>gi|26553591|ref|NP_757525.1| hypothetical protein MYPE1380 [Mycoplasma penetrans HF-2] >gi|26453597|dbj|BAC43929.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (503 aa)
Score = 2125, Expect = 0.0e+00, Identities = 503/503 (100%), Positives = 503/503 (100%)
  Q:     1 MKKMSKFRKGLLAIIGGLTVAGAGIGVTLPLVTSNNNHENSLNNSSSNNGSNLKVNGSVISTDNLNIVATGLSSNVSSQVSRQSLSSSSSSESTVDSKYTAKKKLTTVSGQEKEYLVSTVYENNRKFMPILAYDEDISYNNYQQSREYKDVVYGNFPGWDKKVAVVHQIDNVDLSKAYASVAEFTPTEILKNPSAPESVKQLYVALDSKTMTADVITKLVDRYQPDYLRIESVDDTSIKQLPDMKYFSTVKKVDLGGAFTTIKGVSFPTTTQELKISSDNIKSIDPLQIPESAAIITETVHDARFTEIDLSSHTDLTTDQLQKAVNIVYKDRIKERAFQGNFAGGYIYSWNLQNTGITSFNDVSIPKLNDGTDRFYIAYVAVSSGNSNGTANETITGGKEPSNDSQIGEWWDSSSDGWSKVSKVTVTAKNGASLDYNKTLTEIMGFLAKYPNVKTIDISLLKFEDASKTLDGLKTELTNQIKSKYGEDSSYAKIDFIITSQSN 503
           MKKMSKFRKGLLAIIGGLTVAGAGIGVTLPLVTSNNNHENSLNNSSSNNGSNLKVNGSVISTDNLNIVATGLSSNVSSQVSRQSLSSSSSSESTVDSKYTAKKKLTTVSGQEKEYLVSTVYENNRKFMPILAYDEDISYNNYQQSREYKDVVYGNFPGWDKKVAVVHQIDNVDLSKAYASVAEFTPTEILKNPSAPESVKQLYVALDSKTMTADVITKLVDRYQPDYLRIESVDDTSIKQLPDMKYFSTVKKVDLGGAFTTIKGVSFPTTTQELKISSDNIKSIDPLQIPESAAIITETVHDARFTEIDLSSHTDLTTDQLQKAVNIVYKDRIKERAFQGNFAGGYIYSWNLQNTGITSFNDVSIPKLNDGTDRFYIAYVAVSSGNSNGTANETITGGKEPSNDSQIGEWWDSSSDGWSKVSKVTVTAKNGASLDYNKTLTEIMGFLAKYPNVKTIDISLLKFEDASKTLDGLKTELTNQIKSKYGEDSSYAKIDFIITSQSN
  S:     1 MKKMSKFRKGLLAIIGGLTVAGAGIGVTLPLVTSNNNHENSLNNSSSNNGSNLKVNGSVISTDNLNIVATGLSSNVSSQVSRQSLSSSSSSESTVDSKYTAKKKLTTVSGQEKEYLVSTVYENNRKFMPILAYDEDISYNNYQQSREYKDVVYGNFPGWDKKVAVVHQIDNVDLSKAYASVAEFTPTEILKNPSAPESVKQLYVALDSKTMTADVITKLVDRYQPDYLRIESVDDTSIKQLPDMKYFSTVKKVDLGGAFTTIKGVSFPTTTQELKISSDNIKSIDPLQIPESAAIITETVHDARFTEIDLSSHTDLTTDQLQKAVNIVYKDRIKERAFQGNFAGGYIYSWNLQNTGITSFNDVSIPKLNDGTDRFYIAYVAVSSGNSNGTANETITGGKEPSNDSQIGEWWDSSSDGWSKVSKVTVTAKNGASLDYNKTLTEIMGFLAKYPNVKTIDISLLKFEDASKTLDGLKTELTNQIKSKYGEDSSYAKIDFIITSQSN 503
>gi|31544448|ref|NP_853026.1| hypothetical protein MGA_1071 [Mycoplasma gallisepticum R] >gi|31541293|gb|AAP56594.1| unique hypothetical protein [Mycoplasma gallisepticum R] (512 aa)
Score = 206, Expect = 2.5e-14, Identities = 78/267 (29%), Positives = 129/267 (48%)
  Q:   112 EKEYLVSTVYENNRKFMPILAYDEDISYNNYQQSREYKDVVYGNFPGWDKKVAVVHQIDNVDLSKAYASVAEFTPTEIL--KNPSAPESVKQLYVALDSKTMTADVITKLVDRYQPDYLRIESVDDTSIKQLPDMKYFSTVKKVDLGGAFTTIKGVSFPTT-TQELKISSDNIKSIDPLQIPESAAIITETVHDARFTEIDLSSHTDLTTDQLQKAVNIVYKDRIKERAFQGNFAGGYIYSWNLQNTGITSFNDVSIPKLNDGTDRFYIA 378
           + +Y  S  Y N+R +MPIL  D    Y   +  R   D+   N+ GW   +AV H   N     +  SV  +  T+ L  K  + P+ +    +++D       +I + +  Y PD++ + + D  ++KQL    + S+VKK+ +          S   +  QEL++ + N+   +PL +     +I +  +  RF  I+L     LT  Q   A+  V+  R  ERA QG+F GGYI S  L +TGITS N++ I  +N   D + ++
  S:   146 DNKYYQSPYYYNDRVYMPIL--DSPTIY--LKNERTSSDIGLNNYQGW---IAVGHARVN-----SRVSVFNYRATDELLAKFNNLPDRLI-FTMSIDLYQANPAMINETLKEYSPDFVILSNADSKTMKQL---VFPSSVKKLTIKSNILDRFNFSLVNSEIQELELYTPNLTEYNPLALNPKTHLIFDADYSTRFLSINLYG-AQLTNQQALAALEDVFVHRYYERALQGSFVGGYISSLVLSDTGITSLNNLVIKNINPNYDSYTMS 398
>gi|12045137|ref|NP_072948.1| hypothetical protein MG_281 [Mycoplasma genitalium G37] >gi|1351532|sp|P47523|Y281_MYCGE Uncharacterized protein MG281 >gi|1045977|gb|AAC71503.1| conserved hypothetical protein [Mycoplasma genitalium G37] >gi|166078873|gb|ABY79491.1| conserved hypothetical protein [synthetic Mycoplasma genitalium JCVI-1.0] (556 aa)
Score = 160, Expect = 5.5e-09, Identities = 78/248 (31%), Positives = 116/248 (46%)
  Q:   115 YLVSTVYENNRKFMPILAYDEDISYNNYQQSREYKDVV--YGNFPGW-DKKVAVVHQIDNVDLSKAYASVAEFTPTEILKNPSAPESVKQLYVALDSKTMTADVITKLVDRYQPDYLRIESVDDTSIKQLPDMKYFSTVKKVDLGGAFTTIK-GVSFPTTTQELKI---SSDNIKSIDPLQIPESAAIITETVHDARFTEIDL-------SSHTDLTTDQLQKAVNIVYKDRIKERAFQGNFAGGYIYSWNLQNTGITSFND 362
           Y  ST Y NNR  MPIL         N   +R Y DV     +F GW + K   V   +N+   K     A+ +P          E VK L  A+D+K ++A  +   +D  +P YL I  +      QL +++   +VKKV L G +T +           EL+    S  N    +PL +     +I +      FT IDL       S ++ +  ++L++AV  +Y  R  ER FQG FAGGYI  + ++N      +D
  S:   157 YYQSTEYFNNRVLMPILQTTNGTLMAN---NRGYDDVFRQVPSFSGWSNTKATTVSTSNNLTYDKWTYFAAKGSPLYDSYPNHFFEDVKTL--AIDAKDISA--LKTTIDSEKPTYLIIRGLSGNG-SQLNELQLPESVKKVSLYGDYTGVNVAKQIFANVVELEFYSTSKANSFGFNPLVLGSKTNVIYDLFASKPFTHIDLTQVTLQNSDNSAIDANKLKQAVGDIYNYRRFERQFQGYFAGGYIDKYLVKNVNTNKDSD 410
>gi|13508139|ref|NP_110088.1| hypothetical protein MPN400 [Mycoplasma pneumoniae M129] >gi|2496363|sp|P75383|Y400_MYCPN Uncharacterized protein MG281 homolog >gi|1674125|gb|AAB96086.1| conserved hypothetical protein [Mycoplasma pneumoniae M129] (582 aa)
Score = 141, Expect = 1.1e-06, Identities = 81/261 (31%), Positives = 123/261 (47%)
  Q:   110 GQEKEYLVSTVYENNRKFMPIL-AYDEDISYNNYQQSREYKDVVYGNFPGW----DKKVAVVHQIDNVDLSKAYAS-VAEFTPTEILKNPSAPESVKQL-YVALDS---KTMTADVITKLVDRYQPDYLRIESVDDTSIKQLPDMKYFSTVKKVDLGGAFTTIK-GVSFPTTTQELKISS---DNIKSIDPLQIPESAAIITETVHDARFTEIDLSS------HTDLTTDQLQKAVNIVYKDRIKERAFQGNFAGGYIYSWNLQNTGITSFNDVSIPKLND 370
           G+  +Y  ST Y NNR  MPIL   +  ++ NN      + D     FPGW    DK         +  L K +   VA  +P   L N       KQ+  +A D+   K    D I   + +  PDY+ I  +       L D++   +VKKV + G + +I           EL+  S   DN    +PL + +   II +      F  IDL+S        ++   +L++AV+ +Y  R  ER  QG +AGGYI  + ++NT     N+ ++ K ND
  S:   157 GKTLKYYQSTEYFNNRVVMPILQTTNGTLTANNRAYDDIFVDQGVPKFPGWFHDVDKAYYAGSNGQSEYLFKEWNYYVANGSP---LYNVYPNHHFKQIKTIAFDAPRIKQGNTDGINLNLKQRNPDYVIINGLTGDG-STLKDLELPESVKKVSIYGDYHSINVAKQIFKNVLELEFYSTNQDNNFGFNPLVLGDHTNIIYDLFASKPFNYIDLTSLELKDNQDNIDASKLKRAVSDIYIRRRFERQMQGYWAGGYIDRYLVKNT-----NEKNVNKDND 428
>gi|66879914|ref|ZP_00404903.1| hypothetical protein MgenG_01000753 [Mycoplasma genitalium G-37] (276 aa)
Score = 101, Expect = 4.3e-02, Identities = 39/119 (32%), Positives = 60/119 (50%)
  Q:   244 MKYFSTVKKVDLGGAFTTIK-GVSFPTTTQELKI---SSDNIKSIDPLQIPESAAIITETVHDARFTEIDL-------SSHTDLTTDQLQKAVNIVYKDRIKERAFQGNFAGGYIYSWNLQNTGITSFND 362
           M+   +VKKV L G +T +           EL+    S  N    +PL +     +I +      FT IDL       S ++ +  ++L++AV  +Y  R  ER FQG FAGGYI  + ++N      +D
  S:     1 MQLPESVKKVSLYGDYTGVNVAKQIFANVVELEFYSTSKANSFGFNPLVLGSKTNVIYDLFASKPFTHIDLTQVTLQNSDNSAIDANKLKQAVGDIYNYRRFERQFQGYFAGGYIDKYLVKNVNTNKDSD 130
>gi|150866200|ref|XP_001385710.2| hypothetical protein PICST_90468 [Pichia stipitis CBS 6054] >gi|149387456|gb|ABN67681.2| predicted protein [Pichia stipitis CBS 6054] (523 aa)
Score = 96, Expect = 1.7e-01, Identities = 18/72 (25%), Positives = 41/72 (56%)
  Q:   225 PDYLRIESVDDTSIKQLPDMKYFSTVKKVDLGGAFTTIKGVSFPTTTQELKISSDNIKSIDPLQIPESAAII 296
           P+ LR   V +   + +  +K+   ++ ++L  + TT +G+  P+  + L ++ + + SI+PL++P S  I+
  S:   280 PETLRYLEVSNIPNESMTGVKFPDNLEVLNLQSSMTTTRGLKLPSNVKTLILTGNGVNSINPLKLPNSVEIL 351