P AG+ + +G  I   A  + GL +     ++  G A+ G L +LFA+AI  ++  +    A A  + +++   +           TGA+ G     +      +++  G   +    +  ++G   L   VF G + GFL A+LYNK+ N  KL   + FFNG RFVP V  L      I+  MIWP +  AL   G+ +      A  +  FIFG +ER L+PFGLHH    PL YT  GG+               Y +L   TA ++                     AG   +W                    W    IN                  +    N+T     L T+    FK   VGQ +          L   A AM     K+ R    ++ +SA     LTG+TEPIE+ F+F++P L+ GV+A +   AF L + I L V   G  E      M    G+  D + +  + + Y         F L Y      +F FLIKKFNI TPGR  N      E+ K ++   + +   +S      L + ++   G  +NI +VDAC+T+LR+ +KD+ +V   K   +LGA G I    + V A++G +AD++K +I+ ++
  S:     2 KRNKLISFDFWQKFGKTLLVVVAVMPAAGLMICIGKLIGMQA--SMGLVQSVARVVEDIGWAIIGNLHILFAVAIGGSWAKERAGGAFAGLLTFILTNRI-----------TGAIFGVKPEMFADEAAKVTSMFGRQLVVKDYFTTILGAPALNMGVFIGIISGFLGAYLYNKYYNFNKLPKSLAFFNGKRFVPFVVILGSVVTAIILSMIWPSIQGALNAFGKWIATSKDTAPIVAPFIFGSLERILLPFGLHHMLTVPLNYTSLGGT---------------YKILTGPTAGTIV--------------------AGQDPLWL------------------AWANDLIN------------------LKAAGNMTEYNNLLATVIPARFK---VGQVITSS-----ASLLGVAFAMYKNVDKDKRDKYKTVFLSAALAVFLTGVTEPIEFMFMFISPILY-GVYAVITGTAFALADLINLRVHCFGFVEFIARTPMMIKAGITRDMLNFAIVSVIY---------FVLTY-----LIFNFLIKKFNIPTPGRAGNYIEMEGEEDKKEEKISEKDIDRDS------LPVKIIGLLGEKENIVDVDACMTRLRVTVKDKGLVAEEKEWKKLGALGLIVKD-KGVQAIYGPKADVLKSDIQDIL 550
>gi|148379568|ref|YP_001254109.1| PTS system, glucose/glucoside family, IIBC component [Clostridium botulinum A str. ATCC 3502] >gi|153931080|ref|YP_001383946.1| PTS system, glucose/glucoside family, IIBC component [Clostridium botulinum A str. ATCC 19397] >gi|153935681|ref|YP_001387492.1| PTS system, glucose/glucoside family, IIBC component [Clostridium botulinum A str. Hall] >gi|148289052|emb|CAL83142.1| PTS system, IIbc component [Clostridium botulinum A str. ATCC 3502] >gi|152927124|gb|ABS32624.1| PTS system, glucose/glucoside family, IIBC component [Clostridium botulinum A str. ATCC 19397] >gi|152931595|gb|ABS37094.1| PTS system, glucose/glucoside family, IIBC component [Clostridium botulinum A str. Hall] (552 aa)
Score = 482, Expect = 6.1e-46, Identities = 185/653 (28%), Positives = 288/653 (44%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGL-RVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSA--GNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMI-DWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAK-LMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           K  K  + +F  K  K L++ +A++P AG+ + +G  I   A  + GL +     ++  G A+ G L +LFA+AI  ++  +    + A  + +++   +           TGA+ G     +      +++  G   +    +  ++G   L   VF G + GFL A+LYNK+ N  KL   + FFNG RFVP V  L      I+  MIWP +  AL   G+ +      A  +  FIFG +ER L+PFGLHH    PL YT  GG+               Y +L   TA ++                     AG   +W                    W    IN                  +    N+T     L T+    FK   VGQ +          L   A AM     K+ R    ++ +SA     LTG+TEPIE+ F+F++P L+ GV+A +   AF L + I L V   G  E      M    G+  D + +  + + Y         F L Y      +F FLIKKFNI TPGR  N      E+ K ++   + +   +S      L++ ++   G  +NI +VDAC+T+LR+ +KD+ +V   K   +LGA G I    + V A++G +AD++K +I+ ++
  S:     2 KRNKLVSFDFWQKFGKTLLVVVAVMPAAGLMICIGKLIGMQA--SMGLVQSVARVVEDIGWAIIGNLHILFAVAIGGSWAKERAGGSFAGLLTFILTNRI-----------TGAIFGVKPDMFSDEAAKVTSMFGRQLVVKDYFTTILGAPALNMGVFIGIISGFLGAYLYNKYYNFNKLPKSLAFFNGKRFVPFVVILGSVVTAIILSMIWPSIQGALNAFGKWIATSKDTAPIVAPFIFGSLERILLPFGLHHMLTVPLNYTSLGGT---------------YKILTGPTAGTIV--------------------AGQDPLWL------------------AWANDLIN------------------LKATGNMTEYNNLLATVIPARFK---VGQVITSS-----ASLLGVAFAMYKNVDKDKRDKYKTVFLSAALAVFLTGVTEPIEFMFMFISPILY-GVYAVITGTAFALADLINLRVHCFGFVEFIARTPMMIKAGITRDMLNFAIVSVIY---------FVLTY-----LIFNFLIKKFNIPTPGRAGNYIEMEGEEDKKEEKISEKDIDRDS------LSVKIIGLLGEKENIVDVDACMTRLRVTVKDKGLVAEEKEWKKLGALGLIVKD-KGVQAIYGPKADVLKSDIQDIL 550
>gi|170759422|ref|YP_001787008.1| PTS system, glucose/glucoside family, IIBC component [Clostridium botulinum A3 str. Loch Maree] >gi|169406411|gb|ACA54822.1| PTS system, glucose/glucoside family, IIBC component [Clostridium botulinum A3 str. Loch Maree] (552 aa)
Score = 478, Expect = 1.5e-45, Identities = 186/653 (28%), Positives = 286/653 (43%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGL-RVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSA--GNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMI-DWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAK-LMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           K  K  + +F  K  K L++ +A++P AG+ + +G  I   A  + GL +     ++  G A+ G L +LFA+AI  ++  +    A A  + +++   +           TGA+ G     +      +++  G   +    +  ++G   L   VF G + GFL A+LYNK+ N  KL   + FFNG RFVP V  L      I+  MIWP +  AL   G+ +      A  +  FIFG +ER L+PFGLHH    PL YT  GG+               Y +L   TA ++                     AG   +W                    W    IN                  +    N+T     L T+    FK   VGQ +          L   A AM     K+ R    ++ +SA     LTG+TEPIE+ F+F++P L+ GV+A +   AF L + I L V   G  E      M    G+  D + +  + + Y         F L Y      +F FLIKKFNI TPGR  N      E+ K ++   +     +S      L + ++   G  +NI +VDAC+T+LR+ +KD+ +V   K   +LGA G I    + V A++G +AD++K +I+ ++
  S:     2 KRNKLISFDFWQKFGKTLLVVVAVMPAAGLMICIGKLIGMQA--SMGLVQSVARVVEDIGWAIIGNLHILFAVAIGGSWAKERAGGAFAGLLTFILTNRI-----------TGAIFGVKPDMFSDEAAKVTSMFGRQLVVKDYFTTILGAPALNMGVFIGIISGFLGAYLYNKYYNFNKLPKSLAFFNGKRFVPFVVILGSVVTAIILSMIWPSIQGALNAFGKWIATSKDTAPIVAPFIFGSLERILLPFGLHHMLTVPLNYTSLGGT---------------YKILTGPTAGTIV--------------------AGQDPLWL------------------AWANDLIN------------------LKAAGNMTEYNNLLATVIPARFK---VGQVITSS-----ASLLGVAFAMYKNVDKDKRDKYKTVFLSAALAVFLTGVTEPIEFMFMFISPILY-GVYAVITGTAFALADLINLRVHCFGFVEFIARTPMMIKAGITRDMLNFAIVSVIY---------FVLTY-----LIFNFLIKKFNIPTPGRAGNYIEMEGEEDKKEEKISEKYIDRDS------LPVKIIGLLGEKENIVDVDACMTRLRVTVKDKGLVAEEKEWKKLGALGLIVKD-KGVQAIYGPKADVLKSDIQDIL 550
>gi|81427674|ref|YP_394671.1| N-acetylglucosamine and glucose-specific phosphotransferase system, enzyme IIABC [Lactobacillus sakei subsp. sakei 23K] >gi|78609313|emb|CAI54359.1| N-acetylglucosamine and glucose-specific phosphotransferase system, enzyme IIABC [Lactobacillus sakei subsp. sakei 23K] (672 aa)
Score = 478, Expect = 1.6e-45, Identities = 152/492 (30%), Positives = 243/492 (49%)
  Q:   368 GWTYSAINGTYDNASIASSSNGAIQSVLTWS--------NLTSGQQALGTIGANGFKGV-NVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSEL-SKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHA-KSTITPIIVLN 859
           GW  + + G ++   I +  + A+ SV  +         N   G ++L    ANG   +   G Y  G +  M+ GLPA A A+   A  E RK   S+ ++AGF S  TG+TEP+E++F+F+A W  + +HA+           I L V+A  H       G +FS G++D+++  +++    +      + GL  A IY+F F F IKKFN+ TPGR  +  +   ED       V+ + + +      + A  + +A GG DNIK +D C T+LR+Q++D + V+   +   GA G       ++  + G E   +   +K L  +                N+   +SA E          DS++ S E  V  +   GE++ +  V D TF++ M+G G AV PT GKI +P+DG +  +F T HA   +T  G ++L+H+GID++ L         PF   V+ G T+K G  + TV L  +  A K T   +I+ N
  S:   192 GWVGAGLYGFFNRLLIPTGLHHALNSVFWFDVANINDIGNFLGGAKSL----ANGTAVIGKTGMYQAGFFPVMMFGLPAGAYAIYKNARPERRKATASLMLAAGFASFFTGVTEPLEFSFMFVA-WPLYVLHAAFTG--------ISLAVAAFFHWT----AGFAFSAGLVDYVL--SLKNPVANQPLMLLVEGLVMAVIYYFGFNFAIKKFNLMTPGREADDTV--DEDTAG----VETDATDDKF---MIQAKRIYAAIGGKDNIKVIDNCTTRLRLQLEDTANVNQPAIKAAGAAGINVLDKTNIQIIIGTEVQFVADALKELYNH----------------NTPIATSAPEPAAAPVEAPVDSDINSGETDVFYAVANGELIDIENVDDPTFAQKMLGDGYAVVPTDGKIVAPVDGTIMTIFPTKHAIGIKTTNGLEVLVHMGIDTVELNG------APFEVAVEEGQTIKHGDLLATVDLDQIVAAGKQTAMMVIITN 644
Score = 275, Expect = 5.2e-22, Identities = 73/251 (29%), Positives = 120/251 (47%)
  Q:    40 KEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGS--LQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQA 290
           K ++ ++ + LMLP+A+LP A I +G+ + +     G+    VF  FL   G A+   LPLLFA+ +A+  + D   AA    +   +     L  A  Q++                    GLS      P+          +++ +V  G + G + A +YN+F N+KL   + FF+G R VPI+   A+  V+ +   +WP V   L   G+A+ +   + + ++GF  R L+P GLHHA  S  W+  A
  S:     2 KNYLQRMGRSLMLPVAVLPAAAILIGIANWV---GNGDSNANVFTIFLAAGGGAILNNLPLLFAVGLALGMSKDQDGAAALAGLVAFLVPKTILAPASIQAMQ-------------------GLSDIAEVNPA--------FGKIEGNVLIGIIAGLIAAAMYNRFHNVKLPMALSFFSGKRLVPIMAATAMMVVSAILYFVWPAVFTVLVSFGEAISKLGWVGAGLYGFFNRLLIPTGLHHALNSVFWFDVA 224
>gi|182418726|ref|ZP_02949999.1| pts system glucose-specific eiicba component [Clostridium butyricum 5521] >gi|182377420|gb|EDT74976.1| pts system glucose-specific eiicba component [Clostridium butyricum 5521] (561 aa)
Score = 478, Expect = 1.7e-45, Identities = 114/266 (42%), Positives = 168/266 (63%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIF--GLAYAPIYFFLFYFLIKKFNIQTPGRGEN---TRLFTKEDYK------NKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           +++ GK+ FM+ GLPAAA AM   A    RK   S+ ++AG TSLLTGITEP+E+TF+F+AP L+ GVH  L  ++F LM+   +             IGM+FSGG+ID+ ++G +    G    W  +   G  YA +Y+FLF F+I+KFN++TPGR EN   T+L++K DY+      N   K  + G+   +      A  V+ A GG +NI +VDACIT+LR+++KD+S VD  +L  LGA G ++   + + A+FGA+AD  K  I  ++ N
  S:   301 RFMAGKFPFMMFGLPAAAFAMYRCAAPSKRKAVGSLLLAAGITSLLTGITEPLEFTFIFVAPVLY-GVHCVLAGISFMLMDIFNVF------------IGMTFSGGLIDFSLFGLLPAGAGVPTKWFMVLLVGAVYAVVYYFLFSFIIRKFNLKTPGRDENEEETKLYSKADYQGRNGQSNTDTKASVGGAKGEIAEK---APAVLEALGGPENIVSVDACITRLRVEVKDRSKVDKDRLKSLGAAGVMEVG-KGIQAIFGAKADGYKNAINDILGN 560
Score = 302, Expect = 4.3e-25, Identities = 90/247 (36%), Positives = 137/247 (55%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFG---NFLQVP------------GNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           +++ ++ K +MLPIA LPIAGI LGVG A++  +G +    ++     F+ +P            G+ VFG LP+LFA+ +A+     D G AALA   G+++   +   L        G                L+  N     +     +GI  L  SVFGG + G + A L+++F  I+L  +IGFF+G RFVPIVT + +  V  +   +WP+V   +  +   +  A  I +F +G IERAL+PFGLHH FY+P W+
  S:     3 QYLQRIGKAIMLPIAALPIAGILLGVGGALLGISGLDNPPGIYQPLIAFVNIPFVTAILTVMKNIGDIVFGNLPILFAVGVAVGLAKKDKGTAALASVFGFIVMNQVISTLLSLGVTQLGV---------------LTPDNVGEYGTYVTTNLGIFTLNMSVFGGIITGIITAILHDRFHEIQLPQVIGFFSGSRFVPIVTAITMAFVGAILAYLWPVVQNGIGMIANLVRDAGFIGTFFYGLIERALIPFGLHHVFYTPFWF 250
>gi|163790441|ref|ZP_02184872.1| PTS system, IIABC component [Carnobacterium sp. AT7] >gi|159874345|gb|EDP68418.1| PTS system, IIABC component [Carnobacterium sp. AT7] (553 aa)
Score = 470, Expect = 1.5e-44, Identities = 183/651 (28%), Positives = 292/651 (44%)
  Q:    35 KKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGY--NLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYF----LIKKFNIQTPGRGEN--TRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKD-QSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           KK  + +F  KL K LM+ +A++P AG+ + +G  I   +G    +   G+ ++  G A+ G L +LFA+AI  ++  +    A A  + +++           +  T+GA+ G   ++L  +G       G        + +V+G   L   VF G + GF+ A ++NK+ N  KL   + FFNG RFVP V  L    ++I   ++WP++   +   GQ +      A     FI+G +ER L+PFGLHH    P+ YT  GG+               Y VL  S A S                       G   +W                    W    +N    NA   ++ N  + S+ T +    GQ     IGA G                 +LG+  A   M     K+ R    S+ +SA     LTG+TEP+E+ F+F AP L+ GV+A L  ++F L + I L V + G  E    I MS + G++                 W  +  +    ++FFL YF    +I KF   TPGR  N      T++    +   V    S+++  N       ++ A GG +NI +VDAC+T+LR+ +K+  +V D A   +LGA G +K     + A++G +AD++K +I  ++
  S:     2 KKIFSFDFWQKLGKALMVVVAVMPAAGLMISIGKMIAMFSGDITLVLTIGSVMENLGWAIIGNLHILFAVAIGGSWAKERAGGAFAALLAFIL-----------INMTSGAIFGVTSDMLLTEGATTSTLFGQTIPVDGYFTSVLGSPALNMGVFVGIISGFVGAVVFNKYYNYRKLPEALSFFNGKRFVPFVVILWSVIISIGLALVWPVIQTGINNFGQWIANSSETAPIFAPFIYGTLERLLLPFGLHHMLTIPINYTALGGT---------------YTVLTGSGAGS--------------------QVFGQDPLWL------------------AWVSDLVN--LKNAGDTTAYNELLSSI-TPARFKVGQM----IGAAG----------------TLLGIAFA---MYRRTDKDKRSKYKSMFLSAAIAVFLTGVTEPLEFMFMFAAPALY-GVYAILQGISFALADVIHLRVHSFGTLEFMTRIPMSVNAGLV-----------------WDVVNFIISCVVFFFLAYFISYWMIGKFKFATPGRLGNYIEETATEDGVATEGTPVGATISADAQVN------GIIEALGGSENISDVDACMTRLRVTVKNPDAVQDEASWKKLGALGLVKKG-TGIQAIYGPKADVLKSDINDVL 551
>gi|187603667|ref|ZP_02989879.1| PTS system, IIBC subunit [Exiguobacterium sp. AT1b] >gi|187484442|gb|EDU22434.1| PTS system, IIBC subunit [Exiguobacterium sp. AT1b] (542 aa)
Score = 466, Expect = 4.3e-44, Identities = 182/645 (28%), Positives = 289/645 (44%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQ---GNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALG----QAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVV-DTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           +F  KL K LM+ IA++P AG+ + +G  I  +AG    L      ++  G  +   L +LFA+AI  ++  D    A A  + +++           +   TGA+ G N    Q     I  L   N  + +  + +V+G   L   VF G + GFL   LYN+F N  KL   + FFNG RFVP V  L      I+  ++WP +  AL   G+ +      A  +  FI+G +ER L+PFGLHH    P+ YT+ GG+               Y +L  +TA S+                     AG   +W     +L+     L+       Y+A+      A +  +     Q +L+++ L     A+       ++ V+  +  Q K +F                            +SAG    LTG+TEPIE+ F+F+AP L+  V+A +   AF L + I L V A G  EL   I M    G++  +I   +               + +  + F +F F IKK N+ TPGR  N    T E              S    N+QV+   +++  GG +NI++VDAC+T+LR+ +KD ++V D  +  + GA G I    + V A++G +AD++K +I+ ++
  S:     8 DFWQKLGKALMVVIAVMPAAGLMISIGKLIGMSAGDVGILLTTARIIEDLGWGIIVNLHILFAVAIGGSWAKDRAGGAFAALLAFIL-----------INRVTGAIFGVNGAMLQDPEATIESLFGANLVV-ADYFTSVLGSPALNMGVFVGIIAGFLGGALYNRFYNFNKLPNALSFFNGKRFVPFVVILGSVVAAIVLSIVWPTIQGALNSFGEWIATSRNTAPVLAPFIYGALERLLLPFGLHHMLTVPMNYTELGGT---------------YTILTGATAGSVV--------------------AGQDPLWLAWVTDLVN----LRAAGDTAAYNAL-----LADVVPARFKVGQVILSFAALIGAAYAM-------YRNVDADKKAQYKPMF----------------------------LSAGLAVFLTGVTEPIEFMFMFVAPVLYV-VYALMAGAAFALADIIDLRVHAFGAIELLTRIPMIVKAGLLQDLINFVLVS-------------VVFFFLNFGVFNFFIKKMNLPTPGRNGNYMEETTE-------------KSSVTGNEQVMG--IIALLGGEENIEDVDACMTRLRVTVKDVTLVSDEQEWKKNGAMGLIVKD-RGVQAIYGPKADVLKSDIQDVI 540
>gi|1172705|sp|P45604|PTW3C_KLEPN PTS system N-acetylglucosamine-specific EIICBA component (EIICBA-Nag) (EII-Nag) [Includes: N-acetylglucosamine permease IIC component (PTS system N-acetylglucosamine-specific EIIC component); N-acetylglucosamine-specific phosphotransferase enzyme IIB component (PTS system N-acetylglucosamine-specific EIIB component); N-acetylglucosamine-specific phosphotransferase enzyme IIA component (PTS system N-acetylglucosamine-specific EIIA component)] >gi|43819|emb|CAA44923.1| nagE [Klebsiella pneumoniae] >gi|228466|prf||1804340A GlcNAc phosphorylation enzyme II (651 aa)
Score = 464, Expect = 7.6e-44, Identities = 150/465 (32%), Positives = 248/465 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLNESLEGREIKFLKKSGEIKKGM-PLFEV 885
           G ++ G +  M+ GLP AA AM +AAPK  R +   + +S   T+ LTG+TEP+E+ FLFLAP L+  +HA L  ++  +   +G+            H G SFS G ID+++  ++      N W   + G+ +  +YF LF  +I+ FN++TPGR +       E+  +         + E L     LA + ++A GG DN+K +DACIT+LR+ + D + V+ A   +LGA G +K + Q++  + GA+A+ I   +K ++     +              +  ++A   KP+       +  + E +V  SP TG++V+L +VPDE F+   +G GIAVKPT   + +P  G +  +F+T HA+  ET  G +I++H+GID++ L+ K  K L      V+ G  VK G+ I  + L  L  +A+S I+P++  N   +      +  SG++  G  PL+E+
  S:   227 GMFMSGFFPIMMFGLPGAALAMYLAAPKARRPMVGGMLLSVAITAFLTGVTEPLEFLFLFLAPLLY-LLHAVLTGISLFIATALGI------------HAGFSFSAGAIDYVLMYSLPAA-SKNVWMLLVMGVVFFFVYFLLFSAVIRMFNLKTPGREDKAADVVTEEANSN--------TEEGLTQ---LATSYIAAVGGTDNLKAIDACITRLRLTVGDSAKVNDAACKRLGASGVVKLNKQTIQVIVGAKAESIGDEMKKVVTRGPVA------AAAAAPAGNVATAAPAAKPQA----VANAKTVESLV--SPITGDVVALEQVPDEAFASKAVGDGIAVKPTDNIVVAPAAGTVVKIFNTNHAFCLETNNGAEIVVHMGIDTVALEGKGFKRL------VEEGTDVKAGEPILEMDLDFLNANARSMISPVVCSNS--DDYSALVILASGKVVAGQTPLYEI 648
Score = 245, Expect = 1.5e-18, Identities = 76/257 (29%), Positives = 114/257 (44%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGD-AGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGIN-QLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           N   F  +L + L LPIA+LP+A + L  G   + N            F+   G A+F  L L+FAI +A +++ D AG AALA  +GY +                                            +  A++ IN ++   V  G + G +   +YN++  IKL   + FF G RFVPI T      +  +F  +WP V  A+   G+ +  A  + S IFGFI R L+P GLH    +  W     +T A G++
  S:     2 NILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNV----------PFIAQAGGAIFDNLALIFAIGVASSWSKDNAGSAALAGAVGYFV--------------------------------------------MTKAMVTINPEINMGVLAGIITGLVAGAVYNRWAGIKLPDFLSFFGGKRFVPIATGFFCLILAAIFGYVWPPVQHAIHSGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTV 211
>gi|168204401|ref|ZP_02630406.1| PTS system, IIBC component [Clostridium perfringens E str. JGS1987] >gi|170663956|gb|EDT16639.1| PTS system, IIBC component [Clostridium perfringens E str. JGS1987] (551 aa)
Score = 462, Expect = 1.1e-43, Identities = 174/653 (26%), Positives = 282/653 (43%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDAL-----SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGG----MIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           K+ K  + +F  K  K L++ +A++P AG+ + +G  +       + ++     ++  G A+ G L LLFA+AI  ++  +    A A  I +++   +   +     +    D+T  V  +              G   L    + +V+G   L   VF G + GFL A LYNK+ N  KL   + FFNG RFVP +  +      I+   +WP V   L   GQ +      A  I  F++G +ER L+PFGLHH    P+ YT+ GG                Y +L   TA  +                     AG   +W            W+ +L++          +  A   +S N  I SV+                          ++  G+ +     L   A AM      + +K   S+  SA     LTG+TEPIE+ F+F++P L+  V+A +  L F + + I L V A G  EL     +  + G    +I++II   +           F F      + +F+F FLIKKF I TPGR  N        Y + +++     SS S  +   LA+  +   GG +NI +VDAC+T+LR+ +KD   V   K  +      +    + V A++G +AD++K +I+ ++
  S:     2 KKFKLGSFDFWQKFGKALLVVVAVMPAAGLMISIGKVMGIYID-VDFIKTIARVMEDIGWAIIGNLNLLFAVAIGGSWAKERAGGAFAGTIAFVLINRITGVIFSVSNAMLAGDSTATVQSFT-------------GQTLLVKDYFVSVLGAPALNMGVFVGIISGFLGAALYNKYYNYNKLPNALAFFNGKRFVPFMVIIGSTISAIILSFVWPFVQYGLNTFGQWIATSKDTAPIIAPFLYGTLERLLLPFGLHHMLTVPVNYTELGG---------------VYHILTGPTAGQVV--------------------AGQDPLWL----------AWITDLNN----------FKQAGDITSYNQLIGSVVP------------------------ARFKAGQVILSSASLIGVALAMYKNVDPDKKKKYKSVFFSAAIAVFLTGVTEPIEFMFMFISPILYV-VYAVIAGLGFAIADIINLRVHAFGFIELITRSPLMINAGLTKDLINFIIVAVV-----------FFF------LNYFVFSFLIKKFKIATPGRMGN--------YIDNEDENANKASSNSKASMDELAVKAIELLGGRENIVDVDACMTRLRVTVKDIEKVGDEKAWKDNKALGLIVKDKGVQAIYGPKADVLKSDIQDIL 549
>gi|26554043|ref|NP_757977.1| PTS system enzyme IIABC component [Mycoplasma penetrans HF-2] >gi|26454051|dbj|BAC44381.1| PTS system enzyme IIABC component [Mycoplasma penetrans HF-2] (769 aa)
Score = 461, Expect = 1.6e-43, Identities = 157/473 (33%), Positives = 231/473 (48%)
  Q:   416 KGVNVGQYLQGKYVFMILGLPAAAAAMVM-AAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWI--IYGAIQIQYG---------SNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGEN--TRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDS--INLKDKSGKELKPFAPNV--KTGDTVKVGQEIGTVKLADLKHAKSTITPIIV--LNESLEGREIKFLKKSGEIKKGMPLFEVLPK 888
           +G N G +  G +  M+ GLPA        A  KE ++  +S        S LTGITEPIE+ F+F++P L +GVHA L  +          I  A G       IG  FS G+ID++  I  ++QI            +N  W ++ GL  A  Y F+   L+KK N+  PGRG+N  T    K+D     NK    G SE           +V   GG++NI+N   C T+LR  +KD S +D A L + GA GT K     ++ + G EA+++   I                   I N +SD +  ++    KE  K    L+K  V V SP +G IV L  V DETFS  +MG G+A+ P+  +  +  + ++   F TGHAY  +  K   +L+H+GID+  IN   K G +L+ F+  +  K    +  G++I  V  A LK      T + +      +       +K + ++ KG PLFEV  K
  S:   320 QGNNAGTFQSGFFASMMFGLPALVYVFYRNAESKEQKQRVLSTFGPLALVSFLTGITEPIEFAFMFVSP-LLYGVHALLTGI-------FSFITGAMG-----IQIGFGFSAGLIDYLLSIPKSLQIIEANRTGIDAVFANPGWLWVIGLLCALSYIFVGNLLVKKLNLSVPGRGQNLITESMVKKDNHTDNNKDNKKGLSEKTKK-------LVLGLGGWENIENYQNCTTRLRYDVKDMSKIDEALLKEGGAIGTKKFQDHHLHVILGPEAELVNDEI-------------------INNKNSDLTLNNDNNLVKEKEKQKLALAK-PVKVKSPISGTIVFLEDVKDETFS--LMGKGVAIIPSENEFIAQDNFEIESFFWTGHAYIAKI-KDLDVLVHIGIDTVKINSDKKEGDKLEVFSTKLIDKKNHKISKGEKIIKVDFAKLKKLGYDPTTLFIVLNENLVNNELNLLVKNNQKVNKGDPLFEVKAK 769
Score = 285, Expect = 4.4e-23, Identities = 87/286 (30%), Positives = 142/286 (49%)
  Q:     2 NYSMSGNLQTSLKTYFSKLKFNSLFKKQGAGKEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGD-AGPAALACF----------------IGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGIN------SFIFGFIERALVPFGLHHAFYSPLWY 287
           N    G +Q   + +    K N +F K G+  +K   T E + +L K L+ PIA+LPIA I   +G+ +  +A   E  +     L   GN VF  L +LFA+ +    T D  G AAL                   +   I+G ++  + QS+ D              G +   + G  AL  + Y ++     L  +V  G + G  VA++YN+F N++L  ++GFF+G R +P++  L +    I++ +I+P +G  L  +   L  A G        S ++ F+ R L+PFGLHH   +  W+
  S:     5 NLKTFGLVQDVKQDHKVSFKSNKVFAKIGSSFKK---TFESLGRLGKALLFPIAVLPIAAILNRLGAQLPNSADTPEFAKFVQTLLSAAGNTVFNNLHILFAVGVGFGLTKDNRGEAALTALVGIILLGLLMSSTGADLPQQIYGKIKFPIDQSLIDA-------------GIVSADATGFQALFGNKYDSI-----LSQNVLNGILSGVFVAWVYNRFNNVELPKVLGFFSGRRLLPVLIILGMMFYGIIYAVIFPWLGWILYQISLGLSSATGNRWSNASISGVYAFLNRLLIPFGLHHIPNTLFWF 292
>gi|110803228|ref|YP_697747.1| PTS system, IIBC component [Clostridium perfringens SM101] >gi|110683729|gb|ABG87099.1| PTS system, IIBC component [Clostridium perfringens SM101] (551 aa)
Score = 460, Expect = 1.9e-43, Identities = 173/653 (26%), Positives = 283/653 (43%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDAL-----SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGG----MIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           K+ K  + +F  K  K L++ +A++P AG+ + +G  +       + ++     ++  G A+ G L LLFA+AI  ++  +    A A  I +++   +   +     +   +D+T  V  +              G   L    + +V+G   L   VF G + GFL A LYNK+ N  KL   + FFNG RFVP +  +      I+   +WP V   L   GQ +      A  I  F++G +ER L+PFGLHH    P+ YT+ GG                Y +L   TA  +                     AG   +W            W+ +L++          +  A   +S N  I SV+                          ++  G+ +     L   A AM      + +K   S+  SA     LTG+TEPIE+ F+F++P L+  V+A +  L F + + I L V A G  EL     +  + G    +I++II   +           F F      + +F+F FLIKKF I TPGR  N        Y + +++     SS S  +   LA+  +   GG +NI +VDAC+T+LR+ +K+   V   K  +      +    + V A++G +AD++K +I+ ++
  S:     2 KKFKLGSFDFWQKFGKALLVVVAVMPAAGLMISIGKVMGIYID-VDFIKTIARVMEDIGWAIIGNLNLLFAVAIGGSWAKERAGGAFAGTIAFVLINRITGVIFSVSNAMLASDSTATVQSFT-------------GQTLLVKDYFVSVLGAPALNMGVFVGIISGFLGAALYNKYYNYNKLPNALAFFNGKRFVPFMVIIGSTISAIILSFVWPFVQYGLNTFGQWIATSKDTAPIIAPFLYGTLERLLLPFGLHHMLTVPVNYTELGG---------------VYHILTGPTAGQVV--------------------AGQDPLWL----------AWITDLNN----------FKQAGDITSYNQLIGSVVP------------------------ARFKAGQVILSSASLIGVALAMYKNVDPDKKKKYKSVFFSAAIAVFLTGVTEPIEFMFMFISPILYV-VYAVIAGLGFAIADIINLRVHAFGFIELVTRSPLMINAGLTKDLINFIIVAVV-----------FFF------LNYFVFSFLIKKFKIATPGRMGN--------YIDNEDENANKASSNSKASMDELAVKAIELLGGKENIVDVDACMTRLRVTVKEIEKVGDEKAWKDNKALGLIVKDKGVQAIYGPKADVLKSDIQDIL 549
>gi|168209038|ref|ZP_02634663.1| PTS system, IIBC component [Clostridium perfringens B str. ATCC 3626] >gi|170712935|gb|EDT25117.1| PTS system, IIBC component [Clostridium perfringens B str. ATCC 3626] (551 aa)
Score = 459, Expect = 2.3e-43, Identities = 174/653 (26%), Positives = 282/653 (43%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDAL-----SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGG----MIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           K+ K  + +F  K  K L++ +A++P AG+ + +G  +       + ++     ++  G A+ G L LLFA+AI  ++  +    A A  I +++   +   +     +    D+T  V  +              G   L    + +V+G   L   VF G + GFL A LYNK+ N  KL   + FFNG RFVP +  +      I+   +WP V   L   GQ +      A  I  F++G +ER L+PFGLHH    P+ YT+ GG                Y +L   TA  +                     AG   +W            W+ +L++          +  A   +S N  I SV+                          ++  G+ +     L   A AM      + +K   S+  SA     LTG+TEPIE+ F+F++P L+  V+A +  L F + + I L V A G  EL     +  + G    +I++II   +           F F      + +F+F FLIKKF I TPGR  N        Y + +++     SS S  +   LA+  +   GG +NI +VDAC+T+LR+ +KD   V   K  +      +    + V A++G +AD++K +I+ ++
  S:     2 KKFKLGSFDFWQKFGKALLVVVAVMPAAGLMISIGKVMGIYID-VDFIKTIARVMEDIGWAIIGNLNLLFAVAIGGSWAKERAGGAFAGTIAFVLINRITGVIFSVSNAMLAGDSTATVQSFT-------------GQTLLVKDYFVSVLGAPALNMGVFVGIISGFLGAALYNKYYNYNKLPNALAFFNGKRFVPFMVIIGSTISAIILSFVWPFVQYGLNTFGQWIATSKDTAPIIAPFLYGTLERLLLPFGLHHMLTVPVNYTELGG---------------VYHILTGPTAGQVV--------------------AGQDPLWL----------AWITDLNN----------FKQAGDITSYNQLIGSVVP------------------------ARFKAGQVILSSASLIGVALAMYKNVDPDKKKKYKSVFFSAAIAVFLTGVTEPIEFMFMFISPILYV-VYAVIAGLGFAIADIINLRVHAFGFIELITRSPLMINAGLTKDLINFIIVAVV-----------FFF------LNYFVFSFLIKKFKIATPGRMGN--------YIDNEDENANKASSNSNASMDELAVKAIELLGGRENIVDVDACMTRLRVTVKDIEKVGDEKAWKDNKALGLIVKDKGVQAIYGPKADVLKSDIQDIL 549
>gi|28379408|ref|NP_786300.1| N-acetylglucosamine PTS, EIICBA [Lactobacillus plantarum WCFS1] >gi|28272247|emb|CAD65156.1| N-acetylglucosamine PTS, EIICBA [Lactobacillus plantarum WCFS1] (662 aa)
Score = 459, Expect = 2.9e-43, Identities = 140/506 (27%), Positives = 234/506 (46%)
  Q:   372 SAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGL---MNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIK 877
           + + G ++   I +  + A+ SV  W ++         +   G KGV  G Y  G +  M+ GLPA A A+   A  E +    S+ M+  F S  TG+TEP+E++F+F+A W  + +HA    L+      M+W                 G +FS G++D+I+  +++    +      + GL  A IY+F F F IKKF++ TPGR         E             +    +     A  + +A GG DN+  VD C T+LR+Q+ D S ++ A +   GA G  K    ++  + G E   +   +  L   ++++P  K+           T+S   V          S ++ +   V +   G+ V +  V D+TF+K M+G G A+ P  G I +P+DG +S VF T HA  F+T+ G +IL+H+GID++ L         PF   V+T   +  G+ +    LA +K A    T ++++        +KF   + ++K
  S:   194 AGLYGFFNRLLIPTGLHQALNSVF-WFDVAGINDIGKFLAHKGIKGVT-GMYQAGFFPVMMFGLPAGAYAIYRNALPERKVETASLMMAGAFASFFTGVTEPLEFSFMFVA-WPLYVLHAIFTGLSLAFAAFMHWTA---------------GFAFSAGLVDYIL--SLKNPIANQPLMLILQGLVLAVIYYFGFDFAIKKFHLMTPGR---------EPVTADDADDLAIATDADDDKYTRQAKQIYAALGGADNLTVVDNCTTRLRLQLADTSTINEAAIKHSGAAGINKLDDHNLQIIIGTEVQFVADALSRL--KLTNAPITKT-----------TTSNEAVATAPTATNITSGVTTDFYSVAN---GQYVDIENVDDDTFAKKMLGDGFAIDPADGTITAPVDGTVSTVFPTKHAIGFKTDSGLEILLHMGIDTVELNG------APFEVLVQTDQPIHHGEVVAKADLAAIKAAGKATTMMVIITNMDAVNLMKFKMLTNQVK 651
Score = 260, Expect = 3.1e-20, Identities = 73/252 (28%), Positives = 116/252 (46%)
  Q:    40 KEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAG 291
           K ++ ++ + L LP+A+LP A + +G+G     N   +    +  +FLQ  GNAV   LPLLFA+ +A+  + D   AA    +           L  +V          N+               A  +  +G +        +VF G + G + A LYN+F   KL   + FF+G R VPI+  L +  V++  L++WP V  AL   G+ +     + + ++GF  R L+P GLH A  S  W+  AG
  S:     4 KNYLQRMGRSLQLPVAVLPAAALLVGIG-----NWWASASNDIVAHFLQAGGNAVLSQLPLLFAVGLALGMSKDKDGAAALAGLVAF-------ELPTNVLKPESVATLLNI-------------KVATVNPAFGQI-------GNVFIGIISGLIAAALYNRFHETKLPMALSFFSGKRLVPILAALTMLLVSVALLIVWPPVYDALVTFGKFIVGLGAVGAGLYGFFNRLLIPTGLHQALNSVFWFDVAG 223
>gi|169343020|ref|ZP_02864048.1| PTS system, IIBC component [Clostridium perfringens C str. JGS1495] >gi|169298929|gb|EDS81003.1| PTS system, IIBC component [Clostridium perfringens C str. JGS1495] (551 aa)
Score = 457, Expect = 4.3e-43, Identities = 176/653 (26%), Positives = 284/653 (43%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYL--------IFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGG----MIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           K+ K  + +F  K  K L++ +A++P AG+ + +G  +       + ++     ++  G A+ G L LLFA+AI  ++  +    A A  I ++        IF    D L+   T T  +  G  LL                    + +V+G   L   VF G + GFL A LYNK+ N  KL   + FFNG RFVP +  +      I+   +WP V   L   GQ +      A  I  F++G +ER L+PFGLHH    P+ YT+ GG                Y +L   TA  +                     AG   +W            W+ +L++          +  A   +S N  I SV+                          ++  G+ +     L   A AM      + +K   S+  SA     LTG+TEPIE+ F+F++P L+  V+A +  L F + + I L V A G  EL     +  + G    +I++II   +           F F      + +F+F FLIKKF I TPGR  N       D +++     ++ S+ S++    LA+  +   GG +NI +VDAC+T+LR+ +K+   V   K  +      +    + V A++G +AD++K +I+ ++
  S:     2 KKFKLGSFDFWQKFGKALLVVVAVMPAAGLMISIGKVMGIYID-VDFIKTIARVMEDIGWAIIGNLNLLFAVAIGGSWAKERAGGAFAGTIAFVLINRITGVIFSVSNDMLAGDSTATVQSFTGQTLLV----------------KDYFVSVLGAPALNMGVFVGIISGFLGAALYNKYYNYNKLPNALAFFNGKRFVPFMVIIGSTISAIILSFVWPFVQYGLNTFGQWIATSKDTAPIIAPFLYGTLERLLLPFGLHHMLTVPINYTELGG---------------VYHILTGPTAGQVV--------------------AGQDPLWL----------AWITDLNN----------FKQAGDITSYNQLIGSVVP------------------------ARFKAGQVILSSASLIGVALAMYKNVDPDKKKKYKSVFFSAAIAVFLTGVTEPIEFMFMFISPILYV-VYAVIAGLGFAIADIINLRVHAFGFIELITRSPLMINAGLTKDLINFIIVAVV-----------FFF------LNYFVFSFLIKKFKIATPGRMGNYI-----DNEDENTNKSLSNSNASMDE---LAVKAIELLGGKENIVDVDACMTRLRVTVKEIEKVGDEKAWKDNKALGLIVKDKGVQAIYGPKADVLKSDIQDIL 549
>gi|18309401|ref|NP_561335.1| PTS system, IIBC component [Clostridium perfringens str. 13] >gi|110799845|ref|YP_694879.1| PTS system, IIBC component [Clostridium perfringens ATCC 13124] >gi|18144077|dbj|BAB80125.1| probable PTS system [Clostridium perfringens str. 13] >gi|110674492|gb|ABG83479.1| PTS system, IIBC component [Clostridium perfringens ATCC 13124] (551 aa)
Score = 456, Expect = 5.7e-43, Identities = 173/653 (26%), Positives = 282/653 (43%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDAL-----SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGG----MIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           K+ K  + +F  K  K L++ +A++P AG+ + +G  +       + ++     ++  G A+ G L LLFA+AI  ++  +    A A  I +++   +   +     +    D+T  V  +              G   L    + +V+G   L   VF G + GFL A LYNK+ N  KL   + FFNG RFVP +  +      I+   +WP V   L   GQ +      A  I  F++G +ER L+PFGLHH    P+ YT+ GG                Y +L   TA  +                     AG   +W            W+ +L++          +  A   +S N  I SV+                          ++  G+ +     L   A AM      + +K   S+  SA     LTG+TEPIE+ F+F++P L+  V+A +  L F + + I L V A G  EL     +  + G    +I++II   +           F F      + +F+F FLIKKF I TPGR  N        Y + +++     SS S  +   LA+  +   GG +NI +VDAC+T+LR+ +K+   V   K  +      +    + V A++G +AD++K +I+ ++
  S:     2 KKFKLGSFDFWQKFGKALLVVVAVMPAAGLMISIGKVMGIYID-VDFIKTIARVMEDIGWAIIGNLNLLFAVAIGGSWAKERAGGAFAGTIAFVLINRITGVIFSVSNAMLAGDSTATVQSFT-------------GQTLLVKDYFVSVLGAPALNMGVFVGIISGFLGAALYNKYYNYNKLPNALAFFNGKRFVPFMVIIGSTISAIILSFVWPFVQYGLNTFGQWIATSKDTAPIIAPFLYGTLERLLLPFGLHHMLTVPVNYTELGG---------------VYHILTGPTAGQVV--------------------AGQDPLWL----------AWITDLNN----------FKQAGDITSYNQLIGSVVP------------------------ARFKAGQVILSSASLIGVALAMYKNVDPDKKKKYKSVFFSAAIAVFLTGVTEPIEFMFMFISPILYV-VYAVIAGLGFAIADIINLRVHAFGFIELITRSPLMINAGLTKDLINFIIVAVV-----------FFF------LNYFVFSFLIKKFKIATPGRMGN--------YIDNEDENTNKASSNSKASMDELAVKAIELLGGKENIVDVDACMTRLRVTVKEIEKVGDEKAWKDNKALGLIVKDKGVQAIYGPKADVLKSDIQDIL 549
>gi|37679196|ref|NP_933805.1| PTS system, N-acetylglucosamine-specific IIABC component [Vibrio vulnificus YJ016] >gi|37197939|dbj|BAC93776.1| PTS system, N-acetylglucosamine-specific IIABC component [Vibrio vulnificus YJ016] (523 aa)
Score = 455, Expect = 7.1e-43, Identities = 178/650 (27%), Positives = 274/650 (42%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVP-----GNAVFGALPLLFAIAIAIAFTGDAGPAALACFIG-YLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           N   +  KL K LMLPIA LP+A + L +G                G+ L +P     G A+FG LPLLF + IAI  + D   AA       Y +  +    +  S+          N+ F+ G I G+ AG++                                 YN F   +L   + FF+G R VPI+  L       +  ++WP +   L  L  A+  +  +  F++G + RAL+P GLHH   S  W+                  G    +L T    +  +   L   L  +  +     AG    + F NA     +  +KE++                  +  +G +           G +  G    NGF  V +   L G  + M L  PA           E R        S  F S LTGITEP+E+ F+FLAP L+  +HA    LA  + N  G     T H       G  FS G+ID+++   +     +  +   + GLA+  +YFF F+F I+ FN+++PGR         ED  ++ +      S ++ + D  LA   + A GG +N+ ++DACIT+LR+ +KD+SV D A L +LGA+G +K    ++  + G  A+I+ G +K +  N
  S:     2 NILGYAQKLGKALMLPIATLPVAALLLRLGQ---------------GDLLDIPFMAQAGGAIFGQLPLLFGLGIAIGLSKDGQGAAGLAGAVAYFVLTATATTIDASI----------NMSFFGGIIGGIIAGHS---------------------------------YNAFHATRLPEWLAFFSGKRLVPIMAGLFSLVAGAVAGVVWPSIQGGLDALAHAVSTSGAVGQFVYGTLNRALIPVGLHHVLNSYFWFGM----------------GTCQEILVTGAQAAGQALPAL-QQLCVDPALAKTLVAGQTHTFEFANAVTPEITATVKEVTE-----------------TVKSGDLHRFF------GGDKGAGVF-MNGFFPVMMFG-LPGAALAMYLAAPA-----------EKRSQVGGALFSVAFCSFLTGITEPLEFMFVFLAPALY-ALHAVFTGLALVVANMFG-----TLH-------GFGFSAGLIDFLLNWGL----ATKPFVLLLIGLAFGALYFFTFFFAIRAFNLKSPGR---------EDDDSETSA----ASGDAKSGD--LARQYLKALGGHENLTSIDACITRLRLTLKDRSVADEAVLKKLGAKGVVKLGENNLQVILGPLAEIVAGEMKAIGVN 514
>gi|168212666|ref|ZP_02638291.1| PTS system, IIBC component [Clostridium perfringens CPE str. F4969] >gi|168216495|ref|ZP_02642120.1| PTS system, IIBC component [Clostridium perfringens NCTC 8239] >gi|170715855|gb|EDT28037.1| PTS system, IIBC component [Clostridium perfringens CPE str. F4969] >gi|182381337|gb|EDT78816.1| PTS system, IIBC component [Clostridium perfringens NCTC 8239] (551 aa)
Score = 455, Expect = 8.3e-43, Identities = 173/653 (26%), Positives = 282/653 (43%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDAL-----SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGG----MIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           K+ K  + +F  K  K L++ +A++P AG+ + +G  +       + ++     ++  G A+ G L LLFA+AI  ++  +    A A  I +++   +   +     +    D+T  V  +              G   L    + +V+G   L   VF G + GFL A LYNK+ N  KL   + FFNG RFVP +  +      I+   +WP V   L   GQ +      A  I  F++G +ER L+PFGLHH    P+ YT+ GG                Y +L   TA  +                     AG   +W            W+ +L++          +  A   +S N  I SV+                          ++  G+ +     L   A AM      + +K   S+  SA     LTG+TEPIE+ F+F++P L+  V+A +  L F + + I L V A G  EL     +  + G    +I++II   +           F F      + +F+F FLIKKF I TPGR  N        Y + +++     SS S  +   LA+  +   GG +NI +VDAC+T+LR+ +K+   V   K  +      +    + V A++G +AD++K +I+ ++
  S:     2 KKFKLGSFDFWQKFGKALLVVVAVMPAAGLMISIGKVMGIYID-VDFIKTIARVMEDIGWAIIGNLNLLFAVAIGGSWAKERAGGAFAGTIAFVLINRITGVIFSVSNAMLAGDSTATVQSFT-------------GQTLLVKDYFVSVLGAPALNMGVFVGIISGFLGAALYNKYYNYNKLPNALAFFNGKRFVPFMVIIGSTISAIILSFVWPFVQYGLNTFGQWIATSKDTAPIIAPFLYGTLERLLLPFGLHHMLTVPVNYTELGG---------------VYHILTGPTAGQVV--------------------AGQDPLWL----------AWITDLNN----------FKQAGDITSYNQLIGSVVP------------------------ARFKAGQVILSSASLIGVALAMYKNVDPDKKKKYKSVFFSAAIAVFLTGVTEPIEFMFMFISPILYV-VYAVIAGLGFAIADIINLRVHAFGFIELVTRSPLMINAGLTKDLINFIIVAVV-----------FFF------LNYFVFSFLIKKFKIATPGRMGN--------YIDNEDENANKPSSNSKASMDELAVKAIELLGGKENIVDVDACMTRLRVTVKEIEKVGDEKAWKDNKALGLIVKDKGVQAIYGPKADVLKSDIQDIL 549
>gi|169189561|ref|ZP_02849560.1| PTS system, glucose subfamily, IIA subunit [Paenibacillus sp. JDR-2] >gi|169003751|gb|EDS50616.1| PTS system, glucose subfamily, IIA subunit [Paenibacillus sp. JDR-2] (628 aa)
Score = 454, Expect = 9.4e-43, Identities = 125/442 (28%), Positives = 208/442 (47%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADL-KHAKSTITPIIVLNESL 862
           G ++ G Y  ++  LPA A A++  A ++ +       + A   S LTG+TEP+E+ FLF+AP+LF  VHA L     G++ W+          EL    G SFSGG+ID+I    I     +  W     G+    +Y+ +F + I +F I TPGR E ++L                   E   +    A  ++ A GG DNI  +++CIT+LR+++ ++ ++D   L  LGA G ++    +V  VFG  +++I+  +   ++                                          +E+V+ +SP  G ++ L  VPD  F+  ++G G+A  P  G++ SP+ G + +V+ T HA    T++G ++L+H+GID+  L  KS      F   V+ G  V  G  +    L  + K +KS  TP+++ N  L
  S:   232 GAFMAGMYPIVMFALPAIAFAIIHEAREDLKPKIRKTFLYASLASFLTGVTEPVEFAFLFVAPYLFV-VHAILS----GVIMWVTY--------ELGIRHGFSFSGGVIDYI----INEHLATRGWLLIPIGIVVGLVYYLVFRWAINRFRIPTPGREEGSQL------------------DEWAGDIPYRAPLILQAIGGKDNIVQMESCITRLRLKVSNEKLLDNNALRNLGAAGVLRLGGGNVQVVFGTYSELIRAEMLKAIQR----------------------------------------DQEQVLFSSPVQGRMIPLEDVPDPIFAGKLVGQGVAFIPEKGELVSPVKGTVMIVYPTMHAVGIRTQEGLEVLLHIGIDTSKLTGKS-----YFKAVVEEGQEVMPGDMLVRFDLQRVRKESKSLATPMVITNSDL 594
Score = 192, Expect = 2.6e-12, Identities = 73/261 (27%), Positives = 117/261 (44%)
  Q:    45 KLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQD 305
           +L +  MLP+ +LP A IFL +            G+    ++LQ  G+A+F  LP +FA+ +++  TG+A  A +A   G +I+          VT T                                      Q++ +VF G ++G +  F Y +FKN++L   I FF G RFVP+   +    +++  + + PL+   L  LG  +    G   F+FGF+ R LV FGLHH      W+ Q GG  +    +++Y D
  S:     9 QLGRAFMLPMIVLPAAAIFLFLSQL----PWDLLGIPNAADYLQAAGHAIFTFLPYIFALGVSLGLTGNALAAGMAALAGMVIY--------VGVTGTADP-----------------------------------QIEPTVFVGSIIGMISGFSYERFKNLRLPEYIQFFGGPRFVPLFVSVVTVILSMAMIGVAPLIQRMLEGLGDIVASGGGFGVFLFGFLYRILVVFGLHHLLSHVFWF-QVGG-YETADGSMVYGD 220
>gi|187933951|ref|YP_001887597.1| PTS system, glucose-like IIB component [Clostridium botulinum B str. Eklund 17B] >gi|187722104|gb|ACD23325.1| PTS system, glucose-like IIB component [Clostridium botulinum B str. Eklund 17B] (550 aa)
Score = 452, Expect = 1.7e-42, Identities = 116/264 (43%), Positives = 167/264 (63%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIF--GLAYAPIYFFLFYFLIKKFNIQTPGRGEN---TRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           +++ GK+ FM+ GLPAAA AM  AA    RK   S+ ++A  TSLLTGITEP+E+TF+F+AP L+ GVH  L  L+F LM+   +             IGM+FSGG+ID+ ++G +    G    W  +   G+ YA +Y+FLFYF+I K N++TPGR EN   T+L+TK DY+ K+     N  SE +      A  V+SA GG +NI +VDACIT+LR+++KD++ VD  +L  LGA G ++     + A+FGA+AD  K  I  ++
  S:   301 RFMAGKFPFMMFGLPAAAFAMYRAAAPSKRKTVGSLLLAAAITSLLTGITEPLEFTFIFVAPVLY-GVHCILAGLSFMLMDIFNVF------------IGMTFSGGLIDFSLFGLLPAGAGVPTKWFMVLLIGVVYAVVYYFLFYFMITKLNLKTPGRDENEEETKLYTKADYQGKKG----NAKSEIVEK----APAVLSALGGEENIVSVDACITRLRVEVKDKAKVDKDELKTLGAAGVMEVG-NGIQAIFGAKADGYKNAINDIL 547
Score = 306, Expect = 1.6e-25, Identities = 95/247 (38%), Positives = 139/247 (56%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFG---NFLQVP------------GNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSL--YGAVI----GINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           +++ ++ K +MLPIA LPIAGI LGVG A++  AG N    V+     F+ +P            G+ +FG LP+LFA+ +A+     D G AALA   G+++   +   L                        G++      P S   YG  I    GI  L  SVFGG + G + A L+++F  I+L  I+GFF+G RFVPI+T + +  V  +   +WP+V   +  +   +  A  I SF +G IERAL+PFGLHH FY+P W+
  S:     3 QYLQRIGKAIMLPIAALPIAGILLGVGGALLGIAGLNNPPSVYEPLIAFVSIPAVTAILTVMKNIGDIIFGNLPILFAVGVAVGLAKKDKGTAALASVFGFIVMNQVISTLLA---------------------LGVTQLGVLTPDSFGEYGTYITTNLGIFTLNMSVFGGIITGIITAILHDRFHEIQLPQILGFFSGSRFVPIITAVTMAIVGAILAFLWPVVQDGIGVIANLVRNAGFIGSFFYGVIERALIPFGLHHVFYTPFWF 250
>gi|188589470|ref|YP_001922539.1| PTS system, glucose-like IIB component [Clostridium botulinum E3 str. Alaska E43] >gi|188499751|gb|ACD52887.1| PTS system, glucose-like IIB component [Clostridium botulinum E3 str. Alaska E43] (550 aa)
Score = 451, Expect = 2.2e-42, Identities = 116/264 (43%), Positives = 169/264 (64%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIF--GLAYAPIYFFLFYFLIKKFNIQTPGRGEN---TRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           +++ GK+ FM+ GLPAAA AM  AA    RK   S+ ++A  TSLLTGITEP+E+TF+F+AP L+ GVH  L  L+F LM+   +             IGM+FSGG+ID+ ++G +    G    W  +   G  YA +Y+FLFYF+I K N++TPGR EN   T+L+TK D++ K      NGS++S   ++  A  V++A GG +NI +VDACIT+LR+++KD+S VD  +L  LGA G ++     + A+FGA+AD  K  I  ++
  S:   301 RFMAGKFPFMMFGLPAAAFAMYRAAAPSKRKTVGSLLLAAAITSLLTGITEPLEFTFIFVAPVLY-GVHCILAGLSFMLMDIFNVF------------IGMTFSGGLIDFSLFGLLPAGAGVPTRWFMVLLIGAVYAVVYYFLFYFMITKLNLKTPGRDENEEETKLYTKADFQGK------NGSAKSEIVEKAPA--VLAALGGEENIVSVDACITRLRVEVKDKSKVDKVELKTLGAAGVMEVG-NGIQAIFGAKADGYKNAINDIL 547
Score = 298, Expect = 1.3e-24, Identities = 92/247 (37%), Positives = 140/247 (56%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFG---NFLQVP------------GNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSL--YGAVI----GINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           +++ ++ K +MLPIA LPIAGI LGVG A++  +G +    V+     F+ +P            G+ +FG LP+LFA+ +A+     D G AALA   G+++   +   L                        G++      P S+  YG  I    GI  L  SVFGG + G + A L+++F  I+L  I+GFF+G RFVPI+T + +  V  +   +WP+V   +  +   +  A  I +F +G IERAL+PFGLHH FY+P W+
  S:     3 QYLQRIGKAIMLPIAALPIAGILLGVGGALLGISGLDNPPAVYEPLIAFVSIPAVTAILTVMKNIGDIIFGNLPILFAVGVAVGLAKKDKGTAALASVFGFIVMNQVISTLLA---------------------LGVTQLGVLTPDSVGEYGTYITTNLGIFTLNMSVFGGIITGIITAILHDRFHEIQLPQILGFFSGSRFVPIITAVTMAVVGAILAFLWPVVQDGIGIVANGVRNAGFIGTFFYGVIERALIPFGLHHVFYTPFWF 250
>gi|157151273|ref|YP_001449821.1| PTS system, IIBC component [Streptococcus gordonii str. Challis substr. CH1] >gi|157076067|gb|ABV10750.1| PTS system, IIBC component [Streptococcus gordonii str. Challis substr. CH1] (730 aa)
Score = 446, Expect = 8.9e-42, Identities = 155/491 (31%), Positives = 252/491 (51%)
  Q:   371 YSAINGTYD---NASIASSSNGAIQSVLTW---------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGM-IDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQL-GARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEV--KPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNES 861
           Y+A+ GTY+    A+  +   G     L W         SN+ S  Q L       FK   VGQ + G +  +I G+ AA    V A  K   K  M   ++    + LTG+TEPIEY F+F+A  L+  +++ +   AF + + + L V + G  E      ++ + G+ +D I +           W + +FG+    I +F+  F+IKKFN  TPGR  N   +   D  ++ +  +  GS +     Q  A+NV++  GG  NI +VDAC+T+LR+ +KD   V T +  +  GA G +    Q V A++G +AD++K +I+ L+++    P       + + +    S+A+EV  K   E V+T ++             G+++++  V D  FS+ MMG G AV+P  GKIYSP+ G ++ VF T HA    TE G ++L+H+G+D+++L      E KPF  +V  G  V  G  + T  L  +K A    + ++V   +
  S:   255 YTALGGTYEVLTGAAKGTQVFGQDPLWLAWVTDLVNLKGSNMASYNQLLEAYHPARFK---VGQMI-GSFGILI-GVAAAIYHNVDADKKHKYKGMM---IATALATFLTGVTEPIEYMFMFVATPLYL-IYSLVQGAAFAMADIVNLRVHSFGSIEFLTRTPLAINAGLGMDIINF----------IWVTILFGV----IMYFIANFMIKKFNYATPGRNGN---YETADGSDESSSAEA-GSGKVAAASQ--AVNVINLLGGRANIVDVDACMTRLRVTVKDAEKVGTEEQWKAEGAMGLVMKG-QGVQAIYGPKADVLKSDIQDLLDSGEVIP-------ETLPSQKAESAATEVAYKGVTEEVETVAD-------------GQVIAIDDVKDPVFSQKMMGDGFAVEPENGKIYSPVSGTVTSVFPTKHALGLLTENGLEVLVHIGLDTVSL------EGKPFEVHVSEGQKVAAGDLLVTADLEAIKAAGRETSTVVVFTNA 705
Score = 255, Expect = 1.3e-19, Identities = 79/260 (30%), Positives = 122/260 (46%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGY--NLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLG----QALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ +A++P AG+ + +G ++         L   G  L+  G  V G L +LFA+AI  ++  +    A A  + +++   +           TG + G   +LL           G     S  + +V+    L   VF G + GF+ A  YNK+ N  KL   + FFNG RFVP V  L    V I+   +WP++   +   G     +   A     F++G +ER L+PFGLHH    P+ YT  GG+ ++   A
  S:    13 EFWQKFGKALMVVVAVMPAAGLMISIGKSLPMINPNFGVLVTTGGVLEQIGWGVIGNLHVLFALAIGGSWAKERAGGAFAAGLSFILINRI-----------TGVMFGVTSDLLKKPDATVHTLLGGTIKVSDYFISVLESPALNMGVFVGIIAGFVGATAYNKYYNFRKLPDALSFFNGKRFVPFVVILRSAIVAIVLSFVWPVIQTGINNFGIWIANSQDTAPVFAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYEVLTGA 268
>gi|167464297|ref|ZP_02329386.1| PTS system, glucose-specific IIABC component [Paenibacillus larvae subsp. larvae BRL-230010] (505 aa)
Score = 445, Expect = 9.7e-42, Identities = 105/270 (38%), Positives = 157/270 (58%)
  Q:   417 GVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLME 686
            +  G ++ GK+ FM+ GLPAAA AM   A  E +KL   I  SA  TS LTGITEPIE++FLF+AP LF  +HA    L+F  M+ + +             IGM+FSGG+ID+I++G I        WW  I  GL  A IY+F+F F+I+KFN++TPGR              ++  ++  G  ++      L + ++ A+GG +NI ++DACIT+LRIQ+ +   V+  +L +LGA G ++    ++ A+FG  +D IK  +K LM+
  S:   266 ALTAGTFMTGKFPFMMFGLPAAALAMYHEAKPEKKKLVAGIMGSAALTSFLTGITEPIEFSFLFVAPLLF-AIHAVFAGLSFMTMHLLNV------------KIGMTFSGGVIDYILFGIIP---NRTPWWLVIPVGLVIAVIYYFMFRFVIRKFNLRTPGR-----------EPEEEENIKAGGGDQN-----ELPVQILEAFGGRENISSLDACITRLRIQVHNVDEVNKDRLKELGAAGVLEVG-NNIQAIFGTRSDTIKSQMKQLMD 503
Score = 359, Expect = 9.7e-32, Identities = 95/246 (38%), Positives = 129/246 (52%)
  Q:    42 FIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVP------------GNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLWY 287
            + K+ K LMLP+A+LP AGI L  G+ +      N        F Q P            GN VF  L LLFA+ +A+      G A LA  IGYL+              T G ++G      Q N+              Y  V+G++ LQ+ VFGG ++G L A+LY +F  I+L   +GFF G RFVPIVT  A   V I+ + IWP     L     ++  +   +++FIFG IER+L+PFGLHH FYSP W+
  S:     8 LLQKVGKALMLPVAILPAAGILLAFGNLL-----HNPDFLQLAPFFQTPIIQGLASVMENSGNIVFSNLSLLFAVGVAVGLAEGEGVAGLAAIIGYLVMNV-----------TMGTILGVTPTLVQENM-------------AYANVLGVDTLQTGVFGGIIIGILAAYLYRRFFKIELPAYLGFFAGKRFVPIVTAAASLLVGIIMVFIWPYAQSGLNAFSHSMVDSNRTLSAFIFGVIERSLIPFGLHHIFYSPFWF 237
>gi|192812201|ref|ZP_03040870.1| PTS system, glucose subfamily, IIA subunit [Geobacillus sp. Y412MC10] >gi|192799348|gb|EDV75859.1| PTS system, glucose subfamily, IIA subunit [Geobacillus sp. Y412MC10] (627 aa)
Score = 444, Expect = 1.3e-41, Identities = 126/439 (28%), Positives = 201/439 (45%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           G ++ G +  M+  LPA A A++  A ++ +       M +     LTG++E IE+ FLF +P+L+  +HA +   A  L     +            H G S+S G ID+++          NAW     G  Y  +Y+FLF + I+ F I TPGR E + L                G +  +     L   ++ A GG DNI  V +C+T+LR+ + +   +D+  L  LG+ G IK    +V  VFG  +++I+  I  LM+                                            +V+ ++P  G ++ + +VPD+ F+  ++G G+A  P  G++ SP+ G +  V+ T HA    T +G ++LIH+GID+  LK        PF   V  GDTV+ GQ +    LA LK HA S  TP+++ N
  S:   233 GDFMAGLFPIMMFALPAIAFAIIQEAREDLKPKVKKTFMRSALVCFLTGVSEQIEFAFLFASPYLYV-LHALMAGFAMVLTYAFDI------------HHGFSYSAGFIDYVL----NFHLSQNAWIIIPIGAVYGIVYYFLFRWAIRTFEIPTPGREEGSAL---------------EGRAGDIPYQAPL---ILEALGGKDNIVQVQSCMTRLRLTVYNDRQIDSDALKLLGSAGIIKLGGGNVQVVFGTYSELIREEINKLMQQ----------------------------------------DLPRVLFSAPVQGRMLPIDEVPDDIFAAKLVGNGVAFIPEKGELVSPVYGTVMHVYPTMHAIGISTPEGLEVLIHIGIDTSQLKG-------PFTAVVSEGDTVEPGQLLVKFDLAYLKTHAASLATPMVITN 590
Score = 194, Expect = 1.5e-12, Identities = 68/245 (27%), Positives = 97/245 (39%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIW--PLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + +L + +MLP   LP A + L VGS          G    G   Q  G+ VF  +P LFAI +A   +   GPA LA   G  I+  +   L                                          G   +Q S   G + G +  ++YN+FK+IKL   I FF G RFV  + F+ LF     ++M+   PLV   L    +          F++G + R L  FGLHH   +  W+
  S:     7 LQQLGRAVMLPTMALPAAALLLSVGSL----PWSAWGFGTLGEIAQAAGHGVFYYMPYLFAIGVAWGLSNQGGPAGLAALAGMFIYDQVISRL------------------------------------------GDGSVQPSTLIGIIFGVMSGYVYNRFKHIKLPEAIQFFGGSRFV--LLFMGLFSTIFAWIMLGTAPLVQRGLDAFYELTVHMGAFGLFLYGILYRVLTAFGLHHLLNNVYWF 205
>gi|194398579|ref|YP_002037405.1| PTS system, IIBCA components [Streptococcus pneumoniae G54] >gi|194358246|gb|ACF56694.1| PTS system, IIBCA components [Streptococcus pneumoniae G54] (495 aa)
Score = 444, Expect = 1.4e-41, Identities = 149/506 (29%), Positives = 249/506 (49%)
  Q:   371 YSAINGTYD---NASIASSSNGAIQSVLTW---------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQL-GARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSP-NLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEI 876
           Y+A+ GTYD    A+  +   G     L W         ++ +  Q  L T+    FK   VGQ +    + M  G+  A    V A  K   K  M   ++    + LTG+TEPIEY F+F+A  ++  V++ +   AF + + + L + + G  E      ++ S G         I +   +  W + +F    A I +F+  F+I+KFN  TPGR  N    T E  +   ++V++   S+        A+N+++  GG  NI +VDAC+T+LR+ +KD   V  A+  +  GA G +    Q V A++G +ADI+K +I+ ++++    P  L S+  +   N+      +E                    V S   G++V+L +V D  F++ MMG G AV+P  G I SP+ G +S +F T HA+   TE G ++L+H+G+D+++L      E KPF  +V  G  V  G  + T  L  ++ A    + ++V       + +K L+K+G +
  S:    24 YTALGGTYDILTGAAKGTQVFGQDPLWLAWVTDLVNLKGTDASQYQHLLDTVHPARFK---VGQMIGSFGILM--GVIVAIYRNVDADKKHKYKGMM---IATALATFLTGVTEPIEYMFMFIATPMYL-VYSLVQGAAFAMADVVNLRMHSFGSIEFLTRTPIAISAG---------IGMDIVNFVWVTVLF----AVIMYFIANFMIQKFNYATPGRNGNYE--TAEGSEETSSEVKVAAGSQ--------AVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKAEGAMGLVMKG-QGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEAQQNTVHFKDLTEE-------------------VYSVADGQVVALEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAFGIVTEAGLEVLVHIGLDTVSL------EGKPFTVHVAEGQKVAAGDLLVTADLDAIRAAGRETSTVVVFTNGDAIKSVK-LEKTGSL 484
Score = 94, Expect = 5.1e-01, Identities = 17/37 (45%), Positives = 24/37 (64%)
  Q:   264 IFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           ++G +ER L+PFGLHH    P+ YT  GG+ D+   A
  S:     1 MYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGA 37
>gi|182624609|ref|ZP_02952391.1| PTS system, IIBC component [Clostridium perfringens D str. JGS1721] >gi|177910213|gb|EDT72601.1| PTS system, IIBC component [Clostridium perfringens D str. JGS1721] (551 aa)
Score = 443, Expect = 2.0e-41, Identities = 174/653 (26%), Positives = 284/653 (43%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDAL-----SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGG----MIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           K+ K  + +F  K  K L++ +A++P AG+ + +G  +       + ++     ++  G A+ G L LLFA+AI  ++  +    A A  I +++   +   +     +    D+T  V  +              G   L    + +V+G   L   VF G + GFL A LYNK+ N  KL   + FFNG RFVP +  +      I+   +WP V   L   GQ +      A  I  F++G +ER L+PFGLHH    P+ YT+                G  Y +L   TA  +                     AG   +W            W+ +L++          +  A                 ++TS  Q +G++    FK         G+ +     L   A AM      + +K   S+  SA     LTG+TEPIE+ F+F++P L+  V+A +  L F + + I L V A G  EL     +  + G    +I++II   +           F F      + +F+F FLIKKF I TPGR  N        Y + +++     SS S ++   LA+  +   GG +NI +VDAC+T+LR+ +KD   V   K  +      +    + V A++G +AD++K +I+ ++
  S:     2 KKFKLGSFDFWQKFGKALLVVVAVMPAAGLMISIGKVMGIYID-VDFIKTIARVMEDIGWAIIGNLNLLFAVAIGGSWAKERAGGAFAGTIAFVLINRITGVIFSVSNAMLAGDSTATVQSFT-------------GQTLLVKDYFVSVLGAPALNMGVFVGIISGFLGAALYNKYYNYNKLPNALAFFNGKRFVPFMVIIGSTISAIILSFVWPFVQYGLNTFGQWIATSKDTAPIIAPFLYGTLERLLLPFGLHHMLTVPVNYTEL---------------GGVYHILTGPTAGQVV--------------------AGQDPLWL----------AWITDLNN----------FKQAG----------------DITSYNQLIGSVVPARFKA--------GQVILSSASLIGVALAMYKNVDPDKKKKYKSVFFSAAIAVFLTGVTEPIEFMFMFISPILYV-VYAVIAGLGFAIADIINLRVHAFGFIELITRSPLMINAGLTKDLINFIIVAVV-----------FFF------LNYFVFSFLIKKFKIATPGRMGN--------YIDNEDENTNKASSNSKSSMDELAVKAIELLGGKENIVDVDACMTRLRVTVKDIEKVGDEKAWKDNKALGLIVKDKGVQAIYGPKADVLKSDIQDIL 549
>gi|169344246|ref|ZP_02865228.1| PTS system, glucose-specific IIBC component [Clostridium perfringens C str. JGS1495] >gi|169297705|gb|EDS79805.1| PTS system, glucose-specific IIBC component [Clostridium perfringens C str. JGS1495] (509 aa)
Score = 441, Expect = 2.7e-41, Identities = 107/268 (39%), Positives = 160/268 (59%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIF-GLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENI 688
           G ++ GK+ FM+ GLPAAA AM   A    +K+A  I  SA  TS LTGITEP+E+ FLF+AP LF  +H  L  L+F +M  + +             IGM+FSGG++D+I+ G I        WW  I  GL +A +Y+FLF F I+KF+++TPGR E+  +F  +D  N           E++N+D  LA  ++ A GG  NI  +DACIT+LR+ + D S V+  +L +LGA G ++   +++ A+FG ++DI+K  I+ +M  +
  S:   271 GTFMTGKFPFMMFGLPAAALAMYHEAKPGKKKIASGILFSAALTSFLTGITEPLEFAFLFVAPILF-AIHCVLAGLSFMIMQLLNV------------KIGMTFSGGLLDFILLGVIP---NRTRWWLVILVGLGFAVVYYFLFRFFIRKFDLKTPGR-EDDDIF--DDMHN-----------ETVNDD--LAAEILIALGGAGNINKLDACITRLRVTVNDSSKVNKERLKELGAAGVMQVG-ENIQAIFGGKSDILKTQIREIMNGM 506
Score = 320, Expect = 3.7e-27, Identities = 92/261 (35%), Positives = 142/261 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI----------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSIDLTQNAIIY 303
           + ++ K LMLP+A+LP AG+ LG GS              NAG     ++    +   GN +F  L LLFA+ +A+  +   G A LA  +G+LI          +VT   G  I  +++             A   + +Y  V+GI  LQ+ VFGG ++G + A LY +F  I+L   +GFF G RFVPI+T ++   +  + + +WP +  AL +  Q +  A   +++ +FG IERAL+PFGLHH +Y+P W     YT   G + +  N I +
  S:     8 LQRIGKALMLPVALLPAAGLLLGFGSMFQDPQFLSLVPALNAGW---FQLIATIMSDAGNIIFSNLALLFAVGVAVGLSEGDGVAGLAAIVGFLIL---------NVTMGIGGGITADIV-------------AGTKNGMYATVLGIPTLQTGVFGGIIMGVIAATLYKRFYKIELPSYLGFFAGKRFVPIITAISALILGGIMVFVWPPIQGALLYFSQNMISANQTLSALLFGIIERALIPFGLHHIWYNPFWFQFGEYTNKAGQLIMGDNQIFF 259
>gi|148985892|ref|ZP_01818986.1| PTS system, IIABC component [Streptococcus pneumoniae SP3-BS71] >gi|147922038|gb|EDK73162.1| PTS system, IIABC component [Streptococcus pneumoniae SP3-BS71] (725 aa)
Score = 439, Expect = 5.6e-41, Identities = 149/506 (29%), Positives = 250/506 (49%)
  Q:   371 YSAINGTYD---NASIASSSNGAIQSVLTW---------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQL-GARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSP-NLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEI 876
           Y+A+ GTYD    A+  +   G     L W         ++ +  Q  L T+    FK   VGQ +    + M  G+  A    V A  K   K  M   ++    + LTG+TEPIEY F+F+A  ++  V++ +   AF + + + L + + G  E      ++ S G         I +   +  W + +F    A I +F+  F+I+KFN  TPGR  N    T E  +   ++V++   S+        A+N+++  GG  NI +VDAC+T+LR+ +KD   V  A+  +  GA G +    Q V A++G +ADI+K +I+ ++++    P  L S+  ++  N+      +E                    V S   G++V+L +V D  F++ MMG G AV+P  G I SP+ G +S +F T HA+   TE G ++L+H+G+D+++L      E KPF  +V  G  V  G  + T  L  ++ A    + ++V       + +K L+K+G +
  S:   254 YTALGGTYDILTGAAKGTQVFGQDPLWLAWVTDLVNLKGTDASQYQHLLDTVHPARFK---VGQMIGSFGILM--GVIVAIYRNVDADKKHKYKGMM---IATALATFLTGVTEPIEYMFMFIATPMYL-VYSLVQGAAFAMADVVNLRMHSFGSIEFLTRTPIAISAG---------IGMDIVNFVWVTVLF----AVIMYFIANFMIQKFNYATPGRNGNYE--TAEGSEETSSEVKVAAGSQ--------AVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKAEGAMGLVMKG-QGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEVQQNTVHFKDLTEE-------------------VYSVADGQVVALEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAFGIVTEAGLEVLVHIGLDTVSL------EGKPFTVHVAEGQKVAAGDLLVTADLNAIRAAGRETSTVVVFTNGDAIKSVK-LEKTGSL 714
Score = 247, Expect = 1.1e-18, Identities = 82/260 (31%), Positives = 125/260 (48%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGY--NLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G +IV        L + G  L+  G  V G L +LFA+AI  ++  +    A A  + +++   +           TG + G   ++L     +     G +   +  + +V+    L   VF G + GF+ A  YNK+ N  KL   + FFNG RFVP V  L      IL    WP+V   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ D+   A
  S:    12 EFWQKFGKALMVVIAVMPAAGLMISIGKSIVMINPTFAPLVITGGILEQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLAFILINRI-----------TGTIFGVSGDMLKNPDAMVTTFFGGSIKVADYFISVLEAPALNMGVFVGIISGFVGATAYNKYYNFRKLPDALSFFNGKRFVPFVVILRSAIAAILLAAFWPVVQTGINNFGIWIANSQETAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGA 267
>gi|15902712|ref|NP_358262.1| PTS system, IIABC components [Streptococcus pneumoniae R6] >gi|116517154|ref|YP_816155.1| PTS system, IIABC components [Streptococcus pneumoniae D39] >gi|182683678|ref|YP_001835425.1| PTS system, IIABC components [Streptococcus pneumoniae CGSP14] >gi|15458255|gb|AAK99472.1| PTS glucose-specific enzyme IIABC component [Streptococcus pneumoniae R6] >gi|116077730|gb|ABJ55450.1| PTS system, IIABC components [Streptococcus pneumoniae D39] >gi|182629012|gb|ACB89960.1| PTS system, IIABC components [Streptococcus pneumoniae CGSP14] (726 aa)
Score = 439, Expect = 5.6e-41, Identities = 149/506 (29%), Positives = 250/506 (49%)
  Q:   371 YSAINGTYD---NASIASSSNGAIQSVLTW---------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQL-GARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSP-NLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEI 876
           Y+A+ GTYD    A+  +   G     L W         ++ +  Q  L T+    FK   VGQ +    + M  G+  A    V A  K   K  M   ++    + LTG+TEPIEY F+F+A  ++  V++ +   AF + + + L + + G  E      ++ S G         I +   +  W + +F    A I +F+  F+I+KFN  TPGR  N    T E  +   ++V++   S+        A+N+++  GG  NI +VDAC+T+LR+ +KD   V  A+  +  GA G +    Q V A++G +ADI+K +I+ ++++    P  L S+  ++  N+      +E                    V S   G++V+L +V D  F++ MMG G AV+P  G I SP+ G +S +F T HA+   TE G ++L+H+G+D+++L      E KPF  +V  G  V  G  + T  L  ++ A    + ++V       + +K L+K+G +
  S:   255 YTALGGTYDILTGAAKGTQVFGQDPLWLAWVTDLVNLKGTDASQYQHLLDTVHPARFK---VGQMIGSFGILM--GVIVAIYRNVDADKKHKYKGMM---IATALATFLTGVTEPIEYMFMFIATPMYL-VYSLVQGAAFAMADVVNLRMHSFGSIEFLTRTPIAISAG---------IGMDIVNFVWVTVLF----AVIMYFIANFMIQKFNYATPGRNGNYE--TAEGSEETSSEVKVAAGSQ--------AVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKAEGAMGLVMKG-QGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEVQQNTVHFKDLTEE-------------------VYSVADGQVVALEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAFGIVTEAGLEVLVHIGLDTVSL------EGKPFTVHVAEGQKVAAGDLLVTADLNAIRAAGRETSTVVVFTNGDAIKSVK-LEKTGSL 715
Score = 247, Expect = 1.1e-18, Identities = 82/260 (31%), Positives = 125/260 (48%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGY--NLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G +IV        L + G  L+  G  V G L +LFA+AI  ++  +    A A  + +++   +           TG + G   ++L     +     G +   +  + +V+    L   VF G + GF+ A  YNK+ N  KL   + FFNG RFVP V  L      IL    WP+V   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ D+   A
  S:    13 EFWQKFGKALMVVIAVMPAAGLMISIGKSIVMINPTFAPLVITGGILEQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLAFILINRI-----------TGTIFGVSGDMLKNPDAMVTTFFGGSIKVADYFISVLEAPALNMGVFVGIISGFVGATAYNKYYNFRKLPDALSFFNGKRFVPFVVILRSAIAAILLAAFWPVVQTGINNFGIWIANSQETAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGA 268
>gi|163790806|ref|ZP_02185231.1| hypothetical protein CAT7_07103 [Carnobacterium sp. AT7] >gi|159873874|gb|EDP67953.1| hypothetical protein CAT7_07103 [Carnobacterium sp. AT7] (629 aa)
Score = 438, Expect = 7.2e-41, Identities = 101/300 (33%), Positives = 171/300 (56%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGE---NTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEV 720
            ++  G + FMI G PAAA AM   A  E +K    + MS+  TS+ TGITEP+E++FLF +P+L++GVH  L A +F +M+++ +             +G++FSGG++D+++YG +  Q  +N     + G+ YA +Y+F+F F I KF+++TPGR +    ++++TK DY+ K  K     ++E + ++  ++ ++++  GG DN+ +VD C T+LR+ IKD  +VD A+L   GA G +     +   ++G +   IK NI               EY    + +SD +S   V P  E+
  S:   281 AKFFSGMFPFMIFGFPAAAYAMYQTAKPERKKDVKGLMMSSSLTSIFTGITEPLEFSFLFASPFLYFGVHCVLAAFSFVIMHFLNV------------GVGLTFSGGLLDFVLYGILPGQGITNWIPVVLVGIVYALVYYFVFRFFITKFDLKTPGREDEVAESKMYTKADYQAK--KAGEKATNEPIQDE--MSQDIIAGLGGKDNLIDVDNCATRLRVTIKDGKLVDQAQLKATGAAGVVVKG-NNAQVIYGPKVSNIKSNI--------------DEYLASTSTASDATSTKSVNPADEM 552
Score = 360, Expect = 7.6e-32, Identities = 91/261 (34%), Positives = 143/261 (54%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGN---------EGLRVFG--NFLQVPGNAVFGALPLLFAIAIAIAFTGDAGP-AALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGI-NQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAI 301
           E + K+ K  MLPIA+LP+AG+ LG+GS+    +            EG  ++G    L+  G  +F  LPLLFA+ +A+     A   AAL+  + YL+   +  +L+ S+T+                 FG S         L G+V+G    + + VFGG ++G +VA L+N++  I+L   + FF+G RF+PIV+  A   V ++    WP  G A+ +LG  +     + +F++GFI RAL+P GLHH FY P W T  GG+ ++    +
  S:     7 EGLQKMGKTFMLPIALLPVAGLLLGIGSSFTGESFVGLYDLEWLLGEGTILYGILTVLKDCGTIIFDNLPLLFAVGVALGMAKAAKEVAALSAVVAYLM---MYASLTSSITN-----------------FG-SIETLQQTPGLIGSVLGFETTMNTGVFGGIIMGLVVATLHNRYYKIELPDALSFFSGTRFIPIVSAFAAVIVGMILAFAWPYAGAAIAWLGSVVADLGYVGTFLYGFIYRALIPLGLHHVFYLPFWQTALGGTAEINGTVV 259
>gi|27363661|ref|NP_759189.1| phosphotransferase system IIB component [Vibrio vulnificus CMCP6] >gi|27359777|gb|AAO08716.1|AE016797_171 Phosphotransferase system IIB component [Vibrio vulnificus CMCP6] (509 aa)
Score = 438, Expect = 7.7e-41, Identities = 173/637 (27%), Positives = 268/637 (42%)
  Q:    51 MLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVP-----GNAVFGALPLLFAIAIAIAFTGDAGPAALACFIG-YLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           MLPIA LP+A + L +G                G+ L +P     G A+FG LPLLF + IAI  + D   AA       Y +  +    +  S+          N+ F+ G I G+ AG++                                 YN F   +L   + FF+G R VPI+  L       +  ++WP +   L  L  A+  +  +  F++G + RAL+P GLHH   S  W+                  G    +L T    +  +   L   L  +  +     AG    + F NA     +  +KE++                  +  +G +           G +  G    NGF  V +   L G  + M L  PA           E R        S  F S LTGITEP+E+ F+FLAP L+  +HA    LA  + N  G     T H       G  FS G+ID+++   +     +  +   + GLA+  +YFF F+F I+ FN+++PGR         ED  ++ +      S ++ + D  LA   + A GG +N+ ++DACIT+LR+ +KD+SV D A L +LGA+G +K    ++  + G  A+I+ G +K +  N
  S:     1 MLPIATLPVAALLLRLGQ---------------GDLLDIPFMAQAGGAIFGQLPLLFGLGIAIGLSKDGQGAAGLAGAVAYFVLTATATTIDASI----------NMSFFGGIIGGIIAGHS---------------------------------YNAFHATRLPEWLAFFSGKRLVPIMAGLFSLVAGAVAGVVWPSIQGGLDALAHAVSTSGAVGQFVYGTLNRALIPVGLHHVLNSYFWFGM----------------GTCQEILVTGAQAAGQALPAL-QQLCVDPALAKTLVAGQTHTFEFANAVTPEITATVKEVTE-----------------TVKSGDLHRFF------GGDKGAGVF-MNGFFPVMMFG-LPGAALAMYLAAPA-----------EKRSQVGGALFSVAFCSFLTGITEPLEFMFVFLAPALY-ALHAVFTGLALVVANMFG-----TLH-------GFGFSAGLIDFLLNWGL----ATKPFVLLLIGLAFGALYFFTFFFAIRAFNLKSPGR---------EDDDSETSA----ASGDAKSGD--LARQYLKALGGHENLTSIDACITRLRLTLKDRSVADEAVLKKLGAKGVVKLGENNLQVILGPLAEIVAGEMKAIGVN 500
>gi|149003376|ref|ZP_01828265.1| PTS system, IIABC component [Streptococcus pneumoniae SP14-BS69] >gi|147758559|gb|EDK65557.1| PTS system, IIABC component [Streptococcus pneumoniae SP14-BS69] (654 aa)
Score = 438, Expect = 7.9e-41, Identities = 149/506 (29%), Positives = 249/506 (49%)
  Q:   371 YSAINGTYD---NASIASSSNGAIQSVLTW---------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQL-GARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSP-NLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEI 876
           Y+A+ GTYD    A+  +   G     L W         ++ +  Q  L T+    FK   VGQ +    + M  G+  A    V A  K   K  M   ++    + LTG+TEPIEY F+F+A  ++  V++ +   AF + + + L + + G  E      ++ S G         I +   +  W + +F    A I +F+  F+I+KFN  TPGR  N    T E  +   ++V++   S+        A+N+++  GG  NI +VDAC+T+LR+ +KD   V  A+  +  GA G +    Q V A++G +ADI+K +I+ ++++    P  L S+  +   N+      +E                    V S   G++V+L +V D  F++ MMG G AV+P  G I SP+ G +S +F T HA+   TE G ++L+H+G+D+++L      E KPF  +V  G  V  G  + T  L  ++ A    + ++V       + +K L+K+G +
  S:   183 YTALGGTYDILTGAAKGTQVFGQDPLWLAWVTDLVNLKGTDASQYQHLLDTVHPARFK---VGQMIGSFGILM--GVIVAIYRNVDADKKHKYKGMM---IATALATFLTGVTEPIEYMFMFIATPMYL-VYSLVQGAAFAMADVVNLRMHSFGSIEFLTRTPIAISAG---------IGMDIVNFVWVTVLF----AVIMYFIANFMIQKFNYATPGRNGNYE--TAEGSEETSSEVKVAAGSQ--------AVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKAEGAMGLVMKG-QGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEAQQNTVHFKDLTEE-------------------VYSVADGQVVALEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAFGIVTEAGLEVLVHIGLDTVSL------EGKPFTVHVAEGQKVAAGDLLVTADLDAIRAAGRETSTVVVFTNGDAIKSVK-LEKTGSL 643
Score = 189, Expect = 5.2e-12, Identities = 56/145 (38%), Positives = 77/145 (53%)
  Q:   156 GNIFGLSA----GNAALPSSLYGAVIGINQ----------LQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           G IFG+S        A+ ++ +G  I +            L   VF G + GF+ A  YNK+ N  KL   + FFNG RFVP V  L      IL    WP+V   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ D+   A
  S:    33 GTIFGVSGDMLKNPDAMVTTFFGGSIKVADYFISVLEAPALNMGVFVGIISGFVGATAYNKYYNFRKLPDALSFFNGKRFVPFVVILRSAIAAILLAAFWPVVQTGINNFGIWIANSQETAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGA 196
>gi|194539204|ref|YP_002074260.1| pts system, N-acetylglucosamine-specific iibc component [Vibrio sp. Ex25] >gi|151937759|gb|EDN56608.1| pts system, N-acetylglucosamine-specific iibc component [Vibrio sp. Ex25] (523 aa)
Score = 437, Expect = 9.6e-41, Identities = 178/650 (27%), Positives = 269/650 (41%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIG-YLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWII-YGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           N   +  KL K LMLPIA LPIAG+ L +G   V +            F+   GN++F  LPLLF + IAI  + D   AA       Y +  +    +  SV          N+ F+ G I G+ AG++                                 YN F   +L   + FF+G R VPI+  L       +  ++WP +   L  L   +  +  I  FI+G + RAL+P GLHH   S  W+                  G    VL T  A +       +  L  +  +     AG    + F N+     +  +KE++                  +  +G +           G ++ G    NGF  V +   L G  + M L  PA           E R        S  F S LTGITEP+E+ F+FLAP L+  +HA    L+  + N +G     T H       G +FS G+ID+++ YG       +        GL +  +YFF F F I+ FN+++PGR ++             +      + E  + D  LA   + A GG DN+ ++DACIT+LR+ +KD+SV D   L +LGA+G +K    ++  + G  A+I+ G +K +  N
  S:     2 NILGYAQKLGKALMLPIATLPIAGLLLRLGQPDVFDIA----------FMAQAGNSIFSNLPLLFGLGIAIGLSKDGQGAAGLAGAVAYFVLTATASTIDASV----------NMSFFGGIIAGIIAGHS---------------------------------YNAFHATRLPEWLAFFSGKRLVPIMAGLFALVAGAVGGIVWPTIQGGLDALAHGISTSGAIGQFIYGTLNRALIPVGLHHVLNSFFWFGM----------------GSCQEVLVTG-ANAAGQALPALQQLCVDPALAKTLVAGQTHTFEFANSVTPEITATVKEVTE-----------------TVKSGDLHRFF------GGDKSAGVF-MNGFFPVMMFG-LPGAALAMYLAAPA-----------EKRSQVGGALFSVAFCSFLTGITEPLEFMFVFLAPALY-AIHAVFTGLSLVVANMLG-----TLH-------GFTFSAGLIDYLLNYG-----LATKPLLLGAVGLGFGALYFFTFSFAIRAFNLKSPGREDD-------------DSEAAAPAGEKKSGD--LARQYLKALGGHDNLTSIDACITRLRLTLKDRSVADEEVLKKLGAKGVVKLGENNLQVILGPLAEIVAGEMKAIGAN 514
>gi|169833942|ref|YP_001694220.1| pts system, IIBC component [Streptococcus pneumoniae Hungary19A-6] >gi|168996444|gb|ACA37056.1| pts system, iibc component [Streptococcus pneumoniae Hungary19A-6] (726 aa)
Score = 436, Expect = 1.3e-40, Identities = 149/506 (29%), Positives = 249/506 (49%)
  Q:   371 YSAINGTYD---NASIASSSNGAIQSVLTW---------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQL-GARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSP-NLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEI 876
           Y+A+ GTYD    A+  +   G     L W         ++ +  Q  L T+    FK   VGQ +    + M  G+  A    V A  K   K  M   ++    + LTG+TEPIEY F+F+A  ++  V++ +   AF + + + L + + G  E      ++ S G         I +   +  W + +F    A I +F+  F+I+KFN  TPGR  N    T E  +   ++V++   S+        A+N+++  GG  NI +VDAC+T+LR+ +KD   V  A+  +  GA G +    Q V A++G +ADI+K +I+ ++++    P  L S+  +   N+      +E                    V S   G++V+L +V D  F++ MMG G AV+P  G I SP+ G +S +F T HA+   TE G ++L+H+G+D+++L      E KPF  +V  G  V  G  + T  L  ++ A    + ++V       + +K L+K+G +
  S:   255 YTALGGTYDILTGAAKGTQVFGQDPLWLAWVTDLVNLKGTDASQYQHLLDTVHPARFK---VGQMIGSFGILM--GVIVAIYRNVDADKKHKYKGMM---IATALATFLTGVTEPIEYMFMFIATPMYL-VYSLVQGAAFAMADVVNLRMHSFGSIEFLTRTPIAISAG---------IGMDIVNFVWVTVLF----AVIMYFIANFMIQKFNYATPGRNGNYE--TAEGSEETSSEVKVAAGSQ--------AVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKAEGAMGLVMKG-QGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEAQQNTVHFKDLTEE-------------------VYSVADGQVVALEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAFGIVTEAGLEVLVHIGLDTVSL------EGKPFTVHVAEGQKVTAGDLLVTADLDAIRAAGRETSTVVVFTNGDAIKSVK-LEKTGSL 715
Score = 247, Expect = 9.7e-19, Identities = 82/260 (31%), Positives = 125/260 (48%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGY--NLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G +IV        L + G  L+  G  V G L +LFA+AI  ++  +    A A  + +++   +           TG + G   ++L     +     G +   +  + +V+    L   VF G + GF+ A  YNK+ N  KL   + FFNG RFVP V  L      IL    WP+V   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ D+   A
  S:    13 EFWQKFGKALMVVIAVMPAAGLMISIGKSIVMINPTFTPLVITGGILEQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLAFILINRI-----------TGTIFGVSGDMLKNPDAMVTTFFGGSIKVADYFISVLEAPALNMGVFVGIISGFVGATAYNKYYNFRKLPDALSFFNGKRFVPFVVILRSAIAAILLAAFWPVVQTGINNFGIWIANSQETAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGA 268
>gi|89074520|ref|ZP_01160992.1| PTS system, maltose and glucose-specific IIABC component (malX) [Photobacterium sp. SKA34] >gi|89049624|gb|EAR55183.1| PTS system, maltose and glucose-specific IIABC component (malX) [Photobacterium sp. SKA34] (538 aa)
Score = 436, Expect = 1.3e-40, Identities = 107/277 (38%), Positives = 159/277 (57%)
  Q:   407 LGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI--FGLAYAPIYFFLFYFLIKKFNIQTPGR-GENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLM--QLGARGTIKPSPQSVYAVFGAEADIIKGNIKT 683
            G++    +   +   ++ GK+ FM+ GLPAAA AM   A KEN+K    +  S   T+ LTGITEPIE+TFLFL+  L++ +H  L  L+F +M+ + +             +GM+FSGG ID+ ++G +    G+   W +I   GL Y P+YF LF + I KF+I+TPGR G    +  K+DY+  +     +GS +S  N+ + AL      GG DNI +VDACIT+LRI +KD  +V   K     LGA+G +K     + A++GA+A   K  I +
  S:   275 FGSLANGDYSQFSSTNFMTGKFPFMMFGLPAAAYAMYTLADKENKKEVAGLLFSVALTAFLTGITEPIEFTFLFLSAPLYYFIHVPLAGLSFMIMDLLNV------------KVGMTFSGGFIDFTLFGMLPGLTGTENHWYYIPLLGLIYGPVYFLLFRWFILKFDIKTPGRKGSAVAVVRKKDYQAAKG----SGSDDSQINEMIEAL------GGKDNIVDVDACITRLRITVKDGELVKDNKYWTENLGAKGLVKVGGTGIQAIYGAQAAGFKAQINS 534
Score = 396, Expect = 5.3e-36, Identities = 112/257 (43%), Positives = 149/257 (57%)
  Q:    40 KEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVT-------NAGGNEGLRVFGNFLQV---PGNAVFGALPLLFAIAIAIAFT-GDAGPAALACFIGYLIFGS-LQDALSQS-VTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGI-NQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVG-----INSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDL 296
           K F +KLS+ +MLPIA+LP AGI LG+G +          N G  +   +  +FLQV    G+ +F  LPLLFA+AIAI F   + G AALA  I YLI  + +   LS + + DTT   +      Y G               +   V+GI N L   VFGG + G + A L+NK+ +IKL   +GFF G RFVPIV+  +     I  + IWP +G     +G  LG+        I SFIFG IERAL+P GLHH FY PLW T+ GG+ ++
  S:     2 KAFFSKLSQAVMLPIALLPAAGIMLGLGGSFTNQSMIDAYNIGILQDGTLLNSFLQVMTAAGDIIFANLPLLFALAIAIGFARAEKGAAALAATISYLIMNTAIAKTLSVAGMVDTTNNTVILMGTHYAG---------------VLADVLGIHNTLSMGVFGGLIAGGITAVLHNKYHDIKLPEFLGFFGGARFVPIVSAFSALFYGIALVFIWPYIGAVFGSIGATLGEMTASGHGYIASFIFGIIERALIPVGLHHVFYLPLWQTEIGGTAEI 262
>gi|148989838|ref|ZP_01821132.1| PTS system, IIABC component [Streptococcus pneumoniae SP6-BS73] >gi|147924780|gb|EDK75864.1| PTS system, IIABC component [Streptococcus pneumoniae SP6-BS73] (725 aa)
Score = 435, Expect = 1.4e-40, Identities = 149/506 (29%), Positives = 249/506 (49%)
  Q:   371 YSAINGTYD---NASIASSSNGAIQSVLTW---------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQL-GARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSP-NLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEI 876
           Y+A+ GTYD    A+  +   G     L W         ++ +  Q  L T+    FK   VGQ +    + M  G+  A    V A  K   K  M   ++    + LTG+TEPIEY F+F+A  ++  V++ +   AF + + + L + + G  E      ++ S G         I +   +  W + +F    A I +F+  F+I+KFN  TPGR  N    T E  +   ++V++   S+        A+N+++  GG  NI +VDAC+T+LR+ +KD   V  A+  +  GA G +    Q V A++G +ADI+K +I+ ++++    P  L S+  +   N+      +E                    V S   G++V+L +V D  F++ MMG G AV+P  G I SP+ G +S +F T HA+   TE G ++L+H+G+D+++L      E KPF  +V  G  V  G  + T  L  ++ A    + ++V       + +K L+K+G +
  S:   254 YTALGGTYDILTGAAKGTQVFGQDPLWLAWVTDLVNLKGTDASQYQHLLDTVHPARFK---VGQMIGSFGILM--GVIVAIYRNVDADKKHKYKGMM---IATALATFLTGVTEPIEYMFMFIATPMYL-VYSLVQGAAFAMADVVNLRMHSFGSIEFLTRTPIAISAG---------IGMDIVNFVWVTVLF----AVIMYFIANFMIQKFNYATPGRNGNYE--TAEGSEETSSEVKVAAGSQ--------AVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKAEGAMGLVMKG-QGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEAQQNTVHFKDLTEE-------------------VYSVADGQVVALEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAFGIVTEAGLEVLVHIGLDTVSL------EGKPFTVHVAEGQKVTAGDLLVTADLDAIRAAGRETSTVVVFTNGDAIKSVK-LEKTGSL 714
Score = 247, Expect = 1.0e-18, Identities = 82/260 (31%), Positives = 125/260 (48%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGY--NLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G +IV        L + G  L+  G  V G L +LFA+AI  ++  +    A A  + +++   +           TG + G   ++L     +     G +   +  + +V+    L   VF G + GF+ A  YNK+ N  KL   + FFNG RFVP V  L      IL    WP+V   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ D+   A
  S:    12 EFWQKFGKALMVVIAVMPAAGLMISIGKSIVMINPTFTPLVITGGILEQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLAFILINRI-----------TGTIFGVSGDMLKNPDAMVTTFFGGSIKVADYFISVLEAPALNMGVFVGIISGFVGATAYNKYYNFRKLPDALSFFNGKRFVPFVVILRSAIAAILLAAFWPVVQTGINNFGIWIANSQETAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGA 267
>gi|148997166|ref|ZP_01824820.1| PTS system, IIABC component [Streptococcus pneumoniae SP11-BS70] >gi|183603809|ref|ZP_02721353.2| pts system, iibc component [Streptococcus pneumoniae MLV-016] >gi|147756866|gb|EDK63906.1| PTS system, IIABC component [Streptococcus pneumoniae SP11-BS70] >gi|183578657|gb|EDT99185.1| pts system, iibc component [Streptococcus pneumoniae MLV-016] (726 aa)
Score = 435, Expect = 1.4e-40, Identities = 149/506 (29%), Positives = 249/506 (49%)
  Q:   371 YSAINGTYD---NASIASSSNGAIQSVLTW---------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQL-GARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSP-NLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEI 876
           Y+A+ GTYD    A+  +   G     L W         ++ +  Q  L T+    FK   VGQ +    + M  G+  A    V A  K   K  M   ++    + LTG+TEPIEY F+F+A  ++  V++ +   AF + + + L + + G  E      ++ S G         I +   +  W + +F    A I +F+  F+I+KFN  TPGR  N    T E  +   ++V++   S+        A+N+++  GG  NI +VDAC+T+LR+ +KD   V  A+  +  GA G +    Q V A++G +ADI+K +I+ ++++    P  L S+  +   N+      +E                    V S   G++V+L +V D  F++ MMG G AV+P  G I SP+ G +S +F T HA+   TE G ++L+H+G+D+++L      E KPF  +V  G  V  G  + T  L  ++ A    + ++V       + +K L+K+G +
  S:   255 YTALGGTYDILTGAAKGTQVFGQDPLWLAWVTDLVNLKGTDASQYQHLLDTVHPARFK---VGQMIGSFGILM--GVIVAIYRNVDADKKHKYKGMM---IATALATFLTGVTEPIEYMFMFIATPMYL-VYSLVQGAAFAMADVVNLRMHSFGSIEFLTRTPIAISAG---------IGMDIVNFVWVTVLF----AVIMYFIANFMIQKFNYATPGRNGNYE--TAEGSEETSSEVKVAAGSQ--------AVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKAEGAMGLVMKG-QGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEAQQNTVHFKDLTEE-------------------VYSVADGQVVALEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAFGIVTEAGLEVLVHIGLDTVSL------EGKPFTVHVAEGQKVAAGDLLVTADLDAIRAAGRETSTVVVFTNGDAIKSVK-LEKTGSL 715
Score = 247, Expect = 1.0e-18, Identities = 82/260 (31%), Positives = 125/260 (48%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGY--NLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G +IV        L + G  L+  G  V G L +LFA+AI  ++  +    A A  + +++   +           TG + G   ++L     +     G +   +  + +V+    L   VF G + GF+ A  YNK+ N  KL   + FFNG RFVP V  L      IL    WP+V   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ D+   A
  S:    13 EFWQKFGKALMVVIAVMPAAGLMISIGKSIVMINPTFTPLVITGGILEQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLAFILINRI-----------TGTIFGVSGDMLKNPDAMVTTFFGGSIKVADYFISVLEAPALNMGVFVGIISGFVGATAYNKYYNFRKLPDALSFFNGKRFVPFVVILRSAIAAILLAAFWPVVQTGINNFGIWIANSQETAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGA 268
>gi|149020400|ref|ZP_01835292.1| PTS system, IIABC component [Streptococcus pneumoniae SP23-BS72] >gi|147930702|gb|EDK81684.1| PTS system, IIABC component [Streptococcus pneumoniae SP23-BS72] (725 aa)
Score = 435, Expect = 1.5e-40, Identities = 149/506 (29%), Positives = 249/506 (49%)
  Q:   371 YSAINGTYD---NASIASSSNGAIQSVLTW---------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQL-GARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSP-NLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEI 876
           Y+A+ GTYD    A+  +   G     L W         ++ +  Q  L T+    FK   VGQ +    + M  G+  A    V A  K   K  M   ++    + LTG+TEPIEY F+F+A  ++  V++ +   AF + + + L + + G  E      ++ S G         I +   +  W + +F    A I +F+  F+I+KFN  TPGR  N    T E  +   ++V++   S+        A+N+++  GG  NI +VDAC+T+LR+ +KD   V  A+  +  GA G +    Q V A++G +ADI+K +I+ ++++    P  L S+  +   N+      +E                    V S   G++V+L +V D  F++ MMG G AV+P  G I SP+ G +S +F T HA+   TE G ++L+H+G+D+++L      E KPF  +V  G  V  G  + T  L  ++ A    + ++V       + +K L+K+G +
  S:   254 YTALGGTYDILTGAAKGTQVFGQDPLWLAWVTDLVNLKGTDASQYQHLLDTVHPARFK---VGQMIGSFGILM--GVIVAIYRNVDADKKHKYKGMM---IATALATFLTGVTEPIEYMFMFIATPMYL-VYSLVQGAAFAMADVVNLRMHSFGSIEFLTRTPIAISAG---------IGMDIVNFVWVTVLF----AVIMYFIANFMIQKFNYATPGRNGNYE--TAEGSEETSSEVKVAAGSQ--------AVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKAEGAMGLVMKG-QGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEAQQNTVHFKDLTEE-------------------VYSVADGQVVALEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAFGIVTEAGLEVLVHIGLDTVSL------EGKPFTVHVAEGQKVTAGDLLVTADLDAIRAAGRETSTVVVFTNGDAIKSVK-LEKTGSL 714
Score = 247, Expect = 1.1e-18, Identities = 82/260 (31%), Positives = 125/260 (48%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGY--NLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G +IV        L + G  L+  G  V G L +LFA+AI  ++  +    A A  + +++   +           TG + G   ++L     +     G +   +  + +V+    L   VF G + GF+ A  YNK+ N  KL   + FFNG RFVP V  L      IL    WP+V   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ D+   A
  S:    12 EFWQKFGKALMVVIAVMPAAGLMISIGKSIVMINPTFAPLVITGGILEQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLAFILINRI-----------TGTIFGVSGDMLKNPDAMVTTFFGGSIKVADYFISVLEAPALNMGVFVGIISGFVGATAYNKYYNFRKLPDALSFFNGKRFVPFVVILRSAIAAILLAAFWPVVQTGINNFGIWIANSQETAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGA 267
>gi|15900652|ref|NP_345256.1| PTS system, IIABC components [Streptococcus pneumoniae TIGR4] >gi|111658350|ref|ZP_01409038.1| hypothetical protein SpneT_02000490 [Streptococcus pneumoniae TIGR4] >gi|168492907|ref|ZP_02717050.1| pts system, iibc component [Streptococcus pneumoniae CDC3059-06] >gi|172079640|ref|ZP_02709782.2| pts system, iibc component [Streptococcus pneumoniae CDC1873-00] >gi|18314336|sp|P35595|PTG3C_STRPN PTS system glucose-specific EIICBA component (EIICBA-Glc) (EII-Glc/EIII-Glc) [Includes: Glucose permease IIC component (PTS system glucose-specific EIIC component); Glucose-specific phosphotransferase enzyme IIB component (PTS system glucose-specific EIIB component); Glucose-specific phosphotransferase enzyme IIA component (PTS system glucose-specific EIIA component)] >gi|14972232|gb|AAK74896.1| PTS system, IIABC components [Streptococcus pneumoniae TIGR4] >gi|172042008|gb|EDT50054.1| pts system, iibc component [Streptococcus pneumoniae CDC1873-00] >gi|183577100|gb|EDT97628.1| pts system, iibc component [Streptococcus pneumoniae CDC3059-06] (726 aa)
Score = 435, Expect = 1.5e-40, Identities = 149/506 (29%), Positives = 249/506 (49%)
  Q:   371 YSAINGTYD---NASIASSSNGAIQSVLTW---------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQL-GARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSP-NLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEI 876
           Y+A+ GTYD    A+  +   G     L W         ++ +  Q  L T+    FK   VGQ +    + M  G+  A    V A  K   K  M   ++    + LTG+TEPIEY F+F+A  ++  V++ +   AF + + + L + + G  E      ++ S G         I +   +  W + +F    A I +F+  F+I+KFN  TPGR  N    T E  +   ++V++   S+        A+N+++  GG  NI +VDAC+T+LR+ +KD   V  A+  +  GA G +    Q V A++G +ADI+K +I+ ++++    P  L S+  +   N+      +E                    V S   G++V+L +V D  F++ MMG G AV+P  G I SP+ G +S +F T HA+   TE G ++L+H+G+D+++L      E KPF  +V  G  V  G  + T  L  ++ A    + ++V       + +K L+K+G +
  S:   255 YTALGGTYDILTGAAKGTQVFGQDPLWLAWVTDLVNLKGTDASQYQHLLDTVHPARFK---VGQMIGSFGILM--GVIVAIYRNVDADKKHKYKGMM---IATALATFLTGVTEPIEYMFMFIATPMYL-VYSLVQGAAFAMADVVNLRMHSFGSIEFLTRTPIAISAG---------IGMDIVNFVWVTVLF----AVIMYFIANFMIQKFNYATPGRNGNYE--TAEGSEETSSEVKVAAGSQ--------AVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKAEGAMGLVMKG-QGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEAQQNTVHFKDLTEE-------------------VYSVADGQVVALEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAFGIVTEAGLEVLVHIGLDTVSL------EGKPFTVHVAEGQKVAAGDLLVTADLDAIRAAGRETSTVVVFTNGDAIKSVK-LEKTGSL 715
Score = 247, Expect = 1.0e-18, Identities = 82/260 (31%), Positives = 125/260 (48%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGY--NLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G +IV        L + G  L+  G  V G L +LFA+AI  ++  +    A A  + +++   +           TG + G   ++L     +     G +   +  + +V+    L   VF G + GF+ A  YNK+ N  KL   + FFNG RFVP V  L      IL    WP+V   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ D+   A
  S:    13 EFWQKFGKALMVVIAVMPAAGLMISIGKSIVMINPTFAPLVITGGILEQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLAFILINRI-----------TGTIFGVSGDMLKNPDAMVTTFFGGSIKVADYFISVLEAPALNMGVFVGIISGFVGATAYNKYYNFRKLPDALSFFNGKRFVPFVVILRSAIAAILLAAFWPVVQTGINNFGIWIANSQETAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGA 268
>gi|183603477|ref|ZP_02714988.2| pts system, iibc component [Streptococcus pneumoniae CDC0288-04] >gi|183574746|gb|EDT95274.1| pts system, iibc component [Streptococcus pneumoniae CDC0288-04] (726 aa)
Score = 434, Expect = 2.0e-40, Identities = 149/506 (29%), Positives = 248/506 (49%)
  Q:   371 YSAINGTYD---NASIASSSNGAIQSVLTW---------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQL-GARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSP-NLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEI 876
           Y+A+ GTYD    A+  +   G     L W         ++ +  Q  L T+    FK   VGQ +    + M  G+  A    V A  K   K  M   ++    + LTG+TEPIEY F+F+A  ++  V++ +   AF + + + L + + G  E      ++ S G         I +   +  W + +F    A I +F+  F+I+KFN  TPGR  N    T E  +   ++V++   S+        A+N+++  GG  NI +VDAC+T+LR+ +KD   V  A+  +  GA G +    Q V A++G +ADI+K +I+ ++++    P  L S+  +   N+      +E                    V S   G++V L +V D  F++ MMG G AV+P  G I SP+ G +S +F T HA+   TE G ++L+H+G+D+++L      E KPF  +V  G  V  G  + T  L  ++ A    + ++V       + +K L+K+G +
  S:   255 YTALGGTYDILTGAAKGTQVFGQDPLWLAWVTDLVNLKGTDASQYQHLLDTVHPARFK---VGQMIGSFGILM--GVIVAIYRNVDADKKHKYKGMM---IATALATFLTGVTEPIEYMFMFIATPMYL-VYSLVQGAAFAMADVVNLRMHSFGSIEFLTRTPIAISAG---------IGMDIVNFVWVTVLF----AVIMYFIANFMIQKFNYATPGRNGNYE--TAEGSEETSSEVKVAADSQ--------AVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKAEGAMGLVMKG-QGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEAQQNTVHFKDLTEE-------------------VYSVADGQVVGLEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAFGIVTEAGLEVLVHIGLDTVSL------EGKPFTVHVAEGQKVAAGDLLVTADLDAIRAAGRETSTVVVFTNGDAIKSVK-LEKTGSL 715
Score = 247, Expect = 9.5e-19, Identities = 82/260 (31%), Positives = 125/260 (48%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGY--NLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G +IV        L + G  L+  G  V G L +LFA+AI  ++  +    A A  + +++   +           TG + G   ++L     +     G +   +  + +V+    L   VF G + GF+ A  YNK+ N  KL   + FFNG RFVP V  L      IL    WP+V   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ D+   A
  S:    13 EFWQKFGKALMVVIAVMPAAGLMISIGKSIVMINPTFAPLVITGGILEQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLAFILINRI-----------TGTIFGVSGDMLKNPDAMVTTFFGGSIKVADYFISVLEAPALNMGVFVGIISGFVGATAYNKYYNFRKLPDALSFFNGKRFVPFVVILRSAIAAILLAAFWPVVQTGINNFGIWIANSQETAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGA 268
>gi|168486749|ref|ZP_02711257.1| pts system, iibc component [Streptococcus pneumoniae CDC1087-00] >gi|183570288|gb|EDT90816.1| pts system, iibc component [Streptococcus pneumoniae CDC1087-00] (726 aa)
Score = 434, Expect = 2.0e-40, Identities = 149/506 (29%), Positives = 248/506 (49%)
  Q:   371 YSAINGTYD---NASIASSSNGAIQSVLTW---------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQL-GARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSP-NLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEI 876
           Y+A+ GTYD    A+  +   G     L W         ++ +  Q  L T+    FK   VGQ +    + M  G+  A    V A  K   K  M   ++    + LTG+TEPIEY F+F+A  ++  V++ +   AF + + + L + + G  E      ++ S G         I +   +  W + +F    A I +F+  F+I+KFN  TPGR  N    T E  +   ++V++   S+        A+N+++  GG  NI +VDAC+T+LR+ +KD   V  A+  +  GA G +    Q V A++G +ADI+K +I+ ++++    P  L S+  +   N+      +E                    V S   G++V L +V D  F++ MMG G AV+P  G I SP+ G +S +F T HA+   TE G ++L+H+G+D+++L      E KPF  +V  G  V  G  + T  L  ++ A    + ++V       + +K L+K+G +
  S:   255 YTALGGTYDILTGAAKGTQVFGQDPLWLAWVTDLVNLKGTDASQYQHLLDTVHPARFK---VGQMIGSFGILM--GVIVAIYRNVDADKKHKYKGMM---IATALATFLTGVTEPIEYMFMFIATPMYL-VYSLVQGAAFAMADVVNLRMHSFGSIEFLTRTPIAISAG---------IGMDIVNFVWVTVLF----AVIMYFIANFMIQKFNYATPGRNGNYE--TAEGSEETSSEVKVAADSQ--------AVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKAEGAMGLVMKG-QGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEAQQNTVHFKDLTEE-------------------VYSVADGQVVGLEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAFGIVTEAGLEVLVHIGLDTVSL------EGKPFTVHVAEGQKVAAGDLLVTADLDAIRAAGRETSTVVVFTNGDAIKSVK-LEKTGSL 715
Score = 247, Expect = 9.7e-19, Identities = 82/260 (31%), Positives = 125/260 (48%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGY--NLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G +IV        L + G  L+  G  V G L +LFA+AI  ++  +    A A  + +++   +           TG + G   ++L     +     G +   +  + +V+    L   VF G + GF+ A  YNK+ N  KL   + FFNG RFVP V  L      IL    WP+V   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ D+   A
  S:    13 EFWQKFGKALMVVIAVMPAAGLMISIGKSIVMINPTFTPLVITGGILEQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLAFILINRI-----------TGTIFGVSGDMLKNPDAMVTTFFGGSIKVADYFISVLEAPALNMGVFVGIISGFVGATAYNKYYNFRKLPDALSFFNGKRFVPFVVILRSAIAAILLAAFWPVVQTGINNFGIWIANSQETAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGA 268
>gi|148992421|ref|ZP_01822116.1| PTS system, IIABC component [Streptococcus pneumoniae SP9-BS68] >gi|149010616|ref|ZP_01831987.1| PTS system, IIABC component [Streptococcus pneumoniae SP19-BS75] >gi|183603106|ref|ZP_02712626.2| pts system, iibc component [Streptococcus pneumoniae SP195] >gi|147765097|gb|EDK72026.1| PTS system, IIABC component [Streptococcus pneumoniae SP19-BS75] >gi|147928738|gb|EDK79751.1| PTS system, IIABC component [Streptococcus pneumoniae SP9-BS68] >gi|183572999|gb|EDT93527.1| pts system, iibc component [Streptococcus pneumoniae SP195] (726 aa)
Score = 434, Expect = 2.3e-40, Identities = 149/506 (29%), Positives = 248/506 (49%)
  Q:   371 YSAINGTYD---NASIASSSNGAIQSVLTW---------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQL-GARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSP-NLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEI 876
           Y+A+ GTYD    A+  +   G     L W         ++ +  Q  L T+    FK   VGQ +    + M  G+  A    V A  K   K  M   ++    + LTG+TEPIEY F+F+A  ++  V++ +   AF + + + L + + G  E      ++ S G         I +   +  W + +F    A I +F+  F+I+KFN  TPGR  N    T E  +   ++V++   S+        A+N+++  GG  NI +VDAC+T+LR+ +KD   V  A+  +  GA G +    Q V A++G +ADI+K +I+ ++++    P  L S+  +   N+      +E                    V S   G++V L +V D  F++ MMG G AV+P  G I SP+ G +S +F T HA+   TE G ++L+H+G+D+++L      E KPF  +V  G  V  G  + T  L  ++ A    + ++V       + +K L+K+G +
  S:   255 YTALGGTYDILTGAAKGTQVFGQDPLWLAWVTDLVNLKGTDASQYQHLLDTVHPARFK---VGQMIGSFGILM--GVIVAIYRNVDADKKHKYKGMM---IATALATFLTGVTEPIEYMFMFIATPMYL-VYSLVQGAAFAMADVVNLRMHSFGSIEFLTRTPIAISAG---------IGMDIVNFVWVTVLF----AVIMYFIANFMIQKFNYATPGRNGNYE--TAEGSEETSSEVKVAAGSQ--------AVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKAEGAMGLVMKG-QGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEAQQNTVHFKDLTEE-------------------VYSVADGQVVGLEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAFGIVTEAGLEVLVHIGLDTVSL------EGKPFTVHVAEGQKVAAGDLLVTADLDAIRAAGRETSTVVVFTNGDAIKSVK-LEKTGSL 715
Score = 247, Expect = 1.1e-18, Identities = 82/260 (31%), Positives = 125/260 (48%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGY--NLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G +IV        L + G  L+  G  V G L +LFA+AI  ++  +    A A  + +++   +           TG + G   ++L     +     G +   +  + +V+    L   VF G + GF+ A  YNK+ N  KL   + FFNG RFVP V  L      IL    WP+V   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ D+   A
  S:    13 EFWQKFGKALMVVIAVMPAAGLMISIGKSIVMINPTFTPLVITGGILEQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLAFILINRI-----------TGTIFGVSGDMLKNPDAMVTTFFGGSIKVADYFISVLEAPALNMGVFVGIISGFVGATAYNKYYNFRKLPDALSFFNGKRFVPFVVILRSAIAAILLAAFWPVVQTGINNFGIWIANSQETAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGA 268
>gi|149007637|ref|ZP_01831254.1| PTS system, IIABC component [Streptococcus pneumoniae SP18-BS74] >gi|147760792|gb|EDK67763.1| PTS system, IIABC component [Streptococcus pneumoniae SP18-BS74] (726 aa)
Score = 433, Expect = 2.5e-40, Identities = 149/506 (29%), Positives = 248/506 (49%)
  Q:   371 YSAINGTYD---NASIASSSNGAIQSVLTW---------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQL-GARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSP-NLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEI 876
           Y+A+ GTYD    A+  +   G     L W         ++ +  Q  L T+    FK   VGQ +    + M  G+  A    V A  K   K  M   ++    + LTG+TEPIEY F+F+A  ++  V++ +   AF + + + L + + G  E      ++ S G         I +   +  W + +F    A I +F+  F+I+KFN  TPGR  N    T E  +   ++V++   S+        A+N+++  GG  NI +VDAC+T+LR+ +KD   V  A+  +  GA G +    Q V A++G +ADI+K +I+ ++++    P  L S+  +   N+      +E                    V S   G++V L +V D  F++ MMG G AV+P  G I SP+ G +S +F T HA+   TE G ++L+H+G+D+++L      E KPF  +V  G  V  G  + T  L  ++ A    + ++V       + +K L+K+G +
  S:   255 YTALGGTYDILTGAAKGTQVFGQDPLWLAWVTDLVNLKGTDASQYQHLLDTVHPARFK---VGQMIGSFGILM--GVIVAIYRNVDADKKHKYKGMM---IATALATFLTGVTEPIEYMFMFIATPMYL-VYSLVQGAAFAMADVVNLRMHSFGSIEFLTRTPIAISAG---------IGMDIVNFVWVTVLF----AVIMYFIANFMIQKFNYATPGRNGNYE--TAEGSEETSSEVKVAAGSQ--------AVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKAEGAMGLVMKG-QGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEAQQNTVHFKDLTEE-------------------VYSVADGQVVGLEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAFGIVTEAGLEVLVHIGLDTVSL------EGKPFTVHVAEGQKVAAGDLLVTADLDAIRAAGRETSTVVVFTNGDAIKSVK-LEKTGSL 715
Score = 247, Expect = 1.1e-18, Identities = 82/260 (31%), Positives = 125/260 (48%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGY--NLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G +IV        L + G  L+  G  V G L +LFA+AI  ++  +    A A  + +++   +           TG + G   ++L     +     G +   +  + +V+    L   VF G + GF+ A  YNK+ N  KL   + FFNG RFVP V  L      IL    WP+V   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ D+   A
  S:    13 EFWQKFGKALMVVIAVMPAAGLMISIGKSIVMINPTFAPLVITGGILEQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLAFILINRI-----------TGTIFGVSGDMLKNPDAMVTTFFGGSIKVADYFISVLEAPALNMGVFVGIISGFVGATAYNKYYNFRKLPDALSFFNGKRFVPFVVILRSAIAAILLAAFWPVVQTGINNFGIWIANSQETAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGA 268
>gi|168205608|ref|ZP_02631613.1| PTS system, glucose-specific IIBC component [Clostridium perfringens E str. JGS1987] >gi|170662926|gb|EDT15609.1| PTS system, glucose-specific IIBC component [Clostridium perfringens E str. JGS1987] (509 aa)
Score = 431, Expect = 4.3e-40, Identities = 104/268 (38%), Positives = 158/268 (58%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIF-GLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENI 688
           G ++ GK+ FM+ GLPAAA AM   A    +K+A  I  SA  TS LTGITEP+E+ FLF+AP LF  +H  L  L+F +M  + +             IGM+FSGG++D+I+ G I        WW  I  GL +A IY+FLF F I+KF+++TPGR              + + +  +  +E++N+D  LA  ++ A GG  NI  +DACIT+LR+ + D S V+  +L +LGA G ++   +++ A+FG ++DI+K  I+ +M  +
  S:   271 GTFMTGKFPFMMFGLPAAALAMYHEAKPGKKKIASGILFSAALTSFLTGITEPLEFAFLFVAPVLF-AIHCVLAGLSFMIMQLLNV------------KIGMTFSGGLLDFILLGVIP---NRTRWWLVILVGLGFAVIYYFLFRFFIRKFDLKTPGR--------------EDDDIFDDMDNETVNDD--LAAEILIALGGAGNINKLDACITRLRVTVNDSSKVNKERLKELGAAGVMQVG-ENIQAIFGGKSDILKTQIREIMNGM 506
Score = 318, Expect = 6.0e-27, Identities = 92/261 (35%), Positives = 142/261 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI----------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSIDLTQNAIIY 303
           + ++ K LMLP+A+LP AG+ LG GS              NAG     ++    +   GN +F  L LLFA+ +A+  +   G A LA  +G+LI          +VT   G  I  +++             A   + +Y  V+GI  LQ+ VFGG ++G + A LY +F  I+L   +GFF G RFVPI+T ++   +  + + +WP +  AL +  Q +  A   +++ +FG IERAL+PFGLHH +Y+P W     YT   G + +  N I +
  S:     8 LQRIGKALMLPVALLPAAGLLLGFGSMFQDPQFLSLVPALNAGW---FQLIATIMSDAGNIIFSNLALLFAVGVAVGLSEGDGVAGLAAIVGFLIL---------NVTMGIGGGITADIV-------------AGTKNGMYATVLGIPTLQTGVFGGIIMGVIAATLYKRFYKIELPSYLGFFAGKRFVPIITAISALILGGIMVFVWPPIQGALLYFSQNMISANQTLSALLFGIIERALIPFGLHHIWYNPFWFQFGEYTNKAGQLIMGDNQIFF 259
>gi|187605887|ref|ZP_02992070.1| PTS system, glucose-specific IIBC subunit [Exiguobacterium sp. AT1b] >gi|187482053|gb|EDU20074.1| PTS system, glucose-specific IIBC subunit [Exiguobacterium sp. AT1b] (508 aa)
Score = 430, Expect = 6.3e-40, Identities = 108/287 (37%), Positives = 165/287 (57%)
  Q:   399 NLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           N+  G QA+          +  G ++ GK+ FM+ GLPAAA AM   A  E + +   +  SA  TS LTGITEPIE++FLF+AP LF  VHA    L+F  M+ + +             IGM+FSGG+ID++++G +    G  AWW  I  GL +A +Y+F F F+I+KFN++TPGR         ED   +Q+     GS         LA +++   GG  NIK++DACIT+LR+++KD++ V+  +L +LGA G ++    ++ A+FG  +D +K  I+ ++
  S:   248 NVVRGDQAIFFAQIRDGAELTAGTFMTGKFPFMMFGLPAAALAMYHEARPERKAVVGGLLASAALTSFLTGITEPIEFSFLFVAPLLF-AVHAVFAGLSFMTMHLLNV------------KIGMTFSGGLIDFLLFGVLP---GRTAWWLVIPVGLVFAVVYYFGFRFVIRKFNLKTPGR---------EDEVVEQSTA--TGSE--------LAQDILVGLGGSQNIKHLDACITRLRVEVKDKNQVNKDELKRLGASGVLEVG-NNIQAIFGPRSDALKSEIQAVI 499
Score = 393, Expect = 1.1e-35, Identities = 106/274 (38%), Positives = 150/274 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI----VTNAGG---NEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSIDLTQNAIIYQDGKAYAVLATST 316
           + K+ K LMLP+A+LP AG+ L  G+A+    +T+  G   NEG+  F   ++  G  +F  L LLFA+ +AI   GD G A LA  +G+LI   +     +   +                   L+ G+ A     Y  V+GI  LQ+ VFGG ++G + A+ YNK+ NI+L   +GFF G RFVPIVT +A      + L++WP V   L +F    L +     +FIFG IER+L+PFGLHH FYSP W     YT A G++     AI +   +  A L   T
  S:     9 LQKVGKALMLPVAILPAAGLLLAFGNAMQNPQLTSRAGWLTNEGVVKFAQLMEQAGGIIFSNLALLFAVGVAIGLAGD-GVAGLAAIVGFLIMNKVMGVWLELTPEV------------------LAQGDPA-----YANVLGIPTLQTGVFGGIIMGLIAAWAYNKYFNIELPQFLGFFAGKRFVPIVTAVAAVVAGFVLLLVWPPVQHGLNSFSNFMLNENRTFAAFIFGLIERSLIPFGLHHIFYSPFWFEFGSYTDAAGNVVRGDQAIFFAQIRDGAELTAGT 271
>gi|18311139|ref|NP_563073.1| PTS system, glucose-specific IIBC component [Clostridium perfringens str. 13] >gi|110800153|ref|YP_696835.1| PTS system, glucose-specific IIBC component [Clostridium perfringens ATCC 13124] >gi|168208859|ref|ZP_02634484.1| PTS system, glucose-specific IIBC component [Clostridium perfringens B str. ATCC 3626] >gi|18145822|dbj|BAB81863.1| probable PTS system [Clostridium perfringens str. 13] >gi|110674800|gb|ABG83787.1| PTS system, glucose-specific IIBC component [Clostridium perfringens ATCC 13124] >gi|170713104|gb|EDT25286.1| PTS system, glucose-specific IIBC component [Clostridium perfringens B str. ATCC 3626] (509 aa)
Score = 428, Expect = 9.8e-40, Identities = 103/268 (38%), Positives = 158/268 (58%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIF-GLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENI 688
           G ++ GK+ FM+ GLPAAA AM   A    +K+A  I  SA  TS LTGITEP+E+ FLF+AP LF  +H  L  L+F +M  + +             IGM+FSGG++D+I+ G I        WW  I  GL +A IY+FLF F I+KF+++TPGR              + + +  +  ++++N+D  LA  ++ A GG  NI  +DACIT+LR+ + D S V+  +L +LGA G ++   +++ A+FG ++DI+K  I+ +M  +
  S:   271 GTFMTGKFPFMMFGLPAAALAMYHEAKPGKKKIASGILFSAALTSFLTGITEPLEFAFLFVAPVLF-AIHCVLAGLSFMIMQLLNV------------KIGMTFSGGLLDFILLGVIP---NRTRWWLVILVGLGFAVIYYFLFRFFIRKFDLKTPGR--------------EDDDIFDDMDNQTVNDD--LAAEILIALGGAGNINKLDACITRLRVTVNDSSKVNKERLKELGAAGVMQVG-ENIQAIFGGKSDILKTQIREIMNGM 506
Score = 319, Expect = 4.9e-27, Identities = 93/261 (35%), Positives = 142/261 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI----------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSIDLTQNAIIY 303
           + ++ K LMLP+A+LP AG+ LG GS              NAG     ++    +   GN +F  L LLFA+ +A+  +   G A LA  +G+LI          +VT   G  I  +++             A   + +Y  V+GI  LQ+ VFGG ++G + A LY +F  I+L   +GFF G RFVPIVT ++   +  + + +WP +  AL +  Q +  A   +++ +FG IERAL+PFGLHH +Y+P W     YT   G + +  N I +
  S:     8 LQRIGKALMLPVALLPAAGLLLGFGSMFQDPQFLSLVPALNAGW---FQLIATIMSDAGNIIFSNLALLFAVGVAVGLSEGDGVAGLAAIVGFLIL---------NVTMGIGGGITADIV-------------AGTKNGMYATVLGIPTLQTGVFGGIIMGVIAAALYKRFYKIELPSYLGFFAGKRFVPIVTAVSALVLGGIMVFVWPPIQGALLYFSQNMISANQTLSALLFGIIERALIPFGLHHIWYNPFWFQFGEYTNKAGQLIMGDNQIFF 259
>gi|182623923|ref|ZP_02951711.1| PTS system, glucose-specific IIBC component [Clostridium perfringens D str. JGS1721] >gi|177910816|gb|EDT73170.1| PTS system, glucose-specific IIBC component [Clostridium perfringens D str. JGS1721] (509 aa)
Score = 428, Expect = 1.0e-39, Identities = 103/268 (38%), Positives = 158/268 (58%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIF-GLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENI 688
           G ++ GK+ FM+ GLPAAA AM   A    +K+A  I  SA  TS LTGITEP+E+ FLF+AP LF  +H  L  L+F +M  + +             IGM+FSGG++D+I+ G I        WW  I  GL +A IY+FLF F I+KF+++TPGR              + + +  +  ++++N+D  LA  ++ A GG  NI  +DACIT+LR+ + D S V+  +L +LGA G ++   +++ A+FG ++DI+K  I+ +M  +
  S:   271 GTFMTGKFPFMMFGLPAAALAMYHEAKPGKKKIASGILFSAALTSFLTGITEPLEFAFLFVAPVLF-AIHCVLAGLSFMIMQLLNV------------KIGMTFSGGLLDFILLGVIP---NRTRWWLVILVGLGFAVIYYFLFRFFIRKFDLKTPGR--------------EDDDIFDDMDNQTVNDD--LAAEILIALGGAGNINKLDACITRLRVTVNDSSKVNKERLKELGAAGVMQVG-ENIQAIFGGKSDILKTQIREIMNGM 506
Score = 320, Expect = 3.8e-27, Identities = 92/261 (35%), Positives = 142/261 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI----------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSIDLTQNAIIY 303
           + ++ K LMLP+A+LP AG+ LG GS              NAG     ++    +   GN +F  L LLFA+ +A+  +   G A LA  +G+LI          +VT   G  I  +++             A   + +Y  V+GI  LQ+ VFGG ++G + A LY +F  I+L   +GFF G RFVPI+T ++   +  + + +WP +  AL +  Q +  A   +++ +FG IERAL+PFGLHH +Y+P W     YT   G + +  N I +
  S:     8 LQRIGKALMLPVALLPAAGLLLGFGSMFQDPQFLSLVPALNAGW---FQLIATIMSDAGNIIFSNLALLFAVGVAVGLSEGDGVAGLAAIVGFLIL---------NVTMGIGGGITADIV-------------AGTKNGMYATVLGIPTLQTGVFGGIIMGVIAAALYKRFYKIELPSYLGFFAGKRFVPIITAISALIIGGIMVFVWPPIQGALLYFSQNMISANQTLSALLFGIIERALIPFGLHHIWYNPFWFQFGEYTNKAGQLIMGDNQIFF 259
>gi|168215784|ref|ZP_02641409.1| PTS system, glucose-specific IIBC component [Clostridium perfringens NCTC 8239] >gi|182382346|gb|EDT79825.1| PTS system, glucose-specific IIBC component [Clostridium perfringens NCTC 8239] (509 aa)
Score = 428, Expect = 1.0e-39, Identities = 103/268 (38%), Positives = 158/268 (58%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIF-GLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENI 688
           G ++ GK+ FM+ GLPAAA AM   A    +K+A  I  SA  TS LTGITEP+E+ FLF+AP LF  +H  L  L+F +M  + +             IGM+FSGG++D+I+ G I        WW  I  GL +A IY+FLF F I+KF+++TPGR              + + +  +  ++++N+D  LA  ++ A GG  NI  +DACIT+LR+ + D S V+  +L +LGA G ++   +++ A+FG ++DI+K  I+ +M  +
  S:   271 GTFMTGKFPFMMFGLPAAALAMYHEAKPGKKKIASGILFSAALTSFLTGITEPLEFAFLFVAPVLF-AIHCVLAGLSFMIMQLLNV------------KIGMTFSGGLLDFILLGVIP---NRTRWWLVILVGLGFAVIYYFLFRFFIRKFDLKTPGR--------------EDDDIFDDMDNQTVNDD--LAAEILIALGGAGNINKLDACITRLRVTVNDSSKVNKERLKELGAAGVMQVG-ENIQAIFGGKSDILKTQIREIMNGM 506
Score = 318, Expect = 6.0e-27, Identities = 92/261 (35%), Positives = 142/261 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI----------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSIDLTQNAIIY 303
           + ++ K LMLP+A+LP AG+ LG GS              NAG     ++    +   GN +F  L LLFA+ +A+  +   G A LA  +G+LI          +VT   G  I  +++             A   + +Y  V+GI  LQ+ VFGG ++G + A LY +F  I+L   +GFF G RFVPI+T ++   +  + + +WP +  AL +  Q +  A   +++ +FG IERAL+PFGLHH +Y+P W     YT   G + +  N I +
  S:     8 LQRIGKALMLPVALLPAAGLLLGFGSMFQDPQFLSLVPALNAGW---FQLIATIMSDAGNIIFSNLALLFAVGVAVGLSEGDGVAGLAAIVGFLIL---------NVTMGIGGGITADIV-------------AGTKNGMYATVLGIPTLQTGVFGGIIMGVIAAALYKRFYKIELPSYLGFFAGKRFVPIITAISALILGGIMVFVWPPIQGALLYFSQNMISANQTLSALLFGIIERALIPFGLHHIWYNPFWFQFGEYTNKAGQLIMGDNQIFF 259
>gi|90579074|ref|ZP_01234884.1| PTS system, maltose and glucose-specific IIABC component (malX) [Vibrio angustum S14] >gi|90439907|gb|EAS65088.1| PTS system, maltose and glucose-specific IIABC component (malX) [Vibrio angustum S14] (538 aa)
Score = 428, Expect = 1.1e-39, Identities = 104/277 (37%), Positives = 157/277 (56%)
  Q:   407 LGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI--FGLAYAPIYFFLFYFLIKKFNIQTPGR-GENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLM--QLGARGTIKPSPQSVYAVFGAEADIIKGNIKT 683
            G++    +   +   ++ GK+ FM+ GLPAAA AM   A KEN+K    +  S   T+ LTGITEPIE+TFLFL+  L++ +H  L  L+F +M+ + +             +GM+FSGG ID+ ++G +    G+   W +I   GL Y P+YF LF + I KF+I+TPGR G    +  K+DY+          +S++  +D      ++ A GG DNI +VDACIT+LRI +KD  +V   K     LGA+G +K     + A++GA+A   K  I +
  S:   275 FGSLANGDYSQFSSTNFMTGKFPFMMFGLPAAAYAMYTLADKENKKEVGGLLFSVALTAFLTGITEPIEFTFLFLSAPLYYFIHVPLAGLSFMIMDLLNV------------KVGMTFSGGFIDFALFGMLPGLTGTENHWYYIPLLGLIYGPVYFLLFRWFILKFDIKTPGRKGSAVAVVRKKDYQ----------ASKAGGSDDSQIDEMIEALGGKDNIVDVDACITRLRITVKDGELVKDNKYWTENLGAKGLVKVGGTGIQAIYGAQAAGFKAQINS 534
Score = 396, Expect = 5.7e-36, Identities = 111/257 (43%), Positives = 151/257 (58%)
  Q:    40 KEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVT-------NAGGNEGLRVFGNFLQV---PGNAVFGALPLLFAIAIAIAFT-GDAGPAALACFIGYLIFG-SLQDALSQS-VTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGI-NQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVG-----INSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDL 296
           K F +KLS+ +MLPIA+LP AGI LG+G +          N G  +   +  +FLQV    G  VF  LPL+FA+AIAI F   + G AALA  I YL+   ++   LS + + DTT      N +   GN +          + +   V+GI N L   VFGG + G +   L+NK+ ++KL   +GFF G RFVPIV+  +     I  + IWP +G A   +G  LG+        I SFIFG IERAL+P GLHH FY PLW T+ GG+ ++
  S:     2 KAFFSKLSQAVMLPIALLPAAGIMLGLGGSFTNQSMIDAYNIGILQDGTLLNSFLQVMTAAGGIVFANLPLMFALAIAIGFARAEKGAAALAATISYLVMNVAIAKTLSVAGMVDTTN-----NTVILMGNHY----------AGVLADVLGIHNTLSMGVFGGLIAGGITVVLHNKYHDVKLPEFLGFFGGARFVPIVSAFSALFYGIALVFIWPYIGAAFGSIGATLGEMTASGHGYIASFIFGIIERALIPVGLHHVFYLPLWQTEIGGTAEI 262
>gi|168212806|ref|ZP_02638431.1| PTS system, glucose-specific IIBC component [Clostridium perfringens CPE str. F4969] >gi|170715503|gb|EDT27685.1| PTS system, glucose-specific IIBC component [Clostridium perfringens CPE str. F4969] (509 aa)
Score = 425, Expect = 2.0e-39, Identities = 103/268 (38%), Positives = 158/268 (58%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIF-GLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENI 688
           G ++ GK+ FM+ GLPAAA AM   A    +K+A  I  SA  TS LTGITEP+E+ FLF+AP LF  +H  L  L+F +M  + +             IGM+FSGG++D+I+ G I        WW  I  GL +A IY+FLF F I+KF+++TPGR              + + +  +  ++++N+D  LA  ++ A GG  NI  +DACIT+LR+ + D S V+  +L +LGA G ++   +++ A+FG ++DI+K  I+ +M  +
  S:   271 GTFMTGKFPFMMFGLPAAALAMYHEAKPGKKKIASGILFSAALTSFLTGITEPLEFAFLFVAPVLFV-IHCVLAGLSFMIMQLLNV------------KIGMTFSGGLLDFILLGVIP---NRTRWWLVILVGLGFAVIYYFLFRFFIRKFDLKTPGR--------------EDDDIFDDMDNQTVNDD--LAAEILIALGGAGNINKLDACITRLRVTVNDSSKVNKERLKELGAAGVMQVG-ENIQAIFGGKSDILKTQIREIMNGM 506
Score = 319, Expect = 4.8e-27, Identities = 92/261 (35%), Positives = 143/261 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI----------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSIDLTQNAIIY 303
           + ++ K LMLP+A+LP AG+ LG GS              NAG     ++    +   GN +F  L LLFA+ +A+  +   G A LA  +G+LI          +VT   G  I  +++             A+  + +Y  V+GI  LQ+ VFGG ++G + A LY +F  I+L   +GFF G RFVPI+T ++   +  + + +WP +  AL +  Q +  A   +++ +FG IERAL+PFGLHH +Y+P W     YT   G + +  N I +
  S:     8 LQRIGKALMLPVALLPAAGLLLGFGSMFQDPQFLSLVPALNAGW---FQLIATIMSDAGNIIFSNLALLFAVGVAVGLSEGDGVAGLAAIVGFLIL---------NVTMGIGGGITADVV-------------ASTKNGMYATVLGIPTLQTGVFGGIIMGVIAAALYKRFYKIELPSYLGFFAGKRFVPIITAISALVLGGIMVFVWPPIQGALLYFSQNMISANQTLSALLFGIIERALIPFGLHHIWYNPFWFQFGEYTNKAGQLIMGDNQIFF 259
>gi|19171205|emb|CAD21855.1| putative glucose-specific IIABC component (ptsG) [Mycoplasma mycoides subsp. mycoides] (538 aa)
Score = 425, Expect = 2.4e-39, Identities = 155/544 (28%), Positives = 243/544 (44%)
  Q:    33 KEKKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGN--EGLRVF---GNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGIN---SFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMW-AFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWI-IYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPG 576
           K K+ N  EF +K +K ++  +A+LP AG+ + +G  I     G      +VF   G  ++  G A F  + LLFA+AI   ++ +    + A    Y I  ++  ++  + T   G +   N +           G        + +  G+  ++    GG ++GF+ A +YNK+ N  KL   + FFNG RFVP +  + + P+++   ++WPL    +  LG    +   +     F++G  ER L+PFGLHH    P+ Y+Q GGS+D T          + +  + +T        +   SL  N +     A G + +W ++I A        L  + SGW   A          A  SN          N  + QQA   +       V   ++  G+ +     L  A   M  A PKE R    SI        LLTG+TEPIE+ F+F AP L + +HA L  +AFG+ ++I + + A G  E        F    I  I + G + IQ      W  +  +A+  IYF +FYF  KKF    PG
  S:     9 KAKESNLHEFFSKFAKSILTFVALLPAAGLTIILGKIIGPLRLGQIKASAKVFNQIGGVIETVGWAAFSHMGLLFAVAIGGTWSKNRYGGSFAAAFAYFILLAVGSSMFITRTTEAGEIQFLNYIL----------GRWEKHELFFSSQEGVMSIRYDAIGGIIMGFVGATIYNKYYNFNKLPQALSFFNGARFVPFMVIIIVLPISVGIGLVWPLFQTVINHLGNFFAKEQKLKFLAPFLYGTSERLLLPFGLHHMITIPMNYSQLGGSVDFT----------SASQFSNTTPEKAEVIAKFFQSLENNKEAL--KAQGQEKIWLSWITA--------LGNVKSGWADYA----------AKHSNNV--------NGLTMQQAYEIV----LDSVVPVRFKVGQMITSSGSLVGAGLGMAFAIPKEKRAKYSSIYFLGLAVCLLTGVTEPIEFIFMFSAP-LLYVLHAILTGIAFGISDFIPMRIHAFGGIETLIKYLFVFGPTSISGIGLKGILWIQ----GLWLLLVTIAFGGIYFAVFYFFTKKFKPAIPG 506
>gi|69244471|ref|ZP_00602887.1| Sugar-specific permease, EIIA 1 domain:PTS system, IIBC component:PTS system, glucose-like IIB component [Enterococcus faecium DO] >gi|68196412|gb|EAN10840.1| Sugar-specific permease, EIIA 1 domain:PTS system, IIBC component:PTS system, glucose-like IIB component [Enterococcus faecium DO] (721 aa)
Score = 423, Expect = 4.2e-39, Identities = 132/451 (29%), Positives = 224/451 (49%)
  Q:   420 VGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQ-LGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVL-NESLEGREIKFL 870
           VGQ +    + M       A AM      + +    S+  SA     LTG+TEP+E+ F+F A  L+  +++ +   AF + + + L V + G+ EL     ++   G+   +I   + +             +A+  + +FL  FLIKKFN  TPGR  N        Y N   +  ++ S     + QV+   ++   GG +NIK+VDAC+T+LR+ + D+  V T +  +  GA G I      V AV+G +AD++K +I+ L+++ +  P    E E +   +    S   +  E+E+V              S  +GE++ L++V D  FS+ MMG G AV PT+ ++ +PI GK++ +F + HA   ET+ G ++LIH+GID++ +   +      F   VK G  V  G ++  + L  +++ +   T +IV  N+ +E   IK L
  S:   309 VGQMIGSSGILM-----GMAFAMYRNVDPDKKARYKSMYFSAALAVFLTGVTEPLEFMFMFAAVPLYV-IYSVIQGAAFAMADILPLRVHSFGNIELLTRTPLAIKAGLGGDLINFVLCV-------------IAFGVVTYFLANFLIKKFNFATPGRNGN--------YDNDSEETVVSNSGTGTADQQVV--QIIHLLGGKENIKDVDACMTRLRVSVNDREKVGTEEAWKRAGAMGLIVKD-NGVQAVYGPKADVLKSDIEDLLQSGAEIP----EPEMVSTGNGQAGSKQYLGIEQELV--------------SAASGEVIPLSEVKDPVFSQKMMGDGFAVIPTSREVVAPIAGKVTSIFPSKHAIGLETKDGIEVLIHMGIDTVQMNQPA------FEIAVKEGQEVGTGTKLAEMDLDVIQNEEKDPTIMIVFTNDKVEEVVIKQL 707
Score = 287, Expect = 2.3e-23, Identities = 81/266 (30%), Positives = 128/266 (48%)
  Q:    35 KKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           KK  + EF  K  K LM+ +A++P AG+ + +G +I         L   G  ++  G A+ G L +LFA+AI  ++  +    A A  I +++   +  A+    +D       +    +         G   +    + +V+    L   VF G + GF+ A  YNK+ N  KL   + FFNG RFVP V  L    V ++  ++WP V   +   G  + +    A  +  F+FG +ER L+PFGLHH    P+ YTQ GGS ++   A
  S:     2 KKIFSFEFWQKFGKALMVVVAVMPAAGLMISIGKSIPLINPDWTPLVTTGGVIENIGWAIIGNLHILFALAIGGSWAKERAGGAFAAGISFILINRITGAIFGVTSDMLANEDAFTHTLF---------GTKIMVKGFFTSVLEAPALNMGVFVGIIAGFVGAMAYNKYYNYRKLPDALSFFNGKRFVPFVVILWSTIVALILAVVWPNVQAGINNFGLWIAESQESAPILAPFLFGTLERLLLPFGLHHMLTIPINYTQLGGSYEILSGA 263
>gi|29375541|ref|NP_814695.1| PTS system, IIABC components [Enterococcus faecalis V583] >gi|29343001|gb|AAO80765.1| PTS system, IIABC components [Enterococcus faecalis V583] (722 aa)
Score = 423, Expect = 4.3e-39, Identities = 149/491 (30%), Positives = 241/491 (49%)
  Q:   371 YSAINGTYDNASIASSSN---GAIQSVLTWSNLTSGQQALGTIGANGFKGVN-------VGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQ-LGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNES 861
           Y+ + GTY+  S A +     G     L W+      +  G +    F   N       VGQ +    + M + L     AM      + +    S+  SA     LTG+TEP+E+ F+F A  L+  ++A +   AF + + + L V + G+ EL     ++   G+   +I   + +          IFG+    + +FL  FLIKKFN  TPGR  N        Y N  ++   +G++ S   DQ +A  +V   GG  NIK VDAC+T+LR+ +KD+  V + +  +  GA G I      V AV+G +AD++K +I+ L+ +    P      E ++  S+              V T + L K+K  V +  TGE++ +A+V D  FS+ MMG G AVKP  G++ +PI GK+  VF + HA   +TE+G ++L+H+GID++ +   +      F   VK G ++K G ++  + L  ++ A    T I+    S
  S:   250 YTQLGGTYEILSGAQAGTQVFGQDPLWLAWATDLVNLKGAGDMSKYQFVLENWTPARFKVGQMIGSSGILMGMAL-----AMYRNVDADKKAKYKSMYFSAALAVFLTGVTEPLEFMFMFAAVPLYV-IYAVIQGAAFAMADILPLRVHSFGNIELLTRTPLAIKAGLGGDLINFVLMV---------IIFGV----VTYFLANFLIKKFNYATPGRNGN--------YDNDNSEEIASGAAGSGVVDQQIA-QIVYLLGGKQNIKEVDACMTRLRVSVKDREKVGSEEAWKRAGAMGLIVKD-NGVQAVYGPKADVLKSDIEDLLASGVDIP------EPVIAESTAG------------VPTTNFLGKKKDFV-AVATGEVIPMAQVNDPVFSQKMMGDGFAVKPLEGEVVAPISGKVLSVFPSKHAIGLQTEEGIEVLVHMGIDTVEMATPA------FESFVKEGQSLKAGTKLAKMNLDVIEQAGKETTIIVAFTNS 697
Score = 290, Expect = 9.0e-24, Identities = 90/266 (33%), Positives = 134/266 (50%)
  Q:    35 KKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVF-GNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGY-NLLFYQGNIFGLSA-GNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLG----QALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           KK  + EF  K  K LM+ +A++P AG+ + +G ++      N GL V  G  L+  G A+ G L LLFA+AI  ++  D    A A  I +++   +           TGA+ G  N +      F  +  G   +    + +V+    L   VF G + GF+ A  YNK+ N  KL   + FFNG RFVP V  L    V+I   +IWP +   +   G    Q+   A  +  F++G +ER L+PFGLHH    P+ YTQ GG+ ++   A
  S:     2 KKMFSFEFWQKFGKALMVVVAVMPAAGLMISIGKSLPL-IDPNLGLLVTTGGVLESIGWAIIGNLHLLFALAIGGSWAKDRAGGAFAAGISFVLINRI-----------TGAIFGVTNEMLADEQAFTHTLFGTKIMVKGFFTSVLEAPALNMGVFVGIIAGFVGAMAYNKYYNYRKLPDALSFFNGKRFVPFVVILWSTIVSIALALIWPNIQAGINNFGLWIAQSQDSAPILAPFLYGTLERLLLPFGLHHMLTIPINYTQLGGTYEILSGA 263
>gi|160937933|ref|ZP_02085291.1| hypothetical protein CLOBOL_02827 [Clostridium bolteae ATCC BAA-613] >gi|158439159|gb|EDP16913.1| hypothetical protein CLOBOL_02827 [Clostridium bolteae ATCC BAA-613] (530 aa)
Score = 422, Expect = 4.4e-39, Identities = 174/635 (27%), Positives = 275/635 (43%)
  Q:    51 MLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDAL--SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVG----INSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGG----MIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDY-KNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKD-QSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           M  IA++P AG+ + VG  I    G    +   G+ ++  G AV   L +LFA+AI  ++  +    A A  I +++   +  AL    S      A +   LL           G   L +  + +V+G   L   VF G + GF    +YNK+ N  KL   + FFNG RFVP+V  L    ++++  ++WP+V   +   G  +  +      +  FI+G +ER L+PFGLHH    P+ YT  GG+               Y +L                 +N  SQ+      G   +W                    W    IN   D   +A   N  + + +T +    GQ     IGA G                ++LG+   A AM      + R+   S+ +S      LTG+TEP+E+ F+F A  L+  V+A L   AF +   I L + + G+ E    + MS   G    ++++I+  A+             F   YA     + YF+I +F+  TPGR  N   +T +   +N Q +     S +S       A  ++S  GG DNI  VDAC+T+LR+ +KD   V    +    GA G IK     + A++G +AD++K +I  ++
  S:     1 MTVIAVMPAAGLMISVGKLIQMAGGDMGAVLTIGSTMETIGWAVINNLHILFAVAIGGSWAKERAGGAFAAVIAFILINVITGALFGVSSADLNDPAAVTRTLL-----------GQEILVNGYFTSVLGAPALNMGVFVGIISGFAGGVIYNKYYNYRKLPDALAFFNGKRFVPMVVILWSVIISLVLAIVWPVVQTGINSFGVWIANSSSTSPVLAPFIYGTLERLLLPFGLHHMLTIPMNYTSFGGT---------------YTILT---------------GVNAGSQVF-----GQDPLWL------------------AWATDLIN-LKDAGDMAGYQN--LLATITPARFKVGQM----IGATG----------------LLLGI---ALAMYRRVDPDKRRNYRSMFISTVLAVFLTGVTEPLEFMFMFCALPLYL-VYAVLQGCAFAMAGLIHLRLHSFGNLEFLTRVPMSIRAGLGGDLVNFILCVAV------------FFAAGYA-----IAYFMIGRFHFATPGRLGN---YTDDSVSENSQGRAGFASSGDS------QAGRIISLLGGRDNIVLVDACMTRLRVTVKDVDKVAGLPQWKAEGAMGLIKKD-GGIQAIYGPKADVLKSDINDIL 530
>gi|24380385|ref|NP_722340.1| putative PTS system, glucose-specific IIABC component [Streptococcus mutans UA159] >gi|24378407|gb|AAN59646.1|AE015027_4 putative PTS system, glucose-specific IIABC component [Streptococcus mutans UA159] (729 aa)
Score = 422, Expect = 5.6e-39, Identities = 137/456 (30%), Positives = 224/456 (49%)
  Q:   420 VGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGM-IDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVV-DTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGE 875
           VGQ +    + M L L     AM      + ++    + +SA     LTG+TEP+EY F+F A  L+  V+A +  LAF   + I L V + G+ E      M+   G+ +D + +  +          S +FG+A     +F+  F+IKKFN+ T GR  N   +   D  + +     N  + + N+  V  +N++   GG +NI +VDAC+T+LRI + D + V D A   + GA G I      V AV+G +AD++K +I+ L+++    P             +D ++  E K      K  +E       + +   G+++ + +V D  FS+ MMG G AV+P  G IYSP+ G ++ VF T HA    T+ G ++L+HVG+D++ L         PF+  VK G  V +G  +    L  +K A    T I+    + E + +  L+K+G+
  S:   312 VGQMIGSSGILMGLTL-----AMYRNVDPDKKEKYKGMFLSAAVAVFLTGVTEPLEYMFMFAALPLYL-VYAVVQGLAFASADLIHLRVHSFGNIEFLTRTPMAIKAGLAMDIVNFIVV----------SVVFGVAM----YFITNFMIKKFNLATSGRNGN---YDTGDDASDETASNSNAGTANANSQIVKIINLL---GGKENISDVDACMTRLRITVTDVAKVGDEAAWKKAGAMGLIVKG-NGVQAVYGPKADVLKSDIQDLLDSGVDIPK------------TDVTALEEDKTADVSFKGVTE------EIATVADGQVLPITQVHDPVFSQKMMGDGFAVEPENGNIYSPVAGLVTSVFPTKHALGLLTDDGLEVLVHVGLDTVALNG------APFSAKVKDGQRVALGDLLLVADLEAIKSADRETTVIVAFTNTAELKSVT-LEKTGQ 717
Score = 251, Expect = 3.7e-19, Identities = 85/253 (33%), Positives = 126/253 (49%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGD----AGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGS 293
           EF  K  K LM+ IA++P AG+ + +G+++      +  L    N +   G  V   L +LFA+AI  ++  +    A  AALA  +  LI G+      + + D T          Y  NIFG     A      +  V+G   L   VF G + GF+ A  YNK+ N  KL  ++ FFNG RFVP V  +    V ++  + WP+V   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YTQ GG+
  S:    11 EFWQKFGKCLMVVIAVMPAAGLMVSIGNSLALIDPKSTLLVTVANIIAQIGWGVINNLHILFAVAIGGSWAKERAGGAFAAALAFILINLITGNFYGISLEMIADKTS---------YVHNIFGGKMHVA----DYFINVLGQPALNMGVFVGIISGFVGATAYNKYYNFRKLPDVLSFFNGKRFVPFVVIVRSTIVALILSVFWPIVQSGINGFGMWIASSQHTAPFLAPFLYGTLERLLLPFGLHHMLTIPMNYTQLGGT 259
>gi|149183997|ref|ZP_01862365.1| PTS system, glucose-specific enzyme II, A component [Bacillus sp. SG-1] >gi|148848293|gb|EDL62575.1| PTS system, glucose-specific enzyme II, A component [Bacillus sp. SG-1] (516 aa)
Score = 421, Expect = 5.8e-39, Identities = 107/268 (39%), Positives = 155/268 (57%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           +  G ++ GKY FM+ GLPAAA A+   A  E +K+   I  SA  TS LTGITEPIE++FLF+AP LF G+H     L+F  M+ + +             IGM+FSGG+ID+I++G I  Q  +N W     GL +A +Y+F F F I+KFN+ TPGR E      +               + S  +D  LA +V+ A GG +NI ++DACIT+LR+ + D+  VD  KL +LGA G ++    S+ A+FG ++D +K  +K +M
  S:   268 LTAGTFMTGKYPFMMFGLPAAALAIYHEARPERKKIVAGIMGSAALTSFLTGITEPIEFSFLFVAPILF-GIHTIFAGLSFMTMHLLDV------------KIGMTFSGGLIDYILFGVINPQ--TNWWLVIPVGLVFAVVYYFGFRFAIRKFNLATPGREEVEDDEEE--------------GTTSTGSD--LAYDVLEAMGGKENIAHLDACITRLRVSVNDEKQVDKKKLKKLGASGVLEVG-NSIQAIFGPKSDTLKSQMKDIM 503
Score = 383, Expect = 1.5e-34, Identities = 105/262 (40%), Positives = 143/262 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQV------------PGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSIDLTQNAIIYQ 304
           + K+ K LMLP+A+LP AGI L +G+A+      N  L     FL+              G  +FG L LLFA+ +AI   G  G A LA  +GYLI              T GA +G            +SA +     + +  V+GI  LQ+ VFGG +VG L A++YN+F NI+L   +GFF G RFVPI T  +   + +L L++WP +   L  F    LG+   + +F+FG +ERAL+PFGLHH FYSP W     YT   G I     AI  +
  S:     9 LQKVGKALMLPVAILPAAGILLALGAAL-----ENPTLLELAPFLEADWIAKVAHVMKEAGGIIFGNLALLFAVGVAIGLAGGEGVAGLAAIVGYLIMNV-----------TMGAAMG------------ISAEDVGADMA-FANVLGIPTLQTGVFGGIIVGILAAYMYNRFHNIELASYLGFFAGKRFVPIATAASAVVLGLLMLLVWPPIQTGLNNFSNFMLGENRTVAAFVFGVVERALIPFGLHHIFYSPFWFEFGTYTSEAGQIIRGDQAIFMK 259
>gi|110802584|ref|YP_699433.1| PTS system, glucose-specific IIBC component [Clostridium perfringens SM101] >gi|110683085|gb|ABG86455.1| PTS system, glucose-specific IIBC component [Clostridium perfringens SM101] (509 aa)
Score = 421, Expect = 6.2e-39, Identities = 102/268 (38%), Positives = 157/268 (58%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIF-GLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENI 688
           G ++ GK+ FM+ GLPAAA AM   A    +K+A  I  SA  TS LTGITEP+E+ FLF+AP LF  +H  L  L+F +M  + +             IGM+FSGG++D+I+ G I        WW  I  GL +  IY+FLF F I+KF+++TPGR              + + +  +  ++++N+D  LA  ++ A GG  NI  +DACIT+LR+ + D S V+  +L +LGA G ++   +++ A+FG ++DI+K  I+ +M  +
  S:   271 GTFMTGKFPFMMFGLPAAALAMYHEAKPGKKKIASGILFSAALTSFLTGITEPLEFAFLFVAPVLFV-IHCVLAGLSFMIMQLLNV------------KIGMTFSGGLLDFILLGVIP---NRTRWWLVILVGLGFGVIYYFLFRFFIRKFDLKTPGR--------------EDDDIFDDMDNQTVNDD--LAAEILIALGGAGNINKLDACITRLRVTVNDSSKVNKERLKELGAAGVMQVG-ENIQAIFGGKSDILKTQIREIMNGM 506
Score = 318, Expect = 5.2e-27, Identities = 92/261 (35%), Positives = 143/261 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI----------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQA-VGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSIDLTQNAIIY 303
           + ++ K LMLP+A+LP AG+ LG GS              NAG     ++    +   GN +F  L LLFA+ +A+  +   G A LA  +G+LI          +VT   G  I  +++             A+  + +Y  V+GI  LQ+ VFGG ++G + A LY +F  I+L   +GFF G RFVPI+T ++   +  + + +WP +  AL +  Q +  A   +++ +FG IERAL+PFGLHH +Y+P W     YT   G + +  N I +
  S:     8 LQRIGKALMLPVALLPAAGLLLGFGSMFQDPQFLSLVPALNAGW---FQLIATIMSDAGNIIFSNLALLFAVGVAVGLSEGDGVAGLAAIVGFLIL---------NVTMGIGGGITADVV-------------ASTKNGMYATVLGIPTLQTGVFGGIIMGVIAAALYKRFYKIELPSYLGFFAGKRFVPIITAISALVLGGIMVFVWPPIQGALLYFSQNMISANQTLSALLFGIIERALIPFGLHHIWYNPFWFQFGEYTNKAGQLIMGDNQIFF 259
>gi|149189723|ref|ZP_01868004.1| PTS system, N-acetylglucosamine-specific IIABC component [Vibrio shilonii AK1] >gi|148836372|gb|EDL53328.1| PTS system, N-acetylglucosamine-specific IIABC component [Vibrio shilonii AK1] (520 aa)
Score = 420, Expect = 9.2e-39, Identities = 180/643 (27%), Positives = 268/643 (41%)
  Q:    42 FIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVP-----GNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLAT---STATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTL 684
           +  KL K LMLPIA LPIA + L +G                G+ L +P     G A+FG LP                          L+FG L  A+  S  D  GA      + Y    F L+A    + + +            S FGG   G +    YN F   +L   + FF G R VPI+  L       +  ++WP +   L  L  A+  +  I  F++G + RAL+P GLHH   S  W+                  G    VL T   +   +L S ++L   ++P    T+   AG    + F N+     +  +KE++                  +   G +           G ++ G    NGF  V +   L G  + M L  PA           E R        S  F S LTGITEP+E+ F+FLAP L+  +HA    LA  + N  G     T H       G  FS G+ID+++   +     +  +   + GL +  +YFF F F I+ FN+++PGR ++                      +  N D  LA   + A GG DN+ ++DACIT+LR+ +KD+SV D A L +LGA+G +K    ++  + G  A+II G +K++
  S:     4 YAQKLGKALMLPIATLPIAALLLRLGQ---------------GDLLDIPFMAQAGGAIFGQLP--------------------------LLFG-LGIAIGLS-KDGNGAAGLAGAVAY----FVLTATATTINADV----------NMSFFGGIFAGIIAGHSYNAFHATRLPEWLAFFAGKRLVPIMAGLFALVAGAISGVVWPSIQGGLDALAHAVSTSGAIGQFVYGTLNRALIPVGLHHVLNSYFWFGM----------------GTCQEVLVTGAQAAGQALPSLQQL--CVDPALAKTL--VAGQAHTFEFANSVTPEITATVKEVTE-----------------TVKTGDLHRFF------GGDKSAGVF-MNGFFPVMMFG-LPGAALAMYLAAPA-----------EKRSQVGGALFSVAFCSFLTGITEPLEFMFVFLAPALY-AMHAVFTGLALVVANMFG-----TLH-------GFGFSAGLIDFVLNWGL----ATKPFTLLLIGLGFGALYFFTFSFAIRAFNLKSPGREDDDVEVEV--------------DGDVKNGD--LARQYLKALGGHDNLTSIDACITRLRLTLKDRSVADEAVLKKLGAKGVVKLGENNLQVILGPLAEIIAGEMKSI 508
>gi|163762793|ref|ZP_02169857.1| polar amino acid ABC transporter, inner membrane subunit [Bacillus selenitireducens MLS10] >gi|160356726|gb|EDP83375.1| polar amino acid ABC transporter, inner membrane subunit [Bacillus selenitireducens MLS10] (517 aa)
Score = 419, Expect = 1.2e-38, Identities = 102/261 (39%), Positives = 162/261 (62%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGR-GENTRLFTKEDYKNKQNKVQINGSSESLNND----QVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIK 678
           V  G+++ GK+  ++ GL  AA AM  AA KENR +   + ++A  T+ LTGITEPIE+TFLF+AP LF  VHA L  ++F +   + +            ++G +   G ID+I+  AI    G+N WW + + G  +  IY++LF F IKK+N+ TPGR G+  +L+T++D+  K+ K +  G ++  N+D    Q++A  ++ A GG +NI +VDAC T+LR+ +KD   +D  +L  LGA G +K    ++ A+FG ++D+ K
  S:   265 VTAGRFMAGKFPVIMFGLLGAALAMYKAADKENRPVVKGLLIAAAGTAFLTGITEPIEFTFLFVAPLLFV-VHALLAGVSFAVAFMLNV------------NLGWAGGSGFIDFILVNAIP---GTNNWWMNLVMGAVFFVIYYYLFSFAIKKWNLATPGRAGQENKLYTRKDFNEKKEKGE--GGNDDGNSDKKEYQLVAARILDALGGEENIDHVDACFTRLRVTVKDVEGIDEPELKALGAAGVMK-YQNNIQAIFGGKSDLYK 512
Score = 297, Expect = 1.5e-24, Identities = 74/254 (29%), Positives = 128/254 (50%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGG------NEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFI--FGFIERALVPFGLHHAFYSPLWYTQAGGSIDL 296
           + K  K LM+P+A+LP AGI LG+G+A+            N+ +    + +   G  +F  LP++FAI +AI  +G +G A LA  +GY++  +   +++  +T    A  G                        Y   +GI  L++ V GG +VG +  +++N+FK  +   ++GFF G R V IV       +    ++IWP +   +  +   +        +I  +GF+ER L+P GLHH +Y+P  +T  GG++ +
  S:     6 LQKFGKSLMVPVALLPAAGILLGIGAALTGPLADFVTILQNDTVEAISDAMLQLGLTIFENLPIIFAIGVAIGLSGGSGIAGLAALLGYIMMNT-TISIAMGITPEMAAEGGE-----------------------YALALGIPTLETGVLGGIIVGLVAVWVHNRFKRFQPPEVLGFFAGDRSVGIVMVFVSIALAFGVMIIWPPIQTGIDAVANVIASDTTNPLYIGLYGFLERLLIPTGLHHIWYAPFLWTGLGGTVQV 243
>gi|195962909|ref|ZP_03099114.1| PTS system, maltose and glucose-specific IIABC component (malX) [Borrelia spielmanii A14S] (542 aa)
Score = 416, Expect = 2.4e-38, Identities = 103/254 (40%), Positives = 145/254 (57%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI----VTNAGGNEGLRVFGN-------FLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDAL--SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDL 296
           + K+ K  MLPIA+LP AGI LG+G A     +  A G EG+   G         ++  G  +F  LPL+FA AI I     + G AALA  +G+L+     + +   Q +T  + ++     L       G+    A   S  Y  V+GI  LQ SV GG V GF+  FL+N+F NI+L   + FF G RFVPI+T + +F V I    IWP V  A+T  GQ + Q+    +F +G I+R+L+PFGLHH FY P W T  GG++++
  S:    14 LQKIGKAFMLPIALLPAAGILLGIGGAFTNETMIQAYGLEGVLGKGTVASSILYLMKYTGEVIFANLPLMFAAAIPIGLAKVEKGTAALAGVVGFLVMHQTINGILYIQGITPESASLKALLEL-------GMPETAATAKSQEYTNVLGIFSLQMSVMGGLVAGFVAVFLHNRFYNIQLPTFLAFFGGTRFVPIITTITMFVVGIFLTFIWPFVQGAMTSFGQIVEQSGLFGTFAYGAIKRSLIPFGLHHIFYLPFWQTAVGGTLEI 274
Score = 314, Expect = 1.6e-26, Identities = 96/264 (36%), Positives = 146/264 (55%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDT-AKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++  G++V MI GLP AA AM   +  EN+K   S+ +SA FTS+LTGITEP+E+ FLF AP L++ ++  L  LA+ L + + +             +G++FSGG ID  ++G +Q    +N     I G+ Y   ++F+F F+I KF+++T GR         ED + +++K+     SE  N  +  A  V+   GG DNI  +DAC ++LR+ +K    + + A    LGA G +K    SV  VFG  +D IK  I  LM
  S:   305 RFFSGEFVVMIFGLPGAALAMYHTSKPENKKNVASLLLSASFTSMLTGITEPLEFAFLFAAPALYYFIYVPLFGLAYLLTHLLNV------------GVGLTFSGGFIDMFLFGILQGNSKTNWIAIPILGIFYFIGFYFIFKFVIMKFDLKTIGR---------EDEEMEKDKI----ISEKTNLSET-ASKVLEGLGGKDNITYLDACASRLRVNLKQIEFIKSDAYFKNLGASGILKKG-NSVQIVFGGLSDNIKMEIDKLM 542
>gi|196126816|ref|ZP_03118565.1| PTS system, glucose-specific IIBC component [Clostridium difficile ATCC 43255] (531 aa)
Score = 414, Expect = 4.8e-38, Identities = 101/270 (37%), Positives = 158/270 (58%)
  Q:   417 GVN--VGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLME 686
           GVN   G ++ G + FM+ GLPAAA AMV  A  E +K    I  SA  TS LTGITEPIE+ FLF+AP LF  +H     L++ +M  +G+             IG +FSGG+ID++++G +        W+ + + G+ +A +Y+ +F F+I+KFN++TPGR               +++ + N     ++ ++ LA  ++ A G  DN+K++DACIT+LR+ + D + VD  KL  LGA G +     +V A+FG ++D IK +IK ++E
  S:   262 GVNFTAGTFMTGAFPFMMFGLPAAALAMVHEAKPEKKKFVAGIMASAALTSFLTGITEPIEFAFLFVAPVLF-AIHCLFSGLSYAIMQLLGV------------KIGFTFSGGLIDFLLFGVLP---NRTPWYLAILVGIGFAVLYYSVFRFMIRKFNLKTPGR---------------EDESETNAEVIEMSKNE-LASEILIALGNKDNLKSLDACITRLRLVVNDINKVDKEKLKSLGAAGVMVIG-NNVQAIFGPKSDSIKSDIKDIIE 501
Score = 335, Expect = 6.4e-29, Identities = 86/245 (35%), Positives = 133/245 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAG-------GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIA-LTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + K+ K LMLP+A+LP AGI LGV +A+  +A         N   ++  + ++  G  +F  LPL+FA+ +A+  T   G AALA  +G+LI  +    ++    D                          + +S+Y  ++GI  +Q+ VFGG ++G + A+LY KF  I+L   +GFF G RFVPIVT L    + I+   IWP +    L+F    +     + +F+ G +ER L+PFGLHH F++P WY
  S:     8 LQKVGKSLMLPVALLPAAGILLGVSNALAGDALLAHFPALANPTFQLIISIMESSGQIIFNNLPLIFAVGVAVGLTEGEGVAALAAIVGFLILNTSMGVMAGVTEDM-------------------------VDNSMYANIVGIPTIQTGVFGGIIIGIVAAYLYKKFYKIELPQYLGFFAGKRFVPIVTSLVAIAIGIILSFIWPPIQEGLLSFSKNVIEANQTLAAFMEGSLERLLIPFGLHHVFHNPFWY 235
>gi|167932526|ref|ZP_02519613.1| PTS system, maltose and glucose-specific IIABC component (malX) [Borrelia burgdorferi 156a] (542 aa)
Score = 413, Expect = 5.0e-38, Identities = 102/259 (39%), Positives = 147/259 (56%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI----VTNAGGNEGLRVFGN-------FLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDAL--SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAI 301
           + K+ K  MLPIA+LP AGI LG+G A     +  A G E +   G         ++  G  +F  LPL+FA AI I     + G AALA  +G+L+     + +   Q +T  + ++     L       G+    A   S  Y +V+GI  LQ SV GG + GF+  FL+N+F NI+L   + FF G RFVPIVT +A+F V I    IWP +  A+T  G+ + Q+    +F +G I+R+L+PFGLHH FY P W T  GG++++    I
  S:    14 LQKIGKAFMLPIALLPAAGILLGIGGAFTNETMIQAYGLEEVLGKGTVANSILYLMKYTGEVIFANLPLMFAAAIPIGLAKVEKGTAALAGVVGFLVMHQTINGILYIQGITPESASLKALLEL-------GMPETAATAKSQEYTSVLGIFSLQMSVMGGLIAGFVAVFLHNRFHNIQLPTFLAFFGGTRFVPIVTTMAMFVVGIFLTFIWPFIQGAMTSFGRIVEQSGLFGTFAYGAIKRSLIPFGLHHIFYLPFWQTAVGGTLEINNELI 279
Score = 316, Expect = 8.6e-27, Identities = 97/264 (36%), Positives = 143/264 (54%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDT-AKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++  G++V MI GLP AA AM   +  EN+K   S+ +SA FTS+LTGITEP+E+ FLF AP L++ ++  L  LA+ L + + +             +G++FSGG ID  ++G +Q    +N     I G+ Y   ++F+F F I KFN++T GR         ED   +  K  ++    SL+     A  V+   GG DNI  +DAC ++LR+ +K   V+ + A    LGA G +K    SV  VFG  +D IK  I  LM
  S:   305 RFFSGEFVVMIFGLPGAALAMYHTSKPENKKNVASLLLSASFTSMLTGITEPLEFAFLFAAPALYYFIYVPLFGLAYLLTHLLNV------------GVGLTFSGGFIDMFLFGILQGNGKTNWIAIPILGIFYFIGFYFIFKFAIMKFNLKTIGR---------ED--EEMEKTMMSSEKTSLSET---ASKVLEGLGGKDNITYIDACASRLRVNLKQIEVIKSDAYFKNLGASGILKKG-NSVQIVFGGLSDNIKMEIDKLM 542
>gi|11497021|ref|NP_047015.1| PTS system, maltose and glucose-specific IIABC component (malX) [Borrelia burgdorferi B31] >gi|168526847|ref|ZP_02720486.1| PTS system, maltose and glucose-specific IIABC component (malX) [Borrelia burgdorferi 118a] >gi|168580326|ref|ZP_02724260.1| PTS system, maltose and glucose-specific IIABC component (malX) [Borrelia burgdorferi 72a] >gi|195955667|ref|ZP_03094360.1| PTS system, maltose and glucose-specific IIABC component (malX) [Borrelia burgdorferi CA-11.2a] >gi|2689888|gb|AAC66326.1| PTS system, maltose and glucose-specific IIABC component (malX) [Borrelia burgdorferi B31] (542 aa)
Score = 413, Expect = 5.0e-38, Identities = 102/259 (39%), Positives = 147/259 (56%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI----VTNAGGNEGLRVFGN-------FLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDAL--SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAI 301
           + K+ K  MLPIA+LP AGI LG+G A     +  A G E +   G         ++  G  +F  LPL+FA AI I     + G AALA  +G+L+     + +   Q +T  + ++     L       G+    A   S  Y +V+GI  LQ SV GG + GF+  FL+N+F NI+L   + FF G RFVPIVT +A+F V I    IWP +  A+T  G+ + Q+    +F +G I+R+L+PFGLHH FY P W T  GG++++    I
  S:    14 LQKIGKAFMLPIALLPAAGILLGIGGAFTNETMIQAYGLEEVLGKGTVANSILYLMKYTGEVIFANLPLMFAAAIPIGLAKVEKGTAALAGVVGFLVMHQTINGILYIQGITPESASLKALLEL-------GMPETAATAKSQEYTSVLGIFSLQMSVMGGLIAGFVAVFLHNRFHNIQLPTFLAFFGGTRFVPIVTTMAMFVVGIFLTFIWPFIQGAMTSFGRIVEQSGLFGTFAYGAIKRSLIPFGLHHIFYLPFWQTAVGGTLEINNELI 279
Score = 318, Expect = 6.0e-27, Identities = 97/264 (36%), Positives = 143/264 (54%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDT-AKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++  G++V MI GLP AA AM   +  EN+K   S+ +SA FTS+LTGITEP+E+ FLF AP L++ ++  L  LA+ L + + +             +G++FSGG ID  ++G +Q    +N     I G+ Y   ++F+F F I KFN++T GR         ED   +  K  ++    SL+     A  V+   GG DNI  +DAC ++LR+ +K   V+ + A    LGA G +K    SV  VFG  +D IK  I  LM
  S:   305 RFFSGEFVVMIFGLPGAALAMYHTSKPENKKNVASLLLSASFTSMLTGITEPLEFAFLFAAPALYYFIYVPLFGLAYLLTHLLNV------------GVGLTFSGGFIDMFLFGILQGNSKTNWIAIPILGIFYFIGFYFIFKFAIMKFNLKTIGR---------ED--EEMEKTMMSSEKTSLSET---ASKVLEGLGGKDNITYIDACASRLRVNLKQIEVIKSDAYFKNLGASGILKKG-NSVQIVFGGLSDNIKMEIDKLM 542
>gi|77956825|ref|ZP_00820902.1| COG2190: Phosphotransferase system IIA components [Yersinia bercovieri ATCC 43970] (339 aa)
Score = 413, Expect = 5.3e-38, Identities = 109/338 (32%), Positives = 183/338 (54%)
  Q:   522 MSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQV--LALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLK-HAKSTITPIIVLN 859
           M  S G++D ++     +   +  W+  I  GL +  IY+ +F F I+KFN+ TPGR        ++ Y      V +N ++ ++N  ++  LA   + A GG DN+  +DACIT+LR+ +KD ++V+     +LGA G I+ + QSV  + G  A++I   ++ ++          +         +  +SA          KT S      +V+ SP TGE+V+L +VPDE F+   +G G+A++PT   + SP +G +  +F+T HA+  ETE G +I++H+GID++ L  +       FA  V+ G TV  GQ +  + LA L  +A+S I+P++V N
  S:     1 MVSSAGLVDMVLSSRNPL---ATHWYMLIPQGLVFFAIYYVVFRFTIQKFNLLTPGRELAVEGSEEDGYD-----VNVN-NTPAVNESEINGLARRYIGAIGGSDNLTGIDACITRLRLNVKDSALVNDNVAKRLGASGVIRLNKQSVQVIVGTRAELIASAMRAVLAGGPVPAASSTAAPAAAQPQAVINSA----------KTAS------LVLVSPITGEVVALEQVPDEAFASKAVGEGVAIRPTDKMVVSPANGTIVKIFNTDHAFCLETETGAEIVVHIGIDTVKLNGQG------FARLVEEGATVVAGQPVLELDLAYLNANARSMISPVVVSN 311
>gi|146318053|ref|YP_001197765.1| phosphotransferase system IIC component, glucose/maltose/N-acetylglucosamine-specific [Streptococcus suis 05ZYH33] >gi|145688859|gb|ABP89365.1| Phosphotransferase system IIC component, glucose/maltose/N-acetylglucosamine-specific [Streptococcus suis 05ZYH33] (626 aa)
Score = 413, Expect = 5.9e-38, Identities = 142/508 (27%), Positives = 243/508 (47%)
  Q:   371 YSAINGTYD---NASIASSSNGAIQSVLTW----------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLN-NDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVV-DTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKK 878
           Y+++ GTYD    A   +   G     L W           ++      L  I    FK   VGQ +    + M L       AM     ++ +     + +S+     LTG+TEPIE+ F+F A  L+  V+A +   AF + + + L + + G+ E      M+   G+      G   I +    W + +F +      +F+  F+IKKFN+ T GR  N        Y  +   V  N + ++ + N QV+   +++  GG DNI +VDAC+T+LR+ +KD + V D     Q GA G I      V AV+G +AD++K +I+ L+E+  + P             ++  +  EV PE       ++       V S   G+ +++ +V D  FS+ MMG G AV+P++G +Y+P+ G ++ VF T HA    ++KG ++L+HVG+D++ L         PF+  V  G  V+ G  +    L  ++ A    T ++    + E + +  L+  G++ +
  S:   154 YTSLGGTYDILTGAQAGTQVFGQDPLWLAWITDLINLKDAGDMAQYNDLLANITPARFK---VGQMIGSSGILMGL-----TYAMYRNVDEDKKHKYKGMFISSALAVFLTGVTEPIEFMFMFAAMPLYV-VYAFVQGAAFAMADIVNLRMHSFGNIEFLTRTPMAIKAGI------GMDVINF---IWVTALFAVGM----YFIANFMIKKFNLATAGRNGN--------YDTETTDVVSNSNVDTADANSQVV--QIINLLGGRDNIADVDACMTRLRVSVKDVAQVGDENAWKQAGAMGLIIKD-SGVQAVYGPKADVLKSDIQDLLESGVAIPR------------TEIVATEEVAPE-------TQFKGVTETVYSVAEGQAIAITEVKDPVFSQKMMGDGYAVEPSSGNVYAPVSGIVTSVFPTKHAVGILSDKGVEVLVHVGLDTVALNG------APFSTKVTDGQRVEAGDLLLVADLEAIRSAGRETTIVVAFTNTAEIKSVS-LENLGQVSQ 617
Score = 203, Expect = 1.2e-13, Identities = 54/145 (37%), Positives = 82/145 (56%)
  Q:   156 GNIFGLS----AGNAALPSSLYGA----------VIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           G+ FG++    A  AA  ++++G           ++G   L   VF G + GF+ A  YNK+ N  KL  ++ FFNG RFVP V       V +   + WP+V   +   G+ +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ D+   A
  S:     4 GHFFGVTTDMLADAAATVTTVFGTEIPVSGYFVNILGQPALNMGVFVGIIAGFVGATTYNKYYNYRKLPDVLTFFNGKRFVPFVVIYRSVLVALGLAIFWPVVQTGINSFGKWIASSQDTAPILAPFVYGTLERLLLPFGLHHMLTIPMNYTSLGGTYDILTGA 167
>gi|195978879|ref|YP_002124123.1| PTS system glucose-specific EIICBA component [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975584|gb|ACG63110.1| PTS system glucose-specific EIICBA component [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (728 aa)
Score = 412, Expect = 6.4e-38, Identities = 142/491 (28%), Positives = 237/491 (48%)
  Q:   371 YSAINGTYDNASIASSSNGAIQSVLTW------------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGM-IDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGR-GENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAK-LMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNES 861
           Y+A+ GTY+  + A++          W            SN ++ Q  + T+    FK   VGQ +      M  G+  A    V A  K   K+     +SA     LTG+TEP+EY F+F A  L+  V+A +   +F + + + L V + G+ EL     M+   G+ +D I +           W S +F    A I + +  F+IKK  + T GR G       + D    +++  I+G S+         + +++  GG +NI +VDAC+T+LR+ + D + V + +   Q GA G I      V AV+G +ADI+K +I+ L+++ +  P LK         ++ +S  ++ K   E V T ++             GE++ +  V D+ F+  MMG G AV+P  G IY+P+ G ++ VF T HA+   T+ G ++L+HVG+D+++L        +PF   V  G  V  G  +    LA +  A    T ++    +
  S:   254 YTALGGTYEVMTGAAAGTKVFGQDPLWLAWVTDLVNLKGSNASTYQHLMETVVPARFK---VGQMIGATGTLM--GVALAMYRNVDADKKHKYKMMF---ISAAAAVFLTGVTEPLEYMFMFAAMPLYL-VYALVQGASFAMADLVNLRVHSFGNIELLTRTPMAIKAGLGMDLINF----------VWVSILF----AVIMYVIADFMIKKMKLATAGRLGNYDADMLENDDTRPESQQSIDGQSQ--------VVQIINLLGGRENIADVDACMTRLRVTVNDPNKVGSEEHWKQAGAMGLIIKG-SGVQAVYGPKADILKSDIQDLLDSGAVIPELKPA-----QLAASSSGQTDFKNLTETVLTVAD-------------GEVLPITAVSDQVFAAKMMGDGFAVEPANGAIYAPVTGLVTHVFPTKHAFGLLTDSGLEVLVHVGLDTVDLNG------EPFTVKVSEGQRVSAGDLLAEADLAAITAAGRKTTVVVAFTNT 703
Score = 287, Expect = 2.0e-23, Identities = 83/260 (31%), Positives = 133/260 (51%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYN---LLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G+++      ++ L   GN +   G AV G L LLFA+AI  ++  +    A A  + +++   +           TGA+ G +   L   +  I  L  G   +    + +V+    L + VF G + GF+ A  YNK+ N  KL  ++ FFNG RFVP V  L    V ++  +IWP++   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ ++   A
  S:    12 EFWQKFGKCLMVVIAVMPAAGLMVSIGNSLPMLNQESQLLATLGNVIAQVGWAVIGNLHLLFALAIGGSWAKERAGGAFASGLAFVLINRI-----------TGAIYGVSSAMLTDPEAKIKSL-LGTEMIVKDYFTSVLESPALNTGVFVGIIAGFVGATAYNKYYNYRKLPDVLAFFNGKRFVPFVVILRSALVALVLALIWPVIQSGINGFGMWIASSQDTAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYEVMTGA 267
>gi|4098489|gb|AAD00281.1| putative ptsG protein [Streptococcus mutans] (409 aa)
Score = 412, Expect = 6.6e-38, Identities = 132/429 (30%), Positives = 211/429 (49%)
  Q:   420 VGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGM-IDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVV-DTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHA 848
           VGQ +    + M L L     AM      + ++    + +SA     LTG+TEP+EY F+F A  L+  V+A +  LAF   + I L V + G+ E      M+   G+ +D + +  +          S +FG+A     +F+  F+IKKFN+ T GR  N   +   D  + +     N  + + N+  V  +N++   GG +NI +VDAC+T+LRI + D + V D A   + GA G I      V AV+G +AD++K +I+ L+++    P             +D ++  E K      K  +E       V +   G+++ + +V D  FS+ MMG G AV+P  G IYSP+ G ++ VF T HA    T+ G ++L+HVG+D++ L         PF+  VK G  V +G  +    L  +K A
  S:    30 VGQMIGSSGILMGLTL-----AMYRNVDPDKKEKYKGMFLSAAVAVFLTGVTEPLEYMFMFAALPLYL-VYAVVQGLAFASADLIHLRVHSFGNIEFLTKTPMAIKAGLAMDIVNFIVV----------SVVFGVAM----YFITNFMIKKFNLATSGRNGN---YDTGDDASDETASNSNAGTANANSQIVKIINLL---GGKENISDVDACMTRLRITVTDVAKVGDEAAWKKAGAMGLIVKG-NGVQAVYGPKADVLKSDIQDLLDSGVDIPK------------TDVTAPEEDKTADVSFKGVTE------EVATVADGQVLPITQVHDPVFSQKMMGDGFAVEPENGNIYSPVAGLVTSVFPTKHALGLLTDDGLEVLVHVGLDTVALNG------APFSAKVKDGQRVALGDLLLVADLEAIKSA 409
>gi|126700281|ref|YP_001089178.1| PTS system, glucose-specific IIBC component [Clostridium difficile 630] >gi|115251718|emb|CAJ69553.1| PTS system, glucose-specific IIbc component [Clostridium difficile 630] (523 aa)
Score = 412, Expect = 6.8e-38, Identities = 101/270 (37%), Positives = 158/270 (58%)
  Q:   417 GVN--VGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLME 686
           GVN   G ++ G + FM+ GLPAAA AMV  A  E +K    I  SA  TS LTGITEPIE+ FLF+AP LF  +H     L++ +M  +G+             IG +FSGG+ID++++G +        W+ + + G+ +A +Y+ +F F+I+KFN++TPGR               +++ + N     ++ ++ LA  ++ A G  DN+K++DACIT+LR+ + D + VD  KL  LGA G +     +V A+FG ++D IK +IK ++E
  S:   262 GVNFTAGTFMTGAFPFMMFGLPAAALAMVHEAKPEKKKFVAGIMASAALTSFLTGITEPIEFAFLFVAPVLF-AIHCLFSGLSYAIMQLLGV------------KIGFTFSGGLIDFLLFGVLP---NRTPWYLAILVGIGFAVLYYSVFRFMIRKFNLKTPGR---------------EDESETNAEVIEMSKNE-LASEILIALGNKDNLKSLDACITRLRLVVNDINKVDKEKLKSLGAAGVMVIG-NNVQAIFGPKSDSIKSDIKDIIE 501
Score = 334, Expect = 7.9e-29, Identities = 86/245 (35%), Positives = 133/245 (54%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAG-------GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIA-LTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + K+ K LMLP+A+LP AGI LGV +A+  +A         N   ++  + ++  G  +F  LPL+FA+ +A+  T   G AALA  +G+LI  +    ++    D                          + +S+Y  ++GI  +Q+ VFGG ++G + A+LY KF  I+L   +GFF G RFVPIVT L    + I+   IWP +    L+F    +     + +F+ G +ER L+PFGLHH F++P WY
  S:     8 LQKVGKSLMLPVALLPAAGILLGVSNALAGDALLAHFPVLANPTFQLIISIMESSGQIIFNNLPLIFAVGVAVGLTEGEGVAALAAIVGFLILNTSMGVMAGVTEDM-------------------------VDNSMYANIVGIPTIQTGVFGGIIIGIVAAYLYKKFYKIELPQYLGFFAGKRFVPIVTSLVAIAIGIILSFIWPPIQEGLLSFSKNVIEANQTLAAFMEGSLERLLIPFGLHHVFHNPFWY 235
>gi|94995180|ref|YP_603278.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes MGAS10750] >gi|94548688|gb|ABF38734.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes MGAS10750] (728 aa)
Score = 412, Expect = 7.4e-38, Identities = 140/497 (28%), Positives = 238/497 (47%)
  Q:   371 YSAINGTYDNASIASSSNGAIQSVLTW----SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAK-LMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREI 867
           Y+A+ GTY+  + A++          W    ++L   + +  +  ++    V   ++  G+ +     L   A AM      + +     + +SA     LTG+TEP+EY F+F A  L+  V+A +   +F + + + L V + G+ EL     M+   G+      G   I +    W S +F    A I +F+   +IKK ++ T GR  N       D+  +    Q+  S     N QV+   +++  GG  NI +VDAC+T+LR+ +KD + +       + GA G I+     V AV+G +ADI+K +I+ L+++ +  P +        N S  TS  +  K  K V         EKV+  S   G ++ +  V D+ F+  MMG G AV+PT G IY+P+ G ++ VF T HA+   T+ G ++L+HVG+D++ L         PF+  V  G  V  G  +    LA +K A+   T ++    + E +++
  S:   254 YTALGGTYEVMTGAAAGTKVFGQDPLWLAWVTDLVHLKGSDASAYSHLMDSVTPARFKVGQMIGATGTLMGVALAMYRNVDADKKHTYKMMFISAAAAVFLTGVTEPLEYLFMFAAMPLYL-VYALVQGASFAMADLVNLRVHSFGNIELLTRTPMALKAGL------GMDVINF---VWVSILF----AVIMYFIADMMIKKMHLATAGRLGNYDADILGDHNTQARPTQVADS-----NSQVV--QIINLLGGAGNIDDVDACMTRLRVTVKDPAKIGAEDDWKKAGAMGLIQKG-NGVQAVYGPKADILKSDIQDLLDSGAVIPEV--------NMSQLTSKPTPAKDFKHVT--------EKVL--SVADGMVLPITGVKDQVFAAKMMGDGFAVEPTNGNIYAPVAGLVTSVFPTKHAFGLLTDNGLEVLVHVGLDTVALNG------VPFSVKVSEGQRVHAGDLLVVADLAAIKSAERETTIVVAFTNTAEIQDV 709
Score = 278, Expect = 2.7e-22, Identities = 82/260 (31%), Positives = 131/260 (50%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYN---LLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALG----QAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G++I      +  L   GN +   G AV   L LLFA+AI  ++  +    A A  + +++   +           TGA  G +   L   +  I  L  G   +    + +V+    L + VF G + GF+ A  YNK+ N  KL  ++ FFNG RFVP V  L    V ++ +++WP++   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ ++   A
  S:    12 EFWQKFGKCLMVVIAVMPAAGLMISIGNSIPMINHDSAFLASLGNIIAQIGWAVIVNLHLLFALAIGGSWAKERAGGAFASGLAFVLINRI-----------TGAFYGVSSAMLADPEAKITSL-LGTQMIVKDYFTSVLESPALNTGVFVGIIAGFVGATAYNKYYNYRKLPEVLTFFNGKRFVPFVVILRSIFVALILVVVWPVIQSGINSFGMWIASSQDSAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYEVMTGA 267
>gi|111074146|ref|YP_709274.1| PTS system, maltose and glucose-specific IIABC component [Borrelia afzelii PKo] >gi|110891292|gb|ABH02451.1| PTS system, maltose and glucose-specific IIABC component [Borrelia afzelii PKo] (520 aa)
Score = 412, Expect = 7.9e-38, Identities = 100/251 (39%), Positives = 144/251 (57%)
  Q:    51 MLPIAMLPIAGIFLGVGSAI----VTNAGGNEGLRVFGN-------FLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDAL--SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAI 301
           MLPIA+LP AGI LG+G A     +  A G EG+   G         ++  G  +F  LPL+FA AI I     + G AALA  +G+L+     + +   Q +T  + ++     L       G+    A   S  Y +V+GI  LQ SV GG + GF+  FL+N+F NI+L   + FF G RFVPI+T + +F V I    IWP +  A+T  GQ + Q+  + +F +G I+R+L+PFGLHH FY P W T  GG++++    I
  S:     1 MLPIALLPAAGILLGIGGAFTNETMIQAYGLEGILGKGTVASSILYLMKYTGEVIFANLPLMFAAAIPIGLAKVEKGTAALAGVVGFLVMHQTINGILYIQGITPESASLKALLEL-------GMPETAATAKSQEYTSVLGIFSLQMSVMGGLIAGFVAVFLHNRFYNIQLPTFLAFFGGTRFVPIITTITMFVVGIFLTFIWPFIQGAMTLFGQIVEQSGLLGTFAYGAIKRSLIPFGLHHIFYLPFWQTAVGGTLEINGELI 258
Score = 318, Expect = 5.3e-27, Identities = 97/281 (34%), Positives = 150/281 (53%)
  Q:   405 QALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQ-LGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           + LG      F+     ++  G++V MI GLP AA AM   +  EN+K   S+ +SA FTS+LTGITEP+E+ FLF AP L++ ++  L  LA+ L + + +             +G++FSGG ID  ++G +Q    +N     I G+ Y   ++F+F F+I KFN++T GR              +  +++ + SSE  N  +  AL V+   GG DNI  +DAC ++LR+ +K    + +    + LGA G +K    SV  VFG  +D I+  I  LM
  S:   267 KQLGDTNTVHFEVAKGTRFFSGEFVVMIFGLPGAALAMYHTSKPENKKNVASLLLSASFTSMLTGITEPLEFAFLFAAPALYYFIYVPLFGLAYLLTHLLNV------------GVGLTFSGGFIDMFLFGILQGNSKTNWIAIPILGIFYFIGFYFIFKFVIMKFNLKTIGR--------------EDEEMEKDISSEKTNLSET-ALKVLEGLGGKDNITYLDACASRLRVNLKQIEFIKSDTYFKNLGASGILKKG-NSVQIVFGGLSDNIRMEIDKLM 520
>gi|94991268|ref|YP_599368.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes MGAS10270] >gi|94544776|gb|ABF34824.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes MGAS10270] (728 aa)
Score = 409, Expect = 1.5e-37, Identities = 140/497 (28%), Positives = 236/497 (47%)
  Q:   371 YSAINGTYDNASIASSSNGAIQSVLTW----SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAK-LMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREI 867
           Y+A+ GTY+  + A++          W    ++L   + +  +  ++    V   ++  G+ +     L   A AM      + +     + +SA     LTG+TEP+EY F+F A  L+  V+A +   +F + + + L V + G+ EL     M+   G+      G   I +    W S +F    A I +F+   +IKK ++ T GR  N       D   +    Q+  S     N QV+   +++  GG DNI +VDAC+T+LR+ +KD + V       + GA G I+     V AV+G +ADI+K +I+ L+++ +  P +        N S  TS  +   P K+ +    E       V S   G ++ +  V D+ F+  MMG G AV+PT G IY+P+ G ++ VF T HA+   T  G ++L+HVG+D++ L         PF+  V  G  V  G  +    LA +K A+   T ++    + E +++
  S:   254 YTALGGTYEVMTGAAAGTKVFGQDPLWLAWVTDLVHLKGSDASAYSHLMDSVTPARFKVGQMIGATGTLMGVALAMYRNVDADKKHTYKMMFISAAAAVFLTGVTEPLEYLFMFAAMPLYI-VYALVQGASFAMADLVNLRVHSFGNIELLTRTPMALKAGL------GMDVINF---VWVSILF----AVIMYFIADMMIKKMHLATAGRLGNYDADILGDRNTQATPTQVADS-----NSQVV--QIINLLGGEDNIDDVDACMTRLRVTVKDPAKVGAEDDWKKAGAMGLIQKG-NGVQAVYGPKADILKSDIQDLLDSGALIPEV--------NMSQLTSKPT---PAKDFIHVTEE-------VLSVADGMVLPITGVKDQVFAVKMMGDGFAVEPTNGNIYAPVAGLVTSVFPTKHAFGLLTNNGLEVLVHVGLDTVALNG------VPFSVKVSEGQRVHAGDLLVVADLAAIKSAERETTIVVAFTNTTEIQDV 709
Score = 262, Expect = 1.6e-20, Identities = 82/260 (31%), Positives = 131/260 (50%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYN---LLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALG----QAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G++I      +  L   GN +   G AV   L LLFA+AI  ++  +    A A  + +++   +           TGA  G +   L   +  I  L  G   +    + +V+    L + VF G + GF+ A  YNK+ N  KL  ++ FFNG RFVP V  L    V ++ +++WP++   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ ++   A
  S:    12 EFWQKFGKCLMVVIAVMPAAGLMISIGNSIPMINHDSAFLASLGNIIAQIGWAVIVNLHLLFALAIGGSWAKERAGGAFASGLAFVLINRI-----------TGAFYGVSSAMLADPEAKITSL-LGTQMIVKDYFTSVLESPALNTGVFVGIIAGFVGATAYNKYYNYRKLPEVLTFFNGKRFVPFVVILRSILVALVLVVVWPVIQSGINSFGMWIASSQDSAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYEVMTGA 267
>gi|59713969|ref|YP_206744.1| PTS system, glucose-specific II BC component [Vibrio fischeri ES114] >gi|59482217|gb|AAW87856.1| PTS system, glucose-specific II BC component [Vibrio fischeri ES114] (536 aa)
Score = 409, Expect = 1.7e-37, Identities = 98/258 (37%), Positives = 157/258 (60%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGE-NTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQ-LGARGTIKPSPQSVYAVFGAEADIIKGNI 681
           + G ++ M+ GLPAAA AM   A  +N+K+   I +SA  TS LTGITEP+E+TFLF+AP L+  +HA L  L++ LM+ + + V            G++FS G+ID+  +G +Q    ++  W  I G  Y+ +Y+F+F F+I+KFN  TPGR + + +L T++ YK        N SSE ++       ++V   GG +NI+++DACIT+LR+ +KD  +V + ++ + L A+G I+ S   V  ++G +A+I K  I
  S:   299 MTGGFLPMMFGLPAAAFAMYRCADDKNKKMVKGILISAALTSFLTGITEPLEFTFLFVAPALY-AIHAVLEGLSYMLMHMLDVAV------------GITFSRGLIDFTFFGLLQGTEKTDYQWILILGPIYSVVYYFIFSFMIRKFNYSTPGRNDADNKLQTRDSYKK-------NKSSELID-------DIVKELGGINNIESLDACITRLRVTVKDTDIVASDEVWRSLQAKGVIR-SGNGVQIIYGTQAEIYKNQI 530
Score = 361, Expect = 6.5e-32, Identities = 103/285 (36%), Positives = 148/285 (51%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVT-------NAGGNEGLRVFGNFLQV---PGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDAL--SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTS 322
           N    + ++ +  MLPIA+LP+AGI LGVG A  +       N    +   V   FL +    G  VF  LPLLFA+ +AI     +   AA++  IG+L+F ++   +   Q +T  T  V G   L       G     A   SSLY   +G+  LQ+ VFGG + G L A+L NK+ N +L   + FF+G R VP++T L   P+  LF +IWP +  ++   G+A      I +F +G   R L  FGLHHA Y   WYT+ GG  ++    +       +A LA  T T  +S
  S:     3 NIFSMLQRIGRAFMLPIAVLPMAGILLGVGGAFTSGPLIDTYNLTFLQPGTVANQFLILCFKAGLFVFMNLPLLFAVGVAIGMANKNKETAAISAVIGFLLFHTVIGTILGFQGLTPETTTVDGLIAL-------GYGPVEAVGLSSLYTHELGMFTLQTGVFGGIICGLLAAYLTNKYSNKQLPDYLAFFSGNRLVPVMTMLYFIPLAFLFPIIWPTIFKSIVAAGEAFSAMGYIGTFFYGSGMRILNVFGLHHAIYPLFWYTELGGVQEVAGQMVSGGQKIFFAQLADPTVTHFSS 293
>gi|146320231|ref|YP_001199942.1| phosphotransferase system IIC component, glucose/maltose/N-acetylglucosamine-specific [Streptococcus suis 98HAH33] >gi|145691037|gb|ABP91542.1| Phosphotransferase system IIC component, glucose/maltose/N-acetylglucosamine-specific [Streptococcus suis 98HAH33] (722 aa)
Score = 408, Expect = 2.3e-37, Identities = 142/508 (27%), Positives = 243/508 (47%)
  Q:   371 YSAINGTYD---NASIASSSNGAIQSVLTW----------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLN-NDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVV-DTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKFLKKSGEIKK 878
           Y+++ GTYD    A   +   G     L W           ++      L  I    FK   VGQ +    + M L       AM     ++ +     + +S+     LTG+TEPIE+ F+F A  L+  V+A +   AF + + + L + + G+ E      M+   G+      G   I +    W + +F +      +F+  F+IKKFN+ T GR  N        Y  +   V  N + ++ + N QV+   +++  GG DNI +VDAC+T+LR+ +KD + V D     Q GA G I      V AV+G +AD++K +I+ L+E+  + P             ++  +  EV PE       ++       V S   G+ +++ +V D  FS+ MMG G AV+P++G +Y+P+ G ++ VF T HA    ++KG ++L+HVG+D++ L         PF+  V  G  V+ G  +    L  ++ A    T ++    + E + +  L+  G++ +
  S:   250 YTSLGGTYDILTGAQAGTQVFGQDPLWLAWITDLINLKDAGDMAQYNDLLANITPARFK---VGQMIGSSGILMGL-----TYAMYRNVDEDKKHKYKGMFISSALAVFLTGVTEPIEFMFMFAAMPLYV-VYAFVQGAAFAMADIVNLRMHSFGNIEFLTRTPMAIKAGI------GMDVINF---IWVTALFAVGM----YFIANFMIKKFNLATAGRNGN--------YDTETTDVVSNSNVDTADANSQVV--QIINLLGGRDNIADVDACMTRLRVSVKDVAQVGDENAWKQAGAMGLIIKD-SGVQAVYGPKADVLKSDIQDLLESGVAIPR------------TEIVATEEVAPE-------TQFKGVTETVYSVAEGQAIAITEVKDPVFSQKMMGDGYAVEPSSGNVYAPVSGIVTSVFPTKHAVGILSDKGVEVLVHVGLDTVALNG------APFSTKVTDGQRVEAGDLLLVADLEAIRSAGRETTIVVAFTNTAEIKSVS-LENLGQVSQ 713
Score = 285, Expect = 4.4e-23, Identities = 90/266 (33%), Positives = 132/266 (49%)
  Q:    35 KKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAF----TGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGA-VIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           KK  + EF  K  K LM+ IA++P AG+ + +G++I   +  +E L   GN +   G  + G L LLFA+AI  ++     G A  A LA  +  LI G      +  + D    V           +FG       +P S Y   ++G   L   VF G + GF+ A  YNK+ N  KL  ++ FFNG RFVP V       V +   + WP+V   +   G+ +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ D+   A
  S:     2 KKFLSFEFWQKFGKCLMVVIAVMPAAGLMVSIGNSIPLISPESELLIRIGNIIAQIGWGIIGNLHLLFALAIGGSWAKEKAGGAFSAGLAFILINLITGHFFGVTTDMLADAAATVT---------TVFG-----TEIPVSGYFVNILGQPALNMGVFVGIIAGFVGATTYNKYYNYRKLPDVLTFFNGKRFVPFVVIYRSVLVALGLAIFWPVVQTGINSFGKWIASSQDTAPILAPFVYGTLERLLLPFGLHHMLTIPMNYTSLGGTYDILTGA 263
>gi|172058317|ref|YP_001814777.1| PTS system, glucose-specific IIBC subunit [Exiguobacterium sibiricum 255-15] >gi|171990838|gb|ACB61760.1| PTS system, glucose-specific IIBC subunit [Exiguobacterium sibiricum 255-15] (507 aa)
Score = 407, Expect = 2.4e-37, Identities = 101/271 (37%), Positives = 153/271 (56%)
  Q:   417 GVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
            +  G ++ GK+ FM+ GLPAAA AM   A  E R +   +  SA  T+ LTGITEPIE+ FLF+AP LF  VHA    L+F  M  + +             IGM+FSGG+ID++++G +    G   WW   + GL  A +Y+  F F I+KFN++TPGR               +++VQ      S+     LA  ++ A G   NIK++DACIT+LR+++ D+S VD  +L +LGA G ++    +V A++G ++D IK  I+ ++ +
  S:   265 ALTAGTFMTGKFPFMMFGLPAAALAMYHEARPERRAVVGGLLGSAALTAFLTGITEPIEFAFLFVAPILF-AVHAVFAGLSFMTMQLLNV------------KIGMTFSGGLIDFLLFGVLP---GRTQWWLVIVVGLVLAVVYYVGFRFAIRKFNLKTPGR---------------EDEVQ----ETSMAQGSELAAGILDALGSESNIKHLDACITRLRVEVLDKSKVDKNELKKLGAAGVLEVG-NNVQAIYGPKSDNIKSEIQAVINS 500
Score = 319, Expect = 4.3e-27, Identities = 92/274 (33%), Positives = 135/274 (49%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGN--------FLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSIDLTQNAIIYQDGKAYAVLATST 316
           + ++ K LMLP+A+LP AGI LG G+A+  N      L    N         ++  G+ +FG L LLFA+ +AI   GD      A  +G+LI             +      GY+                         V+GI  LQ+ VFGG ++G + A+ Y K+ N++L   +GFF G RFVPIVT +      ++ + +WP     L TF    + +   + +F+FG IER+L+PFGLHH FY+P W     YT   G++     AI +   K    L   T
  S:     9 LQRVGKALMLPVAILPAAGILLGFGNAM-QNPNLTSKLEFLKNDAVIKVAKLMEAAGDIIFGNLALLFAVGVAIGLAGDGAAGLAA-IVGFLIMNKTMSVWLGVTPEMVANGQGYS------------------------NVLGIPTLQTGVFGGIIIGLIAAWAYGKYHNLELPQFLGFFAGKRFVPIVTAVVSLFAGLVLVFVWPFAQDGLNTFSHFMMEKNPTLAAFVFGLIERSLIPFGLHHIFYAPFWFEFGSYTNKAGTVVHGDQAIFFAQLKDNVALTAGT 270
>gi|163729266|ref|ZP_02136747.1| PTS system, glucose-specific II BC component [Vibrio fischeri MJ11] >gi|161397517|gb|EDQ21805.1| PTS system, glucose-specific II BC component [Vibrio fischeri MJ11] (536 aa)
Score = 407, Expect = 2.5e-37, Identities = 98/258 (37%), Positives = 157/258 (60%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGE-NTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQ-LGARGTIKPSPQSVYAVFGAEADIIKGNI 681
           + G ++ M+ GLPAAA AM   A  +N+K+   I +SA  TS LTGITEP+E+TFLF+AP L+  +HA L  L++ LM+ + + V            G++FS G+ID+  +G +Q    ++  W  I G  Y+ +Y+F+F F+I+KFN  TPGR + + +L T++ YK        N SSE ++       ++V   GG +NI+++DACIT+LR+ +KD  +V + ++ + L A+G I+ S   V  ++G +A+I K  I
  S:   299 MTGGFLPMMFGLPAAAFAMYRCADDKNKKMVKGILISAALTSFLTGITEPLEFTFLFVAPALY-AIHAVLEGLSYMLMHILDVAV------------GITFSRGLIDFTFFGLLQGTEKTDYQWILILGPIYSLVYYFIFSFMIRKFNYSTPGRNDSDNKLQTRDSYKK-------NKSSELID-------DIVKELGGINNIESLDACITRLRVTVKDTEIVASDEVWRSLQAKGVIR-SGNGVQIIYGTQAEIYKNQI 530
Score = 364, Expect = 2.8e-32, Identities = 104/285 (36%), Positives = 148/285 (51%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVT-------NAGGNEGLRVFGNFLQV---PGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDAL--SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTS 322
           N    + ++ +  MLPIA+LP+AGI LGVG A  +       N    +   V   FL +    G  VF  LPLLFA+ +AI     +   AA++  IG+L+F ++   +   Q +T  T  V G   L       G     A   SSLY   +G+  LQ+ VFGG + G L A+L NKF N +L   + FF+G R VP++T L   P+  LF +IWP +  ++   G+A      I +F +G   R L  FGLHHA Y   WYT+ GG  ++    +       +A LA  T T  +S
  S:     3 NIFSMLQRIGRAFMLPIAVLPMAGILLGVGGAFTSGPLIDTYNLTFLQPGTVANQFLILCFKAGLFVFMNLPLLFAVGVAIGMANKNKETAAISAVIGFLLFHTVIGTILGFQGLTPETTTVDGLIAL-------GYDPVEAVGLSSLYTHELGMFTLQTGVFGGIICGLLAAYLTNKFSNKQLPDYLAFFSGNRLVPVMTMLYFIPLAFLFPIIWPTIFKSIVAAGEAFSAMGYIGTFFYGSGMRILNVFGLHHAIYPLFWYTELGGVQEVAGQMVSGGQKIFFAQLADPTVTHFSS 293
>gi|71904340|ref|YP_281143.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes MGAS6180] >gi|71803435|gb|AAX72788.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes MGAS6180] (728 aa)
Score = 407, Expect = 2.6e-37, Identities = 138/497 (27%), Positives = 236/497 (47%)
  Q:   371 YSAINGTYDNASIASSSNGAIQSVLTW----SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAK-LMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREI 867
           Y+A+ GTY+  + A++          W    ++L   + +  +  ++    V   ++  G+ +     L   A AM      + +     + +SA     LTG+TEP+EY F+F A  L+  V+A +   +F + + + L V + G+ EL     M+   G+      G   I +    W S +F    A I +F+   +IKK ++ T GR  N       D+  +    Q+  S     N QV+   +++  GG  NI +VDAC+T+LR+ +KD + +       + GA G I+     V AV+G +ADI+K +I+ L+++ +  P +        N S  TS  +  K  K V +           V S   G ++ +  V D+ F+  MMG G AV+PT G IY+P+ G ++ VF T HA+   T+ G ++L+HVG+D++ L         PF+  V  G  V  G  +    LA +K A+   T ++    + E +++
  S:   254 YTALGGTYEVMTGAAAGTKVFGQDPLWLAWVTDLVHLKGSDASAYSHLMDSVTPARFKVGQMIGATGTLMGVALAMYRNVDADKKHTYKMMFISAAAAVFLTGVTEPLEYLFMFAAMPLYI-VYALVQGASFAMADLVNLRVHSFGNIELLTRTPMALKAGL------GMDVINF---VWVSILF----AVIMYFIADMMIKKMHLATAGRLGNYDADILGDHNTQATPTQVADS-----NSQVV--QIINLLGGAGNIDDVDACMTRLRVTVKDPAKIGAEDDWKKAGAMGLIQKG-NGVQAVYGPKADILKSDIQDLLDSGAVIPEV--------NMSQLTSKPTPAKDFKHVTEE----------VLSVADGMVLPITGVKDQVFAAKMMGDGFAVEPTHGNIYAPVAGLVTSVFPTKHAFGLLTDNGLEVLVHVGLDTVALNG------VPFSVKVSEGQRVHAGDLLVVADLAAIKSAERETTIVVAFTNTTEIQDV 709
Score = 281, Expect = 1.3e-22, Identities = 83/260 (31%), Positives = 132/260 (50%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYN---LLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALG----QAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G++I      +  L   GN +   G AV   L LLFA+AI  ++  +    ALA  + +++   +           TGA  G +   L   +  I  L  G   +    + +V+    L + VF G + GF+ A  YNK+ N  KL  ++ FFNG RFVP V  L    V ++ +++WP++   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ ++   A
  S:    12 EFWQKFGKCLMVVIAVMPAAGLMISIGNSIPMINHESAFLASLGNIIAQIGWAVIVNLHLLFALAIGGSWAKERAGGALASGLAFVLINRI-----------TGAFYGVSSAMLADPEAKITSL-LGTQMIVKDYFTSVLESPALNTGVFVGIIAGFVGATAYNKYYNYRKLPEVLTFFNGKRFVPFVVILRSIFVALILVVVWPVIQSGINSFGMWIASSQDSAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYEVMTGA 267
>gi|21911244|ref|NP_665512.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes MGAS315] >gi|28896620|ref|NP_802970.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes SSI-1] >gi|21905457|gb|AAM80315.1| putative PTS system enzyme II A component [Streptococcus pyogenes MGAS315] >gi|28811874|dbj|BAC64803.1| putative PTS system, enzyme IIA component [Streptococcus pyogenes SSI-1] (728 aa)
Score = 406, Expect = 3.2e-37, Identities = 139/497 (27%), Positives = 235/497 (47%)
  Q:   371 YSAINGTYDNASIASSSNGAIQSVLTW----SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAK-LMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREI 867
           Y+A+ GTY+  + A++          W    ++L   + +  +  ++    V   ++  G+ +     L   A AM      + +     + +SA     LTG+TEP+EY F+F A  L+  V+A +   +F + + + L V + G+ EL     M+   G+      G   I +    W S +F    A I +F+   +IKK ++ T GR  N       D   +    Q+  S     N QV+   +++  GG  NI +VDAC+T+LR+ +KD + V       + GA G I+     V AV+G +ADI+K +I+ L+++ +  P +        N S  TS  +  K  K V +           V S   G ++ +  V D+ F+  MMG G AV+PT G IY+P+ G ++ VF T HA+   T+ G ++L+HVG+D++ L         PF+  V  G  V  G  +    LA +K A+   T ++    + E +++
  S:   254 YTALGGTYEVMTGAAAGTKVFGQDPLWLAWVTDLVHLKGSDASAYSHLMDSVTPARFKVGQMIGATGTLMGVALAMYRNVDADKKHTYKMMFISAAAAVFLTGVTEPLEYMFMFAAMPLYI-VYALVQGASFAMADLVNLRVHSFGNIELLTRTPMALKAGL------GMDVINF---VWVSILF----AVIMYFIADMMIKKMHLATAGRLGNYDADILGDRNTQARPTQVADS-----NSQVV--QIINLLGGAGNIDDVDACMTRLRVTVKDPAKVGAEDDWKKAGAMGLIQKG-NGVQAVYGPKADILKSDIQDLLDSGAVIPEV--------NMSQLTSKPTPAKDFKHVTEE----------VLSVADGMVLPITGVKDQVFAAKMMGDGFAVEPTNGNIYAPVAGLVTSVFPTKHAFGLLTDNGLEVLVHVGLDTVALNG------VPFSVKVSEGQRVHAGDLLVVADLAAIKSAERETTIVVAFTNTAEIQDV 709
Score = 278, Expect = 2.6e-22, Identities = 82/260 (31%), Positives = 131/260 (50%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYN---LLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALG----QAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G++I      +  L   GN +   G AV   L LLFA+AI  ++  +    A A  + +++   +           TGA  G +   L   +  I  L  G   +    + +V+    L + VF G + GF+ A  YNK+ N  KL  ++ FFNG RFVP V  L    V ++ +++WP++   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ ++   A
  S:    12 EFWQKFGKCLMVVIAVMPAAGLMISIGNSIPMINHDSAFLASLGNIIAQIGWAVIVNLHLLFALAIGGSWAKERAGGAFASGLAFVLINRI-----------TGAFYGVSSAMLADPEAKITSL-LGTQMIVKDYFTSVLESPALNTGVFVGIIAGFVGATAYNKYYNYRKLPEVLTFFNGKRFVPFVVILRSIFVALILVVVWPVIQSGINSFGMWIASSQDSAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYEVMTGA 267
>gi|81096237|ref|ZP_00874585.1| Sugar-specific permease, EIIA 1 domain:PTS system, IIBC component:PTS system, glucose-like IIB component [Streptococcus suis 89/1591] >gi|80977724|gb|EAP41259.1| Sugar-specific permease, EIIA 1 domain:PTS system, IIBC component:PTS system, glucose-like IIB component [Streptococcus suis 89/1591] (722 aa)
Score = 406, Expect = 4.1e-37, Identities = 140/499 (28%), Positives = 237/499 (47%)
  Q:   371 YSAINGTYD---NASIASSSNGAIQSVLTW----------SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLN-NDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVV-DTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREIKF 869
           Y+++ GTYD    A   +   G     L W           ++      L  I    FK   VGQ +    + M L       AM     ++ +     + +S+     LTG+TEPIE+ F+F A  L+  V+A +   AF + + + L + + G+ E      M+   G+      G   I +    W + +F +      +F+  F+IKKFN+ T GR  N        Y  +   V  N + ++ + N QV+   +++  GG DNI +VDAC+T+LR+ +KD + V D     Q GA G I      V AV+G +AD++K +I+ L+E+  + P             ++  +  EV PE       ++       V S   G+ +++ +V D  FS+ MMG G AV+P++G +Y+P+ G ++ VF T HA    ++KG ++L+HVG+D++ L         PF+  V  G  V+ G  +    L  ++ A    T ++    + E + +  
  S:   250 YTSLGGTYDILTGAQAGAQVFGQDPLWLAWITDLINLKDAGDMAQYNDLLANITPARFK---VGQMIGSSGILMGL-----TYAMYRNVDEDKKHKYKGMFISSALAVFLTGVTEPIEFMFMFAAMPLYV-VYAFVQGAAFAMADVVNLRMHSFGNIEFLTRTPMAIKAGI------GMDVINF---IWVTALFAVGM----YFIANFMIKKFNLATAGRNGN--------YDTETTDVVSNSNVDTADANSQVV--QIINLLGGRDNIADVDACMTRLRVSVKDVAQVGDENAWKQAGAMGLIIKD-SGVQAVYGPKADVLKSDIQDLLESGVAIPR------------TEIVATEEVAPE-------TQFKGVTETVYSVAEGQAIAITEVKDPVFSQKMMGDGYAVEPSSGNVYAPVSGIVTSVFPTKHAVGILSDKGVEVLVHVGLDTVALNG------APFSAKVTDGQRVEAGDLLLVADLDAIRSAGRETTIVVAFTNTAEIKSVSL 705
Score = 285, Expect = 4.3e-23, Identities = 90/266 (33%), Positives = 132/266 (49%)
  Q:    35 KKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAF----TGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGA-VIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           KK  + EF  K  K LM+ IA++P AG+ + +G++I   +  +E L   GN +   G  + G L LLFA+AI  ++     G A  A LA  +  LI G      +  + D    V           +FG       +P S Y   ++G   L   VF G + GF+ A  YNK+ N  KL  ++ FFNG RFVP V       V +   + WP+V   +   G+ +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ D+   A
  S:     2 KKFLSFEFWQKFGKCLMVVIAVMPAAGLMVSIGNSIPLISPESELLIRIGNIIAQIGWGIIGNLHLLFALAIGGSWAKEKAGGAFSAGLAFILINLITGHFFGVTTDMLADAAATVT---------TVFG-----TEIPVSGYFVNILGQPALNMGVFVGIIAGFVGATTYNKYYNYRKLPDVLTFFNGKRFVPFVVIYRSVLVALGLAIFWPVVQTGINSFGKWIASSQDTAPILAPFVYGTLERLLLPFGLHHMLTIPMNYTSLGGTYDILTGA 263
>gi|139474463|ref|YP_001129179.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes str. Manfredo] >gi|134272710|emb|CAM30982.1| putative glucose-specific phosphotransferase system (PTS), IIABC component [Streptococcus pyogenes str. Manfredo] (728 aa)
Score = 405, Expect = 4.2e-37, Identities = 137/497 (27%), Positives = 236/497 (47%)
  Q:   371 YSAINGTYDNASIASSSNGAIQSVLTW----SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAK-LMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREI 867
           Y+A+ GTY+  + A++          W    ++L   + +  +  ++    V   ++  G+ +     L   A AM      + +     + +SA     LTG+TEP+EY F+F A  L+  V+A +   +F + + + L V + G+ EL     M+   G+      G   I +    W S +F    A I +F+   +IKK ++ T GR  N       D+  +    Q+  S     N QV+   +++  GG  NI +VDAC+T+LR+ +KD + +       + GA G I+     V AV+G +ADI+K +I+ L+++ +  P +        N S  TS  +  K  K V +           V S   G ++ +  V D+ F+  MMG G AV+PT G IY+P+ G ++ VF T HA+   T+ G ++L+HVG+D++ L         PF+  V  G  V  G  +    LA ++ A+   T ++    + E +++
  S:   254 YTALGGTYEVMTGAAAGTKVFGQDPLWLAWVTDLVHLKGSDASAYSHLMDSVTPARFKVGQMIGATGTLMGVALAMYRNVDADKKHTYKMMFISAAAAVFLTGVTEPLEYLFMFAAMPLYI-VYALVQGASFAMADLVNLRVHSFGNIELLTRTPMALKAGL------GMDVINF---VWVSILF----AVIMYFIADMMIKKMHLATAGRLGNYDADILGDHNTQATPTQVADS-----NSQVV--QIINLLGGAGNIDDVDACMTRLRVTVKDPAKIGAEDDWKKAGAMGLIQKG-NGVQAVYGPKADILKSDIQDLLDSGAVIPKV--------NMSQLTSKPTPAKDFKHVTED----------VLSVADGMVLPITGVKDQVFAAKMMGDGFAVEPTNGNIYAPVAGLVTSVFPTKHAFGLLTDNGLEVLVHVGLDTVALNG------VPFSVKVSEGQRVHAGDLLVVADLAAIQSAERETTIVVAFTNTTEIQDV 709
Score = 274, Expect = 8.1e-22, Identities = 81/260 (31%), Positives = 130/260 (50%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYN---LLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALG----QAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G++I      +  L   GN +   G  V   L LLFA+AI  ++  +    A A  + +++   +           TGA  G +   L   +  I  L  G   +    + +V+    L + VF G + GF+ A  YNK+ N  KL  ++ FFNG RFVP V  L    V ++ +++WP++   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ ++   A
  S:    12 EFWQKFGKCLMVVIAVMPAAGLMISIGNSIPMINHDSAFLASLGNIIAQIGWVVIVNLHLLFALAIGGSWAKERAGGAFASGLAFVLINRI-----------TGAFYGVSSTMLADPEAKITSL-LGTQMIVKDYFTSVLESPALNTGVFVGIIAGFVGATAYNKYYNYRKLPEVLTFFNGKRFVPFVVILRSIFVALILVVVWPVIQSGINSFGMWIASSQDSAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYEVMTGA 267
>gi|167943460|ref|ZP_02530534.1| PTS system, maltose and glucose-specific IIABC component [Borrelia afzelii ACA-1] (520 aa)
Score = 405, Expect = 4.4e-37, Identities = 101/251 (40%), Positives = 142/251 (56%)
  Q:    51 MLPIAMLPIAGIFLGVGSAI----VTNAGGNEGLRVFGN-------FLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDAL--SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAI 301
           MLPIA+LP AGI LG+G A     +  A G EG+   G         ++  G  +F  LPL+FA AI I     + G AALA  +G+L+     + +   Q +T  + ++     L       G+    A   S  Y  V+GI  LQ SV GG V GF+  FL+N+F NI+L   + FF G RFVPI+T + +F V I    IWP +  A+T  GQ + Q+    +F +G I+R+L+PFGLHH FY P W T  GG++++    I
  S:     1 MLPIALLPAAGILLGIGGAFTNETMIQAYGLEGILGKGTVASSILYLMKYTGEVIFANLPLMFAAAIPIGLAKVEKGTAALAGVVGFLVMHQTINGILYIQGITPESASLKALLEL-------GMPETAATAKSQEYTNVLGIFSLQMSVMGGLVAGFVAVFLHNRFYNIQLPTFLAFFGGTRFVPIITTITMFVVGIFLTFIWPFIQGAMTSFGQIVEQSGLFGTFAYGAIKRSLIPFGLHHIFYLPFWQTAVGGTLEINGELI 258
Score = 318, Expect = 6.0e-27, Identities = 97/281 (34%), Positives = 150/281 (53%)
  Q:   405 QALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQ-LGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           + LG      F+     ++  G++V MI GLP AA AM   +  EN+K   S+ +SA FTS+LTGITEP+E+ FLF AP L++ ++  L  LA+ L + + +             +G++FSGG ID  ++G +Q    +N     I G+ Y   ++F+F F+I KFN++T GR              +  +++ + SSE  N  +  AL V+   GG DNI  +DAC ++LR+ +K    + +    + LGA G +K    SV  VFG  +D I+  I  LM
  S:   267 KQLGDTNTVHFEVAKGTRFFSGEFVVMIFGLPGAALAMYHTSKPENKKNVASLLLSASFTSMLTGITEPLEFAFLFAAPALYYFIYVPLFGLAYLLTHLLNV------------GVGLTFSGGFIDMFLFGILQGNSKTNWIAIPILGIFYFIGFYFIFKFVIMKFNLKTIGR--------------EDEEMEKDISSEKTNLSET-ALKVLEGLGGKDNITYLDACASRLRVNLKQIEFIKSDTYFKNLGASGILKKG-NSVQIVFGGLSDNIRMEIDKLM 520
>gi|186475065|ref|YP_001856535.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Burkholderia phymatum STM815] >gi|184191524|gb|ACC69489.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Burkholderia phymatum STM815] (588 aa)
Score = 404, Expect = 6.6e-37, Identities = 95/263 (36%), Positives = 142/263 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWII-YGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKT 683
           G ++ G +  M+ GLPAA  AM+  APKE R L   +  S   TS LTG+TEPIE++F+FLAP L+  +HA L  L+  + + +G+             +G +FS G ID+++ YG       +  W +   G+AY+ +Y+ LF F I+KFN+ TPGR + T     E +        + GS+ +       A   ++A GG  N+  VDAC T+LR+ + D   V   +L  +GARG +K    +V  + G EADII   I+T
  S:   229 GTFMTGFFPIMMFGLPAACLAMLHEAPKERRALVGGLLFSMALTSFLTGVTEPIEFSFMFLAPVLY-AIHAVLTGLSLAICSALGI------------KLGFTFSAGAIDYVLNYG-----LSTKGWEAIPIGIAYSVVYYGLFRFFIRKFNMATPGREQETPDVANESFSADGFVAPVGGSAAT---SGTRAQRYIAALGGAANLSVVDACTTRLRLSVVDSEKVSDNELKSIGARGVLKRGGGNVQVIIGPEADIIADEIRT 471
Score = 287, Expect = 2.2e-23, Identities = 83/251 (33%), Positives = 115/251 (45%)
  Q:    37 GNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           GN    + +L + LMLPIA+LP+AG+ L +G   V N             +   G A+F  LPLLFAI +A+ F  D  G AALA  IGYLI    + A+ + + D                                       +L   V  G + G +   LYN++K+IKL   + FF G RFVPIVT +A   + I+F   W  V  A+   G  L  A  + +F+FG + R L+  GLHH   S  W+
  S:     3 GNPFLKVQRLGRALMLPIAVLPVAGLLLRLGQPDVFNI----------KMIADAGGAIFDNLPLLFAIGVAVGFAKDNNGVAALAGAIGYLI----EVAVMKDIND---------------------------------------KLNMGVLSGIIAGIVAGMLYNRYKDIKLPDYLAFFGGKRFVPIVTGVACLVLGIVFGYAWAPVQAAIDAAGHWLTTAGAVGAFVFGLLNRLLLVTGLHHILNSLAWF 201
>gi|21693325|gb|AAM75272.1|AF454824_67 EF0067 [Enterococcus faecalis] (500 aa)
Score = 404, Expect = 6.8e-37, Identities = 103/265 (38%), Positives = 152/265 (57%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFI-FGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLME 686
           ++  G++  M+ GLPAA  AM  A PK+NRK    +  S G TS LTGITEP+EY FLF+APWL+  +HA L  L+F   + + +             +G SFSGG+ID++++G +Q    +N W   I FG+A+A +YF +F F IKKF +  PG GE     T    +NK NK        SLN++   A  ++ A G   NI++V+AC T+LR+ + D  +VD   + QLGA    + +   + AVFG +AD++   I  ++E
  S:   260 RFFAGRFATMMFGLPAACYAMYRAIPKQNRKKNGGLYFSGGLTSFLTGITEPVEYMFLFVAPWLYI-IHAFLDGLSFYFADILNI------------RVGNSFSGGLIDFLLFGVLQGNDKTN-WLKLIPFGIAWAIVYFCVFTFFIKKFKVAIPGMGEELPTTT----ENKLNK------KTSLNDE---AQIIIKALGSKTNIESVEACATRLRLAVVDGRMVDKETIKQLGATAVFEVN-GGIQAVFGGKADLLSQEINQILE 497
Score = 273, Expect = 8.8e-22, Identities = 90/280 (32%), Positives = 138/280 (49%)
  Q:    44 AKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNE-------GLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFT-GDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSW 323
           ++L +  MLPIA+LP+AG+ LG+G A+   +  N         +    + +   GNAVF  L L+FAI IA+    GD G A LA  + YL++              T  + G+  LF        SA +A L               + V G  V+G  VAFL+N+++ I+L   +GFF G RF+PI++ LA   +   F +IWP +   L  +G+ + Q   + +F++GF+ R     GLHH  Y   WYT  GG+  +    +       +A LA    T L ++
  S:     6 SQLGRAFMLPIAILPVAGLLLGLGGALTNESAMNAYPILEQPWIHTVLSIMSYAGNAVFTNLALIFAIGIAVGLANGDKGTAGLAGGVSYLVY--------------TATISGFLALF--------SAKDATL--------------DTGVVGSIVIGGTVAFLHNRYRKIELPQFLGFFGGSRFIPIISSLAAIIIGSFFYLIWPPIQNGLAVVGEHIAQMGSLGTFLYGFLLRLTGAVGLHHTIYPLFWYTSLGGTESVAGVTVSGAQNIFFAQLADPNHTGLFTY 257
>gi|195959776|ref|ZP_03095985.1| PTS system, maltose and glucose-specific IIABC component (malX) [Borrelia sp. SV1] (521 aa)
Score = 403, Expect = 8.2e-37, Identities = 100/251 (39%), Positives = 143/251 (56%)
  Q:    51 MLPIAMLPIAGIFLGVGSAI----VTNAGGNEGLRVFGN-------FLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDAL--SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAI 301
           MLPIA+LP AGI LG+G A     +  A G E +   G         ++  G  +F  LPL+FA AI I     + G AALA  +G+L+     + +   Q +T  + ++     L       G+    A   S  Y +V+GI  LQ SV GG + GF+  FL+N+F NI+L   + FF G RFVPIVT +A+F V I    IWP +  A+T  G+ + Q+    +F +G I+R+L+PFGLHH FY P W T  GG++++    I
  S:     1 MLPIALLPAAGILLGIGGAFTNETMIQAYGLEEVLGKGTVANSILYLMKYTGEVIFANLPLMFAAAIPIGLAKVEKGTAALAGVVGFLVMHQTINGILYIQGITPESASLKALLEL-------GMPETAATAKSQEYTSVLGIFSLQMSVMGGLIAGFVAVFLHNRFHNIQLPTFLAFFGGTRFVPIVTTMAMFVVGIFLTFIWPFIQGAMTSFGRIVEQSGLFGTFAYGAIKRSLIPFGLHHIFYLPFWQTAVGGTLEINNELI 258
Score = 318, Expect = 5.0e-27, Identities = 97/264 (36%), Positives = 143/264 (54%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDT-AKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++  G++V MI GLP AA AM   +  EN+K   S+ +SA FTS+LTGITEP+E+ FLF AP L++ ++  L  LA+ L + + +             +G++FSGG ID  ++G +Q    +N     I G+ Y   ++F+F F I KFN++T GR         ED   +  K  ++    SL+     A  V+   GG DNI  +DAC ++LR+ +K   V+ + A    LGA G +K    SV  VFG  +D IK  I  LM
  S:   284 RFFSGEFVVMIFGLPGAALAMYHTSKPENKKNVASLLLSASFTSMLTGITEPLEFAFLFAAPALYYFIYVPLFGLAYLLTHLLNV------------GVGLTFSGGFIDMFLFGILQGNSKTNWIAIPILGIFYFIGFYFIFKFAIMKFNLKTIGR---------ED--EEMEKTMMSSEKTSLSET---ASKVLEGLGGKDNITYIDACASRLRVNLKQIEVIKSDAYFKNLGASGILKKG-NSVQIVFGGLSDNIKMGIDKLM 521
>gi|195942076|ref|ZP_03087458.1| PTS system, maltose and glucose-specific IIABC component (malX) [Borrelia burgdorferi 80a] >gi|195949747|ref|ZP_03090847.1| PTS system, maltose and glucose-specific IIABC component (malX) [Borrelia burgdorferi WI91-23] >gi|195951529|ref|ZP_03092626.1| PTS system, maltose and glucose-specific IIABC component (malX) [Borrelia burgdorferi 29805] >gi|195961033|ref|ZP_03097238.1| PTS system, maltose and glucose-specific IIABC component (malX) [Borrelia burgdorferi 64b] (521 aa)
Score = 403, Expect = 8.2e-37, Identities = 100/251 (39%), Positives = 143/251 (56%)
  Q:    51 MLPIAMLPIAGIFLGVGSAI----VTNAGGNEGLRVFGN-------FLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDAL--SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAI 301
           MLPIA+LP AGI LG+G A     +  A G E +   G         ++  G  +F  LPL+FA AI I     + G AALA  +G+L+     + +   Q +T  + ++     L       G+    A   S  Y +V+GI  LQ SV GG + GF+  FL+N+F NI+L   + FF G RFVPIVT +A+F V I    IWP +  A+T  G+ + Q+    +F +G I+R+L+PFGLHH FY P W T  GG++++    I
  S:     1 MLPIALLPAAGILLGIGGAFTNETMIQAYGLEEVLGKGTVANSILYLMKYTGEVIFANLPLMFAAAIPIGLAKVEKGTAALAGVVGFLVMHQTINGILYIQGITPESASLKALLEL-------GMPETAATAKSQEYTSVLGIFSLQMSVMGGLIAGFVAVFLHNRFHNIQLPTFLAFFGGTRFVPIVTTMAMFVVGIFLTFIWPFIQGAMTSFGRIVEQSGLFGTFAYGAIKRSLIPFGLHHIFYLPFWQTAVGGTLEINNELI 258
Score = 315, Expect = 1.2e-26, Identities = 96/264 (36%), Positives = 143/264 (54%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQ-LGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++  G++V MI GLP AA AM   +  EN+K   S+ +SA FTS+LTGITEP+E+ FLF AP L++ ++  L  LA+ L + + +             +G++FSGG ID  ++G +Q    +N     I G+ Y   ++F+F F I KFN++T GR         ED   +  K  ++    SL+     A  V+   GG DNI  +DAC ++LR+ +K   V+ +    + LGA G +K    SV  VFG  +D IK  I  LM
  S:   284 RFFSGEFVVMIFGLPGAALAMYHTSKPENKKNVASLLLSASFTSMLTGITEPLEFAFLFAAPALYYFIYVPLFGLAYLLTHLLNV------------GVGLTFSGGFIDMFLFGILQGNSKTNWIAIPILGIFYFIGFYFIFKFAIMKFNLKTIGR---------ED--EEMEKTMMSSEKTSLSET---ASKVLEGLGGKDNITYIDACASRLRVNLKQIEVIKSDTYFKNLGASGILKKG-NSVQIVFGGLSDNIKMEIDKLM 521
>gi|167944713|ref|ZP_02531787.1| PTS system, maltose and glucose-specific IIABC component (malX) [Borrelia burgdorferi Bol26] >gi|168692977|ref|ZP_02725769.1| PTS system, maltose and glucose-specific IIABC component (malX) [Borrelia burgdorferi 94a] (521 aa)
Score = 403, Expect = 8.2e-37, Identities = 100/251 (39%), Positives = 143/251 (56%)
  Q:    51 MLPIAMLPIAGIFLGVGSAI----VTNAGGNEGLRVFGN-------FLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDAL--SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAI 301
           MLPIA+LP AGI LG+G A     +  A G E +   G         ++  G  +F  LPL+FA AI I     + G AALA  +G+L+     + +   Q +T  + ++     L       G+    A   S  Y +V+GI  LQ SV GG + GF+  FL+N+F NI+L   + FF G RFVPIVT +A+F V I    IWP +  A+T  G+ + Q+    +F +G I+R+L+PFGLHH FY P W T  GG++++    I
  S:     1 MLPIALLPAAGILLGIGGAFTNETMIQAYGLEEVLGKGTVANSILYLMKYTGEVIFANLPLMFAAAIPIGLAKVEKGTAALAGVVGFLVMHQTINGILYIQGITPESASLKALLEL-------GMPETAATAKSQEYTSVLGIFSLQMSVMGGLIAGFVAVFLHNRFHNIQLPTFLAFFGGTRFVPIVTTMAMFVVGIFLTFIWPFIQGAMTSFGRIVEQSGLFGTFAYGAIKRSLIPFGLHHIFYLPFWQTAVGGTLEINNELI 258
Score = 319, Expect = 4.6e-27, Identities = 97/264 (36%), Positives = 143/264 (54%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDT-AKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++  G++V MI GLP AA AM   +  EN+K   S+ +SA FTS+LTGITEP+E+ FLF AP L++ ++  L  LA+ L + + +             +G++FSGG ID  ++G +Q    +N     I G+ Y   ++F+F F I KFN++T GR         ED   +  K  ++    SL+     A  V+   GG DNI  +DAC ++LR+ +K   V+ + A    LGA G +K    SV  VFG  +D IK  I  LM
  S:   284 RFFSGEFVVMIFGLPGAALAMYHTSKPENKKNVASLLLSASFTSMLTGITEPLEFAFLFAAPALYYFIYVPLFGLAYLLTHLLNV------------GVGLTFSGGFIDMFLFGILQGNSKTNWIAIPILGIFYFIGFYFIFKFAIMKFNLKTIGR---------ED--EEMEKTMMSSEKTSLSET---ASKVLEGLGGKDNITYIDACASRLRVNLKQIEVIKSDAYFKNLGASGILKKG-NSVQIVFGGLSDNIKMEIDKLM 521
>gi|167934365|ref|ZP_02521440.1| PTS system, maltose and glucose-specific IIABC component (malX) [Borrelia burgdorferi ZS7] (521 aa)
Score = 403, Expect = 8.2e-37, Identities = 100/251 (39%), Positives = 143/251 (56%)
  Q:    51 MLPIAMLPIAGIFLGVGSAI----VTNAGGNEGLRVFGN-------FLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDAL--SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAI 301
           MLPIA+LP AGI LG+G A     +  A G E +   G         ++  G  +F  LPL+FA AI I     + G AALA  +G+L+     + +   Q +T  + ++     L       G+    A   S  Y +V+GI  LQ SV GG + GF+  FL+N+F NI+L   + FF G RFVPIVT +A+F V I    IWP +  A+T  G+ + Q+    +F +G I+R+L+PFGLHH FY P W T  GG++++    I
  S:     1 MLPIALLPAAGILLGIGGAFTNETMIQAYGLEEVLGKGTVANSILYLMKYTGEVIFANLPLMFAAAIPIGLAKVEKGTAALAGVVGFLVMHQTINGILYIQGITPESASLKALLEL-------GMPETAATAKSQEYTSVLGIFSLQMSVMGGLIAGFVAVFLHNRFHNIQLPTFLAFFGGTRFVPIVTTMAMFVVGIFLTFIWPFIQGAMTSFGRIVEQSGLFGTFAYGAIKRSLIPFGLHHIFYLPFWQTAVGGTLEINNELI 258
Score = 319, Expect = 4.9e-27, Identities = 97/264 (36%), Positives = 143/264 (54%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDT-AKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++  G++V MI GLP AA AM   +  EN+K   S+ +SA FTS+LTGITEP+E+ FLF AP L++ ++  L  LA+ L + + +             +G++FSGG ID  ++G +Q    +N     I G+ Y   ++F+F F I KFN++T GR         ED   +  K  ++    SL+     A  V+   GG DNI  +DAC ++LR+ +K   V+ + A    LGA G +K    SV  VFG  +D IK  I  LM
  S:   284 RFFSGEFVVMIFGLPGAALAMYHTSKPENKKNVASLLLSASFTSMLTGITEPLEFAFLFAAPALYYFIYVPLFGLAYLLTHLLNV------------GVGLTFSGGFIDMFLFGILQGNSKTNWIAIPILGIFYFIGFYFIFKFAIMKFNLKTIGR---------ED--EEMEKTMMSSEKTSLSET---ASKVLEGLGGKDNITYIDACASRLRVNLKQIEVIKSDAYFKNLGASGILKKG-NSVQIVFGGLSDNIKMEIDKLM 521
>gi|71911505|ref|YP_283055.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes MGAS5005] >gi|71854287|gb|AAZ52310.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes MGAS5005] (631 aa)
Score = 402, Expect = 9.9e-37, Identities = 139/497 (27%), Positives = 234/497 (47%)
  Q:   371 YSAINGTYDNASIASSSNGAIQSVLTW----SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAK-LMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREI 867
           Y+A+ GTY+  + A++          W    ++L   + +  +  ++    V   ++  G+ +     L   A AM      + +     + +SA     LTG+TEP+EY F+F A  L+  V+A +   +F + + + L V + G+ EL     M+   G+      G   I +    W S +F    A I +F+   +IKK ++ T GR  N       D   +    Q+  S     N QV+   +V+  GG  NI +VDAC+T+LR+ +KD + V       + GA G I+     V AV+G +ADI+K +I+ L+++ +  P +        N S  TS  +  K  K V +           V S   G ++ +  V D+ F+  MMG G AV+PT G IY+P+ G ++ VF T HA+   T+ G ++L+HVG+D++ L         PF+  V  G  V  G  +    LA +K A+     ++    + E +++
  S:   157 YTALGGTYEVMTGAAAGTKVFGQDPLWLAWVTDLVHLKGSDASAYSHLMDSVTPARFKVGQMIGATGTLMGVALAMYRNVDADKKHTYKMMFISAAAAVFLTGVTEPLEYLFMFAAMPLYI-VYALVQGASFAMADLVNLRVHSFGNIELLTRTPMALKAGL------GMDVINF---VWVSVLF----AVIMYFIADMMIKKMHLATAGRLGNYDADILGDRNTQTRPTQVADS-----NSQVV--QIVNLLGGAGNIDDVDACMTRLRVTVKDPAKVGAEDDWKKAGAIGLIQKG-NGVQAVYGPKADILKSDIQDLLDSGALIPEV--------NMSQLTSKPTPAKDFKHVTED----------VLSVADGMVLPITGVKDQVFAAKMMGDGFAVEPTHGNIYAPVAGLVTSVFPTKHAFGLLTDNGLEVLVHVGLDTVALNG------VPFSVKVSEGQRVHAGDLLVVADLAAIKSAERETIIVVAFTNTTEIQDV 612
Score = 208, Expect = 3.6e-14, Identities = 47/137 (34%), Positives = 75/137 (54%)
  Q:   164 GNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQ----AVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           G   +    + +V+    L + VF G + GF+ A  YNK+ N  KL  ++ FFNG RFVP V  L    V ++ +++WP++   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ ++   A
  S:    29 GTQMIVKDYFTSVLESPALNTGVFVGIIAGFVGATAYNKYYNYRKLPEVLTFFNGKRFVPFVVILRSIFVALILVVVWPVIQSGINSFGMWIASSQDSAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYEVMTGA 170
>gi|86148385|ref|ZP_01066677.1| Phosphotransferase system IIB component [Vibrio sp. MED222] >gi|85833799|gb|EAQ51965.1| Phosphotransferase system IIB component [Vibrio sp. MED222] (505 aa)
Score = 401, Expect = 1.5e-36, Identities = 169/634 (26%), Positives = 255/634 (40%)
  Q:    51 MLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVP-----GNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTL 684
           MLPIA LPIA + L +G                G+ L +P     G A+FG LP                          L+FG L  A+  S  D  GA      + Y    F L+A    + + +            S FGG   G +    YN F   +L   + FF G R VPI+  L       +  ++WP V   L  L  A+  +  I  F++G + RAL+P GLHH   S  W+         T   II     A+A                I  L  +  +      G +  + F N+     +  +KE++                  +  +G +           G +  G    NGF  V +   L G  + M L  PA           E R        S  F S LTGITEP+E+ F+FLAP L+  +HA    L+  + N  G     T H       G  FS G+ID+++   +     +  +   + GL +  +YFF F F I+ FN+++PGR ++            + +V               A   + A GG DN+ ++DACIT+LR+ +KD+S+ D A L +LGA+G +K    ++  + G  A+I+ G +K +
  S:     1 MLPIATLPIAALLLRLGQ---------------GDLLDIPFMAEAGGAIFGNLP--------------------------LLFG-LGIAIGLS-KDGNGAAGLAGAVAY----FVLTATATTINADV----------NMSFFGGIFAGIIAGHSYNAFHATRLPEWLAFFAGKRLVPIMAGLFALVAGAVSGVVWPGVQSGLDALAHAVSTSGAIGQFVYGTLNRALIPVGLHHVLNSYFWFGMG------TCQEIIVAGQGAFAN---------------ITQLCVDPSLAKTLVVGQEHTFTFANSVTPEITTVVKEVTE-----------------TVKSGDLHRFF------GGDKGAGVF-MNGFFPVMMFG-LPGAALAMYLAAPA-----------EKRSQVGGALFSVAFCSFLTGITEPLEFMFVFLAPALY-AMHAVFTGLSLVVANMFG-----TLH-------GFGFSAGLIDFVLNWGL----ATKPFVLLLIGLGFGALYFFTFSFAIRAFNLKSPGREDDDEAVAAPAGDAPKGEV---------------ARQYLKALGGHDNLTSIDACITRLRLTLKDRSIADEAVLKKLGAKGVVKLGENNLQVILGPLAEIVAGEMKAI 493
>gi|94989323|ref|YP_597424.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes MGAS9429] >gi|94993211|ref|YP_601310.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes MGAS2096] >gi|94542831|gb|ABF32880.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes MGAS9429] >gi|94546719|gb|ABF36766.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes MGAS2096] (728 aa)
Score = 401, Expect = 1.5e-36, Identities = 138/497 (27%), Positives = 235/497 (47%)
  Q:   371 YSAINGTYDNASIASSSNGAIQSVLTW----SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAK-LMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREI 867
           Y+A+ GTY+  + A++          W    ++L   + +  +  ++    V   ++  G+ +     L   A AM      + +     + +SA     LTG+TEP+EY F+F A  L+  V+A +   +F + + + L V + G+ EL     M+   G+      G   I +    W S +F    A I +F+   +IKK ++ T GR  N       D   +    Q+  S     N QV+   +++  GG  NI +VDAC+T+LR+ +KD + V       + GA G I+     V AV+G +ADI+K +I+ L+++ +  P +        N S  TS  +  K  K V +           V S   G ++ +  V D+ F+  MMG G AV+PT G IY+P+ G ++ VF T HA+   T+ G ++L+HVG+D++ L         PF+  V  G  V  G  +    LA ++ A+   T ++    + E +++
  S:   254 YTALGGTYEVMTGAAAGTKVFGQDPLWLAWVTDLVHLKGSDASAYSHLMDSVTPARFKVGQMIGATGTLMGVALAMYRNVDADKKHTYKMMFISAAAAVFLTGVTEPLEYLFMFAAMPLYI-VYALVQGASFAMADLVNLRVHSFGNIELLTRTPMALKAGL------GMDVINF---VWVSILF----AVIMYFIADMMIKKMHLATAGRLGNYDADILGDRNTQATPTQVADS-----NSQVV--QIINLLGGSGNIDDVDACMTRLRVTVKDPAKVGAEDDWKKAGAMGLIQKG-NGVQAVYGPKADILKSDIQDLLDSGALIPEV--------NMSQLTSKPTPAKDFKHVTEE----------VLSVADGMVLPITGVKDQVFAAKMMGDGFAVEPTHGNIYAPVAGLVTSVFPTKHAFGLLTDNGLEVLVHVGLDTVALNG------VPFSVKVSEGQRVHAGDLLVVADLAAIQSAERETTIVVAFTNTTEIQDV 709
Score = 279, Expect = 1.7e-22, Identities = 83/260 (31%), Positives = 131/260 (50%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYN---LLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALG----QAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G++I      +  L   GN +   G AV   L LLFA+AI  ++  +    A A  + +++   +           TGA  G +   L   +  I  L  G   +    + +V+    L + VF G + GF+ A  YNK+ N  KL  I+ FFNG RFVP V  L    V ++ +++WP++   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ ++   A
  S:    12 EFWQKFGKCLMVVIAVMPAAGLMISIGNSIPMINHDSAFLASLGNIIAQIGWAVIVNLHLLFALAIGGSWAKERAGGAFASGLAFVLINRI-----------TGAFYGVSSAMLADPEAKITSL-LGTQMIVKDYFTSVLESPALNTGVFVGIIAGFVGATAYNKYYNYRKLPEILTFFNGKRFVPFVVILRSIFVALILVVVWPVIQSGINSFGMWIASSQDSAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYEVMTGA 267
>gi|77973184|ref|ZP_00828735.1| COG1263: Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific [Yersinia frederiksenii ATCC 33641] (521 aa)
Score = 400, Expect = 1.6e-36, Identities = 94/269 (34%), Positives = 157/269 (58%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGEN----TRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLME 686
           V   +++ GK+ F + G+P AA A+   A  E RKL + + +SA  T++LTGITEPIE++FLF AP L + +H  L  L+F   +   +             +G +FSG +ID++++G +Q    S+   + + G+   PIY+F F +LI +F+ +TPGR ++    T+L+T++D + +      N  S    +D+V AL ++S  GG  NI ++D C T+LR+ + D++ VD A L   GA+G I+   + V  ++G    +IK N++  ME
  S:   263 VEATRFMAGKFPFYLFGIPGAALAIYHTARPEKRKLVLGLLLSATLTAVLTGITEPIEFSFLFAAP-LLYVLHCILAGLSFMFCHIFNV------------GVGQTFSGSLIDFVLFGVMQGNAKSHWINAILIGIPLFPIYYFSFRYLITRFDFKTPGREDDDTQETKLYTRKDLEARDRPATAN--SNIAGDDKVSAL-ILSGLGGIANISDLDCCATRLRVTVFDENRVDDAMLKSSGAKGVIRKG-KGVQVIYGPHVTLIKSNLEDCME 518
Score = 373, Expect = 2.4e-33, Identities = 91/243 (37%), Positives = 128/243 (52%)
  Q:    51 MLPIAMLPIAGIFLGVGSAIVTNA-----------GGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGS 293
           MLPIA+LP+AG+ LG+G++                G    L      ++  G+ VF  LP+LFAI +A+     +   AA++  IG+ +  +  +A+ +                    I GL     ALP    G  +GIN LQ  VFGG + G  VA L+N+F  I+L     FF G RF+PI++ +    V IL   IWP +  A+  LG  +  A    +FI+G IERAL+PFGLHH FY P W T  GG+
  S:     1 MLPIALLPVAGLLLGIGASFTNQTTIDSYGLQSVLGDGTILHALLTVMKSSGSVVFSNLPVLFAIGVAMGMAKKEKEVAAISGAIGFFVMHATINAMLE--------------------IRGLLVA-GALPDGSLGMTLGINSLQMGVFGGVIAGLGVAALHNRFYRIELPATFSFFGGTRFIPIISAITYVGVGILMFFIWPSIQNAILHLGALVNSAGYAGTFIYGVIERALIPFGLHHVFYMPFWQTGLGGT 234
>gi|51038623|ref|YP_063269.1| PTS system, maltose and glucose-specific IIABC component [Borrelia garinii PBi] >gi|51036296|gb|AAT93759.1| PTS system, maltose and glucose-specific IIABC component [Borrelia garinii PBi] (542 aa)
Score = 400, Expect = 1.8e-36, Identities = 99/259 (38%), Positives = 146/259 (56%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI----VTNAGGNEGLRVFGN-------FLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDAL--SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAI 301
           + K+ K  ML IA+LP AGI LG+G A     +  A G E +   G+        ++  G  +F  LPL+FA AI I     + G AALA  +G+L+     + +   Q +T  + ++     L       G+    A   S  Y +V+GI  LQ SV GG + GF+  FL+N+F NI+L   + FF G RFVPI+T + +F V I    IWP +  A+T  G  + Q+    +F++G I+R+L+PFGLHH FY P W T  GG++++    I
  S:    14 LQKVGKAFMLSIALLPAAGILLGIGGAFTNETMIQAYGLEEILGKGSVANSILYLMKYTGEVIFANLPLMFAAAIPIGLAKLEKGTAALAGVVGFLVMHQTINGILYIQGITPESASLKALLEL-------GMPETAATAKSQEYTSVLGIFSLQMSVMGGLIAGFVAVFLHNRFYNIQLPTFLAFFGGTRFVPIITTMTMFVVGIFLTFIWPFIQGAMTSFGNIVEQSGLFGTFVYGAIKRSLIPFGLHHIFYLPFWQTAVGGAMEINGELI 279
Score = 321, Expect = 2.7e-27, Identities = 95/264 (35%), Positives = 146/264 (55%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDT-AKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++  G++V MI GLP AA AM   +  EN+K   S+ +SA FTS+LTGITEP+E+ FLF AP L++ ++  L  LA+ L + + +             +G++FSGG ID  ++G +Q    +N     I G+ Y   ++F+F F+I KFN++T GR         ED + +++++ +  ++ S    +VL        GG DNI  +DAC ++LRI +K    + + A    LGA G +K    SV  VFG  +D IK  I  LM
  S:   305 RFFSGEFVVMIFGLPGAALAMYHTSKPENKKNVASLLISASFTSMLTGITEPLEFAFLFAAPALYYFIYVPLFGLAYLLTHLLNV------------GVGLTFSGGFIDMFLFGILQGNSKTNWIAIPILGIFYFIGFYFIFKFVIMKFNLKTIGR---------EDEEMEKDEISLEKTNLSETASKVL-----EGLGGKDNITYIDACASRLRINLKQIEFIKSDAYFKHLGASGMLKKG-NSVQIVFGGLSDNIKMEIDKLM 542
>gi|15675776|ref|NP_269950.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes M1 GAS] >gi|13623000|gb|AAK34671.1| putative PTS system, enzyme II, A component [Streptococcus pyogenes M1 GAS] (728 aa)
Score = 399, Expect = 2.6e-36, Identities = 139/497 (27%), Positives = 234/497 (47%)
  Q:   371 YSAINGTYDNASIASSSNGAIQSVLTW----SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAK-LMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREI 867
           Y+A+ GTY+  + A++          W    ++L   + +  +  ++    V   ++  G+ +     L   A AM      + +     + +SA     LTG+TEP+EY F+F A  L+  V+A +   +F + + + L V + G+ EL     M+   G+      G   I +    W S +F    A I +F+   +IKK ++ T GR  N       D   +    Q+  S     N QV+   +V+  GG  NI +VDAC+T+LR+ +KD + V       + GA G I+     V AV+G +ADI+K +I+ L+++ +  P +        N S  TS  +  K  K V +           V S   G ++ +  V D+ F+  MMG G AV+PT G IY+P+ G ++ VF T HA+   T+ G ++L+HVG+D++ L         PF+  V  G  V  G  +    LA +K A+     ++    + E +++
  S:   254 YTALGGTYEVMTGAAAGTKVFGQDPLWLAWVTDLVHLKGSDASAYSHLMDSVTPARFKVGQMIGATGTLMGVALAMYRNVDADKKHTYKMMFISAAAAVFLTGVTEPLEYLFMFAAMPLYI-VYALVQGASFAMADLVNLRVHSFGNIELLTRTPMALKAGL------GMDVINF---VWVSVLF----AVIMYFIADMMIKKMHLATAGRLGNYDADILGDRNTQTRPTQVADS-----NSQVV--QIVNLLGGAGNIDDVDACMTRLRVTVKDPAKVGAEDDWKKAGAIGLIQKG-NGVQAVYGPKADILKSDIQDLLDSGALIPEV--------NMSQLTSKPTPAKDFKHVTED----------VLSVADGMVLPITGVKDQVFAAKMMGDGFAVEPTHGNIYAPVAGLVTSVFPTKHAFGLLTDNGLEVLVHVGLDTVALNG------VPFSVKVSEGQRVHAGDLLVVADLAAIKSAERETIIVVAFTNTTEIQDV 709
Score = 279, Expect = 2.0e-22, Identities = 82/260 (31%), Positives = 131/260 (50%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYN---LLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALG----QAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G++I      +  L   GN +   G AV   L LLFA+AI  ++  +    A A  + +++   +           TGA  G +   L   +  I  L  G   +    + +V+    L + VF G + GF+ A  YNK+ N  KL  ++ FFNG RFVP V  L    V ++ +++WP++   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ ++   A
  S:    12 EFWQKFGKCLMVVIAVMPAAGLMISIGNSIPMINHDSAFLASLGNIIAQIGWAVIVNLHLLFALAIGGSWAKERAGGAFASGLAFVLINRI-----------TGAFYGVSSTMLADPEAKITSL-LGTQMIVKDYFTSVLESPALNTGVFVGIIAGFVGATAYNKYYNYRKLPEVLTFFNGKRFVPFVVILRSIFVALILVVVWPVIQSGINSFGMWIASSQDSAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYEVMTGA 267
>gi|148980751|ref|ZP_01816207.1| PTS system, N-acetylglucosamine-specific IIABC component [Vibrionales bacterium SWAT-3] >gi|145961101|gb|EDK26420.1| PTS system, N-acetylglucosamine-specific IIABC component [Vibrionales bacterium SWAT-3] (504 aa)
Score = 397, Expect = 3.5e-36, Identities = 171/634 (26%), Positives = 253/634 (39%)
  Q:    51 MLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVP-----GNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAAGDQTMWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTL 684
           MLPIA LPIA + L +G                G+ L +P     G A+FG LP                          L+FG L  A+  S  D  GA      + Y    F L+A    + + +            S FGG   G +    YN F   +L   + FF G R VPI+  L       +  ++WP V   L  L  A+  +  I  F++G + RAL+P GLHH   S  W+         T   II     A+A                I  L  +  +      G +  + F N+     +  +KE++                  +  +G +           G +  G    NGF  V +   L G  + M L  PA           E R        S  F S LTGITEP+E+ F+FLAP L+  +HA    L+  + N  G     T H       G  FS G+ID+++   +     +        GL +  +YFF F F I+ FN+++PGR ++           K +                LA   + A GG DN+ ++DACIT+LR+ +KD+SV D A L +LGA+G +K    ++  + G  A+I+ G +K +
  S:     1 MLPIATLPIAALLLRLGQ---------------GDLLDIPFMAQAGGAIFGNLP--------------------------LLFG-LGIAIGLS-KDGNGAAGLAGAVAY----FVLTATATTINADV----------NMSFFGGIFAGIIAGHSYNAFHATRLPEWLAFFAGKRLVPIMAGLFALVAGAVSGVVWPGVQSGLDALAHAVSTSGAIGQFVYGTLNRALIPVGLHHVLNSYFWFGMG------TCQEIIVAGQGAFAN---------------ITQLCVDPSLAKTLVVGQEHTFTFANSVTPEITTVVKEVTD-----------------TVKSGDLHRFF------GGDKGAGVF-MNGFFPVMMFG-LPGAALAMYLAAPA-----------EKRSQVGGALFSVAFCSFLTGITEPLEFMFVFLAPALY-AMHAVFTGLSLVVANMFG-----TLH-------GFGFSAGLIDFVLNWGL----ATKPLVLLAIGLGFGALYFFTFSFAIRAFNLKSPGREDDEEAAAPAGDAPKGD----------------LARQYLKALGGHDNLTSIDACITRLRLTLKDRSVADEAVLKKLGAKGVVKLGENNLQVILGPLAEIVAGEMKAI 492
>gi|19746889|ref|NP_608025.1| PTS system, glucose-specific IIABC component [Streptococcus pyogenes MGAS8232] >gi|19749133|gb|AAL98524.1| putative PTS system, enzyme II, A component [Streptococcus pyogenes MGAS8232] (728 aa)
Score = 396, Expect = 5.3e-36, Identities = 137/497 (27%), Positives = 234/497 (47%)
  Q:   371 YSAINGTYDNASIASSSNGAIQSVLTW----SNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAK-LMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKSEYEKIMNNSSDTSSASEVKPEKEVVKTDSELSKEKVVVNSPFTGEIVSLAKVPDETFSKNMMGVGIAVKPTTGKIYSPIDGKLSLVFDTGHAYSFETEKGTQILIHVGIDSINLKDKSGKELKPFAPNVKTGDTVKVGQEIGTVKLADLKHAKSTITPIIVLNESLEGREI 867
           Y+A+ GTY+  + A++          W    ++L   + +  +  ++    V   ++  G+ +     L   A AM      + +     + +SA     LTG+TEP+EY F+F A  L+  V+A +   +F + + + L V + G+ EL     M+   G+      G   I +    W S +F    A I +F+   +IKK ++ T GR  N       D   +    Q+  S     N QV+   +++  GG  NI +VDAC+T+LR+ +KD + V       +  A G I+     V AV+G +AD++K +I+ L+++ +  P +        N S  TS  +  K  K V +           V S   G ++ +  V D+ F+  MMG G AV+PT G IY+P+ G ++ VF T HA+   T+ G ++L+HVG+D++ L         PF+  V  G  V  G  +    LA +K A+   T ++    + E +++
  S:   254 YTALGGTYEVMTGAAAGTKVFGQDPLWLAWVTDLVHLKGSDASAYSHLMDSVTPARFKVGQMIGATGTLMGIALAMYRNVDADKKHTYKMMFISAAAAVFLTGVTEPLEYLFMFAAMPLYI-VYALVQGASFAMADLVNLRVHSFGNIELLTRTPMALKAGL------GMDVINF---VWVSILF----AVIMYFIADMMIKKMHLATAGRLGNYDADILGDRNTQARPTQVADS-----NSQVV--QIINLLGGAGNIDDVDACMTRLRVTVKDPAKVGAEDDWKKADAMGLIQKG-NGVQAVYGPKADVLKSDIQDLLDSGALIPEV--------NMSQLTSKPTPAKDFKHVTEE----------VLSVADGMVLPITGVKDQVFAAKMMGDGFAVEPTNGNIYAPVAGLVTSVFPTKHAFGLLTDNGLEVLVHVGLDTVALNG------VPFSVKVSEGQRVHAGDLLVVADLAAIKSAERETTIVVAFTNTAEIQDV 709
Score = 279, Expect = 1.8e-22, Identities = 78/260 (30%), Positives = 128/260 (49%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDAL----SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNI-KLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALG----QAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           EF  K  K LM+ IA++P AG+ + +G++I      +  L   GN +   G AV   L LLFA+AI  ++  +    A A  + +++   +  A     S  + D    +  +              G   +    + +V+    L + VF G + GF+ A  YNK+ N  KL  ++ FFNG RFVP V  L    V ++ +++WP++   +   G  +      A  +  F++G +ER L+PFGLHH    P+ YT  GG+ ++   A
  S:    12 EFWQKFGKCLMVVIAVMPAAGLMISIGNSIPMINHDSAFLASLGNIIAQIGWAVIVNLHLLFALAIGGSWAKERAGGAFASGLAFVLINRITGAFYGVSSAMLADPEAKITSF-------------LGTQMIVKDYFTSVLESPALNTGVFVGIIAGFVGATAYNKYYNYRKLPEVLTFFNGKRFVPFVVILRSIFVALILVVVWPVIQSGINSFGMWIASSQDSAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYEVMTGA 267
>gi|195948506|ref|ZP_03089692.1| PTS system, maltose and glucose-specific IIABC component [Borrelia garinii PBr] (521 aa)
Score = 395, Expect = 6.2e-36, Identities = 99/251 (39%), Positives = 142/251 (56%)
  Q:    51 MLPIAMLPIAGIFLGVGSAI----VTNAGGNEGLRVFGN-------FLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDAL--SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAI 301
           MLPIA+LP AGI LG+G A     +  A G E +   G+        ++  G  +F  LPL+FA AI I     + G AALA  +G+L+     + +   Q +T  + ++     L       G+    A   S  Y +V+GI  LQ SV GG + GF+  FL+N+F NI+L   + FF G RFVPIVT + +F V I    IWP +  A+T  G  + Q+    +F +G I+R+L+PFGLHH FY P W T  GG++++    I
  S:     1 MLPIALLPAAGILLGIGGAFTNETMIQAYGLEEILGKGSVANSILYLMKYTGEVIFANLPLMFAAAIPIGLAKVEKGTAALAGVVGFLVMHQTINGILYIQGITPESASLKALLEL-------GMPETAATAKSQEYTSVLGIFSLQMSVMGGLIAGFVAVFLHNRFYNIQLPTFLAFFGGTRFVPIVTTMTMFIVGIFLTFIWPFIQGAMTSFGSIVEQSGLFGTFAYGAIKRSLIPFGLHHIFYLPFWQTAVGGAMEINGELI 258
Score = 316, Expect = 1.1e-26, Identities = 93/264 (35%), Positives = 145/264 (54%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDT-AKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++  G++V MI GLP AA AM   +  EN+K   S+ +SA FTS+LTGITEP+E+ FLF AP L++ ++  L  LA+ L + + +             +G++FSGG ID  ++G +Q    +N     I G+ Y   ++F+F F I KFN++T GR         ED + +++++ +  ++ S    +VL        GG DNI  +DAC ++LR+ +K   ++ +      LGA G +K    SV  VFG  +D IK  I  LM
  S:   284 RFFSGEFVVMIFGLPGAALAMYHTSKPENKKNVASLLISASFTSMLTGITEPLEFAFLFAAPALYYFIYVPLFGLAYLLTHLLNV------------GVGLTFSGGFIDMFLFGILQGNSKTNWIAIPILGIFYFIGFYFIFKFAIMKFNLKTIGR---------EDEEMEKDEISLEKTNLSETASKVL-----EGLGGKDNITYIDACASRLRVNLKQIELIKSDGYFKHLGASGILKKG-NSVQIVFGGLSDNIKMEIDKLM 521
>gi|167576205|ref|ZP_02369079.1| PTS system, maltose and glucose-specific IIABC component [Borrelia valaisiana VS116] (521 aa)
Score = 395, Expect = 7.4e-36, Identities = 99/251 (39%), Positives = 142/251 (56%)
  Q:    51 MLPIAMLPIAGIFLGVGSAI----VTNAGGNEGLRVFGN-------FLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDAL--SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAI 301
           MLPIA+LP AGI LG+G A     +  A G E +   G+        ++  G  +F  LPL+FA AI I     + G AALA  +G+L+     + +   Q +T  + ++     L       G+    A   S  Y +V+GI  LQ SV GG + GF+  FL+N+F NI+L   + FF G RFVPIVT + +F V I    IWP +  A+T  G  + Q+    +F +G I+R+L+PFGLHH FY P W T  GG++++    I
  S:     1 MLPIALLPAAGILLGIGGAFTNETMIQAYGLEEILGKGSVANSILYLMKYTGEVIFANLPLMFAAAIPIGLAKVEKGTAALAGVVGFLVMHQTINGILYIQGITPESASLKALLEL-------GMPETAATAKSQEYTSVLGIFSLQMSVMGGLIAGFVAVFLHNRFYNIQLPTFLAFFGGTRFVPIVTTMTMFIVGIFLTFIWPFIQGAMTSFGSIVEQSGLFGTFAYGAIKRSLIPFGLHHIFYLPFWQTAVGGAMEINGELI 258
Score = 315, Expect = 1.3e-26, Identities = 95/264 (35%), Positives = 145/264 (54%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQ-LGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++  G++V MI GLP AA AM   +  EN+K   S+ +SA FTS+LTGITEP+E+ FLF AP L++ ++  L  LA+ L + + +             +G++FSGG ID  ++G +Q    +N     I G+ Y   ++F+F F I KFN++T GR         ED + +++ +    +S S  + +VL        GG DNI  +DAC ++LR+ +K   +V +    + LGA G +K    SV  VFG  +D IK  I  LM
  S:   284 RFFSGEFVVMIFGLPGAALAMYHTSKPENKKNVASLLISASFTSMLTGITEPLEFAFLFAAPALYYFIYVPLFGLAYLLTHLLNV------------GVGLTFSGGFIDMFLFGILQGNSKTNWIAIPILGIFYFIGFYFIFKFTIMKFNLKTIGR---------EDEEMEKDSIVSEKTSLSETSSKVL-----EGLGGKDNITYIDACASRLRVNLKQIELVKSDTYFKNLGASGILKKG-NSVQIVFGGLSDNIKMEIDKLM 521
>gi|146319055|ref|YP_001198767.1| phosphotransferase system IIC component, glucose/maltose/N-acetylglucosamine-specific [Streptococcus suis 05ZYH33] >gi|146321261|ref|YP_001200972.1| phosphotransferase system IIC component, glucose/maltose/N-acetylglucosamine-specific [Streptococcus suis 98HAH33] >gi|145689861|gb|ABP90367.1| Phosphotransferase system IIC component, glucose/maltose/N-acetylglucosamine-specific [Streptococcus suis 05ZYH33] >gi|145692067|gb|ABP92572.1| Phosphotransferase system IIC component, glucose/maltose/N-acetylglucosamine-specific [Streptococcus suis 98HAH33] (502 aa)
Score = 392, Expect = 1.4e-35, Identities = 98/264 (37%), Positives = 146/264 (55%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++  G++  MI GLPA+  AM  A PKENRK   S   S+  TSLLTGITEPIE++FLF+APWL+  VHA L  L+F + + + +             IG SFSGG+ID++I+G  Q    +N  +    GL +A +Y+ +F FL+ KF++  PG           D  +   KV  NGSS   N     A+ ++ A GG DNI+NV AC T+LR+ +++  +VD   +  +GA   +      + A+FG +A +    I  ++
  S:   261 RFFAGRFATMIFGLPASCLAMYHAIPKENRKKVGSFYSSSALTSLLTGITEPIEFSFLFVAPWLYV-VHAFLDGLSFLVADLLQI------------RIGNSFSGGLIDYLIFGVFQGNDKTNWIYVIPVGLLWAAVYYLVFKFLVTKFHVLVPG-------MESSDQASHSEKVLSNGSSLRDN-----AIAIIDALGGADNIENVTACATRLRVSLRNSGLVDKGVIQSIGATAVLDVK-GGIQAIFGGKAILYSQEINQIL 498
Score = 267, Expect = 4.5e-21, Identities = 88/286 (30%), Positives = 136/286 (47%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAG-------GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFT-GDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSW 323
           N K+F ++L +  MLPI++LP+AG+ LG+G A+  +             L+     +   G+AVF  L L+FAI +A+     D G A L+  + YL++              T  + G+  LF                    GA I      + V G   +G  VA L+NK++ I+L   +GFF G RF+PI++  A   +  +F +IWP +   L   G+A+ +     +F++GF  R    FGLHH  Y   WYT  GGS  +    I       +A LA +  T L ++
  S:     2 NFKKF-SQLGQAFMLPISILPVAGLLLGIGGALSNSNAVAQFPVLDQAWLQAVFTIMSTAGSAVFANLALIFAIGVAVGLADADKGTAGLSAGVAYLVY--------------TATISGFLTLFADK-----------------GASI-----DTGVLGALAIGITVATLHNKYRKIELPAFLGFFGGSRFIPIISSFAAIAIGSIFYIIWPPIQNLLVDFGKAIAEMGSFGTFLYGFGLRLTGAFGLHHTIYPMFWYTSLGGSEVVAGETIQGAQNIFFAQLADANHTGLFTY 258
>gi|81177457|ref|ZP_00876267.1| PTS system, glucose-like IIB component [Streptococcus suis 89/1591] >gi|80975868|gb|EAP39567.1| PTS system, glucose-like IIB component [Streptococcus suis 89/1591] (476 aa)
Score = 392, Expect = 1.5e-35, Identities = 98/264 (37%), Positives = 146/264 (55%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++  G++  MI GLPA+  AM  A PKENRK   S   S+  TSLLTGITEPIE++FLF+APWL+  VHA L  L+F + + + +             IG SFSGG+ID++I+G  Q    +N  +    GL +A +Y+ +F FL+ KF++  PG           D  +   KV  NGSS   N     A+ ++ A GG DNI+NV AC T+LR+ +++  +VD   +  +GA   +      + A+FG +A +    I  ++
  S:   235 RFFAGRFATMIFGLPASCLAMYHAIPKENRKKVGSFYSSSALTSLLTGITEPIEFSFLFVAPWLYV-VHAFLDGLSFLVADLLQI------------RIGNSFSGGLIDYLIFGVFQGNDKTNWIYVIPVGLLWAAVYYLVFKFLVTKFHVLVPG-------MESSDQASHSEKVLSNGSSLRDN-----AIAIIDALGGADNIENVTACATRLRVSLRNSGLVDKGVIQSIGATAVLDVK-GGIQAIFGGKAILYSQEINQIL 472
Score = 254, Expect = 1.5e-19, Identities = 72/244 (29%), Positives = 109/244 (44%)
  Q:    80 LRVFGNFLQVPGNAVFGALPLLFAIAIAIAFT-GDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSW 323
           L+     +   G+AVF  L L+FAI +A+     D G A L+  + YL++              T  + G+  LF                    GA I      + V G   +G  VA L+NK++ I+L   +GFF G RF+PI++  A   +  +F +IWP +   L   G+A+ +     +F++GF  R    FGLHH  Y   WYT  GGS  +    I       +A LA +  T L ++
  S:    24 LQAVFTIMSTAGSAVFANLALIFAIGVAVGLADADKGTAGLSAGVAYLVY--------------TATISGFLTLFADK-----------------GASI-----DTGVLGALAIGITVATLHNKYRKIELPAFLGFFGGSRFIPIISSFAAIAIGSIFYIIWPPIQNLLVDFGKAIAEMGSFGTFLYGFGLRLTGAFGLHHTIYPMFWYTSLGGSEVVAGETIQGAQNIFFAQLADANHTGLFTY 232
>gi|91781694|ref|YP_556900.1| PTS system, N-acetylglucosamine-specific IIBC component [Burkholderia xenovorans LB400] >gi|91685648|gb|ABE28848.1| PTS system, N-acetylglucosamine-specific IIBC component [Burkholderia xenovorans LB400] (595 aa)
Score = 390, Expect = 2.3e-35, Identities = 93/265 (35%), Positives = 141/265 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWII-YGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           G ++ G +  M+ GLPAA  AM   APKE R +   +  S   TS LTG+TEPIE++F+FLAP L+  +HA L  L+  + + +G+            H+G +FS G ID+++ YG       +  WW+   GL Y  +Y+ LF F I+KFN+ TPGR         + +        + G++         A   ++A GG  N+  VDAC T+LR+ + D + V   +L  +GARG +K    +V  + G EADII   I+T++
  S:   229 GTFMTGFFPVMMFGLPAACLAMFHEAPKERRAVVGGLLFSMALTSFLTGVTEPIEFSFMFLAPVLYV-IHALLTGLSLAICSALGI------------HLGFTFSAGAIDYVLNYG-----LSTRGWWAIPIGLVYMVVYYGLFRFFIRKFNMATPGREPAAADEQVDSFSAGGFVSPVAGAAVP------RAQRYIAALGGAANLSVVDACTTRLRLSVVDSNKVSENELKTIGARGVLKRGSTNVQVIIGPEADIIADEIRTVI 470
Score = 281, Expect = 1.2e-22, Identities = 81/251 (32%), Positives = 113/251 (45%)
  Q:    37 GNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           GN    I +L + LMLPIA+LP+AG+ L +G   V N             +   G A+F  LPLLFAI +A+ F  D  G A LA  IGYL+    + A+ + + D                                       +L   V  G V G +   LYN++K+IKL   + FF G RFVPIVT +    + I+F  +W  V   +   G  L  A  + +F+FG + R L+  GLHH   S  W+
  S:     3 GNPFLKIQRLGRALMLPIAVLPVAGLLLRLGQPDVFNI----------KMIADAGGAIFDNLPLLFAIGVAVGFAKDNNGVAGLAGAIGYLV----EVAVMKDIND---------------------------------------KLNMGVLSGIVAGIVAGLLYNRYKDIKLPDYLAFFGGKRFVPIVTGVVCLALGIVFGYVWQPVQAVIDTAGHWLTTAGALGAFVFGVLNRLLLVTGLHHILNSLTWF 201
>gi|170691518|ref|ZP_02882683.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Burkholderia graminis C4D1M] >gi|170143723|gb|EDT11886.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Burkholderia graminis C4D1M] (591 aa)
Score = 390, Expect = 2.4e-35, Identities = 95/265 (35%), Positives = 143/265 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWII-YGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGR-----GENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           G ++ G +  M+ GLPAA  AM   APKE R +   +  S   TS LTG+TEPIE++F+FLAP L+  +HA L  LA  + + +G+            H+G +FS G ID+++ YG       +  W +   G+AY+ +Y+ LF F I+KFN+ TPGR      E    FT   + +      +             A   ++A GG  N+  VDAC T+LR+ + D + V  ++L  +GARG +K    +V  + G EADII   I+T++
  S:   229 GTFMTGFFPVMMFGLPAACLAMFHEAPKERRAVVGGLLFSMALTSFLTGVTEPIEFSFMFLAPVLYV-IHALLTGLALAICSALGI------------HLGFTFSAGAIDYVLNYG-----LSTKGWLAIPVGIAYSVVYYGLFRFFIRKFNMATPGREPAAADEQVESFTAGGFVSPAAGAAVP-----------RAQRYIAALGGAANLSVVDACTTRLRLSVADSNKVSESELKTIGARGVLKRGATNVQVIIGPEADIIADEIRTVI 470
Score = 278, Expect = 2.3e-22, Identities = 82/251 (32%), Positives = 113/251 (45%)
  Q:    37 GNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           GN    I +L + LMLPIA+LP+AG+ L +G   V N             +   G A+F  LPLLFAI +A+ F  D  G A LA  IGYLI    + A+ + + D                                       +L   V  G V G +   LYN++K+IKL   + FF G RFVPIVT +    + I+F  +W  V   +   G  L  A  + +F+FG + R L+  GLHH   S  W+
  S:     3 GNPFLKIQRLGRALMLPIAVLPVAGLLLRLGQPDVFNI----------KMIADAGGAIFDNLPLLFAIGVAVGFAKDNNGVAGLAGAIGYLI----EVAVMKDIND---------------------------------------KLNMGVLSGIVAGVVAGLLYNRYKDIKLPDYLAFFGGKRFVPIVTGVVCLALGIVFGYVWQPVQGVIDTAGHWLTTAGALGAFVFGVLNRLLLVTGLHHILNSLTWF 201
>gi|50120738|ref|YP_049905.1| glucose-specific PTS system IIBC components [Pectobacterium atrosepticum SCRI1043] >gi|49611264|emb|CAG74710.1| PTS system, glucose-specific IIBC component [Erwinia carotovora subsp. atroseptica SCRI1043] (477 aa)
Score = 389, Expect = 3.0e-35, Identities = 103/264 (39%), Positives = 149/264 (56%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQV-LALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           L G ++F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE++F+F+AP L+  +HA L  LAF +   +G+              G SFS G+ID+++        GSN W   I GL YA IY+ +F  LI K N++TPGR ++                    SSE ++ D   +A  +VSA+GG +NI N+DACIT+LR+ + D + VD A L +LGA G +  +   V A+FG ++D +K ++   + N
  S:   250 LSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFSFMFVAPILYV-IHAILAGLAFPICILLGM------------RDGTSFSHGLIDFVVLSG----NGSNLWLFPIVGLCYALIYYTIFRVLITKLNLKTPGREDS--------------------SSEQVSQDSTEMAAALVSAFGGKENITNLDACITRLRVSVGDVAKVDQAGLKKLGAAGVVV-AGSGVQAIFGTKSDNLKTDMDDYIRN 476
Score = 302, Expect = 4.4e-25, Identities = 84/252 (33%), Positives = 126/252 (50%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+++LPIAGI LGVGSA  +         +  + +   G++VF  +PL+FAI +A+ FT + G +ALA  + Y I      A++  V +   A I    L   G                             V GG + G + A+++N+F  I+L   +GFF G RFVPI++ L    +  +   IWP VG A+  F   A  +   +   I+G +ER+LVPFGLHH +  P       +T A G +
  S:     9 LQKVGKSLMLPVSVLPIAGILLGVGSANFSWLP-----EIVSSVMAQAGDSVFANMPLIFAIGVALGFTNNDGVSALAAVVAYGIMVKTMAAIAPIVLNLPAAEITAKHLADTG-----------------------------VLGGIIAGSIAAYMFNRFYRIQLPEYLGFFAGKRFVPIISGLTAIIIGTVLSFIWPPVGSAIQVFSHWAANENPTLAFGIYGVVERSLVPFGLHHIWNVPFQMQVGEFTNAAGQV 232
>gi|187922571|ref|YP_001894213.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Burkholderia phytofirmans PsJN] >gi|187713765|gb|ACD14989.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Burkholderia phytofirmans PsJN] (591 aa)
Score = 389, Expect = 3.2e-35, Identities = 92/265 (34%), Positives = 141/265 (53%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWII-YGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           G ++ G +  M+ GLPAA  AM   APKE R +   +  S   TS LTG+TEPIE++F+FLAP L+  +HA L  ++  + + +G+            H+G +FS G ID+++ YG       +  WW+   GL Y  +Y+ LF F I+KFN+ TPGR         + +        + G++         A   ++A GG  N+  VDAC T+LR+ + D + V   +L  +GARG +K    +V  + G EADII   I+T++
  S:   229 GTFMTGFFPVMMFGLPAACLAMFHEAPKERRAVVGGLLFSMALTSFLTGVTEPIEFSFMFLAPVLYV-IHALLTGISLAICSALGI------------HLGFTFSAGAIDYVLNYG-----LSTRGWWAIPIGLVYMVVYYGLFRFFIRKFNMATPGREPAAADEQVDSFAAGGFVSPVAGTAVP------RAQRYIAALGGASNLSVVDACTTRLRLSVVDSNKVSENELKTIGARGVLKRGSTNVQVIIGPEADIIADEIRTVI 470
Score = 278, Expect = 2.4e-22, Identities = 82/251 (32%), Positives = 112/251 (44%)
  Q:    37 GNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           GN    I +L + LMLPIA+LP+AG+ L +G   V N             +   G A+F  LPLLFAI +A+ F  D  G A LA  IGYLI    + A+ + + D                                       +L   V  G V G +   LYN++K+IKL   + FF G RFVPIVT +    + I F  +W  V   +   G  L  A  + +F+FG + R L+  GLHH   S  W+
  S:     3 GNPFLKIQRLGRALMLPIAVLPVAGLLLRLGQPDVFNI----------KMIADAGGAIFDNLPLLFAIGVAVGFAKDNNGVAGLAGAIGYLI----EVAVMKDIND---------------------------------------KLNMGVLSGIVAGIVAGLLYNRYKDIKLPDYLAFFGGKRFVPIVTGVVCLVLGIAFGYVWQPVQAVIDTAGHWLTTAGALGAFVFGVLNRLLLVTGLHHILNSLTWF 201
>gi|166985608|ref|ZP_02256886.1| PTS system, glucose-specific IIABC component [Bacillus cereus AH187] (429 aa)
Score = 389, Expect = 3.4e-35, Identities = 99/252 (39%), Positives = 133/252 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAI-------VTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQ--SVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+A+LP AGI LG G+A        V  A   +   +    ++  G+ +F  L LLFA+ +AI   G  G A LA F+GYLI         +   +   T +              G            Y  V+GI  LQ+ VFGG +VG + A+ YNK+ NI+L   +GFF G RFVPI T      V I+   +WP +   L TF  Q +     + +FIFG IER+L+PFGLHH FYSP W     YT A G +
  S:     9 LQKVGKALMLPVAILPAAGILLGFGNAFQNPQLTNVIPALKADWFVMVAKIMEQSGDIIFANLALLFAVGVAIGLAGGDGVAGLAAFVGYLIMNKTMSVFLEVDKLVKVTSS--------------GADPVKIGFTDPAYANVLGIPTLQTGVFGGIIVGIVAAYCYNKYFNIELPSYLGFFAGKRFVPIATATFSLIVGIIMCFVWPYIQGGLNTFSHQMIDANRTLAAFIFGLIERSLIPFGLHHIFYSPFWFEFGQYTNAAGEL 261
Score = 330, Expect = 2.1e-28, Identities = 76/160 (47%), Positives = 101/160 (63%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNA-WWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGR 577
           +  G +  GKY FM+ GLPAAA AM   A  EN+KLA  I  SA  TS LTGITEP+E++FLF+AP LF G+HA    L+F  M  +G+             IGM+FSGG+ID++++G +    G  A WW  I GL  A IY+F F F I+K++++TPGR
  S:   279 LTAGTFTTGKYPFMMFGLPAAALAMYHEARPENKKLAAGILGSAALTSFLTGITEPLEFSFLFVAPVLF-GIHAVFAGLSFMTMQILGV------------KIGMTFSGGLIDFLLFGVLP---GRTAWWWVIIVGLVLAVIYYFGFRFAIRKWDLKTPGR 423
>gi|110644159|ref|YP_671889.1| PTS system, glucose-specific IIBC component [Escherichia coli 536] >gi|191173906|ref|ZP_03035425.1| PTS system, glucose-specific IIBC component [Escherichia coli F11] >gi|110345751|gb|ABG71988.1| PTS system, glucose-specific IIBC component [Escherichia coli 536] >gi|190905773|gb|EDV65393.1| PTS system, glucose-specific IIBC component [Escherichia coli F11] (502 aa)
Score = 388, Expect = 4.6e-35, Identities = 94/268 (35%), Positives = 144/268 (53%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIF--GLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           +  G ++ G++  M+  LPAAA AM   A  E + L   + +S   T+ +TGITEP+EY FLF AP L+  +H  L A +F LMN + +            HIG  F+GG+ID+++ G +     +   W  +F  G  YA IY+ +F  LI+K N++TPGR E+  +        ++   QI                 + A GGFDNI++VDAC T+LR+ + D   V+  +L +LGA G +K     V  +FG ++ I++  IKT+M
  S:   254 LTAGLFMTGRFPIMMFALPAAALAMYQEAKPERKALIKGLLLSGALTTFVTGITEPLEYAFLFAAPVLYI-IHIFLYATSFVLMNILNV------------HIGHPFAGGLIDFVLNGVMP----NRTLWYLVFLAGAGYAAIYYTVFRVLIRKLNLKTPGR-EDEEIAVATTLTREERPYQI-----------------IEAVGGFDNIEDVDACATRLRLALVDDKKVNEKRLKELGAAGLVKLGDGGVQVIFGGKSQILRDEIKTVM 488
Score = 326, Expect = 5.9e-28, Identities = 84/245 (34%), Positives = 118/245 (48%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQAL--GQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + K S  LMLPIA+LP AG+ L +G +       N G  +F N            LPLLF + I I  TGD G ++L+  I Y+I  +                         G   G++A + A  +  Y  ++G+  LQ+ VFGG +V   V  LY +F NI+L   +GFF G RFVPI+T +A   V  L   +W  V   L  L   +  G      +FI+   ER+L+PFGLHH +  P +Y
  S:    14 LQKFSSALMLPIAILPAAGLILAIGISFNIELLANCGGLIFAN------------LPLLFCVGIVIGLTGD-GSSSLSAIISYMIMNATM-----------------------GTQLGITAESVAASNGDYAMILGVPTLQTGVFGGLIVAIFVYLLYTRFHNIELPQFLGFFGGKRFVPIITAVAAIIVGYLLPWLWIPVQKGLASLSTLVTSGHNANFAAFIYAVGERSLIPFGLHHIWNVPFYY 224
>gi|26250577|ref|NP_756617.1| PTS system, glucose-specific IIBC component [Escherichia coli CFT073] >gi|91213361|ref|YP_543347.1| PTS system, glucose-specific IIBC component [Escherichia coli UTI89] >gi|117626093|ref|YP_859416.1| PTS system, glucose-specific IIBC component [Escherichia coli APEC O1] >gi|26111007|gb|AAN83191.1|AE016769_306 PTS system, glucose-specific IIBC component [Escherichia coli CFT073] >gi|91074935|gb|ABE09816.1| PTS system, glucose-specific IIBC component [Escherichia coli UTI89] >gi|115515217|gb|ABJ03292.1| PTS system, glucose-specific IIBC component [Escherichia coli APEC O1] (502 aa)
Score = 388, Expect = 4.8e-35, Identities = 94/268 (35%), Positives = 144/268 (53%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW-SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           +  G ++ G++  M+  LPAAA AM   A  E + L   + +S   T+ +TGITEP+EY FLF AP L+  +H  L A +F LMN + +            HIG  F+GG+ID+++ G +        W+  F+ G  YA IY+ +F  LI+K N++TPGR E+  +        ++   QI                 + A GGFDNI++VDAC T+LR+ + D   V+  +L +LGA G +K     V  +FG ++ I++  IKT+M
  S:   254 LTAGLFMTGRFPIMMFALPAAALAMYQEAKPERKALIKGLLLSGALTTFVTGITEPLEYAFLFAAPVLYI-IHIFLYATSFVLMNILNV------------HIGHPFAGGLIDFVLNGVMP---NRTPWYLVFLAGAGYAAIYYTVFRVLIRKLNLKTPGR-EDEEIAVATTLTREERPYQI-----------------IEAVGGFDNIEDVDACATRLRLALVDDKKVNEKRLKELGAAGLVKLGDGGVQVIFGGKSQILRDEIKTVM 488
Score = 326, Expect = 6.0e-28, Identities = 84/245 (34%), Positives = 118/245 (48%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQAL--GQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + K S  LMLPIA+LP AG+ L +G +       N G  +F N            LPLLF + I I  TGD G ++L+  I Y+I  +                         G   G++A + A  +  Y  ++G+  LQ+ VFGG +V   V  LY +F NI+L   +GFF G RFVPI+T +A   V  L   +W  V   L  L   +  G      +FI+   ER+L+PFGLHH +  P +Y
  S:    14 LQKFSSALMLPIAILPAAGLILAIGISFNIELLANCGGLIFAN------------LPLLFCVGIVIGLTGD-GSSSLSAIISYMIMNATM-----------------------GTQLGITAESVAASNGDYAMILGVPTLQTGVFGGLIVAIFVYLLYTRFHNIELPQFLGFFGGKRFVPIITAVAAIIVGYLLPWLWIPVQKGLASLSTLVTSGHNANFAAFIYAVGERSLIPFGLHHIWNVPFYY 224
>gi|187251329|ref|YP_001875811.1| PTS system, glucose-like IIB subunint [Elusimicrobium minutum Pei191] >gi|186971489|gb|ACC98474.1| PTS system, glucose-like IIB subunint [Elusimicrobium minutum Pei191] (551 aa)
Score = 386, Expect = 6.7e-35, Identities = 102/261 (39%), Positives = 147/261 (56%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGR---GENTRLFTKEDYKNKQNKVQINGSSESL-------NNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIK 678
           +   ++L GKY FMI GLP AA AM   A    +KL   +  SA  TS LTGITEPIE+TFLF+AP +F  +H     +AF L + + + V            G +FS G ID  +YG +Q    +N  W     + Y   Y+F F F+I K+N+ TPGR    ++T+L+TK DY+ KQ     +G SE+        + D+ L   ++   GG DNI+N+D+C T+LR+ +KD S+V+   L + GA G +      +  VFG +   IK
  S:   289 IESARFLTGKYPFMIAGLPGAALAMYHTAKTHKKKLVGGLLFSAALTSFLTGITEPIEFTFLFVAPVVFI-IHCGFAGIAFVLTHLLQIAV------------GTTFSCGFIDLTLYGILQGHAKTNWMWLIPIFIVYFIGYYFFFRFVITKWNLMTPGREPDEQDTKLYTKADYQAKQQ----DGKSETTPSAALPASKDEQLE-TILQGLGGKDNIENLDSCATRLRLNVKDPSLVNKDLLKKGGALGVLLKG-NGLQVVFGPKVSSIK 540
Score = 362, Expect = 4.5e-32, Identities = 92/261 (35%), Positives = 136/261 (52%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAG----GNEGLRVFGNFLQVP-------GNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIY 303
           + K+ +   LPI++LP+AG+ LG+G++    A     G E +   G FL          G AVF  LPL+FA+++A+    +    A                LS +++     V    +L + G I    A    + +   G V+GI  L+  VFGG VVG  VA L+N+F  I+L   + FF G+RFVPI+       V   F  +WP +   +   GQ + ++    SFI+GF+ERAL+PFGLHH FY P W T  GG+  L    ++Y
  S:    14 LQKVGRSFFLPISILPVAGLLLGIGASFSNMATVADYGLESIMGAGTFLNYTFIIMSAVGGAVFANLPLIFAMSVALGMANEEKAVA---------------TLSAAISFIIMHVTISKMLLFTGYILPDGALAEKVVAGTIGTVLGIQSLEMGVFGGIVVGLGVAALHNRFYKIELPVFLSFFGGIRFVPIICTFVFLLVGAGFFFVWPPIQKLILASGQLVIKSGYFGSFIYGFMERALIPFGLHHVFYMPFWQTGLGGA-QLIDGVMVY 269
>gi|90413792|ref|ZP_01221779.1| putative PTS system, glucose-specific IIBC component [Photobacterium profundum 3TCK] >gi|90325103|gb|EAS41606.1| putative PTS system, glucose-specific IIBC component [Photobacterium profundum 3TCK] (462 aa)
Score = 385, Expect = 9.8e-35, Identities = 101/261 (38%), Positives = 145/261 (55%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDW-IIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTL 684
           L G Y+F + GLPAA  AM + A KEN+ +  SI  SA  TS LTGITEPIE+ FLF+AP L+   HA L   AF +M  +G+              G +FS G+ D+ +++G       +N W   + G+ YA IYF +F  LIK  +++TPGR +   +            V +N S + L  D      + +A+GG +NIK+++ACIT+LR+ + D S VD  +L  LGA G  +    +  AVFG  ++IIKG I+ L
  S:   236 LAGGYMFKMFGLPAACLAMYVTAKKENKVMVASILGSAALTSFLTGITEPIEFAFLFVAPVLYVA-HALLAGSAFVVMILLGI------------KHGTTFSHGLFDFTLLFGQ-----STNGWLLPVIGVVYAIIYFLVFVTLIKALDLKTPGREDKEEM-----------SVAVNTSKDGLAQD------IAAAFGGKENIKDLEACITRLRVTVFDSSKVDIPRLKALGAAGVFEKG-DNYQAVFGTHSEIIKGQIEVL 461
Score = 268, Expect = 3.2e-21, Identities = 85/252 (33%), Positives = 123/252 (48%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVF-----GNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQ-ALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY-----TQAGGSI 294
           + K+ + LMLP+A +P AGI LG+G        GN  +  F        +   G  VF  + LLFAI +A+ FT + G AALA  +GYL    +   +++  TDT                                           VFGG ++G + A L+NK+ +IKL   +GFF G RFVPIVT LA   V     +IW  +G  +    + A  Q+  +   I+G +ER+L+PFGLHH + +P +Y     T A G +
  S:     7 MQKMGRSLMLPVACMPAAGILLGIG--------GNSEVAKFLPDIVAQIMTEAGLGVFANMALLFAIGVALGFTKNDGVAALAAALGYLTMTRVLGVVAEG-TDT------------------------------------------GVFGGVIMGLVAAQLFNKYHDIKLPTYLGFFGGKRFVPIVTSLAACVVAGALALIWQPIGAGIAAFSEWAAYQSPEVAFGIYGIVERSLIPFGLHHIWNAPFFYEVGEFTTAAGEV 218
>gi|90408200|ref|ZP_01216368.1| Putative PTS system, glucose-specific IIBC [Psychromonas sp. CNPT3] >gi|90310730|gb|EAS38847.1| Putative PTS system, glucose-specific IIBC [Psychromonas sp. CNPT3] (468 aa)
Score = 384, Expect = 1.2e-34, Identities = 101/275 (36%), Positives = 156/275 (56%)
  Q:   411 GANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
             NGF     GQ L G ++F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE++FLF+AP+L+  +HA L   A+ + N++G+I             G SFS G+ID+++       + S  W   + GL YA +Y+ +F  +I KF+++TPGR         ED + ++  V  N         + +A  ++ A+GG  NI+N+DACIT+LR+ + +  ++D A L +LGA G +  S   V A+FG ++D +K +++  M
  S:   234 AGNGF-----GQ-LAGGFMFKMFGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFSFLFVAPFLY-AIHALLAGSAYVVTNYLGMIH------------GTSFSHGLIDFLVLST----HASKLWLFVVIGLGYAAVYYIVFRVVIAKFDLKTPGR---------EDEELEEVAVVTN---------EEMATLLIEAFGGKANIENLDACITRLRVSLHNIELLDKAALKKLGAAGVVV-SGNGVQAIFGTKSDNLKTDMEAFM 466
Score = 251, Expect = 3.7e-19, Identities = 78/253 (30%), Positives = 125/253 (49%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSF-IFGFIERALVPFGLHHAFYSPLWYTQAGGSID 295
           + K+ K LMLP+++LPIAGI LGVG+A  +         V    ++  G A+FG + L+FAI +A+ FT + G A LA  +GY+I           +T T G                L+ G                   + V GG + G + A ++N+F N+ L   +GFF G R VPI+T      +  +  ++WP +G  ++   +       + +F I+G +ERAL+PFGLHH +  P ++ +AG  ++
  S:     7 LQKVGKSLMLPVSVLPIAGILLGVGAAKFSVLPD-----VVSQLMEQAGGAIFGNMALIFAIGVALGFTKNDGVAGLASVVGYVI-----------MTKTIGV---------------LAPG-----------------ADTGVLGGIIAGGIAAAMFNRFYNLSLPDYLGFFAGKRAVPIMTGFVAILMGAVLAVVWPPIGNVISTFSEWSATQNPVLAFGIYGIVERALIPFGLHHIWNVPFFF-EAGTCVN 211
>gi|163789517|ref|ZP_02183956.1| PTS system, glucose-specific enzyme II, ABC component [Carnobacterium sp. AT7] >gi|159875371|gb|EDP69436.1| PTS system, glucose-specific enzyme II, ABC component [Carnobacterium sp. AT7] (451 aa)
Score = 384, Expect = 1.3e-34, Identities = 94/265 (35%), Positives = 148/265 (55%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
            +++ G+++ M+ GL  AA A+   A  EN+K+   + +SA  TS LTGITEP+E++FLF+AP L+  VHA    LAF L +   +             IG +FSGG ID+I++G +Q    +N     + G+ +  +Y+F F FLI KFN QTPGR +   +          NK ++ G           AL+VV+  GG DN+ +VD C T+LR+ +KD+++V+   L + G++G IK     +  V+G +  +IK  I+ L+
  S:   216 ARFMSGRFITMMFGLVGAAFAIYKTAKPENKKVVGGLMLSAALTSFLTGITEPLEFSFLFIAPALYV-VHAVFDGLAFMLAHIFEIT------------IGQTFSGGFIDFILFGVLQGNERTNWIMVLVIGVVWFFLYYFTFMFLITKFNFQTPGRTDKIEV--------AGNKAKVEGR----------ALDVVNGLGGADNLVDVDNCATRLRVTVKDETLVNEELLKETGSQGLIKRG-NGIQVVYGPQVSVIKNEIEELL 448
Score = 316, Expect = 9.3e-27, Identities = 72/206 (34%), Positives = 110/206 (53%)
  Q:    91 GNAVFGALPLLFAIAIAIAFT-GDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDL 296
           GN VF  LP++FA+ +AI     D G AALA  IGYL+  S           +  A++  N      N+  +  G          + +GI  L++ VFGG +VG L ++L+N+F  I+L   +GFF G RFVPI+T  +   +  +   +WP+    +T +G  +     + +F++GFI R L P GLHH FY P W T  GG++++
  S:     2 GNIVFSNLPVIFAVGVAIGLARSDKGTAALAALIGYLVMHS-----------SINAILTINGKLAVDNLAAVGQG----------STLGIQTLETGVFGGIIVGILASYLHNRFNKIELPTYLGFFGGSRFVPIITSFSAIILGAIMYFVWPVFQGLITNVGDVVNATGYLGTFLYGFILRMLGPVGLHHIFYLPFWQTAVGGTLEV 187
>gi|54308949|ref|YP_129969.1| putative PTS system glucose-specific II BC component [Photobacterium profundum SS9] >gi|46913379|emb|CAG20167.1| putative PTS system, glucose-specific IIBCcomponent [Photobacterium profundum SS9] (462 aa)
Score = 383, Expect = 1.7e-34, Identities = 102/261 (39%), Positives = 143/261 (54%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDW-IIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTL 684
           L G Y+F + GLPAA  AM + A KEN+ +  SI  SA  TS LTGITEPIE+ FLF+AP L+   HA L   AF +M  +G+              G +FS G+ D+ +++G       +N W   + GL YA IYF +F  LIK  +++TPGR +   +            V +N S + L  D      +  A+GG +NIK+++ACIT+LR+ + D S VD  +L  LGA G       +  AVFG  ++IIKG I+ L
  S:   236 LAGGYMFKMFGLPAACLAMYVTAKKENKLMVASILGSAALTSFLTGITEPIEFAFLFVAPVLYVA-HALLAGSAFVVMILLGI------------KHGTTFSHGLFDFTLLFGQ-----STNGWLLPVIGLVYAVIYFLVFVTLIKALDLKTPGREDKEEM-----------SVAVNTSKDGLAQD------IAMAFGGKENIKDLEACITRLRVTVFDSSKVDIPRLKALGAAGVFAKG-DNYQAVFGTHSEIIKGQIEVL 461
Score = 277, Expect = 3.3e-22, Identities = 85/252 (33%), Positives = 123/252 (48%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVF-----GNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQ-ALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY-----TQAGGSI 294
           + K+ + LMLP+A +P AGI LG+G        GN  +  F        +   G  VF  + LLFAI +A+ FT + G AALA  +GYL    +   +++  TDT                                           VFGG ++G + A L+NK+ +IKL   +GFF G RFVPIVT LA   V     +IW  +G  +    + A  Q+  +   I+G +ER+L+PFGLHH + +P +Y     T A G +
  S:     7 MQKMGRSLMLPVACMPAAGILLGIG--------GNSEVAKFLPDIVAQIMTEAGLGVFANMALLFAIGVALGFTKNDGVAALAATLGYLTMTRVLGVVAEG-TDT------------------------------------------GVFGGVIMGLVAAQLFNKYHDIKLPTYLGFFGGKRFVPIVTSLAACVVAAALALIWQPIGAGIAAFSEWAAYQSPEVAFGIYGIVERSLIPFGLHHIWNAPFFYEVGEFTTAAGEV 218
>gi|15894632|ref|NP_347981.1| phosphotransferase system IIC component [Clostridium acetobutylicum ATCC 824] >gi|15024287|gb|AAK79321.1|AE007647_1 Phosphotransferase system IIC component, possibly N-acetylglucosamine-specific [Clostridium acetobutylicum ATCC 824] (488 aa)
Score = 383, Expect = 1.9e-34, Identities = 96/266 (36%), Positives = 148/266 (55%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGR--------GENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLME 686
           G Y+ G +  M+  LPAA  AM+ AA KENRK    + +   FT+ LTG+TEPIE+ F+FLAP L+  VHA L  L+  + + +G+              G +FS G +D+I    +     +      + G+ YA IY+FLF F IKKFN+ TPGR          +      +  +  +N  +I  S    +  +  A+ ++ A G  +NI+++DAC+T++R+ +KD S VD  KL +LGA G +K   ++   V G  ADII  +IK +++
  S:   231 GTYMTGFFPIMMFALPAACLAMISAAKKENRKKVSGMLLGIAFTAFLTGVTEPIEFLFMFLAPVLYV-VHAVLTGLSMAITSALGI------------KSGFTFSAGFVDYI----MNFNISTKPILLIVIGILYAIIYYFLFLFTIKKFNLPTPGRMDDLDDLDDLDDLDDLDDLDEEPENTPKIKSSPSKNSTLEEKAVGILEAIGNKNNIQSLDACVTRIRLTVKDGSKVDEPKLKKLGATGIMKLDDKNFQIVVGTTADIIATHIKEIIK 487
Score = 273, Expect = 8.7e-22, Identities = 78/298 (26%), Positives = 131/298 (43%)
  Q:    45 KLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSLTSWRELINSLNPNSQITVNSAA 342
           KL K LM PIA+LP AG+ L +G   + N           +++   GN +F  L ++FAI IA+ F  +  G A L+  +GY +  ++  + ++                                            +   V GG +VG L   LYNK+K+ +L   +GFF G R VPI+T L    + ++  ++WP +   +   G ++  A  + SFI+G + R L+P GLHH   +  W+    G+       I+  D   +  L  +  T +T +  ++    P + + + SAA
  S:    13 KLGKSLMTPIAVLPAAGLLLRLGQPDLLNI----------SWMMAAGNGIFNNLAMIFAIGIAVGFAEENNGVAGLSAAVGYFVLTNVATSFNK-------------------------------------------HIDMGVLGGIIVGILAGNLYNKYKSTRLPDFLGFFGGRRLVPILTSLCSLVLGLISGLVWPAIQNVINAFGNSVSHAGVVGSFIYGLLNRLLIPIGLHHVLNTLFWFQ--FGTFKSASGKIVTGDLHRFFALDKTAGTYMTGFFPIMMFALPAACLAMISAA 256
>gi|15603617|ref|NP_246691.1| hypothetical protein PM1752 [Pasteurella multocida subsp. multocida str. Pm70] >gi|12722168|gb|AAK03836.1| PtsG [Pasteurella multocida subsp. multocida str. Pm70] (450 aa)
Score = 381, Expect = 2.5e-34, Identities = 93/264 (35%), Positives = 148/264 (56%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++  G++  M+ GLPAA  AM    PK  R L   + + A  TS +TGITEPIE+ FLF+APWL+   HA L  ++F + +++ +             IG +FSGG ID++++G +Q    +N     + G+ +A +Y+F F FLI KF++ TPGR E            ++  V+   SS + N     A +++ A G  +NI++VDACIT+LR+ +KD   VD A+L  LGA   ++     + A+FGA+A + K  +  ++
  S:   213 RFFAGRFDTMMFGLPAACLAMYHCVPKARRGLIGGLFLGAALTSFITGITEPIEFMFLFVAPWLYV-FHAFLDGVSFFIADFLNI------------SIGNTFSGGFIDFLLFGILQGNENTNWILVVVVGVFWAMLYYFSFRFLITKFDVMTPGRAE-----------EQEEVVESTNSSLTEN-----AHHIIEALGKAENIEHVDACITRLRVNVKDVKAVDKARLKALGAIDVLEVG-GGIQAIFGAKAVLYKSEVNQIL 446
Score = 255, Expect = 1.1e-19, Identities = 75/227 (33%), Positives = 100/227 (44%)
  Q:    87 LQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLA 313
           +   G+ VF  L LL  I + I     D G AALA  +GYLI           +T T  A+I      +   + G+  G                     V G  V+G L   L+N++ NI+L  I+GFF G RFVPIVT  A   V  LF +IWP     L   G+ +     I +F +GF+ R     GLHH  Y   WYT+ GG+  +    II      +A LA
  S:     9 MSAAGSVVFANLALLLCIGLGIGLAKRDKGVAALAAVVGYLI-----------MTGTINALIS----IFSPEVKGIDTG---------------------VIGSLVMGLLTVKLHNRYHNIQLPQILGFFGGSRFVPIVTAFAAIFVGFLFFLIWPTFQGWLVSAGEGIASMGAIGTFFYGFLMRLSGAVGLHHMIYPLFWYTELGGTEIVNGETIIGAQKIFFAQLA 200
>gi|90579787|ref|ZP_01235596.1| putative phosphotransferase system IIC components, N-acetylglucosamine-specific IIABC component [Vibrio angustum S14] >gi|90439361|gb|EAS64543.1| putative phosphotransferase system IIC components, N-acetylglucosamine-specific IIABC component [Vibrio angustum S14] (461 aa)
Score = 381, Expect = 2.6e-34, Identities = 96/264 (36%), Positives = 152/264 (57%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWII-YGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTL 684
           G+ L G +  ++ GLP+AA A  + A KEN+K+   + +S   T+ LTGITEPIE+ F+FLAP L+  VHA L  ++  + +++ +            H+  SFS G+ID+I+ Y A       N+W     GL    IYF +F  +IK FN++TPGR         ED   + +  + + +S++      LA + ++A GG DN+ ++ ACIT+LR+ I D+SV+D AKL QLGA+G +     ++  + G +A+II   +K+L
  S:   227 GRILSGFFPVVMFGLPSAALAFYVTAKKENKKVVGGMLLSVALTAFLTGITEPIEFMFMFLAPALYV-VHAILMGVSIVVASYLNI------------HMAFSFSSGLIDYILNYNA---PAAHNSWEIIPMGLVVGAIYFVIFVAVIKMFNLKTPGR---------EDTPAENSNPEGDAASKA-----DLAKSYLAALGGKDNLTDISACITRLRLGIVDRSVIDDAKLKQLGAKGVVNVGSNNLQVILGPQAEIIANQMKSL 461
Score = 250, Expect = 4.0e-19, Identities = 80/250 (32%), Positives = 108/250 (43%)
  Q:    45 KLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGD-AGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           KL   +M PIA+LPIAGI L +G   + N            F+   G AVF  L LLFA+ +   F+ D +  AA+A  +GY I  +    L+  V                                              V GG ++G     LYN+F  IKL   +GFF G RFVPIVT L    +   F +IWP +   +  LGQ +  +     F++G   R L+P GLHH   S +W     YT A G +
  S:     9 KLGNAIMFPIAVLPIAGILLRIGQPDLLNI----------PFIAAGGQAVFTNLALLFAMGVGAGFSKDNSAAAAIASAVGYFILMAALKTLNPDV-------------------------------------------DPGVAGGIIIGVCAGLLYNRFNAIKLPEFLGFFGGKRFVPIVTGLVALVLAYAFSIIWPPIQDGINHLGQWILTSGVPGEFVYGVANRLLIPLGLHHILNSMVWFVFGSYTAADGHV 211
>gi|114563818|ref|YP_751331.1| PTS system, glucose-specific IIBC subunit [Shewanella frigidimarina NCIMB 400] >gi|114335111|gb|ABI72493.1| PTS system, glucose-specific IIBC subunit [Shewanella frigidimarina NCIMB 400] (583 aa)
Score = 381, Expect = 2.6e-34, Identities = 109/306 (35%), Positives = 160/306 (52%)
  Q:   411 GANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN---ISSSPNLKSEYEKIMNNSSDTSSASEVKP 716
             NGF     GQ L G Y+F + GLPAAA A+   A  ENR +  SI +SA  T+ LTGITEPIE+ FLF AP L + VHA +   A+ L+N +G++             G SFS G+ID+++            W   + GL YA +Y+ +F FLI KF+++TPGR +                     SSE        A N + A+GG +N+ NVD+CIT+LR+ + D S VD A+L QLGA G +  S  +V A+ G  A++ +  I  ++ +   +S++P        +  ++ D   A  + P
  S:   250 AGNGF-----GQ-LAGGYLFKMFGLPAAAMAIWHTARPENRVMVGSIMISAALTAFLTGITEPIEFAFLFAAP-LLYVVHALMAGFAYVLVNMLGVVH------------GTSFSHGLIDFLVLSG----NSQKIWLLVVLGLIYAALYYVVFRFLILKFDLKTPGRMDVELEIV---------------SSEGTER----ARNFIEAFGGPENLVNVDSCITRLRMDVHDTSKVDQARLKQLGASGVLI-SGNAVQAIVGTIAEVSRTEIDEMLASGGYLSATPTPVIATATVNISAKDREQAQAILP 515
Score = 242, Expect = 3.5e-18, Identities = 81/253 (32%), Positives = 121/253 (47%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQV----PGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQ-ALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSID 295
           + K+ K +MLP+++LP+AGI LGVGSA         G  V  + + V     G A+F  + LLFAI IA+ F  + G AA+A  +GY I           +  T G +                      P +  G           VFGG + G + A  +N+F  I+L   +GFF+G R VPI+T        ++   IWP +G A+      A  Q   +   I+G +ER+L+P GLHH +  P ++ +AG  +D
  S:    23 LQKVGKSVMLPVSVLPVAGILLGVGSA---------GFSVLPDIVNVLMVQAGEAIFSNMGLLFAIGIALGFAKNDGVAAMAALVGYAI-----------MVKTIGVL---------------------EPGTDVG-----------VFGGMIAGAIAAATFNRFFKIQLPSYLGFFSGKRSVPIITGFGAIFAGVILSFIWPPIGNAIAVFSHWAAYQNPTLAFGIYGVVERSLIPAGLHHVWNVPFFF-EAGNCVD 227
>gi|167771060|ref|ZP_02443113.1| hypothetical protein ANACOL_02414 [Anaerotruncus colihominis DSM 17241] >gi|167666730|gb|EDS10860.1| hypothetical protein ANACOL_02414 [Anaerotruncus colihominis DSM 17241] (483 aa)
Score = 381, Expect = 2.7e-34, Identities = 109/339 (32%), Positives = 170/339 (50%)
  Q:   347 MWAFINANLLGKSVWLKELSSGWTYSAINGTYDNASIASSSNGAIQSVLTWSNLTSGQQALGTIGAN----GFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           +W  +   L+    W+  LS+G     I   ++   I    + A+ SV  W ++ +        G N    G  GV  GQY+ G +  M+ GLPAAA AM   +  + +KLA  + +SA F +  TG+TEP+E++F+FLAP L+  VHA L              VSA     L    G +FS G +DW +  + +     N W     GL +A +Y+ LF  +I KFN++TPGR +       +D    + K+ I+ +     N   +A  ++   GG DNI +VD CIT+LR++IK+  +V+  K+   GA G ++PS  SV  + G +   +    K L+
  S:   172 IWPIVYTGLVSFGEWI--LSTGPIGVGIYAFFNRLLIPVGLHHALNSVF-WFDVANIADIARFWGTNPDLPGTLGVT-GQYMVGFFPVMMFGLPAAALAMYHTSKPQKKKLAYGLLISAAFCAFFTGVTEPLEFSFMFLAPGLYV-VHALLTG------------VSAAVCAVLPVRAGFNFSAGFVDWFL--SFKAPMALNPWLIIPIGLVFAVLYYLLFRVIIVKFNLKTPGRED-------DDDIEAEKKITISNA-----NFAAVAAGILEGLGGKDNITSVDNCITRLRLEIKNYELVNDKKIKAAGAAGVMRPSKTSVQVIIGTQVQFVADEFKKLL 483
Score = 274, Expect = 7.4e-22, Identities = 86/250 (34%), Positives = 120/250 (48%)
  Q:    41 EFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEG-LRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDT-TGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQA 290
           +++ KL K LMLP+A LP AGI +G+G  I  +     G   VF  FL   G A+   + +LFAI +A+    D  G +ALA  + +L+    Q  LS +V    TGA                   NAA     +G +       ++ F G + G + A  YN+FKN KL   +GFF+G R V IV  L    V ++   IWP+V   L   G+ +     I   I+ F  R L+P GLHHA  S  W+  A
  S:     3 KYLQKLGKSLMLPVACLPAAGILMGIGYWISPSVMSGVGDPNVFAFFLVKAGGAIIDNMAILFAIGVALGMADDRDGTSALAGIVSWLM---TQLLLSPAVVSVLTGA-----------------EANAA-----FGKI-------NNQFIGIISGLIGATCYNRFKNTKLPDALGFFSGKRSVAIVAALVTIVVDLILFFIWPIVYTGLVSFGEWILSTGPIGVGIYAFFNRLLIPVGLHHALNSVFWFDVA 223
>gi|82544433|ref|YP_408380.1| glucose-specific PTS system IIBC components [Shigella boydii Sb227] >gi|81245844|gb|ABB66552.1| PTS system glucose-specific IIBC component [Shigella boydii Sb227] (477 aa)
Score = 381, Expect = 3.0e-34, Identities = 104/264 (39%), Positives = 150/264 (56%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSF-IFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           L G ++F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE++F+F+AP L+  +HA L  LAF +   +G+            H G SFS G+ID+I+         S+  W F I G+ YA +Y+ +F  LIK  +++TPGR + T     ED K         G+SE       +A  +V+A+GG +NI N+DACIT+LR+ + D S VD A L +LGA G +  +   V A+FG ++D +K  +   + N
  S:   250 LSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFSFMFVAPILYI-IHAILAGLAFPICILLGM------------HDGTSFSHGLIDFIVLSG-----NSSKLWLFPIVGIGYAIVYYTIFRVLIKALDLKTPGREDAT-----EDAK-------ATGTSE-------MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVV-AGSGVQAIFGTKSDNLKTEMDEYIRN 476
Score = 315, Expect = 1.2e-26, Identities = 88/252 (34%), Positives = 129/252 (51%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSF-IFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+++LPIAGI LGVGSA  +         V  + +   G +VF  +PL+FAI +A+ FT + G +ALA  + Y             +   T AV+   +L               LP+     +   +   + V GG + G + A+++N+F  IKL   +GFF G RFVPI++ LA     ++   IWP +G A+    Q       + +F I+GFIER LVPFGLHH +  P       YT A G +
  S:     9 LQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPA-----VVSHVMAEAGGSVFANMPLIFAIGVALGFTNNDGVSALAAVVAY------------GIMVKTMAVVAPLVLH--------------LPAE---EIASKHLADTGVLGGIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLAAIFTGVVLSFIWPPIGSAIQTFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTNAAGQV 232
>gi|167468511|ref|ZP_02333215.1| PTS system, glucose-specific IIBC component [Yersinia pestis FV-1] (334 aa)
Score = 380, Expect = 4.0e-34, Identities = 98/264 (37%), Positives = 147/264 (55%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           L G ++F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE++F+F+AP L++ +HA L  LAF +   +G+              G SFS G+ID+++         S  W   + G+ Y  +Y+ +F  LI K N++TPGR         ED   +Q+   + G +E       ++  +V A+GG DNI N+DACIT+LR+ + D S VD A L +LGA G +  +   V A+FG ++D +K ++   + N
  S:   107 LSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFSFMFVAPILYF-IHAILAGLAFPICILLGM------------RDGTSFSHGLIDFVVLSG----NSSRIWLFPLVGICYGLVYYTIFRVLITKLNLKTPGR---------EDSSTEQS---VQGGTE-------MSAALVEAFGGKDNITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVV-AGSGVQAIFGTKSDNLKTDMDEYIRN 333
Score = 128, Expect = 6.7e-05, Identities = 29/83 (34%), Positives = 46/83 (55%)
  Q:   212 IGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSF-IFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           +GFF G R + I++ +    +  +   IWP +G A+    +       + +F I+G +ER+LVPFGLHH +  P       YT A G +
  S:     1 MGFFAGKRLIRIISGVTAIFLAFMIPFIWPPIGKAIQIFSEWAAYQNSVVAFGIYGVVERSLVPFGLHHIWNVPFQMQIGEYTNAAGQV 89
>gi|168721433|ref|ZP_02753710.1| PTS system, glucose-specific IIBC component [Escherichia coli O157:H7 str. EC4206] (383 aa)
Score = 379, Expect = 5.3e-34, Identities = 103/264 (39%), Positives = 149/264 (56%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSF-IFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           L G ++F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE++F+F+AP L+  +HA L  LAF +   +G+              G SFS G+ID+I+         S+  W F I G+ YA +Y+ +F  LIK  +++TPGR + T     ED K         G+SE       +A  +V+A+GG +NI N+DACIT+LR+ + D S VD A L +LGA G +  +   V A+FG ++D +K  +   + N
  S:   156 LSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFSFMFVAPILYI-IHAILAGLAFPICILLGM------------RDGTSFSHGLIDFIVLSG-----NSSKLWLFPIVGIGYAIVYYTIFRVLIKALDLKTPGREDAT-----EDAK-------ATGTSE-------MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVV-AGSGVQAIFGTKSDNLKTEMDEYIRN 382
Score = 214, Expect = 7.2e-15, Identities = 47/111 (42%), Positives = 66/111 (59%)
  Q:   184 SSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSF-IFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + V GG + G + A+++N+F  IKL   +GFF G RFVPI++ LA     ++   IWP +G A+    Q       + +F I+GFIER LVPFGLHH +  P       YT A G +
  S:    22 TGVLGGIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLAAIFTGVVLSFIWPPIGSAIQTFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTNAAGQV 138
>gi|119953603|ref|YP_945813.1| PTS system, N-acetylglucosamine-specific IIABC component [Borrelia turicatae 91E135] >gi|119862374|gb|AAX18142.1| PTS system, N-acetylglucosamine-specific IIABC component [Borrelia turicatae 91E135] (479 aa)
Score = 378, Expect = 5.9e-34, Identities = 98/265 (36%), Positives = 138/265 (52%)
  Q:   419 NVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKT 683
           N G +  G Y  M+ GLP AA AM + + KE RK    I +SA  TS LTGITEPIEYTF+ +AP+L+  +HA L  ++  + N + +             I  S S G+ID+     +     +NA      GL    +YF +F  LIK F I+TPGR +NT          KQ  +  N S  S N +      ++ A GG DNI N+D+C T+LR+ +K   +V+   + QLGA GTI      V  +FGA+++ I   IK+
  S:   243 NAGAFTSGMYPVMLFGLPGAALAMYLTSKKERRKEVGGILLSASLTSFLTGITEPIEYTFMLIAPFLYL-IHAILTGISLVITNILEI------------RIAFSLSAGIIDYF----LMFPKSTNALLILPIGLVIGTVYFTIFITLIKTFKIKTPGREDNT----------KQQTISNNDSKRSQNEN---FEKIIQALGGIDNITNIDSCFTRLRVDVKSSLLVNKDLMNQLGATGTIITLGNQVQVIFGAKSEQISNYIKS 477
Score = 223, Expect = 5.4e-16, Identities = 73/250 (29%), Positives = 114/250 (45%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFT-GDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           N  + I  L K +  P A+LPIAG+ LG G  I+     +  LR  G  ++  G+A+FG LP+LFAI   +  +  +   AAL   +GYLI                                 L+AG +     + G    +N    SV GG + G   A L ++  N K+   +GFF+G R VPI   L    + I+F  +W  + I +  +G  + +A  +  F+FGF+ R L+  GLH    + +++
  S:     3 NLMKNIQNLGKAVQTPAAVLPIAGLLLGFGYLIIETTEPSNMLRQIGKLMEQSGSAIFGNLPILFAIGTGMGLSKNNKAAAALGGAVGYLI---------------------------------LNAGLSTFTIMINGKSEPVNM---SVLGGIITGISSAMLSDRIVNYKIPQFLGFFSGQRLVPIANGLLSAILAIIFAFLWAPLQITINQIGNWMIEAGNLGVFVFGFLNRLLIITGLHQLLNTLVYF 217
>gi|153094332|gb|EDN75191.1| PTS family glucose (glc) porter component IIABC [Mannheimia haemolytica PHL213] (487 aa)
Score = 378, Expect = 6.3e-34, Identities = 97/264 (36%), Positives = 147/264 (55%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++  G++  M+ GLPAA  AM  A PK  R     + + A  TS +TGITEPIE+ FLF+APWL+   HA L  ++F + + + +             IG +FSGG+ID+ ++G +Q    +N     I GL +A +Y+F F FLIKKFN+ TPGR E +             +  +   + SL  +   A  +++A G  +NI+NVDACIT+LR+ +K+   VD A L +LGA   ++     V AVFGA+A + K  +  ++
  S:   250 RFFAGRFDTMMFGLPAACLAMYHAVPKARRGAISGLFLGAALTSFITGITEPIEFMFLFVAPWLYV-FHAFLDGVSFYIADLLNI------------SIGNTFSGGVIDFTLFGILQGNENTNWLRVIIVGLPWAALYYFSFLFLIKKFNVMTPGRAEES-------------EEVVEQQTSSLTEN---AHKIIAALGSANNIENVDACITRLRVAVKEVKAVDKATLKKLGAIDVLEVG-GGVQAVFGAKAVLYKSEVNQIL 483
Score = 267, Expect = 4.6e-21, Identities = 94/272 (34%), Positives = 124/272 (45%)
  Q:    49 GLMLPIAMLPIAGIFLGVGSAIVTNAG-------GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTG-DAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQDGKAYAVLATSTATSL 320
             MLPIA+LP AG+ LG+G A+   A         N  L+     +   G+ VFG L LL  I + I     D G AALA  +GYLI           +T T  A+I                     P    G       + + V G  V+G +   L+NK+ NI+L  I+GFF G RFVPIVT  A   V  +F +IWP     L   GQ + +   I +F +GF+ R     GLHH  Y   WYT+ GG+  +    II      +A LA  T   L
  S:     1 AFMLPIAILPAAGLLLGIGGALSNKATVQAYPILDNPTLQGIFQIMASAGSVVFGNLALLLCIGLGIGLAKRDKGVAALAAVVGYLI-----------MTGTISALI------------------PLFPPETKG-------IDTGVIGSLVMGLITVKLHNKYHNIQLPQILGFFGGSRFVPIVTAFAAIFVGAVFFLIWPAFQQWLVSAGQGIAEMGEIGTFFYGFLMRLSGAVGLHHMIYPLFWYTELGGTEVVNGETIIGAQKIFFAQLADPTHQGL 244
>gi|196125659|ref|ZP_03117408.1| PTS system, maltose and glucose-specific IIBC component [Clostridium difficile ATCC 43255] (525 aa)
Score = 376, Expect = 1.0e-33, Identities = 97/261 (37%), Positives = 144/261 (55%)
  Q:   425 QGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW--SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQL-GARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           QGK   M+ GLPAAA AM   A  ENR     I ++    + +TGITEP+E++FLF++P LF  +HA L  ++F +M+  G+ +  T              GG+ID +++G +Q     N  W  S I GL YA +Y+ +F  LI +FN+QTPGR E T +    D K   NKV+I  S E+       AL+++   GG DNI+++  CIT+LR+ +KD S VD     +  GA G IK S + +  ++G     ++  +   M
  S:   284 QGKIPIMVFGLPAAAYAMYKTAKPENRSKVKGILLAGALATFVTGITEPLEFSFLFVSPILFV-IHAFLSGISFMMMHIFGVAIGNT-------------QGGIIDLVVFGVMQ----PNTKWIYSIILGLVYAIVYYNVFKILILRFNLQTPGREEITDI--NFDLKPLSNKVEIAQSGETTKR----ALSIIKYLGGKDNIEDITNCITRLRVVVKDMSKVDENAFKKYTGAMGVIKVSDKDIQIIYGPSVSQVRDEVSFAM 523
Score = 330, Expect = 2.4e-28, Identities = 90/259 (34%), Positives = 134/259 (51%)
  Q:    36 KGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSA-----IVTNAG--GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGD-AGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSI 294
           K   K F  +L K  +LPIA++  AGIFLG+ SA     IV++     N  ++    F +     +FG L + FAI+I++    +    +A + F+GYL+       L  SV              Y     G+ A    +        +GI  L+  VFGG VVG + A L+NK+ NIKL   +GFF G RFVPI+T +    + I+   IWP V   +  +G  +     + +F+FGF+ER L+PFGLHH   +   +T+ GGS+
  S:     2 KQKMKGFFLQLGKSFLLPIALISAAGIFLGISSAFSNPNIVSDMPFLANNFIQGILGFTKAITGVLFGNLAIFFAISISVGLAKEEKAVSAFSGFVGYLV-------LHTSVN-------------YMLGCRGILAEPDMMREMGQAVTLGIQTLELGVFGGIVVGIITASLHNKYYNIKLPDYLGFFGGTRFVPIITTVVFSILGIIIPYIWPYVNTIIQSVGIGIASLGYLGTFVFGFLERLLIPFGLHHILNAMFRFTEVGGSL 248
>gi|34496014|ref|NP_900229.1| protein-N p-phosphohistidine-sugar phosphotransferase [Chromobacterium violaceum ATCC 12472] >gi|34101867|gb|AAQ58235.1| protein-N p-phosphohistidine-sugar phosphotransferase [Chromobacterium violaceum ATCC 12472] (562 aa)
Score = 376, Expect = 1.1e-33, Identities = 94/272 (34%), Positives = 139/272 (51%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSP 692
           G ++ G +  M+ GLPAA  AM   A  ENR     +  S   T++LTG+TEP+E+ F+FLAP L+ G+HA L  ++  +M  +G+             +G  FS G+ D++I   I     +        G  Y  +Y+ LF F I+KF+++TPGR         ED      +V+   S          A   + A GG  N+K+VDAC T+LR+Q+     V+ A L  LG+RG IKP+  SV  V G EAD+I   I+  + N ++ P
  S:   230 GMFMAGMFPVMMFGLPAACLAMYRTAKPENRAAVGGLLFSMALTAMLTGVTEPVEFAFMFLAPVLY-GIHAVLTGVSMAVMQMLGV------------KLGFGFSAGLFDYVINYGI----ATKPLLLLPVGAVYFAVYYALFVFFIRKFDLKTPGR---------EDAAVTVAEVKAGTSR---------ARAFIDALGGAANLKSVDACTTRLRLQVASNEKVNEAALKALGSRGLIKPAAGSVQVVLGPEADLIADEIRGALGNAAAEP 466
Score = 253, Expect = 1.9e-19, Identities = 74/256 (28%), Positives = 118/256 (46%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI---DLTQ 298
           I +L + LMLPIA+LP+AG+ L +G   + +            F+   G+A+FG L L+FAI +A+ F  D  G + LA  IGYL+  ++   +                                            +++   V  G + G +  +LYN++K+IKL   + FF G RFVPIVT   +  +  +    WP V   +  +G+ L     +  F +G + R L+  GLHH   + +W     +T A G +   DLT+
  S:    10 IQQLGRALMLPIAVLPVAGLLLRLGQPDLLDI----------KFMAQAGDAIFGNLALIFAIGVAVGFAKDGNGTSGLAGAIGYLVLTAVLKVID-------------------------------------------DKINMGVLSGILSGLIAGYLYNRYKDIKLPSYLAFFGGKRFVPIVTGFGMLVLGAVLGYAWPPVQHGIDAVGKWLIATGEVGVFFYGVLNRILIVTGLHHILNNIVWFQVGDFTNAAGKVVHGDLTR 221
>gi|77977027|ref|ZP_00832488.1| COG1263: Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific [Yersinia intermedia ATCC 29909] (518 aa)
Score = 376, Expect = 1.2e-33, Identities = 94/269 (34%), Positives = 143/269 (53%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLME 686
           +   +++ G+++ M+ GL  A  AM   A  ENRKL   + +SA  TS LTGITEPIE++FLF+AP L+  VHA    LAF L + + +             IG +FSGG ID+I++G +Q +  ++  +  + G+ +  +Y+F F FLI +FN +TPGRG+                   + ++E+       A +V++A GG DNI  +D C T+LRI +K    VD   L   GAR  I      V  ++G    IIK  ++ LM+
  S:   282 IGTARFMSGRFITMMFGLVGACLAMYQTARPENRKLVGGLLLSAALTSFLTGITEPIEFSFLFIAPALYV-VHAVFDGLAFMLAHILHIT------------IGQTFSGGFIDFILFGVLQGEAKTHWMYVPLVGIPWFFLYYFTFRFLILRFNFKTPGRGD-------------------DAATETAPPGTARAQHVLTALGGKDNIVELDCCATRLRITLKQSKCVDETGLKATGARAVIIRG-NGVQVIYGPHVTIIKNEVEELMD 517
Score = 307, Expect = 1.2e-25, Identities = 88/248 (35%), Positives = 126/248 (50%)
  Q:    46 LSKGLMLPIAMLPIAGIFLG----------VGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFT-GDAGPAALACFIGYLIFGSLQDAL----SQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGS 293
             K  MLPIA+LP AG+ LG          V +    N G  +G+ +    +   G+ VF  L +LFA+ +A+     D G A LA  I YL+  +  +AL        TD  GAV                           G ++G+  L++ VFGG ++G +  +L+N++  I L   +GFF G RFVPI++ LA   V  L  ++WP     +  LG  +     + +FI+GF+ R L PFGLHH FY P W T  GGS
  S:    19 FGKSFMLPIAVLPAAGLLLGIGGALSNPNTVEAYPFLNVGWLQGIFIV---MASAGSTVFANLAVLFAVGVAVGLAKSDKGTAGLASLIAYLVMNATINALLKINGSLATDNLGAV-------------------------GQGMILGVQTLETGVFGGVIIGLVTWYLHNRYNKIALPQFLGFFGGSRFVPIISSLAAIGVGGLMTLVWPHFQQVIFGLGGLVDATGYVGTFIYGFVLRMLGPFGLHHIFYLPFWTTALGGS 253
>gi|83721414|ref|YP_441008.1| PTS system, N-acetylglucosamine-specific IIABC component [Burkholderia thailandensis E264] >gi|167617812|ref|ZP_02386443.1| PTS system, N-acetylglucosamine-specific IIABC component [Burkholderia thailandensis Bt4] >gi|83655239|gb|ABC39302.1| PTS system, N-acetylglucosamine-specific IIABC component [Burkholderia thailandensis E264] (589 aa)
Score = 375, Expect = 1.3e-33, Identities = 93/267 (34%), Positives = 136/267 (50%)
  Q:   419 NVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWII-YGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           + G ++ G +  M+ GLPAA  AM   APKE R +   +  S   TS LTG+TEPIE++F+FLAP L + +HA L  L+  +   +G+             +G +FS G ID+++ YG       +  W +   GLAY   Y+ LF F I+KFN+ TPGR         + + +        G+S         A   ++A GG  N+  VDAC T+LR+ + D   V  A L  +GARG +K    SV  + G EAD+I   I+  +
  S:   228 SAGSFMAGFFPIMMFGLPAACLAMFHEAPKERRAIVGGLLFSMALTSFLTGVTEPIEFSFMFLAP-LLYVIHAVLTGLSLAICQLLGV------------KLGFTFSAGAIDYVLNYG-----LSTKGWIAIPLGLAYGLAYYGLFRFFIRKFNMATPGREPAGADAQAQSFASGGFVAPTAGASVP------RAQRYIAALGGAANLSVVDACTTRLRLSVVDPEKVSEADLRTIGARGVLKRGGSSVQVIIGPEADLIADEIRATL 471
Score = 297, Expect = 1.7e-24, Identities = 85/251 (33%), Positives = 116/251 (46%)
  Q:    37 GNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGD-AGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           GN    I  L + LMLPIA+LP+AGI L +G   V N             +   G A+F  LPLLFAI +A+ F  D  G AALA  IGYLI  ++   +                                             +L   V  G + G +   LYN++K+IKL   + FF G RFVPI+T LA   + I+F  +W  V  A+  +GQ L  A  I +F++GF+ R L+  GLHH   S +W+
  S:     3 GNPFLKIQSLGRALMLPIAVLPVAGILLRLGQQDVLNI----------KMIADAGGAIFDNLPLLFAIGVAVGFAKDNNGVAALAGAIGYLIEVAIMKDIDP-------------------------------------------KLNMGVLSGIIAGVVAGLLYNRYKDIKLPDYLAFFGGKRFVPIITGLACVVLGIVFGYVWQPVQHAIDAVGQWLLTAGAIGTFVYGFLNRLLLVTGLHHIINSLVWF 201
>gi|152971487|ref|YP_001336596.1| putative phosphotransferase system IIC component [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150956336|gb|ABR78366.1| putative phosphotransferase system IIC component [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (491 aa)
Score = 375, Expect = 1.4e-33, Identities = 94/265 (35%), Positives = 147/265 (55%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIF--GLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIK 682
           +  G ++ G     +  +PA A A+   A  ENR     I +S   TS++ GITEPIE++FLF+AP L+ G+HA L  L F LM W  +            HIG+SFSGG+ID++ +G +         W  +F  GL    +Y+ LF F I+ +N+ TPGR            + ++N V    + ES  ND  L   ++ AYGG  N+ +++AC+++LRI + D+++VD A L QLGA G ++    ++ +VFG ++D +K  I+
  S:   251 ITAGTFMAGLTPIKMFCIPAIALAIYRCASPENRARVKGIMLSGAITSIVCGITEPIEFSFLFVAPVLY-GIHAVLAGLVFLLMEWFSV------------HIGLSFSGGLIDYLFFGVLP----RAPHWYMVFPVGLVMGALYYALFTFAIRSWNLLTPGR------------EVEENAV----AQESEQND--LVSGIILAYGGLGNMTSIEACMSRLRIDVTDKTLVDKALLKQLGAAGIVEVG-NNIQSVFGMKSDRLKEAIR 481
Score = 285, Expect = 4.2e-23, Identities = 82/236 (34%), Positives = 127/236 (53%)
  Q:    51 MLPIAMLPIAGIFLGVGSA-----IVTNAG--GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALG-QAVGINSFIFGFIERALVPFGLHHAFYSPLW 286
           M+PIAMLP AGI L  G +     IV +    G + L      +   G+ +F  LPLLFA+ +A+  + D G A L+   G+LI          +VT               G   G++  + A     Y  V+GI  LQ+ VFGG ++G + A+LY ++  I+L   + FF+G RFVPI+T  A   V ++  ++WP V   +  L   +  Q  G+++F+FGF+E+ L+PFGL+H ++   W
  S:     1 MIPIAMLPAAGILLAFGVSFQDPNIVASLPFLGADWLVHVLKLMAEAGSVIFANLPLLFAVGVAVGLSDDQGIAGLSAIAGFLIM---------NVT--------------IGQFLGITPESVAQVRD-YTMVLGIPSLQTGVFGGIIIGIIAAWLYKRYYRIQLPSWLEFFSGKRFVPIITSFAALFVGLVMAVVWPPVQHLINGLSNTMTVQGPGVSAFLFGFVEQLLIPFGLNHVWWPTFW 220
>gi|16121876|ref|NP_405189.1| glucose-specific PTS system IIBC components [Yersinia pestis CO92] >gi|22125661|ref|NP_669084.1| glucose-specific PTS system IIBC components [Yersinia pestis KIM] >gi|45442036|ref|NP_993575.1| glucose-specific PTS system IIBC components [Yersinia pestis biovar Microtus str. 91001] >gi|108807912|ref|YP_651828.1| glucose-specific PTS system IIBC components [Yersinia pestis Antiqua] >gi|108812183|ref|YP_647950.1| glucose-specific PTS system IIBC components [Yersinia pestis Nepal516] >gi|149366524|ref|ZP_01888558.1| PTS system, glucose-specific IIBC component [Yersinia pestis CA88-4125] >gi|162421797|ref|YP_001607820.1| glucose-specific PTS system IIBC components [Yersinia pestis Angola] >gi|165925501|ref|ZP_02221333.1| PTS system, glucose-specific IIBC component [Yersinia pestis biovar Orientalis str. F1991016] >gi|165940145|ref|ZP_02228677.1| PTS system, glucose-specific IIBC component [Yersinia pestis biovar Orientalis str. IP275] >gi|166008214|ref|ZP_02229112.1| PTS system, glucose-specific IIBC component [Yersinia pestis biovar Antiqua str. E1979001] >gi|166211018|ref|ZP_02237053.1| PTS system, glucose-specific IIBC component [Yersinia pestis biovar Antiqua str. B42003004] >gi|167401717|ref|ZP_02307208.1| PTS system, glucose-specific IIBC component [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167421747|ref|ZP_02313500.1| PTS system, glucose-specific IIBC component [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167427072|ref|ZP_02318825.1| PTS system, glucose-specific IIBC component [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|21958573|gb|AAM85335.1|AE013779_9 PTS system, glucose-specific IIBC component [Yersinia pestis KIM] >gi|45436899|gb|AAS62452.1| PTS system, glucose-specific IIBC component [Yersinia pestis biovar Microtus str. 91001] >gi|108775831|gb|ABG18350.1| PTS system, glucose-specific IIBC component [Yersinia pestis Nepal516] >gi|108779825|gb|ABG13883.1| PTS system, glucose-specific IIBC component [Yersinia pestis Antiqua] >gi|115347355|emb|CAL20253.1| PTS system, glucose-specific IIBC component [Yersinia pestis CO92] >gi|149290898|gb|EDM40973.1| PTS system, glucose-specific IIBC component [Yersinia pestis CA88-4125] >gi|162354612|gb|ABX88560.1| PTS system, glucose-specific IIBC component [Yersinia pestis Angola] >gi|165911891|gb|EDR30536.1| PTS system, glucose-specific IIBC component [Yersinia pestis biovar Orientalis str. IP275] >gi|165922610|gb|EDR39761.1| PTS system, glucose-specific IIBC component [Yersinia pestis biovar Orientalis str. F1991016] >gi|165992596|gb|EDR44897.1| PTS system, glucose-specific IIBC component [Yersinia pestis biovar Antiqua str. E1979001] >gi|166208198|gb|EDR52678.1| PTS system, glucose-specific IIBC component [Yersinia pestis biovar Antiqua str. B42003004] >gi|166960232|gb|EDR56253.1| PTS system, glucose-specific IIBC component [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167048822|gb|EDR60230.1| PTS system, glucose-specific IIBC component [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167053916|gb|EDR63748.1| PTS system, glucose-specific IIBC component [Yersinia pestis biovar Mediaevalis str. K1973002] (477 aa)
Score = 375, Expect = 1.6e-33, Identities = 98/264 (37%), Positives = 147/264 (55%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           L G ++F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE++F+F+AP L++ +HA L  LAF +   +G+              G SFS G+ID+++         S  W   + G+ Y  +Y+ +F  LI K N++TPGR         ED   +Q+   + G +E       ++  +V A+GG DNI N+DACIT+LR+ + D S VD A L +LGA G +  +   V A+FG ++D +K ++   + N
  S:   250 LSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFSFMFVAPILYF-IHAILAGLAFPICILLGM------------RDGTSFSHGLIDFVVLSG----NSSRIWLFPLVGICYGLVYYTIFRVLITKLNLKTPGR---------EDSSTEQS---VQGGTE-------MSAALVEAFGGKDNITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVV-AGSGVQAIFGTKSDNLKTDMDEYIRN 476
Score = 305, Expect = 2.0e-25, Identities = 89/252 (35%), Positives = 130/252 (51%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQL-QSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVT-FLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSF-IFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+++LPIAGI LGVGSA  +         V  + +   G +VF  +PL+FAI +A+ FT + G +ALA  + Y             +   T AV+                  A L   L    I    L  + V GG + G + A+++N+F  I+L   +GFF G RFVPI++ F A+F + IL   IWP +G A+    +       + +F I+G +ER+LVPFGLHH +  P       YT A G +
  S:     9 LQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPS-----VVSHVMAEAGGSVFANMPLIFAIGVALGFTNNDGVSALAAVVAY------------GIMVKTMAVV------------------APLVLHLPAEEIATKHLADTGVLGGIIAGSVAAYMFNRFYRIQLPEYLGFFAGKRFVPIISGFTAIF-LGILLSFIWPPIGKAIQIFSEWAAYQNSVVAFGIYGVVERSLVPFGLHHIWNVPFQMQIGEYTNAAGQV 232
>gi|51596785|ref|YP_070976.1| glucose-specific PTS system IIBC components [Yersinia pseudotuberculosis IP 32953] >gi|145599121|ref|YP_001163197.1| glucose-specific PTS system IIBC components [Yersinia pestis Pestoides F] >gi|170023935|ref|YP_001720440.1| PTS system, glucose-specific IIBC subunit [Yersinia pseudotuberculosis YPIII] >gi|51590067|emb|CAH21701.1| PTS system, glucose-specific IIBC component [Yersinia pseudotuberculosis IP 32953] >gi|145210817|gb|ABP40224.1| PTS system, glucose-specific IIBC component [Yersinia pestis Pestoides F] >gi|169750469|gb|ACA67987.1| PTS system, glucose-specific IIBC subunit [Yersinia pseudotuberculosis YPIII] (477 aa)
Score = 374, Expect = 1.6e-33, Identities = 98/264 (37%), Positives = 147/264 (55%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           L G ++F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE++F+F+AP L++ +HA L  LAF +   +G+              G SFS G+ID+++         S  W   + G+ Y  +Y+ +F  LI K N++TPGR         ED   +Q+   + G +E       ++  +V A+GG DNI N+DACIT+LR+ + D S VD A L +LGA G +  +   V A+FG ++D +K ++   + N
  S:   250 LSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFSFMFVAPILYF-IHAILAGLAFPICILLGM------------RDGTSFSHGLIDFVVLSG----NSSRIWLFPLVGICYGLVYYTIFRVLITKLNLKTPGR---------EDSSTEQS---VQGGTE-------MSAALVEAFGGKDNITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVV-AGSGVQAIFGTKSDNLKTDMDEYIRN 476
Score = 305, Expect = 2.1e-25, Identities = 89/252 (35%), Positives = 130/252 (51%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQL-QSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVT-FLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSF-IFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+++LPIAGI LGVGSA  +         V  + +   G +VF  +PL+FAI +A+ FT + G +ALA  + Y             +   T AV+                  A L   L    I    L  + V GG + G + A+++N+F  I+L   +GFF G RFVPI++ F A+F + IL   IWP +G A+    +       + +F I+G +ER+LVPFGLHH +  P       YT A G +
  S:     9 LQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPS-----VVSHVMAEAGGSVFANMPLIFAIGVALGFTNNDGVSALAAVVAY------------GIMVKTMAVV------------------APLVLHLPAEEIATKHLADTGVLGGIIAGSVAAYMFNRFYRIQLPEYLGFFAGKRFVPIISGFTAIF-LGILLSFIWPPIGKAIQIFSEWAAYQNSVVAFGIYGVVERSLVPFGLHHIWNVPFQMQIGEYTNAAGQV 232
>gi|186895856|ref|YP_001872968.1| PTS system, glucose-specific IIBC subunit [Yersinia pseudotuberculosis PB1/+] >gi|186698882|gb|ACC89511.1| PTS system, glucose-specific IIBC subunit [Yersinia pseudotuberculosis PB1/+] (477 aa)
Score = 374, Expect = 1.8e-33, Identities = 98/264 (37%), Positives = 148/264 (56%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           L G ++F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE++F+F+AP L++ +HA L  LAF +   +G+              G SFS G+ID+++         S  W   + G++Y  +Y+ +F  LI K N++TPGR         ED   +Q+   + G +E       ++  +V A+GG DNI N+DACIT+LR+ + D S VD A L +LGA G +  +   V A+FG ++D +K ++   + N
  S:   250 LSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFSFMFVAPILYF-IHAILAGLAFPICILLGM------------RDGTSFSHGLIDFVVLSG----NSSRIWLFPLVGISYGLVYYTIFRVLITKLNLKTPGR---------EDSSTEQS---VQGGTE-------MSAALVEAFGGKDNITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVV-AGSGVQAIFGTKSDNLKTDMDEYIRN 476
Score = 303, Expect = 3.3e-25, Identities = 89/252 (35%), Positives = 130/252 (51%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQL-QSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVT-FLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSF-IFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+++LPIAGI LGVGSA  +         V  + +   G +VF  +PL+FAI +A+ FT + G +ALA  + Y             +   T AV+                  A L   L    I    L  + V GG + G + A+++N+F  I+L   +GFF G RFVPI++ F A+F + IL   IWP +G A+    +       + +F I+G +ER+LVPFGLHH +  P       YT A G +
  S:     9 LQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPS-----VVSHVMAEAGGSVFANMPLIFAIGVALGFTNNDGVSALAAVVAY------------GIMVKTMAVV------------------APLVLHLPAEEIATKHLADTGVLGGIIAGSVAAYMFNRFYRIQLPEYLGFFAGKRFVPIISGFTAIF-LGILLSFIWPPIGKAIQIFSEWAAYQNSVVAFGIYGVVERSLVPFGLHHIWNVPFQMQIGEYTNAAGQV 232
>gi|194535179|ref|YP_002070363.1| PTS system, N-acetylglucosamine-specific IIABC component [Vibrio cholerae RC385] >gi|150419973|gb|EDN12281.1| PTS system, N-acetylglucosamine-specific IIABC component [Vibrio cholerae RC385] (521 aa)
Score = 374, Expect = 1.8e-33, Identities = 92/266 (34%), Positives = 144/266 (54%)
  Q:   419 NVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTL 684
           + G ++ G +  M+ GLP AA AM +AAP E R        S  F S LTGITEP+E+ F+FLAP L+  +HA    L+  + N  G     T H       G  FS G+ID+++   +  +  +     F+ GLA+  +YFF F F I+ FN+++PGR              +  +V+ + +  S  +   LA   + A GG +N+ ++DACIT+LR+ +KD+SV D A L +LGA+G +K    ++  + G  A+I+ G +K +
  S:   278 SAGVFMNGFFPVMMFGLPGAALAMYLAAPAERRHQVGGALFSVAFCSFLTGITEPLEFMFVFLAPALY-AMHAVFTGLSLVVANMFG-----TLH-------GFGFSAGLIDFLLNWGLATKPAT----LFVIGLAFFALYFFTFTFAIRAFNLKSPGR--------------EDEEVETDSADASKGD---LARQYLKALGGHENLTSIDACITRLRLTLKDRSVADEAVLKKLGAKGVVKLGENNLQVILGPLAEIVAGEMKAI 509
Score = 219, Expect = 1.7e-15, Identities = 70/250 (28%), Positives = 98/250 (39%)
  Q:    38 NTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           N   +  KL K LMLPIA LP+A + L +G   +              F+   G+A+F  LPLLF + IAI  + D   AA                                        F L+A    + +S+            S FGG   G +    YN F   +L   + FF G R VPI+  L       L  +IWP +   L  L  A+  +  +  F++G + RAL+P GLHH   S  W+
  S:     2 NILGYAQKLGKALMLPIATLPVAALLLRLGQPDLLGI----------PFMAAAGDAIFSQLPLLFGLGIAIGLSKDGSGAAGLAGAVAY--------------------------------FVLTATAKTIDASI----------NMSFFGGIFAGIIAGHSYNAFHTTRLPEWLAFFAGKRLVPIMAGLFALVAGALSGVIWPSIQGGLDALAHAVSTSGALGQFVYGTLNRALIPVGLHHVLNSYFWF 199
>gi|89074901|ref|ZP_01161351.1| putative phosphotransferase system IIC component,N-acetylglucosamine-specific IIABC component [Photobacterium sp. SKA34] >gi|89049298|gb|EAR54861.1| putative phosphotransferase system IIC component,N-acetylglucosamine-specific IIABC component [Photobacterium sp. SKA34] (462 aa)
Score = 374, Expect = 1.9e-33, Identities = 98/264 (37%), Positives = 147/264 (55%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWII-YGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTL 684
           G+ L G +  ++ GLP+AA A  + A KEN+K+   + +S   T+ LTGITEPIE+ F+FLAP L+  VHA L          + ++V++T    L  H+  SFS G+ID+I+ Y A       N+W     GL    IYF +F  +IK FN++TPGR +          +N       +GS E       LA   ++A GG DN+ ++ ACIT+LR+ I D+SV+D   L QLGA+G +     ++  + G +A+II   +K+L
  S:   227 GRILSGFFPVVMFGLPSAALAFYVTAKKENKKVVGGMLLSVALTAFLTGITEPIEFMFMFLAPALYL-VHAILMG--------VSIVVAST----LDIHMAFSFSSGLIDYILNYNA---PAAHNSWEIIPMGLVVGAIYFVIFVAVIKMFNLKTPGREDTPA-------ENSNPSKANDGSKED------LAKAYLAALGGKDNLTDISACITRLRLGIVDRSVIDDTTLKQLGAKGVVNVGSNNLQVILGPQAEIIANQMKSL 462
Score = 260, Expect = 3.3e-20, Identities = 81/250 (32%), Positives = 110/250 (44%)
  Q:    45 KLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGD-AGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           KL   +M PIA+LPIAGI L +G   + N            F+   G AVF  L LLFA+ +A  F+ D + PAA+A  +GY I  +    L+  V                                              V GG ++G     LYN+F  IKL   +GFF G RFVPI+T L    +   F +IWP +   +  LGQ +  +     F++G   R L+P GLHH   S +W     YT A G +
  S:     9 KLGNAIMFPIAVLPIAGILLRIGQPDLLNI----------PFIAAGGQAVFTNLALLFAMGVAAGFSKDNSAPAAIAAAVGYFILMAALKTLNPDV-------------------------------------------DPGVAGGIIIGVFAGLLYNRFHAIKLPEFLGFFGGKRFVPIITGLVALVLAFAFSVIWPPIQDGINHLGQWILSSGAPGEFVYGVANRLLIPLGLHHILNSMVWFVFGSYTAADGHV 211
>gi|192812997|ref|ZP_03041663.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Geobacillus sp. Y412MC10] >gi|192798325|gb|EDV74839.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Geobacillus sp. Y412MC10] (489 aa)
Score = 374, Expect = 2.0e-33, Identities = 94/265 (35%), Positives = 149/265 (56%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           G ++ G +  M+  +PAAA A +  A    RKL  SI + +   S LTGITEP+E+ F+F+AP L+  VHA L  L+ GL+ ++           L  H+G SFS G+ID+++     ++  +NAW     GLA+  +Y+ LF  LI K N++TPGR ++  +    D  +      +  +     +++  A  V+   GG DNI ++DACIT+LR+ +KD+  V  ++L +LGA G ++    +V  VFG +A+ IK  IK +M
  S:   247 GMFMSGFFPIMMFAMPAAALAFMHTAKPSKRKLVGSIFIGSAVASFLTGITEPLEFAFMFIAPVLYV-VHAILTGLS-GLIMYV-----------LDVHLGFSFSAGLIDYLV----NLKLSTNAWLLLPVGLAFGVVYYLLFRILIVKLNLKTPGREDDDDMDPISDDGDT-----VAPAPSGAASNESKAAKVLQNIGGADNITSIDACITRLRLVVKDEKAVKDSELKKLGASGVMRLGQGAVQVVFGPQAESIKDEIKKMM 489
Score = 301, Expect = 5.2e-25, Identities = 91/252 (36%), Positives = 121/252 (48%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGN-----FLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + KL K LMLP+A LP AGI  G+G            L  F N     F+     A+   LP++FAI +AI F GDA  A L+  IGY++   L   L+Q         +   + F   ++                      +L   V GGF VG   A+LYNKF NIK+   +GFF G RFVPI+T  +   + +L  MIW  +   ++  G  +    GI SFIFG   R L+P GLHH   S  W     YT A G +
  S:     5 LQKLGKSLMLPVATLPAAGILQGLGLIDYQKDIPLGALGAFLNQYVTPFMTSGALAILDNLPIIFAIGVAIGFAGDA-VAGLSALIGYMV---LTRVLAQ---------VPLQMPFIPDDV----------------------KLNMGVLGGFFVGLWSAYLYNKFHNIKMPDWLGFFAGKRFVPIITAASTMVLAVLIGMIWSPIQDGISAFGNWVVGLGGIGSFIFGTANRLLIPLGLHHVLNSIAWFQIGDYTNAAGEV 231
>gi|54308396|ref|YP_129416.1| glucose-specific PTS system IIBC components [Photobacterium profundum SS9] >gi|46912824|emb|CAG19614.1| Putative PTS system, glucose-specific IIBC [Photobacterium profundum SS9] (477 aa)
Score = 373, Expect = 2.2e-33, Identities = 105/278 (37%), Positives = 153/278 (55%)
  Q:   410 IGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSF-IFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           +  NGF     GQ L G Y+F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE++F+F+AP L+  +HA L   AF + N +G++             G SFS G ID+++  A      S   W F + GL YA IY+ +F  +I K +++TPGR         ED + + + V +   SE       +A  +V A+GG DNI N+DACIT+LR+ +     VD  +L +LGA G +  +   V A+FG ++D +K ++   + N
  S:   240 LAGNGF-----GQ-LAGGYMFKMFGLPAAAIAIWHSAKPENRAKVGGIMVSAALTSFLTGITEPIEFSFMFVAPVLYV-IHAFLAGSAFVMTNMLGMVH------------GTSFSHGFIDFVVLSA-----NSQKLWLFPVMGLIYAAIYYVVFRVVIAKLDLKTPGR---------ED-EEESDAVVVGAGSE-------MAKELVLAFGGKDNITNLDACITRLRVSVASIENVDQDRLKKLGAAGVVI-AGSGVQAIFGTKSDNLKSDMDEWIRN 476
Score = 285, Expect = 3.6e-23, Identities = 81/258 (31%), Positives = 131/258 (50%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           + K+ K LMLP+++LP+AGI LGVG+A  +         V    ++  G +VFG +PLLFA+ +A+ FT + G A LA  +GY I  +    ++                                       ++G+  +++ V GG +VG + A+ +N+F  I+L   +GFF G RFVPI+T      + IL  ++WP +G A+  F   A  Q   +   I+G +ER+L+PFGLHH +  P ++ +AG  ++    A
  S:     9 LQKVGKALMLPVSVLPVAGILLGVGAANFSWLPD-----VVSQVMEQAGGSVFGQMPLLFAVGVALGFTNNDGVAGLAAIVGYGIMAATLKVMAN--------------------------------------LMGLENIETGVLGGILVGGVAAWAFNRFFRIQLPEYLGFFAGKRFVPIMTGFCSIGLAILLSIVWPPIGGAIGAFSDWAAHQNPTLAFGIYGVVERSLIPFGLHHVWNVPFFF-EAGSCVNAAGEA 223
>gi|119946354|ref|YP_944034.1| glucose-specific PTS system IIBC components [Psychromonas ingrahamii 37] >gi|119864958|gb|ABM04435.1| PTS system, glucose-specific IIBC subunit [Psychromonas ingrahamii 37] (468 aa)
Score = 373, Expect = 2.3e-33, Identities = 113/280 (40%), Positives = 158/280 (56%)
  Q:   411 GANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISS 690
             NGF     GQ L G Y+F + GLPAAA A+  +A  ENR   M I +SA  TS LTGITEPIE+ FLF+AP L+  +HA L   AF + N +G++             G SFS G+ID+++  A   ++     W    GL YA IY+ +F  LI K +++TPGR         ED + +Q         E   +   +++ +V+A+GG  NI ++DACIT+LRI +KD S+VD A+L +LGA G +  S   V A+FG ++D    N+KT MEN  S
  S:   234 AGNGF-----GQ-LAGGYMFKMYGLPAAAIAIAHSAKPENRAKVMGIMVSAALTSFLTGITEPIEFAFLFVAPVLY-AIHALLAGSAFVVTNMLGMVH------------GTSFSHGLIDFLVLSANSQKF----LWFPAIGLIYAAIYYTVFRVLIAKLDLKTPGR---------EDEELEQ---------ELALDSTEMSILLVAAFGGKVNIDSLDACITRLRISVKDISLVDKAELKRLGAAGVVV-SGNGVQAIFGTKSD----NLKTDMENYMS 467
Score = 287, Expect = 2.5e-23, Identities = 83/253 (32%), Positives = 123/253 (48%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSID 295
           + K+ K LMLP+++LPIAGI LGVG+A  +         V    ++  G AVFG + L+FAI +A+ FT + G A LA  +GY+I     + L+       GA  G                                     V GG V G + A ++N+F NIKL   +GFF G R VPI+T      +  +  ++WP VG  +  F   A  Q   +   I+G +ER+L+PFGLHH +  P ++ +AG  ++
  S:     7 LQKVGKSLMLPVSVLPIAGILLGVGAAKFSILPD-----VISQLMEQAGGAVFGNMALIFAIGVALGFTKNDGVAGLAAVVGYVIMMKTIEVLA------PGANTG-------------------------------------VLGGIVAGGIAAAMFNRFYNIKLPDYLGFFAGKRAVPIMTGFVAIIIGAILSVVWPPVGNGIAAFSHWAAEQNPTLAFGIYGVVERSLIPFGLHHIWNVPFFF-EAGSCVN 211
>gi|167579734|ref|ZP_02372608.1| PTS system, N-acetylglucosamine-specific IIABC component [Burkholderia thailandensis TXDOH] (589 aa)
Score = 373, Expect = 2.3e-33, Identities = 93/267 (34%), Positives = 136/267 (50%)
  Q:   419 NVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWII-YGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           + G ++ G +  M+ GLPAA  AM   APKE R +   +  S   TS LTG+TEPIE++F+FLAP L+  +HA L  L+  +   +G+             +G +FS G ID+++ YG       +  W +   GLAY   Y+ LF F I+KFN+ TPGR         + + +        G+S         A   ++A GG  N+  VDAC T+LR+ + D   V  A L  +GARG +K    SV  + G EAD+I   I+  +
  S:   228 SAGSFMAGFFPIMMFGLPAACLAMFHEAPKERRAIVGGLLFSMALTSFLTGVTEPIEFSFMFLAPVLYV-IHAVLTGLSLAICQLLGV------------KLGFTFSAGAIDYVLNYG-----LSTKGWIAIPLGLAYGLAYYGLFRFFIRKFNMATPGREPAGADAQAQSFASGGFVAPTAGASVP------RAQRYIAALGGAANLSVVDACTTRLRLSVVDPEKVSEADLRTIGARGVLKRGGSSVQVIIGPEADLIADEIRATL 471
Score = 297, Expect = 1.7e-24, Identities = 85/251 (33%), Positives = 116/251 (46%)
  Q:    37 GNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGD-AGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           GN    I  L + LMLPIA+LP+AGI L +G   V N             +   G A+F  LPLLFAI +A+ F  D  G AALA  IGYLI  ++   +                                             +L   V  G + G +   LYN++K+IKL   + FF G RFVPI+T LA   + I+F  +W  V  A+  +GQ L  A  I +F++GF+ R L+  GLHH   S +W+
  S:     3 GNPFLKIQSLGRALMLPIAVLPVAGILLRLGQQDVLNI----------KMIADAGGAIFDNLPLLFAIGVAVGFAKDNNGVAALAGAIGYLIEVAIMKDIDP-------------------------------------------KLNMGVLSGIIAGVVAGLLYNRYKDIKLPDYLAFFGGKRFVPIITGLACVVLGIVFGYVWQPVQHAIDAVGQWLLTAGAIGTFVYGFLNRLLLVTGLHHIINSLVWF 201
>gi|15830733|ref|NP_309506.1| glucose-specific PTS system IIBC components [Escherichia coli O157:H7 str. Sakai] >gi|16129064|ref|NP_415619.1| fused glucose-specific PTS enzymes: IIB component/IIC component [Escherichia coli str. K-12 substr. MG1655] >gi|26247243|ref|NP_753283.1| glucose-specific PTS system IIBC components [Escherichia coli CFT073] >gi|74311662|ref|YP_310081.1| glucose-specific PTS system IIBC components [Shigella sonnei Ss046] >gi|82777286|ref|YP_403635.1| glucose-specific PTS system IIBC components [Shigella dysenteriae Sd197] >gi|89107947|ref|AP_001727.1| fused glucose-specific PTS enzyme IIBC components [Escherichia coli W3110] >gi|91210255|ref|YP_540241.1| glucose-specific PTS system IIBC components [Escherichia coli UTI89] >gi|110641277|ref|YP_669007.1| glucose-specific PTS system IIBC components [Escherichia coli 536] >gi|117623286|ref|YP_852199.1| glucose-specific PTS system IIBC components [Escherichia coli APEC O1] >gi|157158322|ref|YP_001462333.1| glucose-specific PTS system IIBC components [Escherichia coli E24377A] >gi|157160627|ref|YP_001457945.1| glucose-specific PTS system IIBC components [Escherichia coli HS] >gi|168707105|ref|ZP_02739382.1| PTS system, glucose-specific IIBC component [Escherichia coli O157:H7 str. EC4045] >gi|168738993|ref|ZP_02771270.1| PTS system, glucose-specific IIBC component [Escherichia coli O157:H7 str. EC4115] >gi|168771325|ref|ZP_02796332.1| PTS system, glucose-specific IIBC component [Escherichia coli O157:H7 str. EC4486] >gi|168783470|ref|ZP_02808477.1| PTS system, glucose-specific IIBC component [Escherichia coli O157:H7 str. EC4076] >gi|168795127|ref|ZP_02820134.1| PTS system, glucose-specific IIBC component [Escherichia coli O157:H7 str. EC4042] >gi|170020504|ref|YP_001725458.1| PTS system, glucose-specific IIBC subunit [Escherichia coli ATCC 8739] >gi|170080752|ref|YP_001730072.1| fused glucose-specific PTS enzymes: iibcomponent; IIC component [Escherichia coli str. K12 substr. DH10B] >gi|170681251|ref|YP_001744078.1| PTS system, glucose-specific IIBC component [Escherichia coli SMS-3-5] >gi|188493718|ref|ZP_03000988.1| PTS system, glucose-specific IIBC component [Escherichia coli 53638] >gi|191168570|ref|ZP_03030354.1| PTS system, glucose-specific IIBC component [Escherichia coli B7A] >gi|191173080|ref|ZP_03034613.1| PTS system, glucose-specific IIBC component [Escherichia coli F11] >gi|194429817|ref|ZP_03062331.1| PTS system, glucose-specific IIBC component [Escherichia coli B171] >gi|194439734|ref|ZP_03071803.1| PTS system, glucose-specific IIBC component [Escherichia coli 101-1] >gi|195938860|ref|ZP_03084242.1| glucose-specific PTS system IIBC components [Escherichia coli O157:H7 str. EC4024] >gi|67471695|sp|P69786|PTGCB_ECOLI PTS system glucose-specific EIICB component (EIICB-Glc) (EII-Glc) [Includes: Glucose permease IIC component (PTS system glucose-specific EIIC component); Glucose-specific phosphotransferase enzyme IIB component (PTS system glucose-specific EIIB component)] >gi|71152916|sp|P69788|PTGCB_ECO57 PTS system glucose-specific EIICB component (EIICB-Glc) (EII-Glc) [Includes: Glucose permease IIC component (PTS system glucose-specific EIIC component); Glucose-specific phosphotransferase enzyme IIB component (PTS system glucose-specific EIIB component)] >gi|71648798|sp|P69787|PTGCB_ECOL6 PTS system glucose-specific EIICB component (EIICB-Glc) (EII-Glc) [Includes: Glucose permease IIC component (PTS system glucose-specific EIIC component); Glucose-specific phosphotransferase enzyme IIB component (PTS system glucose-specific EIIB component)] >gi|26107644|gb|AAN79843.1|AE016759_117 PTS system, glucose-specific IIBC component [Escherichia coli CFT073] >gi|147393|gb|AAA24437.1| glucose-specific enzyme II of phosphotransferase system >gi|1651541|dbj|BAA35908.1| fused glucose-specific PTS enzyme IIBC components [Escherichia coli W3110] >gi|1787343|gb|AAC74185.1| fused glucose-specific PTS enzymes: IIB component/IIC component [Escherichia coli str. K-12 substr. MG1655] >gi|13360943|dbj|BAB34902.1| PTS system, glucose-specific IIBC component [Escherichia coli O157:H7 str. Sakai] >gi|73855139|gb|AAZ87846.1| PTS system, glucose-specific IIBC component [Shigella sonnei Ss046] >gi|81241434|gb|ABB62144.1| PTS system, glucose-specific IIBC component [Shigella dysenteriae Sd197] >gi|91071829|gb|ABE06710.1| PTS system, glucose-specific IIBC component [Escherichia coli UTI89] >gi|110342869|gb|ABG69106.1| PTS system, glucose-specific IIBC component [Escherichia coli 536] >gi|115512410|gb|ABJ00485.1| fused glucose-specific PTS enzyme IIBC components [Escherichia coli APEC O1] >gi|157066307|gb|ABV05562.1| PTS system, glucose-specific IIBC component [Escherichia coli HS] >gi|157080352|gb|ABV20060.1| PTS system, glucose-specific IIBC component [Escherichia coli E24377A] >gi|169755432|gb|ACA78131.1| PTS system, glucose-specific IIBC subunit [Escherichia coli ATCC 8739] >gi|169888587|gb|ACB02294.1| fused glucose-specific PTS enzymes: IIBcomponent; IIC component [Escherichia coli str. K12 substr. DH10B] >gi|170518969|gb|ACB17147.1| PTS system, glucose-specific IIBC component [Escherichia coli SMS-3-5] >gi|188488917|gb|EDU64020.1| PTS system, glucose-specific IIBC component [Escherichia coli 53638] >gi|188999121|gb|EDU68107.1| PTS system, glucose-specific IIBC component [Escherichia coli O157:H7 str. EC4076] >gi|189359845|gb|EDU78264.1| PTS system, glucose-specific IIBC component [Escherichia coli O157:H7 str. EC4486] >gi|190901364|gb|EDV61129.1| PTS system, glucose-specific IIBC component [Escherichia coli B7A] >gi|190906625|gb|EDV66231.1| PTS system, glucose-specific IIBC component [Escherichia coli F11] >gi|194412164|gb|EDX28472.1| PTS system, glucose-specific IIBC component [Escherichia coli B171] >gi|194421353|gb|EDX37371.1| PTS system, glucose-specific IIBC component [Escherichia coli 101-1] (477 aa)
Score = 373, Expect = 2.5e-33, Identities = 103/264 (39%), Positives = 149/264 (56%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSF-IFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           L G ++F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE++F+F+AP L+  +HA L  LAF +   +G+              G SFS G+ID+I+         S+  W F I G+ YA +Y+ +F  LIK  +++TPGR + T     ED K         G+SE       +A  +V+A+GG +NI N+DACIT+LR+ + D S VD A L +LGA G +  +   V A+FG ++D +K  +   + N
  S:   250 LSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFSFMFVAPILYI-IHAILAGLAFPICILLGM------------RDGTSFSHGLIDFIVLSG-----NSSKLWLFPIVGIGYAIVYYTIFRVLIKALDLKTPGREDAT-----EDAK-------ATGTSE-------MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVV-AGSGVQAIFGTKSDNLKTEMDEYIRN 476
Score = 315, Expect = 1.2e-26, Identities = 88/252 (34%), Positives = 129/252 (51%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSF-IFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+++LPIAGI LGVGSA  +         V  + +   G +VF  +PL+FAI +A+ FT + G +ALA  + Y             +   T AV+   +L               LP+     +   +   + V GG + G + A+++N+F  IKL   +GFF G RFVPI++ LA     ++   IWP +G A+    Q       + +F I+GFIER LVPFGLHH +  P       YT A G +
  S:     9 LQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPA-----VVSHVMAEAGGSVFANMPLIFAIGVALGFTNNDGVSALAAVVAY------------GIMVKTMAVVAPLVLH--------------LPAE---EIASKHLADTGVLGGIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLAAIFTGVVLSFIWPPIGSAIQTFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTNAAGQV 232
>gi|126698935|ref|YP_001087832.1| PTS system, maltose and glucose-specific IIBC component [Clostridium difficile 630] >gi|115250372|emb|CAJ68194.1| PTS system, maltose and glucose-specific IIbc component [Clostridium difficile 630] (525 aa)
Score = 373, Expect = 2.5e-33, Identities = 96/261 (36%), Positives = 144/261 (55%)
  Q:   425 QGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW--SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQL-GARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           QGK   M+ GLPAAA AM   A  ENR     I ++    + +TGITEP+E++FLF++P LF  +HA L  ++F +M+  G+ +  T              GG+ID +++G +Q     N  W  S I GL YA +Y+ +F  LI +FN+QTPGR E T +    D +   NKV+I  S E+       AL+++   GG DNI+++  CIT+LR+ +KD S VD     +  GA G IK S + +  ++G     ++  +   M
  S:   284 QGKIPIMVFGLPAAAYAMYKTAKPENRSKVKGILLAGALATFVTGITEPLEFSFLFVSPILFV-IHAFLSGISFMMMHIFGVAIGNT-------------QGGIIDLVVFGVMQ----PNTKWIYSIILGLVYAIVYYNVFKILILRFNLQTPGREEITDI--NFDLEPLSNKVEIAQSGETTKR----ALSIIKYLGGKDNIEDITNCITRLRVVVKDMSKVDENAFKKYTGAMGVIKVSDKDIQIIYGPSVSQVRDEVSFAM 523
Score = 337, Expect = 3.8e-29, Identities = 88/259 (33%), Positives = 134/259 (51%)
  Q:    36 KGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSA-----IVTNAG--GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGD-AGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSI 294
           K   KEF  +L K  +LPIA++  AGIFLG+ SA     IV++     N  ++    F +     +FG L + FAI+I++    +    +A + F+GYL+                     +  + Y     G+ A    +        +GI  L+  VFGG VVG + A L+NK+ NIKL   +GFF G RFVPI+T +    + I+   IWP V   +  +G  +     + +F+FGF+ER L+PFGLHH   +   +T+ GGS+
  S:     2 KQKMKEFFLQLGKSFLLPIALISAAGIFLGISSAFSNPNIVSDMPFLANNFIQGILGFTKAITGVLFGNLAIFFAISISVGLAKEEKAVSAFSGFVGYLVL--------------------HTSINYMLGCRGILAEPDMMREMGQAVTLGIQTLELGVFGGIVVGIITASLHNKYYNIKLPDYLGFFGGTRFVPIITTVVFSILGIIIPYIWPYVNTIIQSVGIGIASLGYLGTFVFGFLERLLIPFGLHHILNAMFRFTEVGGSL 248
>gi|28901522|ref|NP_801177.1| PTS system, glucose-specific IIBC component [Vibrio parahaemolyticus RIMD 2210633] >gi|153838149|ref|ZP_01990816.1| pts system, glucose-specific iibc component [Vibrio parahaemolyticus AQ3810] >gi|28810069|dbj|BAC63010.1| PTS system, glucose-specific IIBC component [Vibrio parahaemolyticus RIMD 2210633] >gi|149748465|gb|EDM59324.1| pts system, glucose-specific iibc component [Vibrio parahaemolyticus AQ3810] (480 aa)
Score = 372, Expect = 2.8e-33, Identities = 100/271 (36%), Positives = 149/271 (54%)
  Q:   415 FKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           F G     YL G +++ +  LPAAA A+   A  E +K+   + MSA  TS LTGITEPIE+TFLF+AP L+  +H  L  +AF +  ++ +  S              F+ G I + +Y  +     SNAW   I G  +A +Y+ LF FLI K +++TPGR  +              +V+I G  +       +A++VV+A GG  NIK+VDACIT+LR+ +KD + VD AKL  LGAR  +     S+ A+FG ++D IK  + +++
  S:   243 FAGDKTAGYLSGGFMYSMWALPAAALAIYHCASPERKKIVGGLMMSAALTSWLTGITEPIEFTFLFVAPVLYV-IHIFLTGIAFAITAFLEIKHST------------DFAHGAIQFFLYYPMS----SNAWMFIIIGPIWATLYYGLFRFLIVKLDLKTPGRETDIA------------EVKIAGQPDE------IAVDVVAALGGKANIKSVDACITRLRVSVKDIANVDVAKLKALGARDVLVIG-DSLQAIFGTQSDSIKSEVHSVL 477
Score = 304, Expect = 2.7e-25, Identities = 86/253 (33%), Positives = 129/253 (50%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFT-GDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSID 295
           + K+ + LMLP+A+LP+AG+ LG+G     NAG           +   G  VFG + L+FA+ +A+  + G+ G AALA  +G +I  +           + G V G         + GL              ++G+  LQ+ VFGG  +G + A +YN+F NIKL   +GFF G RFVPIVT L+   V  +    WP VG  L  F   A  Q   +   ++G  ER+L+P GLHH + +P ++ + G  +D
  S:     9 LQKIGRSLMLPVAVLPVAGLMLGIG-----NAGFGFIPDAVNKVMLAAGEGVFGNMQLMFAVGVALGLSKGNDGAAALAGLVGLIIMNA-----------SLGIVTG---------LRGLETD---------ATIMGVETLQTGVFGGIFIGAVAAIMYNRFYNIKLPEYLGFFAGKRFVPIVTGLSAIVVGAILAFAWPPVGQLLDAFSHWAAYQNPVLAWAVYGVGERSLLPVGLHHIWNAPFFF-EVGSYVD 228
>gi|167835348|ref|ZP_02462231.1| PTS system, N-acetylglucosamine-specific IIABC component [Burkholderia thailandensis MSMB43] (589 aa)
Score = 372, Expect = 2.8e-33, Identities = 94/271 (34%), Positives = 140/271 (51%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWII-YGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSS 691
           G ++ G +  M+ GLPAA  AM   APKE R +   +  S   TS LTG+TEPIE++F+FLAP L+  +HA L  L+  +   +G+             +G +FS G ID+++ YG       +  W +   GLAY   Y+ LF F I+KFN+ TPGR         + + +        G+S         A   ++A GG  N+  VDAC T+LR+ + D   V  A L  +GARG +K    SV  + G EAD+I   I++ + + ++S
  S:   230 GGFMAGFFPIMMFGLPAACLAMFHEAPKERRAIVGGLLFSMALTSFLTGVTEPIEFSFMFLAPVLYV-IHAVLTGLSLAICQLLGV------------KLGFTFSAGAIDYVLNYG-----LSTKGWIAIPLGLAYGVAYYGLFRFFIRKFNMATPGREPAGADAQAQSFASGGFVAPTAGASVP------RAQRYIAALGGAANLSVVDACTTRLRLSVVDPDKVSEADLRTIGARGVLKRGGSSVQVIIGPEADLIADEIRSTLGSGATS 477
Score = 291, Expect = 8.0e-24, Identities = 84/251 (33%), Positives = 115/251 (45%)
  Q:    37 GNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGD-AGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           GN    I  L + LMLPIA+LP+AGI L +G   V N             +   G A+F  LPLLFAI +A+ F  D  G AALA  IGYLI  ++   +                                             +L   V  G + G +   LYN++K+IKL   + FF G RFVPI+T LA   + ++F   W  V  A+  +GQ L  A  I +F++GF+ R L+  GLHH   S +W+
  S:     3 GNPFLKIQSLGRALMLPIAVLPVAGILLRLGQQDVLNI----------KMIADAGGAIFDNLPLLFAIGVAVGFAKDNNGVAALAGAIGYLIEVAIMKDIDP-------------------------------------------KLNMGVLSGIIAGVVAGLLYNRYKDIKLPDYLAFFGGKRFVPIITGLACVVLGVVFGYAWQPVQHAIDAIGQWLLTAGAIGTFVYGFLNRLLLVTGLHHIINSLVWF 201
>gi|194433653|ref|ZP_03065929.1| PTS system, glucose-specific IIBC component [Shigella dysenteriae 1012] >gi|194418082|gb|EDX34175.1| PTS system, glucose-specific IIBC component [Shigella dysenteriae 1012] (477 aa)
Score = 372, Expect = 2.9e-33, Identities = 103/264 (39%), Positives = 149/264 (56%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSF-IFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           L G ++F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE++F+F+AP L+  +HA L  LAF +   +G+              G SFS G+ID+I+         S+  W F I G+ YA +Y+ +F  LIK  +++TPGR + T     ED K         G+SE       +A  +V+A+GG +NI N+DACIT+LR+ + D S VD A L +LGA G +  +   V A+FG ++D +K  +   + N
  S:   250 LSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFSFMFVAPILYI-IHAILAGLAFPICILLGMC------------DGTSFSHGLIDFIVLSG-----NSSKLWLFPIVGIGYAIVYYTIFRVLIKALDLKTPGREDAT-----EDAK-------ATGTSE-------MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVV-AGSGVQAIFGTKSDNLKTEMDEYIRN 476
Score = 315, Expect = 1.3e-26, Identities = 88/252 (34%), Positives = 129/252 (51%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSF-IFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+++LPIAGI LGVGSA  +         V  + +   G +VF  +PL+FAI +A+ FT + G +ALA  + Y             +   T AV+   +L               LP+     +   +   + V GG + G + A+++N+F  IKL   +GFF G RFVPI++ LA     ++   IWP +G A+    Q       + +F I+GFIER LVPFGLHH +  P       YT A G +
  S:     9 LQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPA-----VVSHVMAEAGGSVFANMPLIFAIGVALGFTNNDGVSALAAVVAY------------GIMVKTMAVVAPLVLH--------------LPAE---EIASKHLADTGVLGGIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLAAIFTGVVLSFIWPPIGSAIRTFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTNAAGQV 232
>gi|168245147|ref|ZP_02670079.1| putative phosphotransferase system IIC component [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|194449913|ref|YP_002046716.1| pts system, glucose-specific iibc component [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194408217|gb|ACF68436.1| pts system, glucose-specific iibc component [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (513 aa)
Score = 372, Expect = 3.1e-33, Identities = 93/267 (34%), Positives = 146/267 (54%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIF--GLAYAPIYFFLFYFLIKKFNIQTPGRG-ENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTL 684
           +  G ++ G     +  +PA A A+   A  EN      I +S   TS++ GITEPIE++FLF+AP L+ G+HA L  L F LM W  +            HIG+SFSGG+ID++ +G +         W  +F  GL    +Y+ LF F I+++N+ TPGR  E T +                 + ES  ND  L   ++ AYGG  N+ +++AC+++LRI + D+++VD A L QLGA G ++    ++ +VFG ++D +K  I+ +
  S:   268 ITAGTFMAGLTPIKMFCIPAIALAIYRCASPENIARVKGIMLSGAITSIVCGITEPIEFSFLFVAPVLY-GIHAVLAGLVFLLMEWFSV------------HIGLSFSGGLIDYLFFGVLP----RAPHWYMVFPVGLVMGAVYYVLFTFAIRRWNLLTPGREVEETAV-----------------AQESEQND--LVSGIILAYGGLGNMTSIEACMSRLRIDVTDKTLVDKALLKQLGAAGVVEVG-NNIQSVFGMKSDRLKEAIRAI 500
Score = 320, Expect = 3.8e-27, Identities = 89/252 (35%), Positives = 136/252 (53%)
  Q:    35 KKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSA-----IVTNAG--GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALG-QAVGINSFIFGFIERALVPFGLHHAFYSPLW 286
           K+ N  + +  + + LM+PIAMLP AGI L  G +     IV +    G +GL      +   G+A+F  LPLLFA+ +A+  + D G A L+   G+LI          +VT               G   G++  + A     Y  V+GI  LQ+ VFGG ++G + A+LY ++  I+L   + FF G RFVPIVT  A   V ++  ++WP V   +  L   +  Q  G+++F+FGF+ER L+PFGL+H ++   W
  S:     2 KRFNLLQMLQSIGRSLMIPIAMLPAAGILLAFGVSFQDPNIVASLPFLGTDGLVHVLKLMAEAGSAIFANLPLLFAVGVAVGLSDDQGIAGLSAIAGFLIM---------NVT--------------IGQFLGITPESVAQVRD-YTMVLGIPSLQTGVFGGIIIGIIAAWLYKRYYRIQLPSWLEFFPGKRFVPIVTSFAALFVGLVMAVVWPPVQHLINGLSNTMTVQGPGVSAFLFGFVERLLIPFGLNHVWWPTFW 237
>gi|170768040|ref|ZP_02902493.1| PTS system, glucose-specific IIBC component [Escherichia albertii TW07627] >gi|170122806|gb|EDS91737.1| PTS system, glucose-specific IIBC component [Escherichia albertii TW07627] (477 aa)
Score = 372, Expect = 3.1e-33, Identities = 103/264 (39%), Positives = 149/264 (56%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSF-IFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           L G ++F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE++F+F+AP L+  +HA L  LAF +   +G+              G SFS G+ID+I+         S+  W F I G+ YA +Y+ +F  LIK  +++TPGR + T     ED K         G+SE       +A  +V+A+GG +NI N+DACIT+LR+ + D S VD A L +LGA G +  +   V A+FG ++D +K  +   + N
  S:   250 LSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFSFMFVAPILYI-IHAILAGLAFPICILLGM------------RDGTSFSHGLIDFIVLSG-----NSSKLWLFPIVGIGYAIVYYTIFRVLIKALDLKTPGREDAT-----EDAKAA-------GTSE-------MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVV-AGSGVQAIFGTKSDNLKTEMDEYIRN 476
Score = 316, Expect = 1.1e-26, Identities = 88/252 (34%), Positives = 129/252 (51%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSF-IFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+++LPIAGI LGVGSA  +         V  + +   G +VF  +PL+FAI +A+ FT + G +ALA  + Y             +   T AV+   +L               LP+     +   +   + V GG + G + A+++N+F  IKL   +GFF G RFVPI++ LA     ++   IWP +G A+    Q       + +F I+GFIER LVPFGLHH +  P       YT A G +
  S:     9 LQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPA-----VVSHVMAEAGGSVFANMPLIFAIGVALGFTNNDGVSALAAVVAY------------GIMVKTMAVVAPLVLH--------------LPAE---EIAAKHLADTGVLGGIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLAAIFTGVVLSFIWPPIGSAIQTFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTNAAGQV 232
>gi|16766070|ref|NP_461685.1| putative phosphotransferase system IIC component [Salmonella typhimurium LT2] >gi|167544373|ref|ZP_02339944.1| putative phosphotransferase system IIC component [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|16421305|gb|AAL21644.1| putative phosphotransferase system IIC component [Salmonella typhimurium LT2] (513 aa)
Score = 372, Expect = 3.1e-33, Identities = 93/267 (34%), Positives = 146/267 (54%)
  Q:   418 VNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIF--GLAYAPIYFFLFYFLIKKFNIQTPGRG-ENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTL 684
           +  G ++ G     +  +PA A A+   A  EN      I +S   TS++ GITEPIE++FLF+AP L+ G+HA L  L F LM W  +            HIG+SFSGG+ID++ +G +         W  +F  GL    +Y+ LF F I+++N+ TPGR  E T +                 + ES  ND  L   ++ AYGG  N+ +++AC+++LRI + D+++VD A L QLGA G ++    ++ +VFG ++D +K  I+ +
  S:   268 ITAGTFMAGLTPIKMFCIPAIALAIYRCASPENIARVKGIMLSGAITSIVCGITEPIEFSFLFVAPVLY-GIHAVLAGLVFLLMEWFSV------------HIGLSFSGGLIDYLFFGVLP----RAPHWYMVFPVGLVMGAVYYVLFTFAIRRWNLLTPGREVEETAV-----------------AQESEQND--LVSGIILAYGGLGNMTSIEACMSRLRIDVTDKTLVDKALLKQLGAAGVVEVG-NNIQSVFGMKSDRLKEAIRAI 500
Score = 322, Expect = 1.9e-27, Identities = 89/252 (35%), Positives = 137/252 (54%)
  Q:    35 KKGNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSA-----IVTNAG--GNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALG-QAVGINSFIFGFIERALVPFGLHHAFYSPLW 286
           K+ N  + +  + + LM+PIAMLP AGI L  G +     IV +    G +GL      +   G+A+F  LPLLFA+ +A+  + D G A L+   G+LI          +VT               G   G++  + A     Y  V+GI  LQ+ VFGG ++G + A+LY ++  I+L   + FF+G RFVPIVT  A   V ++  ++WP V   +  L   +  Q  G+++F+FGF+ER L+PFGL+H ++   W
  S:     2 KRFNLLQMLQSIGRSLMIPIAMLPAAGILLAFGVSFQDPNIVASLPFLGTDGLVHVLKLMAEAGSAIFANLPLLFAVGVAVGLSDDQGIAGLSAIAGFLIM---------NVT--------------IGQFLGITPESVAQVRD-YTMVLGIPSLQTGVFGGIIIGIIAAWLYKRYYRIQLPSWLEFFSGKRFVPIVTSFAALFVGLVMAVVWPPVQHLINGLSNTMTVQGPGVSAFLFGFVERLLIPFGLNHVWWPTFW 237
>gi|146310645|ref|YP_001175719.1| PTS system, glucose-like IIB subunint [Enterobacter sp. 638] >gi|145317521|gb|ABP59668.1| PTS system, glucose-like IIB subunint [Enterobacter sp. 638] (499 aa)
Score = 372, Expect = 3.3e-33, Identities = 93/267 (34%), Positives = 141/267 (52%)
  Q:   419 NVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQI--QYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           N G+++QG++  M+  LPAA  AM   A  +N+K+A  I  SA  T  LTGITEP+E+TF+F+AP L+   +A +  LA+  M              L  HI  SFS G ID++ +G +     Y +N   + I G+  A IY+F F F+I++F+++TPGR E T   T +D                   D  +A +++   GG  NI +V +CIT+LR+++     VD   L  LGARG +      +  +FGA A  I   + T++
  S:   261 NAGKFMQGEFPLMLFALPAACLAMYHEAHTKNKKIAAGILFSAALTCFLTGITEPVEFTFIFVAPILYV-FNAIMAGLAYMTMYL------------LHAHIAKSFSAGFIDYLSFGILPSFNGYQTNFLSAIIIGIPMALIYYFTFRFVIRRFDVKTPGRTEVTA--TTDD-----------------KTDSEIATDIIGLLGGAQNINSVGSCITRLRLEVAKSDAVDKDGLNGLGARGVVFVGDNGIQVIFGARAQFIAQTMSTMI 497
Score = 267, Expect = 5.3e-21, Identities = 79/212 (37%), Positives = 112/212 (52%)
  Q:    83 FGNFLQVP-----GNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLV--GI-ALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY------TQAGGSI 294
           FG+   +P     G  +F  LP+LFAI  A+    ++G AAL+             A+S  VT+ T            G +  ++   A+     Y  V+GI  LQ  VFGG + G L A+ YN+F  ++L   +GFF+G RFV I T    F + +L   +W  +  GI AL+ +     QA   ++FIFG +ERAL+P GLHH +Y   WY      TQAG  I
  S:    37 FGDKFHMPLMMNAGGVIFDNLPMLFAIGSAVGLASESGIAALSA------------AVSVFVTNIT-----------IGTVLSITPEMAS-SGGKYAMVVGIPTLQMGVFGGLICGILAAWCYNRFHTLQLPEFLGFFSGKRFVAIATAFLSFILGLLLPYVWQHIQSGIDALSVIVNGDNQAA--STFIFGLVERALIPLGLHHIWYPSFWYSFGDYTTQAGQVI 236
>gi|153823651|ref|ZP_01976318.1| PTS system, N-acetylglucosamine-specific IIABC component [Vibrio cholerae B33] >gi|126518825|gb|EAZ76048.1| PTS system, N-acetylglucosamine-specific IIABC component [Vibrio cholerae B33] (308 aa)
Score = 372, Expect = 3.5e-33, Identities = 92/266 (34%), Positives = 143/266 (53%)
  Q:   419 NVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTL 684
           + G ++ G +  M+ GLP AA AM +AAP E R        S  F S LTGITEP+E+ F+FLAP L+  +HA    L+  + N  G     T H       G  FS G+ID+++   +  +  +     F+ GLA+  +YFF F F I+ FN+++PGR +       +             S+++   D  LA   + A GG +N+ ++DACIT+LR+ +KD+SV D A L +LGA+G +K    ++  + G  A+I+ G +K +
  S:    63 SAGVFMNGFFPVMMFGLPGAALAMYLAAPAERRHQVGGALFSVAFCSFLTGITEPLEFMFVFLAPALY-AMHAVFTGLSLVVANMFG-----TLH-------GFGFSAGLIDFLLNWGLATKPAT----LFVIGLAFFALYFFTFTFAIRAFNLKSPGREDEEVETETD-------------SADASKGD--LARQYLKALGGHENLTSIDACITRLRLTLKDRSVADEAVLKKLGAKGVVKLGENNLQVILGPLAEIVAGEMKAI 296
>gi|153950505|ref|YP_001400563.1| glucose-specific PTS system IIBC components [Yersinia pseudotuberculosis IP 31758] >gi|152962000|gb|ABS49461.1| PTS system, glucose-specific IIBC component [Yersinia pseudotuberculosis IP 31758] (477 aa)
Score = 371, Expect = 3.8e-33, Identities = 98/264 (37%), Positives = 147/264 (55%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           L G ++F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE++F+F+AP L++ +HA L  LAF +   +G+              G SFS G+ID+++         S  W   + G+ Y  +Y+ +F  LI K N++TPGR         ED   +Q+   + G +E       ++  +V A+GG DNI N+DACIT+LR+ + D S VD A L +LGA G +  +   V A+FG ++D +K ++   + N
  S:   250 LSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFSFMFVAPILYF-IHAILAGLAFPICILLGM------------RDGTSFSHGLIDFVVLSG----NSSRIWLFPLVGICYGLVYYTIFRVLITKLNLKTPGR---------EDSSIEQS---VQGGTE-------MSAALVEAFGGKDNITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVV-AGSGVQAIFGTKSDNLKTDMDEYIRN 476
Score = 305, Expect = 2.1e-25, Identities = 89/252 (35%), Positives = 130/252 (51%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQL-QSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVT-FLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSF-IFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+++LPIAGI LGVGSA  +         V  + +   G +VF  +PL+FAI +A+ FT + G +ALA  + Y             +   T AV+                  A L   L    I    L  + V GG + G + A+++N+F  I+L   +GFF G RFVPI++ F A+F + IL   IWP +G A+    +       + +F I+G +ER+LVPFGLHH +  P       YT A G +
  S:     9 LQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPS-----VVSHVMAEAGGSVFANMPLIFAIGVALGFTNNDGVSALAAVVAY------------GIMVKTMAVV------------------APLVLHLPAEEIATKHLADTGVLGGIIAGSVAAYMFNRFYRIQLPEYLGFFAGKRFVPIISGFTAIF-LGILLSFIWPPIGKAIQIFSEWAAYQNSVVAFGIYGVVERSLVPFGLHHIWNVPFQMQIGEYTNAAGQV 232
>gi|194541437|ref|YP_002076470.1| pts system, glucose-specific iibc component [Vibrio sp. Ex25] >gi|151939992|gb|EDN58818.1| pts system, glucose-specific iibc component [Vibrio sp. Ex25] (464 aa)
Score = 371, Expect = 4.2e-33, Identities = 99/271 (36%), Positives = 149/271 (54%)
  Q:   415 FKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           F G     YL G +++ +  LPAAA A+   A  E +K+   + MSA  TS LTGITEPIE+TFLF+AP L+  +H  L  +AF +  ++ +  S              F+ G I + +Y  +     +NAW   I G  +A +Y+ LF FLI K +++TPGR  +              +V+I G  +       +A++VV+A GG  NIK+VDACIT+LR+ +KD + VD AKL  LGAR  +     S+ A+FG ++D IK  + +++
  S:   227 FAGDKTAGYLSGGFMYSMWALPAAALAIYHCASPERKKIVGGLMMSAALTSWLTGITEPIEFTFLFVAPVLYV-IHIFLTGIAFAITAFLEIKHST------------DFAHGAIQFFLYYPMS----TNAWMFIIIGPIWATLYYGLFRFLIVKLDLKTPGRETDIA------------EVKIAGQPDE------IAVDVVAALGGKANIKSVDACITRLRVSVKDIANVDVAKLKALGARDVLVIG-DSLQAIFGTQSDSIKSEVHSVL 461
Score = 290, Expect = 1.0e-23, Identities = 84/245 (34%), Positives = 124/245 (50%)
  Q:    51 MLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFT-GDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSID 295
           MLP+A+LP+AG+ LG+G     NAG           +   G  VFG + L+FA+ +A+  + G+ G AALA  +G +I  +           + G V G         + GL              ++G+  LQ+ VFGG  +G + A +YN+F NIKL   +GFF G RFVPIVT L+   V  +    WP VG  L  F   A  Q   +   ++G  ER+L+P GLHH + +P ++ + G  +D
  S:     1 MLPVAVLPVAGLMLGIG-----NAGFAFIPDAVNKVMLAAGEGVFGNMQLMFAVGVALGLSKGNDGAAALAGLVGLIIMNA-----------SLGIVTG---------LRGLETD---------ATIMGVETLQTGVFGGIFIGAVAAIMYNRFYNIKLPEYLGFFAGKRFVPIVTGLSAIVVGAILAFAWPPVGQLLDAFSHWAAYQNPVLAWAVYGAGERSLLPVGLHHIWNAPFFF-EVGSYVD 212
>gi|153834062|ref|ZP_01986729.1| pts system, glucose-specific iibc component [Vibrio harveyi HY01] >gi|148869617|gb|EDL68607.1| pts system, glucose-specific iibc component [Vibrio harveyi HY01] (469 aa)
Score = 371, Expect = 4.3e-33, Identities = 102/264 (38%), Positives = 145/264 (54%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           L G Y+F + GLPAAA A+  AA  ENR   M I +SA  TS LTGITEPIE+ FLF++P L+  +HA +  LA+ L   +G+              G SFS G+ID++ +  I     +  W     GLAYA +Y+ +F + IK F+++TPGR            +++ +   +N +S         A  +VSA+GG  NI + DACIT+LRIQ+ +Q  VD AKL  LGA G ++     V A+FG  +D+ K  +   M N
  S:   241 LAGGYLFKMFGLPAAAIAIGRAAKPENRTKVMGIMISAALTSFLTGITEPIEFAFLFISPVLYV-IHAIIAGLAYPLCIMLGV------------KHGYSFSAGLIDYVTFFGIS----TKGWMIIPLGLAYAALYYVVFTWFIKTFDLKTPGR------------EDQDSSKAVNDTSSE------FASELVSAFGGKQNILSTDACITRLRIQVAEQDKVDEAKLKALGAAGVVRVG-TGVQAIFGGNSDVYKTQMVDWMNN 468
Score = 290, Expect = 9.6e-24, Identities = 77/237 (32%), Positives = 116/237 (48%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQ-ALGQAVGINSFIFGFIERALVPFGLHH 279
           ++K+ K LMLPIA +P AGI LG+GSA            V    +   G AVFG LPL+FA+ +AI+FT + G  A+A  IGY +  +    ++                                       V+G++ + + V GG + G + A+++N+F  IK+   + FF G RFVPIVT  ++  + I    IW  +G  + + G  A  Q   +  + +G  ERAL+PFGLHH
  S:     9 LSKVGKALMLPIASMPAAGILLGIGSAQFGFIP-----PVVSELMAEAGGAVFGNLPLIFALGVAISFTNNDGVGAVAAGIGYYVLVATLKVMA--------------------------------------GVLGVDHIDTGVLGGIISGAVGAYMFNRFYTIKMPAYLAFFAGKRFVPIVTSFSMLFLGIAIAFIWQPIGSGIDWFGTWATEQNPLVAFWAYGTAERALIPFGLHH 203
>gi|34496434|ref|NP_900649.1| protein-N p-phosphohistidine-sugar phosphotransferase [Chromobacterium violaceum ATCC 12472] >gi|34102287|gb|AAQ58653.1| protein-N p-phosphohistidine-sugar phosphotransferase [Chromobacterium violaceum ATCC 12472] (588 aa)
Score = 371, Expect = 4.4e-33, Identities = 101/282 (35%), Positives = 155/282 (54%)
  Q:   415 FKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKS 696
           F G      L G ++F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE++FLF+AP L+  +HA L A    + N + +            H+G +FS G ID++++  I  +   +A + FI G  YA IY+ +F F+I KFN++TPGR + +                   +S +++ DQ  A  +V A+GG  NI+++DACIT+LRI ++D + VD AKL  +GA G +      + A+FG  ++ +K +++  +    S   L S
  S:   243 FAGDPTAGILSGAFLFKMFGLPAAAIAIWHSAKPENRVKVGGIMISAALTSFLTGITEPIEFSFLFVAPVLYL-IHAVLAASTQFVANTLDM------------HMGFTFSQGGIDFLMFNLIGDK-SKHAGYVFILGPIYAAIYYSVFRFVIAKFNLKTPGREDESA-----------------ETSGAVSEDQ-RARALVLAFGGRSNIRSLDACITRLRIAVQDTAKVDQAKLKSMGASGVVVVG-SGIQAIFGPLSENLKTDMEIYLRGAGSDAELPS 491
Score = 341, Expect = 1.1e-29, Identities = 83/246 (33%), Positives = 133/246 (54%)
  Q:    42 FIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQ-ALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           F+ K+ K LMLP+A+LP+AG+ LG+G+        N       + ++  G+ +FG LPL+FA+ +A+ FT + G AA+A  IG+L+            T T G + G         I G+    A  P      ++G+  +Q+ VFGG + G L A+++N+F  IKL   +GFF G RFVPI+T +    + ++   +WP +G  +    Q A        + ++GF+ER L+PFGLHH +  P ++
  S:     8 FLQKIGKALMLPVAVLPVAGLLLGIGATDFHTQ--NTVFLAILSLMKNSGDVIFGNLPLIFAVGVALGFTENDGVAAIAAVIGHLV-----------TTVTLGVMAG---------ILGV----ATTP------IMGLPSIQTGVFGGILAGGLAAYMFNRFYRIKLPEYLGFFAGKRFVPIITAVGAIGLGVVLSFVWPPIGNGIKSFSQWAAVSDPRTAATVYGFVERMLIPFGLHHIWNVPFFF 222
>gi|110802112|ref|YP_697431.1| PTS system, N-acetylglucosamine-specific IIBC component [Clostridium perfringens SM101] >gi|110682613|gb|ABG85983.1| PTS system, N-acetylglucosamine-specific IIBC component [Clostridium perfringens SM101] (481 aa)
Score = 371, Expect = 4.5e-33, Identities = 96/290 (33%), Positives = 153/290 (52%)
  Q:   396 TWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++++  SGQ A G I          G Y  G Y  M+ GLPAA  AM + A K+N+ +   + +S   T+++TGITEPIE+ F+FL+P L+  +HA L  ++  +   + +            H+  SFSGG+ID+I+Y       G N     + GL    +Y+FLF F IKKFN++TPGR ++     ++   N +   ++  +          A  V+ A GG +NI+ +D CIT+LR+ +KD S +D   L + GA G +K   ++V  + G  AD +   +K L+
  S:   209 SFTDPVSGQIATGDIARFLAGDPTAGVYTAGFYPIMMFGLPAACLAMYVCAKKKNKAVVGGMFLSLALTAIITGITEPIEFAFMFLSPILYV-IHAILTGISLAVAYALNV------------HLAFSFSGGLIDYILY----FGKGQNQLIILLMGLVAFVVYYFLFMFFIKKFNLKTPGREDDFDDENEDVENNSKTVPKLEDNPSKGGTLAEKAEVVLVALGGKENIEVLDNCITRLRLTLKDASKIDEVTLKKAGASGIMKLDGKNVQVIMGTLADPLASQMKKLL 481
Score = 168, Expect = 1.5e-09, Identities = 38/108 (35%), Positives = 52/108 (48%)
  Q:   198 FLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQD 305
            LYNKFK+IK+   +GFF G RFVPI+T      + + F   WP     L      +     I + I+G + R L+P GLHH   + +W+ Q G   D     I   D
  S:   116 LLYNKFKDIKVPQFLGFFGGKRFVPIITSAVCLILGVFFGYTWPTFQAGLDGFANIMVAVGAIGAGIYGILNRLLIPIGLHHVMNTVIWF-QLGSFTDPVSGQIATGD 222
>gi|156975592|ref|YP_001446499.1| PTS system, glucose-specific IIBC component [Vibrio harveyi ATCC BAA-1116] >gi|156527186|gb|ABU72272.1| hypothetical protein VIBHAR_03324 [Vibrio harveyi ATCC BAA-1116] (469 aa)
Score = 370, Expect = 4.7e-33, Identities = 102/264 (38%), Positives = 145/264 (54%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           L G Y+F + GLPAAA A+  AA  ENR   M I +SA  TS LTGITEPIE+ FLF++P L+  +HA +  LA+ L   +G+              G SFS G+ID++ +  I     +  W     GLAYA +Y+ +F + IK F+++TPGR            +++ +   +N +S         A  +VSA+GG  NI + DACIT+LRIQ+ +Q  VD AKL  LGA G ++     V A+FG  +D+ K  +   M N
  S:   241 LAGGYLFKMFGLPAAAIAIGRAAKPENRTKVMGIMISAALTSFLTGITEPIEFAFLFISPVLYV-IHAIIAGLAYPLCIMLGV------------KHGYSFSAGLIDYVTFFGIS----TKGWMIIPLGLAYAALYYVVFTWFIKTFDLKTPGR------------EDQDSSKAVNDTSSE------FASELVSAFGGKQNILSTDACITRLRIQVAEQDKVDEAKLKALGAAGVVRVG-TGVQAIFGGNSDVYKTQMVDWMNN 468
Score = 290, Expect = 1.1e-23, Identities = 77/237 (32%), Positives = 116/237 (48%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQ-ALGQAVGINSFIFGFIERALVPFGLHH 279
           ++K+ K LMLPIA +P AGI LG+GSA            V    +   G AVFG LPL+FA+ +AI+FT + G  A+A  IGY +  +    ++                                       V+G++ + + V GG + G + A+++N+F  IK+   + FF G RFVPIVT  ++  + I    IW  +G  + + G  A  Q   +  + +G  ERAL+PFGLHH
  S:     9 LSKVGKALMLPIASMPAAGILLGIGSAQFGFIPP-----VVSELMAEAGGAVFGNLPLIFALGVAISFTNNDGVGAVAAGIGYYVLVATLKVMA--------------------------------------GVLGVDHIDTGVLGGIISGAVGAYMFNRFYTIKMPAYLAFFAGKRFVPIVTSFSMMFLGIAIAFIWQPIGSGIDWFGTWATEQNPLVAFWAYGTAERALIPFGLHH 203
>gi|37525284|ref|NP_928628.1| PTS system, N-acetylglucosamine-specific IIABC component (EIIABC-NAG) (N-acetylglucosamine-permease IIABC component) (phosphotransferase enzyme II, ABC component) (EII-NAG) [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36784711|emb|CAE13611.1| PTS system, N-acetylglucosamine-specific IIABC component (EIIABC-NAG) (N-acetylglucosamine-permease IIABC component) (Phosphotransferase enzyme II, ABC component) (EII-NAG) [Photorhabdus luminescens subsp. laumondii TTO1] (504 aa)
Score = 370, Expect = 4.7e-33, Identities = 97/278 (34%), Positives = 149/278 (53%)
  Q:   419 NVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGR--GENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMENISSSPNLKS 696
           + G Y+   Y   + GLP AA AM +AAPKE R     + +S   T+ LTGITEPIE++FLFLAP L+  +HA L  ++  ++N +G++             G  FS G+ID ++   +     +  W        +  +YF  F  +I+ FN++TPGR  GE T+                  +S S +N+ +   + ++A GG  NI  VDACIT+LR+ ++D + +D  +L QLGA+G +K   QSV  V G +A+ I G I+T +   S  P+ +S
  S:   263 HAGIYMAWAYPIFMGGLPGAALAMYLAAPKERRPQIGGMLLSVALTAFLTGITEPIEFSFLFLAPALYV-LHAILAGVSMVIVNSLGILH------------GFGFSAGLIDLVLSWGL----ATKPWLLIPLIALFFVLYFVCFTLMIRIFNLRTPGREIGETTQ-----------------ATSASQDNETIQ--HYITALGGAQNIHAVDACITRLRLTVEDNTQLDEHRLKQLGAKGILKIGKQSVQVVLGPQAESIAGQIRTQLS--SDRPDKRS 504
Score = 219, Expect = 1.5e-15, Identities = 71/247 (28%), Positives = 107/247 (43%)
  Q:    42 FIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGD-AGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYT 288
           ++ +L K LMLPIA LP+A + L  G   V N            F+   G  +F  LPLLFA+ IAI    D AG AALA  +G+L+        + SV D+T                                      +  S F G + G +    YN+F N +L   + FF G R VPI+T +    +  +   +WP V   +      + ++     F +G + R+L+PFGLH+  +S  W++
  S:     6 YLQRLGKALMLPIATLPVAALLLRFGQPDVFNI----------PFIASAGGGIFENLPLLFALGIAIGLAKDNAGAAALAGVVGFLVLTK-----ATSVIDST--------------------------------------INMSFFAGIIAGIVAGHCYNRFSNTRLPEFLAFFAGKRLVPIMTGIICLFIAWICGYVWPYVQHGIDTFSLLVSKSGMAGWFTYGVLNRSLIPFGLHYILHSVFWFS 200
>gi|153825191|ref|ZP_01977858.1| pts system, glucose-specific iibc component [Vibrio cholerae MZO-2] >gi|149741170|gb|EDM55221.1| pts system, glucose-specific iibc component [Vibrio cholerae MZO-2] (480 aa)
Score = 370, Expect = 4.9e-33, Identities = 100/271 (36%), Positives = 142/271 (52%)
  Q:   415 FKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           F G     YL G +++ +  LPAAA A+   A  E +K+   + MSA  TS LTGITEPIE+TFLF+AP L+  +H  L  +AF +  ++ +  S              F+ G I + +Y  +     SNAW  FI G  +A +Y+ LF  LI K N++TPGR       T     N+                  +A++VV+A GG  NIK VDACIT+LR+ ++D   VD  KL QLGAR  I     ++ A+FG ++D IK  I  ++
  S:   243 FAGDKTAGYLSGGFMYSMWALPAAALAIYHCASPERKKIVGGLMMSAALTSWLTGITEPIEFTFLFVAPVLYV-IHIFLTGIAFAITAFLEIKHST------------DFAHGAIQFFLYYPMS----SNAWMFFIIGPIWALLYYGLFRLLIVKLNLKTPGRETEVTTVTLAGKPNE------------------IAVDVVAALGGKSNIKTVDACITRLRVSVRDIKHVDVVKLKQLGAREVIVIG-DNLQAIFGTQSDTIKSEIHGVL 477
Score = 270, Expect = 2.3e-21, Identities = 74/242 (30%), Positives = 117/242 (48%)
  Q:    46 LSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFT-GDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQ-ALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWY 287
           + + LMLP+A+LP+AG+  G+G     NAG           +   G  +FG + L+FA+ +A+  + G+ G A LA  +G ++  +                             G+  G   L +     ++G+  LQ+ VFGG +VG + A +YN+F  I+L   +GFF G RFVPIVT L    +  +    WP +G  L      A  Q   +   I+G  ER+L+P GLHH + +P ++
  S:    12 IGRSLMLPVAVLPVAGLMFGIG-----NAGLPFIPAELSKVMLAAGEGIFGNMQLMFAVGVALGLSKGNDGAAGLAGLVGLIMMNA---------------------------ALGIVTGLRGLETD--ATIMGVATLQTGVFGGIIVGAVAAMMYNRFYAIRLPEYLGFFAGKRFVPIVTGLVSIVIGAVLAFAWPPIGNLLDIFSHWAAYQNPVLAWGIYGAGERSLLPVGLHHIWNAPFFF 221
>gi|168215171|ref|ZP_02640796.1| PTS system, N-acetylglucosamine-specific IIBC component [Clostridium perfringens CPE str. F4969] >gi|168218316|ref|ZP_02643941.1| PTS system, N-acetylglucosamine-specific IIBC component [Clostridium perfringens NCTC 8239] >gi|182627062|ref|ZP_02954786.1| PTS system, N-acetylglucosamine-specific IIBC component [Clostridium perfringens D str. JGS1721] >gi|170713416|gb|EDT25598.1| PTS system, N-acetylglucosamine-specific IIBC component [Clostridium perfringens CPE str. F4969] >gi|177907573|gb|EDT70215.1| PTS system, N-acetylglucosamine-specific IIBC component [Clostridium perfringens D str. JGS1721] >gi|182379676|gb|EDT77155.1| PTS system, N-acetylglucosamine-specific IIBC component [Clostridium perfringens NCTC 8239] (481 aa)
Score = 370, Expect = 5.8e-33, Identities = 98/290 (33%), Positives = 157/290 (54%)
  Q:   396 TWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALN---VVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++++  SGQ A G I          G Y  G Y  M+ GLPAA  AM + A K+N+ +   + +S   T+++TGITEPIE+ F+FL+P L+  +HA L  ++  +   + +            H+  SFSGG+ID+I+Y       G N     + GL    +Y+FLF F IKKFN++TPGR ++     ++   N +    ++ S ++ +    LA     V+ A GG +NI+ +D CIT+LR+ +KD S +D   L + GA G +K   ++V  + G  AD +   +K L+
  S:   209 SFTDPVSGQIATGDIARFLAGDPTAGVYTAGFYPIMMFGLPAACLAMYVCAKKKNKAVVGGMFLSLALTAIITGITEPIEFAFMFLSPILYV-IHAILTGISLAVAYALNV------------HLAFSFSGGLIDYILY----FGKGQNQLIILLMGLVAFVVYYFLFMFFIKKFNLKTPGREDDFDDENEDAETNSKT---VSKSEDNPSKGGTLAEKAEVVLEALGGKENIEVLDNCITRLRLTLKDASKIDEVTLKKAGASGIMKLDGKNVQVIMGTLADPLASQMKKLL 481
Score = 172, Expect = 5.0e-10, Identities = 39/108 (36%), Positives = 53/108 (49%)
  Q:   198 FLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQD 305
            LYNKFK+IK+   +GFF G RFVPI+T      + + F   WP     L      +  A  I + I+G + R L+P GLHH   + +W+ Q G   D     I   D
  S:   116 LLYNKFKDIKVPQFLGFFGGKRFVPIITSAVCLILGVFFGYTWPTFQAGLDGFANIMVAAGAIGAGIYGILNRLLIPIGLHHVMNTVIWF-QLGSFTDPVSGQIATGD 222
>gi|148988732|ref|ZP_01820165.1| PTS system, IIBC component [Streptococcus pneumoniae SP6-BS73] >gi|147925933|gb|EDK77008.1| PTS system, IIBC component [Streptococcus pneumoniae SP6-BS73] (288 aa)
Score = 370, Expect = 5.8e-33, Identities = 87/264 (32%), Positives = 151/264 (57%)
  Q:   422 QYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++  G++  M+ GLPAA  AM  + PK  RK    +      TS +TGITEPIE+ FLF++P L+  VHA L  ++F + + + +             IG +FSGG+ID+ ++G +Q    +N      FGL ++ +Y+ +F + I +FN+ TPGRG        E+  +K+     + +S + +  +  +L ++ A GG +NI++VDAC+T+LR+ +K+ + VD A L Q+GA   ++     + A++GA+A + K +I  ++
  S:    43 RFFAGRFSTMMFGLPAACLAMYHSVPKNRRKKYAGLFFGVALTSFITGITEPIEFMFLFVSPVLYV-VHAFLDGVSFFIADVLNI------------SIGNTFSGGVIDFTLFGILQGNAKTNWVLQIPFGLIWSVLYYIIFRWFITQFNVLTPGRG--------EEVDSKEISESADSTSNTADYLKQDSLQIIRALGGSNNIEDVDACVTRLRVAVKEVNQVDKALLKQIGAVDVLEVK-GGIQAIYGAKAILYKNSINEIL 284
>gi|110799623|ref|YP_694536.1| PTS system, N-acetylglucosamine-specific IIBC component [Clostridium perfringens ATCC 13124] >gi|168212018|ref|ZP_02637643.1| PTS system, N-acetylglucosamine-specific IIBC component [Clostridium perfringens B str. ATCC 3626] >gi|110674270|gb|ABG83257.1| PTS system, N-acetylglucosamine-specific IIBC component [Clostridium perfringens ATCC 13124] >gi|170710056|gb|EDT22238.1| PTS system, N-acetylglucosamine-specific IIBC component [Clostridium perfringens B str. ATCC 3626] (481 aa)
Score = 370, Expect = 5.8e-33, Identities = 98/290 (33%), Positives = 157/290 (54%)
  Q:   396 TWSNLTSGQQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALN---VVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           ++++  SGQ A G I          G Y  G Y  M+ GLPAA  AM + A K+N+ +   + +S   T+++TGITEPIE+ F+FL+P L+  +HA L  ++  +   + +            H+  SFSGG+ID+I+Y       G N     + GL    +Y+FLF F IKKFN++TPGR ++     ++   N +    ++ S ++ +    LA     V+ A GG +NI+ +D CIT+LR+ +KD S +D   L + GA G +K   ++V  + G  AD +   +K L+
  S:   209 SFTDPVSGQIATGDIARFLAGDPTAGVYTAGFYPIMMFGLPAACLAMYVCAKKKNKAVVGGMFLSLALTAIITGITEPIEFAFMFLSPILYV-IHAILTGISLAVAYALNV------------HLAFSFSGGLIDYILY----FGKGQNQLIILLMGLVAFVVYYFLFMFFIKKFNLKTPGREDDFDDENEDTETNSKT---VSKSEDNPSKGGTLAEKAEVVLEALGGKENIEVLDNCITRLRLTLKDASKIDEVTLKKAGASGIMKLDGKNVQVIMGTLADPLASQMKKLL 481
Score = 172, Expect = 5.0e-10, Identities = 39/108 (36%), Positives = 53/108 (49%)
  Q:   198 FLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQD 305
            LYNKFK+IK+   +GFF G RFVPI+T      + + F   WP     L      +  A  I + I+G + R L+P GLHH   + +W+ Q G   D     I   D
  S:   116 LLYNKFKDIKVPQFLGFFGGKRFVPIITSAVCLILGVFFGYTWPTFQAGLDGFANIMVAAGAIGAGIYGILNRLLIPIGLHHVMNTVIWF-QLGSFTDPVSGQIATGD 222
>gi|90413266|ref|ZP_01221260.1| Putative PTS system, glucose-specific IIBC [Photobacterium profundum 3TCK] >gi|90325667|gb|EAS42130.1| Putative PTS system, glucose-specific IIBC [Photobacterium profundum 3TCK] (477 aa)
Score = 370, Expect = 5.8e-33, Identities = 104/278 (37%), Positives = 151/278 (54%)
  Q:   410 IGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSF-IFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           +  NGF     GQ L G Y+F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE++F+F+AP L+  +HA L   AF + N +G++             G SFS G ID+++  A      +   W F + GL YA IY+ +F  +I K +++TPGR         ED +  +  V   GS         +A  +V A+GG DNI N+DACIT+LR+ +     VD  +L +LGA G +  +   V A+FG ++D +K ++   + N
  S:   240 LAGNGF-----GQ-LAGGYMFKMFGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFSFMFVAPVLYV-IHAFLAGSAFVMTNMLGMVH------------GTSFSHGFIDFVVLSA-----NAQKLWLFPVMGLIYAAIYYVVFRVVIAKLDLKTPGR---------EDEEESEAVVVGAGSE--------MAKELVIAFGGKDNITNLDACITRLRVSVASVENVDQDRLKKLGAAGVVI-AGSGVQAIFGTKSDNLKSDMDEWIRN 476
Score = 284, Expect = 5.4e-23, Identities = 81/258 (31%), Positives = 131/258 (50%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIAL-TFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNA 300
           + K+ K LMLP+++LP+AGI LGVG+A  +         V    ++  G +VFG +PLLFA+ +A+ FT + G A LA  +GY I  +    ++                                       ++G+  +++ V GG +VG + A+ +N+F  I+L   +GFF G RFVPI+T      + I+  +IWP +G A+  F   A  Q   +   I+G +ER+L+PFGLHH +  P ++ +AG  ++    A
  S:     9 LQKVGKALMLPVSVLPVAGILLGVGAANFSWLPD-----VVSQIMEQAGGSVFGQMPLLFAVGVALGFTNNDGVAGLAAIVGYGIMAATLKVMAN--------------------------------------LMGLENIETGVLGGILVGGVAAWAFNRFFRIQLPEYLGFFAGKRFVPIMTGFCSIGLAIVLSIIWPPIGGAIGAFSDWAAHQNPTLAFGIYGVVERSLIPFGLHHVWNVPFFF-EAGSCVNAAGEA 223
>gi|134297016|ref|YP_001120751.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Burkholderia vietnamiensis G4] >gi|134140173|gb|ABO55916.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Burkholderia vietnamiensis G4] (591 aa)
Score = 370, Expect = 5.8e-33, Identities = 92/265 (34%), Positives = 138/265 (52%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWII-YGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLM 685
           G ++ G +  M+ GLPAA  AM+  APKE R +   +  S   TS LTG+TEPIE++F+FLAP L+  +HA L  L+  +   +G+             +G +FS G ID+++ YG       +  W +   G+AY   Y+ LF F I+KFN+ TPGR   +     E Y +        G+  +    Q      ++A GG  N+  VDAC T+LR+ + D   V   +L  +GARG +K    SV  + G EADII   ++ ++
  S:   230 GTFMAGFFPIMMFGLPAACLAMLHEAPKERRAMVGGLLFSMALTSFLTGVTEPIEFSFMFLAPVLYV-IHAVLTGLSLAICQILGV------------KLGFTFSAGAIDYVLNYG-----LSTKGWIAIPLGIAYGVAYYGLFRFFIRKFNMATPGREPASADAAAESYASGGFVAPAGGAVAAAPRAQ----RYIAALGGAGNLTVVDACTTRLRLSVVDPDKVSEPELKAIGARGVLKRGGNSVQVIIGPEADIIADEMRAVI 473
Score = 295, Expect = 2.5e-24, Identities = 90/258 (34%), Positives = 120/258 (46%)
  Q:    37 GNTKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYT------QAGGSI 294
           GN    I  L + LMLPIA+LP+AGI L +G   V N             +   G A+F  LPLLFAI +A+ F  D  G AALA  IGYLI    + A+ + +                                         +L   V  G + G +   LYN++K+IKL   + FF G RFVPI+T LA   + I+F  +W  +  A+   GQ L  A  I +F+FGF+ R L+  GLHH   S  W+        AGG I
  S:     3 GNPFLKIQGLGRALMLPIAVLPVAGILLRLGQPDVFNI----------KMIADAGGAIFDNLPLLFAIGVAVGFAKDNNGVAALAGAIGYLI----ETAIMKDIDP---------------------------------------KLNMGVLSGIIAGVVAGLLYNRYKDIKLPDYLAFFGGKRFVPIITGLACVVLGIVFGYVWQPIQHAIDAAGQWLTTAGAIGAFVFGFLNRLLLVTGLHHIINSLAWFVFGNFTPPAGGEI 214
>gi|156934909|ref|YP_001438825.1| hypothetical protein ESA_02758 [Enterobacter sakazakii ATCC BAA-894] >gi|156533163|gb|ABU77989.1| hypothetical protein ESA_02758 [Enterobacter sakazakii ATCC BAA-894] (499 aa)
Score = 370, Expect = 6.0e-33, Identities = 93/274 (33%), Positives = 148/274 (54%)
  Q:   404 QQALGTIGANGFKGVNVGQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAP--WLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWW--SFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADII 677
           ++ + +  +N ++  N G+++QG++  M+  LPAA  AM   A  +N+K+A  I  SA  T  LTGITEP+E+TF+F+AP  ++F  + A L  ++  L++                HI  SFS G+ID+I +G +    G    +  + I G+  A IY+F F F+I++F+++TPGR                  V +  S++    D  LA N+V   GG +NI +V ACIT+LR+++    +VD   L  LGARG +      +  +FGA A  I
  S:   248 EEGVKSFSSNTYQ--NAGKFMQGEFPLMLFALPAACLAMYHEASTKNKKIASGILFSAALTCFLTGITEPVEFTFIFVAPVLYVFNAIMAGLAYMSMYLLD---------------AHIAKSFSAGLIDYISFGILPSFNGYQTHYLNAVIVGIPMAIIYYFTFRFVIRRFDVKTPGR------------------VDVTASADD-KTDAELAGNIVGLLGGKENITSVGACITRLRLEVARPDLVDKDGLNGLGARGVVFVGDNGIQVIFGARAQFI 489
Score = 255, Expect = 1.3e-19, Identities = 68/206 (33%), Positives = 101/206 (49%)
  Q:    83 FGNFLQVP-----GNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQAL-GQAVGINSFIFGFIERALVPFGLHHAFYSPLWYT 288
           FG+   +P     G  +F  LPLLFAI  A+    ++G AAL+  +   I          ++T +T                G++   AA     Y  V+GI  LQ  VFGG + G L A+ YN+F  ++L   +GFF+G RFV I      F + +    +W  +   +  L   + G     ++FIFG +ERAL+P GLHH +Y   WY+
  S:    37 FGDKFHLPLMMNAGGVIFDNLPLLFAIGSAVGLASESGIAALSAAVSVFII---------NITISTQ--------------LGITPEMAA-SGGKYAMVVGIPTLQMGVFGGLISGILAAWCYNRFHTLQLPEFLGFFSGKRFVAIAAAFLSFLLGLALPYVWQHIQAGIDALSVIVNGDNQAASTFIFGLVERALIPLGLHHIWYPSFWYS 224
>gi|187251754|ref|YP_001876236.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Elusimicrobium minutum Pei191] >gi|186971914|gb|ACC98899.1| PTS system, N-acetylglucosamine-specific IIBC subunit [Elusimicrobium minutum Pei191] (481 aa)
Score = 370, Expect = 6.0e-33, Identities = 92/262 (35%), Positives = 144/262 (54%)
  Q:   421 GQYLQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWII-YGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIK 682
           G ++ G +  M+ GLPAA  AM++ A    RK    I +S   TS LTGITEPIE++F+FLA +  + +HA L  ++  +M+ + +             +G +FS G  D+++ +G       +N    FI G  YA +YF +FYF IK ++++TPGR E+  + ++E  +  QN   +  +  S           ++A GG +N+K VDAC T+LR+++ D S V    L  LGARG ++P    V  + G EAD+I G I+
  S:   235 GSFMAGFFPVMMFGLPAACFAMMLTAKTAKRKATAGILLSMALTSFLTGITEPIEFSFMFLA-FPLYVLHALLTGISMVVMDLMNI------------KLGFTFSAGAFDFVLNWGK-----ATNPARFFIVGGVYAVLYFVVFYFAIKFWDLKTPGR-EDDVVESEETCEPGQNSKAVEAAPTSAPARDTRGYKYMTALGGKENLKVVDACATRLRLEVVDSSKVKDVDLKALGARGVLRPGDGLVQVIIGPEADLIAGEIR 478
Score = 300, Expect = 7.9e-25, Identities = 84/266 (31%), Positives = 126/266 (47%)
  Q:    39 TKEFIAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDA-GPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAAL-PSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSFIFGFIERALVPFGLHHAFYSPLWYTQAGGSIDLTQNAIIYQ 304
           TK F+  L K LMLPIA+LPIAG+ L +G   + N            FL   G+A+F  LP +FA+ ++I F  D  G A L+ ++GY++                                 L+AG   L P +  G           VFGG ++G +  + YN+F +I+L   + FF G RFVPI+T  +   + +   +IWP V  A+  LG  +  + G+  FIFGF  R L+P GLHH   + +W+      +      ++YQ
  S:     9 TKAFVT-LGKALMLPIAVLPIAGLLLRLGQPDLLNIA----------FLADSGDAIFKNLPTIFALGVSIGFAKDNHGAAPLSAYVGYVV---------------------------------LTAGLKVLNPETNMG-----------VFGGIIIGVMAGYFYNRFHDIQLPSYLAFFGGKRFVPIITGTSAVFLALAASVIWPPVEHAINSLGTWIIGSKGVGLFIFGFANRLLIPLGLHHVLNNLVWFLFGNFEVVKEGAVVLYQ 221
>gi|187732536|ref|YP_001880729.1| PTS system, glucose-specific IIBC component [Shigella boydii CDC 3083-94] >gi|187429528|gb|ACD08802.1| PTS system, glucose-specific IIBC component [Shigella boydii CDC 3083-94] (477 aa)
Score = 369, Expect = 6.3e-33, Identities = 103/264 (39%), Positives = 148/264 (56%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSF-IFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           L G ++F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE+ F+F+AP L+  +HA L  LAF +   +G+              G SFS G+ID+I+         S+  W F I G+ YA +Y+ +F  LIK  +++TPGR + T     ED K         G+SE       +A  +V+A+GG +NI N+DACIT+LR+ + D S VD A L +LGA G +  +   V A+FG ++D +K  +   + N
  S:   250 LSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFFFMFVAPILYI-IHAILAGLAFPICILLGM------------RDGTSFSHGLIDFIVLSG-----NSSKLWLFPIVGIGYAIVYYTIFRVLIKALDLKTPGREDAT-----EDAK-------ATGTSE-------MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVV-AGSGVQAIFGTKSDNLKTEMDEYIRN 476
Score = 315, Expect = 1.2e-26, Identities = 88/252 (34%), Positives = 129/252 (51%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSF-IFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+++LPIAGI LGVGSA  +         V  + +   G +VF  +PL+FAI +A+ FT + G +ALA  + Y             +   T AV+   +L               LP+     +   +   + V GG + G + A+++N+F  IKL   +GFF G RFVPI++ LA     ++   IWP +G A+    Q       + +F I+GFIER LVPFGLHH +  P       YT A G +
  S:     9 LQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPA-----VVSHVMAEAGGSVFANMPLIFAIGVALGFTNNDGVSALAAVVAY------------GIMVKTMAVVAPLVLH--------------LPAE---EIASKHLADTGVLGGIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLAAIFTGVVLSFIWPPIGSAIQTFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTNAAGQV 232
>gi|24112507|ref|NP_707017.1| glucose-specific PTS system IIBC components [Shigella flexneri 2a str. 301] >gi|30062635|ref|NP_836806.1| glucose-specific PTS system IIBC components [Shigella flexneri 2a str. 2457T] >gi|24051396|gb|AAN42724.1| glucose-specific IIBC component [Shigella flexneri 2a str. 301] >gi|30040881|gb|AAP16612.1| glucose-specific IIBC component [Shigella flexneri 2a str. 2457T] (477 aa)
Score = 369, Expect = 6.6e-33, Identities = 102/264 (38%), Positives = 146/264 (55%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           L G ++F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE+ F+F+AP L+  +HA L  LAF +   +G+              G SFS G+ID+I+         S  W   I G+ YA +Y+ +F  LIK  +++TPGR + T     ED K         G+SE       +A  +V+A+GG +NI N+DACIT+LR+ + D S VD A L +LGA G +  +   V A+FG ++D +K  +   + N
  S:   250 LSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFFFMFVAPILYI-IHAILAGLAFPICILLGM------------RDGTSFSHGLIDFIVLSG----NSSKLWLLPIVGIGYAIVYYTIFRVLIKALDLKTPGREDAT-----EDAK-------ATGTSE-------MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVV-AGSGVQAIFGTKSDNLKTEMDEYIRN 476
Score = 315, Expect = 1.2e-26, Identities = 88/252 (34%), Positives = 129/252 (51%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQLQSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSF-IFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+++LPIAGI LGVGSA  +         V  + +   G +VF  +PL+FAI +A+ FT + G +ALA  + Y             +   T AV+   +L               LP+     +   +   + V GG + G + A+++N+F  IKL   +GFF G RFVPI++ LA     ++   IWP +G A+    Q       + +F I+GFIER LVPFGLHH +  P       YT A G +
  S:     9 LQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPA-----VVSHVMAEAGGSVFANMPLIFAIGVALGFTNNDGVSALAAVVAY------------GIMVKTMAVVAPLVLH--------------LPAE---EIASKHLADTGVLGGIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLAAIFTGVVLSFIWPPIGSAIQTFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTNAAGQV 232
>gi|110805115|ref|YP_688635.1| glucose-specific PTS system IIBC components [Shigella flexneri 5 str. 8401] >gi|110614663|gb|ABF03330.1| PTS system, glucose-specific IIBC component [Shigella flexneri 5 str. 8401] (477 aa)
Score = 369, Expect = 6.8e-33, Identities = 102/264 (38%), Positives = 146/264 (55%)
  Q:   424 LQGKYVFMILGLPAAAAAMVMAAPKENRKLAMSICMSAGFTSLLTGITEPIEYTFLFLAPWLFWGVHASLCALAFGLMNWIGLIVSATGHPELAPHIGMSFSGGMIDWIIYGAIQIQYGSNAWWSFIFGLAYAPIYFFLFYFLIKKFNIQTPGRGENTRLFTKEDYKNKQNKVQINGSSESLNNDQVLALNVVSAYGGFDNIKNVDACITKLRIQIKDQSVVDTAKLMQLGARGTIKPSPQSVYAVFGAEADIIKGNIKTLMEN 687
           L G ++F + GLPAAA A+  +A  ENR     I +SA  TS LTGITEPIE+ F+F+AP L+  +HA L  LAF +   +G+              G SFS G+ID+I+         S  W   I G+ YA +Y+ +F  LIK  +++TPGR + T     ED K         G+SE       +A  +V+A+GG +NI N+DACIT+LR+ + D S VD A L +LGA G +  +   V A+FG ++D +K  +   + N
  S:   250 LSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFFFMFVAPILYI-IHAILAGLAFPICILLGM------------RDGTSFSHGLIDFIVLSG----NSSKLWLLPIVGIGYAIVYYTIFRVLIKALDLKTPGREDAT-----EDAK-------ATGTSE-------MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVV-AGSGVQAIFGTKSDNLKTEMDEYIRN 476
Score = 318, Expect = 6.3e-27, Identities = 90/252 (35%), Positives = 128/252 (50%)
  Q:    43 IAKLSKGLMLPIAMLPIAGIFLGVGSAIVTNAGGNEGLRVFGNFLQVPGNAVFGALPLLFAIAIAIAFTGDAGPAALACFIGYLIFGSLQDALSQSVTDTTGAVIGYNLLFYQGNIFGLSAGNAALPSSLYGAVIGINQL-QSSVFGGFVVGFLVAFLYNKFKNIKLHPIIGFFNGVRFVPIVTFLALFPVTILFLMIWPLVGIALTFLGQALGQAVGINSF-IFGFIERALVPFGLHHAFYSPLW-----YTQAGGSI 294
           + K+ K LMLP+++LPIAGI LGVGSA  +         V  + +   G +VF  +PL+FAI +A+ FT + G +ALA                        AV+ Y ++     +F      A L   L    I    L  + V GG + G + A+++N+F  IKL   +GFF G