>gi|26553590|ref|NP_757524.1| hypothetical protein MYPE1370 [Mycoplasma penetrans HF-2] >gi|26453596|dbj|BAC43928.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (349 aa)
Score = 1488, Expect = 4.0e-163, Identities = 348/349 (99%), Positives = 349/349 (100%)
  Q:     1 LNMKKIFNQKNSLNVFDLWRKTQIKVSYIHKQILLGKKKDATDLLEKHELIFSKIGIDTESNWIFEKTIFVALIKYLMDSNIFFDKRLKDSEIDELLLLAYVYEWIVLDKPKDTTLLGNRSQVLKKFKEAANESNSAFKNIFEGIDIYSLDDWQEIVKRINDTTIMTYSEILEFIKKDGSVYKKIIDESFNEKDFNDKQQCLENWNKLFLVNWNNLNYVYSIEDSDSNIIYVSVETDKEKVAIVKYKMFYTYTKENNILIASGISKELLRIDFIKPEYKNNYGDIISQSLKIANRAIKNIFLLDLQLKNDEYYNADNTVKHKKIVNIIKSIPKTDDSTIVGNKRKWILK 349
           +NMKKIFNQKNSLNVFDLWRKTQIKVSYIHKQILLGKKKDATDLLEKHELIFSKIGIDTESNWIFEKTIFVALIKYLMDSNIFFDKRLKDSEIDELLLLAYVYEWIVLDKPKDTTLLGNRSQVLKKFKEAANESNSAFKNIFEGIDIYSLDDWQEIVKRINDTTIMTYSEILEFIKKDGSVYKKIIDESFNEKDFNDKQQCLENWNKLFLVNWNNLNYVYSIEDSDSNIIYVSVETDKEKVAIVKYKMFYTYTKENNILIASGISKELLRIDFIKPEYKNNYGDIISQSLKIANRAIKNIFLLDLQLKNDEYYNADNTVKHKKIVNIIKSIPKTDDSTIVGNKRKWILK
  S:     1 MNMKKIFNQKNSLNVFDLWRKTQIKVSYIHKQILLGKKKDATDLLEKHELIFSKIGIDTESNWIFEKTIFVALIKYLMDSNIFFDKRLKDSEIDELLLLAYVYEWIVLDKPKDTTLLGNRSQVLKKFKEAANESNSAFKNIFEGIDIYSLDDWQEIVKRINDTTIMTYSEILEFIKKDGSVYKKIIDESFNEKDFNDKQQCLENWNKLFLVNWNNLNYVYSIEDSDSNIIYVSVETDKEKVAIVKYKMFYTYTKENNILIASGISKELLRIDFIKPEYKNNYGDIISQSLKIANRAIKNIFLLDLQLKNDEYYNADNTVKHKKIVNIIKSIPKTDDSTIVGNKRKWILK 349
>gi|187029996|emb|CAP30905.1| Hypothetical protein CBG11810 [Caenorhabditis briggsae] (295 aa)
Score = 89, Expect = 5.7e-01, Identities = 32/129 (24%), Positives = 64/129 (49%)
  Q:    87 RLKDSEIDELLLLAYVYEWIVLDKPKDTTLLGNRSQVLKKFKEAANESNSAFKNIFEGIDIYSLDDWQEIVKRINDTTIMTYSEILEFIKKDGSVYKKIIDESFNEKDF------NDKQQCLENWNKLFLVNWNN 215
           +LK+SEI E+  +  + E  +LD P D   L +  ++     +   E  S   +  E +DI++L+D +EI ++             E IKK  +   ++++ +  EK++        +QQ  E+  K+ ++ W +
  S:    85 KLKNSEIVEMKRINAILENEILDLPTDGNRLESPRRLDSTKVKEVTEEQSRLVSWLENMDIHALEDMEEIFRKT------------ESIKKQKATLDELVNATETEKNWLQAQLTKQRQQWNEDKLKMRMLKWKS 207