>gi|26553592|ref|NP_757526.1| thioredoxin reductase [Mycoplasma penetrans HF-2] >gi|26453598|dbj|BAC43930.1| thioredoxin reductase [Mycoplasma penetrans HF-2] (322 aa)
Score = 1467, Expect = 8.7e-161, Identities = 322/322 (100%), Positives = 322/322 (100%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISKNKKDW 322
           MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISKNKKDW
  S:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISKNKKDW 322
>gi|31544534|ref|NP_853112.1| hypothetical protein MGA_1221 [Mycoplasma gallisepticum R] >gi|31541379|gb|AAP56680.1| TrxB [Mycoplasma gallisepticum R] (328 aa)
Score = 431, Expect = 1.1e-40, Identities = 118/312 (37%), Positives = 189/312 (60%)
  Q:     5 LRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTIN---EQELFLFETNKNSFY-AKKIILASGNGSFNPRKLE---INNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKE-KGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHIS 316
           + IYD+ ++G G  GI+ ++      L+S++IE    +GGQP  +YP K IYDFP    I + D + +L QQ K        L T + N T Q  N   +Q+LF  + + N    AKKIILA+GNG F P KL+   I ++ +D   IHY +N  T+ Y+NK +  LGGGDSAVE  N   + KI  +++IIHR ++YR++  ++D ++K  I Q L+ + I+  + NK ++ K  ++ +   L FDY++VQYG +    ++E  + + ++    +VI+ + +T+  NIYAIG A++F  +PN I++   EA  A+ HI+
  S:     1 MNIYDLIVLGAGTSGIYCASYGAMKGLSSLVIEMTDRIGGQPAHVYPFKKIYDFPTANGILAKDFVDQLYQQQKPYITQG--LITYLHNTTIQEQNYLDDQQLFELKLSDNQHVKAKKIILATGNGGFEPIKLKDELIQDQNLDC--IHYKINDLTQ-YQNKDLCFLGGGDSAVELINQLADLKIAKSLSIIHRNHKYRAAQALVDLINKKPINQYLD-QTIELIKDNK-ISFKDNQSGESTQLNFDYLIVQYG-LKPLKSLECFDHLEQDLNNNFVINHHHQTSDPNIYAIGLASNFSKRPNLILSGMYEATVAIKHIN 312
>gi|110004535|emb|CAK98872.1| putative thioredoxine reductase transmembrane protein [Spiroplasma citri] (328 aa)
Score = 413, Expect = 1.5e-38, Identities = 107/309 (34%), Positives = 171/309 (55%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKN----------SNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEI--ID-FNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           D+ I+G G  G++A + +    L+  +IE     GGQP ELYP K +YD P F EIK+   I+ LI+Q ++             SN+   TD   IT  T NE           +   K I++ SGNG F P +LE  +   +   + Y++   T +  +KKI++LGGGDSAV+WAN+ +E+ I+ +V IIHRR+ YR+    +  L +N + +   Y +  +D  N     LT+ H+ T    T+P D+ +VQYG   +P  ++ L        K +I+   +TN  +I+A G+  ++  K   ++T   EA+ AL++I+K
  S:     3 DILIIGAGPVGLYAWSCAGMLGLSGYIIEGNDTPGGQPWELYPEKPLYDMPGFEEIKTKTFIENLIKQAEKNTGKITYIGKTNISNVLETTDGFTITLIT-NE-----------TLTVKTILITSGNGVFTPIRLEHLDPHQEYENLWYAVKNPT-LLTHKKIVILGGGDSAVDWANHLIEDNISKDVTIIHRRSLYRAKESNVQKLQQNKVTELKPYHVKAVDTINNKITALTLVHETTHATLTIPADHFIVQYGAKVAPTMLQQLTLTATPMRKIIIEPTGQTNHPHIFAAGNTAYYAGKYYNMVTGFGEAINALYNITK 311
>gi|29377363|ref|NP_816517.1| pyridine nucleotide-disulfide family oxidoreductase [Enterococcus faecalis V583] >gi|29344830|gb|AAO82587.1| oxidoreductase, pyridine nucleotide-disulfide family [Enterococcus faecalis V583] (336 aa)
Score = 411, Expect = 2.5e-38, Identities = 102/312 (32%), Positives = 175/312 (56%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT-IKHKETEKEQT--LPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M+++  IYD+ I+GGG  G+FA+  +      + +I+    LGGQ   LYP K+IYD P F  IK+ ++I  L +Q +  ++ ++ L+ ++ ++  +      L   +T K + Y+K +I A GNG+F PR+L I N E  +   IHY +  + + +  KK+ + GGGDSA++WA   + E +   V+IIHRR ++R     ++ L K+++  +  Y I D  + N+T T I+  ET+ +QT  LP D +++ YG  SS  +++    ++  +    +  +  TNI  +YA+GD   +  K   I T   EA  A+
  S:     1 MSDEKDIYDLTIIGGGPVGLFAAFYAGIRKAKTKIIDSLPQLGGQLTMLYPEKYIYDIPGFPAIKAGELIANLEKQMQPFQH-DVCLEEEVTHLAQEA---DGLLRLDTTKGTHYSKTVIFAIGNGAFQPRRLAIENVEAFEGESIHYYVT-DMKKFAGKKVAIAGGGDSAIDWA--LMLENVAEEVSIIHRRPQFRGHEHSVEQLEKSSVSIRTPYIISDILKENETFTGIQLTETKGDQTLDLPLDDLIINYGFTSSLTHLKEWG-LDVSRNAINVHSDMSTNIPGVYAVGDICSYEGKVKLIATGFGEAPTAV 308
>gi|47092975|ref|ZP_00230755.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes str. 4b H7858] >gi|153168472|ref|ZP_01928315.1| hypothetical protein LMHG_01336 [Listeria monocytogenes FSL N1-017] >gi|153203965|ref|ZP_01944831.1| hypotehtical protein [Listeria monocytogenes HPB2262] >gi|167015503|ref|ZP_02278036.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes FSL J1-194] >gi|167215109|ref|ZP_02285416.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes FSL R2-503] >gi|167454865|ref|ZP_02321088.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes FSL J2-064] >gi|168266647|ref|ZP_02688612.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes FSL J2-071] >gi|47018629|gb|EAL09382.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes str. 4b H7858] >gi|133726243|gb|EBA27941.1| hypothetical protein LMHG_01336 [Listeria monocytogenes FSL N1-017] >gi|133734377|gb|EBA36075.1| hypotehtical protein [Listeria monocytogenes HPB2262] (331 aa)
Score = 407, Expect = 6.5e-38, Identities = 106/312 (33%), Positives = 179/312 (57%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFE--TNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PIN---IELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M+E  +IYD+ I+GGG  G+FA+  +   N +  +IE    LGGQ   LYP K+IYD P +  +++ +++  LIQQ K   +  I L+  +     Q++ +Q    FE  T K++ Y+K +I+ +GNG+F PR+L++   E  +   IHY +N +   +  +++ V GGGDSAV+WA   + EK+ ++VAI+HRRN +R+    ++ L K++I  K  +   E++   +    +T++  + +  +TL  D  ++ YG +SS  PI    +EL      E+   V++   +T+I  IY  GD   +  K   I T   EA  A+
  S:     1 MDEKTKIYDITIIGGGPVGLFAAFYAGMRNASVKIIESLPQLGGQLSTLYPEKYIYDIPGYPAVRAQELVNNLIQQMKP-FDPTIALEEAV-----QSVEKQVDGTFEIITKKDTHYSKAVIITAGNGAFEPRRLDLPEAEQYEGKNIHYFIN-DLSRFSGRRVAVCGGGDSAVDWA--LMLEKVASSVAIVHRRNAFRAHEHSVNNLEKSSIAIKTPFIPTEVLGNGDKLTHITLQEVKGDTRETLEIDDFIINYGFVSSLGPIKNWGLEL------ERNSIVVNSKMETSIPGIYCAGDICTYDGKVKLIATGFGEAPTAV 308
>gi|46908564|ref|YP_014953.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes str. 4b F2365] >gi|46881836|gb|AAT05130.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes str. 4b F2365] (331 aa)
Score = 407, Expect = 6.5e-38, Identities = 106/312 (33%), Positives = 179/312 (57%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFE--TNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PIN---IELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M+E  +IYD+ I+GGG  G+FA+  +   N +  +IE    LGGQ   LYP K+IYD P +  +++ +++  LIQQ K   +  I L+  +     Q++ +Q    FE  T K++ Y+K +I+ +GNG+F PR+L++   E  +   IHY +N +   +  +++ V GGGDSAV+WA   + EK+ ++VAI+HRRN +R+    ++ L K++I  K  +   E++   +    +T++  + +  +TL  D  ++ YG +SS  PI    +EL      E+   V++   +T+I  IY  GD   +  K   I T   EA  A+
  S:     1 MDEKTKIYDITIIGGGPVGLFAAFYAGMRNASVKIIESLPQLGGQLSTLYPEKYIYDIPGYPAVRAQELVNNLIQQMKP-FDPTIALEEAV-----QSVEKQVDGTFEIITKKDTHYSKAVIITAGNGAFEPRRLDLPEAEQYEGKNIHYFIN-DLSRFSGRRVAVCGGGDSAVDWA--LMLEKVASSVAIVHRRNAFRAHEHSVNNLEKSSIAIKTPFIPTEVLGNGDKLTHITLQEVKGDTRETLEIDDFIINYGFVSSLGPIKNWGLEL------ERNSIVVNSKMETSIPGIYCAGDICTYDGKVKLIATGFGEAPTAI 308
>gi|153175622|ref|ZP_01930950.1| hypothetical protein LMIG_02793 [Listeria monocytogenes FSL N3-165] >gi|133729262|gb|EBA30960.1| hypothetical protein LMIG_02793 [Listeria monocytogenes FSL N3-165] (331 aa)
Score = 407, Expect = 8.2e-38, Identities = 106/312 (33%), Positives = 179/312 (57%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFE--TNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PIN---IELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M+E  +IYD+ I+GGG  G+FA+  +   N +  +IE    LGGQ   LYP K+IYD P +  +++ +++  LIQQ K   +  + L+  +     Q++ +Q    FE  T K++ Y+K II+ +GNG+F PR+L++   E  +   IHY +N +   +  +++ V GGGDSAV+WA   + EK+ ++VAI+HRRN +R+    ++ L K++I  K  +   E++   +    +T++  + +  +TL  D  ++ YG +SS  PI    +EL      E+   V++   +T+I  IY  GD   +  K   I T   EA  A+
  S:     1 MDEKTKIYDITIIGGGPVGLFAAFYAGMRNASVKIIESLPQLGGQLSTLYPEKYIYDIPGYPAVRAQELVNNLIQQMKP-FDPTVALEEAV-----QSVEKQVDGTFEIITKKDTHYSKAIIITAGNGAFEPRRLDLPEAEQYEGTNIHYFIN-DLSRFSGRRVAVCGGGDSAVDWA--LMLEKVASSVAIVHRRNAFRAHEHSVNNLEKSSIAIKTPFIPTEVLGNGDKLTHITLQEVKGDTTETLEIDDFIINYGFVSSLGPIKNWGLEL------ERNSIVVNSKMETSIPGIYCAGDICTYDGKVKLIATGFGEAPTAV 308
>gi|16804428|ref|NP_465913.1| hypothetical protein lmo2390 [Listeria monocytogenes EGD-e] >gi|47095869|ref|ZP_00233473.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes str. 1/2a F6854] >gi|153186633|ref|ZP_01936877.1| hypotehtical protein [Listeria monocytogenes J0161] >gi|153192028|ref|ZP_01939094.1| hypothetical protein LMPG_02895 [Listeria monocytogenes J2818] >gi|153198362|ref|ZP_01942439.1| hypothetical protein LMRG_02735 [Listeria monocytogenes 10403S] >gi|167213057|ref|ZP_02283364.1| hypothetical protein LmonL_21544 [Listeria monocytogenes LO28] >gi|167405222|ref|ZP_02309983.1| hypothetical protein LmonocytFSL_19801 [Listeria monocytogenes FSL J2-003] >gi|16411878|emb|CAD00468.1| lmo2390 [Listeria monocytogenes] >gi|47015746|gb|EAL06675.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes str. 1/2a F6854] >gi|126941011|gb|EBA18913.1| hypotehtical protein [Listeria monocytogenes J0161] >gi|127632036|gb|EBA21753.1| hypothetical protein LMRG_02735 [Listeria monocytogenes 10403S] >gi|127764568|gb|EBA25097.1| hypothetical protein LMPG_02895 [Listeria monocytogenes J2818] (331 aa)
Score = 407, Expect = 8.2e-38, Identities = 106/312 (33%), Positives = 179/312 (57%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFE--TNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PIN---IELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M+E  +IYD+ I+GGG  G+FA+  +   N +  +IE    LGGQ   LYP K+IYD P +  +++ +++  LIQQ K   +  + L+  +     Q++ +Q    FE  T K++ Y+K II+ +GNG+F PR+L++   E  +   IHY +N +   +  +++ V GGGDSAV+WA   + EK+ ++VAI+HRRN +R+    ++ L K++I  K  +   E++   +    +T++  + +  +TL  D  ++ YG +SS  PI    +EL      E+   V++   +T+I  IY  GD   +  K   I T   EA  A+
  S:     1 MDEKTKIYDITIIGGGPVGLFAAFYAGMRNASVKIIESLPQLGGQLSTLYPEKYIYDIPGYPSVRAQELVNNLIQQMKP-FDPTVALEEAV-----QSVEKQVDGTFEIITKKDTHYSKAIIITAGNGAFEPRRLDLPEAEQYEGTNIHYFIN-DLSRFSGRRVAVCGGGDSAVDWA--LMLEKVASSVAIVHRRNAFRAHEHSVNNLEKSSIAIKTPFIPTEVLGNGDKLTHITLQEVKGDTTETLEIDDFIINYGFVSSLGPIKNWGLEL------ERNSIVVNSKMETSIPGIYCAGDICTYDGKVKLIATGFGEAPTAV 308
>gi|15615970|ref|NP_244274.1| thioredoxin reductase [Bacillus halodurans C-125] >gi|10176031|dbj|BAB07127.1| thioredoxin reductase [Bacillus halodurans C-125] (330 aa)
Score = 406, Expect = 9.7e-38, Identities = 107/312 (34%), Positives = 169/312 (54%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKN--NILQKLNY-EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M+    +YD+ I+GGG  G+FA+           +IE    LGGQ   LYP K+IYD   F ++K+ D++  L +Q  EQ N  I L+  + N+T +T    + F  +T+K + Y+K II+ +G G+F PR+LE+   +  +   + Y +N +   Y  K +L+ GGGDSAV+WA   + E +  NV +IHRR+++R+    ++ L K+  NIL      E+    E    +TI+  + +  +TL  D V+V +G +SS   I+    +  EK   V++   +TNI  IYA GD   +  K   I T   EA  A+
  S:     1 MSRKEELYDITIIGGGPTGLFAAFYGGMRQAKVKIIESMPQLGGQLAALYPEKYIYDVAGFPKVKAQDLVNDLKRQ-AEQFNPTIALEQSVQNVTKET---DDTFTIKTDKETHYSKAIIITAGAGAFQPRRLEVEGAKQYEGKNLQYFVN-DLNAYAGKNVLISGGGDSAVDWA--LMLEPVAKNVTLIHRRDKFRAHEHSVELLQKSSVNILTPFAISELSGDGEKIHHVTIQEVKGDAVETLDVDEVIVNFGFVSSLGPIKGWG-LEIEKNSIVVNTKMETNIPGIYAAGDICTYPGKVKLIATGFGEAPTAV 308
>gi|16801551|ref|NP_471819.1| hypothetical protein lin2489 [Listeria innocua Clip11262] >gi|16415011|emb|CAC97716.1| lin2489 [Listeria innocua] (331 aa)
Score = 405, Expect = 1.2e-37, Identities = 105/312 (33%), Positives = 179/312 (57%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFE--TNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PIN---IELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M+E  +IYD+ I+GGG  G+FA+  +   N +  +IE    LGGQ   LYP K+IYD P +  +++ +++  LIQQ K   +  + L+  +     Q++ +Q    FE  T K++ Y+K II+ +GNG+F PR+L++   E  +   IHY +N +   +  +++ V GGGDSAV+WA   + EK+ ++V+I+HRRN +R+    ++ L K++I  K  +   E++   +    +T++  + +  +TL  D  ++ YG +SS  PI    +EL      E+   +++   +TNI  IY  GD   +  K   I T   EA  A+
  S:     1 MDEKTKIYDITIIGGGPVGLFAAFYAGMRNASVKIIESLPQLGGQLSTLYPEKYIYDIPGYPSVRAQELVNNLIQQMKP-FDPTVALEEAV-----QSVEKQVDGTFEIITKKDTHYSKAIIITAGNGAFEPRRLDLPEAEQYEGKNIHYFIN-DLSRFSGRRVAVCGGGDSAVDWA--LMLEKVASSVSIVHRRNAFRAHEHSVNNLEKSSIAIKTPFIPTEVLGNGDKLTHITLQEVKGDTTETLEIDDFIINYGFVSSLGPIKNWGLEL------ERNSIIVNSKMETNIPGIYCAGDICTYDGKVKLIATGFGEAPTAV 308
>gi|116873754|ref|YP_850535.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742632|emb|CAK21756.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (331 aa)
Score = 404, Expect = 1.8e-37, Identities = 102/312 (32%), Positives = 178/312 (57%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PIN---IELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M+E  +IYD+ I+GGG  G+FA+  +   N +  +IE    LGGQ   LYP K+IYD P +  +++ +++  LIQQ K   +  I L+  ++++  Q     E+    T K++ Y+K I++ +GNG+F PR+L++   E  +   IHY +N +   +  +++ V GGGDSAV+WA   + EK+ ++V+I+HRRN +R+    ++ L K++I  K  +   E++   +    +T++  + +  +TL  D  ++ YG +SS  PI    +EL      E+   +++   +T+I  IY  GD   +  K   I T   EA  A+
  S:     1 MDEKTKIYDITIIGGGPVGLFAAFYAGMRNASVKIIESLPQLGGQLSTLYPEKYIYDIPGYPAVRAQELVNNLIQQMKP-FDPTIALEEAVISVEKQVDGTFEII---TKKDTHYSKAIVITAGNGAFEPRRLDLPEAEQYEGKNIHYFIN-DLSRFSGRRVAVCGGGDSAVDWA--LMLEKVASSVSIVHRRNAFRAHEHSVNNLEKSSITIKTPFIPTEVLGNGDKLTHITLQEVKGDTSETLEIDDFIINYGFVSSLGPIKNWGLEL------ERNSIIVNSKMETSIPGIYCAGDICTYDGKVKLIATGFGEAPTAV 308
>gi|196250900|ref|ZP_03149585.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Geobacillus sp. G11MC16] >gi|196209629|gb|EDY04403.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Geobacillus sp. G11MC16] (330 aa)
Score = 394, Expect = 2.0e-36, Identities = 103/312 (33%), Positives = 174/312 (55%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M ED  +YDV ++GGG  G+FA+       +N  +IE    LGGQ   LYP K+IYD   F ++++    ++L+ Q KEQ +      T  LN + + + +QE   F   T+K   Y+K +I+ +GNG+F PR+LEI++    +   +HY ++ + + +  K++LV GGGDSAV+W+   + E I  +V I+HRR+++R+    ++ L  + +  K  Y   E+I   +  + + ++H +   ++T+  D V+V YG ISS   I+    ++ EK    ++   +TNI  +YA GD   +  K   I     EA  A+
  S:     1 MREDRNVYDVTVIGGGPTGMFAAFYGGLRQMNVKIIESLPQLGGQLAALYPEKYIYDIAGFPKVRA----QELVDQLKEQLSRFSP--TICLNQSVEMLEKQEDGTFKLTTDKEIHYSKTVIITAGNGAFQPRRLEIDSASQYEGKNLHYFIS-DLQQFAGKRVLVCGGGDSAVDWS--LMLEPIAASVTIVHRRDKFRAHEHSVEQLMNSRVQVKTPYVPAELIGDEQGIRQVVLEHVKEGAKETIDVDAVIVNYGFISSLGPIKNWG-LDIEKNSIKVNSRMETNIPGVYAAGDICTYDGKIKLIACGFGEAPIAI 308
>gi|149183075|ref|ZP_01861527.1| YumC [Bacillus sp. SG-1] >gi|148849204|gb|EDL63402.1| YumC [Bacillus sp. SG-1] (331 aa)
Score = 394, Expect = 2.3e-36, Identities = 98/312 (31%), Positives = 169/312 (54%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEIN-NEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M ED ++YD+ I+GGG  G+F +        +  +IE    LGGQ   LYP K+IYD   F ++K+ D++  L +Q   Q    + L+  + N+  Q      +F   T+K   Y+K II+ +GNG+F PR+LE+  +   +   +HY ++ + + +  KK+++ GGGDSAV+WA   + E I   V ++HRR+++R+    +D L ++++  K  +   E+I   E    L ++    E ++ L  D ++V +G +SS   I+    +  +K   V++   +TNI  IYA GD + +  K   I +   EA  A+
  S:     1 MKEDQKVYDITIIGGGPTGLFTAFYGGMRKASVKIIESLPQLGGQLSTLYPEKYIYDVAGFPKVKAQDLVNNLKEQ-MAQFEQTVCLEQAVENVEKQA---DGVFKLTTDKEVHYSKTIIITAGNGAFQPRRLELEGSSTYEGKNLHYFID-DMQYFAGKKVVICGGGDSAVDWA--LMLEPIAEKVTLVHRRDKFRAHEHSVDQLHQSSVEIKTPFVPTEVIGNGEKVSQLVLEEVRGEAKEALELDELIVNFGFVSSLGPIKDWG-LEIQKNSIVVNSKMETNIPGIYAAGDVSTYEGKVKLIASGFGEAPTAV 308
>gi|56421489|ref|YP_148807.1| thioredoxin reductase [Geobacillus kaustophilus HTA426] >gi|56381331|dbj|BAD77239.1| thioredoxin reductase [Geobacillus kaustophilus HTA426] (332 aa)
Score = 391, Expect = 5.9e-36, Identities = 103/312 (33%), Positives = 174/312 (55%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           + ED  +YDV I+GGG  G+FA+       +   +IE    LGGQ   LYP K+IYD   F ++++    ++L+ Q KEQ   ++   T  LN +  T+ +QE   F   TN+   Y+K +I+ +GNG+F PR+LEI +    +   +HY +N +   +  K++LV GGGDSAV+W+   + E I  +V I+HRR+++R+    ++ L K+++  K  +   E++    + + + ++H +   ++T+  D V+V YG ISS   I+    ++ EK    ++   +TNI  +YA GD   +  K   I     EA  A+
  S:     3 VKEDRNVYDVTIIGGGPTGMFAAFYGGLRQMKVKIIESLPQLGGQLAALYPEKYIYDVAGFPKVRA----QELVNQLKEQM--DLFSPTVCLNESVDTLEKQEDGTFKLVTNQQIHYSKTVIITAGNGAFQPRRLEIESASRYEGKNLHYFIN-DLGQFSGKRVLVCGGGDSAVDWS--LMLEPIAQSVTIVHRRDKFRAHEHSVEQLKKSSVQVKTPFVPVELVGDEHAIRQVILEHVKEGTKETIDVDAVIVNYGFISSLGPIKNWG-LDIEKNAIKVNSRMETNIPGVYAAGDICTYDGKIKLIACGFGEAPIAI 310
>gi|56964689|ref|YP_176420.1| thioredoxin reductase [Bacillus clausii KSM-K16] >gi|56910932|dbj|BAD65459.1| thioredoxin reductase [Bacillus clausii KSM-K16] (330 aa)
Score = 390, Expect = 6.4e-36, Identities = 99/312 (31%), Positives = 167/312 (53%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPI-DSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFN-ESNKTLTIKHKETEKEQ--TLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQK--TNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M E   ++D+ I+GGG  G+FA+  +    +   +IE    LGGQ   LYP+K+IYD   F ++K+ D++ +L  Q  +Q    I L+  +  +  Q   E E F+  T+ N  Y K +++ +G G+F PRKL++      +   IHY +  +   +  K+++V+GGGDSAV+WA   + E I   V ++HRR+ +R+    +D L K+++     YE  + + + N    +   E + +Q  T+  D V+V +G +S+   +  + +   E  K  I +N K  TNI  +YA GD + +  K   I T   EA  A+
  S:     1 MQEQKDMFDLTIIGGGPAGLFAAFYAGMRKMKVKVIESMPQLGGQLSALYPDKYIYDVAGFPKVKAQDLVDQLTAQ-AQQFQPEIVLEEAVQTLEKQ---EDETFVLTTDANIHYTKAVLITAGAGAFAPRKLQVEKADFYEDKNIHYFIR-DLSAFTGKRVVVIGGGDSAVDWA--LMLEPIAKEVTLVHRRDAFRAHEHSVDLLKKSSVRILTPYETAELHGDENGVTAVTFSEVKGDQTETIAVDDVIVNFGFVST---LGPIKEWGLEIRKNAIPVNTKMETNIPGVYAAGDVSTYDGKIKLIATGFGEAPTAV 308
>gi|138896542|ref|YP_001126995.1| thioredoxin reductase-like protein [Geobacillus thermodenitrificans NG80-2] >gi|134268055|gb|ABO68250.1| thioredoxin reductase-like protein [Geobacillus thermodenitrificans NG80-2] (332 aa)
Score = 389, Expect = 7.8e-36, Identities = 102/312 (32%), Positives = 174/312 (55%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           + ED  +YDV ++GGG  G+FA+       +N  +IE    LGGQ   LYP K+IYD   F ++++    ++L+ Q KEQ +      T  LN + + + +QE   F   T+K   Y+K +I+ +GNG+F PR+LEI++    +   +HY ++ + + +  K++LV GGGDSAV+W+   + E I  +V I+HRR+++R+    ++ L  + +  K  Y   E+I   +  + + ++H +   ++T+  D V+V YG ISS   I+    ++ EK    ++   +TNI  +YA GD   +  K   I     EA  A+
  S:     3 VREDRNVYDVTVIGGGPTGMFAAFYGGLRQMNVKIIESLPQLGGQLAALYPEKYIYDIAGFPKVRA----QELVDQLKEQLSRFSP--TICLNQSVEMLEKQEDGTFKLTTDKEIHYSKTVIITAGNGAFQPRRLEIDSASQYEGKNLHYFIS-DLQQFAGKRVLVCGGGDSAVDWS--LMLEPIAASVTIVHRRDKFRAHEHSVEQLMNSRVQVKTPYVPAELIGDEQGIRQVVLEHVKEGAKETIDVDAVIVNYGFISSLGPIKNWG-LDIEKNSIKVNSRMETNIPGVYAAGDICTYDGKIKLIACGFGEAPIAI 310
>gi|171778255|ref|ZP_02919461.1| hypothetical protein STRINF_00303 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282955|gb|EDT48379.1| hypothetical protein STRINF_00303 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (333 aa)
Score = 386, Expect = 2.0e-35, Identities = 98/312 (31%), Positives = 174/312 (55%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSN-IQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP--IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNI---LQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M+E+  IYD+ I+GGG  G+FA+  +    ++  +IE  S LGGQP  LYP K IYD   F  I ++D+ + LI+Q    K+S  I L  ++         + ++F  ETNK   +++ I++A GNG+F PR L +  E    D+   +    L+   +  K +++ GGGDSAV+WAN+   + +  +V I+HRR+ +R+    ++ L + N+      + +E+    +  K+LT++  ++++   LP D ++V +G  +S  N++  N ++ ++    +    +T+   +YAIGDA  +  K + I T   EA  A+
  S:     1 MSENREIYDITIIGGGPVGLFAAFYAGLRGVSVKIIESLSELGGQPAVLYPEKMIYDVAGFPGITAADLTENLIKQLDRFKDSTAICLKEEVKTFE----KDGDIFTIETNKGQHFSRAIVIACGNGAFAPRTLGLEGEEAYADNNLFYNVHKLDQ--FAGKDVVICGGGDSAVDWANHL--DGLAKSVTIVHRRDAFRAHEHSVEVLKELNVNILTPYMPFELSGDGQFVKSLTVQKVKSDETIELPLDALIVSFGFSTSNKNLKNWN-VDYKRSSIAVSPLFETSQAGVYAIGDAADYEGKVDLIATGFGEAPTAI 309
>gi|172058321|ref|YP_001814781.1| thioredoxin-disulfide reductase [Exiguobacterium sibiricum 255-15] >gi|171990842|gb|ACB61764.1| Thioredoxin-disulfide reductase [Exiguobacterium sibiricum 255-15] (331 aa)
Score = 385, Expect = 2.5e-35, Identities = 98/301 (32%), Positives = 168/301 (55%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQK--TNIKNIYAIGDATHFYCKPNTIITACAEA 308
           YDV I+GGG  G+F +  S    + + +IE    LGGQ   LYP K+IYD   F ++K+ D++ +L++Q  E   + +  +T    + ++ +++  L    TNK   Y K +IL +GNGSF  R L + + E  +   +HY +N E + +K++++++LGGGDSAV+W+   + E I  +V ++HRR+++R+    ++ L  S  N++     E +   +S +TLT KH ET++   +  D V+  +G +SS   +  L +   E  +  I +N K  T I  ++A GD   +  +   I T   EA
  S:     5 YDVTIIGGGPVGLFTAFYSGMRQMKTKVIESLPQLGGQLATLYPEKYIYDIAGFPKVKAQDLVDRLLEQANEFDPTYVLGET---VLAYERLDDG-LIRLVTNKGEHYTKTVILTAGNGSFAARPLGVADAERFEGSNLHYFVN-EMDRFKDRQVVLLGGGDSAVDWS--LMLEPIAKSVTLVHRRDKFRAHEHTVELLHNSSVNVMTPYTLESVTGEDSIETLTFKHAETDEVIVVGADDVVCNFGFVSS---LGPLKEWEVEFERNSIRVNSKMETAIPGVFACGDIATYDGRVKLIATGFGEA 300
>gi|171325437|ref|ZP_02913941.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Geobacillus sp. WCH70] >gi|171088575|gb|EDT34922.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Geobacillus sp. WCH70] (330 aa)
Score = 384, Expect = 3.2e-35, Identities = 101/312 (32%), Positives = 168/312 (53%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M ED +IYDV I+GGG  G+FA+       ++  +IE    LGGQ   LYP K+IYD   F ++++ ++I  L +Q  E+ +  + LD  +  +      E   F   TNK   Y+K +++ +GNG+F PR+LE+ N    +   ++Y +N +   +K +K+LV GGGDSAV+W+   + E I   V I+HRR+++R+    ++ L  + +  K  +   E+I   +  + + I+H +    +T+  D ++V YG ISS   I+    +  EK    ++   +TNI  +YA GD   +  K   I     EA  A+
  S:     1 MKEDQKIYDVTIIGGGPVGLFAAFYGGLRQMSVKIIESLPQLGGQLSALYPEKYIYDVAGFPKVRAQELIDHLKEQ-MEKFSPTVCLDQSVEMLEKL---EDGTFKLTTNKEIHYSKTVVITAGNGAFQPRRLELENATQYEGKNLYYFIN-DLNQFKGQKVLVCGGGDSAVDWS--LMLEPIAEKVTIVHRRDKFRAHEHSVETLMNSTVNVKTPFVPVELIGDEDGIRQVVIEHVKDGSRETIEIDALIVNYGFISSLGPIKNWG-LEIEKNSIKVNSKMETNIPGVYAAGDICTYEGKIKLIACGFGEAPIAI 308
>gi|89100539|ref|ZP_01173399.1| YumC [Bacillus sp. NRRL B-14911] >gi|89084726|gb|EAR63867.1| YumC [Bacillus sp. NRRL B-14911] (355 aa)
Score = 379, Expect = 1.5e-34, Identities = 100/312 (32%), Positives = 169/312 (54%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           + ED  IYD+ I+GGG  G+F +        +  +IE    LGGQ   LYP K+IYD   F ++++ +++  L +Q K+ + + + L+  +  +  Q      +F   TN    Y K +I+ +GNG+F PR+LE+++ P  +   +HY ++ +   +  KK++V GGGDSAV+WA   + E I  NV IIHRR+++R+    ++ L  + +  K  +   E+I   E    + I+  + E+++ +  D V+V YG +SS   I+    +  EK   V++   +TNI  IYA GD   +  K   I +   EA  A+
  S:    24 VKEDQTIYDITIIGGGPVGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKVRAQELVDNLKEQMKKFEPT-VSLEQSVEKLEKQP---DGIFKLTTNSEIHYTKTVIITAGNGAFQPRRLELDSAPQYEGKNLHYFID-DLNHFSGKKVVVFGGGDSAVDWA--LMLEPIAENVKIIHRRDKFRAHEHSVENLHNSKVEIKTPFVPAELIGNEEGISQVIIQDAKGEEKEAIDVDAVIVNYGFVSSLGPIKEWG-LEIEKNNIVVNSKMETNIPGIYAAGDICTYDGKVKLIASGFGEAPTAV 331
>gi|194015275|ref|ZP_03053891.1| ferredoxin--NAD [Bacillus pumilus ATCC 7061] >gi|194012679|gb|EDW22245.1| ferredoxin--NAD [Bacillus pumilus ATCC 7061] (332 aa)
Score = 377, Expect = 2.0e-34, Identities = 104/312 (33%), Positives = 170/312 (54%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNSFYAKKIILASGNGSFNPRKLEIN-NEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M ED ++YD+ ++GGG  G+F +        +  +IE    LGGQ   LYP K+IYD   F +I++ ++I  L    KEQ +   Q  T  L    +T+ +Q   +F   TN+   Y+K II+ +GNG+F PRKLE++  E  +   +HY +N +   +  +++ VLGGGDSAV+WA   + E I   V+IIHRR+++R+    ++ L  SK N++       +   +  + + ++  + +K+Q L  D V+V +G +SS   I+    +  EK   V+    +TNI+  YA GD   +  K   I +   EA  A+
  S:     1 MQEDSKVYDITVIGGGPVGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKIRAQELIDNL----KEQMDKFDQ--TICLEQAVETVEKQADGIFKLVTNQEVHYSKTIIITAGNGAFQPRKLELDAAESFEGSNLHYFIN-DLNQFAGRRVAVLGGGDSAVDWA--LMLEPIAKEVSIIHRRDKFRAHEHSVENLHNSKVNVVTPFVPTELIGEDRIEQIVLEEVKGDKKQVLDVDDVIVNFGFVSSLGPIKQWG-LEIEKNSIVVKSTMETNIEGFYAAGDICTYEGKVKLIASGFGEAPTAV 307
>gi|124521462|ref|ZP_01696393.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Bacillus coagulans 36D1] >gi|124496789|gb|EAY44369.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Bacillus coagulans 36D1] (331 aa)
Score = 377, Expect = 2.0e-34, Identities = 97/312 (31%), Positives = 171/312 (54%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTI-----NEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M ED  +YD+ ++GGG  G+F +  +    ++  +IE    LGGQ   LYP K+IYD   F ++K++D++ +L     E++ S  Q     +  T Q+      NE  +F   T+K   ++K +I+ +G G+F PR+LE+ N    +   + Y +N + + +  K + +LGGGDSAV+WA   + E +   V +IHRR+++R+    ++ L ++ +  K  +   E++   E+   L I+  + + ++ L  D ++  YG ISS  +I+    +  +K   V++   +TNI  +YA GD   F  K   I+T   EA  A+
  S:     1 MKEDQTVYDITVIGGGPTGLFTAFYAGLRKMSVKIIESLPQLGGQLAALYPEKYIYDVAGFPKVKAADLVNQL-----EEQASMFQ----PVICTGQSAEMLEKNEDGIFTLTTDKEIHHSKAVIITAGVGAFQPRRLEVENAAQYEGKNLFYFVN-DMDQFAGKSVAILGGGDSAVDWA--LMLEPVAEKVTLIHRRDKFRAHERTVEQLKQSRVEIKTPFVASEVMGDGENISRLMIEEVKGDAKEALDIDAIICNYGFISSLGSIKNWG-LEIQKNSIVVNSKMETNIPGVYAAGDVCTFEGKVKLIVTGFGEATTAV 308
>gi|116492169|ref|YP_803904.1| thioredoxin reductase [Pediococcus pentosaceus ATCC 25745] >gi|116102319|gb|ABJ67462.1| Thioredoxin reductase [Pediococcus pentosaceus ATCC 25745] (328 aa)
Score = 377, Expect = 2.3e-34, Identities = 100/309 (32%), Positives = 169/309 (54%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKE--TEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHI 315
           +YD+ I+GGG  G+FA   +      + +IE     GGQ   LYP K IYD   +  IK++++ K+L +Q +    + I+L+  +++I  Q     + +  +TN+N +  + I+LA+GNG+FNPRKL +   + ++   I+Y +  + E ++N+ ILV GGGDSA++ A   + E I  +++++HRR ++R     +  L ++ +     Y I    E+ + + +  KE  TE  +   FD ++V YG  SS   I+     + +E   + +D    TN+KNIYAIGD   +  K   I TA  E   A+  I
  S:     4 MYDITIIGGGPAGLFAGFYAGMRTAKTQIIESLPQAGGQVAALYPEKMIYDVGGYAGIKAANLAKELEKQTR-LVGTEIRLNETVVDIQAQA----DFYHVKTNRNEYDTRAILLATGNGAFNPRKLAVEGLDHLEDKKIYYHMP-DVEHFENQDILVAGGGDSAIDIA--LMLEPIAKSISLVHRRQQFRGMERNVQHLQESTVKVMTPYLINGVREAVEGIDVDLKEIGTEALKATHFDKLIVNYGFTSSNKIIKGWEIDLTQEHRMFAVDSLMHTNMKNIYAIGDGVEYPGKLRLIATAFGEGPIAVNQI 308
>gi|157693626|ref|YP_001488088.1| ferredoxin--NAD(+) reductase [Bacillus pumilus SAFR-032] >gi|157682384|gb|ABV63528.1| ferredoxin--NAD(+) reductase [Bacillus pumilus SAFR-032] (332 aa)
Score = 375, Expect = 3.7e-34, Identities = 103/312 (33%), Positives = 170/312 (54%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNSFYAKKIILASGNGSFNPRKLEIN-NEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M ED ++YD+ ++GGG  G+F +        +  +IE    LGGQ   LYP K+IYD   F +I++ +++  L    KEQ +   Q  T  L    +T+ +Q   +F   TN+   Y+K II+ +GNG+F PRKLE++  E  +   +HY +N +   +  +++ VLGGGDSAV+WA   + E I   V+IIHRR+++R+    ++ L  SK N++       +   +  + + ++  + +K+Q L  D V+V +G +SS   I+    +  EK   V+    +TNI+  YA GD   +  K   I +   EA  A+
  S:     1 MQEDSKVYDITVIGGGPVGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKIRAQELVDNL----KEQMDKFDQ--TICLEQAVETVEKQADGIFKLVTNQEIHYSKTIIITAGNGAFQPRKLELDAAESFEGSNLHYFIN-DLNQFAGRRVAVLGGGDSAVDWA--LMLEPIAKEVSIIHRRDKFRAHEHSVENLHNSKVNVVTPFVPTELIGEDRIEQIVLEEVKGDKKQVLDVDDVIVNFGFVSSLGPIKQWG-LEIEKNSIVVKSTMETNIEGFYAAGDICTYEGKVKLIASGFGEAPTAV 307
>gi|24379323|ref|NP_721278.1| putative thioredoxin reductase [Streptococcus mutans UA159] >gi|24377246|gb|AAN58584.1|AE014928_5 putative thioredoxin reductase [Streptococcus mutans UA159] >gi|93277284|tpg|DAA01811.1| TPA_exp: thioredoxin reductase [Streptococcus mutans UA159] (337 aa)
Score = 374, Expect = 4.5e-34, Identities = 95/312 (30%), Positives = 171/312 (54%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKN-SNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           +  +  IYD+ ++GGG  G+F +  +    ++  +IE  S LGGQP  LYP K IYD P F  I  +D++  LI+Q +  K+ + I L  ++         E  +F   TNK + ++K II+A GNG+F PR+L +++E   +    +    + + +  KK+++ GGGDSAV+WAN    +KI  +V ++HRR+ +R+    ++ L  +++     Y   E+    +   +L I+  ++E+ + L  D ++V +G  +S  N++  N I+ ++    +    +T+   ++AIGDA  +  K + I T   EA  A+
  S:     6 LTSEKEIYDITVIGGGPVGLFTAFYAGLRGISVKVIESLSELGGQPAILYPEKVIYDIPAFPAITGADLVDNLIEQLERFKDKTTICLKEEVKTFE----KENAIFTITTNKGNHFSKAIIIACGNGAFAPRRLGLDDEERYADHNLFYNVHKLDQFAGKKVVICGGGDSAVDWANAL--DKIAESVTLVHRRDAFRAHEHSVEVLKTSHVNIMTPYVPLELKGEGDEATSLVIQKVKSEETKELSLDSLIVSFGFSTSNKNLKSWN-IDYKRSSINVSPLFETSQTGVFAIGDAAEYEGKIDLIATGFGEAPTAV 314
>gi|195978230|ref|YP_002123474.1| thioredoxin reductase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974935|gb|ACG62461.1| thioredoxin reductase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (330 aa)
Score = 374, Expect = 5.0e-34, Identities = 97/303 (32%), Positives = 170/303 (56%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQ-NKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPI--DSPFIH--YSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           R YD+ I+GGG  G+FA+  +    +   +IE  S LGGQP  LYP K IYD P +  +  +++ +KLI+Q ++      + L  ++L  +++ ++    F+ +T+K   Y+K II+A GNG+F PR L ++NE +  D    +  +SLN     +  K++++ GGGDSAV+WA     + +  +V ++HRR+ +R+    ++ L  +++     +  +     N     +TI+  ++E+E TL  D ++V +G  +S  N++  N   K     V  L Q T+ + I+AIGDA  +  + + I T   EA
  S:     4 RTYDITIIGGGPVGLFAAFYAGLRGMTVKIIESLSELGGQPAVLYPEKVIYDIPAYPALTGAELTQKLIEQLSRFDDRIAVCLKEEVL--SFEKVDGD--FVIQTSKARHYSKAIIVACGNGAFAPRTLGLDNEQLFADHNLFYNVHSLNQ----FAGKRVVICGGGDSAVDWA--LALDGLAKSVTLVHRRDAFRAHEHSVELLKNSHVTTLTPFVPLALEGENGFVNKMTIQKVKSEEEITLELDSLIVSFGFSTSNKNLKHWNLDYKRSSLLVSPLFQ-TSQEGIFAIGDAAAYEGRVDLIATGFGEA 303
>gi|192813646|ref|ZP_03042305.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Geobacillus sp. Y412MC10] >gi|192797483|gb|EDV74004.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Geobacillus sp. Y412MC10] (333 aa)
Score = 373, Expect = 6.5e-34, Identities = 102/312 (32%), Positives = 167/312 (53%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTIN--EQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M +D  + D+ I+GGG  G+FA+        +  LIE    LGGQ   LYP K+IYD   F ++ + +++  L  Q  E   ++I+L+  +     Q +   E+  F+ +TN    +AK +I+ +G G+F PR+LEI   E  +   +HY +N +   +K KK+L+ GGGDSAV+WA   + E I   V ++HRR+++R+    ++ L  SK NI+       +   ++   +T+ H +T++ Q +  D V+V +G +SS   I     I  E    V+D   +T+I  I+A GD T +  K   I     EA  A+
  S:     4 MPQDNNMTDLLIIGGGPAGMFAAFYGGMRQASVKLIESMPQLGGQLAALYPEKYIYDVAGFPKVTAQELVNNLSAQ-MELFKTDIRLEEKV-----QAVEKLEERHFVVKTNLGEHHAKAVIITAGVGAFQPRRLEIEGAEKYEKANLHYFVN-DLSRFKGKKVLISGGGDSAVDWA--LMIEPIAEQVTLVHRRDKFRAHEHSVEQLMASKVNIVTPTEITELHGEDAITKVTLSHIKTKETQEIEVDDVIVNFGFVSSLGPISEWG-IAIESNSIVVDSRMETSIPGIFAAGDITTYPGKVKLIAVGFGEAPTAV 310
>gi|22537500|ref|NP_688351.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus agalactiae 2603V/R] >gi|25011465|ref|NP_735860.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus agalactiae NEM316] >gi|76787927|ref|YP_329994.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus agalactiae A909] >gi|76797704|ref|ZP_00779972.1| thioredoxin reductase [Streptococcus agalactiae 18RS21] >gi|77406829|ref|ZP_00783860.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus agalactiae H36B] >gi|77409292|ref|ZP_00785997.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus agalactiae COH1] >gi|77414636|ref|ZP_00790775.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus agalactiae 515] >gi|22534380|gb|AAN00224.1|AE014254_4 pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus agalactiae 2603V/R] >gi|24413003|emb|CAD47082.1| unknown [Streptococcus agalactiae NEM316] >gi|76562984|gb|ABA45568.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus agalactiae A909] >gi|76586928|gb|EAO63418.1| thioredoxin reductase [Streptococcus agalactiae 18RS21] >gi|77159323|gb|EAO70495.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus agalactiae 515] >gi|77172089|gb|EAO75253.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus agalactiae COH1] >gi|77174560|gb|EAO77398.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus agalactiae H36B] (330 aa)
Score = 372, Expect = 8.1e-34, Identities = 104/306 (33%), Positives = 169/306 (55%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNS-NIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP--IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNK---TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           IYD+ IVGGG  G+FA+  +    ++  +IE  S LGGQP  LYP K IYD P +  I   ++I K I+Q +  K+S  I L  ++L  +++ ++  ++F  +T+K+   ++ I+ A GNG+F PR L + NE    D+   +    LE   +  K +++ GGGDSAV+WAN    +KI  +VAI+HRR+ +R+    +D L  + +     Y  I  N  ++   +L ++  + ++   LP D ++V +G  +S  N+   N   K     V  L + T  + +YAIGDA ++  K   I T   EA  A+
  S:     5 IYDITIVGGGPVGLFAAFYAGLRGVSVKIIESLSELGGQPAILYPEKKIYDIPGYPVITGRELIDKHIEQLERFKDSIEICLKEEVL--SFEKVD--DVFTIQTDKDQHLSRAIVFACGNGAFAPRLLGLENEENYADNNLFYNVTKLEQ--FAGKHVVICGGGDSAVDWANEL--DKIAASVAIVHRRDAFRAHEHSVDILKASGVRILTPYVPIGLNGDSQRVSSLVVQKVKGDEVIELPLDNLIVSFGFSTSNKNLRYWNLDYKRSSINVSSLFETTQ-EGVYAIGDAANYPGKVELIATGYGEAPVAI 307
>gi|81428049|ref|YP_395048.1| thioredoxin reductase [Lactobacillus sakei subsp. sakei 23K] >gi|78609690|emb|CAI54736.1| Thioredoxin reductase [Lactobacillus sakei subsp. sakei 23K] (328 aa)
Score = 372, Expect = 9.1e-34, Identities = 101/302 (33%), Positives = 164/302 (54%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTI---KHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQK--TNIKNIYAIGDATHFYCKPNTIITACAEA 308
           ++D+ ++GGG  G+FA+  +     +  +IE    LGGQ   LYP K I+D   F  I  + +   L +Q    + +  QL+T +  I  Q   E   ++ ET+K + + + +I+A GNG+F PRKL ++ +P  ++ +IHY    E   +K++ + V GGGDSA++WA   + EK+   V IIHRR+++R     +D L  ++I  K  + I    E +  L +   K K T++EQ L  D +LV YG IS   +  +L         + + +NQ+  TN+ N+YAIGD   +  K   I +   EA
  S:     7 LFDITVIGGGPVGMFAAYYAGMRKADVQIIESLPELGGQVATLYPEKEIFDVAGFKGITGAQLTANLAEQLAVFEPTT-QLETSVKAILPQ---EDGTYILETSKGTTHTRGVIVAVGNGAFTPRKLAVDYQPEWENNYIHY-FAKEMAQFKDQTVAVAGGGDSAIDWA--LMLEKVAKQVYIIHRRDQFRGLESSVDALMNSSIQIKTPFLIDGLTEVDHQLALSLNKMKSTDQEQ-LVVDKLLVNYGFIS---DTRILRDWGLTLDHHQVSVNQQMATNLPNVYAIGDIATYPGKVKLIASGFGEA 303
>gi|191637705|ref|YP_001986871.1| Thioredoxin reductase [Lactobacillus casei] >gi|190712007|emb|CAQ66013.1| Thioredoxin reductase [Lactobacillus casei BL23] (328 aa)
Score = 371, Expect = 1.1e-33, Identities = 90/306 (29%), Positives = 167/306 (54%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPI--DSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKET--EKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           +Y++ ++GGG  G+FA+  +     + +L+E    LGGQ   LYP+K +YD   F  +   D++ +L  Q     +  ++  T++     QTI++     F   T++  F +K +I+A+G G+F PRKL ++ +P        ++  +LET  ++++++ V GGGDSA++WA     E +  +V++IHRR ++R     +  L K+++  +  Y I      +  L IK KE   E + TL  D +L+ YG ++   +++   Q++ ++   ++D   +T+   I+AIGDA  +  K   I +   EA  A+
  S:     6 VYEITVIGGGPVGMFAAFYAGLRQADVLLLESLDELGGQTGNLYPDKILYDIGGFPHVSGKDLVTQLKTQ-LVHFHPEVKTATEV-----QTIDQDPDGFFTLHTSQGDFRSKTVIVATGGGAFTPRKLAVDYDPALEGKKLFYFVQDLET--FRDQEVAVAGGGDSAIDWA--LALEPVAKHVSLIHRRAKFRGLEASVAALEKSSVTIQTPYLIESVTPQDDQLAIKLKEVRGEAQPTLTVDKLLINYGFVTDKHHLQAW-QLDTDRNGILVDTQMQTSRPGIFAIGDAVSYAGKLPLIASGFGEAPTAI 306
>gi|157151294|ref|YP_001450566.1| thioredoxin-disulfide reductase [Streptococcus gordonii str. Challis substr. CH1] >gi|157076088|gb|ABV10771.1| thioredoxin-disulfide reductase [Streptococcus gordonii str. Challis substr. CH1] (322 aa)
Score = 370, Expect = 1.6e-33, Identities = 102/306 (33%), Positives = 166/306 (54%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           +YD+ IVGGG  G+FA+  ++       +I+    LGGQP  LYP K I D P F  +   ++ ++LI+Q  E   + I L+  +L+I    +  +E F   T+K     K II+A G G+F PR LE+++    S   ++  N+    Y  KK++VLGGGDSAV+WA  F  EKI    +++HRR+ +R+    ++ L  +++  K  +    ++  N     L I   + E+ Q LP D++ V YG  SS  N++    ++N+   K +++  Q+T++  IYA GD   +  K + I T   EA  A+
  S:     4 LYDITIVGGGPVGLFAAFYAHLRQAKVKIIDSLPQLGGQPAILYPEKKILDVPGFTNLTGEELTQRLIEQ-LETFQTEICLNETVLDI----VKGEEGFTITTSKAKHQTKTIIIAMGGGAFKPRALELDDAESYSNLHYHVSNINQ--YAGKKVVVLGGGDSAVDWALAF--EKIA-ETSLVHRRDNFRALEHSVEELKASSVEIKTPFVPSRLVGENGKITHLEISQVKGEESQLLPLDHLFVNYGFKSSVGNLKNWGLELNRH--KILVNSKQETSVPGIYAAGDCCSYEGKIDLIATGLGEAPTAV 301
>gi|69245251|ref|ZP_00603329.1| Thioredoxin-disulfide reductase [Enterococcus faecium DO] >gi|68195926|gb|EAN10360.1| Thioredoxin-disulfide reductase [Enterococcus faecium DO] (332 aa)
Score = 369, Expect = 1.8e-33, Identities = 104/308 (33%), Positives = 167/308 (54%)
  Q:     5 LRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT-IKHKETEKEQT--LPFDYVLVQYGQISSPINIELLNQ--INKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           + IYD+ I+G G  G+FA+  +      + +I+    LGGQ   LYP K+IYD P +  IK+S++I +L +Q     N    L  ++L++T     E E+    TNK   Y+K +ILA GNGSF PRKL ++N E  ++  + Y +N +   Y  KK+ + GGGDSA++W    + E I + V +IHRR E+R+    +  L  +++     Y I   + +N  LT I+ K+ + ++T  L  D ++V YG  S   N+E L+   ++  +    +  +  T+I  +YA GD   +  K   I T   EA  A+
  S:     1 MEIYDITIIGAGPVGMFAAFYAGMRQAKTKIIDSLPQLGGQLATLYPEKYIYDIPGYPAIKASELIDQLEKQ-LTTFNHTFHLKEEVLSLT----REDEVIEITTNKGIHYSKAVILALGNGSFQPRKLNLDNAESFENHGLDYFVN-DLMKYAGKKVAIAGGGDSAIDWT--LMLEPIASEVYLIHRRPEFRAHEHSVSRLKSSSVNLLTPYLIDGLSGNNGELTDIRLKKVKSDETIDLMIDSLIVNYGFSS---NLEHLSSWGLDSTRNAITVKSDMSTSIPGVYAAGDICTYEGKVKLIATGLGEAPTAV 303
>gi|52081702|ref|YP_080493.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase YumC [Bacillus licheniformis ATCC 14580] >gi|52787088|ref|YP_092917.1| YumC [Bacillus licheniformis ATCC 14580] >gi|52004913|gb|AAU24855.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase YumC [Bacillus licheniformis ATCC 14580] >gi|52349590|gb|AAU42224.1| YumC [Bacillus licheniformis DSM 13] (332 aa)
Score = 369, Expect = 1.9e-33, Identities = 99/312 (31%), Positives = 170/312 (54%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M ED ++YD+ I+GGG  G+F +        +  +IE    LGGQ   LYP K+IYD   F +I++ +++  L +Q   + +  + L+  + ++  Q      +F   TNK   Y+K +I+ +GNG+F PRKLE+ +    ++  +HY ++ +   +  K++ VLGGGDSAV+WA   + E I   V+IIHRR+++R+    ++ L  SK N+L       +  +E  + + I+  + E+++ +  D V+V +G +SS   I+    +  EK   V+    +TNI+  YA GD   +  K   I +   EA  A+
  S:     1 MREDTKVYDITIIGGGPVGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKIRAQELVDNLKEQ-MAKFDQTVCLEQAVESVEKQA---DGIFKLVTNKEIHYSKTVIITAGNGAFQPRKLELESAAQFENANLHYFID-DLNQFAGKRVAVLGGGDSAVDWA--LMLEPIAKEVSIIHRRDKFRAHEHSVENLRNSKVNVLTPFVPTELIGSERIEQIVIEEVKGERKEIIDVDDVIVNFGFVSSLGPIKNWG-LEIEKNSIVVKSTMETNIEGFYAAGDICTYEGKVKLIASGFGEAPTAV 307
>gi|81176835|ref|ZP_00875815.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Streptococcus suis 89/1591] >gi|80976402|gb|EAP40013.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Streptococcus suis 89/1591] (322 aa)
Score = 366, Expect = 3.8e-33, Identities = 106/315 (33%), Positives = 168/315 (53%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDI-LNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKH---KETEKEQTLPFDYVLVQYGQISSPINI-ELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAV----RALWHISKNKK 320
           ++YD+ I+GGG  G+FA+  ++       +I+    LGGQP  LYP K I D P F  +   ++   L+ Q           DT I LN T   I   E     TNK S   K +I+A G G+F PR LEI+  +  D+  +HY ++   + Y +K I+VLGGGDSAV+W+  F  EKI     I+HRR+ +R+    ++ L ++++     +     +  N   +  H    ++E + TL FD++ V YG  SS   + E   ++N+   + V++  Q+T++  IYAIGD   +  K + I T   EA      A+ +I+ N+K
  S:     3 QVYDITIIGGGPVGLFAAFYAHLRQAKVKIIDSLPQLGGQPAILYPEKAILDIPAFPSLTGQELTDNLLAQLAP-------FDTTICLNETLTAIEPGETITLTTNKGSHQTKTLIIAMGGGAFKPRPLEIDGADSFDN--VHYHVS-NIQQYADKDIVVLGGGDSAVDWSLAF--EKIAKTTQIVHRRDNFRALEHSVEELKQSSVTIHTPFIPKGLSGENGRASSIHFDKVKSEDKLTLSFDHLFVNYGFKSSVGTLKEWGLELNRH--RIVVNSKQETSVPGIYAIGDCCFYEGKVDLIATGLGEAPTAVNNAMNYINPNEK 313
>gi|116494370|ref|YP_806104.1| thioredoxin reductase [Lactobacillus casei ATCC 334] >gi|116104520|gb|ABJ69662.1| Thioredoxin reductase [Lactobacillus casei ATCC 334] (328 aa)
Score = 364, Expect = 6.2e-33, Identities = 89/306 (29%), Positives = 166/306 (54%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPI--DSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKET--EKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           +Y++ ++GGG  G+FA+  +     + +L+E    LGGQ   LYP K +YD   F  +   D++ +L  Q     +  ++  T++     QTI++     F   T++  F +K +I+A+G G+F PRKL ++ +P        ++  +LET  ++++++ V GGGDSA++WA     E +  +V++IHRR ++R     +  L K+++  +  Y I      +  L I+ KE   E + TL  D +L+ YG ++   +++   Q++ ++   ++D   +T+   I+AIGDA  +  K   I +   EA  A+
  S:     6 VYEITVIGGGPVGMFAAFYAGLRQADVLLLESLDELGGQTGNLYPAKILYDIGGFPHVSGKDLVTQLKTQ-LVHFHPEVKTATEV-----QTIDQDPDGFFTLHTSQGDFRSKTVIVATGGGAFTPRKLAVDYDPALEGKKLFYFVQDLET--FRDQEVAVAGGGDSAIDWA--LALEPVAKHVSLIHRRAKFRGLEASVAALEKSSVTIQTPYLIESVTPQDDQLAIQLKEVRGEAQPTLTVDKLLINYGFVTDKHHLQAW-QLDTDRNGILVDTQMQTSRPGIFAIGDAVSYAGKLPLIASGFGEAPTAI 306
>gi|163764524|ref|ZP_02171580.1| penicillin-binding protein, transpeptidase [Bacillus selenitireducens MLS10] >gi|160354902|gb|EDP81559.1| penicillin-binding protein, transpeptidase [Bacillus selenitireducens MLS10] (332 aa)
Score = 364, Expect = 7.4e-33, Identities = 95/312 (30%), Positives = 167/312 (53%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M+++  +YD+ ++GGG  GIF +  +        LIE    LGGQ   LYP K+IYD   F +I++ +++  L +Q + Q N  I L   + ++         +F   T+K + Y+K II+ +G G+F PR LE+   E  +   +HY ++ +   +   ++++ GGGDSAV+W    + E I   + I+HRRN++R+    ++  L  + I  +  Y + + + +    + +T+K K+ +K + +  D ++V YG IS+   I+    +  EK   V++ N +TNI+ IYA GD   +  K   I     EA  A+
  S:     1 MSQEREVYDITVIGGGPVGIFTTFYAGLRQAKVKLIEAMPQLGGQLSALYPEKYIYDIAGFPKIRAQELVDNLSEQAR-QFNPEITLSQSVESV---EKGSDGVFTITTDKETHYSKSIIITAGVGAFKPRPLEVEGAEQFEGKNLHYFVS-DLNKFAGDRVVLAGGGDSAVDWT--LMLEDIAEEITIVHRRNKFRAHEHSVEQLLGSDKINVRTPYVVSEIHANGDKIEAVTLKEKDGDKTERIDIDTLIVNYGFISNLGPIKNWG-LEIEKNSIVVNSNMETNIEGIYACGDIVTYDGKTKLIAAGFGEAPTAV 309
>gi|125717661|ref|YP_001034794.1| thioredoxin reductase, putative [Streptococcus sanguinis SK36] >gi|125497578|gb|ABN44244.1| Thioredoxin reductase, putative [Streptococcus sanguinis SK36] (322 aa)
Score = 363, Expect = 8.1e-33, Identities = 100/306 (32%), Positives = 164/306 (53%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           +YD+ IVGGG  G+FA+  ++       +I+    LGGQP  LYP K I D P F  +   ++ ++LI+Q  E   + I L+  +L+I    +   + F   T++     K II+A G G+F PR LE++     S   ++  N+    Y  KK++VLGGGDSAV+WA  F  EKI    +++HRR+ +R+    ++ L  +++  K  +    ++  N     L I   + E+ Q LP D++ V YG  SS  N++    ++N+   K +++  Q+T++  IYA GD   +  K + I T   EA  A+
  S:     4 LYDITIVGGGPVGLFAAFYAHLRQAKVKIIDSLPQLGGQPAILYPEKKILDVPGFTNLSGEELTQRLIEQ-LETFQTEICLNETVLDI----VKSDDGFTITTSQAQHQTKTIIIAMGGGAFKPRALELDAAESYSNLHYHVSNISQ--YAGKKVVVLGGGDSAVDWALAF--EKIA-ETSLVHRRDNFRALEHSVEELKASSVEIKTPFVPSRLVGENGKITHLEISQVKGEESQLLPLDHLFVNYGFKSSVGNLKDWGLELNRH--KILVNSKQETSVPGIYAAGDCCSYEGKIDLIATGLGEAPTAV 301
>gi|148997369|ref|ZP_01824974.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP11-BS70] >gi|168575239|ref|ZP_02721202.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae MLV-016] >gi|147756424|gb|EDK63465.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP11-BS70] >gi|183578936|gb|EDT99464.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae MLV-016] (321 aa)
Score = 361, Expect = 1.4e-32, Identities = 103/307 (33%), Positives = 170/307 (55%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDI-LNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           ++YD+ IVGGG  G+FA+  ++       +I+    LGGQP  LYP K I D P F  +   ++  +LI    EQ N     DT I LN T   I++QE F   T+K S   K +I+A G G+F PR LE+   E  ++  IHY ++   + Y  KK+ +LGGGDSAV+WA  F  EKI     ++HRR+ +R+    +  L ++++  K  +   +++   ++   L I   ++++ +T+  D++ V YG  SS  N++    ++  + K +++  Q+++   IYAIGD  ++  K + I T   EA  A+
  S:     3 QLYDITIVGGGPVGLFAAFYAHLRQAKVQIIDSLPQLGGQPAILYPEKEILDVPGFPNLTGEELTNRLI----EQLNG---FDTPIHLNETVLEIDKQEEFAITTSKGSHLTKTVIIAMGGGAFKPRPLELEGVEGYEN--IHYHVS-NIQQYAGKKVTILGGGDSAVDWALAF--EKIA-PTTLVHRRDNFRALEHSVQALQESSVTIKTPFAPGQLLGNGKTLDKLEITKVKSDETETIDLDHLFVNYGFKSSVGNLKNWG-LDLNRHKIIVNSKQESSQAGIYAIGDCCYYDGKIDLIATGLGEAPTAV 300
>gi|146319640|ref|YP_001199352.1| thioredoxin reductase [Streptococcus suis 05ZYH33] >gi|145690446|gb|ABP90952.1| Thioredoxin reductase [Streptococcus suis 05ZYH33] (322 aa)
Score = 361, Expect = 1.6e-32, Identities = 102/307 (33%), Positives = 161/307 (52%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDI-LNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINI-ELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           ++YD+ I+GGG  G+FA+  ++       +I+    LGGQP  LYP K I D P F  +   ++   L+ Q           DT I LN T   I   E     TNK +   K +I+A G G+F PR LEI+  +  D+  +HY ++   + Y +K I+VLGGGDSAV+W+  F  EKI     IIHRR+ +R+    ++ L ++++     +     +  N     +     ++E + TL FD++ V YG  SS   + E   ++N+   + V++  Q+T++  IYAIGD   +  K + I T   EA  A+
  S:     3 QVYDITIIGGGPVGLFAAFYAHLRQAKVKIIDSLPQLGGQPAILYPEKAILDIPAFPSLTGQELTDNLLAQLAP-------FDTTICLNETLTAIEPGETITLTTNKGNHQTKTLIIAMGGGAFKPRPLEIDGADSFDN--VHYHVS-NIQQYADKDIVVLGGGDSAVDWSLAF--EKIAKTTQIIHRRDNFRALEHSVEELKQSSVTIHTPFIPKGLSGENGRASAIDFDKVKSEDKLTLSFDHLFVNYGFKSSVGTLKEWGLELNRH--RIVVNSKQETSVPGIYAIGDCCFYEGKIDLIATGLGEAPTAV 301
>gi|149003204|ref|ZP_01828100.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP14-BS69] >gi|147758664|gb|EDK65661.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP14-BS69] (321 aa)
Score = 360, Expect = 2.0e-32, Identities = 105/307 (34%), Positives = 168/307 (54%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDI-LNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKT---LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           ++YD+ IVGGG  G+FA+  ++       +I+    LGGQP  LYP K I D P F  +   ++  +LI    EQ N     DT I LN T   I++QE F   T+K S   K +I+A G G+F PR LE+   E  ++  IHY ++   + Y  KK+ +LGGGDSAV+WA  F  EKI     ++HRR+ +R+    +  L ++++  K  +       + KT   L I   ++++ +T+  D++ V YG  SS  N++    ++  + K +++  Q+++   IYAIGD  ++  K + I T   EA  A+
  S:     3 QLYDITIVGGGPVGLFAAFYAHLRQAKVQIIDSLPQLGGQPAILYPEKEILDVPGFPNLTGEELTNRLI----EQLNG---FDTPIHLNETVLKIDKQEEFAITTSKGSHLTKTVIIAMGGGAFKPRPLELEGVEGYEN--IHYHVS-NIQQYAGKKVTILGGGDSAVDWALAF--EKIA-PTTLVHRRDNFRALEHSVQALQESSVTIKTPFAPSQLLGNGKTLDKLEITKVKSDETETIDLDHLFVNYGFKSSVGNLKNWG-LDLNRHKIIVNSKQESSQAGIYAIGDCCYYDGKIDLIATGLGEAPTAV 300
>gi|15901406|ref|NP_346010.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae TIGR4] >gi|111658469|ref|ZP_01409142.1| hypothetical protein SpneT_02000369 [Streptococcus pneumoniae TIGR4] >gi|149021842|ref|ZP_01835849.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP23-BS72] >gi|168486826|ref|ZP_02711334.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae CDC1087-00] >gi|182684518|ref|YP_001836265.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae CGSP14] >gi|14973054|gb|AAK75650.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae TIGR4] >gi|147930078|gb|EDK81065.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP23-BS72] >gi|182629852|gb|ACB90800.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae CGSP14] >gi|183570185|gb|EDT90713.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae CDC1087-00] (321 aa)
Score = 360, Expect = 2.0e-32, Identities = 105/307 (34%), Positives = 168/307 (54%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDI-LNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKT---LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           ++YD+ IVGGG  G+FA+  ++       +I+    LGGQP  LYP K I D P F  +   ++  +LI    EQ N     DT I LN T   I++QE F   T+K S   K +I+A G G+F PR LE+   E  ++  IHY ++   + Y  KK+ +LGGGDSAV+WA  F  EKI     ++HRR+ +R+    +  L ++++  K  +       + KT   L I   ++++ +T+  D++ V YG  SS  N++    ++  + K +++  Q+++   IYAIGD  ++  K + I T   EA  A+
  S:     3 QLYDITIVGGGPVGLFAAFYAHLRQAKVQIIDSLPQLGGQPAILYPEKEILDVPGFPNLTGEELTNRLI----EQLNG---FDTPIHLNETVLEIDKQEEFAITTSKGSHLTKTVIIAMGGGAFKPRPLELEGVEGYEN--IHYHVS-NIQQYAGKKVTILGGGDSAVDWALAF--EKIA-PTTLVHRRDNFRALEHSVQALQESSVTIKTPFAPSQLLGNGKTLDKLEITKVKSDETETIDLDHLFVNYGFKSSVGNLKNWG-LDLNRHKIIVNSKQESSQAGIYAIGDCCYYDGKIDLIATGLGEAPTAV 300
>gi|154687317|ref|YP_001422478.1| YumC [Bacillus amyloliquefaciens FZB42] >gi|154353168|gb|ABS75247.1| YumC [Bacillus amyloliquefaciens FZB42] (331 aa)
Score = 360, Expect = 2.1e-32, Identities = 95/312 (30%), Positives = 170/312 (54%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M ED ++YD+ ++GGG  G+F +        +  +IE    LGGQ   LYP K+IYD   F +I++ +++  L +Q   + +  I L+  + ++  Q      +F   TN  + Y+K +I+ +GNG+F PRKLE+ + E  +   +HY ++ +   +  +++ VLGGGDSAV+WA   + E I   V+IIHRR+++R+    ++ L  SK N+L       +   +  + L ++  + ++++ +  D ++V YG +SS   I+    ++ EK   V+    +TNI+  +A GD   +  K   I +   EA  A+
  S:     1 MQEDSKVYDITVIGGGPVGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKIRAQELVNNLKEQ-MAKFDQTICLEQAVESVEKQA---DGVFKLVTNSETHYSKTVIITAGNGAFKPRKLELESAEQYEGKNLHYFID-DLNQFAGRRVAVLGGGDSAVDWA--LMLEPIAKEVSIIHRRDKFRAHEHSVENLHNSKVNVLTPFVPAELVGEDRIEQLVLEEVKGDRKEIIEIDDLIVNYGFVSSLGPIKNWG-LDIEKNSIVVKSTMETNIEGFFAAGDICTYEGKVKLIASGFGEAPTAV 307
>gi|148984914|ref|ZP_01818167.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP3-BS71] >gi|147922936|gb|EDK74052.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP3-BS71] (321 aa)
Score = 359, Expect = 3.0e-32, Identities = 105/307 (34%), Positives = 168/307 (54%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDI-LNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKT---LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           ++YD+ IVGGG  G+FA+  ++       +I+    LGGQP  LYP K I D P F  +   ++  +LI    EQ N     DT I LN T   I++QE F   T+K S   K +I+A G G+F PR LE+   E  ++  IHY ++   + Y  KK+ +LGGGDSAV+WA  F  EKI     ++HRR+ +R+    +  L ++++  K  +       + KT   L I   ++++ +T+  D++ V YG  SS  N++    ++  + K +++  Q+++   IYAIGD  ++  K + I T   EA  A+
  S:     3 QLYDITIVGGGPIGLFAAFYAHLRQAKVQIIDSLPQLGGQPAILYPEKEILDVPGFPNLTGEELTNRLI----EQLNG---FDTPIHLNETVLEIDKQEEFAITTSKGSHLTKTVIIAMGGGAFKPRPLELEGVEGYEN--IHYHVS-NIQQYAGKKVTILGGGDSAVDWALAF--EKIA-PTTLVHRRDNFRALEHSVQALQESSVTIKTPFAPSQLLGNGKTLDKLEITKVKSDETETIDLDHLFVNYGFKSSVGNLKNWG-LDLNRHKIIVNSKQESSQAGIYAIGDCCYYDGKIDLIATGLGEAPTAV 300
>gi|55821403|ref|YP_139845.1| thioredoxin reductase [Streptococcus thermophilus LMG 18311] >gi|55823328|ref|YP_141769.1| thioredoxin reductase [Streptococcus thermophilus CNRZ1066] >gi|116628127|ref|YP_820746.1| thioredoxin reductase [Streptococcus thermophilus LMD-9] >gi|55737388|gb|AAV61030.1| thioredoxin reductase [Streptococcus thermophilus LMG 18311] >gi|55739313|gb|AAV62954.1| thioredoxin reductase [Streptococcus thermophilus CNRZ1066] >gi|116101404|gb|ABJ66550.1| Thioredoxin reductase [Streptococcus thermophilus LMD-9] (332 aa)
Score = 358, Expect = 3.1e-32, Identities = 95/307 (30%), Positives = 175/307 (57%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKK-LIQQNKEQKNSNIQLDTDILNITWQTINEQE-LFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSL--NLET-EIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           +IYD+ I+GGG  G++A+  +    +   +IE  S LGGQP  LYP K IYD P F +   +++I+  LIQ  + +   +I L  ++     QT  + + +F   T+K    +K I++A GNG+F PR L ++NE     F + +L  N+ + + +  KK+++ GGGDSAV+WAN+   + +  +V +IHRR+ +R+    ++ L ++++     Y   EI   N   ++LT++  ++++   LP D ++V +G  ++  N+   N ++ ++    ++   +T+ + +YAIG A  +  K + I     EA  A+
  S:     5 KIYDITIIGGGPVGLWAAFYAGLRGMTVNIIESLSELGGQPAILYPEKKIYDIPAFPQTTGAELIENLLIQLKRFEDRVSIHLKEEV-----QTFKKTDGIFTIATSKGQHLSKAIVIACGNGAFAPRPLGVDNE---EDFANNNLLYNVHSLDQFAGKKVVIAGGGDSAVDWANHL--DGVAESVTLIHRRDAFRAHEHSVELLYQSSVNVMTPYVPLEIKGENGHAQSLTVQRVKSDEVVELPIDALIVSFGFSTNNKNLRNWN-VDYKRSSITVNAQFETSQEGVYAIGGAAEYDGKIDLIAVGMGEAPIAI 308
>gi|15903464|ref|NP_359014.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae R6] >gi|116516331|ref|YP_816853.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae D39] >gi|15459075|gb|AAL00225.1| Thioredoxin reductase [Streptococcus pneumoniae R6] >gi|116076907|gb|ABJ54627.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae D39] (322 aa)
Score = 356, Expect = 6.0e-32, Identities = 98/307 (31%), Positives = 167/307 (54%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           ++YD+ IVGGG  G+FA+  ++       +I+    LGGQP  LYP K I D P F  +   ++  +LI+Q     ++ I L+  +L I  Q    +E F   T+K S   K +I+A G G+F PR LE+     D   IHY ++   + Y  KK+ +LGGGDSAV+WA  F  EKI     ++HRR+ +R+    +  L ++++  K  +   +++   ++   L I   ++++ +T+  D++ V YG  SS  N++    ++  + K +++  Q+++   IYAIGD  ++  K + I T   EA  A+
  S:     3 QLYDITIVGGGPVGLFAAFYAHLRQAKVQIIDSLPQLGGQPAILYPEKEILDVPGFPNLTGEELTNRLIEQ-LNGFDTPIHLNETVLEIDKQ----EEEFAITTSKGSHLTKTVIIAMGGGAFKPRPLELEGVE-DYENIHYHVS-NIQQYAGKKVTILGGGDSAVDWALAF--EKIA-PTTLVHRRDNFRALEHSVQALQESSVTIKTPFAPSQLLGDGKTLDKLEITKVKSDETETIDLDHLFVNYGFKSSVGNLKNWG-LDLNRHKIIVNSKQESSQAGIYAIGDCCYYDGKIDLIATGLGEAPTAV 301
>gi|168491543|ref|ZP_02715686.1| thioredoxin reductase [Streptococcus pneumoniae CDC0288-04] >gi|183574127|gb|EDT94655.1| thioredoxin reductase [Streptococcus pneumoniae CDC0288-04] (322 aa)
Score = 355, Expect = 7.1e-32, Identities = 100/307 (32%), Positives = 165/307 (53%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKT---LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           ++YD+ IVGGG  G+FA+  ++       +I+    LGGQP  LYP K I D P F  +   ++  +LI+Q     ++ I L+  +L I  Q    +E F   T+K S   K +I+A G G+F PR LE+     D   IHY ++   + Y  KK+ +LGGGDSAV+WA  F  EKI     ++HRR+ +R+    +  L ++++  K  +       + KT   L I   ++++ +T+  D++ V YG  SS  N++    ++  + K +++  Q+++   IYAIGD  ++  K + I T   EA  A+
  S:     3 QLYDITIVGGGPVGLFAAFYAHLRQAKVQIIDSLPQLGGQPAILYPEKEILDVPGFPNLTGEELTNRLIEQ-LNGFDTPIHLNETVLEIDKQ----EEEFAITTSKGSHLTKTVIIAMGGGAFKPRPLELEGVE-DYENIHYHVS-NIQQYAGKKVTILGGGDSAVDWALAF--EKIA-PTTLVHRRDNFRALEHSVQTLQESSVTIKTPFAPSQLLGNGKTLDKLEITKVKSDETETIDLDHLFVNYGFKSSVGNLKNWG-LDLNRHKIIVNSKQESSQAGIYAIGDCCYYDGKIDLIATGLGEAPTAV 301
>gi|168493468|ref|ZP_02717611.1| thioredoxin reductase [Streptococcus pneumoniae CDC3059-06] >gi|183576414|gb|EDT96942.1| thioredoxin reductase [Streptococcus pneumoniae CDC3059-06] (322 aa)
Score = 353, Expect = 1.2e-31, Identities = 98/307 (31%), Positives = 171/307 (55%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           ++YD+ IVGGG  G+FA+  ++       +I+    LGGQP  LYP K I D P F  +   ++  +LI+Q     ++ I L+  +L I  Q    +E F+  T+K S  +K +I+A G G+F PR LE+   E  ++  IHY ++   + Y  KK+ +LGGGDSAV+WA  F  EKI     ++HRR+ +R+    +  L ++++  K  +   +++   ++   L I   ++++ +T+  D++ V YG  SS  N++    ++  + K +++  Q+++   IYAIGD  ++  K + I T   EA  A+
  S:     3 QLYDITIVGGGPVGLFAAFYAHLRQAKVQIIDSLPQLGGQPAILYPEKEILDVPGFPNLTGEELTNRLIEQ-LNGFDTPIHLNETVLEIEKQ----EEGFVITTSKGSHLSKTVIIAMGGGAFKPRPLELEGVEGYEN--IHYHVS-NIQQYAGKKVTILGGGDSAVDWALAF--EKIA-QTTLVHRRDNFRALEHSVQALQESSVSIKTPFIPSQLLGDGKTLDKLEITKVKSDETETIDLDHLFVNYGFKSSVGNLKNWG-LDLNRHKIIVNSKQESSQAGIYAIGDCCYYDGKIDLIATGLGEAPTAV 301
>gi|152977221|ref|YP_001376738.1| thioredoxin-disulfide reductase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152025973|gb|ABS23743.1| Thioredoxin-disulfide reductase [Bacillus cereus subsp. cytotoxis NVH 391-98] (329 aa)
Score = 353, Expect = 1.3e-31, Identities = 98/312 (31%), Positives = 171/312 (54%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDF--NESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M E+  +YD+ I+GGG  G+F +        +  +IE    LGGQ   LYP K+IYD   F ++++ +++  L +Q K + +  I L+  +     +T+ +Q   +F   TNK + Y+K +I+ +GNG+F PR+LE++  +  +   +HY ++ +   +  K+++V GGGDSAV+W    + E I   V IIHRR+++R+    ++ L  +    K  Y  ++    E  + + ++H +TE++  +  D V+V YG +SS   I+    +N +K   V++   +TNI  IYA GD   +  K   I     EA  A+
  S:     1 MTENQNVYDITIIGGGPTGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKVRAQELVDNLKEQMK-KFDPTICLEEAV-----ETLEKQADGVFKLVTNKQTHYSKSVIITAGNGAFQPRRLELDGAQKFEKKNLHYFVD-DMNKFARKRVVVFGGGDSAVDWT--LMLEPIAEQVTIIHRRDKFRAHEHSVENLINSRADIKTPYVPVELIGEEQIEQVVLQHVKTEEKVVIDVDDVIVNYGFVSSLGPIKNWG-LNIQKNSIVVNSKMETNIPGIYAAGDVCTYEGKVKLIACGFGEAPTAV 307
>gi|169832922|ref|YP_001694968.1| thioredoxin reductase [Streptococcus pneumoniae Hungary19A-6] >gi|168995424|gb|ACA36036.1| thioredoxin reductase [Streptococcus pneumoniae Hungary19A-6] (322 aa)
Score = 352, Expect = 1.7e-31, Identities = 100/307 (32%), Positives = 167/307 (54%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           ++YD+ IVGGG  G+FA+  ++       +I+    LGGQP  LYP K I D P F  +   ++  +LI+Q     ++ I L+  +L I  Q    +E F   T+K S   K +I+A G G+F PR LE+   E  ++  IHY ++   + Y  KK+ +LGGGDSAV+WA  F  EKI     ++HRR+ +R+    +  L ++++  K  +       + KTL    I   ++++ +T+  D++ V YG  SS  N++    ++  + K +++  Q+++   IYAIGD  ++  K + I T   EA  A+
  S:     3 QLYDITIVGGGPVGLFAAFYAHLRQAKVQIIDSLPQLGGQPAILYPEKEILDVPGFPNLTGEELTNRLIEQ-LNGFDTPIHLNETVLEIDKQ----EEEFAITTSKGSHLTKTVIIAMGGGAFKPRPLELEGVEGYEN--IHYHVS-NIQQYAGKKVTILGGGDSAVDWALAF--EKIA-PTTLVHRRDNFRALEHSVQALQESSVTIKTPFAPSQLLGNGKTLAKLEITKVKSDETETIDLDHLFVNYGFKSSVGNLKNWG-LDLNRHKIIVNSKQESSQAGIYAIGDCCYYDGKIDLIATGLGEAPTAV 301
>gi|168483558|ref|ZP_02708510.1| thioredoxin reductase [Streptococcus pneumoniae CDC1873-00] >gi|172043081|gb|EDT51127.1| thioredoxin reductase [Streptococcus pneumoniae CDC1873-00] (322 aa)
Score = 352, Expect = 2.0e-31, Identities = 98/307 (31%), Positives = 170/307 (55%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           ++YD+ IVGGG  G+FA+  ++       +I+    LGGQP  LYP K I D P F  +   ++  +LI+Q     ++ I L+  +L I  Q    +E F   T+K S   K +I+A G G+F PR LE+ + E  ++  IHY ++   + Y  KK+ +LGGGDSAV+WA  F  EKI     ++HRR+ +R+    +  L ++++  K  +   +++   ++   L I   ++++ +T+  D++ V YG  SS  N++    ++  + K +++  Q+++   IYAIGD  ++  K + I T   EA  A+
  S:     3 QLYDITIVGGGPVGLFAAFYAHLRQAKVQIIDSLPQLGGQPAILYPEKEILDVPGFPNLTGEELTNRLIEQ-LNGFDTPIHLNETVLEIDKQ----EEEFAITTSKGSHLTKTVIIAMGGGAFKPRPLELESVEGYEN--IHYHVS-NIQQYAGKKVTILGGGDSAVDWALAF--EKIA-PTTLVHRRDNFRALEHSVQALQESSVTIKTPFAPSQLLGDGKTLDKLEITKVKSDETETIDLDHLFVNYGFKSSVGNLKNWG-LDLNRHKIIVNSKQESSQAGIYAIGDCCYYDGKIDLIATGLGEAPTAV 301
>gi|194398040|ref|YP_002038195.1| Pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae G54] >gi|194357707|gb|ACF56155.1| Pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae G54] (322 aa)
Score = 351, Expect = 2.2e-31, Identities = 100/307 (32%), Positives = 168/307 (54%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKT---LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           ++YD+ IVGGG  G+FA+  ++       +I+    LGGQP  LYP K I D P F  +   ++  +LI+Q     ++ I L+  +L I  Q    +E F   T+K S   K +I+A G G+F PR LE+ + E  ++  IHY ++   + Y  KK+ +LGGGDSAV+WA  F  EKI     ++HRR+ +R+    +  L ++++  K  +       + KT   L I   ++++ +T+  D++ V YG  SS  N++    ++  + K +++  Q+++   IYAIGD  ++  K + I T   EA  A+
  S:     3 QLYDITIVGGGPVGLFAAFYAHXRQAKVQIIDSLPQLGGQPAILYPEKEILDVPGFPNLTGEELTNRLIEQ-LNGFDTPIHLNETVLEIDKQ----EEEFAITTSKGSHLTKTVIIAMGGGAFKPRPLELESVEGYEN--IHYHVS-NIQQYAGKKVTILGGGDSAVDWALAF--EKIA-PTTLVHRRDNFRALEHSVQALQESSVTIKTPFAPSQLLGNGKTLDKLEITKVKSDETETIDLDHLFVNYGFKSSVGNLKNWG-LDLNRHKIIVNSKQESSQAGIYAIGDCCYYDGKIDLIATGLGEAPTAV 301
>gi|148988617|ref|ZP_01820050.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP6-BS73] >gi|148990387|ref|ZP_01821559.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP6-BS73] >gi|147924342|gb|EDK75434.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP6-BS73] >gi|147925818|gb|EDK76893.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP6-BS73] (322 aa)
Score = 351, Expect = 2.2e-31, Identities = 98/307 (31%), Positives = 169/307 (55%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           ++YD+ IVGGG  G+FA+  ++       +I+    LGGQP  LYP K I D P F  +   ++  +LI+Q     ++ I L+  +L I  Q    +E F   T+K S   K +I+A G G+F PR LE+   E  ++  IHY ++   + Y  KK+ +LGGGDSAV+WA  F  EKI     ++HRR+ +R+    +  L ++++  K  +   +++   ++   L I   ++++ +T+  D++ V YG  SS  N++    ++  + K +++  Q+++   IYAIGD  ++  K + I T   EA  A+
  S:     3 QLYDITIVGGGPVGLFAAFYAHLRQAKVQIIDSLPQLGGQPAILYPEKEILDVPGFPNLTGEELTNRLIEQ-LNGFDTPIHLNETVLEIDKQ----EEEFAITTSKGSHLTKTVIIAMGGGAFKPRPLELEGVEGYEN--IHYHVS-NIQQYAGKKVTILGGGDSAVDWALAF--EKIA-PTTLVHRRDNFRALEHSVQALQESSVTIKTPFAPGQLLGNGKTLDKLEITKVKSDETETIDLDHLFVNYGFKSSVGNLKNWG-LDLNRHKIIVNSKQESSQAGIYAIGDCCYYDGKIDLIATGLGEAPTAV 301
>gi|148992545|ref|ZP_01822213.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP9-BS68] >gi|149007522|ref|ZP_01831157.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP18-BS74] >gi|149007884|ref|ZP_01831471.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP18-BS74] >gi|149011802|ref|ZP_01832998.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP19-BS75] >gi|168488773|ref|ZP_02712972.1| thioredoxin reductase [Streptococcus pneumoniae SP195] >gi|147760611|gb|EDK67585.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP18-BS74] >gi|147760881|gb|EDK67851.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP18-BS74] >gi|147764233|gb|EDK71165.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP19-BS75] >gi|147928562|gb|EDK79576.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pneumoniae SP9-BS68] >gi|183572823|gb|EDT93351.1| thioredoxin reductase [Streptococcus pneumoniae SP195] (322 aa)
Score = 350, Expect = 2.7e-31, Identities = 100/307 (32%), Positives = 167/307 (54%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKT---LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           ++YD+ IVGGG  G+FA+  ++       +I+    LGGQP  LYP K I D P F  +   ++  +LI+Q     ++ I L+  +L I  Q    +E F   T+K S   K +I+A G G+F PR LE+   E  ++  IHY ++   + Y  KK+ +LGGGDSAV+WA  F  EKI     ++HRR+ +R+    +  L ++++  K  +       + KT   L I   ++++ +T+  D++ V YG  SS  N++    ++  + K +++  Q+++   IYAIGD  ++  K + I T   EA  A+
  S:     3 QLYDITIVGGGPVGLFAAFYAHLRQAKVQIIDSLPQLGGQPAILYPEKEILDVPGFPNLTGEELTNRLIEQ-LNGFDTPIHLNETVLEIDKQ----EEEFAITTSKGSHLTKTVIIAMGGGAFKPRPLELEGVEGYEN--IHYHVS-NIQQYAGKKVTILGGGDSAVDWALAF--EKIA-PTTLVHRRDNFRALEHSVQALQESSVTIKTPFAPSQLLGNGKTLDKLEITKVKSDETETIDLDHLFVNYGFKSSVGNLKNWG-LDLNRHKIIVNSKQESSQAGIYAIGDCCYYDGKIDLIATGLGEAPTAV 301
>gi|16080264|ref|NP_391091.1| hypothetical protein BSU32110 [Bacillus subtilis subsp. subtilis str. 168] >gi|1934830|emb|CAB07954.1| thioredoxine reductase [Bacillus subtilis] >gi|2635708|emb|CAB15201.1| yumC [Bacillus subtilis subsp. subtilis str. 168] (332 aa)
Score = 350, Expect = 2.8e-31, Identities = 96/312 (30%), Positives = 167/312 (53%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M ED ++YD+ I+GGG  G+F +        +  +IE    LGGQ   LYP K+IYD   F +I++ ++I  L +Q   + +  I L+  + ++  Q      +F     K     K+  + +GNG+F PRKLE+ N E  +   +HY ++ + + +  +++ +LGGGDSAV+WA   + E I   V+IIHRR+++R+    ++ L  SK N+L       +   +  + L ++  + ++++ L  D ++V YG +SS   I+    ++ EK   V+    +TNI+  +A GD   +  K N I +   EA  A+
  S:     1 MREDTKVYDITIIGGGPVGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKIRAQELINNLKEQ-MAKFDQTICLEQAVESVEKQA---DGVFKLVQMKKPTTLKRSCITAGNGAFKPRKLELENAEQYEGKNLHYFVD-DLQKFAGRRVAILGGGDSAVDWA--LMLEPIAKEVSIIHRRDKFRAHEHSVENLHASKVNVLTPFVPAELIGEDKIEQLVLEEVKGDRKEILEIDDLIVNYGFVSSLGPIKNWG-LDIEKNSIVVKSTMETNIEGFFAAGDICTYEGKVNLIASGFGEAPTAV 307
>gi|23099806|ref|NP_693272.1| thioredoxin reductase [Oceanobacillus iheyensis HTE831] >gi|22778037|dbj|BAC14307.1| thioredoxin reductase [Oceanobacillus iheyensis HTE831] (328 aa)
Score = 350, Expect = 3.1e-31, Identities = 95/309 (30%), Positives = 164/309 (53%)
  Q:     4 DLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTL--PFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           D +++DV I+G G  G+F +        +  +IE   ++GGQ   LYP K+IYD   F ++ + ++I +L +Q K   +  I L   I  +  + + ++ + L          K II+ +GNG+F PR+L I N+E  +   +HY +  +   YK K++++LGGGDSAV+WA   + EKI   V ++HRR+++R+    ++ L ++++     Y  I+   S+K   I+ +E + E+ +    D ++  YG ISS   I+    +  EK   V++   +TNI  +YA GD   +  K   I T   E   A+
  S:     2 DSKVFDVTIIGAGPTGLFTAFYGGMREASVKIIESLPHIGGQLTALYPEKYIYDIAGFPKVHAQELIDRLEEQAK-FFDPEIVLGQAIDKV--ERLEDETIRLTSNTGEVHLTKTIIITAGNGAFQPRRLNIGNSEAFEGKNLHYYVR-DMNQYKGKRVVLLGGGDSAVDWA--LMLEKIAAKVTLVHRRDQFRAHEHSVNQLKESSVEILTPYAPINVEASDKIEKIQLQEVKGEKIIDVEVDDIICNYGFISSLGPIKDWG-LEIEKNSIVVNSKMETNIPGVYAAGDVCTYDGKVKLIATGFGEGPTAI 306
>gi|196040506|ref|ZP_03107806.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus NVH0597-99] >gi|196028638|gb|EDX67245.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus NVH0597-99] (329 aa)
Score = 343, Expect = 2.1e-30, Identities = 93/312 (29%), Positives = 167/312 (53%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEIN-NEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M E+ ++YD+ I+GGG  G+F +        +  +IE    LGGQ   LYP K+IYD   F ++++ +++  L +Q K + +  + LD  +  +  Q      +F   TNK + Y+K +I+ +GNG+F PR+LE+      +   +HY ++ +   +  K+++V GGGDSAV+W    + E I + V I+HRR+++R+    ++ L  +       Y  ++    +K   + ++H +TE++  +  D V+V YG +SS   I+    ++ +K   +++   +TNI  IYA GD   +  K   I     EA  A+
  S:     1 MAENQKVYDITIIGGGPTGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKVRAQELVDNLKEQMK-KFDPTVCLDEAVDTLEKQA---DGIFKLVTNKQTHYSKSVIITAGNGAFQPRRLELEGTAKYEKKNLHYFVD-DMNKFAGKRVVVFGGGDSAVDWT--MMLEPIADKVTIVHRRDKFRAHEHSVESLMNSRAEVSTPYVPVELIGDDKIEQVVLQHVKTEEKIIIDVDDVIVNYGFVSSLGPIKNWG-LDIQKNSILVNSKMETNIPGIYAAGDICTYEGKVKLIACGFGEAPTAV 307
>gi|187605883|ref|ZP_02992066.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Exiguobacterium sp. AT1b] >gi|187482049|gb|EDU20070.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Exiguobacterium sp. AT1b] (325 aa)
Score = 342, Expect = 2.2e-30, Identities = 96/309 (31%), Positives = 162/309 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDI-LNITWQTINEQE--LFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           DV I+GGG  G+F +  +    L++ LIE    LGGQ   LYP K+IYD   F ++K+ D+I +L  Q         Q + D  L  T +T+   E   F+  TNK  ++ K II+ +GNG+F+ R L ++    D   +HY ++   E ++++++++ GGGDSAV+WA   + E I   V I+HRR+ +R+    ++ +  S  N+L   N E +      +++ +  K+ E  + +  D ++  YG +SS   I+    +  EK    +D   +T +  I+A GD   +  K   I T   EA  A+  + +
  S:     6 DVIIIGGGPVGLFTAFYAGMRQLDTTLIESLPQLGGQLSTLYPEKYIYDIAGFPKVKAQDLIDQLKAQAD-------QFEQDYRLGETVETVERLEDGTFVLTTNKEEYHTKAIIITAGNGAFSARPLGLDGCE-DYANLHYFVD-NMEKFRDRRVMIAGGGDSAVDWA--LMLEGIAKEVHIVHRRDRFRAHEHTVEQMKASTINVLTPYNIESLSGETHIESVELTDKDGE-SKIVEIDDLICNYGFVSSLGPIKNWG-MEFEKNTIRVDSRMETTVAGIFACGDIATYEGKVKLIATGFGEAPIAINQVKQ 306
>gi|153180492|ref|ZP_01933535.1| hypothetical protein LMMG_01896 [Listeria monocytogenes F6900] >gi|133731885|gb|EBA33583.1| hypothetical protein LMMG_01896 [Listeria monocytogenes F6900] (304 aa)
Score = 339, Expect = 5.6e-30, Identities = 94/283 (33%), Positives = 160/283 (56%)
  Q:    30 NLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFE--TNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PIN---IELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           N +  +IE    LGGQ   LYP K+IYD P +  +++ +++  LIQQ K   +  + L+  +     Q++ +Q    FE  T K++ Y+K II+ +GNG+F PR+L++   E  +   IHY +N +   +  +++ V GGGDSAV+WA   + EK+ ++VAI+HRRN +R+    ++ L K++I  K  +   E++   +    +T++  + +  +TL  D  ++ YG +SS  PI    +EL      E+   V++   +T+I  IY  GD   +  K   I T   EA  A+
  S:     3 NASVKIIESLPQLGGQLSTLYPEKYIYDIPGYPSVRAQELVNNLIQQMKP-FDPTVALEEAV-----QSVEKQVDGTFEIITKKDTHYSKAIIITAGNGAFEPRRLDLPEAEQYEGTNIHYFIN-DLSRFSGRRVAVCGGGDSAVDWA--LMLEKVASSVAIVHRRNAFRAHEHSVNNLEKSSIAIKTPFIPTEVLGNGDKLTHITLQEVKGDTTETLEIDDFIINYGFVSSLGPIKNWGLEL------ERNSIVVNSKMETSIPGIYCAGDICTYDGKVKLIATGFGEAPTAV 281
>gi|163789683|ref|ZP_02184120.1| pyridine nucleotide-disulfide oxidoreductase family protein [Carnobacterium sp. AT7] >gi|159874905|gb|EDP68972.1| pyridine nucleotide-disulfide oxidoreductase family protein [Carnobacterium sp. AT7] (329 aa)
Score = 339, Expect = 5.8e-30, Identities = 99/306 (32%), Positives = 158/306 (51%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQK--TNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           I+D+ I+GGG  G+FA+      N    +IE    LGGQ   LYP K IYD      +K  ++I  L  Q   + +  I L+ +++N+     N+  +F   T  +  Y+K II+ +GNG+F PR+LE+ + +  +   +HY +N   E +KN+ + + GGGDSAV+WA     E I   V +IHRRN++R+    +  L+++++     Y  +    ++   K++ +K    E E+ L  D  L+ YG  SS   I  +     E  +  I +N K  T +  IYA GD   +  K   I T   EA  A+
  S:     6 IFDITIIGGGPVGMFAAFYGGMRNAKVKIIESLPQLGGQLSMLYPEKDIYDIAALPVVKGQELIDNLSVQ-ISRFDPTICLEEEVINV---VKNDNGIFELTTTNSVHYSKSIIITAGNGAFQPRRLELEHADDYEGKTLHYYVN-NIEQFKNRTVAICGGGDSAVDWA--LALEPIAKKVYLIHRRNKFRALEHSVSLLNQSSVEVITPYIPVALKGNHPHIKSIQLKEVRGESEKELEIDNFLINYGFTSS---IGPMKNWGFEVKRNEIPVNTKMETTVPGIYAAGDICTYEGKIKLIATGFGEAPTAI 307
>gi|165870857|ref|ZP_02215509.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. A0488] >gi|166984327|ref|ZP_02255683.1| thioredoxin-disulfide reductase [Bacillus cereus AH187] >gi|166996870|ref|ZP_02263330.1| thioredoxin-disulfide reductase [Bacillus cereus AH820] >gi|167635010|ref|ZP_02393328.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. A0442] >gi|167640054|ref|ZP_02398322.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. A0193] >gi|170685862|ref|ZP_02877085.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. A0465] >gi|170706951|ref|ZP_02897408.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. A0389] >gi|177652282|ref|ZP_02934785.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. A0174] >gi|190567145|ref|ZP_03020060.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis Tsiankovskii-I] >gi|196032763|ref|ZP_03100176.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus W] >gi|196043956|ref|ZP_03111193.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus 03BB108] >gi|164713366|gb|EDR18891.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. A0488] >gi|167512135|gb|EDR87513.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. A0193] >gi|167529760|gb|EDR92509.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. A0442] >gi|170128054|gb|EDS96924.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. A0389] >gi|170670326|gb|EDT21066.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. A0465] >gi|172082288|gb|EDT67354.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. A0174] >gi|190561649|gb|EDV15619.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis Tsiankovskii-I] >gi|195994192|gb|EDX58147.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus W] >gi|196025292|gb|EDX63962.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus 03BB108] (329 aa)
Score = 338, Expect = 6.8e-30, Identities = 92/312 (29%), Positives = 167/312 (53%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEIN-NEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M E+ ++YD+ I+GGG  G+F +        +  +IE    LGGQ   LYP K+IYD   F ++++ +++  L +Q K + +  + L+  +  +  Q      +F   TNK + Y+K +I+ +GNG+F PR+LE+      +   +HY ++ +   +  K+++V GGGDSAV+W    + E I + V I+HRR+++R+    ++ L  +       Y  ++    +K   + ++H +TE++  +  D V+V YG +SS   I+    ++ +K   +++   +TNI  IYA GD   +  K   I     EA  A+
  S:     1 MAENQKVYDITIIGGGPTGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKVRAQELVDNLKEQMK-KFDPTVCLEEAVDTLEKQA---DGIFKLVTNKQTHYSKSVIITAGNGAFQPRRLELEGTAKYEKKNLHYFVD-DMNKFAGKRVVVFGGGDSAVDWT--MMLEPIADKVTIVHRRDKFRAHEHSVESLMNSRAEVSTPYVPVELIGDDKIEQVVLQHVKTEEKIIIDVDDVIVNYGFVSSLGPIKNWG-LDIQKNSILVNSKMETNIPGIYAAGDICTYEGKVKLIACGFGEAPTAV 307
>gi|167938305|ref|ZP_02525380.1| thioredoxin-disulfide reductase [Bacillus cereus AH1134] (329 aa)
Score = 337, Expect = 1.1e-29, Identities = 92/312 (29%), Positives = 166/312 (53%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEIN-NEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M E+ ++YD+ I+GGG  G+F +        +  +IE    LGGQ   LYP K+IYD   F ++++ +++  L +Q K + +  + L+  +  +  Q      +F   TNK + Y+K +I+ +GNG+F PR+LE+      +   +HY ++ +   +  K+++V GGGDSAV+W    + E I   V I+HRR+++R+    ++ L  +       Y  ++    +K   + ++H +TE++  +  D V+V YG +SS   I+    ++ +K   +++   +TNI  IYA GD   +  K   I     EA  A+
  S:     1 MAENQKVYDITIIGGGPTGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKVRAQELVDNLKEQMK-KFDPTVCLEEAVDTLEKQA---DGIFKLVTNKQTHYSKSVIITAGNGAFQPRRLELEGTAKYEKKNLHYFVD-DMNKFAGKRVVVFGGGDSAVDWT--MMLEPIAEKVTIVHRRDKFRAHEHSVESLMNSRAEVSTPYVPVELIGDDKIEQVVLQHVKTEEKIIIDVDDVIVNYGFVSSLGPIKNWG-LDIQKNSILVNSKMETNIPGIYAAGDICTYEGKVKLIACGFGEAPTAV 307
>gi|163942642|ref|YP_001647526.1| thioredoxin-disulfide reductase [Bacillus weihenstephanensis KBAB4] >gi|163864839|gb|ABY45898.1| Thioredoxin-disulfide reductase [Bacillus weihenstephanensis KBAB4] (329 aa)
Score = 335, Expect = 1.5e-29, Identities = 90/312 (28%), Positives = 168/312 (53%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEIN-NEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDF--NESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M E+ ++YD+ I+GGG  G+F +        +  +IE    LGGQ   LYP K+IYD   F ++++ +++  L +Q K + +  + L+  +  +  Q      +F   TNK + Y+K +I+ +GNG+F PR+LE+      +   +HY ++ +   +  ++++V GGGDSAV+W    + E I + V I HRR+++R+    ++ L  +       Y  ++   +++ + + ++H +TE++  +  D V+V YG +SS   I+    ++ +K   +++   +TNI  IYA GD   +  K   I     EA  A+
  S:     1 MTENQKVYDITIIGGGPTGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKVRAQELVDNLKEQMK-KFDPTVCLEEAVDTLEKQA---DGIFKLVTNKQTHYSKSVIITAGNGAFQPRRLELEGTAKYEKKNLHYFVD-DMNKFAGRRVVVFGGGDSAVDWT--MMLEPIADKVTIAHRRDKFRAHEHSVESLMNSRAEVSTPYVPVELIGDDTIEQVVLQHVKTEEKIIIDVDDVIVNYGFVSSLGPIKNWG-LDIQKNSILVNSKMETNIPGIYAAGDICTYEGKVKLIACGFGEAPTAV 307
>gi|125623628|ref|YP_001032111.1| TrxB2 protein [Lactococcus lactis subsp. cremoris MG1363] >gi|124492436|emb|CAL97378.1| TrxB2 protein [Lactococcus lactis subsp. cremoris MG1363] (321 aa)
Score = 335, Expect = 1.5e-29, Identities = 92/310 (29%), Positives = 159/310 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP--IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISKN 318
           D+ IVG G  G++A+  +    L+  +IE     GGQP  LYP K IYD      +  +D+ K L++Q   Q +  + L   +  I      E  +F   T+K++  AK ++L +G G   PRKL I+NE    +   I Y +    E ++ K + V GGGDSA++W+   + EK+   V ++HRR  +R     +D +  + I     Y   +FNE++  L +K  + E+      D +LV YG +++ +++    ++++  G+   D   ++NI+ +Y  GDA+ +  K   +     EAV A+  ++KN
  S:     5 DLIIVGAGPVGLYAAFYAGMRGLSVAIIESAQVAGGQPQNLYPEKLIYDIAGLPAVTGADLTKNLLEQ-LAQISHRLFLGEGVQKIE----KEDGIFSVITDKSNRKAKAVLLTTGAGLLKPRKLGIDNEENLANEGKISYFITSLKE-FEGKNVAVFGGGDSALDWS--LMLEKVAKEVHLVHRRTAFRGHEMTVDRVMDSGIQVHTPYTFSNFNEND--LELKKVKAEENLNFSIDKILVNYGFLTNQVSLAENLEVSR-NGRVKADSMMQSNIEGLYVAGDASDYAGKMPLMSVGFGEAVHAINAMTKN 305
>gi|162447330|ref|YP_001620462.1| thioredoxin reductase [Acholeplasma laidlawii PG-8A] >gi|161985437|gb|ABX81086.1| thioredoxin reductase [Acholeplasma laidlawii PG-8A] (331 aa)
Score = 335, Expect = 1.5e-29, Identities = 97/313 (30%), Positives = 165/313 (52%)
  Q:     4 DLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIK-KLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNK----TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHIS 316
           D  + +V I+G G  G++A+ ++   NL + +IE  +  GGQ   +Y +K+IYD P F +I + D I  +++Q  + + +  I  + + ++I        + F+  T   +   K +++A G G F P+KL+I+    +  +    LN     +K+KKI+VLGGGDSA++WA    E   T +V ++HRR+E+R+    +D   +   +  L   I+D  E N     TL +KH +T +   L  DY++V YG + +   ++    I  EKG   +D   KT++  IYA G+   +  K   I T   EA  A+  I+
  S:     7 DAFMLEVLIIGAGPTGLYAAFLAGLRNLKAAVIESSAEPGGQLTAVYKDKYIYDIPGFPKITAKDYIDGQVLQYERFKSDLPIYYNEEAIDIK----KHDDHFIVTTTTKTIETKFVLIAHGGGGFVPQKLKIDEHYDNILYFIKDLNQ----FKDKKIVVLGGGDSALDWAIDLSE--YTKDVTLVHRRDEFRALQSSVDHFREKGTI--LTPYIVDTVEGNDKLVHTLVLKHAKTHERLNLDADYIVVNYGFVLTKSRLDEWG-IEGEKGLIKVDYTMKTSLDGIYAAGNGIDYPGKVKLISTGQGEAATAIQSIT 311
>gi|184156179|ref|YP_001844519.1| thioredoxin reductase [Lactobacillus fermentum IFO 3956] >gi|183227523|dbj|BAG28039.1| thioredoxin reductase [Lactobacillus fermentum IFO 3956] (330 aa)
Score = 335, Expect = 1.8e-29, Identities = 93/310 (30%), Positives = 159/310 (51%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFN---ESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           YDV I+GGG  G+FA+       L + LIE    LGGQP  LYP K ++D      +   ++   L  Q  E    +  L   + ++  +   +   F   + K +  +K I++A GNG+F+PRKL +   E ++   + Y  N   E +K++++ VLGGGD+A++ A   + E +   V ++HRR+ +R+    +  L  + I +   Y   D     + + TL +K    ++E+ L  D VLV YG  S+   ++  +  +  E+G+  +D   KT++  +YAIGD   +  K   I T   EA  A+ +++K
  S:     5 YDVTIIGGGPAGMFAAFYCGLHQLKAQLIEALPQLGGQPAALYPEKRVWDVAGKAGVTGQELADDLAAQ-IEVAPVDQFLGEKVTDVVKE---DDGSFTIHSAKRTSTSKSIVIAMGNGAFSPRKLALPGAEELEGKQVRYFAN-HKEDFKDQRVAVLGGGDAAIDMA--LMLEDVAEQVYLVHRRDAFRALEHTVAQLEASTIEKLTPYLPKDLTVNADQSVTLNLKKMRADEERPLEVDKVLVNYGFTSNNAALKDWSLDLASERGQIKVDQTMKTSVPGVYAIGDGVVYEGKVALIATGFGEAPTAITNLAK 312
>gi|30264969|ref|NP_847346.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. Ames] >gi|42784111|ref|NP_981358.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus ATCC 10987] >gi|47530465|ref|YP_021814.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. 'Ames Ancestor'] >gi|47566962|ref|ZP_00237679.1| oxidoreductase, pyridine nucleotide-disulfide family [Bacillus cereus G9241] >gi|49187787|ref|YP_031040.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. Sterne] >gi|49481010|ref|YP_038950.1| thioredoxin-disulfide reductase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140597|ref|YP_086231.1| thioredoxin-disulfide reductase [Bacillus cereus E33L] >gi|65316918|ref|ZP_00389877.1| COG0492: Thioredoxin reductase [Bacillus anthracis str. A2012] >gi|118480018|ref|YP_897169.1| thioredoxin-disulfide reductase [Bacillus thuringiensis str. Al Hakam] >gi|30259646|gb|AAP28832.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. Ames] >gi|42740042|gb|AAS43966.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus ATCC 10987] >gi|47505613|gb|AAT34289.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. 'Ames Ancestor'] >gi|47556280|gb|EAL14614.1| oxidoreductase, pyridine nucleotide-disulfide family [Bacillus cereus G9241] >gi|49181714|gb|AAT57090.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus anthracis str. Sterne] >gi|49332566|gb|AAT63212.1| thioredoxin-disulfide reductase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51974066|gb|AAU15616.1| thioredoxin-disulfide reductase [Bacillus cereus E33L] >gi|118419243|gb|ABK87662.1| thioredoxin-disulfide reductase [Bacillus thuringiensis str. Al Hakam] (331 aa)
Score = 334, Expect = 2.1e-29, Identities = 91/310 (29%), Positives = 166/310 (53%)
  Q:     3 EDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEIN-NEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           E+ ++YD+ I+GGG  G+F +        +  +IE    LGGQ   LYP K+IYD   F ++++ +++  L +Q K + +  + L+  +  +  Q      +F   TNK + Y+K +I+ +GNG+F PR+LE+      +   +HY ++ +   +  K+++V GGGDSAV+W    + E I + V I+HRR+++R+    ++ L  +       Y  ++    +K   + ++H +TE++  +  D V+V YG +SS   I+    ++ +K   +++   +TNI  IYA GD   +  K   I     EA  A+
  S:     5 ENQKVYDITIIGGGPTGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKVRAQELVDNLKEQMK-KFDPTVCLEEAVDTLEKQA---DGIFKLVTNKQTHYSKSVIITAGNGAFQPRRLELEGTAKYEKKNLHYFVD-DMNKFAGKRVVVFGGGDSAVDWT--MMLEPIADKVTIVHRRDKFRAHEHSVESLMNSRAEVSTPYVPVELIGDDKIEQVVLQHVKTEEKIIIDVDDVIVNYGFVSSLGPIKNWG-LDIQKNSILVNSKMETNIPGIYAAGDICTYEGKVKLIACGFGEAPTAV 309
>gi|168143665|ref|ZP_02586894.1| Thioredoxin reductase [Bacillus cereus G9842] (329 aa)
Score = 333, Expect = 3.1e-29, Identities = 92/312 (29%), Positives = 166/312 (53%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEIN-NEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M E+ ++YD+ I+GGG  G+F +        +  +IE    LGGQ   LYP K+IYD   F ++++ +++  L +Q K + +  + L+  +  +  Q      +F   TNK + Y+K +I+ +GNG+F PR+LE+      +   +HY ++ +   +  K+++V GGGDSAV+W    + E I   V I+HRR+++R+    ++ L  +       Y  ++    +K   + ++H +TE++  +  D V+V YG +SS   I+    ++ +K   +++   +TNI  IYA GD   +  K   I     EA  A+
  S:     1 MAENQKVYDITIIGGGPTGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKVRAQELVDNLKEQMK-KFDPTVCLEEAVDTLEKQA---DGIFKLVTNKQTHYSKSVIITAGNGAFQPRRLELEGTAKYEKKNLHYFVD-DMNKFAGKRVVVFGGGDSAVDWT--MMLEPIAEKVTIVHRRDKFRAHEHSVENLMNSRAEVSTPYVPVELIGDDKIEQVVLQHVKTEEKVIIDVDDVIVNYGFVSSLGPIKNWG-LDIQKNSILVNSKMETNIPGIYAAGDICTYEGKVKLIACGFGEAPTAV 307
>gi|116512509|ref|YP_811416.1| thioredoxin reductase [Lactococcus lactis subsp. cremoris SK11] >gi|116108163|gb|ABJ73303.1| Thioredoxin reductase [Lactococcus lactis subsp. cremoris SK11] (321 aa)
Score = 331, Expect = 4.8e-29, Identities = 91/309 (29%), Positives = 158/309 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP--IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           D+ IVG G  G++A+  +    L+  +IE     GGQP  LYP K IYD      +  +D+ K L++Q   Q +  + L   +  I      E  +F   T+K++  AK ++L +G G   PRKL I+NE    +   I Y +    E ++ K + V GGGDSA++W+   + EK+   V ++HRR  +R     +D +  + I     Y   +FNE++  L +K  + E+      D +LV YG +++ +++    ++++  G+   D   ++NI+ +Y  GDA+ +  K   +     EAV A+  ++K
  S:     5 DLIIVGAGPVGLYAAFYAGMRGLSVAIIESAQVAGGQPQNLYPEKLIYDIAGLPAVTGADLTKNLLEQ-LAQISHRLFLGESVQKIE----KEDGIFSVITDKSNRKAKAVLLTTGAGLLKPRKLGIDNEENLANEGKISYFITSLKE-FEGKNVAVFGGGDSALDWS--LMLEKVAKEVHLVHRRTAFRGHEMTVDRVMNSGIQVHTPYTFSNFNEND--LELKKVKAEENLNFSIDKILVNYGFLTNQVSLAENLEVSR-NGRVKADSMMQSNIEGLYVAGDASDYAGKMPLMSVGFGEAVHAINAMTK 304
>gi|168161664|ref|ZP_02596897.1| thioredoxin-disulfide reductase [Bacillus cereus H3081.97] (331 aa)
Score = 331, Expect = 5.1e-29, Identities = 91/310 (29%), Positives = 165/310 (53%)
  Q:     3 EDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEIN-NEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           E+ ++YD+ I+GGG  G+F +        +  +IE    LGGQ   LYP K+IYD   F ++++ +++  L  Q K + +  + L+  +  +  Q      +F   TNK + Y+K +I+ +GNG+F PR+LE+      +   +HY ++ +   +  K+++V GGGDSAV+W    + E I + V I+HRR+++R+    ++ L  +       Y  ++    +K   + ++H +TE++  +  D V+V YG +SS   I+    ++ +K   +++   +TNI  IYA GD   +  K   I     EA  A+
  S:     5 ENQKVYDITIIGGGPTGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKVRAQELVDNLKGQMK-KFDPTVCLEEAVDTLEKQA---DGIFKLVTNKQTHYSKSVIITAGNGAFQPRRLELEGTAKYEKKNLHYFVD-DMNKFAGKRVVVFGGGDSAVDWT--MMLEPIADKVTIVHRRDKFRAHEHSVESLMNSRAEVSTPYVPVELIGDDKIEQVVLQHVKTEEKIIIDVDDVIVNYGFVSSLGPIKNWG-LDIQKNSILVNSKMETNIPGIYAAGDICTYEGKVKLIACGFGEAPTAV 309
>gi|15673629|ref|NP_267803.1| thioredoxin reductase [Lactococcus lactis subsp. lactis Il1403] >gi|12724658|gb|AAK05745.1|AE006395_5 thioredoxin reductase (EC 1.6.4.5) [Lactococcus lactis subsp. lactis Il1403] (321 aa)
Score = 331, Expect = 5.1e-29, Identities = 90/309 (29%), Positives = 158/309 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPI--DSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           D+ IVG G  G++A+  +    L+  +IE     GGQP  LYP K IYD      +  +D+ K L++Q   Q +  + L   +  I      E+ +F   T+K++  AK ++L +G G   PRKL I+NE    +   I Y +    E ++ K + V GGGDSA++W+   + EK+  NV ++HRR  +R     +D +  +N+     Y   +  E+   L +K  ++E+      D +LV YG +++ + +    ++++  G+   D   ++NI+ +Y  GDA+ +  K   +     EAV A+  ++K
  S:     5 DLIIVGAGPVGLYAAFYAGMRGLSVAIIESAQVPGGQPQNLYPEKLIYDIAGLPAVTGADLTKNLLEQ-LAQISHRLFLGESVQKIE----KEEGIFSVTTDKSTRRAKGVLLTTGAGLLKPRKLGIDNEETLANEGKISYFITSLKE-FEGKNVAVFGGGDSALDWS--LMLEKVAKNVHLVHRRTAFRGHEITVDRVMNSNVQVHTPYTFSNLIENE--LELKKIKSEESLNFSIDKILVNYGFLTNQVTLAENLEVSR-NGRVKADSMMQSNIEGLYVAGDASDYPGKMPLMSVGFGEAVHAINAMTK 304
>gi|170016647|ref|YP_001727566.1| thioredoxin reductase [Leuconostoc citreum KM20] >gi|169803504|gb|ACA82122.1| Thioredoxin reductase [Leuconostoc citreum KM20] (360 aa)
Score = 330, Expect = 5.9e-29, Identities = 92/306 (30%), Positives = 160/306 (52%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFY-AKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFN---ESNKTLTIKH-KETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGK-YVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           IYD+AI+GGG  G+FA+  +   +   IL+E  + LGGQ   LYP K I D   F   K +D I  L QQ  ++   +I+  T ++N+         LF   TN  +F  AK +I+A+G G+F PRK+++   + +    +HY +  + + + N  I + GGGDSAV+ A       I     +IHRR+ +R+    +  L  + ++++   +I+  +   +    L + H K+ ++   +  D +++ YG IS    I+      K  G+ + ++   +TN+  ++ IGDA+H+  K + I     EA  A+
  S:    26 IYDIAIIGGGPVGMFAAFYAGLRDTKVILLESLATLGGQVTSLYPEKTILDVAGFSATKGTDFIAALSQQ-LQRFPVDIRTQTTVVNLE----KSGNLFTVTTNNGTFIQAKTVIVATGKGAFEPRKIQVAGVDNLVGQGVHYFIKNKHD-FDNHHIAIAGGGDSAVDMATML--SHIAAETTLIHRRDNFRAMEQSVKTLMASKVIRETPKKILSVSKQPDGRLKLRLAHVKDNQQVNDIIVDDLIINYGFISENKTIQAWAVQPKLAGQVFAVNQTLETNVPGLFVIGDASHYIGKADLIAIGLGEAPSAV 330
>gi|42518597|ref|NP_964527.1| hypothetical protein LJ0501 [Lactobacillus johnsonii NCC 533] >gi|41582882|gb|AAS08493.1| hypothetical protein LJ_0501 [Lactobacillus johnsonii NCC 533] (318 aa)
Score = 330, Expect = 6.5e-29, Identities = 97/311 (31%), Positives = 163/311 (52%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYR---SSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQ--TLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISKN 318
           YD+AI+G G  G+FA++ +N   L +I  +    +GGQ   LYP K I D P F  IK  +++ +L +Q    +N+ + L   +  I++ T   +++ +     + +  K +++A+G G+F P+ L ++  P     IHYS+    EI+ NKK+ +LGGGDSA++WA   +E   T++V ++HRRNE+R   SS   +  L    +L     + +  N +N+   + H+        T   D +LV YG  S   N +L    I  E     +    +TN+ ++YAIGDA  +  +   I     EA  A+  I ++
  S:     4 YDLAIIGAGPVGLFAASFANLHGLKTITFDALDEVGGQINMLYPQKDIKDIPAFSSIKGKELVSRLFEQT---ENTKLTLSHKVKKISFST--GEDIII----DDDYQVKSLLIATGLGAFKPKTLPLSTTPELQAHIHYSMQ-HPEIFSNKKVAILGGGDSALDWA---LELSKTSDVYVVHRRNEFRGLESSVSQLKSLKNVELLTPYLPKELHLN-NNRIELVLHRVGASHDFITKDVDEILVAYGFKSD--NRQLRKWGIELENNLISVSQTMQTNLPHVYAIGDAITYPGRVPMIALGFGEAQIAISSIMQD 304
>gi|116617425|ref|YP_817796.1| thioredoxin reductase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096272|gb|ABJ61423.1| Thioredoxin reductase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (336 aa)
Score = 329, Expect = 8.8e-29, Identities = 93/306 (30%), Positives = 160/306 (52%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDF-NESNKTLTIKHKETEKEQT---LPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           +YDVAI+GGG  G+F +  +   +  ++L+E  + LGGQ   LYP K I D   F  IK S +I  L +Q K        +D              +LF    N  +SF AK II+ +G GSF PRK++++  + +    IHY +  + + + N  + + GGGDSA++ A    E   T++  IIHRR+++R+    +  LS+++++++   ++     +S+  L I   + + +Q    +  D +++ YG IS    +   + Q   E   + +D   +T I  ++AIGDA+H+  K + I     EA  A+
  S:     4 LYDVAIIGGGPVGMFTAFYAGLRDTKAVLVESLATLGGQVTSLYPEKKILDVAGFTGIKGSALIDSLDEQMKL-----FPIDIKTSTTVTNVTKTNDLFTVTINNGSSFQAKTIIITTGKGSFEPRKMQVSGVDQLVGQGIHYFVTNKHD-FDNHDVAIAGGGDSAIDMATMLNE--FTHSTRIIHRRDQFRAMEQSVKQLSQSSVIKETPKKVSQIEKQSDGKLKITLAQVKNDQVTNDICVDDLIINYGFISENKIVHGWDIQPENEGQAFSVDQAMQTTIPGVFAIGDASHYEGKADLIAVGFGEAPTAV 308
>gi|30022967|ref|NP_834598.1| thioredoxin reductase [Bacillus cereus ATCC 14579] >gi|75758938|ref|ZP_00739049.1| Ferredoxin--NAD(P)(+) reductase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|168137388|ref|ZP_02580617.1| Thioredoxin reductase [Bacillus cereus B4264] >gi|29898527|gb|AAP11799.1| Thioredoxin reductase [Bacillus cereus ATCC 14579] >gi|74493612|gb|EAO56717.1| Ferredoxin--NAD(P)(+) reductase [Bacillus thuringiensis serovar israelensis ATCC 35646] (331 aa)
Score = 329, Expect = 9.0e-29, Identities = 91/310 (29%), Positives = 165/310 (53%)
  Q:     3 EDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEIN-NEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           E+ ++YD+ I+GGG  G+F +        +  +IE    LGGQ   LYP K+IYD   F ++++ +++  L +Q K + +  + L+  +  +  Q      +F   TNK + Y+K +I+ +GNG+F PR+LE+      +   +HY ++ +   +  K+++V GGGDSAV+W    + E I   V I+HRR+++R+    ++ L  +       Y  ++    +K   + ++H +TE++  +  D V+V YG +SS   I+    ++ +K   +++   +TNI  IYA GD   +  K   I     EA  A+
  S:     5 ENQKVYDITIIGGGPTGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKVRAQELVDNLKEQMK-KFDPTVCLEEAVDTLEKQA---DGIFKLVTNKQTHYSKSVIITAGNGAFQPRRLELEGTAKYEKKNLHYFVD-DMNKFAGKRVVVFGGGDSAVDWT--MMLEPIAEKVTIVHRRDKFRAHEHSVENLMNSRAEVSTPYVPVELIGDDKIEQVVLQHVKTEEKVIIDVDDVIVNYGFVSSLGPIKNWG-LDIQKNSILVNSKMETNIPGIYAAGDICTYEGKVKLIACGFGEAPTAV 309
>gi|194467157|ref|ZP_03073144.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Lactobacillus reuteri 100-23] >gi|194454193|gb|EDX43090.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Lactobacillus reuteri 100-23] (332 aa)
Score = 326, Expect = 2.0e-28, Identities = 95/312 (30%), Positives = 160/312 (51%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE-LFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQK---LNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ----INKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           +IYDV I+GGG  G+FAS       L++ LIE    LGGQ   LYP K ++D      +   D+I KL     E++ +   +D  +       I E +  F  ++ K    ++ +I+A GNG+F PRKL +     I+   + Y +N + + Y +K++ +LGGGDSA++ A   + E +   V ++HRR+++R     +  L ++++      L   +   ++   TL +K   +E E  L  D ++V YG  S   N   LNQ    +  E+    +D   +T+++ +YAIGD   +  K   I     EA  A+  ++K
  S:     4 KIYDVTIIGGGPAGMFASFYCGLHELDAQLIESLPQLGGQVGALYPEKQVWDVAGMPGVTGHDLIAKL-----EEQMAVAPIDQFLGETVEDVIKEDDGTFTIKSAKRVSRSRAVIIALGNGAFTPRKLALEGATEIEGKQLSYFVNHKAD-YADKRVAILGGGDSAIDIA--LMLEPVAKEVHLVHRRDQFRGLEHTVTQLKQSSVQLDTPFLPRTLTVEDDETVTLDLKKMRSEDEAQLNVDKIVVNYGFTS---NNAALNQWSLDLAAERNLIKVDSMMETSVEGVYAIGDGVTYPGKVALIAAGFGEAPTAVTALAK 313
>gi|83855571|ref|ZP_00949100.1| thioredoxin reductase [Croceibacter atlanticus HTCC2559] >gi|83849371|gb|EAP87239.1| thioredoxin reductase [Croceibacter atlanticus HTCC2559] (353 aa)
Score = 324, Expect = 3.2e-28, Identities = 101/300 (33%), Positives = 163/300 (54%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-------NYEIIDFNESNK--TLTIKHKETEKEQT-LPFDYVLVQYGQISS--PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+F    +    L   LI+     GGQ  E+YP K IYD P F E+ + D++  L++Q +  +          L    QTI++QE   F+  TNK +  +A  + +A G GSF PRK  I+N +  +   + Y +  + E+Y++KK+++ GGGDSA++W+ +  +  + + V ++HRR+E+R +   +D + K + L KL       N E++  N S K  ++ I+HK+   + T L  D  +  +G      PI    L +I K   K    L+ +TNI  IYAIGD   +  K   I+    EA
  S:     5 DILIIGAGPTGLFTVFEAGLLKLKCHLIDALPQPGGQCSEIYPKKPIYDIPAFPEVLAGDLVNNLMKQIEPFQPGF------TLGERAQTIDKQEDGTFIVTTNKGTKHHAPVVAIAGGLGSFEPRKPPISNIKDFEDRGVSYIIR-DPEVYRDKKVIIAGGGDSALDWSIFLAD--VASEVTLVHRRSEFRGA---LDSVEKVSELSKLGKIKLVTNAEVVGINGSEKLESVVIQHKDKAAQDTLLEVDDFIPLFGLSPKLGPIADWGL-EIEKNAIKVDNTLDYQTNIPGIYAIGDVNTYPGKLKLILCGFHEA 307
>gi|169190014|ref|ZP_02849999.1| Thioredoxin-disulfide reductase [Paenibacillus sp. JDR-2] >gi|169003231|gb|EDS50102.1| Thioredoxin-disulfide reductase [Paenibacillus sp. JDR-2] (333 aa)
Score = 324, Expect = 3.2e-28, Identities = 88/295 (29%), Positives = 157/295 (53%)
  Q:    18 GGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKT--LTIKHKETEKEQTLPFDYVLVQYGQISS--PI---NIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
            G+FA+        +  +IE    LGGQ   LYP K+IYD   F ++ + +++ +LI+Q        + L+  ++ +  Q+   + LF   TNK   YAK +I+ +G G+F PRKLE+      +   +HY +  +   +K +K+L+ GGGDSAV+WA   + E I  +V ++HRR+++R+    ++ L  + ++ +   E+   +   +   +T+   +T+ +  +  D V+V YG +SS  PI    IE+      + G  ++D   +T++  I+A GD T +  K   I     EA  A+
  S:    21 AGLFAAFYGGMRQASVKIIESMPQLGGQLAALYPEKYIYDVAGFPKVTAQELVDRLIEQ-ISLFQPEVLLEEKVVEVNKQS---ERLFEVITNKAVHYAKAVIITAGVGAFEPRKLELPEAVQYEKSNLHYFVG-DLNRFKGQKVLLTGGGDSAVDWA--LMLEPIAESVTLVHRRDKFRAHEHSVENLMNSKVIVQTPKEVTSLHGDGRISRVTLTDVKTKDQTEVEVDAVIVNYGFVSSLGPIAEWGIEI------QGGSIIVDTRMETSVSGIFAAGDITTYPGKLKLIAVGFGEAPTAI 310
>gi|126653464|ref|ZP_01725560.1| thioredoxin reductase [Bacillus sp. B14905] >gi|126589820|gb|EAZ83953.1| thioredoxin reductase [Bacillus sp. B14905] (349 aa)
Score = 324, Expect = 3.4e-28, Identities = 94/306 (30%), Positives = 164/306 (53%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           +YDV IVGGG  G++ +  S   +L + +IE  S LGG+ M +YP K I+D      I    +I +L++Q  +  +  I L+  +  +  Q   +    L  +     Y+K +ILA G G    +KLEI   +  +   +HY++  E EI++NK +L+ GGG+SAV+WAN    E I  +V I+HRR+++      +  ++++++  K  YE++  +      ++++I +KETE+ + +  D V+V +G       +E    ++ E G  +++  ++TNI+ IY  GD      K   I  A  + V AL
  S:     5 LYDVTIVGGGPAGLYTAFYSGMRDLKTKIIEYSSQLGGR-MLIYPEKMIWDVGGVTPILGGQLINQLVEQ-AQTFDPTIVLNQKVEGLEKQP--DGTFILTSSTGEKHYSKTVILAVGYGVLTMQKLEIEGADRYEVTNLHYTVQ-ELEIFRNKHVLISGGGNSAVDWANEL--EPIAASVTIVHRRDDFGGHEKNVLRINESSVCVKTPYEVVQLHSDGDLIQSVSIMNKETEEIERVEVDAVIVNHGLKCDYGALEEWG-LHIEDGVALVNEKRETNIEGIYGAGDFIDHPSKVRLIAGAFTDGVLAL 306
>gi|163786657|ref|ZP_02181105.1| Thioredoxin-disulfide reductase [Flavobacteriales bacterium ALC-1] >gi|159878517|gb|EDP72573.1| Thioredoxin-disulfide reductase [Flavobacteriales bacterium ALC-1] (349 aa)
Score = 315, Expect = 3.2e-27, Identities = 103/312 (33%), Positives = 163/312 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY----EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVID-LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAV----RALWHISKNKK 320
           D+ I+G G  G+F    +    L   LI+     GGQ  ELYP K IYD P F EI + D+   L++Q K+ +          L    +TI +QE   F+  TNK +  +A  I +A G GSF PRK ++ N E  +   ++Y +  + E+Y++KK+++ GGGDSA++W+ +     + + V ++HRRNE+R +   ++ + +  +L K+N     EI      +K   +      + QTL  D  +  +G   SP    + N  +  EK    +D L+ +TNI  IYAIGD   +  K   I+    EA      A   ++ NKK
  S:     5 DILIIGAGPTGLFTVFEAGLLKLKCHLIDALPQPGGQCSELYPKKPIYDIPGFPEILAGDLTANLLEQGKQFQPGF------TLGERAETIEKQEDSSFIVTTNKGTQHHAPIIAIAGGLGSFEPRKPKLENIEKYEDKGVNYFIK-DPEVYRDKKVIIAGGGDSALDWSIFLA--NVASEVTLVHRRNEFRGALDSVEQVQELKLLNKINLITPAEITALYGEDKIEGVSVARNGETQTLEADAFIPLFGL--SPKLGPIGNWGLEIEKNAIKVDTLDYQTNIPGIYAIGDVNTYEGKLKLILCGFHEATLMCQSAYKKLNPNKK 319
>gi|86134267|ref|ZP_01052849.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Tenacibaculum sp. MED152] >gi|85821130|gb|EAQ42277.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Polaribacter dokdonensis MED152] (363 aa)
Score = 313, Expect = 6.0e-27, Identities = 100/300 (33%), Positives = 158/300 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIID-------FNESNKTLTIKHKETEKEQTLPFDYVLVQYG---QISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+F    +    L   LI+     GGQ  E+YP K IYD P + EI + D+  KL++Q K+ +          L    +TI++QE   F+  TNK +  +AK + +A G GSF PRK +I N    +   + Y +  E E+Y++KK+++ GGGDSA++WA +  +  + + V +IHRRNE+R +   +D + K   L+ L    II          +   T  +  K+ E    +  D+ +  +G   ++ S  N  L  +I K   K    L+ +TN+  IYAIGD   +  K   I+    EA
  S:    17 DILIIGAGPTGLFTIFEAGLLKLKCHLIDALPQPGGQCSEIYPKKPIYDIPAYPEILAGDLTAKLLEQTKQFEPGF------TLGERAETIDKQEDGSFIVTTNKGTKHHAKVVAIAGGLGSFEPRKPQIENLAKFEDKGVEYIIK-EPELYRDKKVVISGGGDSALDWAIFLAD--VASEVTLIHRRNEFRGA---LDSVEKAQELKNLGKINIITPAEVKGILGDEKVTGVVVEKKGEDGFIIDTDHFIPLFGLSPKLGSIANWGL--EIEKNAIKVNNALDYQTNVPGIYAIGDVNTYPGKLKLILCGFHEA 317
>gi|193213248|ref|YP_001999201.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chlorobaculum parvum NCIB 8327] >gi|193086725|gb|ACF12001.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chlorobaculum parvum NCIB 8327] (356 aa)
Score = 313, Expect = 6.1e-27, Identities = 97/313 (30%), Positives = 171/313 (54%)
  Q:     2 NEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFY-AKKIILASGNGSFNPRKLEI--NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYR---SSSFMIDCLSKNNILQ-KLNYEIIDFNESNKTLTIKHKETE--KEQTLPFDYVLVQYGQISS--PI---NIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           ++D+R  D+ I+GGG  GIFA+      N++  +IE  S LGGQ   LYP K IYD   F E+ + D+++ L  Q  E+ N ++ L      +T  T  +   F   TN  + Y ++ +++A+G G+F PRKL    N + +    ++Y++    + +K K+++++GGGDSA++W    +  K   +V ++HR  E++    ++  ++    + ++   L  E+    ESN  LT  H  +   +E T+  D +L+  G  S+  P+   ++EL       +   V+D + KT++  +YA GD  H+  K   I T  +EA  A+ H
  S:    11 HQDIR--DLTIIGGGPTGIFAAFQCGMNNISCRIIESMSQLGGQLAALYPEKHIYDVAGFPEVPAIDLVESLWAQ-AERYNPDVVLGE---AVTKYTKLDDGTFETRTNAGNVYRSRAVLIAAGLGAFEPRKLPQLGNIDHLTGSSVYYAVK-SVDNFKGKRVVIVGGGDSALDWTVGLL--KNAESVTLVHRAKEFQGHGKTAHEVEQAKADGLIDVHLQTEVASIEESNGALTHVHLRSSNGEEWTVEADRLLILIGFKSNLGPLAGWDLEL------AENALVVDSHMKTSVDGLYAAGDIAHYPGKLKIIQTGLSEATMAVRH 322
>gi|86134909|ref|ZP_01053491.1| probable thioredoxin resuctase [Tenacibaculum sp. MED152] >gi|85821772|gb|EAQ42919.1| probable thioredoxin resuctase [Polaribacter dokdonensis MED152] (351 aa)
Score = 312, Expect = 7.5e-27, Identities = 97/300 (32%), Positives = 157/300 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY----EIIDFNESNKTLTIKHKETEKEQ-TLPFDYVLVQYGQISS--PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+F    +    L   LI+     GGQ  E+YP K IYD P + EI + D+  KL++Q+K+ +          L    +TI++QE   F+  TNK +  +A  + +A G GSF PRK  I N    +   + Y +  + E+Y+NK +++ GGGDSA++W+ +  +  +  +V +IHRRNE+R +   +D + +     K+      E+I  +   K   ++ K+ +KE   +  D+ +  +G      PI    L +I K   K    L+ +TNI  IYAIGD   +  K   I+    EA
  S:     5 DILIIGAGPTGLFTVFEAGLLKLRCHLIDALPQAGGQCSEIYPKKPIYDIPAYPEILAGDLTDKLLEQSKQFEPGF------TLGERAETIDKQEDGSFIVTTNKGTKHHAPVVAIAGGLGSFEPRKPPIPNIADFEDKGVEYIIR-DPEVYRNKNVVISGGGDSALDWSIFLTD--VAASVTLIHRRNEFRGALDSVDKVQELKDAGKIRLITPAEVIGISGKEKVTAVEVKQKDKENFIIETDHFIPLFGLSPKLGPIGSWGL-EIEKNAIKVNNALDYQTNIPGIYAIGDVNTYPGKLKLILCGFHEA 305
>gi|148544863|ref|YP_001272233.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Lactobacillus reuteri F275] >gi|184154201|ref|YP_001842542.1| thioredoxin reductase [Lactobacillus reuteri F275] >gi|148531897|gb|ABQ83896.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Lactobacillus reuteri F275] >gi|183225545|dbj|BAG26062.1| thioredoxin reductase [Lactobacillus reuteri F275] (332 aa)
Score = 308, Expect = 2.3e-26, Identities = 93/312 (29%), Positives = 157/312 (50%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTIN-EQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQK---LNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ----INKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           +IYDV I+GGG  G+FAS       L++ LIE    LGGQ   LYP K ++D      +   D+I KL     E++ +   +D  +       I  +   F  ++ K    ++ +I+A GNG+F PRKL +     I+   + Y +N + + Y +K++ +LGGGDSA++ A   + E +   V ++HRR+++R     +  L ++++      L   +   ++   TL +K   ++ E  L  D ++V YG  S   N   LNQ    +  E     +D   +T+ + +YAIGD   +  K   I     EA  A+  ++K
  S:     4 KIYDVTIIGGGPAGMFASFYCGLHELDAQLIESLPQLGGQVGALYPEKQVWDVAGMPGVTGHDLIAKL-----EEQMAVAPIDQFLGETVEDVIKGDDGTFTIKSAKRVSRSRAVIIALGNGAFTPRKLALEGAAEIEGKQLSYFVNHKAD-YADKRVAILGGGDSAIDIA--LMLEPVAKEVHLVHRRDQFRGLEHTVTQLKQSSVQLDTPFLPRALTVEDDETVTLDLKKMRSDDEAQLNVDKIVVNYGFTS---NNAALNQWSLDLAAEHNLIKVDSMMETSTEGVYAIGDGVTYPGKVALIAAGFGEAPTAVTALAK 313
>gi|21674332|ref|NP_662397.1| thioredoxin reductase, putative [Chlorobium tepidum TLS] >gi|21647507|gb|AAM72739.1| thioredoxin reductase, putative [Chlorobium tepidum TLS] (360 aa)
Score = 307, Expect = 3.2e-26, Identities = 96/313 (30%), Positives = 169/313 (53%)
  Q:     2 NEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS---FYAKKIILASGNGSFNPRKLEI--NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYR---SSSFMIDCLSKNNILQ-KLNYEIIDFNESNKTLTIKHKETE--KEQTLPFDYVLVQYGQISSPINIELLNQINKE--KGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           + D+R  D+ I+GGG  GIFA+      N++  +IE    LGGQ   LYP K IYD   F E+ + D+++ L  Q  E+ N ++     +LN T     + +   FET  N+   + ++ +++A+G G+F PRKL    N + +    ++Y++    E +K K+++++GGGDSA++W    +  K   +V ++HR +E++    ++  ++    N  +   L  E+    ESN  LT  H  +    + T+  D +L+  G  S   N+  L + + E  +   V+D + KT++  +YA GD  ++  K   I T  +EA  A+ H
  S:    11 HHDMR--DLTIIGGGPTGIFAAFQCGMNNISCRIIESMPQLGGQLAALYPEKHIYDVAGFPEVPAIDLVESLWAQ-AERYNPDV-----VLNETVTKYTKLDDGTFETRTNTGNVYRSRAVLIAAGLGAFEPRKLPQLGNIDHLTGSSVYYAVK-SVEDFKGKRVVIVGGGDSALDWTVGLI--KNAASVTLVHRGHEFQGHGKTAHEVERARANGTIDVYLETEVASIEESNGVLTRVHLRSSDGSKWTVEADRLLILIGFKS---NLGPLARWDLELYENALVVDSHMKTSVDGLYAAGDIAYYPGKLKIIQTGLSEATMAVRH 322
>gi|169826577|ref|YP_001696735.1| thioredoxin reductase [Lysinibacillus sphaericus C3-41] >gi|168991065|gb|ACA38605.1| Thioredoxin reductase [Lysinibacillus sphaericus C3-41] (349 aa)
Score = 304, Expect = 6.9e-26, Identities = 92/306 (30%), Positives = 161/306 (52%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQ---ELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           +YDV IVGGG  G++ +  S   +L + +IE  S LGG+ M +YP K I+D      I    +IK+L++Q +          T ILN   + + +Q      L  +     ++K +ILA G G    +KLEI   +  +   +HY++  E EI++NK +L+ GGG+SAV+WAN    E I  +V I+HRR ++      +  + ++++  K  +E++  +      + ++I +KET + + +  D V+V +G       +E    ++ + G  +++  ++TNI+ IY  GD      K   I  A  + + AL
  S:     5 LYDVTIVGGGPAGLYTAFYSGMRDLKTKIIEYSSQLGGR-MLIYPEKMIWDVGGVTPILGGQLIKQLVEQAQTFD------PTIILNQKVEGLEKQPDGTFILTSSTGEKHFSKTVILAVGYGVLTMQKLEIEGADRYEVTNLHYTVQ-ELEIFRNKHVLISGGGNSAVDWANEL--EPIAASVTIVHRREDFGGHEKNVLRMKESSVCVKTPFEVVQLHSDGDLIQFVSIMNKETNEIERVEVDAVIVNHGLKCDYGALEEWG-LHIKDGVALVNEKRETNIEGIYGAGDFIDHPSKVRLIAGAFTDGILAL 306
>gi|116629118|ref|YP_814290.1| thioredoxin reductase [Lactobacillus gasseri ATCC 33323] >gi|116094700|gb|ABJ59852.1| Thioredoxin reductase [Lactobacillus gasseri ATCC 33323] (332 aa)
Score = 303, Expect = 7.7e-26, Identities = 100/311 (32%), Positives = 161/311 (51%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL-SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQ---TLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQK---------TNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISKN 318
           YD+AI+G G  G+FA++ +N   L +I  +    +GGQ   LYP K I D P F  IK   ++ +L++QN    N+   L   +  I++    E E  L +     +  K +++A+G G+F P+ L ++     +  IHYS+    EI+ NKK+ +LGGGDSA++WA   +E   T++V +IHRRNE+R     ++ L S  N+     Y   D   +N  + +   +    Q   T   D +LV YG  S           N++  K+ I L+           TN+ ++YAIGDA  +  +   I     EA  A+ +I ++
  S:    18 YDLAIIGAGPIGLFAASFANLHGLKTISFDALDEIGGQINMLYPQKNIKDIPAFPSIKGKKLVSQLLEQN---INTKFILSHKVKEISFL---ENENILVD---KKYEVKSLLIATGLGAFKPKTLPLSTTLDVNQHIHYSMQ-HPEIFANKKVAILGGGDSALDWA---LELANTSDVFLIHRRNEFRGLESSVNKLKSLKNVELLTPYLPKDLQLNNNRMELVLHKVGASQDFVTKNVDEILVAYGFKSD----------NRQLRKWGIKLDHNLIAVSQKMHTNLPHVYAIGDAITYPGRVPMIALGFGEAQIAISNIMQD 318
>gi|167045508|gb|ABZ10161.1| putative Pyridine nucleotide-disulphide oxidoreductase [uncultured marine microorganism HF4000_APKG10H11] (342 aa)
Score = 303, Expect = 9.0e-26, Identities = 104/308 (33%), Positives = 169/308 (54%)
  Q:    14 GGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIK--HKETEKEQTLPFDYVLVQ--YGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISKNKKD 321
           G G  G+FAS  S    + + +IE  + LGGQP+ LYP K++YD   F +I + +++K+L+ Q   Q N  I L+  +  +      E  +F   TNKN  Y K +++  G G+  P+KL I + E  +   + Y L  + EI+++KK+L++GGGDSA +WA  F   KI+  + +IHRR+ +R+    I  + +++I  KL  E+      +K   +K  + +T+ E+ +  D +LVQ  Y  I  PI    L      KG+ VI  N+ +TNI+ +YA GD        N ++T  ++   A+  I KN+ D
  S:    20 GSGPTGLFASFYSGMREMKTKIIEAHTELGGQPIVLYPEKYVYDMAGFPKILAKNLVKELVDQ-AAQFNPYICLEEQVEKLEKL---ENGIFKLITNKNIHYTKTVLITGGIGAVVPKKLNIEDLERFEGKGVDY-LVRDKEIFRDKKVLIIGGGDSAADWAIEF--SKISKELTLIHRRDIFRAHENSISKIYESDINIKLFTELKGITGEDKITKVKLINNKTQIEEEIEIDLILVQVGYKAILGPIKEWGLEM----KGRSVIVNNKMETNIEGVYAAGDIALDDFNLNLLVTCVSQGAIAVNWI-KNRID 321
>gi|194017924|ref|ZP_03056532.1| thioredoxin-disulfide reductase [Bacillus pumilus ATCC 7061] >gi|194010390|gb|EDW19964.1| thioredoxin-disulfide reductase [Bacillus pumilus ATCC 7061] (347 aa)
Score = 303, Expect = 9.1e-26, Identities = 89/312 (28%), Positives = 168/312 (53%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNK---TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKY-VIDLNQK--TNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M E L ++DV I+GGG  G++ +  S   +L + ++E    LGG+ + LYP K I+D       +   +IK+L QQ K  +   I L+  I +  +  + +  + +   N +    K +ILA G+G    RKLE+ N +  +   ++Y++  E + +  K++++ GGGDSAV+WAN  V   I  +V +IHRR+ +      +  +  ++      +E+ D + + K    +T++H ET +++ +  D V+V +G      ++ +L +   ++G++ +I++N++  TN+  +YA+GD      K   I     + V AL
  S:     1 MTEQLELFDVTIIGGGPAGMYTAFYSGMRDLKTKVLEYNESLGGKIL-LYPEKVIWDVGGLVPTRGEQLIKQLEQQAKTFEPV-IALNQKITD--FHRLEDGNILITSENGDHHLTKTLILAMGHGIPVQRKLEVENADRYEVTNLYYTVQ-ELKTFAGKRVVISGGGDSAVDWANALV--PIAKSVTVIHRRDMFGGHEKNVANMKASSARILTPHELTDLHGNGKEIEAVTVQHLETGEKERIETDAVIVNHGMKG---DLSVLAEWGLKQGEWGLIEVNEQMETNLPGVYAVGDLCTHKSKVRLIAGTFVDGVNAL 309
>gi|163753035|ref|ZP_02160159.1| hypothetical protein KAOT1_12782 [Kordia algicida OT-1] >gi|161326767|gb|EDP98092.1| hypothetical protein KAOT1_12782 [Kordia algicida OT-1] (351 aa)
Score = 303, Expect = 9.2e-26, Identities = 98/300 (32%), Positives = 161/300 (53%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTIN--EQELFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQ---KLNY----EIIDFNESNKTLTIK-HKETEKEQTLPFDYVLVQYGQISSPINIELLN---QINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+F    +    L + LI+     GGQ  E+YP K IYD P F EI + D+IK L++Q +  +          L    +T+   E + F+  TNK +  +A  +++A G GSF PRK  I N +  +   + Y +  + E+Y+NKK+++ GGGDSA++W+ +  +  + + V ++HRRNE+R +   +D + K   L+   K+N     EI D +  N+   +   K+ E+   L  D+ +  +G   SP    L +   +I K   K     + +TNI  +YAIGD   +  K   I++   EA
  S:     5 DILIIGAGPTGLFTVFEAGLLKLKTHLIDALPQPGGQCAEIYPKKPIYDIPGFPEILAGDLIKNLLKQIESFEPGF------TLGERAETLERLEDDTFIVTTNKGTKHHAPVVVIAGGLGSFEPRKPPIANLQKYEDNGVAYIIR-DPEVYRNKKVVIAGGGDSALDWSIFLAD--VASEVTLVHRRNEFRGA---LDSVEKVQELKNQGKINLITPAEITDLHGENELSGVTVQKKGEEPAFLEVDHFIPLFGL--SPKLGPLGDWGLEIEKNAIKVDNSYDYQTNIPGVYAIGDVNTYKGKLKLILSGFHEA 305
>gi|88801954|ref|ZP_01117482.1| probable thioredoxin resuctase [Polaribacter irgensii 23-P] >gi|88782612|gb|EAR13789.1| probable thioredoxin resuctase [Polaribacter irgensii 23-P] (351 aa)
Score = 302, Expect = 1.1e-25, Identities = 97/300 (32%), Positives = 156/300 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQ--ELFLFETNKNS-FYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSK----NNILQKLNYEIIDFNESNKTLTIKH-KETEKEQTLPFDYVLVQYGQISSPINIELLN---QINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+F    +    +   LI+     GGQ  E+YP K IYD P + EI + D+  KL++Q K+ +          L    +TI +Q  E F+  TNK +  +AK + +A G GSF PRK  I N    +   + Y +  + E+Y+NKK+++ GGGDSA++WA +  +  +   V +IHRRNE+R +   +D + +      I+     E+     ++K   +   ++  +E T+  D+ +  +G   SP    + N   +I K   K    L+ +TNI  IYAIGD   +  K   I+    EA
  S:     5 DILIIGAGPTGLFTVFEAGLLKMRCHLIDALPQAGGQCSEIYPKKPIYDIPAYPEILAGDLTLKLMEQIKQFEPGF------TLGERAETIEKQADETFVVTTNKGTKHHAKTVAIAGGLGSFEPRKPPILNISDFEDKGVEYIIR-DPELYRNKKVVISGGGDSALDWAIFLTD--VAAEVTLIHRRNEFRGALDSVDKVQELKDAGKIIMITPAEVKGILGTDKVTGVAVIRDGGEEFTIVTDHFIPLFGL--SPKLGPIANWGLEIEKNAIKVNNALDYQTNIPGIYAIGDVNTYPGKLKLILCGFHEA 305
>gi|78188912|ref|YP_379250.1| thioredoxin reductase, putative [Chlorobium chlorochromatii CaD3] >gi|78171111|gb|ABB28207.1| thioredoxin reductase, putative [Chlorobium chlorochromatii CaD3] (353 aa)
Score = 301, Expect = 1.5e-25, Identities = 93/314 (29%), Positives = 174/314 (55%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS---FYAKKIILASGNGSFNPRKL-EINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEY----RSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETE--KEQTLPFDYVLVQYGQISSPINIELLNQINKE--KGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           + E++R  D+ I+GGG  GIFA+      N++  +IE    LGGQ   LYP K IYD   F E+ ++ ++  L +Q  E+ +  I     ILN T    ++++  +FE + +S   + ++ +++A+G G+F PRKL ++ N E ++   I Y++      +  K ++++GGGDSA++W+   +  K   +V ++HR +E+    +++  +++      +   L+ E++  +  N+ L   H +++  K +T P D +L+  G  S   NI  L +   E      V+D + KT++  +YA GD  ++  K   I T  ++A  A+ H
  S:    10 IEEEIR--DLTIIGGGPTGIFAAFQCGMNNISCRIIESMPQLGGQLAALYPEKHIYDVAGFPEVPAAGLVDTLWKQ-AERHHPEI-----ILNETVMRYHKRDNGMFEVSVSSGHTYVSRAVLIAAGLGAFTPRKLPQLENIEALEGKSIFYAVK-NVADFTGKHVVIVGGGDSALDWSVGLL--KSAASVTLVHRMHEFQGHGKTAHEVMEARDAGRLNVMLDTEVMGIDVENEELKAVHVQSKNGKTRTFPADRLLLLIGFKS---NIGPLAEWGLEIVDNALVVDSHMKTSVDGLYAAGDIAYYTGKLKIIQTGLSDATMAVRH 322
>gi|146303526|ref|YP_001190842.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Metallosphaera sedula DSM 5348] >gi|145701776|gb|ABP94918.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Metallosphaera sedula DSM 5348] (335 aa)
Score = 301, Expect = 1.5e-25, Identities = 84/297 (28%), Positives = 156/297 (52%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE---LFLFETNKNSFY-AKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL---SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITA 304
           Y+V ++GGG  G+F +  S   ++  +LI+ +  LGGQ + LYP K +YD   F  I++ D+ ++LI+Q K           DI    W    E+    +++ +T+K   Y  K +++A+G G   P +L    E   ++  ++Y++  ++E ++ K++L++GGGDSAV+WA       I   V +IHRR+++R+    +  +   +K     +L     D N   + +   ++ T++E+TL  D V++  G      N+ L   +N +    V++   +TN+  +YA+GD       P   + A
  S:     7 YEVIVIGGGPVGLFGTFYSGLRDMKVLLIDSQDELGGQLVTLYPEKMVYDVGGFAGIQAYDLAQRLIEQAK-------MFGPDIRTREWADTLEKTQDGMWVVKTDKGGEYKTKTVMIAAGIGKITPSRLGAKGEVEYENKGVYYTVRRKSE-FQGKRVLIVGGGDSAVDWA--LTLAPIAKEVTLIHRRDQFRAHERSVKEMFEVAKVYTWHELKEVKGDGNRVTQAIIFDNR-TKEEKTLNVDAVIISIGHKGDLGNM-LKWGLNMKGRDIVVNGKMETNLPGVYAVGDIASVEGMPKLALIA 299
>gi|28379114|ref|NP_786006.1| thioredoxin reductase (NADPH) [Lactobacillus plantarum WCFS1] >gi|28271952|emb|CAD64857.1| thioredoxin reductase (NADPH) [Lactobacillus plantarum WCFS1] (331 aa)
Score = 300, Expect = 1.9e-25, Identities = 88/305 (28%), Positives = 155/305 (50%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNK---TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYV-IDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           YD+ I+GGG  G+FA+  +   N    L+E    LGGQ   LYP K I+D   +  IK  +++ +L +Q   Q   +IQL + + ++T       +  +   +    ++K II+A+G+G+F PR+L ++N    ++  + Y +    + + ++ +LV GGGDSA++ A   + E +  +V I+HRR+ +R     +D L  +++  K  + I    E+      LT+K      E+TL  D ++V YG I+    I   +       + + +D    T++  I AIGD   +  K   I +   EA  A+
  S:     5 YDLTIIGGGPVGMFAAFYAGMRNARVQLLESLPELGGQVQALYPEKIIHDVAGYPAIKGRELVAQLEKQ-LTQFPIDIQLASPVTDVTGAM---GDFTITTASGQQSHSKAIIVATGSGAFEPRRLAVDNAAEFENKQLFYHIP-SVKQFADRTVLVAGGGDSAIDMA--LMLEPVAKHVYIMHRRDRFRGMEHNVDLLKASSVEIKTPFLIKQLAETATGQLQLTMKEVRGTTEETLAVDDLIVNYGFIADNKVIRNWHVTPTMAHRLITVDTEMNTDVPGIAAIGDTVTYAGKLGLIASGFGEAPNAV 307
>gi|163787251|ref|ZP_02181698.1| thioredoxin reductase [Flavobacteriales bacterium ALC-1] >gi|159877139|gb|EDP71196.1| thioredoxin reductase [Flavobacteriales bacterium ALC-1] (353 aa)
Score = 300, Expect = 2.1e-25, Identities = 101/300 (33%), Positives = 159/300 (53%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNSFYAKKII-LASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQ---KLNY----EIIDFNESNKTLTIKHKET---EKEQTLPFDYVLVQYGQISSPINIELLN---QINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+F    +    L   LI+     GGQ  E+YP K IYD P + EI + D+  KL++Q K+ +          L    +TI +QE   F+  TNK + +   +I +ASG GSF PRK  I+N    +   + Y +  E E+Y++KK+++ GGGDSA++W+ +  +  I + V +IHRRNE+R     +D + K   L+   K+N     E++      +   +  K+    EKE  +  D+ +  +G   SP    + N   +I K   K    L+ +TNI  I+AIGD   +  K   I+    EA
  S:     5 DILIIGAGPTGLFTVFEAGLLKLKCHLIDALPQPGGQCSEIYPKKPIYDIPAYPEILAGDLTDKLMEQCKQFEPGF------TLGERAETIEKQEDGTFIVTTNKGTKHQAPVIAIASGLGSFEPRKPLIHNIADFEDKGVEYIIK-EPELYRDKKVVIAGGGDSALDWSIFLSD--IASEVTLIHRRNEFRGH---LDSVEKVQELKNKGKINLITPAEVVGIVGDKRVSAVVVKQAQHIEKEFEVECDHFVPLFGL--SPKLGPIANWGLEIEKNAIKVNNALDYQTNIPGIFAIGDGNTYPGKLKLILCGFHEA 307
>gi|86141880|ref|ZP_01060404.1| thioredoxin reductase [Flavobacterium sp. MED217] >gi|85831443|gb|EAQ49899.1| thioredoxin reductase [Leeuwenhoekiella blandensis MED217] (350 aa)
Score = 299, Expect = 2.3e-25, Identities = 93/300 (31%), Positives = 160/300 (53%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNSFYAKKII-LASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY----EIIDF---NESNKTLTIKHKE---TEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+F    +    L   +I+  +  GGQ  E+YP K IYD P F E+ + +++  L++Q K+ +          L    +TI +QE   F+  TNK + +   ++ +A G GSF PRK  I N    +   + Y +  + E+Y++KK+++ GGGDSA++W+ Y  +  I   V ++HRRNE+R +   ++ + +  +L K+N     E++     +E  + +  K+KE    E +  +P   +  + G I+   N  L  +I K   K    L+ +TNI  ++AIGD   +  K   I+    EA
  S:     5 DILIIGAGPTGLFTVFEAGLLKLKCHIIDALAQPGGQLAEIYPKKPIYDIPGFPEVGAGELVDNLLEQGKQFQPGF------TLGERAETIEKQEDGSFIVTTNKGTQHQAPVVAIAGGLGSFEPRKPVIPNIHEFEDKGVAYMIK-DPEVYRDKKVVIAGGGDSALDWSIYLAD--IAKEVTLVHRRNEFRGALDSVEKVRELKMLGKINLITPAEVVGLGGVDELKEVVIEKNKEQFSVEADAFIPLFGLSPKLGPIA---NWGL--EIEKNAIKVDNTLDYQTNIPGVFAIGDVNTYPGKLKLILCGFHEA 304
>gi|88801402|ref|ZP_01116930.1| probable thioredoxin resuctase [Polaribacter irgensii 23-P] >gi|88782060|gb|EAR13237.1| probable thioredoxin resuctase [Polaribacter irgensii 23-P] (351 aa)
Score = 298, Expect = 2.9e-25, Identities = 109/312 (34%), Positives = 160/312 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQ--ELFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESNKTLTIK-------HKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVID--LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAV----RALWHISKNKK 320
           D+ I+G G  G+F    +    L   LI+     GGQ  E+YP K IYD P + EI + D+  KLI+Q+K Q +    L         +TI++Q    F+  TNK +  +AK + +A G GSF PRK  I N    +   + Y +  E EIY++KK+++ GGGDSA++WA +     I   V +IHRRNE+R +   +D + K   L+ L    +I   E    L           K+ E    L  D+ +  +G   SP    + N  ++ EK    +D  L+ +TNI  +YAIGD   +  K   I+    EA      A   I  NKK
  S:     5 DILIIGAGPTGLFTVFEAGLLKLKCHLIDALPQPGGQCSEIYPKKPIYDIPAYPEILAGDLTHKLIEQSK-QFSPGFTLGERA-----ETIDKQVDGSFIVTTNKGTKHHAKIVAIAGGLGSFEPRKPLIPNIAAFEDKGVEYIIK-EPEIYRDKKVVISGGGDSALDWAIFL--SNIAAEVTLIHRRNEFRGA---LDSVEKVQELKNLGKIRLITPAEVKGILGTDFVTGVAVEKKGEDAFILDADHFIPLFGL--SPKLGPIGNWGLDIEKNAIKVDNALDYQTNIPGVYAIGDVNTYPGKLKLILCGFHEATLMCQSAYKRIFPNKK 321
>gi|118587124|ref|ZP_01544553.1| thioredoxin reductase [Oenococcus oeni ATCC BAA-1163] >gi|118432403|gb|EAV39140.1| thioredoxin reductase [Oenococcus oeni ATCC BAA-1163] (346 aa)
Score = 298, Expect = 2.9e-25, Identities = 95/309 (30%), Positives = 163/309 (52%)
  Q:     4 DLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKN-SFYAKKIILASGNGSFNPRKLEI--NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLS---KNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINI----ELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           D  I+D+AI+G G  G+FA   +    L + LIE    +GGQ   LYP K I D   F  I   D++ +L  Q  +  +S   L++++ N+  + I     F  E N + SF AK +I+ASGNGSF+PRK+++  ++E   S  + Y L   +E+  +K   V+GGG++AV++A   ++     +V++IHRR+ +R+    +  L    + N L  +    +   +    + ++       + +  D ++  +G  +S   I    E   Q N+    ++ +  Q T+I  I+AIGDA+ +  K + I TA  EA  A+
  S:     2 DNEIFDIAIIGAGPAGLFAQFYAGLRELKTALIEATPRIGGQITALYPEKTILDVAGFLGISGRDLVNELKLQT-DLVDSKTFLNSEVTNL--KKIASH--FEIEINHHASFLAKSVIIASGNGSFSPRKIDVPGSSEAEQSGMLTYLLPGLSEV-ADKDFAVVGGGNTAVDYAVELIDHDC--HVSLIHRRDNFRAMESSVTKLKNSRRTNFLTPMKITGLSPKKEKLEIELQSVPDGAVKRVSVDRLIGGFGFTASSRTINQWEEFPEQFNQ---GFLTNEAQMTSIAGIFAIGDASSYPGKSDLIATAFGEAPTAI 309
>gi|91214966|ref|ZP_01251938.1| thioredoxin reductase [Psychroflexus torquis ATCC 700755] >gi|91186571|gb|EAS72942.1| thioredoxin reductase [Psychroflexus torquis ATCC 700755] (353 aa)
Score = 297, Expect = 3.8e-25, Identities = 102/312 (32%), Positives = 166/312 (53%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNS-FYAKKIILASGNGSFNPRKLEINNEPI-DSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY----EIIDFN--ESNKTLTIK-HKETEKEQTLPFDYVLVQYGQISS--PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAV----RALWHISKNKK 320
           D+ I+G G  G+FA   +    L   +I+     GGQ  ELYP K IYD P F E+K+  ++  L++Q K  +          L    Q I +QE   F+  T++ +  +A  I +A G GSF PRK  I N  + ++  +HY +  + E +++K +++ GGGDSA++W+ Y  +  I + V ++HRRNE+R +   +D + +   + K+      EI+D +  E  ++++I+ +   E++  L  DY +  +G      PI    L +I K   K    L+ +TNI  IYAIGD   +  K   I+    EA      A   I  NK+
  S:     5 DILIIGAGPTGLFAVFEAGLLKLKCHIIDALPQPGGQLSELYPKKPIYDIPGFPEVKAGQLVDNLMEQIKSFQPGF------TLGEKAQDIEKQEDGSFIVTTDQGTKHHAPIIAIAGGLGSFVPRKPPIANLSLFENKGVHYMVK-DPEKFRDKSVVISGGGDSALDWSIYLAD--IASEVTLVHRRNEFRGALESVDRVKELKDIGKIKLITPAEIVDVHGGEQLESVSIRMNNNPEEDFELDTDYFIPLFGLSPKLGPIADWGL-EIEKNAIKVDNTLDYQTNIPGIYAIGDVNIYPGKLKLILCGFHEATLMCQSAFRRIHPNKR 323
>gi|189184229|ref|YP_001938014.1| thioredoxin reductase [Orientia tsutsugamushi str. Ikeda] >gi|189181000|dbj|BAG40780.1| thioredoxin reductase [Orientia tsutsugamushi str. Ikeda] (338 aa)
Score = 297, Expect = 4.0e-25, Identities = 89/314 (28%), Positives = 160/314 (50%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKE--------QKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSK----NNILQKLNYEIIDFNESNKTL--TIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           +++++   DV IVG G  G+FA   +    +   +++    +GGQ + LYP+K IYD P +  I ++++I++L QQ+          Q+    ++D D++ IT  T  EQ +           AK +I+A+G G+F  ++L ++N E  ++  + YS+  +   + NKK+++ GGGDSA++W    +   +   + ++HRR  +R +   ++ + K      +   + Y++      N  L   +        QTLP DY+L  +G  +    I         +   V  +  +T I  IYAIGD   +  K   I+T  AEA  A+ H
  S:     2 LSKNVHTTDVVIVGAGPVGLFAVFQAGMLEMKCHVVDALDCIGGQCVTLYPDKPIYDIPAYPVITAAELIEQLKQQSAPFDTVYHLGQQVIGCKIDNDMITIT--TSAEQVIC----------AKSLIIAAGCGAFKYKRLTLDNIEAFENKTVFYSVK-DKNKFINKKVVIAGGGDSAIDWT--LLLSDVAEVIYLVHRRENFRCAPHSLNQIKKLAECGKVQMIVPYQLAKLTGENGLLQEVLVTNFDGGAQTLPADYLLAFFGLAADLGPIHKWGLKTDLRRIEVNSITYETTIPGIYAIGDVASYPGKLKLILTGFAEAATAMSH 315
>gi|120434697|ref|YP_860384.1| thioredoxin reductase [Gramella forsetii KT0803] >gi|117576847|emb|CAL65316.1| thioredoxin reductase [Gramella forsetii KT0803] (354 aa)
Score = 296, Expect = 5.8e-25, Identities = 95/300 (31%), Positives = 159/300 (53%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-------NYEIIDF-NESN-KTLTIKHKETEK-------EQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+F    +    L + LI+     GGQ  E+YP K IYD P F EI + D++  L++Q +  K          L    +T+ + +   F+  TNK +  +A  + +A G GSF PRK  I N    +   + Y +  + E+Y++KK+++ GGGDSA++WA Y  +  + + VA++HRR E+R +   +D + + + L KL       N E++    E N + + I+HK+  +       +  +P   +  + G I S   +E+     K    Y    + +TNI  +YAIGD   +  K   I++   EA
  S:     5 DILIIGAGPTGLFTVFEAGLLKLKTHLIDALPQPGGQCSEIYPKKPIYDIPAFPEILAGDLVSNLMEQIRPFKPGF------TLGERAETLEKLDDGSFIVTTNKGTQHHAPVVAIAGGLGSFEPRKPPIPNIADFEDKGVSYFIK-DPEVYRDKKVVIAGGGDSALDWAIYLAD--VASEVALVHRRAEFRGA---LDSVERVSELAKLGRIEMITNAEVVGLRGEDNLEQVVIRHKDKARGEEFRDVDDFIPLFGLSPKLGPIGS-WGLEIERNAIKVDNSY----DYQTNIPGVYAIGDVNTYKGKLKLILSGFHEA 307
>gi|90961416|ref|YP_535332.1| thioredoxin reductase [Lactobacillus salivarius UCC118] >gi|90820610|gb|ABD99249.1| Thioredoxin reductase [Lactobacillus salivarius UCC118] (341 aa)
Score = 296, Expect = 6.1e-25, Identities = 108/312 (34%), Positives = 176/312 (56%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQT--LPFDYVLVQYGQIS--SPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M ED  +YD++I+GGG  G+FA+T +   +    L+E    LGGQP  L+  K IYD P F  I   D+I+ L  Q  +Q N ++ +++ +LNI      E+  F   TN    Y+K II+++G GSF PR+L I N E +++  + Y++N +  I++NK I + GGGDSA++WA       I  +  +IHRRN++R+    +D L  S + I+     + +  + S+  LTI+ K+   + T  L  D +LV YG +S  S +    L+ I  +     ++   +TN++N+YAIGD  ++  + + I     EA  A+
  S:     1 MPED-NLYDISIIGGGPIGMFAATYAGMRSAKVQLLESLGQLGGQPQALFSEKTIYDIPGFSSISGKDLIRNLNTQ-LQQFNVDVYVNSPVLNI---QKTEKNQFKIITNNRISYSKSIIISTGIGSFEPRRLRIANAEALENDKLFYTVN-DPSIFENKTIAIAGGGDSAIDWA--LELNTIAKDTIVIHRRNQFRAMESNVDKLKESGSKIMTPYTIDNLSTDNSHNNLTIQLKKVRTKDTVELSVDALLVNYGFMSNNSILKSWDLDLITTKNNLIPVNSKLETNLQNVYAIGDIANYPGRIDLIAVGMGEAPMAV 311
>gi|126651083|ref|ZP_01723294.1| YcgT [Bacillus sp. B14905] >gi|126592284|gb|EAZ86333.1| YcgT [Bacillus sp. B14905] (349 aa)
Score = 295, Expect = 6.2e-25, Identities = 93/306 (30%), Positives = 164/306 (53%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN-----KTLTIKHKETEKEQTLPFDYVLVQYGQI-------SSPINIELLNQINKEKGKYVI--DLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           +YDV I+GGG  G+++S       + + LIE +S LGG+ + +YP K I+D      I    +IK+L++Q     N +I  D  +L+I     NE+ +F+      N  Y++ +I+A G G  NP+K+EI   E  +   ++Y++    E +KNK +++ GGG++AV+WA   +E  + + V + +R+++  +    I  L+ + I    N EI      +     K + + + ET     +P D V++ +G +       +SP+ IE        K  Y I   +N +++I  +YA GD  H   K + I  A  +A+ A+
  S:     6 LYDVTIIGGGPAGLYSSFYCGLREMKTKLIESQSQLGGK-IHVYPEKMIWDIGGVTPISGGQLIKQLVEQ-ALTFNPSIYTDEKVLSI---AKNEEGIFVITAESGNIHYSRTVIVAIGGGILNPQKIEIEGAERFEVSNLNYTIK-SYEKFKNKAVIISGGGNTAVDWALELME--VASKVYLTYRKDQLSAHEAQITELTNSAIECHYNSEITKLIADDQEGMIKAIALTNHETGTVTEIPIDEVVISHGYVRDKELLDNSPLAIE-------RKNDYFIAGTINSESSIPGLYAAGDILHHDGKIHLIAAAFHDALHAV 312
>gi|116490277|ref|YP_809821.1| thioredoxin reductase [Oenococcus oeni PSU-1] >gi|116091002|gb|ABJ56156.1| Thioredoxin reductase [Oenococcus oeni PSU-1] (346 aa)
Score = 295, Expect = 6.2e-25, Identities = 95/309 (30%), Positives = 163/309 (52%)
  Q:     4 DLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKN-SFYAKKIILASGNGSFNPRKLEI--NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLS---KNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINI----ELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           D  I+D+AI+G G  G+FA   +    L + LIE    +GGQ   LYP K I D   F  I   D++ +L  Q  +  +S   L++++ N+  + I     F  E N + SF AK +I+ASGNGSF+PRK+++  ++E   S  + Y L   +E+  +K   V+GGG++AV++A   ++     +V++IHRR+ +R+    +  L    + N L  +    +   +    + ++       + +  D ++  +G  +S   I    E   Q N+    ++ +  Q T+I  I+AIGDA+ +  K + I TA  EA  A+
  S:     2 DNEIFDIAIIGAGPAGLFAQFYAGLRELKTALIEATPRIGGQITALYPEKTILDVAGFLGISGRDLVNELKLQT-DLVDSKTFLNSEVTNL--KKIASH--FEIEINHHASFLAKSVIIASGNGSFSPRKIDVPGSSEAEQSGMLTYLLPGLSEV-ADKDFAVVGGGNTAVDYAVELIDHDC--HVSLIHRRDNFRAMESSVTKLKNSRRTNFLTPMKITGLSPKKEKLEIELQSVPDGAVKRVSVDRLIGGFGFTASSRTINQWEEFPEQFNQ---GFLTNEAQMTSIAGIFAIGDASIYPGKSDLIATAFGEAPTAI 309
>gi|167471777|ref|ZP_02336481.1| thioredoxin reductase [Rickettsia africae ESF-5] (340 aa)
Score = 294, Expect = 8.7e-25, Identities = 96/306 (31%), Positives = 160/306 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKK-IILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL------SKNNILQKLNYEIIDFNESN------KTLTIKHKETEKEQTLPFDYVLVQYGQISS-PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           DV I+G G  G+FA   +    +   +I+ +  +GGQ + LYP K IYD P + +I + ++IK+L  Q     N    L+   + +  Q     + F  +T+KN+    K II+A+G GSF P K  + N E  +S  + Y +N +++ +  K I++ GGGDSAV+WA       I N + ++HRR+++ ++   +  L       K  ++       +D N S       K L    ++ +    LPF  +    G +++  +N++ L+ I  +   Y      +TNI+ IYAIGD  H+  K   I+T  AEA  +L H
  S:     5 DVVIIGAGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITLYPEKPIYDIPAYPKIAAEELIKQLALQ-AAPFNPIYHLNQQAIELNKQ----DDFFEIKTSKNTLIKSKVIIIAAGAGSFGPNKPSLANIEDFESKSVFYFINDKSK-FAGKNIVIAGGGDSAVDWA--IALSDIANKIYLVHRRDKFTAAPESVRQLRHIAETDKIELITGYQLNALDGNNSELQSVIVKDLQNNTRKLDANILLPFFGLKQDLGSLANWGLNVK-LHHIEVDSSYY------QTNIEGIYAIGDIAHYVGKLKLILTGFAEAASSLHH 310
>gi|120434495|ref|YP_860192.1| thioredoxin reductase [Gramella forsetii KT0803] >gi|117576645|emb|CAL65114.1| thioredoxin reductase [Gramella forsetii KT0803] (353 aa)
Score = 294, Expect = 9.1e-25, Identities = 90/300 (30%), Positives = 166/300 (55%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY----EIIDFNESNK--TLTIKHKETEKEQTLP-FDYVLVQYGQISSPINIELLN---QINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+FA   +    L   LI+     GGQ  E+YP K IYD P F E+ + D++  L++Q K  +          L    +TI++QE   F+  T++ +  +A  +++A G GSF PRK  I + +  ++  + Y +  + E+Y++KK+++ GGGDSA++W+ +  +  + + V+++HRR ++R +   ++ + + + + K+N     E++D    N+  ++ I+H++  + + L   D+ +  +G   SP    + N   +I K   K     + +TNI  IYAIGD   +  K   I+    EA
  S:     5 DILIIGAGPTGLFAVFEAGLLKLKCHLIDALPQPGGQCSEIYPKKPIYDIPGFPEVLAGDLVDNLMEQIKPFEPGF------TLGERAETIDKQEDGSFIVTTSQGAKHHAPVVVIAGGLGSFEPRKPPIPSIKEYENKGVAYIIR-DPEVYRDKKVVIAGGGDSALDWSIFLAD--VASEVSLVHRRKDFRGALDSVEKVEELSKIGKINLITDAEVVDLKGENELDSVLIRHRDQARGEELKDTDHFIPLFGL--SPKLGPIANWGLEIEKNAIKVDNAYDYQTNIPGIYAIGDVNTYKGKLKLILCGFHEA 307
>gi|189500662|ref|YP_001960132.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chlorobium phaeobacteroides BS1] >gi|189496103|gb|ACE04651.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chlorobium phaeobacteroides BS1] (348 aa)
Score = 293, Expect = 1.2e-24, Identities = 90/306 (29%), Positives = 162/306 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI--NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL----SKNNILQKLNYEIIDFNESNKTLTIKH--KETEKEQTLPFDYVLVQYGQISS--PI---NIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           D+ I+GGG  GIFA+      N++  +IE    LGGQ   LYP K IYD   F E+++S++++ L  Q K + +  + LD  +    ++ +++    +   +  +F ++ +++A+G G+F+PRKL    +   ++   + YS+    E+ + KK+L++GGGDSA++WA   +      ++ + HR  ++R+     D L     K  +   LN E+I  +     L   +   ++ KE +L  +Y+LV  G  S   P+    +EL       +   V+D   KT +  +YA GD  ++  K   I T  ++A  A+ H
  S:    16 DLTIIGGGPTGIFAAFQCGMNNISCRIIESMPELGGQLTALYPEKHIYDVAAFPEVQASELVESLWGQAK-RYDPEVVLDEQVRQ--YKKLDDGSFEVETLSGRTFASRALLVAAGLGAFSPRKLPQLGDISELEGHTVLYSVQNMKEL-EGKKVLIVGGGDSALDWAMMLLPH--AEHITVAHRSPDFRAHGKTKDDLFAAAEKGLVDVHLNTEVIAIDHDGPALRHAYLRSKSGKETSLEAEYMLVLIGFKSDLGPLAEWGLELC------ENAMVVDSQMKTEVDGLYAAGDIAYYPGKLKIIQTGLSDATMAVRH 322
>gi|46198404|ref|YP_004071.1| thioredoxin reductase [Thermus thermophilus HB27] >gi|46196026|gb|AAS80444.1| thioredoxin reductase [Thermus thermophilus HB27] (335 aa)
Score = 293, Expect = 1.2e-24, Identities = 87/299 (29%), Positives = 156/299 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQ--------NKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLN----YEI--IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE 307
           DV IVG G  G+FA        L+   ++     GGQ   LYP K+IYD   F ++ + D++K L++Q        +  ++   ++ + D+  +T             +  N++ AK +I+A+G G+F PR++    E   +   ++Y++  + E ++ K++L++GGGDSAV+WA   ++      + +IHRR ++R+    +  L K +   +L     YE+  ++ +E  +   + H +T++E  L  D VL+  G I+   P    L N  +  EK K  +D    T+I  +YA GD   +  K   I+    E
  S:     7 DVLIVGAGPAGLFAGFYVGMRGLSFRFVDPLPEPGGQLTALYPEKYIYDVAGFPKVYAKDLVKGLVEQVAPFNPVYSLGERAETLEREGDLFKVT------------TSQGNAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKAE-FQGKRVLIVGGGDSAVDWALNLLD--TARRITLIHRRPQFRAHEASVKELMKAHEEGRLEVLTPYELRRVEGDERVRWAVVFHNQTQEELALEVDAVLILAGYITKLGP----LANWGLALEKNKIKVDTTMATSIPGVYACGDIVTYPGKLPLIVLGFGE 304
>gi|15892560|ref|NP_360274.1| thioredoxin reductase [Rickettsia conorii str. Malish 7] >gi|15619723|gb|AAL03175.1| thioredoxin reductase [EC:1.6.4.5] [Rickettsia conorii str. Malish 7] (340 aa)
Score = 293, Expect = 1.3e-24, Identities = 96/306 (31%), Positives = 161/306 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKK-IILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL------SKNNILQKLNYEIIDFNESN------KTLTIKHKETEKEQTLPFDYVLVQYGQISS-PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           DV I+G G  G+FA   +    +   +I+ +  +GGQ + LYP K IYD P + +I + ++IK+L  Q     N    L+   + +  Q     + F  +T+KN+    K II+A+G GSF P K  + N E  +S  + Y +N +++ +  K I++ GGGDSAV+WA    +  I N + ++HRR+++ ++   +  L       K  ++       +D N S       K L    ++ +    LPF  +    G +++  +N++ L+ I  +   Y      +TNI+ IYAIGD  H+  K   I+T  AEA  +L H
  S:     5 DVVIIGAGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITLYPEKPIYDIPAYPKIAAEELIKQLALQ-AAPFNPIYHLNQQAIELNKQ----DDFFEIKTSKNTLIKSKVIIIAAGAGSFGPNKPPLANIEDFESKSVFYFINDKSK-FAGKNIVIAGGGDSAVDWAISLSD--IANKIYLVHRRDKFTAAPESVRQLRHIAETDKIELITGYQLNALDGNNSELQSVIVKDLQNNTRKLDANILLPFFGLKQDLGSLANWGLNVK-LHHIEVDSSYY------QTNIEGIYAIGDIAHYVGKLKLILTGFAEAASSLHH 310
>gi|119357701|ref|YP_912345.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chlorobium phaeobacteroides DSM 266] >gi|119355050|gb|ABL65921.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chlorobium phaeobacteroides DSM 266] (350 aa)
Score = 293, Expect = 1.3e-24, Identities = 89/308 (28%), Positives = 168/308 (54%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN--EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEY----RSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKH--KETEKEQTLPFDYVLVQYGQISS--PI---NIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           I D+ IVGGG  GIFA+      N++  +IE  + LGGQ   LYP K IYD   F E+ ++ +++ L +Q  E+ N ++ L   +    +  +++    +  T+ + ++++ ++LA+G G+F PRKL   N  + ++   + Y++    + +  KK++++GGGDSA++WA   +   +   V ++HR +E+    +++  + +   +  I   LN E+   + S + LT  H  K+      +  D +LV  G  S+  P+   ++EL++         V+D + KT++  +YA GD   +  K   I T  ++A  A+ H
  S:    14 IRDLCIVGGGPTGIFAAFQCGMNNISCRIIESMTQLGGQLAALYPEKHIYDVAGFPEVPAAGLVESLWKQ-AERYNPDVVLGEAVTR--YSKLDDGSFEITTTSGSVYHSRAVLLAAGLGAFTPRKLPQLNAIDHLEGHSVFYAVK-NMQDFAGKKVVIIGGGDSALDWAVGLL--PVAERVTLVHRMHEFQGHGKTARDVEEAKERGAIDVYLNTEVTAIDTSGENLTKVHLCKKNGTGFQVEADRLLVLIGFKSNLGPLADWDLELVDN------ALVVDSHMKTSVDGLYAAGDIAFYPGKLKIIQTGLSDAAMAVRH 322
>gi|34580449|ref|ZP_00141929.1| thioredoxin reductase [Rickettsia sibirica 246] >gi|28261834|gb|EAA25338.1| thioredoxin reductase [Rickettsia sibirica 246] (340 aa)
Score = 293, Expect = 1.3e-24, Identities = 96/306 (31%), Positives = 161/306 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKK-IILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL------SKNNILQKLNYEIIDFNESN------KTLTIKHKETEKEQTLPFDYVLVQYGQISS-PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           DV I+G G  G+FA   +    +   +I+ +  +GGQ + LYP K IYD P + +I + ++IK+L  Q     N    L+   + +  Q     + F  +T+KN+    K II+A+G GSF P K  + N E  +S  + Y +N +++ +  K I++ GGGDSAV+WA    +  I N + ++HRR+++ ++   +  L       K  ++       +D N S       K L    ++ +    LPF  +    G +++  +N++ L+ I  +   Y      +TNI+ IYAIGD  H+  K   I+T  AEA  +L H
  S:     5 DVVIIGAGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITLYPEKPIYDIPAYPKIAAEELIKQLALQ-AAPFNPIYHLNQQAIELNKQ----DDFFEIKTSKNTLIKSKVIIIAAGAGSFGPNKPPLANIEDFESKSVFYFINDKSK-FAGKNIVIAGGGDSAVDWAISLSD--IANKIYLVHRRDKFTAAPESVRQLRHIAETDKIELITGYQLNALDGNNSELQSVIVKDLQNNTRKLDANILLPFFGLKQDLGSLANWGLNVK-LHHIEVDSSYY------QTNIEGIYAIGDIAHYVGKLKLILTGFAEAANSLHH 310
>gi|165933231|ref|YP_001650020.1| ferredoxin--NAD(P)(+) reductase [Rickettsia rickettsii str. Iowa] >gi|165908318|gb|ABY72614.1| ferredoxin--NAD(P)(+) reductase [Rickettsia rickettsii str. Iowa] (340 aa)
Score = 292, Expect = 1.6e-24, Identities = 96/306 (31%), Positives = 162/306 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKK-IILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL------SKNNILQKLNYEIIDFNESN------KTLTIKHKETEKEQTLPFDYVLVQYGQISS-PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           DV I+G G  G+FA   +    +   +I+ +  +GGQ + LYP K IYD P + +I + ++IK+L  Q     N    L+   + +  Q     + F  +T+KN+    K II+A+G GSF P K  + N E  +S  + Y +N +++ +  K I++ GGGDSAV+WA    +  I N + ++HRR+++ ++   +  L      +K  ++       +D N S       K L    ++ +    LPF  +    G +++  +N++ L+ I  +   Y      +TNI+ IYAIGD  H+  K   I+T  AEA  +L H
  S:     5 DVVIIGAGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITLYPEKPIYDIPAYPKIVAEELIKQLALQ-AAPFNPIYHLNQQAIELNKQ----DDFFEIKTSKNTLIKSKVIIIAAGAGSFGPNKPPLANIEDFESKSVFYFINDKSK-FAGKNIVIAGGGDSAVDWAISLSD--IANKIYLVHRRDKFTAAPESVRQLRHIAETNKIELITGYQLNALDGNNSELQSVIVKDLQNNTRKLDANILLPFFGLKQDLGSLANWGLNVK-LHHIEVDSSYY------QTNIEGIYAIGDIAHYVGKLKLILTGFAEAASSLHH 310
>gi|192811767|ref|ZP_03040437.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Geobacillus sp. Y412MC10] >gi|192799605|gb|EDV76115.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Geobacillus sp. Y412MC10] (345 aa)
Score = 292, Expect = 1.8e-24, Identities = 93/312 (29%), Positives = 154/312 (49%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIID-FNESNKTL---TIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M E L IYDV I+GGG  G++ +  S   +L + LIE K  LGG+ M +YP K I+D      I   ++I +L +Q     +  I     I+ +  Q   +    L        + + +ILA G G     KLE+   E  +   +HY++  E E ++ K++L+ GGG+SAV+WAN  V   I   V ++HRR+ +      I  + +++      YE+   F+ + KT+   TI H E+   + +  D V+V +G  S    I+    ++ ++    +    +TN+  I+  GD  ++  K N I  A  +A  AL
  S:     1 MTEQLEIYDVTIIGGGPAGMYTAFYSGMRDLKTKLIEAKDELGGR-MLIYPEKMIWDVGGVPPILCENLIAQLSEQ-AMTFDPTIVFGQHIIGLEKQA--DSTYILEAATGERHWTRTVILAIGRGILRMAKLELEGAERYEVSNLHYTVQ-ELEPFRGKRVLISGGGNSAVDWANELV--PIAGQVTVVHRRDRFGGHEKNIVRMKESSADVLTPYEVTQLFSGNGKTIERVTITHLESGDSRQIEIDEVIVNHGLKSDFTGIKDWG-LDMDEWNIFVSPRLETNLPGIFGAGDFANYESKLNLIAGAFTDAALAL 309
>gi|160286442|pdb|2ZBW|A Chain A, Crystal Structure Of Thioredoxin Reductase-Like Protein From Thermus Thermophilus Hb8 >gi|160286443|pdb|2ZBW|B Chain B, Crystal Structure Of Thioredoxin Reductase-Like Protein From Thermus Thermophilus Hb8 (335 aa)
Score = 292, Expect = 1.8e-24, Identities = 87/299 (29%), Positives = 156/299 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQ--------NKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLN----YEI--IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE 307
           DV IVG G  G+FA        L+   ++     GGQ   LYP K+IYD   F ++ + D++K L++Q        +  ++   ++ + D+  +T             +  N++ AK +I+A+G G+F PR++    E   +   ++Y++  + E ++ K++L++GGGDSAV+WA   ++      + +IHRR ++R+    +  L K +   +L     YE+  ++ +E  +   + H +T++E  L  D VL+  G I+   P    L N  +  EK K  +D    T+I  +YA GD   +  K   I+    E
  S:     7 DVLIVGAGPTGLFAGFYVGXRGLSFRFVDPLPEPGGQLTALYPEKYIYDVAGFPKVYAKDLVKGLVEQVAPFNPVYSLGERAETLEREGDLFKVT------------TSQGNAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKAE-FQGKRVLIVGGGDSAVDWALNLLD--TARRITLIHRRPQFRAHEASVKELXKAHEEGRLEVLTPYELRRVEGDERVRWAVVFHNQTQEELALEVDAVLILAGYITKLGP----LANWGLALEKNKIKVDTTXATSIPGVYACGDIVTYPGKLPLIVLGFGE 304
>gi|55980434|ref|YP_143731.1| thioredoxin reductase [Thermus thermophilus HB8] >gi|55771847|dbj|BAD70288.1| thioredoxin reductase [Thermus thermophilus HB8] (335 aa)
Score = 291, Expect = 2.0e-24, Identities = 87/299 (29%), Positives = 156/299 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQ--------NKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLN----YEI--IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE 307
           DV IVG G  G+FA        L+   ++     GGQ   LYP K+IYD   F ++ + D++K L++Q        +  ++   ++ + D+  +T             +  N++ AK +I+A+G G+F PR++    E   +   ++Y++  + E ++ K++L++GGGDSAV+WA   ++      + +IHRR ++R+    +  L K +   +L     YE+  ++ +E  +   + H +T++E  L  D VL+  G I+   P    L N  +  EK K  +D    T+I  +YA GD   +  K   I+    E
  S:     7 DVLIVGAGPTGLFAGFYVGMRGLSFRFVDPLPEPGGQLTALYPEKYIYDVAGFPKVYAKDLVKGLVEQVAPFNPVYSLGERAETLEREGDLFKVT------------TSQGNAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKAE-FQGKRVLIVGGGDSAVDWALNLLD--TARRITLIHRRPQFRAHEASVKELMKAHEEGRLEVLTPYELRRVEGDERVRWAVVFHNQTQEELALEVDAVLILAGYITKLGP----LANWGLALEKNKIKVDTTMATSIPGVYACGDIVTYPGKLPLIVLGFGE 304
>gi|157828513|ref|YP_001494755.1| thioredoxin reductase [Rickettsia rickettsii str. 'Sheila Smith'] >gi|157800994|gb|ABV76247.1| thioredoxin reductase [Rickettsia rickettsii str. 'Sheila Smith'] (340 aa)
Score = 291, Expect = 2.1e-24, Identities = 96/306 (31%), Positives = 161/306 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKK-IILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL------SKNNILQKLNYEIIDFNESN------KTLTIKHKETEKEQTLPFDYVLVQYGQISS-PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           DV I+G G  G+FA   +    +   +I+ +  +GGQ + LYP K IYD P + +I + ++IK+L  Q     N    L+   + +  Q     + F  +T+KN+    K II+A+G GSF P K  + N E  +S  + Y +N +++ +  K I++ GGGDSAV+WA    +  I N + ++HRR+++ ++   +  L       K  ++       +D N S       K L    ++ +    LPF  +    G +++  +N++ L+ I  +   Y      +TNI+ IYAIGD  H+  K   I+T  AEA  +L H
  S:     5 DVVIIGAGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITLYPEKPIYDIPAYPKIVAEELIKQLALQ-AAPFNPIYHLNQQAIELNKQ----DDFFEIKTSKNTLIKSKVIIIAAGAGSFGPNKPPLANIEDFESKSVFYFINDKSK-FAGKNIVIAGGGDSAVDWAISLSD--IANKIYLVHRRDKFTAAPESVRQLRHIAETDKIELITGYQLNALDGNNSELQSVIVKDLQNNTRKLDANILLPFFGLKQDLGSLANWGLNVK-LHHIEVDSSYY------QTNIEGIYAIGDIAHYVGKLKLILTGFAEAASSLHH 310
>gi|186472579|ref|YP_001859921.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia phymatum STM815] >gi|184194911|gb|ACC72875.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia phymatum STM815] (351 aa)
Score = 291, Expect = 2.3e-24, Identities = 86/304 (28%), Positives = 165/304 (54%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNK---------EQKNSNIQLDTDILNITWQTINEQELFLFETNKN-SFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTL-TIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDL-NQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           DV I+G G  G+FA+  +    L+S++++     GGQ +ELYP+K IYD P      + +++ +L++Q +          + ++  QLD    N  W         L  T+K  +  +  I++A+GNGSF P++L++++  P++  ++HYS++   + +  KK++V GGGDSA++WA       +  +V ++HRRN + ++   +  + +     ++N+    I   N     L +I+ ++ E    L  D++LV +G ++    I+    +    G+  +D  N +++   I+A GD   +  K   I++   EA  AL
  S:    16 DVLIIGAGPVGLFAAFEAGVIGLSSVIVDNVERAGGQCIELYPDKPIYDIPAIPSCTARELVDRLLEQCRPFAPPLHLGHRVDTVEQLD----NGRW---------LARTDKGLTVESAAILIAAGNGSFVPQRLQLDDAAPLEGHYVHYSVSNLAD-FAGKKMVVAGGGDSALDWA--LALRTVAQHVTLVHRRNGFSATDSSVANMRRAVEAGEMNFAVGTIASLNAPGGQLESIELRQAEGSVQLATDHLLVLFGLVADLGPIQQWG-VEVRGGRITVDTSNYESSRPGIFAAGDIAGYPNKQKLILSGFHEASLAL 318
>gi|67459092|ref|YP_246716.1| thioredoxin reductase [Rickettsia felis URRWXCal2] >gi|67004625|gb|AAY61551.1| Thioredoxin reductase [Rickettsia felis URRWXCal2] (335 aa)
Score = 290, Expect = 2.5e-24, Identities = 96/306 (31%), Positives = 161/306 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTI---NEQELFLFETNKNSFYAKK-IILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL------SKNNILQKLNYEIIDFNESN------KTLTIKHKETEKEQTLPFDYVLVQYGQISS-PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           DV I+G G  G+FA   +    +   +I+ +  +GGQ + LYP K IYD P + +I + ++IK+L  Q    K         + ++  Q I    + + F  +T+KN+    K II+A+G GSF P K  + N E  +   + Y +N +++ +  K I++ GGGDSAV+WA    E  I N + ++HRR+++ ++   +  L       K  ++       +D N S       K L    ++ +    LPF  +    G +++  +N++ L+ I  +   Y      +TNI+ IYAIGD  H+  K   I+T  AEA  +L H
  S:     6 DVVIIGTGPVGLFAVFQAGMLGMKCHIIDAQEIIGGQCITLYPEKPIYDIPAYPKIAAEELIKQLELQAAPFK--------PVYHLNQQAIELNKQDDFFEIKTSKNTLIKSKVIIIAAGAGSFGPNKPPLANIEDFEGKSVFYFINDKSK-FAGKNIVIAGGGDSAVDWAISLSE--IANKIYLVHRRDKFTAAPESVRQLRHIAETGKIELVTGYQLNALDGNNSELQSVIVKDLQNNTRKLDANILLPFFGLKQDLGSLANWGLNVK-LHHIEVDNSYY------QTNIEGIYAIGDIAHYAGKLKLILTGFAEAASSLHH 311
>gi|196234796|ref|ZP_03133600.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermus aquaticus Y51MC23] >gi|196220752|gb|EDY15367.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermus aquaticus Y51MC23] (335 aa)
Score = 290, Expect = 2.5e-24, Identities = 90/299 (30%), Positives = 161/299 (53%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNI--TWQTINEQE-LFLFETNK-NSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLN----YEI--IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PI---NIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE 307
           DV ++G G  G+FA        L+   I+     GGQ   LYP K+IYD   F ++ + D+++ L++Q        +     I N+    +T++ ++ LF   T+  N++ AK +I+A+G G+F PR+L    E  ++   ++Y++  + E ++ K++L++GGGDSAV+WA   ++      + +IHRR ++R+    +  L K +   +L     YE+  ++ +   +   I H +T++E TL  D VL+  G ++   P+    +EL      EK K  +D    T+I  +YA GD   +  K   I+    E
  S:     5 DVIVIGAGPAGLFAGFYVGMRGLSFRFIDPLPEPGGQLSALYPEKYIYDVAGFPKVYAKDLVRGLVEQ--------VAPFNPIYNLGERAETLSREDGLFKVTTSAGNTYTAKAVIIAAGVGAFEPRRLGAPGERELEGRGVYYAVRAKAE-FQGKRVLIVGGGDSAVDWALNLLD--TAGAITLIHRRPQFRAHEASVQELMKAHEEGRLKVLTPYEVRRLEGDTWVRRAVIFHNQTQEELTLEVDAVLILAGYLTKLGPLANWGLEL------EKNKIKVDTTMATSIPGVYACGDIVTYPGKLPLIVLGFGE 302
>gi|150025720|ref|YP_001296546.1| thioredoxin-disulfide reductase [Flavobacterium psychrophilum JIP02/86] >gi|149772261|emb|CAL43737.1| Thioredoxin-disulfide reductase [Flavobacterium psychrophilum JIP02/86] (351 aa)
Score = 290, Expect = 2.9e-24, Identities = 97/300 (32%), Positives = 155/300 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNS-FYAKKIILASGNGSFNPRKLEINNEPI--DSPFIHYSLNLE-----TEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY----EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYG---QISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+F    +    L   +I+     GGQ  ELYP K I+D P +  + + D+I  LI+Q K+ +          LN T +TI + E   F+  +NK +  +A  I +A G GSF PRK      PI  D  F      +E      E +++KK+++ GGGDSA++W+ Y     I + V ++HRRNE+R +   ++ + +     K+      E++ F  S K  ++  +      T+P DY +  +G   ++ +  N  L  +I K   K    L+ +TNI+ IYAIGD   +  K   I+    EA
  S:     5 DILIIGAGPTGLFTVFEAGLLKLKCHIIDGLPQPGGQLTELYPKKPIFDIPGYPSVLAGDLITNLIEQIKQFQPGF------TLNETAETIEKLEDGTFIVTSNKGTKHHANSIAIAGGLGSFEPRK------PILKDIEFYENDKGVEYFVKDPEKFRDKKVVISGGGDSALDWSIYL--SNIASEVTLVHRRNEFRGALDSVEKVQELKSAGKIKLITPGEVVGFKGSEKIESVDIQVNTTLTTVPCDYFIPLFGLTPKLGAIANWGL--EIEKNAIKVNNALDYQTNIEGIYAIGDVNTYPGKLKLILCGFHEA 305
>gi|149371977|ref|ZP_01891296.1| Thioredoxin reductase [unidentified eubacterium SCB49] >gi|149355117|gb|EDM43678.1| Thioredoxin reductase [unidentified eubacterium SCB49] (350 aa)
Score = 289, Expect = 3.4e-24, Identities = 95/300 (31%), Positives = 153/300 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTIN--EQELFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY----EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PI---NIELLNQINKEKGKYVID--LNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+FA   +    L   LI+     GGQ  E+YP K IYD P F E+ + D++  L++Q +  +          L    QTI   E + F+  TNK +  +A  + +A G GSF PRK  I N    +   + Y +  + E+Y+ KK+++ GGGDSA++W+ +  +  I  +V ++HRRNE+R +   +D + +     K+      E+ID   + K   +  K   +      D+ +  +G      PI    +E+      EK   V++  L+ +TNI  IYAIGD   +  K   I+    EA
  S:     5 DILIIGAGPTGLFAVFEAGLLKLKCHLIDALPQPGGQCSEIYPKKPIYDIPAFPEVLAGDLVDNLMKQIEAFQPGF------TLGERAQTIEKLEDDTFIVTTNKGTKHHAPVVAIAGGLGSFEPRKPPITNIGDYEDHGVEYIIR-DPEMYRGKKVVIAGGGDSALDWSIFLTD--IAESVTLVHRRNEFRGALDSVDKVQELKDAGKIELITPAEVIDVVGNGKVEGVSVKRGAEVFNKECDHFIPLFGLAPKLGPIADWGLEI------EKNAIVVNNALDYQTNIPGIYAIGDVNTYPGKLKLILCGFHEA 304
>gi|169188431|ref|ZP_02848530.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Paenibacillus sp. JDR-2] >gi|169004723|gb|EDS51579.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Paenibacillus sp. JDR-2] (345 aa)
Score = 289, Expect = 3.6e-24, Identities = 93/312 (29%), Positives = 152/312 (48%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNS---NIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN----KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M E L +YDV I+GGG  G++ +  S   +L + LIE K+ LGG+ M +YP K I+D      I    + +KLI Q KEQ  +    I     I+ +  Q   +    L        + + +ILA G G     KLE+   E  +   +HY++  E E ++ K++L+ GGG+S V+WAN  +   I   V ++HRR+ +      I  + +++      YE+      N    + +TI H E+   + L  D V+V +G  S    I+    ++ +     +    +TN+  I+  GD  ++  K N I  A  +A  AL
  S:     1 MTEQLELYDVTIIGGGPAGMYTAFYSGMRDLKTKLIEAKNELGGR-MLIYPEKMIWDVGGVAPI----LCEKLIDQLKEQAKTFDPTIVFGQHIIGLEKQA--DSTYILEAATGEKHWTRTVILAIGRGILRMAKLELAGAERYEVSNLHYTVQ-ELEPFRGKRVLISGGGNSTVDWANELI--PIAAQVMVVHRRDRFGGHEKNIVRMKESSADVLTPYEVTQLYSGNGKTIERVTITHIESGDSRELEIDEVIVNHGLKSDFTGIKDWG-LDMDDWNIFVSPRLETNLPGIFGAGDFANYESKLNLIAGAFTDAALAL 309
>gi|170696693|ref|ZP_02887809.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia graminis C4D1M] >gi|170138396|gb|EDT06608.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia graminis C4D1M] (361 aa)
Score = 289, Expect = 3.7e-24, Identities = 89/304 (29%), Positives = 168/304 (55%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNK--------EQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEI---------IDFNESN-----KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ--INKEKGKYVIDL-NQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           DV IVG G  G+FA+  +    L+  +++    +GGQ  ELYP+K IYD P      + +++ +L+ Q K        EQ+  +++  +D     W    ++ L         F    I+LA+GNG+F P+KL +    P++S  +HYS+    + + +K ++V GGGDSA++WA      K+   V ++HRRN + ++   ++ + +     ++++ +          D  E+      K++T++H E E E  LP + ++V YG ++   ++  + Q  ++   G+  +D  N +++   I+A+GD  ++  K   I++   EA  AL
  S:    19 DVLIVGAGPVGLFAAFEAGVIGLSCQIVDALGKIGGQCTELYPDKPIYDIPAIPSCTARELVDRLLAQCKPFDVPIHLEQRVESVEQRSD---GRWTVRTDRGLV--------FDVAAIMLAAGNGAFVPQKLPLAEAVPLESRHVHYSVQRLAD-FADKTVVVAGGGDSALDWA--LALRKVARRVTLVHRRNGFSAADSSVELMRRAVEAGEMDFIVGAISGLKVQSDAQENAESAALKSITLRHIEGETE--LPAEQLVVLYGLVA---DLGPIGQWGLSLHGGRVDVDTSNYESSRPGIFAVGDIANYPNKQKLILSGFHEASLAL 329
>gi|157691560|ref|YP_001486022.1| thioredoxin-disulfide reductase [Bacillus pumilus SAFR-032] >gi|157680318|gb|ABV61462.1| thioredoxin-disulfide reductase [Bacillus pumilus SAFR-032] (346 aa)
Score = 289, Expect = 3.8e-24, Identities = 89/312 (28%), Positives = 166/312 (53%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFN---ESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKY-VIDLNQK--TNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M E L ++DV I+GGG  G++ +  S   +L + ++E    LGG+ + LYP K I+D       +   +I++L +Q K  +   I L+  I   +++    Q + L   N +    K +ILA G+G    RKLEI + +  +   ++Y++  E + +  K++++ GGGDSAV+WAN  V   I  +V ++HRR+ +      +  +  +       +E+ D +   +    +TI+H ET + + +  D V+V +G      ++ +L++   ++G++ +I++N+K  TN+  +YA+GD      K   I     + V AL
  S:     1 MTEQLELFDVTIIGGGPAGMYTAFYSGMRDLKTKVLEYNESLGGKIL-LYPEKVIWDVGGLPPTRGEQLIQQLEKQAKTFE-PEIALNQKI--TSFERDEHQNILLTAENGDRHLTKTLILAMGHGIPVQRKLEIEHADRYEVTNLYYTVQ-ELKTFAGKRVVISGGGDSAVDWANALV--PIAESVTVVHRRDMFGGHEKNVANMKASCARILTPHELTDLHGQGDKIDAVTIQHLETGEIERIETDAVIVNHGMKG---DLSVLSEWGLKQGEWGLIEVNEKMETNLPGVYAVGDLCTHKSKVRLIAGTFVDGVNAL 309
>gi|169826377|ref|YP_001696535.1| thioredoxin reductase [Lysinibacillus sphaericus C3-41] >gi|168990865|gb|ACA38405.1| Thioredoxin reductase [Lysinibacillus sphaericus C3-41] (353 aa)
Score = 288, Expect = 4.2e-24, Identities = 92/306 (30%), Positives = 163/306 (53%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN-----KTLTIKHKETEKEQTLPFDYVLVQYGQI-------SSPINIELLNQINKEKGKYVI--DLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           +YDV I+GGG  G+++S       + + LIE +  LGG+ + +YP K I+D      I    +IK+L++Q     N +I  D  +L+I     N++ +F+      N  Y+K +I+A G G  NP+K+EI   E  +   ++Y++    E +KNK +++ GGG++AV+WA   +E  + + V + +R+++  +    I  L+ + I    N EI      +     K + + + ET     +P D V++ +G +       +SP+ IE        K  Y I   +N +++I  +YA GD  H   K + I  A  +A+ A+
  S:    10 MYDVTIIGGGPAGLYSSFYCGLREMKTKLIESQPQLGGK-IHVYPEKMIWDIGGVTPISGGQLIKQLVEQ-ALTFNPSIYTDEKVLSI---AKNDEGIFVITAESGNIHYSKTVIVAIGGGILNPQKIEIEGAERFEVSNLNYTIK-SYEKFKNKAVIISGGGNTAVDWALELME--VASKVYLTYRKDQLSAHEAQITELTNSAIECHYNSEITKLIADDQEGMIKAIALTNHETGTITEIPIDEVVISHGYVRDKELLDNSPLAIE-------RKNDYFIAGTINSESSIPGLYAAGDILHHDGKIHLIAAAFHDALHAV 316
>gi|94990225|ref|YP_598325.1| thioredoxin reductase [Streptococcus pyogenes MGAS10270] >gi|94543733|gb|ABF33781.1| Thioredoxin reductase [Streptococcus pyogenes MGAS10270] (330 aa)
Score = 288, Expect = 4.5e-24, Identities = 100/307 (32%), Positives = 167/307 (54%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQ-NKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIID--FNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           + YD+ I+GGG  G+FA+  +    +   +IE  S LGGQP  LYP K IYD P +  +  +++ + LI+Q ++ +  + I L  ++L  T+  +     F   TNK   ++K II+A GNG+F PR L + +E       + Y+++ + + +  +K+++ GGGDSAV+WA     E I  +V ++HRR+ +R+    ++ L  S  N+L     + +    N + K +  K KE E  + L  D ++V +G  +S  N++  N   K     V  L Q T+ + I+AIGDA  +  K + I T   EA  A+
  S:     4 KAYDITIIGGGPIGLFAAFYAGLRGVTVKIIESLSELGGQPAILYPEKMIYDIPAYPSLTGAELTENLIKQLSRFEDRTTICLKEEVL--TFDKVKGG--FSIRTNKAEHFSKAIIIACGNGAFAPRTLGLESEENFADHNLFYNVH-QLDQFAGQKVVICGGGDSAVDWA--LALEDIAESVTVVHRRDAFRAHEHSVELLKASTVNLLTPYVPKALKGIGNLAEKLVIQKVKEDEVLE-LELDSLIVSFGFSTSNKNLKNWNLDYKRSSITVSPLFQ-TSQEGIFAIGDAAAYKGKVDLIATGFGEAPTAV 307
>gi|89890073|ref|ZP_01201584.1| thioredoxin reductase [Flavobacteria bacterium BBFL7] >gi|89518346|gb|EAS21002.1| thioredoxin reductase [Flavobacteria bacterium BBFL7] (354 aa)
Score = 288, Expect = 4.9e-24, Identities = 98/300 (32%), Positives = 154/300 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKE-QKNSNI---QLDTDILNITWQTINEQELFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY----EIIDFNESNK----TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN---QINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+F    +    L   LI+     GGQ  ELYP K IYD P F E+ + D++  L++Q K  Q    +     D D L        E   F+  TNK +  +A  + +A G GSF PRK +I   E  +   + Y +  + E Y++KK+++ GGGDSA++W+ +     +   V ++HRR E+R +   ++ + +     K+N     E+ D   ++K    T+TI H E ++ Q +  D  +  +G   SP    + N   +I K   K    L+ +TNI  IYAIGD   +  K   I+    EA
  S:     5 DILIIGAGPTGLFTVFEAGLLKLKCHLIDALPQPGGQCSELYPKKPIYDIPGFPEVLAGDLVDNLMEQIKPFQPGFTLGERAEDIDKL--------EDGTFIVTTNKGTKHHANAVAIAGGLGSFEPRKPQIVGIENYEDRGVAYMIK-DPEAYRDKKVVIAGGGDSALDWSIFLA--NVAQEVTLVHRREEFRGALDSVEKVQELVTQNKINLITPAEVTDVKGTDKVESVTITI-HDEAKRFQEIECDAFVPLFGL--SPKLGPIANWGLEIEKNAIKVDNTLDYQTNIPGIYAIGDVNTYPGKLKLILCGFHEA 307
>gi|21910111|ref|NP_664379.1| putative thioredoxin reductase [Streptococcus pyogenes MGAS315] >gi|21904303|gb|AAM79182.1| putative thioredoxin reductase [Streptococcus pyogenes MGAS315] (330 aa)
Score = 287, Expect = 5.6e-24, Identities = 100/307 (32%), Positives = 167/307 (54%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQ-NKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIID--FNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           + YD+ I+GGG  G+FA+  +    +   +IE  S LGGQP  LYP K IYD P +  +  +++ + LI+Q ++ +  + I L  ++L  T+  +     F   TNK   ++K II+A GNG+F PR L + +E       + Y+++ + + +  +K+++ GGGDSAV+WA     E I  +V ++HRR+ +R+    ++ L  S  N+L     + +    N + K +  K KE E  + L  D ++V +G  +S  N++  N   K     V  L Q T+ + I+AIGDA  +  K + I T   EA  A+
  S:     4 KAYDITIIGGGPIGLFAAFYAGLRGVTVKIIESLSELGGQPAILYPEKMIYDIPAYPSLTGAELTENLIKQLSRFEDRTTICLKEEVL--TFDKVKGG--FSIRTNKAEHFSKAIIIACGNGAFAPRTLGLESEENFADHNLFYNVH-QLDQFAGQKVVICGGGDSAVDWA--LALEDIAESVTVVHRRDAFRAHEHSVELLKASTVNLLTPYVPKALKGIGNLAEKLVIQKVKEDEVLE-LELDSLIVSFGFSTSNKNLKNWNLDYKRSSITVSPLFQ-TSQEGIFAIGDAAAYNGKVDLIATGFGEAPTAV 307
>gi|56807462|ref|ZP_00365412.1| COG0492: Thioredoxin reductase [Streptococcus pyogenes M49 591] (330 aa)
Score = 287, Expect = 5.9e-24, Identities = 100/307 (32%), Positives = 167/307 (54%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQ-NKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIID--FNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           + YD+ I+GGG  G+FA+  +    +   +IE  S LGGQP  LYP K IYD P +  +  +++ + LI+Q ++ +  + I L  ++L  T+  +     F   TNK   ++K II+A GNG+F PR L + +E       + Y+++ + + +  +K+++ GGGDSAV+WA     E I  +V ++HRR+ +R+    ++ L  S  N+L     + +    N + K +  K KE E  + L  D ++V +G  +S  N++  N   K     V  L Q T+ + I+AIGDA  +  K + I T   EA  A+
  S:     4 KAYDITIIGGGPIGLFAAFYAGLRGVTVKIIESLSELGGQPAILYPEKMIYDIPAYPSLTGAELTENLIKQLSRFEDRTTICLKEEVL--TFDKVKGG--FSIRTNKAEHFSKAIIIACGNGAFAPRTLGLESEENFADHNLFYNVH-QLDQFAGQKVVICGGGDSAVDWA--LALEDIAESVTVVHRRDAFRAHEHSVELLKTSTVNLLTPYVPKALKGIGNLAEKLVIQKVKEDEVLE-LELDSLIVSFGFSTSNKNLKNWNLDYKRSSITVSPLFQ-TSQEGIFAIGDAAAYNGKVDLIATGFGEAPTAV 307
>gi|163753377|ref|ZP_02160501.1| Thioredoxin reductase [Kordia algicida OT-1] >gi|161327109|gb|EDP98434.1| Thioredoxin reductase [Kordia algicida OT-1] (351 aa)
Score = 286, Expect = 7.2e-24, Identities = 94/300 (31%), Positives = 155/300 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY----EIIDFNESNKTLTIK-HKETEKEQTLPFDYVLVQYGQISS--PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+FA   +    L   LI+     GGQ  E+YP K IYD P + E+ + D++  L++Q +  +       T  L    +TI + +   F+  TNK +  +A  + +A G GSF PRK  I N    +   + Y +  + E+Y++KK+++ GGGDSA++W+ +  +  + + V ++HRR E+R +   ++ + +   L K+N     EI   +  N    ++  K+ E   TL  D+ +  +G      PI    L +I K   K    L+ +TNI  IYAIGD   +  K   I+    EA
  S:     5 DILIIGAGPTGLFAVFEAGLLKLKCHLIDALPQPGGQCSEIYPKKPIYDIPGYPEVLAGDLVDNLMKQIEPFE------PTFTLGERAETIEKLDDGTFIVTTNKGTKHHAPIVAIAGGLGSFEPRKPPIQNLANYEDKGVEYIIR-DPEVYRDKKVVIAGGGDSALDWSIFLTD--VASEVTLVHRRTEFRGALDSVEKVQELKNLGKINLITPAEITGIHGENHVSGVEVTKKGEAPFTLETDHFIPLFGLAPKLGPIGDWGL-EIEKNAIKVDNTLDYQTNIPGIYAIGDVNTYPGKLKLILCGFHEA 305
>gi|157827075|ref|YP_001496139.1| thioredoxin reductase [Rickettsia bellii OSU 85-389] >gi|157802379|gb|ABV79102.1| Thioredoxin reductase [Rickettsia bellii OSU 85-389] (332 aa)
Score = 286, Expect = 7.3e-24, Identities = 95/306 (31%), Positives = 161/306 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKN-SFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLS------KNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYG---QISSPINIEL---LNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           DV I+G G  G+FA   +    +   +I+ +  +GGQ + LYP K IYD P + +I ++D+IK+L  Q     N    L+   + +      E E F  +T+K+    +K I++A+G GSF P K  + N E  ++  + Y +N  ++ +  K I++ GGGDSAV+WA    E  I N + ++HRR+++R+++  +  L       K  ++     + ++ N S     I        + L  + +L  +G   ++ + +N +L   L+ I  +   Y      +TNI  IYAIGD  H+  K   I+T  AEA  +L H
  S:     5 DVLIIGAGPVGLFAIFQAGMLGMKCHVIDAQEVIGGQCITLYPEKPIYDIPAYPKIAAADLIKQLELQ-AAPFNPVYHLNQQAVELK----KEGEFFEVKTSKDIVIKSKVIVIAAGAGSFGPNKPPLANIEEFENESVFYFINNRSK-FTGKNIVIAGGGDSAVDWAISLSE--IANKIYLVHRRDKFRAANESLRQLKDIAESGKIELVTGYQLDSLEGNNSELQSVIVRDLQNNTRKLNVNILLPFFGLKQELGNLVNWDLDIKLHHIEVDPVYY------QTNISGIYAIGDVAHYSGKLKLILTGFAEAASSLHH 310
>gi|146299267|ref|YP_001193858.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Flavobacterium johnsoniae UW101] >gi|146153685|gb|ABQ04539.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Flavobacterium johnsoniae UW101] (357 aa)
Score = 286, Expect = 8.6e-24, Identities = 93/300 (31%), Positives = 154/300 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLN-------YEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+FA   +    L   +++     GGQ  ELYP K IYD P F E+ + D++  L++Q K+ +          L    +T+ +QE   F+  +NK + F+A  I +A G GSF PRK  I + E  +   + Y +    E +++K++++ GGGDSA++W+ +     + + V +IHRRNE+R +   +D + K   L+           E+I  N +    ++  +E    + +  DY +  +G      PI    L +I K   K    L+ +TNI  I+AIGD   +  K   I+    EA
  S:    12 DILIIGAGPTGLFAVFEAGLLKLKCHILDALPQPGGQLSELYPKKPIYDIPGFPEVLAGDLVDGLMEQIKQFEPGF------TLGERAETVEKQEDGTFIVTSNKGTKFHAPVIAIAGGLGSFEPRKPLIEDIEFYEDKGVKYFIK-NPEKFRDKRVVIAGGGDSALDWSIFLA--NVASEVTLIHRRNEFRGA---LDSVEKVQELKSAGKIKLITPAEVIGINGAEHVESLDIEENGAHRKIECDYFIPLFGLTPKLGPIGDWGL-EIEKNAIKVNNALDYQTNIPGIFAIGDVNTYPGKLKLILCGFHEA 311
>gi|91205797|ref|YP_538152.1| thioredoxin reductase [Rickettsia bellii RML369-C] >gi|91069341|gb|ABE05063.1| Thioredoxin reductase [Rickettsia bellii RML369-C] (332 aa)
Score = 286, Expect = 8.7e-24, Identities = 95/306 (31%), Positives = 161/306 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKN-SFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLS------KNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYG---QISSPINIEL---LNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           DV I+G G  G+FA   +    +   +I+ +  +GGQ + LYP K IYD P + +I ++D+IK+L  Q     N    L+   + +      E E F  +T+K+    +K I++A+G GSF P K  + N E  ++  + Y +N  ++ +  K I++ GGGDSAV+WA    E  I N + ++HRR+++R+++  +  L       K  ++     + ++ N S     I        + L  + +L  +G   ++ + +N +L   L+ I  +   Y      +TNI  IYAIGD  H+  K   I+T  AEA  +L H
  S:     5 DVLIIGAGPVGLFAIFQAGMLGMKCHVIDAQEVIGGQCITLYPEKPIYDIPAYPKIAAADLIKQLELQ-AATFNPVYHLNQQAVELK----KEGEFFEVKTSKDIVIKSKVIVIAAGAGSFGPNKPPLANIEEFENESVFYFINNRSK-FTGKNIVIAGGGDSAVDWAISLSE--IANKIYLVHRRDKFRAANESLRQLKDIAESGKIELVTGYQLDSLEGNNSELQSVIVRDLQNNTRKLNANILLPFFGLKQELGNLVNWDLDIKLHHIEVDPVYY------QTNISGIYAIGDVAHYSGKLKLILTGFAEAASSLHH 310
>gi|157964541|ref|YP_001499365.1| thioredoxin reductase [Rickettsia massiliae MTU5] >gi|157844317|gb|ABV84818.1| Thioredoxin reductase [Rickettsia massiliae MTU5] (337 aa)
Score = 286, Expect = 8.8e-24, Identities = 96/306 (31%), Positives = 164/306 (53%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFY-AKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL------SKNNILQKLNYEIIDFNESN-KTLTIK--HKETEKEQT---LPFDYVLVQYGQISS-PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           DV I+G G  G+FA   +    +   +I+ +  +GGQ + LYP K IYD P + +I + ++IK+L  Q     N    L+   + +  Q     + F  +T+KN+    K II+A+G GSF P K  + N E  +S  + Y +N +++ +  K I++ GGGDSAV+WA +  +  I N + ++HRR+++ ++   +  L       K  ++       +D N +  +++ +K  H  T K      LPF  +    G +++  +N++  + I  +   Y      +TNI+ IYAIGD  H+  K   I+T  AEA  +L H
  S:     8 DVVIIGAGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITLYPEKPIYDIPAYPKIAAEELIKQLELQ-AAPFNPIYHLNQQAIELNKQ----DDFFEIKTSKNTLIKGKVIIIAAGAGSFGPNKPPLANIEDFESKSVFYFINDKSK-FAGKNIVIAGGGDSAVDWAIFLSD--IANKIYLVHRRDKFTAAPESVRQLRHIAETDKIELVTGYQLNALDGNNAELQSVIVKDLHNNTRKLDANILLPFFGLKQDLGSLANWGLNVK-HHHIEVDSSYY------QTNIEGIYAIGDIAHYGGKLKLILTGFAEAASSLHH 313
>gi|148285001|ref|YP_001249091.1| thioredoxin reductase [Orientia tsutsugamushi str. Boryong] >gi|146740440|emb|CAM80936.1| Thioredoxin reductase [Orientia tsutsugamushi Boryong] (338 aa)
Score = 285, Expect = 8.9e-24, Identities = 88/314 (28%), Positives = 159/314 (50%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQ--------NKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSK----NNILQKLNYEIIDFNESNKTL--TIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           +++++   DV IVG G  G+FA   +    +   +++    +GGQ + LYP+K IYD P +  I ++ +I++L QQ        +  Q+    ++D DI+ IT  T  EQ +           +K +I+A+G G+F  ++L ++N E  ++  + YS+  +   + NKK+++ GGGDSA++W    +   +   + ++HRR  +R +   ++ + +      +   + Y++      N  L   +        QTLP DY+L  +G  +    I         +   V  +  +T I  IYAIGD   +  K   I+T  AEA  A+ H
  S:     2 LSKNVHTADVVIVGAGPVGLFAVFQAGMLEMKCHVVDALDCIGGQCVTLYPDKPIYDIPAYPVITAAKLIEQLKQQVAPFDTVYHLGQQVIGCKIDNDIITIT--TSAEQVIC----------SKSLIIAAGCGAFKYKRLILDNIEAFENKTVFYSVK-DKNKFINKKVVIAGGGDSAIDWT--LLLSDVAEVIYLVHRRENFRCAPHSLNQIKQLAEYGKVQMIVPYQLAKLTGENGLLQEVLVTNFNGGTQTLPADYLLAFFGLAADLGPIHKWGLKTDLRRIEVNSITYETTIPGIYAIGDVASYPGKLKLILTGFAEAATAMSH 315
>gi|71903304|ref|YP_280107.1| thioredoxin reductase [Streptococcus pyogenes MGAS6180] >gi|71802399|gb|AAX71752.1| thioredoxin reductase [Streptococcus pyogenes MGAS6180] (330 aa)
Score = 285, Expect = 1.1e-23, Identities = 95/307 (30%), Positives = 162/307 (52%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQ-NKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           + YD+ I+GGG  G+FA+  +    +   +IE  S LGGQP  LYP K IYD P +  +   ++ + LI+Q N+ +    I L  ++L  T+  +     F   TNK   ++K II+A GNG+F PR L + +E       + Y+++ + + +  +K+++ GGGDSAV+WA     E I  +V ++HRR+ +R+    ++ L+ + +     Y    +       + L I+  + ++   L  D ++V +G  +S  N++  N   K     V  L Q T+ + I+AIGDA  +  K + I T   EA  A+
  S:     4 KAYDITIIGGGPIGLFAAFYAGLRGVTVKIIESLSELGGQPAILYPEKMIYDIPAYPSLTGVELTENLIKQLNRFEDRITICLKEEVL--TFDKVKGG--FSIRTNKAEHFSKAIIIACGNGAFAPRTLGLESEENFADHNLFYNVH-QLDQFAGQKVVICGGGDSAVDWA--LALEDIAESVTVVHRRDAFRAHEHSVELLTTSTVNLLTPYVPKALKGIGNLAEKLVIQKVKEDEVLELELDSLIVSFGFSTSNKNLKNWNLDYKRSSITVSPLFQ-TSQEGIFAIGDAAAYNGKVDLIATGFGEAPTAV 307
>gi|117647579|gb|ABK51757.1| putative thioredoxin reductase [Lactobacillus sanfranciscensis] (229 aa)
Score = 284, Expect = 1.2e-23, Identities = 80/231 (34%), Positives = 129/231 (55%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETE 236
           ++YD+ I+GGG  G+FA   +   N    +IE  S LGGQ   LYP K I D   F  +K S++I  L  Q         ++ T + N+    I + + F  ET++ ++  K +ILA+GNGSF PR+L  +N + +   FI YS+  + + + N+ ++V GGGDSAV+ A   + E + N+V+++HRRNE+R    M+D L  +++     Y I   +E +  L +  K+ E
  S:     4 KLYDITIIGGGPIGMFAGFYAGMRNAKVQIIESLSELGGQVNALYPEKTILDVAGFAGLKGSELINNLQTQLDTMPEVEQRVGTKVTNV----IRKDDHFEIETDQATYETKAVILATGNGSFKPRELRADNVDAVAEKFITYSVR-DLKKFANQDVIVAGGGDSAVDMA--LMLEPVANHVSLLHRRNEFRGLENMVDKLKASSVEILTPYLIKQLDEIDGRLQVTAKKNE 228
>gi|15865462|emb|CAC81333.1| putative reductase [Pseudomonas sp. KIE171] (326 aa)
Score = 284, Expect = 1.2e-23, Identities = 82/300 (27%), Positives = 148/300 (49%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFI-HYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE 307
           YD+ IVG G  G++A+  + +  L + L +    +GGQ   +YP K I+D   F  IK  D +K L++Q++ Q   +  L    L ++ +++++    +     N + AK +++A+G G   PR L    E +DSP I H+  +L   +     +++ GGGDSAV+WA   V      +V +IHRR  +R+    +  + ++ +      E+  ++E N    ++    +K++ L FD  ++  G  S    +E    +  E  +  +  N +TNI  ++AIGD + +  K   I     E
  S:     7 YDLVIVGAGPIGLYAAYYAGFRGLKTALFDGLPQVGGQVATMYPEKLIHDVAGFPGIKGGDFVKNLLEQSQRQ---DYDLYLSELIVSLESLSDDTFSITTDRGNHYTAKAVVIAAGLGKCTPRSLPA-LEGVDSPNIMHFVPDL--SVLDGNDVVIAGGGDSAVDWAIAAVPR--AKSVTVIHRRARFRAHEASVKDMYESGVRVVAPGEVAAYHEENGHEFLEIWSGDKKEILNFDSFVMALGFHSDLGPMESWG-LGIEGFRIPVKPNMETNISRVFAIGDISEYPGKVRLIAVGFGE 298
>gi|15674883|ref|NP_269057.1| putative thioredoxin reductase [Streptococcus pyogenes M1 GAS] >gi|71910470|ref|YP_282020.1| thioredoxin reductase [Streptococcus pyogenes MGAS5005] >gi|13622021|gb|AAK33778.1| putative thioredoxin reductase [Streptococcus pyogenes M1 GAS] >gi|71853252|gb|AAZ51275.1| thioredoxin reductase [Streptococcus pyogenes MGAS5005] (330 aa)
Score = 284, Expect = 1.3e-23, Identities = 100/307 (32%), Positives = 166/307 (54%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQ-NKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIID--FNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           + YD+ I+GGG  G+FA+  +    +   +IE  S LGGQP  LYP K IYD P +  +   ++ + LI+Q ++ +  + I L  ++L  T+  +     F   TNK   ++K II+A GNG+F PR L + +E       + Y+++ + + +  +K+++ GGGDSAV+WA     E I  +V ++HRR+ +R+    ++ L  S  N+L     + +    N + K +  K KE E  + L  D ++V +G  +S  N++  N   K     V  L Q T+ + I+AIGDA  +  K + I T   EA  A+
  S:     4 KAYDITIIGGGPIGLFAAFYAGLRGVTVKIIESLSELGGQPAILYPEKMIYDIPAYPSLTGVELTENLIKQLSRFEDRTTICLKEEVL--TFDKVKGG--FSIRTNKAEHFSKAIIIACGNGAFAPRTLGLESEENFADHNLFYNVH-QLDQFAGQKVVICGGGDSAVDWA--LALEDIAESVTVVHRRDAFRAHEHSVELLKASTVNLLTPYVPKALKGIGNLAEKLVIQKVKEDEVLE-LELDSLIVSFGFSTSNKNLKNWNLDYKRSSITVSPLFQ-TSQEGIFAIGDAAAYNGKVDLIATGFGEAPTAV 307
>gi|19745924|ref|NP_607060.1| putative thioredoxin reductase [Streptococcus pyogenes MGAS8232] >gi|50914022|ref|YP_059994.1| thioredoxin reductase [Streptococcus pyogenes MGAS10394] >gi|94988343|ref|YP_596444.1| thioredoxin reductase [Streptococcus pyogenes MGAS9429] >gi|94992224|ref|YP_600323.1| thioredoxin reductase [Streptococcus pyogenes MGAS2096] >gi|139473977|ref|YP_001128693.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pyogenes str. Manfredo] >gi|19748080|gb|AAL97559.1| putative thioredoxin reductase [Streptococcus pyogenes MGAS8232] >gi|50903096|gb|AAT86811.1| Thioredoxin reductase [Streptococcus pyogenes MGAS10394] >gi|94541851|gb|ABF31900.1| thioredoxin reductase [Streptococcus pyogenes MGAS9429] >gi|94545732|gb|ABF35779.1| Thioredoxin reductase [Streptococcus pyogenes MGAS2096] >gi|134272224|emb|CAM30476.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus pyogenes str. Manfredo] (330 aa)
Score = 284, Expect = 1.4e-23, Identities = 100/307 (32%), Positives = 166/307 (54%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQ-NKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIID--FNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           + YD+ I+GGG  G+FA+  +    +   +IE  S LGGQP  LYP K IYD P +  +   ++ + LI+Q ++ +  + I L  ++L  T+  +     F   TNK   ++K II+A GNG+F PR L + +E       + Y+++ + + +  +K+++ GGGDSAV+WA     E I  +V ++HRR+ +R+    ++ L  S  N+L     + +    N + K +  K KE E  + L  D ++V +G  +S  N++  N   K     V  L Q T+ + I+AIGDA  +  K + I T   EA  A+
  S:     4 KAYDITIIGGGPIGLFAAFYAGLRGVTVKIIESLSELGGQPAILYPEKMIYDIPAYPSLTGVELTENLIKQLSRFEDRTTICLKEEVL--TFDKVKGG--FSIRTNKAEHFSKAIIIACGNGAFAPRTLGLESEENFADHNLFYNVH-QLDQFAGQKVVICGGGDSAVDWA--LALEDIAESVTVVHRRDAFRAHEHSVELLKTSTVNLLTPYVPKALKGIGNLAEKLVIQKVKEDEVLE-LELDSLIVSFGFSTSNKNLKNWNLDYKRSSITVSPLFQ-TSQEGIFAIGDAAAYNGKVDLIATGFGEAPTAV 307
>gi|51892103|ref|YP_074794.1| thioredoxin reductase [Symbiobacterium thermophilum IAM 14863] >gi|51855792|dbj|BAD39950.1| thioredoxin reductase [Symbiobacterium thermophilum IAM 14863] (336 aa)
Score = 283, Expect = 1.7e-23, Identities = 95/312 (30%), Positives = 157/312 (50%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS---FYAKKIILASGNGSFNPRKLEINNEP---IDSPFIHYSL-NLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M+    +YDV ++G G  G+F    +    + + +IE    +GGQ   LYP K I+D   F  I +    K+L++Q KEQ +S     T + N     +N  E   FE   ++    Y+K +I+ +G G+F P +  I NE     +   + YS+ NL    ++ K++LV+GGGDSAV++A   + E I   V +IHRR+ +R+    +  L+ + +  K+ YE+          K  TI    T +E T+  D V++  G  +S  ++       + K + V++   +TNI  +YA GD   +  K   I T   E   A+
  S:     1 MSGTKELYDVTLIGAGPTGLFGVFYAGMRGMKTKVIEALPEVGGQLAALYPEKDIFDVAGFPRISA----KRLVEQCKEQADSANPDATYVFNQRVDKLNRLEDGTFELVTHTGERHYSKAVIITAGIGAFEPNR--IPNESARQYEGKGVFYSVTNLPQ--FEGKRVLVIGGGDSAVDYA--LMVEPIAAEVTLIHRRDGFRAHEESLKKLAASRVHVKVFYELRRVEGDGNWVKKATIFDNRTGEETTIDVDCVIIGTGFKASLGSMLEWGLEIENKRQIVVNSKGETNIPGVYAAGDICWYPGKIRLIATGFGEVATAV 312
>gi|48477503|ref|YP_023209.1| thioredoxin reductase [Picrophilus torridus DSM 9790] >gi|48430151|gb|AAT43016.1| thioredoxin reductase [Picrophilus torridus DSM 9790] (331 aa)
Score = 283, Expect = 1.7e-23, Identities = 95/310 (30%), Positives = 166/310 (53%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFY-AKKIILASGNGSFNPRKLEINNEPIDSPF---IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKN-NILQKLNYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQIS-SPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITAC--AEAVRALWHISK 317
           YD+ I+G G  G+FA+ ++   ++ SI +E   Y+GGQ  ELYP K +YD     +I +  +  ++ +Q K   N+ I+L++ + +I    I E ++F  E N    Y A+ ++L +G G F PRK+    E  D  F   + Y++  +TE +++  + V+GGGDSA+++A          +V IIH    ++++   ID   KN  I   +N  +I  +  +K  ++ IK++ T     L  D ++V  G +  + I   L  Q++  K   +++   +TNI  IYA GD      +P   + A   A+A +A+ +I K
  S:     4 YDLVIIGAGPTGLFATFLAGLRDIKSITLEALDYVGGQIPELYPEKPVYDVQGIPKINAIKLRDQMYEQAK-TFNNRIELNSKVTDI----IKENDIFKIEVNGVYKYNARAVLLCTGIGDFTPRKIGCEGE--DRFFNKGLTYTVK-DTEKFRDLTVAVVGGGDSALDYATELA--NTARHVYIIHHSENFKAAEKTIDLARKNEKITFIVNSSVISIDGGSKLESIKIKNELTNDISELGLDALVVAIGHVGRANIYKSLPLQLSPNKRGVLVNSKLETNIPGIYAAGDVASVEGEPANPLIAIGGAQAYQAINYIKK 313
>gi|86132469|ref|ZP_01051063.1| probable thioredoxin resuctase [Cellulophaga sp. MED134] >gi|85817030|gb|EAQ38214.1| probable thioredoxin resuctase [Dokdonia donghaensis MED134] (350 aa)
Score = 283, Expect = 1.8e-23, Identities = 92/300 (30%), Positives = 151/300 (50%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYR----SSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+F    +    L   LI+     GGQ  E+YP K IYD P F E+ + D++  L++Q +  +          L    QTI++QE   F+  TNK +  +A  + +A G GSF PRK  I+N    +   + Y +  + E+Y++K +++ GGGDSA++W+ +  +  + + V ++HRRNE+R    S   + D  ++  I      E+++         +  K+  +  T   D+ +  +G      PI    L +I K   K    L+ +TNI  IYAIGD   +  K   I+    EA
  S:     5 DILIIGAGPTGLFTVFEAGLLKLKCHLIDALPQPGGQCAEIYPKKPIYDIPAFPEVLAGDLVDNLMKQIEPFQPGF------TLGERAQTIDKQEDGSFIVTTNKGTKHHAPVVAIAGGLGSFEPRKPPISNIASYEDKGVEYIIR-DPELYRDKSVVIAGGGDSALDWSIFLAD--VASEVTLVHRRNEFRGALDSVEKVQDLKNQGKIKLITPAEVVEVIGEGAVSGVSIKQGAEVFTKDCDHFIPLFGLAPKLGPIADWGL-EIEKNAIKVDNTLDYQTNIPGIYAIGDVNTYPGKLKLILCGFHEA 304
>gi|94994144|ref|YP_602242.1| Thioredoxin reductase [Streptococcus pyogenes MGAS10750] >gi|94547652|gb|ABF37698.1| Thioredoxin reductase [Streptococcus pyogenes MGAS10750] (330 aa)
Score = 283, Expect = 2.0e-23, Identities = 99/307 (32%), Positives = 166/307 (54%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQ-NKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIID--FNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           + YD+ I+GGG  G+FA+  +    +   +IE  S LGGQP  LYP K IYD P +  +   ++ + LI+Q ++ +  + I L  ++L  T+  +     F   TNK   ++K II+A GNG+F PR L + +E       + Y+++ + + +  +K+++ GGGDSAV+WA     E I  +V ++HRR+ +R+    ++ L  S  N+L     + +    N + K +  K KE E  + L  D ++V +G  +S  N++  N   K     V  L Q T+ + ++AIGDA  +  K + I T   EA  A+
  S:     4 KAYDITIIGGGPIGLFAAFYAGLRGVTVKIIESLSELGGQPAILYPEKMIYDIPAYPSLTGVELTENLIKQLSRFEDRTTICLKEEVL--TFDKVKGG--FSIRTNKAEHFSKAIIIACGNGAFAPRTLGLESEENFADHNLFYNVH-QLDQFAGQKVVICGGGDSAVDWA--LALEDIAESVTVVHRRDAFRAHEHSVELLKASTVNLLTPYVPKALKGIGNLAEKLVIQKVKEDEVLE-LELDSLIVSFGFSTSNKNLKNWNLDYKRSSITVSPLFQ-TSQEGVFAIGDAAAYNGKVDLIATGFGEAPTAV 307
>gi|15604374|ref|NP_220890.1| thioredoxin reductase (trxB2) [Rickettsia prowazekii str. Madrid E] >gi|3861066|emb|CAA14966.1| THIOREDOXIN REDUCTASE (trxB2) [Rickettsia prowazekii] (334 aa)
Score = 282, Expect = 2.3e-23, Identities = 97/306 (31%), Positives = 156/306 (50%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKK-IILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL----SKNNILQKLNYEIIDFNESN--------KTLTIKHKETEKEQTLPFDYVLVQYGQISS-PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           D+ I+G G  G+FA   +    +   +I+ +  +GGQ + LYP K IYD P + +I + ++IK+L  Q     N    L+     +        + F  +T+KN+    K II+A+G G+F P K  I N E  +   I Y +N +++ +  K I+V GGGDSAV+WA    E  I N + ++HRR+++ +++  +  L        I     Y++ + +  N        K L    ++ +    LPF  +    G +++   N+  L  I  +   Y      +TNIK IYAIGD  H+  K   IIT  AEA  +L H
  S:     5 DIVIIGSGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITLYPEKHIYDIPAYPKIAAKELIKQLESQ-AAPFNPVYHLNQQATELN----KHDDFFEIKTSKNTLIKSKVIIIAAGAGAFGPNKPPIANIEAFEGKSIFYFINDKSK-FLGKNIVVAGGGDSAVDWAITLSE--IANKIYLVHRRDKFTAATESVRQLRHIAETGKIELVTGYQLNNLDGHNSELRSVIVKDLQNNIRKLDANILLPFFGLKQDLGPLANWGFNVR-LQHIEVDNYYY------QTNIKGIYAIGDVAHYVGKLKLIITGFAEAACSLHH 310
>gi|91783788|ref|YP_558994.1| putative thioredoxin reductase, trxB [Burkholderia xenovorans LB400] >gi|91687742|gb|ABE30942.1| Putative thioredoxin reductase, trxB [Burkholderia xenovorans LB400] (353 aa)
Score = 281, Expect = 2.7e-23, Identities = 84/304 (27%), Positives = 166/304 (54%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNK--------EQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEI-----IDF-NESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDL-NQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           DV IVG G  G+FA+  +    L+  +++    +GGQ +ELYP+K IYD P      + +++++L+ Q +        EQ+  +++   D     W    ++ L         F    I+LA+GNG+F P+KL +    P++S  +HYS+    + +  K ++V GGGDSA++WA      K+   V ++HRR+ + ++   ++ + +     ++++ +     +D  +++ K++T++H E E +  L  ++++  YG ++    I     ++   G+  +D  N +++   I+A+GD  H+  K   I++   EA  AL
  S:    19 DVLIVGAGPVGLFAAFEAGVIGLSCQIVDGLDKVGGQCIELYPDKPIYDIPAIPSCTARELVERLLAQCRPFDPPIHLEQRVESVEQGGD---GRWTVRTDRGLV--------FDVAAILLAAGNGAFVPQKLALAEAVPLESRHVHYSVPRLAD-FAGKTVVVAGGGDSALDWA--LALRKVARRVTLVHRRSGFSAADSSVESMRRAVEAGEMDFVVGAIAGLDVEDDALKSITLRHIEGETQ--LAAEHLVALYGLVADLGPIAQWG-LSIHGGRVDVDTSNYESSRPGIFAVGDIAHYPNKQKLILSGFHEASLAL 321
>gi|119713360|gb|ABL97423.1| thioredoxin-disulfide reductase [uncultured marine bacterium EB80_69G07] (339 aa)
Score = 279, Expect = 4.7e-23, Identities = 95/314 (30%), Positives = 162/314 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL------SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAE---AVRALWHISKNKKDW 322
           D  I+G G  G+F +       LN  +++    +GGQ +ELYP+K IYD P   E    ++   L+ Q K   +    L+  +  +      E + +L +TN   SF    +I+A G GSF PRK      E  ++  + YS+  + +I+K K + + GGGDSA++WA   VE     +V +IHRR+E+R +   ID +       K N+  +     +  +++ +++ IKH   E  +++  DYVL  +G I     I     +N +K    +D  + +TN K IYA+GD  ++  K   I++   E   A RA + +++  + +
  S:     5 DALIIGAGPTGLFTAHQLKLIGLNCEVVDNLDKIGGQCIELYPDKPIYDIPAVPECTGEELTNNLVNQLKP-FDIKFHLNERVEEVK----KENDNWLVKTNNGTSFSTPNVIIAGGVGSFEPRKFSPKECEKFENKSLFYSVK-DKKIFKGKTVSIFGGGDSALDWA---VELSKECSVNLIHRRDEFRGAQATIDKVHQLAKDGKINLFTQYQMASVKGDKNLESIDIKHDNNEI-KSIKTDYVLGFFGLIMQLGPIANWG-LNIDKKTIEVDTEKFETNQKGIYAVGDICNYPGKLKLILSGFHEGALAARACFKLARPNEKY 319
>gi|57239131|ref|YP_180267.1| thioredoxin reductase [Ehrlichia ruminantium str. Welgevonden] >gi|58579079|ref|YP_197291.1| thioredoxin reductase [Ehrlichia ruminantium str. Welgevonden] >gi|57161210|emb|CAH58124.1| putative pyridine nucleotide-disulphide oxidoreductase [Ehrlichia ruminantium str. Welgevonden] >gi|58417705|emb|CAI26909.1| Thioredoxin reductase [Ehrlichia ruminantium str. Welgevonden] (337 aa)
Score = 279, Expect = 4.7e-23, Identities = 96/309 (31%), Positives = 165/309 (53%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTD-ILNITWQTINEQ-ELFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVE-EKITNNVAIIHRRNEYR----SSSFMIDCLSKNNILQKLNYEIIDFNESNKTL---TIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVID-LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA---LWHI 315
           + D+ ++G G  GIF    S   ++   +I+  + +GGQ + LYP K IYD P +  I + ++I  L++Q+K         D   +L    + I E  +  L +TN  +    K II+A+G+G+F P +L ++N    ++  + YS+   ++ Y +K +++ GGGDSA +WA   VE  K+T  + ++HRR  +R    +S  + D   +  I   + Y+I      +  L    +K+  T +E TL  DY+L  +G  S+ +   L   I     + VID    +TN   IYA+GD + +  K   I+T  +E+  A   ++HI
  S:     5 VTDIVVIGAGPIGIFTVFQSGMLSMQCCVIDSLNEIGGQCVALYPEKPIYDIPAYPIITAKELINNLVEQSKP-------FDPQYLLGQVAEKIEEYIDYLLVKTNYGTVIQCKAIIIAAGSGAFGPNRLPVDNIIDFENKSVFYSVKQISDFY-DKSVMIAGGGDSAADWA---VELSKVTKQLYMVHRRKNFRCSPNTSLKLDDLFQRGKINLVVPYQIKQLCGKDGKLDYVVVKNITTSEELTLQVDYLLPFFGT-SANLGPILNWGITISGYQIVIDPATCRTNRNRIYAVGDVSTYPGKIKLILTGFSESAMACHDIYHI 317
>gi|88806874|ref|ZP_01122390.1| thioredoxin reductase [Robiginitalea biformata HTCC2501] >gi|88783208|gb|EAR14381.1| thioredoxin reductase [Robiginitalea biformata HTCC2501] (353 aa)
Score = 279, Expect = 4.9e-23, Identities = 89/300 (29%), Positives = 160/300 (53%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNSFY-AKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKT----------LTIKHKETEK-EQTLPFDYVLVQYGQISS--PI---NIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+F    +    L   LI+     GGQ  E+YP K IYD P + EI + D++ +L++Q +   N    L         +T+ +QE   F+  TN+ + + A  +++A G GSF PRK +I+N    +   + Y +  + E++++KK+++ GGGDSA++W+ +  +  +   V+++HRRNE+R +   +D + K + L     +I  + E+  T          + + + + E+ E  +  D+ +  +G      PI    +E+     K    Y    + +TNI  +YAIGD   +  K   I++   EA
  S:     5 DILIIGAGPTGLFTVFEAGLLQLKCHLIDALPQPGGQCAEIYPKKPIYDIPAYPEILAGDLVDRLMEQIRP-FNPGFTLGERA-----ETLEKQEDGQFVVTTNRGTRHKAPVVVIAGGLGSFEPRKPQIDNLADFEDRGVSYMVR-DPEVFRDKKVVIAGGGDSALDWSIFLAD--VAAEVSLVHRRNEFRGA---LDSVEKASALAAAG-KIRLYTEAQVTRLYGDAHLEAVVVSYNDQERGESYVEADHFIPLFGLSPKLGPIGDWGLEIERNAIKVNNAY----DYQTNIPGVYAIGDVNTYPGKLKLILSGFHEA 307
>gi|116334382|ref|YP_795909.1| thioredoxin reductase [Lactobacillus brevis ATCC 367] >gi|116099729|gb|ABJ64878.1| Thioredoxin reductase [Lactobacillus brevis ATCC 367] (331 aa)
Score = 278, Expect = 6.0e-23, Identities = 97/308 (31%), Positives = 156/308 (50%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKE---QTLP----FDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ--KTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHI 315
           YD+ I+GGG  G+FA+  +   N  + L+E  S LGGQ   LYP K I D      I   D+IK   +Q   Q    I+   ++ N+T   +     F   T+  +     II+A GNG+F PR L +   E      + YS+    + ++++ ++V GGGD+A++ A   + E +  +V ++HRR ++R  + M+D L  + +  K  Y I    E   T T + K T KE   QT       D ++V YG  S    +   + I+  + + +I+++Q  +T++  IYAIGD   +  K   I T   EA  A+  I
  S:     5 YDITIIGGGPAGMFAAFYAGMHNAKTQLLESLSELGGQVNALYPEKTILDVAGLPAINGRDLIKAQREQ-LTQFPLTIKTGQEVTNVTANEVG----FTVTTDAGTTQTTAIIVAIGNGAFAPRPLTVPGAEAATGKQLVYSVPRLAD-FQDQTVMVAGGGDAAIDQA--LMLEPVAKSVTLLHRRAQFRGLAHMVDLLHASTVAVKTPYLI---REVAPTATGQLKVTLKEVGSQTATAEQIVDKLVVSYGYTSDHHTLAGWD-IDLAETRNLINVSQTMETSVPGIYAIGDGVTYPGKQPLIATGYGEAPVAVQSI 310
>gi|194015431|ref|ZP_03054047.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Bacillus pumilus ATCC 7061] >gi|194012835|gb|EDW22401.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Bacillus pumilus ATCC 7061] (349 aa)
Score = 278, Expect = 6.2e-23, Identities = 94/310 (30%), Positives = 162/310 (52%)
  Q:     3 EDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDIL---NITWQTINEQELFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEII------DFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELL--NQINKEKGKYVIDLN--QKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           +D+ +YDV I+GGG  G+F++  S    + + LIE + +LGG+ + +YP K I+D      +  S +I +++ Q        +  +  ++    +T  + +E+  F+  T  N   Y+K +ILA G G   P KL+I   E  +   +HY++      +K+K +L+ GGG+SA++WAN    E I   V + +R+   +     I  L KN+ +Q L +  I      D +E  KT+ +K+ + +    L  D V++ +G        ELL  + I  E+  Y I      +T+++ IYA GD  H   K + I  A  +A  A+
  S:     2 QDMEVYDVTIIGGGPAGLFSAFYSGLREMKTKLIEFQPFLGGK-VHVYPEKMIWDIGGLTPVPGSQLIDQIVAQ-------GLTFEPKVVLGEKVTSLSQDERGHFVLHTASNQKHYSKTVILAVGGGILKPIKLDIEGAERFEVQNLHYTVK-SLARFKDKTVLISGGGNSAIDWANEL--EPIAKQVYLTYRKEALKGHEAQISHL-KNSSVQFLLHTSIEKLIAADDHERIKTVVLKNNQDDALFDLAIDEVIINHGYERDK---ELLANSTIKLEQKDYWIAGTPLSETSVRGIYAAGDILHHEGKLHLIAGAFQDAANAV 311
>gi|58617137|ref|YP_196336.1| thioredoxin reductase [Ehrlichia ruminantium str. Gardel] >gi|58416749|emb|CAI27862.1| Thioredoxin reductase [Ehrlichia ruminantium str. Gardel] (337 aa)
Score = 278, Expect = 6.3e-23, Identities = 96/309 (31%), Positives = 165/309 (53%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTD-ILNITWQTINE-QELFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVE-EKITNNVAIIHRRNEYR----SSSFMIDCLSKNNILQKLNYEIIDFNESNKTL---TIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVID-LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA---LWHI 315
           + D+ ++G G  GIF    S   ++   +I+  + +GGQ + LYP K IYD P +  I + ++I  L++Q+K         D   +L    + I E  +  L +TN  +    K II+A+G+G+F P +L ++N    ++  + YS+   ++ Y +K +++ GGGDSA +WA   VE  K+T  + ++HRR  +R    +S  + D   +  I   + Y+I      +  L    +K+  T +E TL  DY+L  +G  S+ +   L   I     + VID    +TN   IYA+GD + +  K   I+T  +E+  A   ++HI
  S:     5 VTDIVVIGAGPIGIFTVFQSGMLSMQCCVIDTLNEIGGQCVALYPEKPIYDIPAYPIITAKELINNLVEQSKP-------FDPQYLLGQMAEKIEEYMDYLLVKTNYGTVIQCKAIIIAAGSGAFGPNRLPVDNIIDFENKSVFYSVKQISDFY-DKSVMIAGGGDSAADWA---VELSKVTKQLYMVHRRKNFRCSPNTSLKLDDLFQRGKINLVVPYQIKQLCGKDGKLDYVVVKNITTSEELTLQVDYLLPFFGT-SANLGPILNWGITISGYQIVIDPATCRTNRNKIYAVGDISTYPGKIKLILTGFSESAMACHDIYHI 317
>gi|24461667|gb|AAN62236.1|AF440524_23 putative thioredoxin reductase [Pseudomonas aeruginosa] (326 aa)
Score = 278, Expect = 6.5e-23, Identities = 80/300 (26%), Positives = 150/300 (50%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINNEPIDSPFI-HYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE 307
           YD+ IVG G  G++A+  + +  L + L +    +GGQ   +YP K I+D   F  IK  D +K L++Q++ Q + ++ L   I+ + + +    + +   T++ N + AK +++A+G G   PR L    E +DSP I H+  +L   +     +++ GGGDSAV+WA          +V +IHRR  +R+    ++ + ++ +      E+  ++E N    ++    + ++ L FD  ++  G  S    +E    +  E  +  +  N +TN+  ++AIGD + +  K   I     E
  S:     7 YDLVIVGAGPIGLYAAYYAGFRGLKTALFDGLPQVGGQVATMYPEKLIHDVAGFSAIKGGDFVKNLLEQSQRQ-DYDLYLSELIVGLEYLS---DDTYSITTDRGNHYTAKAVVIAAGLGKCTPRSLPALEE-VDSPSIMHFVPDL--SVLDGNDVVIAGGGDSAVDWA--IAAAPRAKSVTVIHRRARFRAHEASVNEMYESGVRVVAPGEVAAYHEENGQEFLELWSGDNKEILGFDRFVMALGFHSDLGPMESWG-LGIEGFRIPVKPNMETNMSRVFAIGDVSEYPGKVRLIAVGFGE 298
>gi|145588569|ref|YP_001155166.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145046975|gb|ABP33602.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Polynucleobacter sp. QLW-P1DMWA-1] (348 aa)
Score = 278, Expect = 6.8e-23, Identities = 86/299 (28%), Positives = 152/299 (50%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-----CLSKNNILQKLNYEIIDFNESNKTLT--IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAE 307
           D  I+G G  G+F         + + +I+     GGQ +ELYP+K IYD P        ++ + L++Q  E   +   L  ++  +  Q   +  L +  +    F +K + +A+G G+F PRKL +   E ++   I Y +    E +  KKI++ GGGDSA++WA + VE+  +  V +IHRR++++++   I      C SK   +Q L  +I  +   +  L   +      K Q LP D +L+ +G +S  +       ++ E+ + V+D  + +T+I  IYA+GD   +  K   I++   E
  S:     9 DAVIIGAGPVGLFQVFELGLLEIKAHVIDSLPEAGGQCIELYPDKPIYDIPAVPVCTGRELTQNLLKQ-IEPFGAQFHLGQEVRTLEQQA--DGRLLIGTSQNQYFLSKTVFIAAGVGAFQPRKLALEGIEALEDKHIFYHVK-HPEQFSGKKIVICGGGDSALDWALFLVEKAAS--VTLIHRRDDFKAAPKSIAKMRELCASKQ--MQLLIGQITSYEAQDDHLKEIVVTDIDGKTQALPVDDLLIFFG-LSPKLGPIAEWGLDIERKQLVVDTEKFQTSIPGIYAVGDINIYPGKKKLILSGFHE 307
>gi|88607053|ref|YP_505314.1| pyridine nucleotide-disulphide oxidoreductase family protein [Anaplasma phagocytophilum HZ] >gi|88598116|gb|ABD43586.1| pyridine nucleotide-disulphide oxidoreductase family protein [Anaplasma phagocytophilum HZ] (338 aa)
Score = 277, Expect = 7.7e-23, Identities = 91/305 (29%), Positives = 165/305 (54%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINE-QELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINNEPID------SPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLN----YEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ---KTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           ++DVAIVG G  G+F    +    +NS +I+    +GGQ   LYP K IYD P +  I + D++  L      +K +       I+    ++I+E  + F+ +TNK  S   + II+A+G+G F P     N  P+D      +  + Y+++ +   +KNKK+++ GGGDSA +WA    E  + + + +IHRR  +R +   +  L +     ++N    Y++   +  N   +++ +++  T++E  +  D++L  +G IS+ +  E++N     +G + I + Q   +T    IYA+GD   +  K   I+   +EA  A
  S:     6 VFDVAIVGAGPVGLFTVFQAGMLGMNSCVIDALDIVGGQCAVLYPEKPIYDIPGYPMITAQDLVNNL------KKQAEPFAPVYIMGQFVESISEGPDCFVLQTNKGTSVKCRAIIVAAGSGGFGP-----NRPPLDGIMEYENKSVFYNVS-QMATFKNKKVVIAGGGDSAADWAVNLAE--VADKLYVIHRRKSFRCAPNTLKKLEELADEGRINVLIPYQLAGLDGENGELRSVVVRNITTKEEIPIGADFLLPFFG-ISANLG-EIVNWGLGVEG-FQIPVEQSTCRTRRSKIYAVGDIAAYPGKIKLILVGFSEAALA 311
>gi|187924224|ref|YP_001895866.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia phytofirmans PsJN] >gi|187715418|gb|ACD16642.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia phytofirmans PsJN] (349 aa)
Score = 277, Expect = 7.9e-23, Identities = 85/304 (27%), Positives = 165/304 (54%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNK--------EQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFN---ESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDL-NQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           DV IVG G  G+FA+  +    L+  +++    +GGQ +ELYP+K IYD P      + +++++L+ Q K        EQ+  +++ + D     W    ++ L         F    I+LA+GNG+F P+KL +    P++S  +HYS+    + + +K ++V GGGDSA++WA      K+   V ++HRR+ + ++   +  + +     ++++    I   N   ++ K++T++H E E +  L  ++++  YG ++    I     ++   G+  +D  N +++   I+A+GD  ++  K   I++   EA  AL
  S:    15 DVLIVGAGPVGLFAAFEAGVIGLSCQIVDGLDKVGGQCIELYPDKPIYDIPAIASCTARELVERLLAQCKPFDPPIHLEQRVESVEQNDD---GRWTVRTDRGLV--------FDVAAILLAAGNGAFVPQKLALAEAVPLESRHVHYSVPRLAD-FADKVVVVAGGGDSALDWA--LALRKVARRVTLVHRRSGFSAADSSVASMRRAVEAGEMDFIVGAIAGLNVEGDALKSITLRHIEGETQ--LAAEHLVALYGLVADLGPIAQWG-LSIHAGRVDVDTSNYESSRPGIFAVGDIANYPNKQKLILSGFHEASLAL 317
>gi|104774393|ref|YP_619373.1| thioredoxin reductase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116514491|ref|YP_813397.1| thioredoxin reductase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103423474|emb|CAI98375.1| Thioredoxin reductase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093806|gb|ABJ58959.1| Thioredoxin reductase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (308 aa)
Score = 276, Expect = 1.1e-22, Identities = 77/283 (27%), Positives = 146/283 (51%)
  Q:    12 IVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN-ILQKLNY--EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYG-----QISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHF 294
           ++G G  G+FA+  ++   L ++++E  +  GGQP  LYP K I D P F EI ++D+ K+L+        +N+  D D+  +T   +++ E          +  + II+A+GNG+F  +K  +   P     IHY      +++  +KI + GGGD+A++WA    E     +V ++HRR+++R     ++ L  +  +  K  Y  + +   +    +++K    ++     FD +LV YG     +  S   ++L      ++G   +D + +T++  IYAIGD+  +
  S:     1 MIGAGPVGLFAAYFAHLHGLKTVILESLNEPGGQPEMLYPFKKILDIPVFNEITAADLTKRLL--------ANLT-DQDL--VTGHKVSQLEKTDEFVIDGEYQVRSIIVATGNGAFKAKKFPLKATPEAEDHIHYFFK-NPDLFAGQKIGIFGGGDTALDWAQ---ELSQIADVTLVHRRDQFRGMESSVENLKADQKVTLKTPYLPKSMQVEKGQLEISLKMVGGDEVTQETFDQILVAYGFRADNRFVSKWGVDL------DQGLIAVDRSMQTSVPGIYAIGDSCGY 270
>gi|15898996|ref|NP_343601.1| thioredoxin reductase (trxB-1) [Sulfolobus solfataricus P2] >gi|13815521|gb|AAK42391.1| Thioredoxin reductase (trxB-1) [Sulfolobus solfataricus P2] (332 aa)
Score = 276, Expect = 1.3e-22, Identities = 83/313 (26%), Positives = 164/313 (52%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLD--TDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL---SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISKNKK 320
           YD+ ++GGG  G+F +  +   ++ ++LI+ +  LGGQ + LYP K +YD      I++ ++ ++LI+Q K     +I+++   D++  T        +++ +T+K ++  K I +A+G G   P +L    E   ++  ++Y++  + + ++ K++L++GGGDSAV+WA       +  +V +IHRR+++R+    +  L   +   +  +L     D N+  + +   ++ T++E+ L  D V++  G      NI       K +   V++   +TN+  +YA GD       P   + A   A  A+  IS  KK
  S:     4 YDIVVIGGGPVGLFGTFYAGLRDMKTLLIDAQDELGGQLVSLYPEKIVYDVGGLAGIQAYELAQRLIEQAK-MFGPDIKVNELADMIEKT-----NDNMWIVKTDKATYKTKTIFIAAGIGKIVPSRLGAKGEIEYENRGVYYTVRRKKD-FEGKRVLIVGGGDSAVDWA--LTLAPVAKSVTLIHRRDQFRAHERSVKELFRVANVYVWHELKEVKGDGNKVTQAIIFDNR-TKEEKVLDVDSVIISIGYKGDLGNIPKWGVTMKGR-DIVVNGRMETNLPGVYAGGDIVQMEGSPKLALIAVGFAHAAI-AISVAKK 310
>gi|110597753|ref|ZP_01386037.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chlorobium ferrooxidans DSM 13031] >gi|110340660|gb|EAT59140.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chlorobium ferrooxidans DSM 13031] (353 aa)
Score = 274, Expect = 2.1e-22, Identities = 84/308 (27%), Positives = 169/308 (54%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKL-EINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEY----RSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETE--KEQTLPFDYVLVQYGQISS--PI---NIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           I D+ IVGGG  GIFA+      N++  +IE    LGGQ   LYP K IYD   F E+ ++ +++ L +Q  E+ +  + L   +    ++ + +    +   +   F ++ +++A+G G+F+PRKL ++++ + ++   + Y++   ++ +  K+++++GGGDSA++W    +     ++V ++HR  ++    +++  +++   +  +   LN E+   +  N  LT  H  T+  K   L  D +L+  G  S+  P+   ++EL++         V+D + KT+I  +YA GD  ++  K   I T  ++A  A+ H
  S:    14 IRDLTIVGGGPTGIFAAFQCGMNNISCRIIESMPLLGGQLAALYPEKHIYDVAGFQEVPAAGLVESLWKQT-ERYHPEVILGETVTR--YRKLADGTFEVTVGSGRVFLSRALLIAAGLGAFSPRKLPQLHDIDHLEGSSVFYAVKNVSD-FAGKRVVIVGGGDSALDWTVGLL--NTAHSVTLVHRMPDFQGHGKTAREVLEAREEGRVDVYLNTEVTAVDSENDQLTAVHVRTKGGKTHILEADCLLLLIGFKSNLGPLAEWDLELMDN------ALVVDSHMKTSIDGLYAAGDIAYYPGKLKIIQTGLSDAAMAVRH 322
>gi|28896191|ref|NP_802541.1| putative thioredoxin reductase [Streptococcus pyogenes SSI-1] >gi|28811442|dbj|BAC64374.1| putative thioredoxin reductase [Streptococcus pyogenes SSI-1] (294 aa)
Score = 273, Expect = 2.7e-22, Identities = 89/273 (32%), Positives = 148/273 (54%)
  Q:    40 SYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQ-NKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIID--FNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           S LGGQP  LYP K IYD P +  +  +++ + LI+Q ++ +  + I L  ++L  T+  +     F   TNK   ++K II+A GNG+F PR L + +E       + Y+++ + + +  +K+++ GGGDSAV+WA     E I  +V ++HRR+ +R+    ++ L  S  N+L     + +    N + K +  K KE E  + L  D ++V +G  +S  N++  N   K     V  L Q T+ + I+AIGDA  +  K + I T   EA  A+
  S:     2 SELGGQPAILYPEKMIYDIPAYPSLTGAELTENLIKQLSRFEDRTTICLKEEVL--TFDKVKGG--FSIRTNKAEHFSKAIIIACGNGAFAPRTLGLESEENFADHNLFYNVH-QLDQFAGQKVVICGGGDSAVDWA--LALEDIAESVTVVHRRDAFRAHEHSVELLKASTVNLLTPYVPKALKGIGNLAEKLVIQKVKEDEVLE-LELDSLIVSFGFSTSNKNLKNWNLDYKRSSITVSPLFQ-TSQEGIFAIGDAAAYNGKVDLIATGFGEAPTAV 271
>gi|124520371|ref|ZP_01695538.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Bacillus coagulans 36D1] >gi|124497709|gb|EAY45263.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Bacillus coagulans 36D1] (345 aa)
Score = 272, Expect = 2.9e-22, Identities = 96/312 (30%), Positives = 152/312 (48%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYV-IDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M  D  IYDV I+GGG  G+F +  S    L + ++E    LGG+    YP K + D     +I   D++K+LI+Q  E  +  I     +  +  +   +  L L   N      K +IL  G G F P KL I   E  +S  +HY+++ +   ++NK++L+ GGG++AV+WAN      I  ++ I+HRR  +    + +  + KN  L  + Y I   + +    + + +KH  T +E  L  D V+V +G       I  LN   K K + + ++   +TNI  I+A GDA  +  K   I    AE   AL
  S:     1 MALDHEIYDVTIIGGGPIGLFTAFYSGMRKLKTKVLESSGQLGGKISMFYPEKTLRDIGGIRKITGGDLVKELIRQ-AETFSPTILFHQHVSGLKRRP--DGILMLSTENGGLHLTKTVILTVGAGIFKPIKLHIPGVERYESGNLHYAVD-DLNRFRNKRVLISGGGNAAVDWANELA--GIAESITIVHRREAFSGHEYDVSEMVKNARL-FIPYCISALHGTGNRIERVAVKHAGTGEEIWLEADEVVVNHGIQGDYGGI--LNWGLKMKDERIEVNGAMETNIPGIFAAGDAAIYPHKLKLIAGGFAEGPVAL 308
>gi|91762238|ref|ZP_01264203.1| thioredoxin-disulfide reductase [Candidatus Pelagibacter ubique HTCC1002] >gi|91718040|gb|EAS84690.1| thioredoxin-disulfide reductase [Candidatus Pelagibacter ubique HTCC1002] (338 aa)
Score = 272, Expect = 3.4e-22, Identities = 101/303 (33%), Positives = 156/303 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINE-QELFLFETNKN-SFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLS------KNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           D  I+G G  G+F +       LN  +++    +GGQ +ELYP+K IYD P   E    ++   LI+Q K     NI+     LN   + +N+    ++ +TNKN  F    II+A G GSF PRK      E  ++  + YS+  +T I+++K I + GGGDSA++WA   +E   ++ V +IHRR+E+  +   ID +       K  I  K     +   ++ K++ IKH + E  + L  +YVL  +G I    PI    LN    +K   V   N +TN+  I+AIGD   +  K   I++   E   A
  S:     5 DALIIGAGPTGLFCAHQLGLIGLNCEIVDNLDKIGGQCIELYPDKPIYDIPAVPECTGEELTNNLIKQIKP---FNIKFH---LNERVEEVNKVNNKWIVKTNKNKEFETPNIIIAGGVGSFEPRKFSPKECEKYENRSLFYSIKDKT-IFQDKTISIFGGGDSALDWA---IELSKSSYVNLIHRRDEFTGAQLSIDKIKELEKSGKLKIYTKYQLNSVKGEQNIKSIEIKHDD-ESLKELETNYVLGFFGLIMKLGPIVDWGLNL--DKKTIPVNTENFETNLNGIFAIGDICTYPGKLKLILSGFHEGALA 305
>gi|126663011|ref|ZP_01734009.1| Thioredoxin reductase [Flavobacteria bacterium BAL38] >gi|126624669|gb|EAZ95359.1| Thioredoxin reductase [Flavobacteria bacterium BAL38] (350 aa)
Score = 272, Expect = 3.5e-22, Identities = 94/300 (31%), Positives = 158/300 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNS-FYAKKIILASGNGSFNPRKLEINNEPI-DSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYE-IIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYG------------QISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+FA   +    L   +I+     GGQ  ELYP K I+D P +  + + D++  L++Q K+ +          L  T +TI++ E   F+  TNK +  +AK + +A G G+F PRK  + N    +   + Y +  + E++ +K+I++ GGGDSA++W+ +     +   V ++HRRNE+R +   +D + K   +Q+L  E  I+     + + I+ K+  +  TL  D VL Q+             ++ +  N  L  +I K   K    L+ +TNI  IYAIGD   +  K   I+    EA
  S:     5 DILIIGAGPTGLFAVFEAGLLQLKCHIIDALPQPGGQLAELYPKKPIFDIPGYPSVLAGDLVTNLMEQIKQFQPGF------TLAETAETIDKLEDGTFIVTTNKGTKHHAKAVAIAGGLGTFEPRKPALENITFYEEKGVEYFVK-DPELFCDKEIVIAGGGDSALDWSIFL--SNVAKKVTLVHRRNEFRGA---LDSVEK---VQELKKEGKINLITPAEVVGIQGKDHVESITLDRDGVLEQFKTDYFIPLFGLTPKLGAIANWGL--EIEKNAIKVNNALDYQTNIDGIYAIGDVNIYPGKLKLILCGFHEA 304
>gi|6010297|emb|CAB57297.1| NADH oxidase [Sulfolobus solfataricus] (332 aa)
Score = 271, Expect = 4.1e-22, Identities = 83/313 (26%), Positives = 163/313 (52%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLD--TDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL---SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISKNKK 320
           YD+ ++GGG  G+F +  +   ++ ++LI+ +  LGGQ + LYP K +YD      I++ ++ ++LI+Q K     +I+++   D++  T        +++ +T+K ++  K I +A+G G   P +L    E   ++  ++Y++  + + ++ K++L++GGGDSAV+WA       +  +V +IHRR++ R+    +  L   +   +  +L     D N+  + +   ++ T++E+ L  D V++  G      NI       K +   V++   +TN+  +YA GD       P   + A   A  A+  IS  KK
  S:     4 YDIVVIGGGPVGLFGTFYAGLRDMKTLLIDAQDELGGQLVSLYPEKIVYDVGGLAGIQAYELAQRLIEQAK-MFGPDIKVNELADMIEKT-----NDNMWIVKTDKATYKTKTIFIAAGIGKIVPSRLGAKGEIEYENRGVYYTVRRKKD-FEGKRVLIVGGGDSAVDWA--LTLAPVAKSVTLIHRRDQLRAHERSVKELFRVANVYVWHELKEVKGDGNKVTQAIIFDNR-TKEEKVLDVDSVIISIGYKGDLGNIPKWGVTMKGR-DIVVNGRMETNLPGVYAGGDIVQMEGSPKLALIAVGFAHAAI-AISVAKK 310
>gi|51473697|ref|YP_067454.1| NADP-thioredoxin reductase. [Rickettsia typhi str. Wilmington] >gi|51460009|gb|AAU03972.1| thioredoxin-disulfide reductase; NADP-thioredoxin reductase.; NADPH-thioredoxin reductase.; NADPH:oxidized thioredoxin oxidoreductase.; Thioredoxin reductase (NADPH). [Rickettsia typhi str. Wilmington] (334 aa)
Score = 271, Expect = 4.2e-22, Identities = 97/306 (31%), Positives = 159/306 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQK---NSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKK-IILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL----SKNNILQKLNYEIIDFNESN--------KTLTIKHKETEKEQTLPFDYVLVQYGQISS-PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           D+ I+G G  G+FA   +    +   +I+ +  +GGQ + LYP K IYD P + +I +    K+LI+Q K Q    N    L+   + +        + F  +T+KN+    K II+A+G G+F P K  + N E  +   I Y +N +++ +  K I+V GGGDSAV+W     E  I N + ++HRR+++ +++  I  L        I     Y++ + +  N        K L    ++ +    LPF  +    G +++  +N++ L  I  +   Y      +TNIK IYAIGD  H+  K   IIT  AEA  ++ H
  S:     5 DIVIIGSGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITLYPEKHIYDIPAYPKITA----KELIEQLKSQAAPFNPVYHLNQQAIELN----KHNDFFEIKTSKNTIIKSKVIIIAAGAGAFGPNKPPLANIEDFEGKSIFYFINDKSK-FLGKNIVVAGGGDSAVDWTIALSE--IANKIYLVHRRDKFTAATESIRQLRHIAETGKIELVTGYQLNNLDGHNNELQAVIVKDLQNNIRKLDANILLPFFGLKQDLGPLANWGLNVK-LQHIEVDNYYY------QTNIKGIYAIGDVAHYVGKLKLIITGFAEAAHSINH 310
>gi|71278249|ref|YP_268653.1| pyridine nucleotide-disulfide oxidoreductase [Colwellia psychrerythraea 34H] >gi|71143989|gb|AAZ24462.1| pyridine nucleotide-disulfide oxidoreductase [Colwellia psychrerythraea 34H] (349 aa)
Score = 270, Expect = 5.5e-22, Identities = 88/309 (28%), Positives = 165/309 (53%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDC---LSKNNILQKLNYEIIDFNESNKT---LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           DVAI+G G  G+F         L++++I+    +GGQ  ELYP+K IYD P     K+S+VI  L QQ     +    L   + +I  + ++E    +    +   + + +++A+GNG+F+P KL++   P+   F    + Y ++   E +++K ++VLGGGDSA++W+     +K   +V +IHR + ++++   ++    L +   +Q L  ++  F E       LTI  K+    + +  D ++V +G   SP    + N Q+   + +  +D    +T++  IYA+GD  ++  K   I++   EA  A + I++
  S:     7 DVAIIGAGPVGLFQIFELGLQGLSTVVIDSLPEIGGQCSELYPDKPIYDIPALPNAKASEVIDNLWQQ-AAIFDPTFLLAERVEHI--EKVSEHSFIVTTHKQTQIHCRAVVIAAGNGAFSPVKLKL---PLIDKFEDTQLFYRIS-NIEHFRDKNVVVLGGGDSALDWS--LTLQKTAKSVLLIHRSSNFKAAKSSVNKMYELCEQLKMQFLCGQVSSFQEKENKLTGLTITSKDGVNRR-VELDELVVLFGM--SPKLGPIDNWQLEMHQHQIKVDTQSFQTSVTGIYAVGDINYYPGKRKLILSGFHEAALAAFSIAE 315
>gi|67906663|gb|AAY82753.1| predicted thioredoxin reductase [uncultured bacterium eBACmed18B02] (339 aa)
Score = 270, Expect = 6.3e-22, Identities = 97/303 (32%), Positives = 156/303 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKN-SFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLN----YEIIDFNESNKTLTIKHKETEKE-QTLPFDYVLVQYGQISS--PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           DV I+G G  G+F +       L   +++     GGQ +ELYP+K IYD P   E    ++   L+QQ K   N N  L+  +  +       +  +  +TN N  F    I++A G GSF PRK  +   E  +   + YS+  +T I+K+K I + GGGDSA++WA   +E   ++ V +IHRR+ +  +   +  + + N   K+N    Y++   +  NK  ++K K  + E + +  D+VL  +G I    PI    LN I+K+K +   + N +TNI  I+AIGD   +  K   I++   E   A
  S:     5 DVLIIGAGPTGLFCAHQLGIIGLTCEIVDNLDKAGGQCIELYPDKPIYDIPAIPECTGEELTNNLLQQIKP-FNVNFHLNQRVEELK----KVENRWHIKTNGNKEFDVASIVIAGGVGSFEPRKFPVKECEKFEGKTLFYSVKDKT-IFKDKTISIFGGGDSALDWA---IELSNSSKVNLIHRRDGFSGAESSVQKVKELNDQGKINLYTKYQMDSVSGENKINSVKIKNDDGEVKDIKSDFVLGFFGLIMQLGPILDWGLN-IDKKKVEVNTE-NFETNINGIFAIGDICSYPGKLKLILSGFHEGALA 305
>gi|16077396|ref|NP_388209.1| hypothetical protein BSU03270 [Bacillus subtilis subsp. subtilis str. 168] >gi|2632613|emb|CAB12121.1| ycgT [Bacillus subtilis subsp. subtilis str. 168] (336 aa)
Score = 269, Expect = 7.1e-22, Identities = 84/312 (26%), Positives = 156/312 (50%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDIL---NIT-WQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFN---ESNKTLTIKHKETEKEQTLPFDYVLVQYG-QISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M E+  +YDV I+GGG  G+F +       L + +IE    LGG+    +P K I D      I      K+LI+Q KEQ  +    D DI+    +T ++ +++  + L  +     Y + +ILA G G+    + +  +        +HY +  + + +K K++++ GGGD+AV+WAN    E I  +V ++HRR E+      +  + ++++     Y +   N   E  K++T+ H E+ + + +  D +++ +G +I     +E   +I  E+G+   D + +TN+  ++  GDA  +  K   I     E   A+
  S:     1 MAENQEVYDVTIIGGGPIGLFTAFYCGMRELKTKVIEFLPKLGGKVSLFFPEKIIRDIGGIPGIAG----KQLIEQLKEQAAT---FDPDIVLNQRVTGFERLDDGTIVLTGSEGKKHYTRTVILACGMGTLEVNEFDSEDAARYAGKNLHYGVE-KLDAFKGKRVVISGGGDTAVDWANEL--EPIAASVTVVHRREEFGGMESSVTKMKQSSVRVLTPYRLEQLNGDEEGIKSVTVCHTESGQRKDIEIDELIINHGFKIDLGPMMEWGLEI--EEGRVKADRHMRTNLPGVFVAGDAAFYESKLRLIAGGFTEGPTAV 309
>gi|194336131|ref|YP_002017925.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Pelodictyon phaeoclathratiforme BU-1] >gi|194308608|gb|ACF43308.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Pelodictyon phaeoclathratiforme BU-1] (353 aa)
Score = 269, Expect = 7.9e-22, Identities = 82/306 (26%), Positives = 167/306 (54%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKL-EINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEY----RSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKH--KETEKEQTLPFDYVLVQYGQISS--PI---NIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           I D+ IVGGG  GIFA+      N++  +IE    LGGQ   LYP K IYD   F E+ ++ +++ L +Q  E+ N  + L   +    ++ +++    +  ++   F ++ +++A+G G+F+PRKL ++NN + ++   + Y++   ++ +  ++++++GGGDSA++W    +       V ++HR +E+    +++  +++      +   LN E+   +   + LT  H   ++ K + +  D +L+  G  S   P+   ++EL +         V+D + KT++  +YA GD  ++  K   I T  ++A  A+
  S:    14 IRDLTIVGGGPTGIFAAFQCGMNNISCRIIESMPQLGGQLAALYPEKHIYDVAGFPEVPAAGLVESLWKQT-ERYNPEVILGETVTR--YRKLDDGSFEVTVSSGKVFLSRALLIAAGLGAFSPRKLPQLNNIDDLEGRSVFYAVKNISD-FVGQRVVIVGGGDSALDWTVGLLNA--AAEVTLVHRMHEFQGHGKTAREVLEAKESGRVNVFLNTEVRSVDREGEVLTAVHLRSKSGKSRRIEADRLLLLIGFKSDLGPLAGWDLELADN------ALVVDSHMKTSVDGLYAAGDIAYYPGKLKIIQTGLSDAAMAV 320
>gi|15922460|ref|NP_378129.1| thioredoxin reductase [Sulfolobus tokodaii str. 7] >gi|15623250|dbj|BAB67238.1| 327aa long hypothetical thioredoxin reductase [Sulfolobus tokodaii str. 7] (327 aa)
Score = 268, Expect = 8.9e-22, Identities = 75/281 (26%), Positives = 151/281 (53%)
  Q:    10 VAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQ---ELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNIL---QKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           + ++GGG  G++A+  +   ++ ++LI+ +  LGGQ + LYP K +YD   F  I + ++ ++L++Q K           DI    W  + E+    +++ +T+K NSF  K I++A+G G   P +L    E   ++  ++Y++  + + ++ K++L++GGGDSAV+WA       +  +V +IHRR+++R+    +  L +   +    +L     D N   + +   ++ T+ E+ L  D V++  G      N+     +N +    +++   +TN+  +YA GD
  S:     1 MVVIGGGPVGLYATFYAGLRDMKALLIDAQDELGGQLVTLYPEKMVYDVGGFPGILAYELAQQLVEQAK-------MFSPDIRIKEWADMIERTQDNMWVVKTDKGNSFKTKTILIAAGIGKMTPSRLGAKGEVEYENKGVYYTVRRKKD-FEGKRVLIVGGGDSAVDWA--LTLAPVAKSVTLIHRRDQFRAHERSVKQLYQVATVYTWHELKEVRGDGNRVTQAVIFDNR-TKDEKILDVDAVIISIGFKGDLGNMPKWG-VNMKGRDIIVNAKMETNLPGVYAAGD 277
>gi|193214663|ref|YP_001995862.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chloroherpeton thalassium ATCC 35110] >gi|193088140|gb|ACF13415.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chloroherpeton thalassium ATCC 35110] (347 aa)
Score = 268, Expect = 9.6e-22, Identities = 83/308 (26%), Positives = 163/308 (52%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLE--INNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIID-----FNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PIN---IELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           + DV I+GGG  GIFA+      ++N  +I+    LGGQ   LYP K IYD   F E+ ++ +I++L  Q    K   + L   ++++  + +++    +F    +S++++ +++A+G G+F+PRKL    + E ++   I Y+++   + +K++K++V+GGGDSA++W    +   +  +V ++HR  E+++    +    +     KL+  +         +S++      K  ++E T+    +L   G  S+  PI    IE+           ++D + +T ++ IYA GD   +  K   I T  ++A  A+ H
  S:    15 VRDVTIIGGGPTGIFAAVQCGMHHINCRIIDSMPSLGGQLTALYPEKHIYDVAGFPEVSAAGLIEQLWSQAARYK-PEVVLGDKVVDV--KKLDDGSFEVFTEKGHSYFSRAVLIAAGLGAFSPRKLPQLKDFEHLEETSIFYTVS-SIDHFKDEKVVVVGGGDSALDWTIALL--NVAEHVTLVHRMKEFQAHGKTVADAYEAQETGKLDIYLESEVASVLADSDRLTHAILKTPDEEITIEATRLLPLIGFRSNLGPIKNWGIEI------SGNGILVDNHMQTTVEGIYAAGDIAVYEGKLKLIQTGLSDAAMAVRH 322
>gi|23097641|ref|NP_691107.1| thioredoxin reductase [Oceanobacillus iheyensis HTE831] >gi|22775864|dbj|BAC12142.1| thioredoxin reductase [Oceanobacillus iheyensis HTE831] (348 aa)
Score = 268, Expect = 9.7e-22, Identities = 87/308 (28%), Positives = 168/308 (54%)
  Q:     5 LRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLD-TDILNITWQTINEQELFLFETNKNS---FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDF----NESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ-----INKEKGKYVI-DLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           + ++DV IVGGG  G++++  S    + + +I+ ++ LGG+ + +YP K I+D      +   +VIK++++Q        +  D T +LN   ++I++ E+ LF+ +  S    Y+K II+A G G  +P++L +   E  +   ++Y +    + YK+K++++ GGG+SAV+WAN  V+  I  +V + +R++        +  L K++     N  I       N+S + + + + E+     LP D V++ +G      +I+LL+      +  + G +V    N ++++  IYA GD  H   K + I  A  +A  A+
  S:     1 MEVFDVTIVGGGPAGLYSAFYSGLREMKTKIIDYQAELGGK-VHIYPEKVIWDIGGLTPMSGENVIKQMVEQA-------MTFDPTVVLNEKVESIDKNEMGLFQLHTASGEIHYSKTIIVAVGGGILHPKRLNLEGAEKYEVTNLNYKIT-SLQRYKDKRVIISGGGNSAVDWANELVD--IAKSVYLTYRKDVLSGHEAQVTKLMKSSAECYFNCSITKLISENNQSIEHVELTNHESGDILALPIDEVIINHGYDR---DIDLLDNSPSLGVEIKDGYFVAGSPNSESSVPGIYAAGDILHHEGKLHLIAGAFQDAANAV 309
>gi|71083332|ref|YP_266051.1| thioredoxin-disulfide reductase [Candidatus Pelagibacter ubique HTCC1062] >gi|71062445|gb|AAZ21448.1| thioredoxin-disulfide reductase [Candidatus Pelagibacter ubique HTCC1062] (338 aa)
Score = 268, Expect = 9.9e-22, Identities = 100/303 (33%), Positives = 155/303 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINE-QELFLFETN-KNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLS------KNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           D  I+G G  G+F +       LN  +++    +GGQ +ELYP+K IYD P   E    ++   LI+Q K     NI+     LN   + +N+    ++ +TN K  F    II+A G GSF PRK      E  ++  + YS+  +T I+++K I + GGGDSA++WA   +E   ++ V +IHRR+E+  +   ID +       K  I  K     +   ++ K++ IKH + E  + L  +YVL  +G I    PI    LN    +K   V   N +TN+  I+AIGD   +  K   I++   E   A
  S:     5 DALIIGAGPTGLFCAHQLGLIGLNCEIVDNLDKIGGQCIELYPDKPIYDIPAVPECTGEELTNNLIKQIKP---FNIKFH---LNERVEEVNKVNNKWIVKTNKKKEFVTPNIIIAGGVGSFEPRKFSPKECEKYENRSLFYSIKDKT-IFQDKTISIFGGGDSALDWA---IELSKSSYVNLIHRRDEFTGAQLSIDKIKELEKSGKLKIYTKYQLNSVKGEQNIKSIEIKHDD-ESLKELETNYVLGFFGLIMKLGPIVDWGLNL--DKKTIPVNTENFETNLNGIFAIGDICTYPGKLKLILSGFHEGALA 305
>gi|88804868|ref|ZP_01120388.1| thioredoxin reductase [Robiginitalea biformata HTCC2501] >gi|88785747|gb|EAR16916.1| thioredoxin reductase [Robiginitalea biformata HTCC2501] (353 aa)
Score = 267, Expect = 1.1e-21, Identities = 89/300 (29%), Positives = 155/300 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNSFYAKKII-LASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL----SKNNILQKLNYEIIDFNESNKTLTI---KHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVID--LNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+FA   +    L   +I+     GGQ  E+YP K IYD P F E+ + D++  L++Q +  +          L    +TI +QE   F+  T++ + +   ++ +A G GSF PRK  + N +  +   + Y +  + EIY+ K++++ GGGDSA++W+ +  +  I ++V ++HRRNE+R +   ++ +    +K  I      E++    S K   +   +  E   +  +  D  +  +G   SP    + N  +  EK    +D  L+ +TNI  IYAIGD   +  K   I+    EA
  S:     5 DILIIGAGPTGLFAVFEAGLLQLKCHIIDALPQPGGQLAEIYPKKPIYDIPGFPEVLAGDLVDNLMEQIEPFQPGF------TLGERAETIEKQEDGSFIVTTSEGTRHQAPVVAIAGGLGSFEPRKPLLKNLDEYEGKGLTYMIR-DPEIYRGKQVVIAGGGDSALDWSIFLAD--IASSVTLVHRRNEFRGALDSVEKVRELKNKGRIRLITPAEVVRLEGSGKLEAVVVRRSAEPAGDTRIETDAFIPLFGL--SPKLGPIANWGLEIEKNAIRVDNTLDYQTNIPGIYAIGDVNTYPGKLKLILCGFHEA 307
>gi|194334415|ref|YP_002016275.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prosthecochloris aestuarii DSM 271] >gi|194312233|gb|ACF46628.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prosthecochloris aestuarii DSM 271] (348 aa)
Score = 267, Expect = 1.1e-21, Identities = 80/306 (26%), Positives = 152/306 (49%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI--NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEY----RSSSFMIDCLSKNNILQKLNYEIIDFNESNKTL--TIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ--INKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           D+ IVGGG  GIFA+      N++  +IE    LGGQ   LYP K IYD   F E+++S ++  L  Q   + N  + L+     ++++ +++    +      SF ++ +++A+G G+F PR L    +   ++   + YS+    + ++ K+++++GGGDSA++W    +   +   V ++HR   +    +++  ++D      I    N E+     S   L       ++  E+ +  D +L+  G  S   N+  + Q  +  +    V+D   KT++  +YA GD   +  K   I T  ++A  A+ H
  S:    17 DLTIVGGGPTGIFAAFQCGMNNMSCRIIESMPQLGGQLTALYPEKHIYDVAAFNEVQASGLVDSLWTQ-AGRYNPEVVLNDQA--VSFKKLDDGSFVVMSAAGASFRSRALLIAAGLGAFTPRTLPQLGDVSHLEGSSLFYSVTSRND-FEGKRVVIVGGGDSALDWTMGLL--PLAERVTVVHRMASFQGHGKTAHEVLDAREDGKIEVHFNTEVASLETSGSCLRRVCTRSKSGHEEVIDADCLLLLIGFKS---NLGPIAQWGLELQDNAIVVDNQMKTSVDGLYAAGDIASYPGKLKIIQTGLSDATMAVRH 323
>gi|167036870|ref|YP_001664448.1| thioredoxin reductase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167039576|ref|YP_001662561.1| thioredoxin reductase [Thermoanaerobacter sp. X514] >gi|166853816|gb|ABY92225.1| thioredoxin reductase [Thermoanaerobacter sp. X514] >gi|166855704|gb|ABY94112.1| thioredoxin reductase [Thermoanaerobacter pseudethanolicus ATCC 33223] (304 aa)
Score = 265, Expect = 1.9e-21, Identities = 95/307 (30%), Positives = 157/307 (51%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN--KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQIN--KEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALW 313
           +YD+ I+GGG  G+ A   +    L ++LIE K+YLGGQ +  Y    + ++P + EI  +D+I K+  Q ++     +  D + L+IT       ++   +T+  ++ AK IILA G     P+KL + NE       I +    +   Y++  + V+GGG++AVE A Y    K    V IIHRRNE R++    +    N  ++ + +  ++D       + L +K+ +T +E TL  D V V  G   +P N EL+  I    E G  + D + +TNI  ++A GD  H   +   +ITA  +   A +
  S:     1 MYDLIILGGGPAGLTAGLYAARSRLKTVLIE-KTYLGGQIVNTYQ---LENYPGYEEISGADLIAKMEAQVRKHGLEIVNEDVESLDIT------GDVKKVKTSNKTYEAKAIILAMGA---TPKKLGVPNEDRFIGAGISFCATCDGAFYRDATVAVIGGGNTAVEDALYLT--KFAKKVYIIHRRNELRATKIEQEKAFANEKIEFIWDTVVVDVEGEYGVERLKLKNVKTGEESTLNVDGVFVAIGY--AP-NTELVKGIVDLDEYGYIMTDDDMRTNIPGVFAAGDIRHKSLR--QVITAAGDGAIAAY 293
>gi|68171877|ref|ZP_00545204.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ehrlichia chaffeensis str. Sapulpa] >gi|88657729|ref|YP_507458.1| pyridine nucleotide-disulphide oxidoreductase family protein [Ehrlichia chaffeensis str. Arkansas] >gi|67998700|gb|EAM85425.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ehrlichia chaffeensis str. Sapulpa] >gi|88599186|gb|ABD44655.1| pyridine nucleotide-disulphide oxidoreductase family protein [Ehrlichia chaffeensis str. Arkansas] (338 aa)
Score = 264, Expect = 2.7e-21, Identities = 91/309 (29%), Positives = 158/309 (51%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKN-SFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVE-EKITNNVAIIHRRNEYR---SSSFMIDCLSKNNILQKL-NYEIIDFNESNKTL---TIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKN---IYAIGDATHFYCKPNTIITACAEAVRALWHI 315
           + D+A++G G  GIF    +    +   +I+  S +GGQ + LYP K IYD P +  I   ++I  L +Q+ E  N    L      +  +  +  + FL  T       +K II+A+G G+F P +L I+N    ++  + Y +   ++ + +K I++ GGGDSA +WA   VE  K+   + ++HRR  +R   +++  +D LS++  ++ +  Y++      N  L    +K+    +E  L  DY+   +G   +  N+  +     E   Y I +N +T + N   IYA+GD   +  K   I+T  +EA  A  HI
  S:     5 VTDIAVIGAGPVGIFTVFQAGMLKMRCCVIDALSEIGGQCLALYPEKPIYDIPGYPVINGKELIDSLKKQS-EPFNPQYLLG----QVAEKIEDYSDYFLIRTTTGIVVQSKVIIIAAGAGAFGPNRLPIDNILDYENKSVFYQVRKVSD-FCDKNIMIAGGGDSAADWA---VELSKVAKQLYVVHRRKNFRCAPNTALQMDNLSQSGKIKIIVPYQVKKLCGENGKLHSVIVKNITNHEEMALQVDYLFPFFG---TSANLGPILNWGMEVKNYQILVNAETCLTNRNRIYAVGDIATYPGKLKLILTGFSEAAMACHHI 314
>gi|42520795|ref|NP_966710.1| pyridine nucleotide-disulphide oxidoreductase family protein [Wolbachia endosymbiont of Drosophila melanogaster] >gi|42410535|gb|AAS14644.1| pyridine nucleotide-disulphide oxidoreductase family protein [Wolbachia endosymbiont of Drosophila melanogaster] (338 aa)
Score = 263, Expect = 4.0e-21, Identities = 96/309 (31%), Positives = 161/309 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS-FYAKKIILASGNGSFNPRK------LEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVE-EKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLN----YEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ--INKEKGKYVID-LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           D+ I+G G  GIF +  +   ++   +I+     GGQ   LYP K IYD P +  I +  +I++L++Q+   K     L   +  I   + NE E F   TN  +    K +I+A+GNG F P +      LE  N+      + YS+N  ++ +++K I++ GGGDSA +W    VE  K+   + +IHRR E+R +    + L    I  K+     Y++ +    N  L+   +K+  +++E+ +  D++L  +G     +N+  +N   I  E  + V+D    KT+   IYAIGD   +  K   I+   AE+  A + I K
  S:     4 DIVIIGAGPVGIFTAFQAGMLDMRCHIIDVLDQAGGQCTALYPEKPIYDIPGYPVITAQKLIEQLMEQSSPFK-PVYHLSQKVEKI---SNNEGESFTVITNIGTEVKCKAVIVAAGNGMFKPNRPPLSGILEYENKS-----VFYSVNKISD-FQDKTIVIAGGGDSAADWT---VELSKVAKKIYVIHRRKEFRCTPETRNKLESLEIDGKIELVVPYQLHELAGGNGQLSAVIVKNIASKEEKEISADFLLPFFGL---SMNLGPINNWGIQLEHSRIVVDPATLKTSRDRIYAIGDIAIYSGKLKLILNGFAESAMACYDIYK 314
>gi|88608472|ref|YP_506654.1| pyridine nucleotide-disulphide oxidoreductase family protein [Neorickettsia sennetsu str. Miyayama] >gi|88600641|gb|ABD46109.1| pyridine nucleotide-disulphide oxidoreductase family protein [Neorickettsia sennetsu str. Miyayama] (333 aa)
Score = 261, Expect = 6.5e-21, Identities = 94/309 (30%), Positives = 153/309 (49%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKN-SFYAKKIILASGNGSFNPRKLEINNEPI-DSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLN----YEIIDFNESNKTLTIKHKE----TEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           DV I+G G  GIF +  +    + + +I+    +GGQ   LYP KFIYD P + +I ++ +I  L +Q    +  N    TD        ++    F+ +T+K     AK +I+A+G G+F+  ++ I +  + +   + YS+  +  I+ +K +++ GGGDSA +W    +  K+   V +IHRR+++R S      L      +KL     Y+I     S     I H E    T +  TL  DY+L  +G   S  ++E            V  L   TNIK +YA+GD  H+  K   I++  +EA  A  HI +
  S:     4 DVIIIGAGPVGIFTAFQAGMLGMRAHVIDSLLSIGGQCTALYPEKFIYDIPGYKQITAAALISNLAEQ---AERFNPTYHTDQFATHMDRLDTS--FVVKTSKEIEITAKAVIIAAGAGAFDYNRIPIESSHVYEGKSLFYSVK-DPSIFTSKVVVIAGGGDSAADWG--LILSKLARKVYLIHRRSKFRCSDSTFKDLKSLEETKKLKILTPYQITGLRGSGG--QISHIELGGLTGESVTLEADYLLAFFGLKPSLRHLEEWGIEITHNCINVDPLTCSTNIKGVYAVGDVAHYDSKLKLILSGFSEAATACHHIRE 312
>gi|119713289|gb|ABL97354.1| thioredoxin-disulfide reductase [uncultured marine bacterium HF10_45G01] (338 aa)
Score = 260, Expect = 7.7e-21, Identities = 97/303 (32%), Positives = 149/303 (49%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLN-YEIIDFN-----ESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PINIELLN------QINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           DV I+G G  G+F +       L+  +++     GGQ +ELYP+K IYD P   E    ++   L++Q K   N    L+  +  +     N+    +  +    F    I++A G GSF PRK  +   E  +   + YS+  +  I+K+K I + GGGDSA++WA   +E   T+ V +IHRR  +  +   +  + K N   KL+ Y     N     +  + LTIKH E E ++ +  DYVL  +G I    PI    LN      Q+N E        N +TN+  I+AIGD   +  K   I++   E   A
  S:     5 DVLIIGAGPTGLFCAHQLGIIGLSCEIVDNLDKAGGQCIELYPDKPIYDIPAVPECTGEELTNNLLKQIKP-FNIKFYLNERVEEL---KKNQNRWHVKTSGGVEFDVAAIVIAGGVGSFEPRKFSLKECEKFEGNSLFYSIK-DKSIFKDKTISIFGGGDSALDWA---IELSNTSKVNLIHRREGFSGAEASVQKVKKLNEQGKLHLYTKFQMNSVLGDKKIEGLTIKHDEGEIKE-IKSDYVLGFFGLIMQLGPILDWGLNIDKKTVQVNTE--------NFETNVGGIFAIGDICSYPGKLKLILSGFHEGALA 305
>gi|187604892|ref|ZP_02991097.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Exiguobacterium sp. AT1b] >gi|187483087|gb|EDU21086.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Exiguobacterium sp. AT1b] (348 aa)
Score = 260, Expect = 8.4e-21, Identities = 82/312 (26%), Positives = 164/312 (52%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEY--------RSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN----QINKEKGKYVI-DLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           MNE+  ++DV I+GGG  G++A+  S    + + +IE + +LGG+ + +YP K ++D         + +I +L++Q     +  + L   + +I+ ++    +LF  +T      +K +I+A+G+G   P K+E++  E  +   +HY++      +K K++L+ GGG+SAV+WAN    E I   V + +R+ E         +     +DC  ++ +   ++++     +S + + + H ET +   +  D V++ +G      + ELL     Q++   G YV  +   ++++  +YA GD      K + I  A  +A  A+
  S:     1 MNEE--VFDVTIIGGGPAGLYAAFYSGLRGMKTKIIEFQPFLGGK-VHVYPEKMVWDVGGLLPTTGAKLIDQLVEQGL-TFSPTVLLGEKVESISKRS---DDLFGIDTTNGHHISKTVIVATGSGILKPHKVEVSGAERFELSNLHYTVK-SLGRFKGKRVLISGGGNSAVDWANAL--EPIAEQVVLTYRKEELSGHEAQVEKIKQSRVDCCPQSKVTDLISHD----GKSIQQVLLTHVETGETNVIDVDEVVINHGYEQ---DAELLRNSELQVDMNDGFYVKGNSGSESSVPGLYAAGDILTHEGKVHLIAGAFQDAANAV 309
>gi|83748251|ref|ZP_00945277.1| Ferredoxin--NAD(P)(+) reductase [Ralstonia solanacearum UW551] >gi|83725092|gb|EAP72244.1| Ferredoxin--NAD(P)(+) reductase [Ralstonia solanacearum UW551] (474 aa)
Score = 260, Expect = 8.6e-21, Identities = 79/304 (25%), Positives = 149/304 (49%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDIL----NITWQTINEQELFLFETNK---NSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEI-----IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           DV IVG G  G+FA+  +    L+ +L++     GGQ  ELYP K IYD P      + +++ +L+ Q              IL      T +TI  +    F  +    ++F    +++ +GNG+F P+++ +     ++  ++HY++  +T  +  K ++V GGGDSA++WA      K    V ++HRR  +R++   +  +       ++++++     +D         I  ++ E E  LP D ++  YG +S P  I    ++    G+ V++    +T+   ++A GD   +  K   I++   E   AL
  S:   135 DVLIVGAGPVGLFAAFEAGVLGLSCVLVDALDRPGGQCTELYPEKPIYDIPALVSCTAQELVDRLMAQCAP-------FGYPILCGRRAETVETIESEHGRRFRVSTSAGDAFDCAAVLITAGNGAFVPQRVALPEAAALEGRYLHYAVR-DTTRFAGKHVVVAGGGDSALDWA--LALRKTAARVTLVHRREGFRAADASVAEMRAAVAAGEMDFQVGMIGRLDSTPDGTLTGIALRQREGETRLPCDELIALYGLVSEPGPIAGW-EVEMRAGRIVVETTAYETSRPGVFAAGDIALYPNKQKLILSGFHEVAMAL 441
>gi|70607860|ref|YP_256730.1| thioredoxin reductase [Sulfolobus acidocaldarius DSM 639] >gi|68568508|gb|AAY81437.1| thioredoxin reductase [Sulfolobus acidocaldarius DSM 639] (332 aa)
Score = 259, Expect = 9.7e-21, Identities = 84/286 (29%), Positives = 157/286 (54%)
  Q:     5 LRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           ++ YD+ IVGGG  G+FA+  S   +++++LI+ +  LGGQ + +YP K +YD   +  I + D+ + LI+Q K   + +I+L      + W T  +  L++ +T+K N F AK I+LA G G   P +L    E   ++  ++Y++  + + ++ K+IL++GGGDSAV+WA       +  ++ +IHRR+++R+    +  L     +    +E+ +       +T   I    T++E+TL  D V++  G      N+     +N +    +++   +TN+  +YA GD
  S:     1 MKEYDIIIVGGGPIGLFATFYSGLRDMSALLIDAQDELGGQLVTIYPEKMVYDVGGYPGILAYDLAQNLIEQAK-MFSPDIRLKE---WVDWITRTQDNLWVIKTDKGNEFKAKTILLALGIGRITPSRLGAGGEIEYENRGVYYTVKRKKD-FEEKRILIVGGGDSAVDWAINLA--PVAKSITLIHRRDQFRAHESSVKQLYNIASVHTW-HELKEVKGDGSKVTQAVIFDNRTKEEKTLDVDAVIISIGHKGDLGNVPRWG-LNMKGRDILVNAKMETNLPGVYAAGD 282
>gi|160902043|ref|YP_001567624.1| thioredoxin reductase [Petrotoga mobilis SJ95] >gi|160359687|gb|ABX31301.1| thioredoxin reductase [Petrotoga mobilis SJ95] (340 aa)
Score = 259, Expect = 9.8e-21, Identities = 104/307 (33%), Positives = 160/307 (52%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELF---LFETNKNSFYAKKIILASGNGSFNPRKLEIN-NEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNILQKLNYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQI--SSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           YDV I+GGG  GI A+  +     ++++IEK +  GGQ M L     I ++P F  IK  + +  L++++ EQ  ++      I  I   T ++ E F   +   N  +  +K II+ASG+    PRKL +   E   S  + Y  + +   +KNKKI V+GGG++AVE A Y     I   V IIHRR + R+     D   S+NNI  K N  I +    +K  +L IK+ + ++    PFD V V  G +  +S +N +L +    E G  + D N +T +K IYA+GD      +   I+TA ++   A  H
  S:    18 YDVVIIGGGPAGISAAIYALQGGASTLVIEK-AIEGGQ-MNL--TDIIENYPGFKTIKGEE-LSSLMKEHAEQFGADFYDGKVIELIDSLTADKDEDFHKMVVMENGKTIKSKAIIIASGS---YPRKLGVKGEEEFSSRGVSYCASCDGHFFKNKKIAVVGGGNTAVEEAVYL--SNIAKEVYIIHRREKLRADKLYQDRAFSRNNIKFKWNSVIEEIKGKDKVESLVIKNLKNDEVYEEPFDGVFVFVGLVPETSFLNKDLFD--FDEYGFLITDENMETKVKGIYAVGDVRKKELR--QIVTAVSDGAIAASH 319
>gi|192809307|ref|ZP_03037982.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Geobacillus sp. Y412MC10] >gi|192801978|gb|EDV78483.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Geobacillus sp. Y412MC10] (349 aa)
Score = 259, Expect = 1.0e-20, Identities = 90/306 (29%), Positives = 149/306 (48%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFET-NKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQT-----LPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTN--IKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           I+DV ++GGG  G++++  S    + + +IE +  LGG+ + +YP K I+D      I  + +I++++QQ     N  + L+  + +I     NE+ LF   T N     +K +I+A G G  NP+KLEI   E  +   ++Y++    + +K K ++V GGG+SAV+WAN    E +   V + +R++E       ++ L  +     LN  I     S+    I+  E     T     L  D V++ +G       +E  N        Y I  N   N  I  +YA GD  HF  K + I  A  +A  A+
  S:     6 IFDVTVIGGGPAGLYSAFYSGLRGMKTKIIEYQPMLGGK-VHVYPEKMIWDVGGLTPIPGAKLIEQMVQQGL-TFNPEVLLNEKVESI---ACNEEGLFELHTANSGVHLSKTVIVAVGGGILNPQKLEIEGAERFEVSNLNYTVK-SLQHFKGKTVIVSGGGNSAVDWANEL--EPVAKKVYLAYRKDELSGHEAQVEQLMNSKATCYLNTSITKLIASDNHEVIERVELTNNATGEVSYLAVDEVIINHGYERDMSLLENSNLDIHRVDDYYIAGNASCNSSIPGLYAAGDILHFDGKLHLIAGAFQDAANAV 312
>gi|126646698|ref|ZP_01719208.1| probable thioredoxin resuctase [Algoriphagus sp. PR1] >gi|126576746|gb|EAZ80994.1| probable thioredoxin resuctase [Algoriphagus sp. PR1] (334 aa)
Score = 259, Expect = 1.1e-20, Identities = 85/300 (28%), Positives = 154/300 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYF--VEEKITNNVAIIHRRNEYRSSS------FMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDL-NQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+ I+G G  G+FA   +    +   LI+    +GGQ  E+YP K IYD P + E+K+ +++  L++Q K  K +   L   + ++  Q   +    +  ++K   +A+ II+A G G F PRK  + N E  +   I Y +    E +++KK+++ GGGDSA++W  +   V EK+T    ++HR   +R +       F +    K +++   N + +  N +  ++T+  K  E E  +  DY++  +G +S  +       ++ +K    +D  +  T ++ IYAIGD   +  K   I+    EA
  S:     5 DICIIGAGPVGLFAIFEAGLLKMRCHLIDALPQVGGQLSEIYPQKPIYDIPGYPEVKAQELVDNLMEQAKPFKPT-FSLGERVDHLDKQ--EDGSYIVTTSDKTHVHAQVIIIAGGLGCFEPRKPALENLETFEGKGITYMVK-NPETFRDKKVVLAGGGDSALDWTIFLANVAEKVT----LVHRNETFRGAPDSAAKVFDLANQGKIDLILSANLKTVGGNGTLDSVTLLSKAKE-EIKIDADYLIPLFG-LSPKLGPIADWGLSIDKNAIEVDTRDYSTGVERIYAIGDINTYPGKLKLILCGFHEA 304
>gi|58336776|ref|YP_193361.1| thioredoxin reductase [Lactobacillus acidophilus NCFM] >gi|58254093|gb|AAV42330.1| thioredoxin reductase [Lactobacillus acidophilus NCFM] (294 aa)
Score = 259, Expect = 1.1e-20, Identities = 88/288 (30%), Positives = 146/288 (50%)
  Q:    31 LNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYR---SSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISKN 318
           LN+I+ +  S +GGQP  LYP K I D P +  I  +D+I+KL    K +  + I  +  ++++T Q+    + F+ +   N  YA+ II+A+G G+F P++L +         IHY +   ++ +KN+ I V GGGDSA++ A   +E     NV +IHRR+++R   S+   +  L    IL     + I+   +   +++K    E+ + +  D ++V YG   +         IN E+    +D   KTNI  IYA GD   +  +   I     EA  A+  I +N
  S:     4 LNTIVFDSLSEVGGQPQMLYPFKQINDIPAYNSISGTDLIQKLKHDIKNE--TEIITNHKVVDVTKQS----DGFIID---NIIYARSIIIATGAGAFKPKELPLKISDEIKEKIHYFVKDPSQ-FKNQTIGVFGGGDSALDLA---LEVAKYANVKLIHRRDQFRGLESNVKKLKSLKNVEILTPYLPKKIELINNQLDISLKKMGVEQLRNVQLDQIVVAYG-FRANNRFAKKWGINLEQSNIPVDPTMKTNIDGIYAAGDVVTYPGRVPLIALGFGEAQIAITSIMRN 280
>gi|52081162|ref|YP_079953.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Bacillus licheniformis ATCC 14580] >gi|52786545|ref|YP_092374.1| YcgT [Bacillus licheniformis ATCC 14580] >gi|52004373|gb|AAU24315.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Bacillus licheniformis ATCC 14580] >gi|52349047|gb|AAU41681.1| YcgT [Bacillus licheniformis DSM 13] (349 aa)
Score = 258, Expect = 1.4e-20, Identities = 83/306 (27%), Positives = 157/306 (51%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFY-AKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQT-----LPFDYVLVQYG--QISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           ++DV ++GGG  G++++  S    + + +IE +  LGG+ + +YP K I+D      I  + +I++L+QQ     +  + L+  + +I     NE+ LF   T  +  + +K +I+A G G  NP+KL+I   E  +   ++Y++    + +K+K ++V GGG+SAV+WAN    E +   V + +R++        +D L  +++    + EI     S     I+  E    QT     LP D V++ +G  + +S +    L+    +        N ++++  +YA GD  H+  K + I  A  +A  A+
  S:     6 LFDVTVIGGGPAGLYSAFYSGLRGMKAKIIEYQPMLGGK-VHVYPEKMIWDVGGLTPISGAKLIEQLVQQGL-TFHPEVLLNEKVESIAR---NEEGLFELHTAASGVHLSKTVIVAVGGGILNPQKLQIEGAERFEVSNLNYTVK-SLQHFKDKTVIVSGGGNSAVDWANEL--EPVAKKVYLAYRKDALSGHEAQVDQLLNSSVSCFFHTEITKLIASEDHEVIERVELTNAQTGEVMELPVDEVVINHGYERDTSLLENSRLDVTRVDDYYIAGTSNCQSSVPGLYAAGDIVHYEGKLHLIAGAFQDAANAV 312
>gi|56416794|ref|YP_153868.1| thioredoxin reductase [Anaplasma marginale str. St. Maries] >gi|56388026|gb|AAV86613.1| thioredoxin reductase [Anaplasma marginale str. St. Maries] (340 aa)
Score = 258, Expect = 1.4e-20, Identities = 89/309 (28%), Positives = 157/309 (50%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKN-SFYAKKIILASGNGSFNPRKLEINNEPID--------SPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL----SKNNILQKLNYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKG--KYVIDLNQ---KTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           DVAI+G G  G+F    +    +++ +I+  S +GGQ   LYP K IYD P +    + D++  L +Q    K + +     + +   Q + E E F+  T+K      + I++A+G+G F P     N  P+D        S F H S   +   ++ K++++ GGGDSA +WA    E  + ++V +IHRR+ +R +   +  L     +  I   + Y++     S+  L    I++  +++E  +  D++L  +G     I+ +L    N   G   + I ++Q   +T    IYA+GD  H+  K   I+   +E+  A   I K
  S:    11 DVAIIGAGPVGLFTVFQAGMLGMSACVIDALSEVGGQCAVLYPEKPIYDIPAYPVTLARDLVNNLKRQADPFKPTYL-----LGHTAEQVLEEGEHFVVVTDKKVGVRCRAIVIAAGSGGFGP-----NRPPLDGITEYEDKSVFYHVS---DVSRFRGKRVVIAGGGDSAADWAVSLSE--VADSVHVIHRRHSFRCAPNTLRNLESLAERGQIKLLVPYQLAGLAGSDGMLNGVIIRNISSKEETRIDADFLLPFFG-----ISAKLGPIANWGLGVESFYIPIDQSTCRTARTRIYAVGDVAHYQGKLKLILVGFSESALACHDIYK 320
>gi|20808597|ref|NP_623768.1| thioredoxin reductase [Thermoanaerobacter tengcongensis MB4] >gi|20517227|gb|AAM25372.1| Thioredoxin reductase [Thermoanaerobacter tengcongensis MB4] (305 aa)
Score = 258, Expect = 1.5e-20, Identities = 93/287 (32%), Positives = 148/287 (51%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFY-AKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN--KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINK--EKGKYVIDLNQKTNIKNIYAIGDATH 293
           +YD+ I+GGG  G+ A   +    L ++LIE K+YLGGQ +  Y    + ++P + EI  +D++ K+  Q ++     +  D + L+IT       E+   +T  N  Y AK IILA G     PRKL + NE       I +    +   Y++  + V+GGG++AVE A Y    K    V IIHRR++ R++    +    N  ++ + N  ++D       + + +K+ +T +E TL  D V V  G    P N EL+  I +  E G  + D + KTNI  ++A GD  H
  S:     1 MYDLIILGGGPAGLTAGLYAARSRLKTVLIE-KTYLGGQIVNTYQ---LENYPGYEEITGADLVAKMEAQVRKHGLEIVLEDVESLDIT------GEIKRVKTANNKVYEAKAIILAMGA---TPRKLGVPNEDRFIGAGISFCATCDGAFYRDAVVAVIGGGNTAVEDALYLT--KFAKKVYIIHRRDQLRATKIEQEKAFANEKIEFIWNTVVVDVEGEYGVERIRLKNVKTGEESTLNVDGVFVAIGY--DP-NTELVKGIVELDEYGYIITDDDMKTNIPGVFAAGDIRH 276
>gi|73667016|ref|YP_303032.1| FAD-dependent pyridine nucleotide- disulphide oxidoreductase [Ehrlichia canis str. Jake] >gi|72394157|gb|AAZ68434.1| FAD-dependent pyridine nucleotide- disulphide oxidoreductase [Ehrlichia canis str. Jake] (338 aa)
Score = 257, Expect = 1.6e-20, Identities = 96/307 (31%), Positives = 161/307 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKN-SFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEI-----YKNKKILVLGGGDSAVEWANYFVE-EKITNNVAIIHRRNEYR---SSSFMIDCLSKNNILQKL-NYEIID-FNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKG-KYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHI 315
           D+A++G G  GIF    +    +   +I+  + +GGQ   LYP K IYD P +  +   ++I  L +Q+ E  N    L      I  +  +  + FL  T+K     +K I++A+G G+F P     N  PID+   + + ++  ++     + NK I++ GGGDSA +WA   VE  KI + + I+HRR  +R   +++  ID LS+N  +  +  Y+I     E  K  ++ +++    +E TL  DY+   +G  +S     +LN   + KG +  +D    +T+   IYA+GD   +  K   I+T  +EA  A  HI
  S:     7 DIAVIGAGPVGIFTVFQAGMLKMQCCVIDALTEVGGQCTALYPEKPIYDIPGYPIVSGKELIDNLKKQS-EPFNPQYLLG----QIAEKIEDYSDYFLIRTSKGIVIQSKVIVIAAGAGAFGP-----NRPPIDNILDYENKSVFYQVKNISDFHNKNIMIAGGGDSAADWA---VELSKIASQLYIVHRRRNFRCAPNTALQIDNLSQNGKINVIVPYQIKKLLGEEGKLHSVVVQNITNHEEITLQVDYLFPFFG--TSANLGSMLNWGIEIKGYQMTVDFETCRTSRDRIYAVGDIATYPGKVKLILTGFSEAAMACHHI 314
>gi|70605882|ref|YP_254752.1| thioredoxin reductase [Sulfolobus acidocaldarius DSM 639] >gi|68566530|gb|AAY79459.1| thioredoxin reductase [Sulfolobus acidocaldarius DSM 639] (328 aa)
Score = 257, Expect = 1.6e-20, Identities = 79/303 (26%), Positives = 155/303 (51%)
  Q:    10 VAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQ---ELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           + I+GGG  G++A+  +   ++ +++I+ +  LGGQ + LYP K +YD   +  I + D+ + LI+Q K           DI    W  + E+    +++ +T+K  +F  K I++A+G G   P +L    E   ++  ++Y++  + + ++ K+IL++GGGDSAV+WA       +  +V +IHRR+++R+    +  + +   +    +E+ +       +T   I    T++E+TL  D V++  G      N+     +N +     ++   +TN+  +YA GD       P   + A   A  A+
  S:     1 MVIIGGGPIGLYATFYAGLRDMRALVIDAQDELGGQLVTLYPEKVVYDVGGYPGILAYDLAQNLIEQAK-------MFSPDIRINEWADMIERTPDNMWIIKTDKGGAFKTKTILIAAGIGKIIPSRLNAKGEIEYENKGVYYTVRRKRD-FEGKRILIVGGGDSAVDWA--LTLSPVAKSVTLIHRRDQFRAHERSVKQMFQVATVYTW-HELKEVKGDGSKVTQAVIFDNRTKEEKTLDVDAVIISIGHKGDLGNMVKWG-LNMKGRSITVNGKMETNLAGVYAAGDIVEQEGTPKLALIATGFAQAAI 299
>gi|121605332|ref|YP_982661.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Polaromonas naphthalenivorans CJ2] >gi|120594301|gb|ABM37740.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Polaromonas naphthalenivorans CJ2] (366 aa)
Score = 257, Expect = 2.0e-20, Identities = 84/303 (27%), Positives = 154/303 (50%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEE--KITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKE---QTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           D  IVG G  G+F         + + +I+  +Y GGQP+ELYP+K IYD P        ++   L++Q  E       L  ++  +  Q   E   F  ET+K + F  K I +A+G G+F P+ L ++  +  D+  + Y +    + +  K ++++GGGDSA++WA  FV E      +V +IHRR+ ++++   +  + +     ++ +   ++  ++E    LT   K T  +   + +P D +LV +G +S  +       ++ E+ +  +D  +  TNI  I+A+GD   +  K   I++   E   A
  S:    23 DAVIVGAGPVGLFQVFELGLLEIKAHIIDSLAYPGGQPIELYPDKPIYDIPAIPVCTGKELTDNLMKQ-IEPFGPTFHLGQEVSVLEKQ---EDGRFFVETSKGTKFLTKTIFIAAGVGAFQPKLLRVDGLDKFDNSQLFYRVKNPAD-FAGKNLIIVGGGDSALDWALNFVAEGPNKAESVILIHRRDGFKAAPANVAKMKELCDAYEMQFIIGQVTGYDEKEGRLTAA-KVTGADGITRVVPLDVMLVFFG-LSPKLGPIAHWGLDIERKQIKVDTEKFSTNIPGIFAVGDINTYPGKKKLILSGFHECALA 329
>gi|46908195|ref|YP_014584.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes str. 4b F2365] >gi|46881465|gb|AAT04761.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes str. 4b F2365] (332 aa)
Score = 256, Expect = 2.6e-20, Identities = 75/289 (25%), Positives = 153/289 (52%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF-IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKY--VIDLNQKTNIKNIYAIGDATHF 294
           ++YDV I+GGG  G+F++  S   ++ + +I+ +  +GG+    +P K I D      I   +++  L QQ  E  +  I     ++++T   +++    L   N +  ++K I++A+G+G+F   KLE  +   D PF IHY +    E +++K ++V GGG+SA++WA     E I   V +I+R  ++++    +  L  + +   +++EI +   +N  LT   +   +T+  +T+  D + + +G     +++  + +   E+  +  V+D   KT +  I+A GD+  +
  S:     4 KVYDVTIIGGGPIGLFSAFYSGLRSMKTKIIDAEPAVGGKVRYFFPEKIIRDIGGIPAITGENLVANLKQQ-AETFHPTIVCSERVVDVT--KLSDGTFQLTSHNGSIHFSKTIVIATGSGTFEVNKLEALHAE-DFPFAIHYDVK-NIEQFRDKVVVVSGGGNSAIDWAQTL--EPIAKQVHLIYRGEDFKAHEESVRELQNSRVEIHIHHEINELIGTNNQLTKINVCCNKTQATKTIQTDALFINHG---VKVDLGTMAEWGFEQADFGIVVDDEMKTTVPGIFACGDSATY 288
>gi|154684817|ref|YP_001419978.1| YcgT [Bacillus amyloliquefaciens FZB42] >gi|154350668|gb|ABS72747.1| YcgT [Bacillus amyloliquefaciens FZB42] (336 aa)
Score = 255, Expect = 2.9e-20, Identities = 78/312 (25%), Positives = 151/312 (48%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLE-INNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFN---ESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ--INKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           M E+  +YDV I+GGG  G+FA+       L + +IE    LGG+    +P K I D      I    +I +L +Q    K  +I L+  +    ++ + +  + L  +     Y + +ILA G G+    +L+  +        +HY +  + + +++K +++ GGGD+AV+WAN    E I  +V ++HRR E+      +  + ++++     Y +   N   E  +++TI   E+   + +  D +++ +G     I++  +    +  E+G+   D + +TN+  ++  GDA H+  K   I     E   A+
  S:     1 MAENHEVYDVTIIGGGPIGLFAAFYCGMRELKTKVIEFLPRLGGKVSMFFPEKIIRDIGGIPGIAGEQLITQLKEQAATFK-PDIVLNQRVTG--FERLEDGTIVLESSEGEKHYTRTVILAVGMGTLEVNELDSADASRYSGKNLHYKVE-KLDAFRDKHVVISGGGDTAVDWANEL--EPIAASVTVLHRREEFGGLESSVAKMKRSSVRVLAPYRLKHLNGTGERIESVTICQTESGLSEVIKLDELVINHG---FKIDLGPMKDWGLEIEEGRIKADRHMRTNLPGVFVAGDAAHYESKLRLIAGGFTEGPTAV 309
>gi|157803773|ref|YP_001492322.1| thioredoxin reductase [Rickettsia canadensis str. McKiel] >gi|157785036|gb|ABV73537.1| Thioredoxin reductase [Rickettsia canadensis str. McKiel] (337 aa)
Score = 255, Expect = 2.9e-20, Identities = 98/306 (32%), Positives = 161/306 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTI--NEQ-ELFLFETNKNSF-YAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL----SKNNILQKLNYEIIDFNESN--------KTLTIKHKETEKEQTLPFDYVLVQYGQISS-PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           DV I+G G  G+FA   +  F +   +I+ +  +GGQ + LYP K IYD P + +I + ++IK+L  Q    K         + ++  Q I  N+Q + F  +T+KN+   +K II+A+G GSF P K  + N E  +   + Y +N +   +  K I++ GGGDSAV+WA    E  I N + ++HRR+++ +S   +  L        I   + Y++   + +N        + L     + E    LPF  +    G +++  +N++ L  I  +   Y      +TNI+ IYAIGD  H+  K   I+   AEA  +L H
  S:     5 DVVIIGAGPVGLFAVFQAGMFGMKCHVIDAQETIGGQCITLYPEKPIYDIPAYPKIVAEELIKQLELQAAPFK--------PVYHLNQQAIELNKQGDFFEIKTSKNTLIKSKIIIIAAGAGSFGPNKPPLANIEDFEGKSVFYFIN-DKNKFTGKNIVIAGGGDSAVDWAISLSE--IANKIYLVHRRDKFTASPESVRQLRNLAETGKIELVIGYQLNALDGNNGELQSVIVRDLQNNTHKLEANILLPFFGLKQNLGSLANWGLNVK-LQHIEVDNSYY------QTNIEGIYAIGDIAHYTGKLKLILIGFAEAASSLHH 310
>gi|193216226|ref|YP_001997425.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chloroherpeton thalassium ATCC 35110] >gi|193089703|gb|ACF14978.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chloroherpeton thalassium ATCC 35110] (341 aa)
Score = 255, Expect = 3.2e-20, Identities = 84/288 (29%), Positives = 143/288 (49%)
  Q:     3 EDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDF--------NESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PIN---IELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           E+  + D+ I+G G  G++A+  +    + + +++    +GGQ   LYP K IYD   + +I +  +I  L  Q   Q +  I   T I  I     N     LF  +   F +K +++A+G G+F PRKL +           +    +  ++  KK+L++GGGDSA++WA   +       V +IHRR+++ +    ++ + K+    K  YE+            E +K +   +K T +E TL  D +L   G  ++  PI    +E+LN   K      +D+N  TN+  IYA GD
  S:     8 ENNEVADITIIGAGPIGLYAAFYAGLRTMKARVVDSLPQIGGQLTALYPKKAIYDVAGYPKIVAEALIANLAIQ-ASQYHPEILTSTQITEIHR---NGALFELFSEDGRQFLSKTVLIAAGVGAFAPRKLPMEEAVKWEGNGLFYFVQDPTVFFGKKVLIIGGGDSALDWAMALMANA---EVTLIHRRDKFTAHEDSVEKVRKSPANIKTFYELKSIVGKDSPQGKELHKVVIFNNK-TNEETTLEVDAILCNLGFSTNLGPIKNWGVEILNNAVK------VDVNMATNVTGIYAAGD 294
>gi|47093291|ref|ZP_00231061.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes str. 4b H7858] >gi|153167816|ref|ZP_01927901.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes FSL N1-017] >gi|153202954|ref|ZP_01944392.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes HPB2262] >gi|167015115|ref|ZP_02277648.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes FSL J1-194] >gi|47018311|gb|EAL09074.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes str. 4b H7858] >gi|133726687|gb|EBA28385.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes FSL N1-017] >gi|133735024|gb|EBA36722.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes HPB2262] (332 aa)
Score = 253, Expect = 4.6e-20, Identities = 75/288 (26%), Positives = 152/288 (52%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF-IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKY--VIDLNQKTNIKNIYAIGDATHF 294
           +YDV I+GGG  G+F++  S   ++ + +I+ +  +GG+    +P K I D      I   +++  L QQ  E  +  I     ++++T   +++    L   N +  ++K I++A+G+G+F   KLE  +   D PF IHY +    E +++K ++V GGG+SA++WA     E I   V +I+R  ++++    +  L  + +   +++EI +   +N  LT   +   +T+  +T+  D + + +G     +++  + +   E+  +  V+D   KT +  I+A GD+  +
  S:     5 VYDVTIIGGGPIGLFSAFYSGLRSMKTKIIDAEPAVGGKVRYFFPEKIIRDIGGIPAITGENLVANLKQQ-AETFHPTIVCSERVVDVT--KLSDGTFQLTSHNGSIHFSKTIVIATGSGTFEVNKLEALHAE-DFPFAIHYDVK-NIEQFRDKVVVVSGGGNSAIDWAQTL--EPIAKQVHLIYRGEDFKAHEESVRELQNSRVEIHIHHEINELIGTNNQLTKINVCCNKTQATKTIQTDALFINHG---VKVDLGTMAEWGFEQADFGIVVDDEMKTTVPGIFACGDSATY 288
>gi|167214787|ref|ZP_02285094.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes FSL R2-503] (331 aa)
Score = 253, Expect = 5.3e-20, Identities = 75/288 (26%), Positives = 152/288 (52%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF-IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKY--VIDLNQKTNIKNIYAIGDATHF 294
           +YDV I+GGG  G+F++  S   ++ + +I+ +  +GG+    +P K I D      I   +++  L QQ  E  +  I     ++++T   +++    L   N +  ++K I++A+G+G+F   KLE  +   D PF IHY +    E +++K ++V GGG+SA++WA     E I   V +I+R  ++++    +  L  + +   +++EI +   +N  LT   +   +T+  +T+  D + + +G     +++  + +   E+  +  V+D   KT +  I+A GD+  +
  S:     5 VYDVTIIGGGPIGLFSAFYSGLRSMKTKIIDAEPAVGGKVRYFFPEKIIRDIGGIPAITGENLVANLKQQ-AETFHPTIVCSERVVDVT--KLSDGTFQLTSHNGSIHFSKTIVIATGSGTFEVNKLEALHAE-DFPFAIHYDVK-NIEQFRDKVVVVSGGGNSAIDWAQTL--EPIAKQVHLIYRGEDFKAHEESVRELQNSRVEIHIHHEINELIGTNNQLTKINVCCNKTQATKTIQTDALFINHG---VKVDLGTMAEWGFEQADFGIVVDDEMKTTVPGIFACGDSATY 288
>gi|146321838|ref|YP_001201549.1| thioredoxin reductase [Streptococcus suis 98HAH33] >gi|145692644|gb|ABP93149.1| Thioredoxin reductase [Streptococcus suis 98HAH33] (257 aa)
Score = 253, Expect = 5.9e-20, Identities = 77/226 (34%), Positives = 122/226 (53%)
  Q:    87 LDTDI-LNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINI-ELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
            DT I LN T   I   E     TNK +   K +I+A G G+F PR LEI+  +  D+  +HY ++   + Y +K I+VLGGGDSAV+W+  F  EKI     IIHRR+ +R+    ++ L ++++     +     +  N     +     ++E + TL FD++ V YG  SS   + E   ++N+   + V++  Q+T++  IYAIGD   +  K + I T   EA  A+
  S:    12 FDTTICLNETLTAIEPGETITLTTNKGNHQTKTLIIAMGGGAFKPRPLEIDGADSFDN--VHYHVS-NIQQYADKDIVVLGGGDSAVDWSLAF--EKIAKTTQIIHRRDNFRALEHSVEELKQSSVTIHTPFIPKGLSGENGRASAIDFDKVKSEDKLTLSFDHLFVNYGFKSSVGTLKEWGLELNRH--RIVVNSKQETSVPGIYAIGDCCFYEGKIDLIATGLGEAPTAV 236
>gi|91976124|ref|YP_568783.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Rhodopseudomonas palustris BisB5] >gi|91682580|gb|ABE38882.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Rhodopseudomonas palustris BisB5] (342 aa)
Score = 252, Expect = 6.5e-20, Identities = 91/320 (28%), Positives = 165/320 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNE---SNKTL---TIKHKETEKEQ-----TLPFDYVLVQYGQISSPINIELLNQ-INKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE----AVRALWHISKNKK 320
           M E ++  DV IVG G  G+FA       ++   L++    +GGQ  ELYP K IYD P    I    + + L++Q K   N  I L+  I ++  + I + E  +       F  K +++A+G GSF P++  +   E  +   +HY++  + E ++ K I+++GGGDSA++W        I  ++ ++HRR+++R +   ++ + +     KL+ +I    E    N  L   TIK  +    Q      LPF  + ++ G +++   ++L N  I  + G +      +TN+  I+AIGD   +  K   I++   E    A +A+ ++  +K+
  S:     1 MTEAIKT-DVLIVGAGPCGLFAVFELGLLDIKVHLVDILDKVGGQCAELYPEKPIYDIPGIPMITGHGLTESLMEQIKP-FNPTIHLNEMIESV--EKIGDPEFRVITNAGTVFECKVLVVAAGGGSFQPKRPPVPGVEAYEGKSVHYAVR-KMEEFRGKDIVIVGGGDSALDWTLNL--NPICKSMTLVHRRDDFRGAPHSVEQMRQLVASGKLDLKIGQITELQGDNGQLSGATIKLNDNSVAQIKCDAMLPFFGLTMKLGPVAN-WGLQLENNLIPVDTGTF------ETNVPGIFAIGDINTYPGKLKLILSGFHEGALMAQKAVKYVYPDKR 323
>gi|31544665|ref|NP_853243.1| hypothetical protein MGA_0124 [Mycoplasma gallisepticum R] >gi|31541511|gb|AAP56811.1| TrxB [Mycoplasma gallisepticum R] (314 aa)
Score = 252, Expect = 7.2e-20, Identities = 83/287 (28%), Positives = 148/287 (51%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFE-TNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATH 293
           ++D+ IVG G  GI A+  +   N+N  ++E  S  GG+ ++     FI ++P +  IK  D+   ++ Q     NS   L   I       I +QE + F   +  +  +K +I+A+G      RKL + NE   ++  I Y    +  +YKN+ + V+GGG++AVE + Y     I N V ++HRR+E+R+ S+ +  L +   +  L   ++D    ++TL    +K+ +  +   L  D +    G + +   ++  N +N+E G  ++D NQKT++  +YA GD  H
  S:    12 LFDLVIVGSGPAGISAAIYAKRANINVCVVEG-SAPGGKILK---TGFIDNYPGYSSIKGPDLAVNMLNQ----LNS---LSVPIFYSQVNAIEKQENYFFTYLDSKTLLSKAVIVATGTLE---RKLGLANEAKFETKGISYCAICDGPLYKNRDVAVVGGGNAAVEESLYL--SGICNKVYLVHRRDEFRADSYAVAKLKEKKNVHFLLSHVVDSYLGDQTLKGIKVKNLKNNELTDLTIDCLFPYIGAVPNTSFLKPFNILNEE-GYVLVDANQKTSVDGLYAAGDCVH 286
>gi|70725682|ref|YP_252596.1| hypothetical protein SH0681 [Staphylococcus haemolyticus JCSC1435] >gi|68446406|dbj|BAE03990.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (343 aa)
Score = 252, Expect = 7.6e-20, Identities = 93/303 (30%), Positives = 161/303 (53%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFY-AKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLS--KNNILQKLNY-EIIDFN--ESNKTLTIKHKETEKEQTLPFDYVLVQYG-QISSPINIELLNQINKEKGKYVIDL-NQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           DV I+GGG  G+FAS  +    ++  +I+ +  LGG+ M++YP K I+D         +++IK +I Q     N  + L+  + +I  + I E+  F  ET+    Y +K +I A G G  NP+ L+I + E      +HY +   ++ +K K IL+ GGG++A++WA       I N++ +++R+++ +    MI  L     N+L K    E+I  N  E  K + +++ ET +  T  FD V+V +G    +P+  +  ++++      V    N  TNI  I+A GD  H   K + I +A ++A  A
  S:     3 DVTIIGGGPAGLFASFYAGLRGMSVRIIDVQDKLGGK-MQIYPEKIIWDIGGVAPKPCNEIIKDMINQGL-HFNPKVNLNERVTDI--RKIAERH-FEVETDSGQIYESKAVIFAVGGGIINPKPLQIKDAERYRLTNLHYVVQSFSK-FKGKDILISGGGNTALDWARDLA--NIANSITLVYRKSDIKGYEAMISVLKALNVNLLPKTQIKELIGDNKCECIKEVKLENIETGEVTTQAFDDVIVSHGFDHENPLLKDCTSKLDLYDEYRVKGFGNTTTNIPGIFACGDIVHHDAKVHLIASAFSDAGNA 306
>gi|190571402|ref|YP_001975760.1| pyridine nucleotide-disulphide oxidoreductase family protein [Wolbachia pipientis] >gi|190357674|emb|CAQ55118.1| pyridine nucleotide-disulphide oxidoreductase family protein [Wolbachia pipientis] (334 aa)
Score = 250, Expect = 1.0e-19, Identities = 93/309 (30%), Positives = 159/309 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS-FYAKKIILASGNGSFNPRK------LEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVE-EKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLN-------------YEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ--INKEKGKYVID-LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           D+ I+G G  GIF +  +   ++   +I+     GGQ   LY  K IYD P +  I +  +I++L++Q    +     L   +  I   + NE E F   TN  +    K +I+A+GNG F P +      LE  N+      + YS+N  ++ +++K I++ GGGDSA +W    VE  K+   + +IHRR E+R +          N L+ L              +E+   N   + + +K+  +++E+ +  D++L  +G     +N+  +N   I  E G+ ++D    +T+   IYAIGD   +  K   I+   AE+  A +HI K
  S:     4 DIVIIGAGPIGIFTAFQAGMLDMRCHVIDVLDQAGGQCTALYSEKPIYDIPGYPVITAQKLIEQLMEQASPFEPV-YHLSQKVEKI---SNNEGENFTIITNIGTEVKCKAVIIAAGNGMFEPNRPPLSGILEYENKS-----VFYSVNKISD-FQDKTIVIAGGGDSAADWT---VELSKVAKKIYVIHRRKEFRCTP------ETRNKLESLENDGKIELVVPYQLHELAGGNGQLRAVIVKNIASKEEREISADFLLPFFGL---SMNLGPINNWGIELEHGRIIVDPATLRTSRDRIYAIGDIATYPDKLKLILNGFAESAMACYHIYK 314
>gi|17545858|ref|NP_519260.1| thioredoxin reductase oxidoreductase protein [Ralstonia solanacearum GMI1000] >gi|17428152|emb|CAD14841.1| probable thioredoxin reductase oxidoreductase protein [Ralstonia solanacearum] (379 aa)
Score = 250, Expect = 1.1e-19, Identities = 79/304 (25%), Positives = 146/304 (48%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDIL----NITWQTINEQELFLFETNK---NSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEI-----IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           DV IVG G  G+FA+  +    L+ +L++     GGQ  ELYP K IYD P      + +++ +L+ Q              IL      T +TI  +    F       + F    +++ +GNG+F P+++ +     ++   +HY++  +T  +  K ++V GGGDSA++WA      K    V ++HRR  +R++   +  +       ++++++     +D         I  ++ E E  LP D ++  YG +S P  I   + +    G+ V++    +T+   ++A GD   +  K   I++   E   AL
  S:    40 DVLIVGAGPVGLFAAFEAGVLGLSCVLVDVLDRPGGQCTELYPEKPIYDIPALVSCTAQELVDRLLAQCAP-------FGYPILCGRRAETVETIEGEHGRRFRVTTSVGDVFDCAAVLITAGNGAFAPQRVALPEAAALEGRHLHYAVR-DTARFAGKHVVVAGGGDSALDWA--LALRKTAARVTLVHRREGFRAADASVAGMRAAVAAGEMDFQVGMIGRLDSAPDGTLTGIALRQREGETRLPCDELIALYGLVSEPGPIASWD-VEMRAGRIVVETTAYETSRAGVFAAGDIALYPNKQKLILSGFHEVAMAL 346
>gi|73540801|ref|YP_295321.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase:aromatic-ring hydroxylase [Ralstonia eutropha JMP134] >gi|72118214|gb|AAZ60477.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase:Aromatic-ring hydroxylase [Ralstonia eutropha JMP134] (362 aa)
Score = 250, Expect = 1.2e-19, Identities = 79/309 (25%), Positives = 151/309 (48%)
  Q:     4 DLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKE---QKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDF--------NESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           D    DV IVG G  G+FA+  +    L   LI+     GGQ  ELYP K IYD P      + D++ +L++Q        + N + ++    +  Q      L +   +   F    +++ +G G+F P+++ +   P ++   +HY++  +   +  K+++V GGGDSA++WA      K+   V ++HRR  +R++   +  +       ++++ I            E    + I+ +  +  QTL  D ++  YG +S P  I   + ++   G+ ++D    +++ + I+A GD  ++  K   I++   EA  AL
  S:    14 DTTTTDVLIVGAGPVGLFAAFQAGVLGLKCELIDVLDRAGGQCTELYPEKPIYDIPAVPGCLAQDLVDRLLEQCAPFAFPMHFNQRAESVAEVLPAQDGVHSRLLVTTDSGKRFDVAAVLVCAGAGAFAPQRVSLPEAPGLEGRHVHYAVR-DVSRFAGKRVVVAGGGDSALDWA--LALRKVAARVTLLHRREGFRAADGSVAEMRAAVEAGEMDFVIGMLGALKTSGEGEHAALMEIEIRSRDGVQTLAADELVALYGLVSEPGPIAQWD-MDMRAGRILVDTTTYESSRRGIFAAGDIAYYANKQKLILSGFHEAALAL 331
>gi|149280700|ref|ZP_01886811.1| Thioredoxin-disulfide reductase [Pedobacter sp. BAL39] >gi|149228565|gb|EDM33973.1| Thioredoxin-disulfide reductase [Pedobacter sp. BAL39] (336 aa)
Score = 250, Expect = 1.3e-19, Identities = 81/300 (27%), Positives = 150/300 (50%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRK--LEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL------SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D+AI+G G  G+FA   +    +   LI+    +GGQ  E+YP K IYD P +  + + +++  L++Q K   +    L   I  +  +   E +  L      +  AK +++A G G F PRK  +E   +  +   ++Y + L+ E Y+ +K+++ GGGDSA++W  +  +  I   + ++HR   +R +   ++ +       K N++   N   +  +   +T+ I H  + ++ T+  D+++  +G       IE  N +N  K    ++++   TNI  IYAIGD   +  K   I+    EA
  S:     5 DIAIIGAGPVGLFAIFEAGLLKMRCHLIDYLPQVGGQLSEIYPKKPIYDIPGYPSVGAQELVDNLMEQAKP-FHPGFTLGERIEGL--EKRGEADFVLTTNMGTTIEAKVVVIAGGLGCFEPRKPVVEGLEQFENGRGVNYMI-LDPEKYRGQKMVIAGGGDSALDWTIFLAD--IVEELTLVHRSESFRGAPDSVNKVMELANSGKINLILNSNLSAVSGHGKLETVDIVHNRSLEKTTIQADHLIPLFGLSPKLGPIEGWN-LNISKSAIEVNVDDYSTNIPGIYAIGDINTYTNKLKLILCGFHEA 306
>gi|86750949|ref|YP_487445.1| thioredoxin reductase [Rhodopseudomonas palustris HaA2] >gi|86573977|gb|ABD08534.1| Thioredoxin reductase [Rhodopseudomonas palustris HaA2] (342 aa)
Score = 249, Expect = 1.3e-19, Identities = 87/320 (27%), Positives = 165/320 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNE--------SNKTLTIKHKETEK---EQTLPFDYVLVQYGQISSPINIELLNQ-INKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE----AVRALWHISKNKK 320
           M E ++  DV IVG G  G+FA       ++ + L++    +GGQ  ELYP K IYD P    I    + + L++Q K   N  I L+  I ++  + I + E  +       F  K +++A+G GSF P++  +   E  +   +HY++  + E ++ K I+++GGGDSA++W        I  ++ ++HRR+++R +   ++ + +     KL+ +I    E        S  T+ +      +   +  LPF  + ++ G +++   ++L N  I  + G +      +TN+  I+AIGD   +  K   I++   E    A +A+ ++  +K+
  S:     1 MTETIKT-DVLIVGAGPCGLFAVFELGLLDIKTHLVDILDKVGGQCAELYPEKPIYDIPGVPMITGHGLTEALMEQIKP-FNPTIHLNEMIESV--EKIGDPEFRVTTNAGTVFECKVLVVAAGGGSFQPKRPPVPGVEAYEGKSVHYAVR-KMEEFRGKDIVIVGGGDSALDWTLNL--NPICKSMTLVHRRDDFRGAPHSVEQMRQLVASGKLDLKIGQITELQGEDGQLSGATIKLNGNSIAQIKCDAMLPFFGLTMKLGPVAN-WGLQLENNLIPVDTGTF------ETNVPGIFAIGDINTYPGKLKLILSGFHEGALMAQKAVKYVYPDKR 323
>gi|91788202|ref|YP_549154.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Polaromonas sp. JS666] >gi|91697427|gb|ABE44256.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Polaromonas sp. JS666] (366 aa)
Score = 249, Expect = 1.3e-19, Identities = 84/303 (27%), Positives = 154/303 (50%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEE--KITNNVAIIHRRNEYR---SSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKE---QTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           D  IVG G  G+F         + + +I+  +Y GGQ +ELYP+K IYD P        ++   L++Q  E   +      ++  +  Q   E   F  ET+K + F  K I +A+G G+F P+ L ++  +  D+  + Y +    + +  K ++++GGGDSA++WA  FV E      +V ++HRR+ ++   +S   +  L     +Q +  ++  ++E N  +T   K T  +   + +P D +LV +G +S  +       ++ E+ + ++D  +  TNI  I+A+GD   +  K   I++   E   A
  S:    23 DAVIVGAGPVGLFQVFELGLLEIKAHVIDSLAYPGGQCIELYPDKPIYDIPAVPMCTGKELTDSLLKQ-IEPFGATFHFGQEVSVVEKQ---EDGRFFVETSKGTKFLTKTIFIAAGVGAFQPKLLRVDGLDQFDNTQLFYRVKNPAD-FAGKNLVIVGGGDSALDWALNFVAEGPNKAESVILVHRRDGFKAAPASVAKMKELCDAYEMQFIVGQVTGYDEKNGKMT-GAKVTGADGVTRVVPLDVLLVFFG-LSPKLGPIAHWGLDIERKQLMVDTEKFSTNIPGIFAVGDINTYPGKKKLILSGFHECALA 329
>gi|94310008|ref|YP_583218.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia metallidurans CH34] >gi|93353860|gb|ABF07949.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia metallidurans CH34] (353 aa)
Score = 248, Expect = 1.8e-19, Identities = 77/304 (25%), Positives = 146/304 (48%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQ--------NKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEI-----IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           DV IVG G  G+FA+  +    L   +++     GGQ  ELYP K IYD P      + D++ +L++Q        +  Q+  ++  DT   N          L +       F    +++ +G G+F P+++ +     ++   +HY++  +   +  K+++V GGGDSA++WA      K    V ++HRR  +R++   +  +       ++++ +     +  N          K  + EQT+P D ++  YG +S P  I   + ++   G+  +D    +++ + I+A GD   +  K   I++   EA  AL
  S:    15 DVLIVGAGPVGLFAAFQAGVLGLKCEIVDVLDRAGGQCTELYPEKPIYDIPAVPGCLAQDLVDRLLEQCAPFAFPMHFSQRAESVS-DTTCTN------GHPRLLVTTDAGKRFDVAAVLICAGAGAFAPQRVSLPEAAALEDRHLHYAVR-DLSRFAGKRVIVAGGGDSALDWA--MALRKTAARVTLLHRREGFRAADHTVKAMRDAVAAGEMDFVVGMLGGLQTNGDGALTGAVVKSRDGEQTIPADDLVALYGLVSEPGPIAQWD-MDMRAGRIAVDTTTYESSRRGIFAAGDIAFYPNKQKLILSGFHEAALAL 322
>gi|124266689|ref|YP_001020693.1| thioredoxin reductase [Methylibium petroleiphilum PM1] >gi|124259464|gb|ABM94458.1| thioredoxin reductase [Methylibium petroleiphilum PM1] (366 aa)
Score = 247, Expect = 2.3e-19, Identities = 83/299 (27%), Positives = 151/299 (50%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEE--KITNNVAIIHRRNEYR---SSSFMIDCLSKNNILQKLNYEIIDFNESNKTL-TIKHKETEK-EQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAE 307
           D  IVG G  G+F         + + +I+  +Y GGQ +ELYP+K IYD P        ++   L++Q  E   +   L  +   +T     +   F  ET+K + F  K I +A G GSF PR L+++  +  D   +HY +      +  K ++++GGGDSA++W   FV++      +V ++HRR+ ++   +S   +  L     +Q +  ++  F  +   L ++K    +   + +P D +LV +G +S  +       +N E+ + V+D  + +TN+  I+A+GD   +  K   I++   E
  S:    23 DAVIVGAGPVGLFQVFELGLLEIKAHIIDSLAYPGGQCIELYPDKPIYDIPAVPVCTGKELTDNLLKQ-IEPFGATFHLGQE---VTLVNKRDDGRFDLETSKGTRFITKTIFIAGGVGSFQPRLLKVDGLDQFDGSQLHYRVR-NPSAFAGKNLVIVGGGDSALDWTLNFVQDGPNKAESVILVHRRDGFKAAPASVAKMKELCDAYEMQFIVGQVTGFEATEGQLRSVKVTGGDGVTRVVPLDMLLVFFG-LSPKLGPIAEWGLNIERKQVVVDTEKFETNVPGIFAVGDINVYPGKKKLILSGFHE 325
>gi|157825765|ref|YP_001493485.1| thioredoxin reductase [Rickettsia akari str. Hartford] >gi|157799723|gb|ABV74977.1| Thioredoxin reductase [Rickettsia akari str. Hartford] (334 aa)
Score = 247, Expect = 2.3e-19, Identities = 98/306 (32%), Positives = 161/306 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQ-ELFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMI----DCLSKNNILQKLNYEIIDFNESNKTL-TIKHKETEKE-QTLPFDYVLVQYG---QISSPINIEL---LNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           DV I+G G  G+F    +    +   +I+ +  +GGQ + LYP K IYD P + +I + ++IK+L  Q    K          LN     +N+Q + F   T+KN+   +K II+A+G GSF P K  + N E  +   + Y +N +++ +  K I++ GGGDSAV+WA    E  I N + ++HRR+++ ++   +    D      I     Y++   + +N TL T+  K+ +   + L  + +L  +G    + S  N  L   L+ I  +   Y      +TNI+ IYAIGD  H+  K   I+T  AEA  ++ H
  S:     5 DVIIIGAGPVGLFTIFQAGMLGMKCHVIDAQETVGGQCITLYPEKPIYDIPAYPKIAAEELIKQLEFQAAPFK------PVYHLNQHATDLNKQGDFFEIRTSKNTIIKSKAIIIAAGAGSFGPNKPPLANIEDFEGKSVFYFINNKSK-FAGKNIVIAGGGDSAVDWAISLSE--IANKIYLVHRRDKFTAAPESVRQLRDIAETGKIELVTGYQLNALDGNNGTLQTVIVKDLQNNIRKLDANVLLPFFGLKQDLGSLANWGLDVKLHHIEVDNSYY------QTNIEGIYAIGDIAHYAGKLKLILTGFAEAASSIHH 310
>gi|58584942|ref|YP_198515.1| thioredoxin reductase [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|58419258|gb|AAW71273.1| Thioredoxin reductase [Wolbachia endosymbiont strain TRS of Brugia malayi] (339 aa)
Score = 247, Expect = 2.4e-19, Identities = 92/309 (29%), Positives = 160/309 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNK--EQKNSNIQLDTDILNITWQTINEQELFLFETNKNS-FYAKKIILASGNGSFNPRK------LEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVE-EKITNNVAIIHRRNEYRSSSFMIDCL----SKNNILQKLNYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVID-LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           D+ ++G G  GIF +  +   ++   +I+     GGQ   LYP K IYD P +  I +  +I++L++Q    E      Q   +I N      N+ + F+  T+  +    K II+A+GNG F P +      LE  N+      + Y++N  ++ +++K I++ GGGDSA +W    VE  K+   + +IHRR E+R  S   + L    S   I   + Y++     ++  L+   IK+  +++E+ +  D++L  +G +S  +       I  E+ + V+D    +T+   IYAIGD   +  K   I+   AE+  A + I K
  S:     4 DIVVIGAGPVGIFTAFQAGMLDMRCHIIDVLDQAGGQCTALYPEKPIYDIPGYPVITAQKLIEQLMEQASPFEPVYHLSQRVEEIAN------NDSQSFIVVTSAGTKVKCKAIIIAAGNGIFEPNRPPLSGILEYENKS-----VFYNVNKISD-FQDKIIVIAGGGDSAADWT---VELSKVAKKIYVIHRRKEFRCVSETRNKLKLLESSGRIELVVPYQLHKLTGNDGQLSAVIIKNITSKEEKKISADFLLPFFG-LSMDLGPIGSWDIQLERSRVVVDQATLRTSRDRIYAIGDVAAYLGKLKLILNGFAESTMACYDIYK 314
>gi|168266347|ref|ZP_02688312.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes FSL J2-071] (332 aa)
Score = 247, Expect = 2.5e-19, Identities = 71/288 (24%), Positives = 149/288 (51%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKY--VIDLNQKTNIKNIYAIGDATHF 294
           +YDV I+GGG  G+F++  S   ++ + +I+ +  +GG+    +P K I D      I  ++++  L +Q  E  +  I  +  ++++T   + +    L   N +  ++K I++A+G+G+F   KLE  +       IHY +    E ++NK + V GGG++A++WA     E I   V +I+R  ++++    +  L  + +   +++EI +   +N  LT   +   +T+  +T+  D + + +G     +++  + +   E+  +  V+D   KT +  I+A GD+  +
  S:     5 VYDVTIIGGGPIGLFSAFYSGLRSMKTKIIDAEPAVGGKIRYFFPEKIIRDIGGIPAITGANLVANLKEQ-AETFHPTIVCNERVVDVT--RLADGTFQLTSHNGSIHFSKTIVIATGSGTFEVNKLEALHAEDFPSAIHYDVK-NIEQFRNKVVAVSGGGNAAIDWAQTL--EPIAKQVHLIYRGEDFKAHEESVRELQNSRVEIHIHHEISELIGTNNQLTEINVCCNQTQATKTIQTDALFINHG---VKVDLGTMAEWGFEQADFGIVVDDEMKTTVPGIFACGDSATY 288
>gi|160878412|ref|YP_001557380.1| thioredoxin reductase [Clostridium phytofermentans ISDg] >gi|160427078|gb|ABX40641.1| thioredoxin reductase [Clostridium phytofermentans ISDg] (308 aa)
Score = 247, Expect = 2.5e-19, Identities = 83/284 (29%), Positives = 146/284 (51%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSS-SFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVI-DLNQKTNIKNIYAIGD 290
           I+D+AI+G G  G+ AS  ++   LN+I+IEK+   GGQ +  Y    + ++P    I   D+  K  + + +   +++  +     +    I +  L     N   FYAK +I+A+G  S   RKL++  E  +    + Y    +   ++ K + V+GGGD AVE A +    +I   V +IHRR+E+R++ +F+   LS  N+    N    EI+  +  N  + +++  TE+   L  D V +  G +    N E+    +  ++G Y+I D + +TN+  I+A GD
  S:     5 IHDLAIIGSGPAGLTASIYASRAELNTIVIEKEPMSGGQIINTYE---VDNYPGIPGIGGFDLAVKFREHSDKLGATHVYGEVKAFEVE-DGIKKIVL----DNGEEFYAKSLIIATGAAS---RKLDVKGEAELQGMGVSYCATCDGAFFRGKTVAVVGGGDVAVEDAIFLA--RICKEVHVIHRRDEFRAAKTFITKLLSLENVTVHWNSVVDEIVGTDAVN-AVKVRNVATEETSELNVDGVFIAVGNVP---NSEVYTPAVAVDRGGYIIADESCETNVPGIFAAGD 278
>gi|167212668|ref|ZP_02282975.1| hypothetical protein LmonL_17635 [Listeria monocytogenes LO28] (333 aa)
Score = 246, Expect = 3.2e-19, Identities = 76/298 (25%), Positives = 154/298 (51%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF-IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTL---TIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKY--VIDLNQKTNIKNIYAIGDATHFYCKPNTIITA 304
           +YDV I+GGG  G+F++  S   ++ + +I+ +  +GG+    +P K I D      I   +++  L QQ  E  +  I     ++++T   + +    L   N +  ++K I++A+G+G+F   KLE  +   D PF IHY +    E +++K ++V GGG+SA++WA     E I   V +I+R  ++++    +  L  + +   +++EI +   +N  L   T+   +T+  +T+  + + + +G     +++  + +   ++  +  V+D   KT +  I+A GD+     +   II A
  S:     5 VYDVTIIGGGPIGLFSAFYSGLRSMKTKIIDAEPAVGGKVRYFFPEKIIRDIGGIPAITGENLVANLKQQ-AETFHPTIVCSERVVDVT--KLADGTFQLTSHNGSIHFSKTIVIATGSGTFEVNKLEALHAE-DFPFAIHYDVK-NIEQFRDKVVVVSGGGNSAIDWAQTL--EPIAKKVHLIYRGEDFKAHEESVRELKNSRVEIHIHHEISELIGTNNQLTEITVCCNQTQTTKTIETEALFINHG---VKVDLGTMAEWGFKQADFGIVVDDEMKTTVPGIFACGDSATLPLEKIRIIAA 298
>gi|153183446|ref|ZP_01934306.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes J0161] >gi|126943737|gb|EBA21454.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes J0161] (335 aa)
Score = 246, Expect = 3.6e-19, Identities = 73/288 (25%), Positives = 151/288 (52%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF-IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTL---TIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKY--VIDLNQKTNIKNIYAIGDATHF 294
           +YDV I+GGG  G+F++  S   ++ + +I+ +  +GG+    +P K I D      I   +++  L QQ  E  +  I     ++++T   + +    L   N +  ++K I++A+G+G+F   KLE  +   D PF IHY +    E +++K ++V GGG+SA++WA     E I   V +I+R  ++++    +  L  + +   +++EI +   +N  L   T+   +T+  +T+  + + + +G     +++  + +   ++  +  V+D   KT +  I+A GD+  +
  S:     8 VYDVTIIGGGPIGLFSAFYSGLRSMKTKIIDAEPAVGGKVRYFFPEKIIRDIGGIPAITGENLVANLKQQ-AETFHPTIVCSERVVDVT--KLADGTFQLTSHNGSIHFSKTIVIATGSGTFEVNKLEALHAE-DFPFAIHYDVK-NIEQFRDKVVVVSGGGNSAIDWAQTL--EPIAKQVHLIYRGEDFKAHEESVRELKNSRVEIHIHHEISELIGTNNQLTEITVCCNQTQTTKTIETEALFINHG---VKVDLGTMAEWGFKQADFGIVVDDEMKTTVPGIFACGDSATY 291
>gi|47096605|ref|ZP_00234193.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes str. 1/2a F6854] >gi|153175188|ref|ZP_01930583.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes FSL N3-165] >gi|153191457|ref|ZP_01938677.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes J2818] >gi|47014990|gb|EAL05935.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes str. 1/2a F6854] >gi|127765236|gb|EBA25586.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes J2818] >gi|133729641|gb|EBA31339.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes FSL N3-165] (332 aa)
Score = 246, Expect = 3.6e-19, Identities = 73/288 (25%), Positives = 151/288 (52%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF-IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTL---TIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKY--VIDLNQKTNIKNIYAIGDATHF 294
           +YDV I+GGG  G+F++  S   ++ + +I+ +  +GG+    +P K I D      I   +++  L QQ  E  +  I     ++++T   + +    L   N +  ++K I++A+G+G+F   KLE  +   D PF IHY +    E +++K ++V GGG+SA++WA     E I   V +I+R  ++++    +  L  + +   +++EI +   +N  L   T+   +T+  +T+  + + + +G     +++  + +   ++  +  V+D   KT +  I+A GD+  +
  S:     5 VYDVTIIGGGPIGLFSAFYSGLRSMKTKIIDAEPAVGGKVRYFFPEKIIRDIGGIPAITGENLVANLKQQ-AETFHPTIVCSERVVDVT--KLADGTFQLTSHNGSIHFSKTIVIATGSGTFEVNKLEALHAE-DFPFAIHYDVK-NIEQFRDKVVVVSGGGNSAIDWAQTL--EPIAKQVHLIYRGEDFKAHEESVRELKNSRVEIHIHHEISELIGTNNQLTEITVCCNQTQTTKTIETEALFINHG---VKVDLGTMAEWGFKQADFGIVVDDEMKTTVPGIFACGDSATY 288
>gi|16804000|ref|NP_465485.1| hypothetical protein lmo1961 [Listeria monocytogenes EGD-e] >gi|16411414|emb|CAD00039.1| lmo1961 [Listeria monocytogenes] (332 aa)
Score = 246, Expect = 3.7e-19, Identities = 73/288 (25%), Positives = 151/288 (52%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF-IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTL---TIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKY--VIDLNQKTNIKNIYAIGDATHF 294
           +YDV I+GGG  G+F++  S   ++ + +I+ +  +GG+    +P K I D      I   +++  L QQ  E  +  I     ++++T   + +    L   N +  ++K I++A+G+G+F   KLE  +   D PF IHY +    E +++K ++V GGG+SA++WA     E I   V +I+R  ++++    +  L  + +   +++EI +   +N  L   T+   +T+  +T+  + + + +G     +++  + +   ++  +  V+D   KT +  I+A GD+  +
  S:     5 VYDVTIIGGGPIGLFSAFYSGLRSMKTKIIDAEPAVGGKVRYFFPEKIIRDIGGIPAITGENLVANLKQQ-AETFHPTIVCSERVVDVT--KLADGTFQLTSHNGSIHFSKTIVIATGSGTFEVNKLEALHAE-DFPFAIHYDVK-NIEQFRDKVVVVSGGGNSAIDWAQTL--EPIAKKVHLIYRGEDFKAHEESVRELKNSRVEIHIHHEISELIGTNNQLTEITVCCNQTQTTKTIETEALFINHG---VKVDLGTMAEWGFKQADFGIVVDDEMKTTVPGIFACGDSATY 288
>gi|56961876|ref|YP_173598.1| thioredoxin reductase [Bacillus clausii KSM-K16] >gi|56908110|dbj|BAD62637.1| thioredoxin reductase [Bacillus clausii KSM-K16] (354 aa)
Score = 244, Expect = 6.0e-19, Identities = 81/310 (26%), Positives = 156/310 (50%)
  Q:     3 EDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFN---ESNKTLTIKHKETEKEQTLPFDYVLVQYG-QISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           ++  ++D+ I+GGG  G++++  +   +L   L+E    LGG+ +  YP K I+D           +I +L++Q     N  I L+  I+ +  +  N   LF       + Y + ++LASG+G    +KLEI   +  +   +HY++  + +I+ NK++L+ GGG++AV+WAN      I+  V + HRR+E+      ++ +     +    Y+I + +    + + +T+ H +T +++ +  D V+V +G ++     IE    + +E G   +    +T+   I+A GD T    K   I  A  E   A+
  S:     8 QEKEMFDLTIIGGGPAGLYSTFYAGMRDLKVKLVEYNKELGGKIL-FYPEKIIWDVGGMPPTTGRTLINQLVEQ-ATTFNPTICLNEHIVRMVREPDNTYTLF--NEQGKAHYTRAVMLASGHGIPVMQKLEIEGADRYEVSNLHYTVT-QMDIFANKRVLISGGGNAAVDWANELA--NISKEVVVCHRRDEFGGHEKNVEQMKSVTKIHT-PYQIKELHGVGSAIEAVTLAHCDTGEQRQIEVDAVIVNHGMKLDGCFLIEAGLAL-EEDGFLRVSACMETSQPGIFAAGDVTRHEGKLQLISGAFVEGATAV 313
>gi|187928074|ref|YP_001898561.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia pickettii 12J] >gi|187724964|gb|ACD26129.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia pickettii 12J] (359 aa)
Score = 242, Expect = 9.1e-19, Identities = 72/304 (23%), Positives = 148/304 (48%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS---FYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEI-----IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           DV +VG G  G+FA+  +    ++ +L++     GGQ  ELYP K IYD P      + +++ +L+ Q       N  +       T +T+  +    F    ++   F    +++ +GNG+F P+++ +     ++   +HY++  +T  +  K++++ GGGDSA++WA      K+   V ++HRR  +R++   +  +    +  ++++ +     +D       +    +  + E  LP D ++  YG +S P  I  +N  +    G+  ++    +T+   ++A GD   +  K   I++   E   AL
  S:    20 DVLVVGAGPVGLFAAFQAGVLGMSCVLVDALDRPGGQCTELYPEKPIYDIPALVSCTAQELVDRLMAQCAP---FNYPILCGRRAETVETLENEHGRRFRVTTSAGDVFDCAAVLITAGNGAFTPQRVALPEAAALEGRHLHYAVR-DTARFTGKRVVIAGGGDSALDWA--LALRKVAARVTLVHRREGFRAADASVAEMRAAVVAGEMDFVLGMLSRLDSTPDGTLIGAAIRGRDGETVLPCDELIALYGLVSEPGPI--VNWGVEMRAGRITVETTAYETSRPGVFAAGDIALYPNKQKLILSGFHEVAMAL 326
>gi|167935251|ref|ZP_02522326.1| Thioredoxin reductase [Bacillus cereus AH1134] >gi|168138501|ref|ZP_02581730.1| Thioredoxin reductase [Bacillus cereus B4264] (349 aa)
Score = 241, Expect = 1.2e-18, Identities = 87/312 (27%), Positives = 161/312 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEII-----DFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVID-------LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           MN +  ++DV ++GGG  G++++  S    + + +IE + +LGG+ + +YP K I+D      +    +I++L+QQ    K   + LDT + +I     N+   F  +T+     ++K +I+A+G+G   P+KL I   E  +   ++Y++    + +K K +++ GGG+SAV+WAN    E I   V + +R+ E       +  L  ++     N  I      D +E+ + + + + ET +   LP D V++ +G      +I LL   N E    +ID        N ++++  +YA GD      K + I  A  +A  A+
  S:     1 MNRE-ELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPHLGGK-IHVYPEKMIWDVGGLLPVTGDKLIEQLVQQGLTFK-PEVVLDTKVESIIR---NQDGTFTLKTSTGEEHFSKTVIVATGSGILKPQKLSIEGAERFEVSNLNYTVK-SLKRFKGKTVIISGGGNSAVDWANEL--EPIAKKVYVTYRKEELSGHEAQVKQLMNSSAECFFNTSITKLIAGDNHEAIEYVELTNHETGEVSHLPIDEVIINHGYER---DITLLE--NSELDVAIIDNYYIAGNANSESSVDGLYAAGDILKHEGKLHLIAGAFQDAGNAV 312
>gi|30018593|ref|NP_830224.1| thioredoxin reductase [Bacillus cereus ATCC 14579] >gi|29894134|gb|AAP07425.1| Thioredoxin reductase [Bacillus cereus ATCC 14579] (349 aa)
Score = 241, Expect = 1.2e-18, Identities = 87/312 (27%), Positives = 160/312 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEII-----DFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVID-------LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           MN +  ++DV ++GGG  G++++  S    + + +IE   +LGG+ + +YP K I+D      +    +I++L+QQ    K   + LDT + +I     N+   F  +T+     ++K +I+A+G+G   P+KL I   E  +   ++Y++    + +K K +++ GGG+SAV+WAN    E I   V + +R+ E       +  L  ++     N  I      D +E+ + + + + ET +   LP D V++ +G      +I LL   N E    +ID        N ++++  +YA GD      K + I  A  +A  A+
  S:     1 MNRE-ELFDVTVIGGGPAGLYSAFYSGLREMRTKIIEFHPHLGGK-IHVYPEKMIWDVGGLLPVTGDKLIEQLVQQGLTFK-PEVVLDTKVESIIR---NQDGTFTLKTSTGEEHFSKTVIVATGSGILKPQKLSIEGAERFEVSNLNYTVK-SLKRFKGKTVIISGGGNSAVDWANEL--EPIAKKVYVTYRKEELSGHEAQVKQLMNSSAECFFNTSITKLIAGDNHEAIEYVELTNHETGEVSHLPIDEVIINHGYER---DITLLE--NSELDVAIIDNYYIAGNANSESSVDGLYAAGDILKHEGKLHLIAGAFQDAGNAV 312
>gi|113867219|ref|YP_725708.1| thioredoxin reductase [Ralstonia eutropha H16] >gi|113525995|emb|CAJ92340.1| thioredoxin reductase [Ralstonia eutropha H16] (361 aa)
Score = 240, Expect = 1.8e-18, Identities = 77/304 (25%), Positives = 152/304 (50%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKE--------QKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEI-----IDFNESNKTLT-IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           DV IVG G  G+FA+  +    L   LI+     GGQ  ELYP K IYD P      + D++ +L++Q           Q+  ++              +E+ L   +  K  F    +++ +G G+F P+++ +   P ++   +HY++  +   +  K+++V GGGDSA++WA      K+   V ++HRR  +R++   +  + +     ++++ +     +     +  LT ++ +  +    LP D ++  YG +S P  I   + ++   G+ ++D    +++ + I+A GD  ++  K   I++   EA  AL
  S:    16 DVLIVGAGPVGLFAAFQAGVLGLRCELIDVLDRAGGQCTELYPEKPIYDIPAVPGCLAQDLVDRLLEQCAPFAFPMHFGQRAESLSEIPRQPAPDGHAAHERLLVTTDGGKR-FDVSAVLICAGAGAFAPQRVSLPEAPALEGRHVHYAVR-DVSRFAGKRVVVAGGGDSALDWA--LALRKVAARVTLLHRREGFRAADGTVAEMREAVAAGEMDFVVGMLGALRTEGQDGPLTEVEVRTRDGSTVLPADELVALYGLVSEPGPIAQWD-MDMRAGRILVDTTTYESSRRGIFAAGDIAYYTNKQKLILSGFHEAALAL 330
>gi|21666491|gb|AAM73724.1|AF395874_1 thioredoxin reductase [Streptococcus mutans] (256 aa)
Score = 240, Expect = 1.9e-18, Identities = 62/212 (29%), Positives = 119/212 (56%)
  Q:   101 EQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           E ++F   TNK + ++K II+A GNG+F PR+L +++E   +    +    + + +  KK+++ GGGDSAV+WAN    +KI  +V ++HRR+ +R+    ++ L  +++     Y   E+    +   +L I+  ++E+ + L  D ++V +G  +S  N++  N I+ ++    +    +T+   ++AIGDA  +  K + I T   EA  A+
  S:    22 ENDIFTITTNKGNHFSKAIIIACGNGAFAPRRLGLDDEERYADHNLFYNVHKLDKFAGKKVVICGGGDSAVDWANAL--DKIAESVTLVHRRDAFRAHEHSVEVLKASHVNIMTPYVPLELKGEGDEATSLVIQKVKSEETKELSLDSLIVSFGFSTSNKNLKSWN-IDYKRSSINVSPLFETSQTGVFAIGDAAEYEGKIDLIATGFGEAPTAV 233
>gi|52144896|ref|YP_081933.1| thioredoxin reductase [Bacillus cereus E33L] >gi|51978365|gb|AAU19915.1| probable thioredoxin reductase [Bacillus cereus E33L] (349 aa)
Score = 239, Expect = 2.4e-18, Identities = 90/312 (28%), Positives = 162/312 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFET-NKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMI--------DCLSKNNILQKL---NYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVID-------LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           MN +  ++DV ++GGG  G++++  S    + + +IE +  LGG+ + +YP K I+D      +    +I++L+QQ    K   + LDT + +I     NE   F  +T N    ++K +I+A+G+G   P+KL I   E  +   ++Y++    + +K+K +++ GGG+SAV+WAN    E I   V + +R+ E       +        DC    +I + +   N+E I++ E      + + ET +   L  D V++ +G      +I LL   N E    +ID        N ++++  +YA GD      K + I  A  +A  A+
  S:     1 MNRE-ELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPQLGGK-IHVYPEKMIWDVGGLLPVTGDKLIEQLVQQGLTFK-PEVVLDTKVESIIR---NEDGTFTLKTSNGAEHFSKTVIVATGSGILKPQKLSIEGAERFEVSNLNYTVK-SLKRFKDKTVIISGGGNSAVDWANEL--EPIAKKVYVTYRKEELSGHEAQVKQLLNSSADCFFNTSITKLIAGDNHEAIEYVE------LTNHETGEVSHLSIDEVIINHGYER---DITLLE--NSELDVAIIDNYYIAGNANSESSVDGLYAAGDILKHEGKLHLIAGAFQDAGNAV 312
>gi|188584777|ref|YP_001916322.1| thioredoxin reductase (NADPH) [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349464|gb|ACB83734.1| thioredoxin reductase (NADPH) [Natranaerobius thermophilus JW/NM-WN-LF] (309 aa)
Score = 239, Expect = 2.5e-18, Identities = 85/311 (27%), Positives = 154/311 (49%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFM----IDCLSKNNILQKLNYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           IYDVAI+G G GG+ A+  +    L  ++IE+ +  GGQ   L   + + +FP F +  +   + + +++   +  + +++   I     +T       + +T    + AK +I+A+G    +P +L    E  +    + Y    +   +KNK + V+GGGDSAVE A Y    ++ + V +IHRR++ R+  ++    IDC    N+  K N  + +     K  +L ++   T+  +TL    + V  G  + P    L NQ++ E G  V     +TN+K ++A+GD      +   I+TA ++   A +H  K
  S:    10 IYDVAIIGSGPGGLTAAIYATRAGLKVLMIERMA-PGGQ---LLNTEEVDNFPGFPDGTTGVELAQKLEKQARRFGTELKMGEVI-----ETNLSGSEKMIKTRDEVYKAKSVIIATGE---SPTELSAPGEQNLKGRGVSYCAICDGAFFKNKNVAVVGGGDSAVESALYL--SRLASQVTLIHRRDQLRAVEYLKKRAIDC---ENLEIKYNTVVKEIQGEQKVESLLVEDVNTQARETLNCQGIFVYVG--AHPNTDFLSNQLDLEDGYLVTSETMETNLKGVFAVGDVRKKELR--QIVTAVSDGAIAAFHAEK 306
>gi|182679301|ref|YP_001833447.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Beijerinckia indica subsp. indica ATCC 9039] >gi|182635184|gb|ACB95958.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Beijerinckia indica subsp. indica ATCC 9039] (344 aa)
Score = 238, Expect = 2.9e-18, Identities = 82/305 (26%), Positives = 152/305 (49%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLT---IKHKETEK----EQTLPFDYVLVQYGQISS-PINI-ELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           + DV IVG G  G+FA       ++ S LI+  +  GGQ  ELYP K IYD P +  +   +++  L+ Q  E  +        +  +      E   F   T+    F +K +I+A+G GSF P+K  I   E  +   + Y++  + E +++K ++++GGGDSA++W        I   + ++HRR+++R++   ++ + +      ++    +I+        L+   +K  + E     E+ +PF  + ++ G I+   +N+ E L  ++ EK         +TN+  I+AIGD   +  K   I++   E   A
  S:     6 VTDVVIVGAGPAGLFAVFELGLLDIKSHLIDILAKPGGQCAELYPEKPIYDIPGYPRVNGQELVDNLLAQ-IEPFHPTFHFGEMVERLEVLGTPEAPSFRVHTSGGEIFESKVVIVAAGGGSFQPKKPPIEGIEAFERKSVFYAVR-KMEDFRDKHVVIVGGGDSALDWTLNL--HPIAKRITLVHRRDDFRAAPHSVNSMRELVAAGHMDLRLGQIVSLRGEAGELSAVVLKGSDGEAEIACERLVPFFGLTMKLGPIADWGLNLHENLIPVDTEKF--------ETNVSGIFAIGDINTYPGKLKLILSGFHEGALA 312
>gi|75763804|ref|ZP_00743462.1| Thioredoxin reductase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74488708|gb|EAO52266.1| Thioredoxin reductase [Bacillus thuringiensis serovar israelensis ATCC 35646] (352 aa)
Score = 238, Expect = 3.1e-18, Identities = 87/312 (27%), Positives = 161/312 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFE-TNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEII-----DFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVID-------LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           MN++  ++DV ++GGG  G++++  S    + + +IE +  LGG+ + +YP K I+D      +    +I++L+QQ    K   + L+T + +I     NE   F  + +N    ++K +I+A+G+G   P+KL I   E  +   ++Y++    + +K K +++ GGG+SAV+WAN    E I   V + +R+ E       +  L  ++     N  I      D +E+ + + + + ET +   LP D V++ +G      +I LL   N E    +ID        N ++++  +YA GD      K + I  A  +A  A+
  S:     4 MNQE-ELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPQLGGK-IHVYPEKMIWDVGGLLPVTGDKLIEQLVQQGLTFK-PEVVLNTKVESIIR---NEDGTFTLKASNGEEHFSKTVIVATGSGILKPQKLSIEGAERFEVSNLNYTVK-SLKRFKGKTVIISGGGNSAVDWANEL--EPIAKKVYVTYRKEELSGHEAQVKQLLNSSAECFFNTSITKLIAGDNHEAIEYVELTNHETGEVSHLPIDEVIINHGYER---DITLLE--NSELDVAIIDNYYIAGNANSESSVDGLYAAGDILKHEGKLHLIAGAFQDAGNAV 315
>gi|13470952|ref|NP_102521.1| thioredoxin reductase [Mesorhizobium loti MAFF303099] >gi|14021695|dbj|BAB48307.1| thioredoxin reductase [Mesorhizobium loti MAFF303099] (343 aa)
Score = 238, Expect = 3.1e-18, Identities = 85/299 (28%), Positives = 155/299 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTL---TIKHK-----ETEKEQTLPFDYVLVQYGQISS-PINI-ELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE 307
           DV IVG G  G+FA      F++   LI+     GGQ  ELYP K IYD P +  I +  ++ KL++Q    K        + +  + + + E   F   T++N  F AK +++A+G GSF P++  I   EP +   + YS+    E ++   ++++GGGDSA++W      + +  +V ++HRR E+R++   ++ +     +++L +   ++     ++  L   TIK       E    + LPF  + ++ G I+   +N+ E L  ++ EK         +T++  I+A+GD   +  K   I++   E
  S:     8 DVLIVGAGPVGLFAVFELGLFDMKCHLIDILDKPGGQCAELYPEKPIYDIPGWPSISAQGLVDKLLEQIHPFKPD---FTYNRMVSSLEKL-EDGSFRVTTDENEVFEAKVVVIAAGGGSFQPKRPPIPGIEPYEGKSVFYSVR-RMEDFRGHDLVIVGGGDSALDWTLNL--QPVAKSVTLVHRRPEFRAAPDSVNKMYAMQEMKQLEFRVGQVTGLTGADGQLSSATIKGGPDGDIEVPCTRMLPFFGLTMKLGPIAEWGLNLHENLIPVDTEKF--------QTSVPGIFAVGDINSYPGKLKLILSGFHE 306
>gi|134291589|ref|YP_001115358.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia vietnamiensis G4] >gi|134134778|gb|ABO59103.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia vietnamiensis G4] (351 aa)
Score = 238, Expect = 3.2e-18, Identities = 83/304 (27%), Positives = 158/304 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTL----TIKHKETEKEQTLPFDYVLVQYGQISS--PINIELLN-QINKEKGKYVIDLN-QKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           DV IVG G  G+FA+  +    L+  +++     GGQ +ELYP+K IYD P      + D++ +L++Q +   N  + L   I  +      E   +L  T+K ++F A  I++A+GNG+F P++L ++    ++  ++HY ++ +        ++V GGGDSA++WA       +  +V ++HRR+ + ++   +  L +     ++++ +      N  +    +I+ ++      L  D +LV YG ++   PI    +N  I  + G+ V+D +  +++   I+A GD   +  K   I+    EA  AL
  S:    16 DVLIVGAGPVGLFAAFEAGVIGLSCQIVDGIERPGGQCIELYPDKPIYDIPAVPSCTARDLVDRLVEQCRP-FNPPMHLGQRIERLDPL---EGGRWLARTDKGHTFDAAAILIAAGNGAFVPQRLALDEAARLEGRYVHYRVS-DMNGLAGTNVVVAGGGDSALDWA--LALRSVARHVTLVHRRSGFSATDSSVARLRQAVAAGEMDFVVGTIARLNSPVGPLESIEVRQIGGSVCLDADQLLVLYGLVADLGPI----VNWGIAIQAGRIVVDTSYYESSRPGIFAAGDIACYPNKQKLILCGFHEASLAL 318
>gi|116873403|ref|YP_850184.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742281|emb|CAK21405.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (332 aa)
Score = 237, Expect = 3.4e-18, Identities = 70/288 (24%), Positives = 151/288 (52%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLE---INNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTL---TIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKY--VIDLNQKTNIKNIYAIGDATHF 294
           +YDV I+GGG  G+F++  S   ++ + +I+ +  +GG+    +P K I D      I   +++  L +Q  E  +  I  +  ++++T   + +    L   N +  ++K I++A+G+G+F   KLE   + + P+    IHY +    E +++K + V GGG+SA++WA     E I   V +I+R  ++++    +  L  + +   +++EI +   +N  L   ++   +T+  +T+  + + + +G     +++  + +   E+  +  V+D   KT +  I+A GD+  +
  S:     5 VYDVTIIGGGPIGLFSAFYSGLRSMKTKIIDAEPAVGGKVRYFFPEKIIRDIGGIPAITGENLVANLKEQ-AETFHPTIVCNERVVDVT--RLTDGTFQLITHNGSIHFSKTIVIATGSGTFEVNKLEALHVEDFPLA---IHYDVK-NIEQFRDKVVAVSGGGNSAIDWAQTL--EPIAKQVHLIYRGEDFKAHEESVRELKNSRVKIHIHHEIHELFGTNNQLAEISVICNQTQATKTIETEALFINHG---VKVDLGTMAEWGFEQADFGIVVDDEMKTTVPGIFACGDSATY 288
>gi|153886647|ref|ZP_02007801.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia pickettii 12D] >gi|151576821|gb|EDN41223.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia pickettii 12D] (359 aa)
Score = 237, Expect = 3.6e-18, Identities = 73/304 (24%), Positives = 146/304 (48%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS---FYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEI-----IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           DV +VG G  G+FA+  +    L+ +L++     GGQ  ELYP K IYD P      + +++ +L+ Q       N  +       T +T+  +    F    ++   F    +++ +GNG+F P+++ +     ++   +HY++  +T  +  K++++ GGGDSA++WA      K+   V ++HRR  +R++   +  +       ++++ +     +D            +  + E  LP D ++  YG +S P  I  +N  +    G+  ++    +T+   ++A GD   +  K   I++   E   AL
  S:    20 DVLVVGAGPVGLFAAFQAGVLGLSCVLVDALDRPGGQCTELYPEKPIYDIPALVSCTAQELVDRLMAQCAP---FNYPILCGRRAETVETLESEHGRRFRVTTSAGDVFDCAAVLITAGNGAFTPQRVALPEAAALEGRHLHYAVR-DTARFAGKRVVIAGGGDSALDWA--LALRKVAARVTLVHRREGFRAADASVAEMRAAVAAGEMDFVLGMLSRLDSTPDGTLTGAAIRGRDGETVLPCDELIALYGLVSEPGPI--VNWGVEMRAGRITVETTAYETSRPGVFAAGDIALYPNKQKLILSGFHEVAMAL 326
>gi|41615274|ref|NP_963772.1| hypothetical protein NEQ491 [Nanoarchaeum equitans Kin4-M] >gi|40068998|gb|AAR39333.1| NEQ491 [Nanoarchaeum equitans Kin4-M] (313 aa)
Score = 237, Expect = 4.0e-18, Identities = 91/304 (29%), Positives = 154/304 (50%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNILQKLNYEIIDFNESNKTLTIKHKETE-KEQTLPFDYVLVQYGQISSPINIELLNQIN---KEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           +DV I+GGG  G+ A   S  + L ++LI      GG   E     FI ++P F  I   D+ ++L +Q   +KN    L   + +I      ++   +         AK IILA+G+     RKL +  E +  P + Y    +  ++K K + V+GGG++A  + +  V     N V +IHRR+++R+ S++++    K+NI   LN  + +    NK  +I  ++ E   + L  D V V  G  +   NIEL  ++     E+GK ++D  Q+TNI+ +YA G+ T+  C  + I+T+ A+   A
  S:    16 WDVIIIGGGPAGVVAGLYSARYGLKTLLISPDK--GGMLTEA---SFIENYPGFISISGPDLAERLFEQ--YEKNGGHYLKDKVSDIK----KDKNFIVITEGGYELEAKAIILATGS---RRRKLNVKGENL--PGVSYCAECDAPLFKGKTVAVVGGGNTA--FHDALVLSNYANKVYLIHRRDQFRAESYLVENAKKKDNIEFILNSVVKEIRGQNKVESIIVQDKEGNTKELKVDGVFVAIGMET---NIELAKKLGVQLDERGKIIVDRCQRTNIQYVYAAGNITNNCCDLDQIVTSMAQGAIA 303
>gi|168142766|ref|ZP_02585995.1| Thioredoxin reductase [Bacillus cereus G9842] (349 aa)
Score = 237, Expect = 4.1e-18, Identities = 87/312 (27%), Positives = 161/312 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFE-TNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEII-----DFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVID-------LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           MN++  ++DV ++GGG  G++++  S    + + +IE +  LGG+ + +YP K I+D      +    +I++L+QQ    K   + L+T + +I     NE   F  + +N    ++K +I+A+G+G   P+KL I   E  +   ++Y++    + +K K +++ GGG+SAV+WAN    E I   V + +R+ E       +  L  ++     N  I      D +E+ + + + + ET +   LP D V++ +G      +I LL   N E    +ID        N ++++  +YA GD      K + I  A  +A  A+
  S:     1 MNQE-ELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPQLGGK-IHVYPEKMIWDVGGLLPVTGDKLIEQLVQQGLTFK-PEVVLNTKVESIIR---NEDGTFTLKASNGEEHFSKTVIVATGSGILKPQKLSIEGAERFEVSNLNYTVK-SLKRFKGKTVIISGGGNSAVDWANEL--EPIAKKVYVTYRKEELSGHEAQVKQLLNSSAECFFNTSITKLIAGDNHEAIEYVELTNHETGEVSHLPIDEVIINHGYER---DITLLE--NSELDVAIIDNYYIAGNANSESSVDGLYAAGDILKHEGKLHLIAGAFQDAGNAV 312
>gi|126650770|ref|ZP_01722986.1| probable thioredoxin reductase [Bacillus sp. B14905] >gi|126592435|gb|EAZ86453.1| probable thioredoxin reductase [Bacillus sp. B14905] (364 aa)
Score = 236, Expect = 4.3e-18, Identities = 88/306 (28%), Positives = 149/306 (48%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDIL-NITWQTINEQE-LFLFET-NKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVE-EKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIK-----HKETEKEQTLPFDYVLVQYG-QISSPINIELLNQINKEKGKYVIDLNQKTNIK-NIYAIGDATHFYCKPNTIITACAEAVRAL 312
           +YDV I+GGG  G++++  S    L + LIE +S LGG+ + LYP K I+D      I     +K+LIQQ K         D  IL N     I  QE LF+  T      Y+K ++LA G G  NP+KL +   E  +   +HY++    + + N+ IL+ GGG++A++WA   VE   I  +V +++R+    +    +       +L + N  I     ++    I+     + +T++  T   D V++ +G    + +  +    I K+   Y         ++  I+A GD   F  K N ++    +A  A+
  S:    19 VYDVTIIGGGPAGLYSAFYSGLRGLKTKLIESQSQLGGKVL-LYPEKLIWDIGGHPPILGEKFVKQLIQQAK-------TFDPTILTNTKVDFIERQENLFIVHTATGERHYSKTVLLAVGGGIINPQKLTLEGAEKYEMSNLHYTVQ-SYKRFVNRDILISGGGNAAIDWA---VELSPIAKSVTVVYRKETLSAHEATVKEALDAGVLIECNTTITKLLANDDKTAIQLVRCENSKTKESYTRQIDEVIISHGYNCEASLTFDEAISIPKKDDYYFEGKATGETVQPGIFAAGDILSFEGKINLLLGTFQDAANAV 324
>gi|39937015|ref|NP_949291.1| thioredoxin reductase [Rhodopseudomonas palustris CGA009] >gi|192292841|ref|YP_001993446.1| Thioredoxin-disulfide reductase [Rhodopseudomonas palustris TIE-1] >gi|39650872|emb|CAE29395.1| thioredoxin reductase [Rhodopseudomonas palustris CGA009] >gi|192286590|gb|ACF02971.1| Thioredoxin-disulfide reductase [Rhodopseudomonas palustris TIE-1] (342 aa)
Score = 236, Expect = 4.9e-18, Identities = 87/320 (27%), Positives = 163/320 (50%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNE---SNKTL---TIKHKETEKEQ-----TLPFDYVLVQYGQISS-PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE----AVRALWHISKNKK 320
           M E ++  DV IVG G  G+FA       ++ + L++    +GGQ  ELYP K IYD P    +    + + L++Q K   N    L   + N+  + I +    +       F    +++A+G GSF P++  +   E  +   +HY++  + E ++ K IL++GGGDSA++W        I  ++ ++HRR+++R +   ++ + +     KL+ +I    E    N  L   T+K  +    Q      LPF  + ++ G +++  +++E  N I  + G +      +TN+  I+AIGD   +  K   I++   E    A +A+ ++  +K+
  S:     1 MTETIKT-DVLIVGAGPCGLFAVFELGLLDVKAHLVDILDKVGGQCAELYPEKPIYDIPGIPMVTGHGLTEALMEQIKP-FNPTFHLSEMVENV--EKIGDPGFRVTTNAGKVFECTVLVVAAGGGSFLPKRPPVPGVEAYEGTSVHYAVR-KMEDFRGKDILIVGGGDSALDWTLNL--NPIAKSMTLVHRRDDFRGAPHSVEQMRQLVASGKLDLKIGQITELQGDNGQLTGATVKLNDNTTSQIKCDAMLPFFGLTMKLGPVANWGLDLE-NNLIPVDTGTF------ETNVPGIFAIGDINTYPGKLKLILSGFHEGALMAQKAVKYVYPDKR 323
>gi|169827855|ref|YP_001698013.1| thioredoxin reductase [Lysinibacillus sphaericus C3-41] >gi|168992343|gb|ACA39883.1| Thioredoxin reductase [Lysinibacillus sphaericus C3-41] (349 aa)
Score = 235, Expect = 6.0e-18, Identities = 88/306 (28%), Positives = 150/306 (49%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDIL-NITWQTINEQE-LFLFET-NKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVE-EKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIK-----HKETEKEQTLPFDYVLVQYG-QISSPINIELLNQINKEKGKYVI-DLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           +YDV I+GGG  G++++  S    L + LIE +S LGG+ + LYP K I+D      I     +K+LIQQ K         D  IL N     I  QE LF+  T      Y+K ++LA G G  NP+KL +   E  +   +HY++    + + N+ IL+ GGG++A++WA   VE   +  +V +++R++   +    +       +L + N  I     ++    I+     + +T++  T   D V++ +G    + +  +    I K+   Y       +T    I+A GD   F  K N ++    +A  A+
  S:     4 VYDVTIIGGGPAGLYSAFYSGLRGLKTKLIESQSQLGGKVL-LYPEKLIWDIGGQPPILGEKFVKQLIQQAK-------TFDPTILTNTKVDFIERQEHLFIVHTATGERHYSKTVLLAVGGGIINPQKLTLEGAEKYEMSNLHYTVQ-SYKRFVNRDILISGGGNAAIDWA---VELSPLAKSVTVVYRKDTLSAHEATVKEAIDAGVLIECNTTITKLLANDDKTAIQLVRCENSKTKESYTRQIDEVIISHGYNCEASLTFDEAISIPKKDDYYFEGKATGETAQPGIFAAGDILSFEGKINLLLGTFQDAANAV 309
>gi|166995172|ref|ZP_02261632.1| thioredoxin reductase [Bacillus cereus AH820] (349 aa)
Score = 233, Expect = 1.1e-17, Identities = 86/312 (27%), Positives = 162/312 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEII-----DFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVID-------LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           MN +  ++DV ++GGG  G++++  S    + + +IE +  LGG+ + +YP K I+D      +    +I++L+QQ    +   + L+T I +I     N+  +F  +T+     ++K +I+A+G+G  NP+KL I   E  +   ++Y++    + +KNK +++ GGG+SA++WAN    E I   V + +R+ E       +  L  ++     N  I      D +E+ + + + + ET +   L  D V++ +G      +I LL   N E    +ID        N ++++  +YA GD      K + I  A  +A  A+
  S:     1 MNRE-ELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPQLGGK-IHVYPEKMIWDIGGLLPVTGEKLIEQLVQQGLTFQ-PEVVLNTKIESIIR---NKDGIFTLKTSTGEEHFSKTVIVATGSGILNPQKLSIEGAERFEVSNLNYTVK-SLKRFKNKTVIISGGGNSAIDWANEL--EPIAKKVYLTYRKEELSGHEAQVKQLMNSSAECFFNTSITTLIAGDNHEAIEYVELTNHETGEVSQLAIDEVIINHGYER---DITLLE--NSELDVAIIDNYYIAGNANSESSVDGLYAAGDILKHEGKLHLIAGAFQDAGNAV 312
>gi|15678735|ref|NP_275851.1| thioredoxin reductase [Methanothermobacter thermautotrophicus str. Delta H] >gi|2621795|gb|AAB85213.1| thioredoxin reductase [Methanothermobacter thermautotrophicus str. Delta H] (303 aa)
Score = 233, Expect = 1.2e-17, Identities = 87/304 (28%), Positives = 160/304 (52%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEI--IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ------INKEKGKYVI-DLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           YD+ ++G G  G+ A  I      +S+L+  K   GG  +E+     + ++P F  I    ++ K+    K+Q  +  +L  ++  +  + I + ++F  +T+++++ A  II A+G+     R+L +  E  +    + Y    +  +YK +K+L++GGG+SA + A +   + I  +V+I+HRR+E R+  ++ D L +  I    N  +  I  +E  + + I ++ T +++TL  D V +  G+       E LNQ      +  +KG Y+I D  Q+TN+  +YA GD T      N  +TACAE   A
  S:     5 YDMIVIGAGPAGLTAG-IYGGRQGSSVLMLDKGPAGGLGLEV---PMMENYPGFEMIAGMSLVTKM----KKQATAVAEL-REMEEV--KEIEKGDVFTVKTSRDTYTASAIIFATGS---KHRQLGVPGENDLLGRGVCYCATCDGPLYKGRKVLMVGGGNSAAQEAVFL--KNIGCDVSIVHRRDELRADKYLQDKLREMEIPVIWNSVVKEIGGDERVEEVIIHNRVTGRDETLKVDGVFIAIGE-------EPLNQLAVDLGVEVDKGGYIITDKFQRTNVPLVYAAGDITGGL---NQWVTACAEGAIA 292
>gi|30260522|ref|NP_842899.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. Ames] >gi|47525619|ref|YP_016968.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183365|ref|YP_026617.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. Sterne] >gi|49476788|ref|YP_034671.1| thioredoxin reductase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|65317777|ref|ZP_00390736.1| COG0492: Thioredoxin reductase [Bacillus anthracis str. A2012] >gi|118476100|ref|YP_893251.1| thioredoxin reductase [Bacillus thuringiensis str. Al Hakam] >gi|165871394|ref|ZP_02216042.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. A0488] >gi|167634207|ref|ZP_02392529.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. A0442] >gi|167640092|ref|ZP_02398359.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. A0193] >gi|170688329|ref|ZP_02879538.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. A0465] >gi|170708944|ref|ZP_02899377.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. A0389] >gi|177653681|ref|ZP_02935820.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. A0174] >gi|190567562|ref|ZP_03020475.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis Tsiankovskii-I] >gi|196045321|ref|ZP_03112553.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus cereus 03BB108] >gi|30253890|gb|AAP24385.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. Ames] >gi|47500767|gb|AAT29443.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49177292|gb|AAT52668.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. Sterne] >gi|49328344|gb|AAT58990.1| probable thioredoxin reductase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|118415325|gb|ABK83744.1| thioredoxin reductase [Bacillus thuringiensis str. Al Hakam] >gi|164712878|gb|EDR18407.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. A0488] >gi|167511903|gb|EDR87282.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. A0193] >gi|167530521|gb|EDR93236.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. A0442] >gi|170126177|gb|EDS95071.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. A0389] >gi|170667661|gb|EDT18415.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. A0465] >gi|172081261|gb|EDT66336.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis str. A0174] >gi|190561349|gb|EDV15321.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus anthracis Tsiankovskii-I] >gi|196023905|gb|EDX62580.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus cereus 03BB108] (349 aa)
Score = 232, Expect = 1.3e-17, Identities = 86/312 (27%), Positives = 162/312 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEII-----DFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVID-------LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           MN +  ++DV ++GGG  G++++  S    + + +IE +  LGG+ + +YP K I+D      +    +I++L+QQ    +   + L+T I +I     N+  +F  +T+     ++K +I+A+G+G  NP+KL I   E  +   ++Y++    + +KNK +++ GGG+SA++WAN    E I   V + +R+ E       +  L  ++     N  I      D +E+ + + + + ET +   L  D V++ +G      +I LL   N E    +ID        N ++++  +YA GD      K + I  A  +A  A+
  S:     1 MNRE-ELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPQLGGK-IHVYPEKMIWDIGGLLPVTGEKLIEQLVQQGLTFQ-PEVVLNTKIESIIR---NKDGIFTLKTSTGEEHFSKTVIVATGSGILNPQKLSIEGAERFEVSNLNYTVK-SLKRFKNKTVIISGGGNSAIDWANEL--EPIAKKVYLTYRKEELSGHEAQVKQLMNSSAECFFNTSITTLIAGDNHEAIEYVELTNHETGEVSQLAIDEVIINHGYER---DITLLE--NSELDVAIIDNYYIAGNANSESSVDGLYAAGDILKHEGKLHLIAGAFQDAGNAV 312
>gi|196034573|ref|ZP_03101981.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus cereus W] >gi|195992616|gb|EDX56576.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus cereus W] (349 aa)
Score = 232, Expect = 1.3e-17, Identities = 86/312 (27%), Positives = 162/312 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEII-----DFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVID-------LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           MN +  ++DV ++GGG  G++++  S    + + +IE +  LGG+ + +YP K I+D      +    +I++L+QQ    +   + L+T I +I     N+  +F  +T+     ++K +I+A+G+G  NP+KL I   E  +   ++Y++    + +KNK +++ GGG+SA++WAN    E I   V + +R+ E       +  L  ++     N  I      D +E+ + + + + ET +   L  D V++ +G      +I LL   N E    +ID        N ++++  +YA GD      K + I  A  +A  A+
  S:     1 MNRE-ELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPQLGGK-IHVYPEKMIWDIGGLLPVTGEKLIEQLVQQGLTFQ-PEVVLNTKIESIIR---NKDGIFTLKTSTGEEHFSKTVIVATGSGILNPQKLSIEGAERFEVSNLNYTVK-SLKRFKNKTVIISGGGNSAIDWANEL--EPIAKKVYLTYRKEELSGHEAQVKQLMNSSAECFFNTSITTLIAGDNHEAIEYVELTNHETGEVSQLAIDEVIINHGYER---DITLLE--NSELDVAIIDNYYIAGNANSESSVDGLYAAGDILKHEGKLHLIAGAFQDAGNAV 312
>gi|83312991|ref|YP_423255.1| thioredoxin reductase [Magnetospirillum magneticum AMB-1] >gi|82947832|dbj|BAE52696.1| Thioredoxin reductase [Magnetospirillum magneticum AMB-1] (337 aa)
Score = 232, Expect = 1.5e-17, Identities = 83/302 (27%), Positives = 148/302 (49%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRS---SSFMIDCLSKNNILQ-KLNYEIIDFNESNKTLTIKHKETEKEQT--LPFDYVLVQYGQISSPINIELLNQINKEKGKYVID-LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVR 310
           D  IVG G  G+FA        +   +++    +GGQ   LYP K IYD P    I ++D++++L +Q      +     T +   T   +++       +N +S  A+ +I+ +G G+F P +  ++  E  +   + Y L  + E ++ KK+++ GGGDSAV+WA    E  +   V ++HRR ++R+   S   +  L++   ++  + Y++      N TL+     T + +T  LP D +L  YG +SS +       +  ++    +D     T+   IYA GD   +  K   I++  AEA R
  S:     7 DAVIVGAGPVGLFAVFQCGMVKVRCHVVDALEAVGGQLSALYPEKPIYDIPGHPSILAADLVERLSEQAAPFAPT-YHFGTQV--STLSRLDDGRWLCGLSNGDSIAARAVIICAGGGAFGPNRPPLDGLEQFEGTGVFY-LVRKREDFRGKKVVIAGGGDSAVDWAISLSE--VAAKVMVVHRRPKFRAAPESEARLKQLAETGAVELVVPYQLHGLEGENGTLSAVVVATLEGETKSLPADVLLPFYG-LSSDLGPIAQWNLGMDRNLIAVDPATGATDAPGIYAAGDICTYPGKLKLILSGFAEAAR 309
>gi|73541974|ref|YP_296494.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia eutropha JMP134] >gi|72119387|gb|AAZ61650.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia eutropha JMP134] (368 aa)
Score = 231, Expect = 1.9e-17, Identities = 82/299 (27%), Positives = 148/299 (49%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYR---SSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT-IKHKETEK-EQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAE 307
           D  IVG G  G+F         + + +I+    +GGQ +ELYP+K IYD P        ++   L++Q  E       L  ++  +  +  ++   F+  +    F  K I +A+G GSF PR L+++  +  D   + Y +  +   +  + ++++GGGDSA++W    V +    +V +IHRR+ +R   +S   +  L +   +Q L  +I  + E +  LT IK    +   + LP D VLV +G +S  +       ++ E+ +  +D  + +TNI  I+A+GD   +  K   I++   E
  S:    29 DALIVGAGPVGLFQVFELGLLEIKAHVIDSLKVVGGQCVELYPDKPIYDIPAVPSCTGQELTDNLLKQ-IEPFGPTFHLGQEVAVV--ERRDDGRFFVETSLGTRFITKTIFIAAGVGSFQPRTLKVDGIDKFDGKQLFYRVK-DPSRFHGRNLVIVGGGDSALDWTLDLVGK--AESVVMIHRRDGFRAAPASVAKMKELCEQMEMQFLVGQIGGYEEKDGVLTEIKVTGADGVTRRLPVDDVLVFFG-LSPKLGPIAEWGLDLERKQIKVDTEKFQTNIPGIFAVGDINTYPGKKKLILSGFHE 327
>gi|47569406|ref|ZP_00240088.1| pyridine nucleotide-disulfide oxidoreductase [Bacillus cereus G9241] >gi|47553914|gb|EAL12283.1| pyridine nucleotide-disulfide oxidoreductase [Bacillus cereus G9241] (349 aa)
Score = 231, Expect = 2.0e-17, Identities = 86/312 (27%), Positives = 160/312 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEII-----DFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVID-------LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           MN +  ++DV ++GGG  G++++  S    + + +IE +  LGG+ + +YP K I+D      +    +I++L+QQ    +   + L+T + +I     NE   F  + N     ++K +I+A+G+G   P+KL I   E  +   ++Y++    + +K+K I++ GGG+SAV+WAN    E I   V + +R+ E       +  L  ++     +  I      D +E+ + + + + ET +   LP D V++ +G      +I LL   N E    +ID        N ++++  +YA GD      K + I  A  +A  A+
  S:     1 MNRE-ELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPQLGGK-IHVYPEKMIWDIGGLLPVTGEKLIEQLVQQGLTFQ-PEVVLNTKVESIIR---NEDGTFTLKANDGKEHFSKTVIVATGSGILKPQKLSIEGAERFEVSNLNYTVK-SLKRFKDKTIIISGGGNSAVDWANEL--EPIAKKVYVAYRKEELSGHEAQVKQLLNSSAECFFHTSITKLIAGDSHEAIEYVELTNHETGEVSHLPIDEVIINHGYER---DITLLE--NSELDVAIIDNFYIAGNANSESSVDGLYAAGDILKHEGKLHLIAGAFQDAGNAV 312
>gi|46201854|ref|ZP_00054225.2| COG0492: Thioredoxin reductase [Magnetospirillum magnetotacticum MS-1] (337 aa)
Score = 231, Expect = 2.0e-17, Identities = 80/302 (26%), Positives = 146/302 (48%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYR----SSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDY-VLVQYGQISSPINIELLNQINKEKGKYVID-LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVR 310
           DV IVG G  G+FA        L   +++    +GGQ   LYP K IYD P    I ++D++++L +Q     +    + T +  ++ Q+    +  L  +N +   A  +I+ +G G+F P +  ++  E  +   + Y L  + E +++KK+++ GGGDSAV+WA    E  +   V ++HRR ++R    S + +        +   + Y++   + +N  L+     T + +T   D  VL+ +  +SS +       +  ++    +D     T+   IYA GD   +  K   I++  AEA R
  S:     7 DVVIVGAGPVGLFAVFQCGMVKLRCHVVDALEAVGGQLSALYPEKPIYDIPGHPSILAADLVERLSEQ-ASPFHPTYHVATQVSTLSRQSDGHWQCGL--SNGDCITAPAVIICAGGGAFGPNRPPLDGLEQYEGSGVFY-LVRKREDFRDKKVVIAGGGDSAVDWAISLSE--VAQKVMVVHRRPKFRAAPESEARLKQLAEAGRVELVVPYQLHGLDGANGKLSAVVVATLEGETKRLDADVLLPFYGLSSDLGPIAQWNLGMDRNLIAVDPATGATDAPGIYAAGDICTYPGKLKLILSGFAEAAR 309
>gi|194290187|ref|YP_002006094.1| putative THIOREDOXIN REDUCTASE; class-II pyridine nucleotide-disulfide oxidoreductase family. [Cupriavidus taiwanensis] >gi|193224022|emb|CAQ70031.1| putative THIOREDOXIN REDUCTASE; class-II pyridine nucleotide-disulfide oxidoreductase family. [Cupriavidus taiwanensis] (369 aa)
Score = 230, Expect = 2.3e-17, Identities = 81/299 (27%), Positives = 148/299 (49%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYR---SSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT-IKHKETEK-EQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAE 307
           D  IVG G  G+F         + + +I+    +GGQ +ELYP+K IYD P        ++   L++Q  E       L  ++  +  +  ++   F+  +    F  K I +A+G GSF PR L+++  +  D   + Y +  +   +  + ++++GGGDSA++W    V +    +V +IHRR+ +R   +S   +  L +   +Q L  +I  + E +  LT IK    +   + LP D +LV +G +S  +       ++ E+ +  +D  + +TNI  I+A+GD   +  K   I++   E
  S:    30 DALIVGAGPVGLFQVFELGLLEIKAHVIDSLKVVGGQCVELYPDKPIYDIPAVPSCTGQELTDNLLKQ-IEPFEPTFHLGQEVSVV--ERRDDGRFFVETSLGTRFITKTIFIAAGVGSFQPRTLKVDGIDKFDGKQLFYRVK-DPSRFHGRNLVIVGGGDSALDWTLDLVGK--AESVVMIHRRDGFRAAPASVAKMKELCEQMEMQFLVGQISGYEEKDGVLTEIKVSGADGVTRRLPLDDLLVFFG-LSPKLGPIAEWGLDLERKQIKVDTEKFQTNIPGIFAVGDINTYPGKKKLILSGFHE 328
>gi|196040095|ref|ZP_03107397.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus cereus NVH0597-99] >gi|196028950|gb|EDX67555.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus cereus NVH0597-99] (349 aa)
Score = 229, Expect = 2.9e-17, Identities = 85/312 (27%), Positives = 161/312 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDF-----NESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVID-------LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           MN +  ++DV ++GGG  G++++  S    + + +IE +  LGG+ + +YP K I+D      +    +I++L+QQ    +   + L+T I +I     N+  +F  +T+     ++K +I+A+G+G  NP+KL I   E  +   ++Y++    + +KNK +++ GGG+SA++WAN    E I   V + +R+ E       +  L  ++     N  I        +E+ + + + + ET +   L  D V++ +G      +I LL   N E    +ID        N ++++  +YA GD      K + I  A  +A  A+
  S:     1 MNRE-ELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPQLGGK-IHVYPEKMIWDIGGLLPVTGEKLIEQLVQQGLTFQ-PEVVLNTKIESIIR---NKDGIFTLKTSTGEEHFSKTVIVATGSGILNPQKLSIEGAERFEVSNLNYTVK-SLKRFKNKTVIISGGGNSAIDWANEL--EPIAKKVYLTYRKEELSGHEAQVKQLMNSSAECFFNTSITTLIAGGNHEAIEYVELTNHETGEVSQLAIDEVIINHGYER---DITLLE--NSELDVAIIDNYYIAGNANSESSVDGLYAAGDILKHEGKLHLIAGAFQDAGNAV 312
>gi|78187373|ref|YP_375416.1| thioredoxin reductase, putative [Pelodictyon luteolum DSM 273] >gi|78167275|gb|ABB24373.1| thioredoxin reductase, putative [Pelodictyon luteolum DSM 273] (363 aa)
Score = 229, Expect = 2.9e-17, Identities = 83/308 (26%), Positives = 162/308 (52%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI--NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEY----RSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQT--LPFDYVLVQYGQISS--PI---NIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           I D+ I+GGG  GIFA+      N++  +IE    LGGQ   LYP K IYD   F E+ ++ ++  L +Q  E+    + L   +  I+++ +   +  +   +  +F ++ ++LA+G G+F+PRKL    N  P++   + Y++    + +++K ++++GGGDSA++W    +   +   V ++HR +E+    +++  + +      I   L+ E+   + +  TL   H +     T  +  D +L+  G  S+  P+    +EL++   +      +D + KT++  +YA GD   +  K   I T  ++A  A+ H
  S:    24 ILDLTIIGGGPTGIFAAFQCGMNNISCRIIESMPQLGGQLSALYPEKHIYDVAGFPEVPAAGLVDSLWKQT-ERYGPEVILGETV--ISYRKLENGDFQVVTASGRTFVSRALLLAAGLGAFSPRKLPQLGNISPLEDRSVFYAVKNRAD-FRDKNVVIVGGGDSALDWTVGLM--GVARKVTLVHRMHEFQGHGKTAREVDEAKESGAIDVHLSTEVSAIDLNGDTLQAVHLKRRDGITSRVEADRLLLLIGFKSNLGPLADWGLELVDNAVE------VDGHMKTSVDGLYAAGDIASYPGKLKIIQTGLSDAAMAVRH 332
>gi|163938342|ref|YP_001643226.1| hypothetical protein BcerKBAB4_0332 [Bacillus weihenstephanensis KBAB4] >gi|163860539|gb|ABY41598.1| HI0933 family protein [Bacillus weihenstephanensis KBAB4] (349 aa)
Score = 229, Expect = 3.1e-17, Identities = 79/290 (27%), Positives = 155/290 (53%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEII-----DFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVID-------LNQKTNIKNIYAIGD 290
           MN++  ++DV ++GGG  G++++  S    + + +IE +  LGG+ + +YP K I+D      +    +I++L+QQ    +   + L+T I +I     N+  +F  +T+     ++K +I+A+G+G  NP+KL I   E  +   ++Y++    + +K+K +++ GGG+SA++WAN    E I   V + +R+ E       +  L  ++     N  I      D +E+ + + + + ET +   L  D V++ +G      +I LL   N E    ++D        N ++++  +YA GD
  S:     1 MNQE-ELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPQLGGK-IHVYPEKMIWDIGGLLPVTGEKLIEQLVQQGLTFQ-PEVVLNTKIESIIR---NQDGIFTLKTSSGEEHFSKTVIVATGSGILNPQKLSIEGAERFEVSNLNYTVK-SLKRFKDKTVIISGGGNSAIDWANEL--EPIAKKVYLTYRKEELSGHEAQVKQLMNSSAECFFNTSITKLIAGDNHEAIEYVELTNHETGEVSHLSIDEVIINHGYER---DITLLE--NSELDVAIVDNYYIAGNANSESSVDGLYAAGD 290
>gi|152974170|ref|YP_001373687.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152022922|gb|ABS20692.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus subsp. cytotoxis NVH 391-98] (349 aa)
Score = 229, Expect = 3.2e-17, Identities = 79/290 (27%), Positives = 158/290 (54%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDF-----NESNKTLTIKHKETEKEQTLPFDYVLVQYGQ-------ISSPINIELLNQINKEKGKYVI--DLNQKTNIKNIYAIGD 290
           MN++  ++DV ++GGG  G++++  S    + + +IE + +LGG+ + +YP K I+D      I  + +I++L++Q    +   + L+  + +IT    +E   FL  T+     ++K +I+A+G+G   P+KL I   E  +   ++Y++    + +K+K ++V GGG+SA++WAN    E +   V + +R+         I  L  +++   LN  I        +E+ + + + + ET +   L  D V++ +G         +S +NIE+++        Y I  + N +++I  +YA GD
  S:     1 MNKE-ELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPHLGGK-IHVYPEKMIWDIGGLPPITGAKLIEQLVEQGLTFQ-PEVVLNEKVESITR---DEYGTFLLTTSSGQQHFSKTVIIATGSGILKPQKLAIEGAERFEVSNLNYTVK-SLKHFKDKTVIVSGGGNSAIDWANEL--EPLAKKVYVTYRKEALSGHEAQITQLLNSSVTCLLNTSITKLIAGENHEAIERVELTNHETGEISYLSIDEVIINHGYERDMTLLENSELNIEMIDN-------YFIAGNANSESSIPGLYAAGD 290
>gi|115523497|ref|YP_780408.1| thioredoxin-disulfide reductase [Rhodopseudomonas palustris BisA53] >gi|115517444|gb|ABJ05428.1| Thioredoxin-disulfide reductase [Rhodopseudomonas palustris BisA53] (342 aa)
Score = 228, Expect = 4.7e-17, Identities = 88/320 (27%), Positives = 161/320 (50%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTL---TIKHKETEKEQ-----TLPFDYVLVQYGQISS-PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE----AVRALWHISKNKK 320
           M+E ++  DV IVG G  G+FA       ++   L++    +GGQ  ELYP K IYD P    I    + + L++Q K     + Q     +  T + I +    +       F  K +++A+G GSF P++  +   E  +   +HY++    E ++ K IL++GGGDSA++W        I  ++ ++HRR+++R +   ++ + +     KL+    +I      N  L   TIK  +    Q      LPF  + ++ G +++  +++E  N I  + G +      +TN+  I+AIGD   +  K   I++   E    A +A+ ++  +K+
  S:     1 MSEAIKT-DVLIVGAGPCGLFAVFELGLLDVKVHLVDILDKVGGQCAELYPEKPIYDIPGIPMITGHGLTESLMEQIKP---FDPQFHLGEMIETVEQIGDPGFRVTTDAGTVFECKVLVVAAGGGSFQPKRPPVPGVEHYEGKSVHYAVRKMDE-FRGKDILIVGGGDSALDWTLNL--NPICKSMTLVHRRDDFRGAPHSVEQMRQLVASGKLDLKIGQITALQGENGQLEGATIKLNDNSTAQIKCDAMLPFFGLTMKLGPVANWGLHLE-NNLIPVDTGTF------ETNVPGIFAIGDINTYPGKLKLILSGFHEGALMAQKAVKYVYPDKR 323
>gi|15616133|ref|NP_244438.1| thioredoxin reductase (NADPH) [Bacillus halodurans C-125] >gi|10176195|dbj|BAB07290.1| thioredoxin reductase (NADPH) [Bacillus halodurans C-125] (315 aa)
Score = 226, Expect = 6.2e-17, Identities = 76/290 (26%), Positives = 151/290 (52%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPIN--IELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M E+ ++YDV I G G  G+ A+  ++  NL+++++E +   GGQ   +   + + ++P F  I   ++  K+ +  K+        D        + I++ +L L +     + A+ +I+A+G      +KL +  E  +    + Y    +   +K K+++V+GGGDSAVE A Y    +  + V IIHRR++ R+   +      N+ ++ + ++ +   N ++    ++TI+H +T ++Q    D V +  G +  P+N  ++ LN +N E G  V +   +T++  I+A GD
  S:     1 MGEEQKVYDVVIAGAGPAGMTAAVYTSRANLSTVMVE-RGVPGGQ---MANTEDVENYPGFDHILGPELSTKMFEHAKKFGAEYAYGDIK------EIIDQGDLKLVKAGNKEYKARAVIVATGA---EYKKLGVPGEKELSGRGVSYCAVCDGAFFKGKELVVVGGGDSAVEEAVYLT--RFASKVTIIHRRDQLRAQKILQQRAFDNDKIEFIWDHVVKQINGTDGKVSSVTIEHAKTGEQQDFKTDGVFIYIGML--PLNEAVKNLNILNDE-GYIVTNEEMETSVPGIFAAGD 279
>gi|166982328|ref|ZP_02253766.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus cereus AH187] >gi|168159267|ref|ZP_02594500.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus cereus H3081.97] (349 aa)
Score = 226, Expect = 6.4e-17, Identities = 85/312 (27%), Positives = 160/312 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEII-----DFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVID-------LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           MN +  ++DV ++GGG  G++++  S    + + +IE +  LGG+ + +YP K I+D      +    +I++L+QQ    +   + L+T + +I     N+   F  + N     ++K +I+A+G+G   P+KL I   E  +   ++Y++    + +K+K I++ GGG+SAV+WAN    E I   V + +R+ E       +  L  ++     +  I      D +E+ + + + + ET +   LP D V++ +G      +I LL   N E    +ID        N ++++  +YA GD      K + I  A  +A  A+
  S:     1 MNRE-ELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPQLGGK-IHVYPEKMIWDVGGLLPVTGDKLIEQLVQQGLTFQ-PEVVLNTKVESIIR---NKDGTFTLKANDGKEHFSKTVIVATGSGILKPQKLSIEGAERFEVSNLNYTVK-SLKRFKDKTIIISGGGNSAVDWANEL--EPIAKKVYVTYRKEELSGHEAQVKQLLNSSAECFFHTSITKLIAGDSHEAIEYVELTNHETGEVSHLPIDEVIINHGYER---DITLLE--NSELDVAIIDNFYIAGNANSESSVDGLYAAGDILKHEGKLHLIAGAFQDAGNAV 312
>gi|154252964|ref|YP_001413788.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Parvibaculum lavamentivorans DS-1] >gi|154156914|gb|ABS64131.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Parvibaculum lavamentivorans DS-1] (343 aa)
Score = 226, Expect = 6.8e-17, Identities = 87/308 (28%), Positives = 156/308 (50%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQN-----KEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNIL---QKLNY---EIIDFNESNKTL---TIKHK-----ETEKEQTLPFDYVLVQYGQISS-PINI-ELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           M ++    DV IVG G  G+FA       ++   L++     GGQ  ELYP K IYD P    +   ++ ++L++Q      +   N  ++    + +  W+   +  L         F AK +++A+G GSF P+K  I   E  +   + Y++    E ++ K +L+ GGGDSA++W        I  ++ +IHRR+ +R++    D ++K + L   +K+ +   +I   +  N  L   T+K       + E +  LPF  + ++ G I++  IN+ E L  ++ EK         +T+   ++AIGD   +  K   I++   EA
  S:     1 MTQETITTDVVIVGAGPCGLFAVFELGLLDMKCHLVDILDKPGGQCAELYPEKPIYDIPALPVVSGHELTERLMEQAAPFGPQYHYNEMVEEVQKLEDGRWRVKTDGGLV--------FEAKVVVIAAGGGSFQPKKPPIPGIEAYEGKSVFYAVK-RMETFRGKNVLISGGGDSALDWTINL--HPIVQSMQLIHRRDGFRAAP---DSVNKMHALVEEKKMQFHLGQITSLHGDNGQLEGVTVKGNDGADYQIECDTLLPFFGLTMKLGPIANWGINLHENLIPVDTEKF--------QTSEPGLFAIGDINTYPGKLKLILSGFHEA 308
>gi|172058776|ref|YP_001815236.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Exiguobacterium sibiricum 255-15] >gi|171991297|gb|ACB62219.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Exiguobacterium sibiricum 255-15] (352 aa)
Score = 226, Expect = 7.6e-17, Identities = 65/249 (26%), Positives = 137/249 (55%)
  Q:     3 EDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSF-YAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLN---YEIIDFNESNKTLTIKHKETEKEQT--LPFDYVLVQYG 251
           E   ++DV ++GGG  G++++  S    + + LIE ++ LGG+ + +YP K I+D      I  + ++++L++Q     N  + L+  I++IT         F+ E       Y+K +I+A G G  NP+KL+I   E  +   ++Y++    E +K+K +++ GGG+SA++WAN    E +   V + +R++ +      ++ L  ++ +  LN   +++I  ++ ++  +++  +    +T  L  D V++ +G
  S:     2 EQQELFDVTVIGGGPAGLYSTFYSGLRGMKTKLIEYQAELGGK-IHVYPEKMIWDVGGQPPITGAKLMEQLVEQGL-TFNPTVHLNEKIISITKDVFGN---FVLEAESGMIHYSKTVIVAVGGGILNPQKLKIEGAERYEVSNLNYTVK-SIERFKDKTVIISGGGNSAIDWANEL--EPVAKKVYVTYRKDCFTGHEAQVEQLVNSSAVCLLNTTIHKLIASDDHHRIASVELIDCTTNETVALEIDEVIINHG 249
>gi|163759621|ref|ZP_02166706.1| thioredoxin reductase [Hoeflea phototrophica DFL-43] >gi|162283218|gb|EDQ33504.1| thioredoxin reductase [Hoeflea phototrophica DFL-43] (341 aa)
Score = 225, Expect = 8.9e-17, Identities = 82/300 (27%), Positives = 154/300 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQ----------------NKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQ---KLNYEIIDF------NESNKTLTIKHKETEK----EQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           DV IVG G  G+FA      ++L   LI+     GGQ  ELYP K IYD P + EI    ++ +L++Q                 ++  N   +++TD          E EL          +   +++A+G GSF P++  +   E  +   ++YS+    E ++++ +L++GGGDSA++W      + +  +V ++HRR ++R++    D ++K   L+   K+ +++         +      TIK  + E     ++ LPF  + ++ G I+          +N+ +    +D  + +T+I  ++AIGD   +  K   I++   EA
  S:     8 DVVIVGAGPVGLFAVFELGLYDLKCHLIDILDRPGGQCAELYPEKPIYDIPAWPEISGQALVDRLMEQIAPFSPEFHFNRMVSGFRKLDNGRFEVETD----------EGEL---------LHCHAVVIAAGGGSFQPKRPPVPGIEAYEGKSVYYSVR-RMEEFRDRDLLIVGGGDSALDWTLNL--QPVAKSVTLVHRRPDFRAAP---DSVNKMFALRDEGKITFQVGQVTGLKGDDGQLSAATIKGPDGEVDIACDRLLPFFGLTMKLGPIADW-------GLNQHENLITVDTEKFETSIPGVFAIGDINWYPGKLKLILSGFHEA 306
>gi|145220141|ref|YP_001130850.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prosthecochloris vibrioformis DSM 265] >gi|145206305|gb|ABP37348.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prosthecochloris vibrioformis DSM 265] (353 aa)
Score = 224, Expect = 1.1e-16, Identities = 85/308 (27%), Positives = 167/308 (54%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS-FYAKKIILASGNGSFNPRKL----EINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEY----RSSSFMIDCLSKNNILQKLNYEIIDFN---ESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PI---NIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           I D+ I+GGG  GIFA+      N++  +IE    LGGQ   LYP K IYD   F E+ ++ ++  L QQ +      +  +T    ++++ + E   F   T+  S F ++ ++LA+G G+F+PRKL    +I++  ++   + Y++  +++ ++ K+++++GGGDSA++W      + + + + ++HR +E+    +++  + +      +   LN E+       E   ++ ++ K      T+  D +L+  G  S+  PI    +EL++         V+D + KT++  +YA GD   +  K   I T  ++A  A+ H
  S:    14 IIDLTIIGGGPTGIFAAFQCGMNNISCRVIESMPQLGGQLRALYPEKHIYDVAGFPEVPAASLVDSLWQQTERYSPEVVTGET---VVSFRKL-ENGNFEVSTDAGSVFESRALLLAAGLGAFSPRKLPQLGDISD--LEGSSVFYAVKAKSD-FEGKRVVIVGGGDSALDWTVGL--QGVASGITLVHRMHEFQGHGKTAREVDEARDAGTVDVHLNTEVASIERRGEGIASVQLRRKNASV-CTVEADRLLLLIGFKSNLGPIANWGLELVDN------AVVVDAHMKTSVDGLYAAGDIASYPGKLKIIQTGLSDAAMAVRH 322
>gi|113868554|ref|YP_727043.1| thioredoxin reductase [Ralstonia eutropha H16] >gi|113527330|emb|CAJ93675.1| thioredoxin reductase [Ralstonia eutropha H16] (369 aa)
Score = 224, Expect = 1.1e-16, Identities = 83/299 (27%), Positives = 148/299 (49%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYR---SSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT-IKHKETEK-EQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAE 307
           D  IVG G  G+F         + + +I+    +GGQ +ELYP+K IYD P        ++   L++Q  E       L  ++  +  +   E   F  ET+  + F  K I +A+G GSF PR L++   +  D   + Y +  +   +  + ++++GGGDSA++W    V +    +V +IHRR+ +R   +S   +  L +   +Q L  ++  + E +  LT IK    +   + LP D +LV +G +S  +       ++ E+ +  +D  + +TNI  I+A+GD   +  K   I++   E
  S:    30 DALIVGAGPVGLFQVFELGLLEIKAHVIDSLKVVGGQCVELYPDKPIYDIPAVPICTGQELTDNLLKQ-IEPFEPTFHLGQEVAVVERR---EDGRFFVETSLGTRFITKTIFIAAGVGSFQPRTLKVEGIDKFDGKQLFYRVK-DPSRFHGRNLVIIGGGDSALDWTLDLVGK--AESVVMIHRRDGFRAAPASVAKMKELCEQMEMQFLVGQVGGYEEKDGVLTEIKVTGADGVTRRLPVDDLLVFFG-LSPKLGPIAEWGLDLERKQIKVDTEKFETNIPGIFAVGDINTYPGKKKLILSGFHE 328
>gi|119717040|ref|YP_924005.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nocardioides sp. JS614] >gi|119537701|gb|ABL82318.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nocardioides sp. JS614] (330 aa)
Score = 224, Expect = 1.2e-16, Identities = 73/299 (24%), Positives = 145/299 (48%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE------LFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIIDFNESNKT--LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ--INKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE 307
           D+ ++G G  G+FA+  + +      +++    LGGQ   +YP K I D   F  +K  D+++ L+ Q            T +L+ T  T++E +      + +   +     AK +++ +G G F+PR L   +  +      +  +     Y  K ++++GGGDSA +WA +   E +  +V ++HRR+ +R+    ++ +  S   I+ +     I  N   ++  +T+  + TE+    P   ++   G ++   ++  L Q  ++ EK   V+D + +TN+  ++A GD T +  K   I     E
  S:    10 DLLVIGAGPTGLFATYYAGFRGFRVAVVDSLPELGGQITAMYPEKQILDVAGFPSVKGRDLVEGLVAQAATAD------PTYLLDRTATTLHEDDDAENGAVVVGLDDGTEVRAKAVLITAGIGKFSPRPLPAGDGWLGRGLEFFVPSFAP--YAGKDVVIVGGGDSAFDWALHL--EPVARSVTLVHRRDGFRAHQRTVEAVQASSVQIVTRAEVSAIRGNGVVESIEITVDGESTER----PAQAIVAALGFVA---DLGPLQQWGLDVEKRHLVVDSSMRTNLARVFAAGDITEYPGKVRLIAVGFGE 303
>gi|194289300|ref|YP_002005207.1| putative THIOREDOXIN REDUCTASE OXIDOREDUCTASE, putative general stress protein [Cupriavidus taiwanensis] >gi|193223135|emb|CAQ69140.1| putative THIOREDOXIN REDUCTASE OXIDOREDUCTASE, putative general stress protein [Cupriavidus taiwanensis] (360 aa)
Score = 224, Expect = 1.2e-16, Identities = 77/304 (25%), Positives = 145/304 (47%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKE--------QKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKN----------NILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           DV IVG G  G+FA+  +    L   LI+     GGQ  ELYP K IYD P      + D++ +L++Q           Q+  ++  +      +      + L +       F    +++ +G G+F P+++ +     ++   +HY++  +   +  K+++V GGGDSA++WA      K+   V ++HRR  +R++   +  + +            +L  L  E  D   S   +  +   T     LP + ++  YG +S P  I   + ++   G+ ++D    +++ + I+A GD   +  K   I++   EA  AL
  S:    15 DVLIVGAGPVGLFAAFQAGVLGLKCELIDVLDRAGGQCTELYPEKPIYDIPAVPGCLAQDLVDRLLEQCAPFDFPMHFGQRAESVA-EIPAPAASAGHAGHERLLVTTDGGKRFDVAAVLICAGAGAFAPQRVSLPEAAALEGRHVHYAVR-DVSHFAGKRVIVAGGGDSALDWA--LALRKVAARVTLLHRREGFRAADGTVAEMRRAVAEGEMDFVVGMLGALRTEGADGGLSEVEVRTRDGST----VLPAEELVALYGLVSEPGPIAQWD-LDMRAGRILVDTTTYESSRRGIFAAGDIAFYPNKQKLILSGFHEAALAL 329
>gi|90422969|ref|YP_531339.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Rhodopseudomonas palustris BisB18] >gi|90104983|gb|ABD87020.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Rhodopseudomonas palustris BisB18] (342 aa)
Score = 224, Expect = 1.2e-16, Identities = 82/320 (25%), Positives = 164/320 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID---CLSKNNILQKLNYEIIDFNESNKTL---TIKHKETEKEQT-----LPFDYVLVQYGQISS-PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE----AVRALWHISKNKK 320
           M+E ++  DV IVG G  G+FA       ++   L++    +GGQ  ELYP K IYD P    I    + + L++Q K   N    L+  I  +  + I +    +       F  K +++A+G GSF P++  +   E  +   +HY++  + E +++K ++++GGGDSA++W        +   + ++HRR+++R++   ++    L  +  +  L  ++   +   K L   T+K  +    +      LPF  + ++ G +++  +++E  N +  + G +      +TN+  I+AIGD   +  K   I++   E    A +A+ ++  +K+
  S:     1 MSEAIKT-DVLIVGAGPCGLFAVFELGLLDVKVHLVDILDKIGGQCAELYPEKPIYDIPGIPMITGHGLTESLLEQIKP-FNPTFHLNEMIETV--EKIGDPGFRVTTDAGKVFECKVLVVAAGGGSFQPKRPPVPGIEAYEGGSVHYAVR-KMEEFRDKDLMIVGGGDSALDWVLNL--HPLAKRITLVHRRDDFRAAPHSVEQMRALVASGQMDLLIGQVTALDGEGKELSAATVKGNDGTTTKVACNAMLPFFGLTMKLGPVANWGLHLE-NNLVPVDTGTF------ETNVPGIFAIGDINTYPGKLKLILSGFHEGALMAQKAVKYVYPDKR 323
>gi|182702397|ref|ZP_02955398.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methylocella silvestris BL2] >gi|172068042|gb|EDT54156.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methylocella silvestris BL2] (345 aa)
Score = 224, Expect = 1.3e-16, Identities = 85/317 (26%), Positives = 154/317 (48%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELF-LFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSK---NNILQKLNYEIIDFNESN---KTLTIKH-----KETEKEQTLPFDYVLVQYGQISS-PINI-ELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           M+E ++  DV IVG G  G+FA       ++   L++     GGQ  ELYP K IYD P +  +    ++  L+QQ  E  +        +  I      E  LF +  T    F  K II+A+G GSF P+K  I   E  +   + Y++  + E ++ + ++++GGGDSA++W      + I   + +IHRR+++R +   +  + +   N ++     ++          + LT+K      ++   E+ +PF  + ++ G ++   +N+ E L  ++ EK         +TN+  ++AIGD   +  K   I+    E   A   I +
  S:     1 MSETIKT-DVLIVGAGPAGLFAVFELGLLDIKCHLVDILPKAGGQCSELYPEKPIYDIPGYPIVTGQGLVDHLLQQ-IEPFHPTFHYGEMVEAIEPLGTAEAPLFKVSATGGKIFECKSIIVAAGGGSFQPKKPPIEGIEAYEGNSVFYAVR-KMEDFRGRHVVIVGGGDSALDWTLNL--QPIVERLTLIHRRDDFRGAPHSVKAMRELVANGLIDLHIGQVASLAGEGGQLRGLTLKGADGALRDIACERLIPFFGLTMKLGPVAEWGLNLHENLVPVDTEKF--------ETNVPGVFAIGDINTYPGKLKLILCGFHEGALAAQKIHR 319
>gi|126650644|ref|ZP_01722867.1| thioredoxin reductase [Bacillus sp. B14905] >gi|126592800|gb|EAZ86799.1| thioredoxin reductase [Bacillus sp. B14905] (348 aa)
Score = 224, Expect = 1.3e-16, Identities = 75/245 (30%), Positives = 125/245 (51%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKL--------EINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQK-LNYEIIDFN-ESNKT--LTIKHKETEKEQTLPFDYVLVQYG 251
           IYDV I+GGG  G++A+  S    + + +IE K  LGG  M  YP K ++D      ++  ++I  LI+Q     N  I    +I+ +  +  ++    L        Y K IILA+G G    +KL        E+NN       +HY++      +K+K++L+ GGGDSAV+WA       I   V ++HRR+++  S+F        +I+   + Y +   +   NK   +T++H  ++    +  D VLV +G
  S:     5 IYDVIIIGGGPAGMYAAFYSGMREMKTKIIEVKHELGGF-MRTYPEKLVWDVGGIEPVRCEEIIHSLIKQ-ATTFNPTIVFGQEIVGM--EKRDDGIFVLTAKTGEKHYTKTIILATGRGITRIQKLTVEGADRYELNN-------LHYTVT-NINRFKDKRVLISGGGDSAVDWAIEMA--PIAKEVYVVHRRDDF--SAFESSVTRMKSIVTTFVPYTVSRLHGNGNKIEHVTLQHVHSDDTTNIEVDEVLVNHG 245
>gi|111220489|ref|YP_711283.1| putative thioredoxin reductase [Frankia alni ACN14a] >gi|111148021|emb|CAJ59687.1| putative Thioredoxin reductase [Frankia alni ACN14a] (375 aa)
Score = 224, Expect = 1.3e-16, Identities = 70/304 (23%), Positives = 136/304 (44%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN--------KTLTIKHKETEKEQTLPFDYVLVQYGQISS--PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           D+ IVG G  G++ +  + +  ++  L++     GGQ   +YP K IYD   F  I+  +++  L+ Q   Q +    LD     +  +      + +  +  +   A+ +++  G G+F PR L      +    +++   L  ++Y ++ ++V+GGGDSA +WA     E I  +V ++HRR+ +R+ +  I+ +  + +      EI+ F+E          + + +    T      P   V+   G  +   P+    L    +      +D    T +  ++A GD T +  K   I T   E   A+
  S:    54 DMLIVGAGPAGLYGAYYAGFRGMSVALMDSLPEAGGQVTAMYPEKVIYDVAGFPAIRGRELVDALVTQ-AAQFDPTYLLDQQAAELAHEP---DAVVVTSSQGHRVRARVVVITGGLGTFTPRPLPTGTGHLGRGLVYFVPKL--DVYADQDVIVVGGGDSAFDWA--LALEPIARSVTLVHRRDRFRAHAATIERVEASRV------EILTFSEVAAIHGEDRIEKVELVQTRTGDRHVRPAQAVVAALGFTADLGPLTRWGLTMARRH---IAVDSTMFTGVDRVFAAGDITEYPGKVRLIATGFGEVATAV 350
>gi|16801683|ref|NP_471951.1| thioredoxin reductase [Listeria innocua Clip11262] >gi|20140653|sp|Q928B5|TRXB_LISIN Thioredoxin reductase (TRXR) >gi|16415158|emb|CAC97848.1| thioredoxin reductase [Listeria innocua] (319 aa)
Score = 224, Expect = 1.3e-16, Identities = 80/290 (27%), Positives = 138/290 (47%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKL-EINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKHKET--EKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M  + +IYDV I+G G  G+ A+  ++  +L++++IE+    GGQ   +     + ++P F  I   D+  K++   K+        D        + I+ +E         ++ A+ II+A+G      RKL     E +    + Y    +   +KN++++V+GGGDSAVE   Y    +  + V I+HRR++ R+   + D   K+     I      EII   +  K  ++K   T    E  +P D V +  G +  P+    L+  I  E+G  V D   +TN+  I+A GD
  S:     1 MASEEKIYDVIIIGAGPAGMTAALYTSRADLDTLMIER-GVPGGQ---MVNTAEVENYPGFDSILGPDLSDKMLSGAKQFGAEYAYGDIK------EVIDGKEFKTVTAGSKTYKARAIIIATGA---EHRKLGAAGEEELSGRGVSYCAVCDGAFFKNRELVVVGGGDSAVEEGTYLT--RYADKVTIVHRRDKLRAQQILQDRAFKDEKVDFIWNNTVEEII--GDGKKVTSVKLVSTVDGSESIMPVDGVFIYVGLV--PLTKAFLSLGITDEEGYIVTDEEMRTNLPGIFAAGD 279
>gi|170788682|gb|EDT29726.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Oligotropha carboxidovorans OM5] (342 aa)
Score = 223, Expect = 1.7e-16, Identities = 62/207 (29%), Positives = 112/207 (54%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINE--QELFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSK 207
           M+E ++  DV I+G G  G+FA       ++   L++    +GGQ  ELYP K IYD P    +    + + L++Q K          T  LN   QT+ +    LF   T+  + F AK +++A+G GSF P++  +   E  +   + Y++  + E ++ K++L++GGGDSA++W      + I   V ++HRR+++R++   ++ + K
  S:     1 MSEAIKT-DVLIIGAGPCGLFAVFELGLLDMRVHLVDILDKIGGQCAELYPEKPIYDIPGIPMVTGQGLTEALMEQVKPFN------PTFHLNEMVQTVEKIGDPLFRCTTDAGTVFEAKVLVIAAGGGSFQPKRPPVPGIEAYEGTSVFYAVR-KMEQFRGKELLIVGGGDSALDWTLNL--QPIAKRVTLLHRRDDFRAAPHSVEQMRK 201
>gi|117928074|ref|YP_872625.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Acidothermus cellulolyticus 11B] >gi|117648537|gb|ABK52639.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Acidothermus cellulolyticus 11B] (350 aa)
Score = 222, Expect = 2.0e-16, Identities = 77/286 (26%), Positives = 139/286 (48%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS--PI---NIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHF 294
           DV IVG G  G++A+  + +  ++ ++++  +  GGQ   LYP K IYD      I   ++   L +Q     N  + L      +    +++    +  T     +AK II+ +G G F PR+L +  E  +   + Y +    E+   K+ILV+GGGDSAV++A   + EK+  +V +IHRR+E+R+    ++ L  S   IL       +  ++    + +   +T+  + L  D ++   G ++   P+    +EL       +   V+D    T++  IYA GD   +
  S:    25 DVLIVGAGPAGLYAAYYAGFRAMSVVVLDSLTEPGGQLAALYPEKVIYDVGGIPAILGRELAADLYKQAMTY-NPVMLLGHGADQLF--RLDDGSFLVTTTTGLLIHAKAIIVTAGIGVFTPRRLPVGQE-YEGRGLRYFVPNPQEL-AGKRILVVGGGDSAVDYA--LMLEKVAASVTLIHRRHEFRAHEASVEQLRASSVRILTPYQVSAVYGDDRVTAVDVTDHDTKHVERLDVDEIVAALGFVAELGPLAEWGMEL------RQRHIVVDTTMATSVPRIYAAGDIADY 304
>gi|159036474|ref|YP_001535727.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Salinispora arenicola CNS-205] >gi|157915309|gb|ABV96736.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Salinispora arenicola CNS-205] (322 aa)
Score = 222, Expect = 2.1e-16, Identities = 72/303 (23%), Positives = 139/303 (45%)
  Q:     5 LRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNE----SNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ--INKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE 307
           +R  DVA++G G  G+FA+  + +  L+  +++     GGQ   +YP K I+D   F  I+  D+I  L+ Q     +    L T    +T+    +    L            +++  G GSF PR L +    + +  +++    +     N+ +L++GGGDSA +WA+    + +  +V ++HRR  +R+ +  +  +    +   +N E+   +     +   +T++    E    LP D V+   G  +   ++  L +  +  ++   V+D    TN+  ++A GD T +  K   I T   E
  S:     1 MREIDVAVIGAGPSGLFAAYYAGFRGLSVAVVDALPEPGGQVTAMYPEKLIHDVAGFPAIRGRDLIANLVAQ-AAPFDPRYLLGTRAEKLTYV---DGRPVLGLAGGEQLACGAVVITGGLGSFTPRPLPVAERFLGTGIVYFVP--QPADLTNRDVLIVGGGDSAFDWASTL--QPLARSVTLVHRRERFRAHAATVARVRALPVRIVVNAEVTRLHGGGTVTGAEITVRGGAAE---LLPVDTVVAALGFTA---DLGPLTEWGLRLDRRHIVVDSTMATNLPRVFAAGDITEYPGKVRLIATGFGE 295
>gi|89901239|ref|YP_523710.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Rhodoferax ferrireducens T118] >gi|89345976|gb|ABD70179.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Rhodoferax ferrireducens T118] (354 aa)
Score = 221, Expect = 2.4e-16, Identities = 86/312 (27%), Positives = 161/312 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEE--KITNNVAIIHRRNEYRSSSFMI-------DCLSKNNILQKLNYEIIDFNESNKTLT-IKHKETEK-EQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITA---CA-EAVRALWHISKNKK 320
           D  IVG G  G+F         + + +++  +Y GGQ +ELYP+K IYD P        ++ + L++Q      +      ++  +  Q+      F  ET+K + F +K I +A+G G+F PR L+++  E  +   + Y +    + + +K ++++GGGDSA++WA  FV++      +V +IHRR+ ++++   +       D L     +Q +  ++  F   +  LT IK    +   + +P D +LV +G +S  +       ++ E+ +  +D  +  T+   I+A+GD   +  K   I++    CA  A  A+  IS  KK
  S:    11 DAVIVGAGPVGLFQVFELGLLEIKAHVVDSLAYPGGQCIELYPDKPIYDIPAVPVCTGRELTQNLLKQ-IAPFGATFHYGQEVTVVEKQSDGR---FFVETSKGTRFLSKTIFIAAGVGAFQPRTLKVDGLEVFEDSQLFYRVRNPAD-FADKNLVIVGGGDSALDWALDFVKDGPNKAASVILIHRRDGFKAAPASVAKMRELCDALE----MQFIVGQVTGFEAQDSLLTGIKVTGADGVTRVVPLDVLLVFFG-LSPKLGPIAEWGLDIERKQLKVDTEKFSTSEPGIFAVGDINIYPGKKKLILSGFHECALAAFGAMPIISPEKK 330
>gi|16801141|ref|NP_471409.1| hypothetical protein lin2075 [Listeria innocua Clip11262] >gi|16414576|emb|CAC97305.1| lin2075 [Listeria innocua] (332 aa)
Score = 221, Expect = 2.7e-16, Identities = 75/306 (24%), Positives = 158/306 (51%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLE---INNEPIDSPFIHYSL-NLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEI---IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKY--VIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           +YDV I+GGG  G+F++  S   ++ + +I+ +  +GG+    +P K I D      I  ++++  L +Q  E  +  I  +  ++++T   + +    L   N +  ++K +++A+G+G+F   KLE   +++ P+    I+Y + NLE   +++K + V GGG+SA++WA     E I   V +I+R  ++++    +  L  + +   +++EI   I  N    ++ I   +T+  +T+  + + + +G     +++  + +   E   +  V+D   KT +  I+A GD+  +  K   I     E   A+
  S:     5 VYDVTIIGGGPIGLFSAFYSGLRSMKTKIIDAEPDVGGKVRYFFPEKIIRDIGGIPAITGANLVANLKEQ-AETFHPTIVCNERVVDVT--KLTDGVFQLTSHNGSIHFSKTVVIATGSGTFEVNKLEAMHVDDFPLA---INYDVKNLEQ--FRDKIVTVSGGGNSAIDWAQTL--EPIAKKVHLIYRGEDFKAHEESVRELKNSRVEIHIHHEIKELIGANNQLASIKICCNQTQVTKTIETEALFINHG---VKVDLGTMAEWGFELADFGIVVDDEMKTTVPGIFACGDSATYSRKIRIIAAGLHEGPIAI 306
>gi|27380994|ref|NP_772523.1| thioredoxin resuctase [Bradyrhizobium japonicum USDA 110] >gi|27354160|dbj|BAC51148.1| bll5883 [Bradyrhizobium japonicum USDA 110] (342 aa)
Score = 221, Expect = 2.8e-16, Identities = 78/300 (26%), Positives = 143/300 (47%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL-----------------SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISS-PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           DV I+G G  G+FA+      ++ +  ++    +GGQ  ELYP K IYD P    +    +   L++Q K   +    L   +  +  + I +            F  K +++A+G GSF P++  +   E  +   +HY++  + E +++K +L++GGGDSA++W        +   + ++HRR+E+R++   ++ +                 S      KL    I  N++N T      E   +  LPF  + ++ G +++  I +E  N +  E   +      +TNI  I+AIGD   +  K   I+    E 
  S:     8 DVLIIGAGPCGLFAAFELGLLDMKAHFVDILDKVGGQCAELYPEKPIYDIPGIPHVSGQGLTDALMEQIKP-FHPTFHLGEMVETV--EKIGDPAFRCTTDAGKVFECKVLVIAAGGGSFQPKRPPVPGIEAYEGTSVHYAVR-KMETFRDKNVLIVGGGDSALDWTLNL--HPVAKRITLLHRRDEFRAAPHSVEQMRALVAAGKMDLRLGQVTSLAGTDGKLTGATIKGNDNNVT------EIACDAMLPFFGLTMKLGPVANWGIALE-NNLVPVETSAF------ETNISGIFAIGDINTYPGKIKLILCGFHEG 307
>gi|85715016|ref|ZP_01046001.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nitrobacter sp. Nb-311A] >gi|85698213|gb|EAQ36085.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nitrobacter sp. Nb-311A] (356 aa)
Score = 221, Expect = 2.8e-16, Identities = 57/207 (27%), Positives = 110/207 (53%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSK 207
           MNE ++  DV I+G G  G+FA       ++   L++    +GGQ  ELYP K IYD P    +    + + L++Q K   N    L+  + +I  + I +    +       F  K +++++G GSF P++  +   E  ++  + Y++  + E +++K+IL++GGGDSA++W        +   + ++HRR+E+R++   ++ + K
  S:    15 MNEAIKT-DVLIIGAGPCGLFAVFELGLLDMKVHLVDILDKIGGQCAELYPEKPIYDIPGIPLVTGQGLTEALLEQIKP-FNPTFHLNEMVESI--EKIGDPGFRVTTDAGKVFECKVVVVSAGGGSFQPKRPPVPGIEAYENTSVFYAVR-KMEQFRDKEILIVGGGDSALDWTLNL--HPLAKRITLLHRRDEFRAAPHSVEQMRK 215
>gi|189347210|ref|YP_001943739.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chlorobium limicola DSM 245] >gi|189341357|gb|ACD90760.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chlorobium limicola DSM 245] (350 aa)
Score = 220, Expect = 3.7e-16, Identities = 90/308 (29%), Positives = 161/308 (52%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS---FYAKKIILASGNGSFNPRKLEINN--EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEY----RSSSFMIDCLSKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISS--PI---NIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWH 314
           I D+ IVGGG  GIFA+      N+ S +IE    LGGQ   LYP K IYD   F E+ ++ ++  L +Q  E+ +  I L   +    ++ +++     FET   S   F ++ ++LA+G G+F PR L      + ++   I Y++      +  KK++++GGGDSA++WA   ++     +V ++HR +E+    +++  + +   K  I   ++ E+     +    K +T+  K       L  D +L+  G  S+  P+   ++EL++         V+D + KT++  +YA GD   +  K   I T  ++A  A+ H
  S:    14 IRDLTIVGGGPTGIFAAFQCGMNNITSRIIESMPQLGGQLAALYPEKHIYDVAGFHEVPAAGLVDSLWKQ-AERYHPEINLGEAVTR--YRKLDDGS---FETTTKSGKVFLSRALLLAAGLGAFTPRTLPQLGCVDHLEGRSIFYAVK-NIRDFAGKKVVIVGGGDSALDWAVGLLDA--AEHVTLVHRMHEFQGHGKTAREVDEARDKGVIDVYMDTEVTAIETAEGGMKNVTLLRKNG-ASVVLEADRLLILIGFRSNLGPLAEWDLELVDN------ALVVDSHMKTSVDGLYAAGDIAWYPGKLKIIQTGLSDAAMAVRH 322
>gi|94311388|ref|YP_584598.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia metallidurans CH34] >gi|93355240|gb|ABF09329.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia metallidurans CH34] (367 aa)
Score = 219, Expect = 4.2e-16, Identities = 82/299 (27%), Positives = 149/299 (49%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS-FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYR---SSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT-IKHKETEK-EQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAE 307
           D  IVG G  G+F         + + +I+    +GGQ +ELYP+K IYD P        ++   L++Q  E  +    L  ++  +  +   E   F  ET+  + F  K I +A+G GSF PR L++   +  +   + Y +  +   +  + ++V+GGGDSA++W    V +    +V +IHRR+ +R   +S   +  L +   +Q +  +I  + E +  LT IK    +   + +P D +LV +G +S  +       ++ E+ +  +D  + +TNI  I+A+GD   +  K   I++   E
  S:    28 DALIVGAGPVGLFQVFELGLLEIKAHIIDSLKVVGGQCVELYPDKPIYDIPAVPICTGQELTDNLLKQ-IEPFSPTFHLGQEVSVVERR---EDGRFFVETSLGTRFITKTIFIAAGVGSFQPRTLKVEGIDKFEGKQLFYRVK-DPSRFHGRNLVVVGGGDSALDWTLDLVGK--AESVVMIHRRDGFRAAPASVAKMRELCEQMEMQFMVGQIGGYEEKDGVLTEIKVTGADGVTRRMPVDDILVFFG-LSPKLGPIAEWGLDLERKQIKVDTEKFETNIPGIFAVGDINTYPGKKKLILSGFHE 326
>gi|138896654|ref|YP_001127107.1| thioredoxin reductase [Geobacillus thermodenitrificans NG80-2] >gi|196249356|ref|ZP_03148054.1| thioredoxin reductase [Geobacillus sp. G11MC16] >gi|134268167|gb|ABO68362.1| Thioredoxin reductase [Geobacillus thermodenitrificans NG80-2] >gi|196211113|gb|EDY05874.1| thioredoxin reductase [Geobacillus sp. G11MC16] (318 aa)
Score = 219, Expect = 4.4e-16, Identities = 75/287 (26%), Positives = 137/287 (47%)
  Q:     4 DLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           D +IYDV I G G  G+ A+  ++  NL++++IE +   GGQ   +   + + ++P F  I   ++  K+ +  K+        D        + I+ +           + A+ +I+A+G      +KL +  E  +    + Y    +   +K K ++V+GGGDSAVE   Y    +  N V I+HRR++ R+   + D    N  +  + N+ +   NE +    ++T+ H +T +E+  P D V +  G +  P++    N  I  E G  V +   +T +  I+A GD
  S:     3 DEKIYDVIIAGAGPAGLTAAVYTSRANLSTLMIE-RGVPGGQ---MVNTEEVENYPGFETILGPELATKMFEHAKKFGAEYAYGDVK------EIIDGEAYKTVVVGDKEYKARAVIIATGA---EYKKLGVPGEAELGGRGVSYCAVCDGAFFKGKDLVVVGGGDSAVEEGVYLT--RFANKVTIVHRRDQLRAQKILQDRAFANEKVDFIWNHTVKQINEKDGKVGSVTLVHTQTGEEREFPCDGVFIYIGMV--PLSKPFANLGITNENGYIVTNEKMETKVPGIFAAGD 278
>gi|145593429|ref|YP_001157726.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Salinispora tropica CNB-440] >gi|145302766|gb|ABP53348.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Salinispora tropica CNB-440] (322 aa)
Score = 218, Expect = 5.4e-16, Identities = 69/299 (23%), Positives = 136/299 (45%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNE----SNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE 307
           D+A+VG G  G+FA+  + +  L+  +++     GGQ   +YP K I+D   F  IK  D++  L+ Q        + L T    +++    +    L        +   +++  G GSF PR L +    + +  I++    +      + +L++GGGDSA +WA+    + +  +V ++HRR ++R+ +  +  +    +   +N E+   +     +   +T++    E    LP D V+   G  ++ +       +  ++   V+D    TN+  ++A GD T +  K   I T   E
  S:     5 DIAVVGAGPAGLFAAYYAGFRGLSVAVVDALPEPGGQITAMYPEKLIHDVAGFPAIKGRDLVANLVAQAAPFAPRYL-LGTRAEKLSYA---DGRPVLGLAGGEQLHCGAVVITGGLGSFTPRPLPVAERFVGTGIIYFVP--QPADLTGQDVLIVGGGDSAFDWASTL--QPLARSVTLVHRREKFRAHAATVARVHALPVRVVVNAEVTRLHGGGAVTGAEITVRGGAAE---LLPVDTVVAALG-FTADLGPLAEWGLRLDRRHLVVDSTMATNLPRVFAAGDITEYQGKVRLIATGFGE 295
>gi|90962691|ref|YP_536607.1| thioredoxin reductase [Lactobacillus salivarius UCC118] >gi|90821885|gb|ABE00524.1| Thioredoxin reductase [Lactobacillus salivarius UCC118] (311 aa)
Score = 218, Expect = 5.4e-16, Identities = 78/301 (25%), Positives = 148/301 (49%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDIL--NITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQ----KLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           YDV ++G G GG+ A+  ++  NL   ++++  Y GGQ   +     + ++P F  I   D+ +++ Q       S+ Q   + +  N+   T+++  +   +T+     A  +I+A+G+     RKL +   E      + Y    +   Y++K + V+GGGDSAVE   Y    K+T++V +IHRR+E R+   + D    N+ +      +  EI+  ++    +   +K+T ++  +  + V +  G +      + L  I  +KG  V D +  T++  I+AIGD    + +   I TA  +A
  S:     5 YDVIVIGAGPGGMTAALYASRANLKVAMLDRGVY-GGQ---MNNTAEVENYPGFKSILGPDLAEEMFQ-------SSTQFGAEFVYGNVEDLTVDDNGIKHVKTDDGELEAPVVIIATGS---QYRKLGVPGEEKYSGRGVSYCAVCDGAFYRDKPVGVIGGGDSAVEEGMYLA--KLTSSVNVIHRRDELRAQKILQDRAFANDKMHFTWDTIVTEIVGDDKKVTGVKTHNKKTGEDGEIEANGVFIYVGSVPMSEPFQKLG-ITDDKGWIVTDDHMATSVPGIFAIGDVRSKFLR--QITTAVGDA 293
>gi|58696938|ref|ZP_00372435.1| pyridine nucleotide-disulphide oxidoreductase family protein [Wolbachia endosymbiont of Drosophila simulans] >gi|58536833|gb|EAL60049.1| pyridine nucleotide-disulphide oxidoreductase family protein [Wolbachia endosymbiont of Drosophila simulans] (313 aa)
Score = 218, Expect = 5.8e-16, Identities = 87/275 (31%), Positives = 144/275 (52%)
  Q:    43 GGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETN-KNSFYAKKIILASGNGSFNPRK------LEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVE-EKITNNVAIIHRRNEYRSSSFMIDCL----SKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ--INKEKGKYVID-LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           GGQ   LYP K IYD P +  I +  +I++L++Q    K     L   +  I   + NE E F   T+       K +I+A+GNG F P +      LE  N+      + YS+N  ++ +++K I++ GGGDSA +W    VE  K+   + +IHRR E+R +    + L    S   I   + Y++ +    N    T+ +K+  +++E+ +  D++L  +G     +N+  +N   I  E  + V+D    KT+   IYAIGD   +  K   I++  AE+  A + I K
  S:    13 GGQCTALYPEKPIYDIPGYPVITAQKLIEQLMEQASPFK-PIYHLSQKVEKI---SNNEGENFTIITSIGTEVKCKAVIVAAGNGMFEPNRPPLSGILEYENKS-----VFYSVNKISD-FQDKTIVIAGGGDSAADWT---VELSKVAKKIYVIHRRKEFRCTPETRNKLESLESDGKIELVVPYQLHELAGGNGQLSTVIVKNIASKEEKEISADFLLPFFGL---SMNLGPINNWGIQLEHSRIVVDPATLKTSRDRIYAIGDIAIYSGKLKLILSGFAESAMACYDIYK 289
>gi|116873842|ref|YP_850623.1| thioredoxin reductase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742720|emb|CAK21844.1| trxB [Listeria welshimeri serovar 6b str. SLCC5334] (319 aa)
Score = 218, Expect = 6.4e-16, Identities = 76/290 (26%), Positives = 138/290 (47%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKL-EINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY-------EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M  + +IYDV I+G G  G+ A+  ++  +L++++IE+    GGQ   +     + ++P F  I   D+  K++   K+        D        + ++ +E         ++ A+ II+A+G      RKL     E +    + Y    +   +KN++++V+GGGDSAVE   Y    +  + V I+HRR++ R+   + D   K+   +K+++       EII   +      +       E  +P D V +  G +  P+    LN  I  ++G  V D   +TN+  I+A GD
  S:     1 MASEEKIYDVIIIGAGPAGMTAALYTSRADLDTLMIER-GVPGGQ---MVNTAEVENYPGFDSILGPDLSDKMLSGAKQFGAEYAYGDIK------EVVDGKEFKTVTAGSKTYKARAIIIATGA---EHRKLGAAGEEELSGRGVSYCAVCDGAFFKNRELVVVGGGDSAVEEGTYLT--RYADKVTIVHRRDKLRAQQILQDRAFKD---EKVDFVWNSTVEEIIGDGKKVTGAKLVSTVDGSESIMPVDGVFIYVGLV--PLTKAFLNLGITDDEGYIVTDEEMRTNLPGIFAAGD 279
>gi|56421603|ref|YP_148921.1| thioredoxin reductase [Geobacillus kaustophilus HTA426] >gi|56381445|dbj|BAD77353.1| thioredoxin reductase [Geobacillus kaustophilus HTA426] (318 aa)
Score = 217, Expect = 7.0e-16, Identities = 75/287 (26%), Positives = 137/287 (47%)
  Q:     4 DLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           D +IYDV I G G  G+ A+  ++  NL++++IE +   GGQ   +   + + ++P F  I   ++  K+ +  K+        D        + I+ +           + A+ +I+A+G      +KL +  E  +    + Y    +   +K K ++V+GGGDSAVE   Y    +  N V I+HRR++ R+   + D    N  +  + N+ +   NE +    ++T+ H +T +E+  P D V +  G +  P++    N  I  E G  V +   +T +  I+A GD
  S:     3 DEKIYDVIIAGAGPAGLTAAVYTSRANLSTLMIE-RGVPGGQ---MVNTEEVENYPGFETILGPELAAKMFEHAKKFGAEYAYGDVK------EIIDGEAYKTVIVGDKEYKARAVIIATGA---EYKKLGVPGEAELGGRGVSYCAVCDGAFFKGKDLVVVGGGDSAVEEGVYLT--RFANKVTIVHRRDKLRAQKILQDRAFANEKIDFIWNHTVKQINEKDGKVGSVTLVHTQTGEEREFPCDGVFIYIGMV--PLSKPFANLGITNENGYIVTNEKMETKVPGIFAAGD 278
>gi|109947300|ref|YP_664528.1| hypothetical protein Hac_0729 [Helicobacter acinonychis str. Sheeba] >gi|109714521|emb|CAJ99529.1| trxB [Helicobacter acinonychis str. Sheeba] (311 aa)
Score = 217, Expect = 7.5e-16, Identities = 84/303 (27%), Positives = 148/303 (48%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLN----YEIIDFNESNKTLTIKHKETE--KEQTLPFDYVLVQYGQISSPINIELLNQINK--EKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           D AI+GGG  G+ A   +    + + ++ +K   GGQ   +  +  I ++P   E+ S       +Q  +EQ      L  ++  I   +  +    +   +  +F AK +I+A+G    +P++  I  E   S +    +      +   YKNK++ VLGGGD+AVE A Y     I   V +IHRR+ +R +   ++   KN+ ++ L      EI   N    +L+IK+  T   +E  +P  +V V Y   ++ +  E  + + K  E G  V+D + KTN++ ++A GD   F   P  ++ A ++   A
  S:     3 DCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQ---ITGSSEIENYPGVKEVVSG---LDFMQPWQEQ-CFRFGLKHEMTAIQRVSKKDSHFVILAEDGKTFEAKSVIIATGG---SPKRTGIKGE---SEYWGKGVSTCATCDGFFYKNKEVAVLGGGDTAVEEAIYLA--NICKRVYLIHRRDGFRCAPITLEHARKNDKIEFLTPYVVEEIKGDNAGVSSLSIKNTATNQTRELVVPGFFVFVGYDVNNAVLKQEDGSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIF--APKQVVCAASDGATA 300
>gi|170016284|ref|YP_001723006.1| thioredoxin-disulfide reductase [Leuconostoc citreum KM20] >gi|169804966|gb|ACA83582.1| Thioredoxin-disulfide reductase [Leuconostoc citreum KM20] (309 aa)
Score = 217, Expect = 7.7e-16, Identities = 81/283 (28%), Positives = 137/283 (48%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNILQKLNYEIIDF-NESNKTLTIK--HKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           YDV ++G G GG+ AS  +   NL   +I++  Y GGQ   +     I ++P F  IK  D+ +K+ Q        N  ++    ++   T+++ +    +T+     +K +I+A+G+   N RKL I  E       + Y    +   +KN+ + V+GGGDSA+    Y     IT++V I+H R++ R+   + D   S N I    N  +++   + N+   IK    ++ K  T+    V +  G I +      LN I  E G  + +   +TNI  I+AIGD
  S:     4 YDVIVIGAGPGGMTASLYAARANLKVAMIDRGVY-GGQ---MNNTDDIENYPGFPTIKGPDLGEKMYQN-----TVNAGVEFIFGDVQEVTVDDNQYKHVKTDSEDLVSKVVIIATGS---NNRKLGIPGEKEFSGKGVSYCAVCDGAFFKNENVTVVGGGDSAISEGTYLA--NITDHVGIVHHRDKLRAQKVLQDRAFSNNKIDFTWNSNVVEIVGDDNRVTGIKMVDNQSGKLTTVDTTGVFIYIGNIPNTQMFSNLN-ITDESGWIITNSEMETNIPGIFAIGD 276
>gi|16804516|ref|NP_466001.1| thioredoxin reductase [Listeria monocytogenes EGD-e] >gi|46908650|ref|YP_015039.1| thioredoxin-disulfide reductase [Listeria monocytogenes str. 4b F2365] >gi|47092764|ref|ZP_00230549.1| thioredoxin-disulfide reductase [Listeria monocytogenes str. 4b H7858] >gi|47096070|ref|ZP_00233671.1| thioredoxin-disulfide reductase [Listeria monocytogenes str. 1/2a F6854] >gi|153168586|ref|ZP_01928409.1| thioredoxin-disulfide reductase [Listeria monocytogenes FSL N1-017] >gi|153180575|ref|ZP_01933618.1| thioredoxin-disulfide reductase [Listeria monocytogenes F6900] >gi|153184945|ref|ZP_01935593.1| thioredoxin-disulfide reductase [Listeria monocytogenes J0161] >gi|153192138|ref|ZP_01939183.1| thioredoxin-disulfide reductase [Listeria monocytogenes J2818] >gi|153197216|ref|ZP_01941486.1| thioredoxin-disulfide reductase [Listeria monocytogenes 10403S] >gi|153204049|ref|ZP_01944915.1| thioredoxin-disulfide reductase [Listeria monocytogenes HPB2262] >gi|167015573|ref|ZP_02278106.1| thioredoxin-disulfide reductase [Listeria monocytogenes FSL J1-194] >gi|167454949|ref|ZP_02321172.1| thioredoxin-disulfide reductase [Listeria monocytogenes FSL J2-064] >gi|3122975|sp|O32823|TRXB_LISMO Thioredoxin reductase (TRXR) >gi|2246749|gb|AAB63804.1| thioredoxin reductase [Listeria monocytogenes] >gi|16411966|emb|CAD00556.1| thioredoxin reductase [Listeria monocytogenes] >gi|46881922|gb|AAT05216.1| thioredoxin-disulfide reductase [Listeria monocytogenes str. 4b F2365] >gi|47015531|gb|EAL06463.1| thioredoxin-disulfide reductase [Listeria monocytogenes str. 1/2a F6854] >gi|47018852|gb|EAL09600.1| thioredoxin-disulfide reductase [Listeria monocytogenes str. 4b H7858] >gi|47559002|gb|AAT35570.1| thioredoxin reductase [Listeria monocytogenes] >gi|126942457|gb|EBA20196.1| thioredoxin-disulfide reductase [Listeria monocytogenes J0161] >gi|127633267|gb|EBA22684.1| thioredoxin-disulfide reductase [Listeria monocytogenes 10403S] >gi|127764466|gb|EBA24998.1| thioredoxin-disulfide reductase [Listeria monocytogenes J2818] >gi|133726149|gb|EBA27847.1| thioredoxin-disulfide reductase [Listeria monocytogenes FSL N1-017] >gi|133731968|gb|EBA33666.1| thioredoxin-disulfide reductase [Listeria monocytogenes F6900] >gi|133734461|gb|EBA36159.1| thioredoxin-disulfide reductase [Listeria monocytogenes HPB2262] (319 aa)
Score = 217, Expect = 7.9e-16, Identities = 75/290 (25%), Positives = 134/290 (46%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKL-EINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M  + +IYDV I+G G  G+ A+  ++  +L++++IE+    GGQ   +     + ++P F  I   D+  K++   K+        D        + ++ +E         ++ A+ II+A+G      RKL     E +    + Y    +   +KN++++V+GGGDSAVE   Y    +  + V I+HRR++ R+   + D   K+     I      EI+   +      +       E  +P D V +  G +  P+    LN  I  ++G  V D   +TN+  I+A GD
  S:     1 MASEEKIYDVIIIGAGPAGMTAALYTSRADLDTLMIER-GVPGGQ---MVNTAEVENYPGFDSILGPDLSDKMLSGAKQFGAEYAYGDIK------EVVDGKEFKTVTAGSKTYKARAIIIATGA---EHRKLGAAGEEELSGRGVSYCAVCDGAFFKNRELIVVGGGDSAVEEGTYLT--RYADKVTIVHRRDKLRAQQILQDRAFKDEKVDFIWNSTVEEIVGDGKKVTGAKLVSTVDGSESIMPVDGVFIYVGLV--PLTKAFLNLGITDDEGYIVTDEEMRTNLPGIFAAGD 279
>gi|169187678|ref|ZP_02847837.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Paenibacillus sp. JDR-2] >gi|169005687|gb|EDS52539.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Paenibacillus sp. JDR-2] (350 aa)
Score = 216, Expect = 9.3e-16, Identities = 80/284 (28%), Positives = 152/284 (53%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTD-ILNITWQTINEQELFLFETNKNS---FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRR-----NEYRSSSFM----IDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQI-------SSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +YDV ++GGG  G++++  S    L + LIE + +LGG+ + +YP K I+D         + +I++L++Q        +  D + +LN   ++I + E  +FE + +S    Y+K +I+A G G  NP KL I   E  +   +HY++    + +K+K +++ GGG+SAV+WA   +       + I +R+     +E   ++ +    ++CL    I + L     +  E  +    K  E  +   L  D V++ +G         +S +NIE+++     KG    D + +T++  ++A GD
  S:     6 LYDVTVIGGGPAGLYSTFYSGLRELKTKLIEFQPFLGGK-VHVYPEKMIWDIGGLTPTPGAQLIEQLVKQ-------GLTFDPEVVLNEKVESITKNEDNIFELHGSSGRIHYSKTVIVAVGGGILNPTKLTIEGAEKFEVTNLHYTVK-SLKRFKDKNVVISGGGNSAVDWAMELL--PFAKKIYITYRKEALSGHEANVTTLLNSPKVECLFHTEISKLLANSGDELVEHVELTNSKSGEVSR---LSIDEVVINHGYDRDSSLLENSKLNIEMVDNW-YVKG----DASGETSVPGMFAAGD 291
>gi|89097029|ref|ZP_01169920.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus sp. NRRL B-14911] >gi|89088409|gb|EAR67519.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus sp. NRRL B-14911] (349 aa)
Score = 216, Expect = 1.0e-15, Identities = 87/312 (27%), Positives = 162/312 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTD-ILNITWQTINEQELFLFETNKNS---FYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYR-----------SSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYG--QISSPINIELLNQINKEKGKYVI-DLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           MN+   I+DV I+GGG  G++++  S    + + LIE +  LGG+ + +YP K I+D         + +I +L++Q        +  D + +LN   + I+  E  +F  + +S    Y++ II+A G+G  NP+KL I   E  +   ++Y++    + +K+K +++ GGG+SA++WAN    E +   V I  R+               SS+  + C S   ++   ++E I+       + + + ET +   L  D V++ +G  Q +S +    L +I+  +  Y+  +   +++I  +YA GD      K N I  A  +A  A+
  S:     1 MNQQ-EIFDVTIIGGGPAGLYSAFYSGLREMKTKLIEFQPQLGGK-IHVYPEKMIWDVGGLTPTPGAKLITQLVEQ-------GLTFDPEVVLNEKVEAISRGEDGIFVLSVSSGRLHYSRTIIVAVGSGILNPQKLNIEGAERFEVSNLNYTVK-SLQHFKDKTVIISGGGNSAIDWANEL--EPVARQVYIAFRKENLSGHEAQVSQLLGSSAICLGCTSITKLIAGESHEEIE------KVELTNCETGEVSYLDVDEVIINHGYEQDASLLKNSGL-KIDIAQDFYISGNSCSESSIDGLYAAGDILQHEGKLNLIAGAFQDAANAV 312
>gi|57642035|ref|YP_184513.1| thioredoxin reductase [Thermococcus kodakarensis KOD1] >gi|57160359|dbj|BAD86289.1| thioredoxin reductase [Thermococcus kodakarensis KOD1] (330 aa)
Score = 216, Expect = 1.0e-15, Identities = 77/290 (26%), Positives = 144/290 (49%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFE---------TNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFY 295
           + +DV I+G G  G  A+  +  + L +++I K   LGG  M L     I ++P F E I  S++  ++ +Q K       +L  D++      I+  E   +E          N   + A+ II+A G     PRKL +   E +    + Y    +  ++K KK++V+GGG++A++ A Y   + I  +V ++HRR ++R+   + D   ++ I   L+  + +    +K   + +K+ +T +E  +  D V +  G       ++ L  I  E G   +D+  +T +  I+A GD T+ +
  S:    16 KTWDVLIIGAGPAGFTAAIYAARYGLETLIISKD--LGGN-MAL--TDLIENYPGFPEGISGSELTNRMHEQVK-------KLGVDVIFDEVVRIDPAECAYYEGPCKFTVKTANGKEYKARTIIIAVGAA---PRKLRVPGEEELTGKGVSYCATCDGPLFKGKKVIVVGGGNTALQEALYL--KSIGVDVTLVHRRQQFRADKILQDRFKESGIPAILDTVVTEIIGKDKVEAVRLKNVKTGEETVMEVDGVFIFIGYEPKTDFVKHLG-ITDEYGYIPVDMYMRTKVPGIFAAGDITNVF 300
>gi|146341943|ref|YP_001206991.1| putative thioredoxin reductase, FAD/NAD(P)-binding [Bradyrhizobium sp. ORS278] >gi|146194749|emb|CAL78774.1| Putative thioredoxin reductase, FAD/NAD(P)-binding [Bradyrhizobium sp. ORS278] (342 aa)
Score = 216, Expect = 1.1e-15, Identities = 81/308 (26%), Positives = 151/308 (49%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTL---TIKHKETEK-----EQTLPFDYVLVQYGQISS-PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           M+E ++  DV I+G G  G+FA       ++ + LI+    +GGQ  ELYP K IYD P    +    +  +L++Q K   +    L   + N+  + I +    +       F  K +++A+G GSF P++  +   E  +   + Y++  + E ++ K ++++GGGDSA++W        I   +A+IHRR+++R++   ++ +       K++    ++     +N  L   TIK  +        E  LPF  + ++ G ++   I +E  N I  E   +      +T++  I+AIGD   +  K   I+    E 
  S:     1 MSEAIKT-DVLIIGAGPCGLFAVFELGLLDIKAHLIDILDKVGGQCAELYPEKPIYDIPGVPMVTGQGLTDQLMEQIKP-FSPTFHLGEMVSNV--EKIGDPGFRVTTDAGKVFECKVVVIAAGGGSFQPKRPPVPGIEAYEGTSVFYAVR-KMEQFRGKNVVIVGGGDSALDWTLNL--HPIAKRIALIHRRDDFRAAPHSVEQMRALVASGKMDLRIGQVTALEGTNGQLSAATIKGNDNAVETIPCEMMLPFFGLTMKLGPVADWGIALE-HNLIPVETSAF------ETSVPGIFAIGDINTYPGKIKLILCGFHEG 307
>gi|42779533|ref|NP_976780.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus cereus ATCC 10987] >gi|42735449|gb|AAS39388.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus cereus ATCC 10987] (349 aa)
Score = 216, Expect = 1.1e-15, Identities = 84/312 (26%), Positives = 159/312 (50%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEII-----DFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVID-------LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           MN +  ++DV ++GGG  G++++  S    + + +IE +  LGG+ + +YP K I+D      +    +I++L+QQ    +   + L+T + +I     N+   F  + N     ++K +I+A+G+G   P+KL I   E  +   ++Y++    + +K+K I++ GGG+SAV+WAN    E I   V + +R+ E       +  L  ++     +  I      D +E+ + + + + ET +   L  D V++ +G      +I LL   N E    +ID        N ++++  +YA GD      K + I  A  +A  A+
  S:     1 MNRE-ELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPQLGGK-IHVYPEKMIWDVGGLLPVTGDKLIEQLVQQGLTFQ-PEVVLNTKVESIIR---NKDGTFTLKANDGKEHFSKTVIVATGSGILKPQKLSIEGAERFEVSNLNYTVK-SLKRFKDKTIIISGGGNSAVDWANEL--EPIAKKVYVTYRKEELSGHEAQVKQLLNSSAECFFHTSITKLIAGDSHEAIEYVELTNHETGEVSHLLIDEVIINHGYER---DITLLE--NSELDVAIIDNFYIAGNANSESSVDGLYAAGDILKHEGKLHLIAGAFQDAGNAV 312
>gi|86739243|ref|YP_479643.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Frankia sp. CcI3] >gi|86566105|gb|ABD09914.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Frankia sp. CcI3] (321 aa)
Score = 215, Expect = 1.2e-15, Identities = 72/301 (23%), Positives = 135/301 (44%)
  Q:    12 IVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKE--------QKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL--SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           IVG G  G++ +  + +  ++  L++     GGQ   +YP K IYD      ++  ++I  L+ Q  +        Q+ + +    D + +T    + Q L           AK +++  G G+F PR L      +    +++   L  +++  + ++V+GGGDSA +WA     E I  +V ++HRR+ +R+    ++ +  S   IL      ++   E  + + +    T      P   V+   G  +    +   N +  +K   V+D    T ++ I+A GD T +  K   I T   EA  A+
  S:     3 IVGAGPAGLYGAYYAGFRGMSVALMDSLPEAGGQVTAMYPEKVIYDIAGLPAVRGRELIDALLIQANQFSPTYLLGQQAAELAHKPDAVVVT----SSQGL--------RVRAKVVVITGGLGTFAPRPLPTGTAHLGRGLVYFVPKL--DVHTGQDVIVVGGGDSAFDWA--LALEPIARSVTLVHRRDRFRAHMSTVERVEASSVEILTFTEVAMVHGEEWIEKVELVQTRTGDRHVRPAQAVVAALGFTADLGPLTRWN-LTIDKRHIVVDPTMATGVERIFAAGDITEYPGKVRLIATGFGEAATAV 296
>gi|150015016|ref|YP_001307270.1| thioredoxin reductase [Clostridium beijerinckii NCIMB 8052] >gi|149901481|gb|ABR32314.1| thioredoxin reductase [Clostridium beijerinckii NCIMB 8052] (311 aa)
Score = 215, Expect = 1.2e-15, Identities = 87/317 (27%), Positives = 159/317 (50%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQK-LNYEIIDFN--ESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQIN-KEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           M+++ +  D+ I+GGG  G+ A+  +    L+++L+E +  +GGQ    Y    I ++P F  I   D +  + Q+      +NI  + D +   + + +E+   + ET    +  K +I+A+G     PRKL I   E      IHY    +  +Y+ KK+ V+GGG+SA+E + +    +    V +I R + ++    +ID +  N  ++  LN ++I  N  E  +++ IK  +T++  +L  + V    G  + P   E+ + I   E+G  + D + +TNI+ +YA GD      K   I TA ++   AL +  K
  S:     1 MSKEKKELDLIIIGGGPAGLTAAMYAGRAKLDTLLLENE-LVGGQVRNSYT---IENYPGFKSIGGGD-LADIFQEQARDLGANID-EFDSIEKIYISDDEK---IIETESYVYQPKAVIIATGAA---PRKLPIPQEEQFSGRGIHYCAICDGALYQGKKVAVVGGGNSALEESIFLT--RFAEKVYLIRRYDYFKGEQSLIDEVFNNPKIEVLLNKDLIQANGKEFLESVIIKDTKTQESSSLDVNAVFGYIG--TEPRTKEVKDYIKLNEQGYIITDEDLQTNIQGVYAAGDVRQ--KKYRQITTAVSDGTIALLNAEK 304
>gi|75675282|ref|YP_317703.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nitrobacter winogradskyi Nb-255] >gi|74420152|gb|ABA04351.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nitrobacter winogradskyi Nb-255] (342 aa)
Score = 215, Expect = 1.3e-15, Identities = 77/308 (25%), Positives = 154/308 (50%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSK---NNILQKLNYEIIDFNESNKTLTIKHKETEKEQT--------LPFDYVLVQYGQISS-PINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           M+E ++  DV I+G G  G+FA       ++   L++    +GGQ  ELYP K IYD P    +    + + L++Q K   N    L+  + +I  + I +    +       F  K +++++G GSF P++  +   E  ++  + Y++  + E +++K+IL++GGGDSA++W        +   + ++HRR+E+R++   ++ + K   +  +     ++     ++  LT    +     T        LPF  + ++ G +++  +++E  N I  E   +      +TN+  I+AIGD   +  K   I++   E 
  S:     1 MSEAIKT-DVLIIGAGPCGLFAVFELGLLDMKVHLVDILDKIGGQCAELYPEKPIYDIPGIPLVTGQGLTEALLEQIKP-FNPTFHLNEMVESI--EKIGDPGFRVTTDAGQVFECKVVVVSAGGGSFQPKRPPVPGIEAYENISVFYAVR-KMEQFRDKEILIVGGGDSALDWTLNL--HPLAKRITLLHRRDEFRAAPHSVEQMRKLVADGTMDLKIGQVTALEGADGKLTGAQVKGSDNTTSTVSCDTMLPFFGLTMKLGPVANWGLHLE-NNLIPVETASF------ETNVPGIFAIGDINTYPGKLKLILSGFHEG 307
>gi|148642400|ref|YP_001272913.1| thioredoxin reductase (NADPH), TrxB [Methanobrevibacter smithii ATCC 35061] >gi|148551417|gb|ABQ86545.1| thioredoxin reductase (NADPH), TrxB [Methanobrevibacter smithii ATCC 35061] (304 aa)
Score = 215, Expect = 1.3e-15, Identities = 78/286 (27%), Positives = 146/286 (51%)
  Q:     5 LRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNI--LQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYG-----QISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           ++ YD+ IVG G GG+ A   +      +++++K    GG   E+     + ++P F  I   ++++K+    K Q    I+L  + +    +  N+   FL  T+K+ +  K IILA+G+     + LEI   E      + Y    +   +K+K  +++GGG+SA++ A +   + +  NV IIHRR+E R+  ++   + + NI  +     E I  N    ++ +K+ +T +        V V  G     +++  +N+EL      E G+ + D +Q+TNI+N+Y+ GD
  S:     1 MKTYDIIIVGAGPGGLTAGIYAGRQGTKTLILDK-GLAGGIGREV---PLMENYPGFDTISGFELVEKM----KLQCMKYIELHENEIVKNIEKNNDN--FLVTTHKDEYCGKTIILATGSSH---KHLEIPGEEEYLGKGVSYCATCDGLFFKDKDAIMIGGGNSALQEAIFL--DNVGCNVTIIHRRDELRAQQYLQKEIKERNIDVIYDTTVEEIKGNALVNSVILKNVKTNEYSEFKTQGVFVGIGYKPHNELAKKLNVEL-----SESGEIITDKHQRTNIENVYSAGD 274
>gi|153175730|ref|ZP_01931034.1| thioredoxin-disulfide reductase [Listeria monocytogenes FSL N3-165] >gi|133729155|gb|EBA30853.1| thioredoxin-disulfide reductase [Listeria monocytogenes FSL N3-165] (319 aa)
Score = 215, Expect = 1.3e-15, Identities = 75/290 (25%), Positives = 133/290 (45%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKL-EINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M  + +IYDV I+G G  G+ A+  ++  +L++++IE+    GGQ   +     + ++P F  I   D+  K++   K+        D        + ++ +E         ++ A+ II+A+G      RKL     E +    + Y    +   +KN++++V+GGGDSAVE   Y    +  + V I+HRR++ R+   + D   K+     I      EI+   +      +       E  +P D V +  G +  P+    LN  I   +G  V D   +TN+  I+A GD
  S:     1 MASEEKIYDVIIIGAGPAGMTAALYTSRADLDTLMIER-GVPGGQ---MVNTAEVENYPGFDSILGPDLSDKMLSGAKQFGAEYAYGDIK------EVVDGKEFKTVTAGSKTYKARAIIIATGA---EHRKLGAAGEEELSGRGVSYCAVCDGAFFKNRELIVVGGGDSAVEEGTYLT--RYADKVTIVHRRDKLRAQQILQDRAFKDEKVDFIWNSTVEEIVGDGKKVTGAKLVSTVDGSESIMPVDGVFIYVGLV--PLTKAFLNLGITNAEGYIVTDEEMRTNLPGIFAAGD 279
>gi|92116877|ref|YP_576606.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nitrobacter hamburgensis X14] >gi|91799771|gb|ABE62146.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nitrobacter hamburgensis X14] (342 aa)
Score = 214, Expect = 1.6e-15, Identities = 55/207 (26%), Positives = 111/207 (53%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSK 207
           M+E ++  DV I+G G  G+FA       ++   L++    +GGQ  ELYP K IYD P    +    + + L++Q K   N N  L+  + +I  + I +    +       F  K +++++G GSF P++  +   E  ++  + Y++  + E +++++IL++GGGDSA++W        +   + ++HRR+++R++   ++ + K
  S:     1 MSEAIKT-DVLIIGAGPCGLFAVFELGLLDMKVHLVDILDKIGGQCAELYPEKPIYDIPGIPFVTGQGLTEALLEQIKP-FNPNFHLNEMVESI--EKIGDPGFRVTTDAGKVFECKIVVVSAGGGSFQPKRPPVPGIEAYENTSVFYAVR-KMEQFRDREILIVGGGDSALDWTLNL--HPLAKRITLLHRRDDFRAAPHSVEQMRK 201
>gi|167748491|ref|ZP_02420618.1| hypothetical protein ANACAC_03235 [Anaerostipes caccae DSM 14662] >gi|167652483|gb|EDR96612.1| hypothetical protein ANACAC_03235 [Anaerostipes caccae DSM 14662] (311 aa)
Score = 214, Expect = 1.6e-15, Identities = 75/286 (26%), Positives = 143/286 (50%)
  Q:     5 LRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDV-------IKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEI---IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQIN-KEKGKYVIDLNQKTNIKNIYAIGD 290
           ++IYD+ I+G G  G+ A+  +    L  +++EK++  GGQ ++ Y    + ++P   ++   D+          L  + K  + S I+ D  I  I  +            N      K ++LA+G      RKL +   E +    + Y    +   ++NK + V+GGGD A+E A +    +I   V +IHRR+E+R +  + D ++KN+ +Q +   +   ID NE  ++++IK    + +++L  D + +  G  ++P +  L +++   E+G      +  TNI  I+  GD
  S:     1 MKIYDLIIIGAGPAGMSAAIYAKRAMLEVLVLEKEAMSGGQIVQTYE---VDNYPGLPKMTGMDLGDQFFNHASDLGAEVKTGEVSEIRHDQPIKEIVLK------------NGEVLKTKTVMLATGA---THRKLGVPGEEELTGLGVSYCATCDGAFFRNKTVAVVGGGDVALEDALFL--SRICEKVYLIHRRDEFRGAKILRDQVTKNDKIQVIWNTVVTKIDGNERVESISIKDVHNDVDKSLKVDGIFIAVG--TAPQSTLLKDELEMDERGYIAAGEDGVTNIPGIFVGGD 276
>gi|57650916|ref|YP_187174.1| pyridine nucleotide-disulfide oxidoreductase [Staphylococcus aureus subsp. aureus COL] >gi|87160801|ref|YP_494954.1| pyridine nucleotide-disulfide oxidoreductase [Staphylococcus aureus subsp. aureus USA300] >gi|88196294|ref|YP_501116.1| hypothetical protein SAOUHSC_02654 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148268809|ref|YP_001247752.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Staphylococcus aureus subsp. aureus JH9] >gi|150394879|ref|YP_001317554.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Staphylococcus aureus subsp. aureus JH1] >gi|151222486|ref|YP_001333308.1| pyridine nucleotide-disulfide oxidoreductase family protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|161510566|ref|YP_001576225.1| thioredoxin-disulfide reductase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728958|ref|ZP_02761235.1| possible thioredoxin-disulfide reductase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|57285102|gb|AAW37196.1| pyridine nucleotide-disulfide oxidoreductase [Staphylococcus aureus subsp. aureus COL] >gi|87126775|gb|ABD21289.1| pyridine nucleotide-disulfide oxidoreductase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203852|gb|ABD31662.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147741878|gb|ABQ50176.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Staphylococcus aureus subsp. aureus JH9] >gi|149947331|gb|ABR53267.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Staphylococcus aureus subsp. aureus JH1] >gi|150375286|dbj|BAF68546.1| pyridine nucleotide-disulfide oxidoreductase family protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|160369375|gb|ABX30346.1| possible thioredoxin-disulfide reductase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (344 aa)
Score = 213, Expect = 2.4e-15, Identities = 80/303 (26%), Positives = 157/303 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFY-AKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNI----LQKLNYEIIDFNESN-KTLTIKHKETEKEQTLPFDYVLVQYG-QISSPINIELLNQINKEKGKYVIDL-NQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           DV I+GGG  G++AS  +   +++  LI+ +S LGG+ M +YP K I+D          +++K  I+Q    K   + L+  +++I  +    +  F  ET     Y +K +I+A G G  NP++L++   E      +HY +      +K+K +L+ GGG++A++WA+     KI  +V +++R+ +      M   ++  N+      ++ Y + + +E++   + ++H E+    T+ FD V++ +G    + +  E  ++++      V    N  T+I  IYA GD  +   K + I +A ++   A
  S:     3 DVTIIGGGPSGLYASFYAGLRDMSVRLIDVQSELGGK-MRIYPEKIIWDIGGIAPKPCHEILKDTIKQGLYFK-PEVHLNERVVDIRKKA---ERHFEVETEAGEIYTSKAVIIAIGAGIINPKQLDVKGVERYQLTNLHYVVQ-SYRRFKDKDVLISGGGNTALDWAHDIA--KIAKSVTVVYRKEDVSGHEAMKTLVTDLNVKLCPKTRIKYLVGNDDETHISEVVLEHVESGDRHTVKFDDVIISHGFDRCNTLLSETSSKLDMHDDCRVKGFGNTTTSIPGIYACGDIVYHDAKSHLIASAFSDGANA 306
>gi|34556881|ref|NP_906696.1| thioredoxin reductase [Wolinella succinogenes DSM 1740] >gi|34482596|emb|CAE09596.1| THIOREDOXIN REDUCTASE [Wolinella succinogenes] (316 aa)
Score = 213, Expect = 2.5e-15, Identities = 78/284 (27%), Positives = 140/284 (49%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQ-----PMELYPN-KFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKT----LTIKHKETEKEQTLPFDYVLVQYG-----QISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           + DVAI+GGG  G+ A   +      ++++ +K  +GGQ      ME YP    +     F E       +  +Q              ++  I  Q+  E    +  ++   F A+ +I+ +G     P+K  +  E       +      +   Y+N+ + V+GGGD+A+E A Y     I ++V +IHRR E+R++   ++ + KN  +  L   +I+    + +    + I+HKE+++ +TL    V V  G     Q+    +   L ++N EKG+ V+DL+ KTNI  ++A GD
  S:     2 VLDVAIIGGGPAGLSAGLYATRGGAENVVLFEKGMVGGQITSSSEMENYPGVAHVMSGLDFMEPWREQCFRFGLQHEM----------AEVSRIARQS--EGNFAIHLSDGRIFEARSVIVTTGG---KPKKAGVKGELEFFGRGVSTCATCDGFFYRNRDVAVIGGGDTALEEALYLA--NICSHVYLIHRREEFRAAPLSVEKVKKNPKITLLTSRVIEEIVGDASGVNGVKIRHKESKEVETLSVMGVFVFVGYDVNHQVLKQEDGSFLCEVN-EKGEVVVDLSMKTNIPGLFAAGD 283
>gi|21284023|ref|NP_647111.1| hypothetical protein MW2294 [Staphylococcus aureus subsp. aureus MW2] >gi|49487156|ref|YP_044377.1| pyridine nucleotide-disulphide oxidoreductase family protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|21205466|dbj|BAB96159.1| MW2294 [Staphylococcus aureus subsp. aureus MW2] >gi|49245599|emb|CAG44077.1| pyridine nucleotide-disulphide oxidoreductase family protein [Staphylococcus aureus subsp. aureus MSSA476] (344 aa)
Score = 212, Expect = 3.1e-15, Identities = 80/303 (26%), Positives = 157/303 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFY-AKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNI----LQKLNYEIIDFNESN-KTLTIKHKETEKEQTLPFDYVLVQYG-QISSPINIELLNQINKEKGKYVIDL-NQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           DV I+GGG  G++AS  +   +++  LI+ +S LGG+ M +YP K I+D          +++K  I+Q    K   + L+  +++I  +    +  F  ET     Y +K +I+A G G  NP++L++   E      +HY +      +K+K +L+ GGG++A++WA+     KI  +V +++R+ +      M   ++  N+      ++ Y + + +E++   + ++H E+    T+ FD V++ +G    + +  E  ++++      V    N  T+I  IYA GD  +   K + I +A ++   A
  S:     3 DVTIIGGGPSGLYASFYAGLRDMSVRLIDVQSELGGK-MRIYPEKIIWDIGGIAPKPCHEILKDTIKQGLYFK-PEVHLNERVVDIRKKA---ERHFEVETEAGEIYTSKAVIIAIGAGIINPKQLDVKGVERYQLTNLHYVVQ-SYRRFKDKDVLISGGGNTALDWAHDIA--KIAKSVTVVYRKEDVSGHEAMKTLVTDLNVKLCPKTRIKYLVGNDDETHISEVVLEHVESGDTHTVKFDDVIISHGFDRCNTLLSETSSKLDMHDDCRVKGFGNTTTSIPGIYACGDIVYHDAKSHLIASAFSDGANA 306
>gi|82751968|ref|YP_417709.1| thioredoxin reductase [Staphylococcus aureus RF122] >gi|82657499|emb|CAI81941.1| probable thioredoxin reductase [Staphylococcus aureus RF122] (344 aa)
Score = 211, Expect = 3.5e-15, Identities = 80/303 (26%), Positives = 157/303 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFY-AKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNI----LQKLNYEIIDFNESN-KTLTIKHKETEKEQTLPFDYVLVQYG-QISSPINIELLNQINKEKGKYVIDL-NQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           DV I+GGG  G++AS  +   +++  LI+ +S LGG+ M +YP K I+D          +++K  I+Q    K   + L+  +++I  +    +  F  ET     Y +K +I+A G G  NP++L++   E      +HY +      +K+K +L+ GGG++A++WA+     KI  +V +++R+ +      M   ++  N+      ++ Y + + +E++   + ++H E+    T+ FD V++ +G    + +  E  ++++      V    N  T+I  IYA GD  +   K + I +A ++   A
  S:     3 DVTIIGGGPSGLYASFYAGLRDMSVRLIDVQSELGGK-MRIYPEKIIWDIGGIAPKPCHEILKDTIKQGLYFK-PEVHLNERVVDIRKKA---ERHFEVETEAGEIYTSKAVIIAIGAGIINPKQLDVKGVERYQLTNLHYVVQ-SYRRFKDKDVLISGGGNTALDWAHDIA--KIAKSVTVVYRKEDVTGHEAMKTLVTDLNVKLCPKTRIKYLVGNDDETHISEVVLEHVESGDTHTVKFDDVIISHGFDRCNTLLSETSSKLDMHDDCRVKGFGNTTTSIPGIYACGDIVYHDAKSHLIASAFSDGANA 306
>gi|118586970|ref|ZP_01544402.1| thioredoxin reductase [Oenococcus oeni ATCC BAA-1163] >gi|118432592|gb|EAV39326.1| thioredoxin reductase [Oenococcus oeni ATCC BAA-1163] (313 aa)
Score = 211, Expect = 4.0e-15, Identities = 80/283 (28%), Positives = 137/283 (48%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNK----EQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNI---LQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           YDV I+G G  G+ A+T ++  NL+ ++I+K  Y GGQ   +     + ++P F  I   D+ +K+   +     E     +Q            I+  +     T+   + AK +I+ASG      R + +  E       + Y    +   +KN++I+V+GGGDSAVE A+Y     +  +V I+HRR++ R+S          +NI     K   EII  +E    + +  K + +E  +  + V +  G   +   +E L  ++ EKG  + D N +T +  IYA+GD
  S:     5 YDVVIIGAGPAGMTAATYASRANLSVMMIDKGIY-GGQ---MNDTAEVENYPAFDSILGPDLAEKMYASSTRFGAEYTFGEVQ----------NVIDHGKTKTIVTDDEQYEAKVVIVASGA---THRHIGVPGEDKYSGRGVSYCAVCDGAFFKNEQIVVIGGGDSAVEEASYLA--NLAKDVTIVHRRDQLRASRIAQKRAFDTDNIDFSWNKRTEEIIGDDEKVTGVKVLDKISNQESVIKTNGVFIYVGIDPNTQGLENLGILD-EKGWVLTDDNMQTKVPGIYAVGD 276
>gi|50843746|ref|YP_056973.1| thioredoxin reductase [Propionibacterium acnes KPA171202] >gi|50841348|gb|AAT84015.1| thioredoxin reductase [Propionibacterium acnes KPA171202] (350 aa)
Score = 210, Expect = 4.6e-15, Identities = 80/303 (26%), Positives = 146/303 (48%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKN-NILQKLNYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI--DLNQKTNIKNIYAIGDA--THFYCKPNTIITACAEAVRA 311
           DV IVG G  G  A+  +    L  ++ E     GG  M+      + ++P F E I   D++ ++  Q +      I  D   +++T +        L +T+ N++ A  +ILA G+     RKL + +EP +    + +    +   +  K I V+GGGDSAVE A +    +  N+V ++HRR++ R+S  M D  + +  I    N E++     +K  ++T++  +T +E+ L    V    G    P +  +  Q++ +   YV+  + + +TN+  ++A GD   +H+       +TA     RA
  S:    45 DVIIVGSGPAGYTAAVYTARAGLKPLVFEGSMDAGGALMQ---TTEVENYPGFSEGIMGPDLMAQMRAQAERFGAELIADDVTDIDLTGEIKK-----LVDTDGNTYKAHVVILAMGSAY---RKLGLEDEPRLSGRGVSWCATCDGFFFTGKDIAVVGGGDSAVEEATFLT--RFANSVTLVHRRDQLRASQIMADRAAADPKITFAWNSEVVAMQGESKLESITLRDTKTGEERQLEVAGVFEAIGH--DPRSELVRGQVDLDDAGYVVCAEPSTRTNVPGVFACGDLVDSHY----QQAVTAAGSGCRA 337
>gi|167045276|gb|ABZ09934.1| putative Pyridine nucleotide-disulphide oxidoreductase [uncultured marine crenarchaeote HF4000_APKG9P22] (310 aa)
Score = 210, Expect = 4.8e-15, Identities = 83/319 (26%), Positives = 159/319 (49%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNILQKLNYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI-DLNQKTNIKNIYAIGDA-THFYCKPNTIIT-ACAEAVRALWHISKNK 319
           M+E    +D+ ++G G  G  A   S+    +++LI      GGQ M       + ++P F E I   D++  +I + + +K     +D +++++ +++    +     T  ++F A  +I+ +G    NPRK+ ++ E       + Y    +   +KN++++V+GGGDSA+E A +    K  + V I+HRR+E+R+S  M +  LS   I    N  + D     K   + +K+ + +++ TL    + V  G    P +  L +Q+  +K  YV+   N +T+I  ++  GD   H Y +  T     C  A+ A  ++++ K
  S:     1 MSEQKTKHDIIVIGAGPAGYTAGIYSSRARRDTLLISG-ILPGGQLMN---TTDVENYPGFDEGIMGPDLM--IIMRKQAEKMGTKIIDDEVVSVDFKS----KPLKVSTASSTFEANSVIVCTGA---NPRKIGLDGEQAFAGKGVSYCATCDGAFFKNQELIVVGGGDSAMEEATFLT--KFASTVHIVHRRDEFRASKIMQERALSNEKIKVHFNCTVEDIQGDQKFQKVILKNVKNDEKITLEAGGLFVAIGH--EPNSKILEDQVELDKNGYVVLKNNTETSIPGVFCAGDVHDHRYRQAVTAAGFGCMAAIDADKYLAEQK 310
>gi|166030518|ref|ZP_02233347.1| hypothetical protein DORFOR_00179 [Dorea formicigenerans ATCC 27755] >gi|166029680|gb|EDR48437.1| hypothetical protein DORFOR_00179 [Dorea formicigenerans ATCC 27755] (307 aa)
Score = 210, Expect = 5.2e-15, Identities = 90/312 (28%), Positives = 156/312 (50%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKN-NILQKLNYEI--IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKE-KGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           MNE+  +YD+ IVGGG GG  ++  +     ++I++EK S  GGQ M L     I ++P F        + + +Q+  E+  +  +   ++ N+        +L   ET+   +  K +++A+G    NPRKL +  E  +    + Y  + +   YK+K ++V+GGG+SAV  ++  +  +I   V I+HRR+  R++    D L K  NI  + N  +  + + E    + +K   T +E  +  D + V  G+   P    L NQI  + KG  V   N +T+I  +YA+GD      +   I+TA A+   A+
  S:     1 MNEN-HVYDMIIVGGGPGGYTSALYAARAGFDTIVLEKLS-AGGQ-MSLTWQ--IDNYPGFENGIDGFSLAEKMQKQAEKFGAKSEY-AEVFNMDLTG----KLKRVETSSGIYIGKTVVIATGA---NPRKLGLAKEKELIGHGVAYCASCDGMFYKDKIVVVVGGGNSAV--SDAVLLSRIAKKVIIVHRRDTLRATKIYHDQLMKTENIELRWNNTVNELIYGERLTGVRLKDTVTGEENIIECDGLFVSIGR--KPTTDFLDNQIELDNKGYIVAGENTETSIPGVYAVGDVRTKLLR--QIVTAVADGAMAV 298
>gi|161507010|ref|YP_001576964.1| thioredoxin reductase [Lactobacillus helveticus DPC 4571] >gi|160347999|gb|ABX26673.1| Thioredoxin reductase [Lactobacillus helveticus DPC 4571] (288 aa)
Score = 210, Expect = 5.5e-15, Identities = 89/285 (31%), Positives = 136/285 (47%)
  Q:    34 ILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINE----QELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL-SKNNILQKLNYEIIDFNESNKTLTIKHK-----ETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISKN 318
           ++ +  S +GGQP  LYP K I D P +  I  + +I+ L         S +  +T+I  IT   +N+     + F+ +   N   AK II+A+G G+F P++L +         +HY +  + + + N+KI V GGG+SA++ A   +E     NV IIHRRNE+R     +  L S  N+     Y   D    N  L I  K     ++  EQ   FD ++V YG  +    I+    I        +D   KTNI  IYA GD   +  +   I     EA  A+  I ++
  S:     1 MIFDSLSEVGGQPQMLYPFKKISDIPAYNSINGTALIQNL--------KSGLPKETEI--ITNHKVNDIKKNADGFVLD---NVVLAKSIIIATGAGAFKPKELPLKMRDEIQKRVHYFIK-DPKDFANQKIGVFGGGNSALDLA---IELANYANVKIIHRRNEFRGLELNVKKLRSLTNVEILTPYLPKDIQLINNQLDITLKGMGDVQSRHEQ---FDQIVVAYGFKADNRFIKNWG-IELNGTNIAVDPTMKTNIDGIYAAGDVVSYPGRVPLIALGFGEAQIAITSIMRD 274
>gi|167043997|gb|ABZ08683.1| putative Pyridine nucleotide-disulphide oxidoreductase [uncultured marine crenarchaeote HF4000_APKG3K8] (310 aa)
Score = 209, Expect = 6.4e-15, Identities = 84/319 (26%), Positives = 157/319 (49%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNILQKLNYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQIN-KEKGKYVIDLNQKTNIKNIYAIGDA-THFYCKPNTIIT-ACAEAVRALWHISKNK 319
           M+E    YD+ ++G G  G  A   S+    +++LI      GGQ M       + ++P F E I   D++  +I + + +K     +D +++++ +++    +     T  ++F A  +I+ +G    NPRK+ ++ E       + Y    +   +KN++++V+GGGDSA+E A +    K  + V I+HRR+E+R+S  M +  LS   I    N  + D     K     +K+ + +++ TL    + V  G    P +  L +Q+   E G  V+  N +T+I  ++  GD   H Y +  T     C  A+ A  ++++ K
  S:     1 MSEQKTKYDIIVIGAGPAGYTAGIYSSRARRDTLLISG-ILPGGQLMN---TTDVENYPGFDEGIMGPDLM--IIMRKQAEKMGTKIIDDEVVSVDFKS----KPLKVSTASSTFEANSVIVCTGA---NPRKIGLDGEQTFAGKGVSYCATCDGAFFKNQELIVVGGGDSAMEEATFLT--KFASTVHIVHRRDEFRASKIMQERALSNEKIKVHFNCTVEDIQGDQKFQKAILKNVKNDEKITLEAGGLFVAIGH--EPNSKILEDQVELDENGYVVLKNNTETSIPGVFCAGDVHDHRYRQAVTAAGFGCMAAIDADKYLAEQK 310
>gi|163764597|ref|ZP_02171653.1| NLPA lipoprotein [Bacillus selenitireducens MLS10] >gi|160354975|gb|EDP81632.1| NLPA lipoprotein [Bacillus selenitireducens MLS10] (319 aa)
Score = 208, Expect = 8.0e-15, Identities = 79/290 (27%), Positives = 146/290 (50%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNK----EQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQ-KLNYEIIDFN-ESNKTLTIKHKETEKEQTLPF--DYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M+E+ RIYDV I+G G  G+ A+  ++  NL++++IE +   GGQ   +   + + ++P +  I   D+ +K+ + ++    E +  +++          + I+ +E             + II+ +G      + L +  E  +    + Y    +   +K K+++V+GGGDSAVE A Y    +  + V I+HRR++ R+   + D    N+ ++ + N+ + + N E  K  ++  + T+   T  F  D V +  G    PIN   LN  I  E G  V + N +T+I  I+A GD
  S:     1 MSEE-RIYDVVIIGAGPAGMTAAVYTSRANLDTVMIE-RGMPGGQ---MANTEDVENYPGYDSILGPDLSQKMFEHSRKFGAEYQYGDVK----------EIIDGKEYKTIVLGNGEVKTRSIIIGTGA---KYKHLNVPGEQELGGRGVSYCAVCDGAFFKEKELVVVGGGDSAVEEAVYLT--RFASKVTIVHRRDQLRAQKILQDRAFDNDKIEFEWNHVVKEINGEGGKVSSVTLESTKDGSTKDFKTDGVFIYIGM--DPINEPFLNLGITNEDGYVVTNENMETDIPGIFAAGD 278
>gi|49484590|ref|YP_041814.1| pyridine nucleotide-disulphide oxidoreductase family protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|49242719|emb|CAG41443.1| pyridine nucleotide-disulphide oxidoreductase family protein [Staphylococcus aureus subsp. aureus MRSA252] (344 aa)
Score = 208, Expect = 8.0e-15, Identities = 79/303 (26%), Positives = 157/303 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFY-AKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNI----LQKLNYEIIDFNESN-KTLTIKHKETEKEQTLPFDYVLVQYG-QISSPINIELLNQINKEKGKYVIDL-NQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           DV I+GGG  G++AS  +   +++  LI+ +S LGG+ M +YP K I+D          +++K  I+Q    K   + L+  +++I  ++   +  F  ET     Y +K +I+A G G  NP++L++   E      +HY +      +K+K +L+ GGG++A++WA+     KI  +V +++R+ +      M   ++  N+      ++ Y + + +E++   + ++H E+     + FD V++ +G    + +  E  ++++      V    N  T+I  IYA GD  +   K + I +A ++   A
  S:     3 DVTIIGGGPSGLYASFYAGLRDMSVRLIDVQSELGGK-MRIYPEKIIWDIGGIAPKPCHEILKDTIKQGLYFK-PEVHLNERVVDIRKKS---ERHFEVETEAGEIYTSKAVIIAIGAGIINPKQLDVKGVERYQLTNLHYVVQ-SYRRFKDKDVLISGGGNTALDWAHDIA--KIAKSVTVVYRKEDVSGHEAMKTLVTDLNVKLCPKTRIKYLVGNDDETHISEVVLEHVESGDTHAVKFDDVIISHGFDRCNTLLSETSSKLDMHDDCRVKGFGNTTTSIPGIYACGDIVYHDAKSHLIASAFSDGANA 306
>gi|15645444|ref|NP_207618.1| thioredoxin reductase (trxB) [Helicobacter pylori 26695] >gi|3024765|sp|P56431|TRXB_HELPY Thioredoxin reductase (TRXR) >gi|151567914|pdb|2Q0K|A Chain A, Oxidized Thioredoxin Reductase From Helicobacter Pylori In Complex With Nadp+ >gi|151567915|pdb|2Q0K|B Chain B, Oxidized Thioredoxin Reductase From Helicobacter Pylori In Complex With Nadp+ >gi|151567916|pdb|2Q0L|A Chain A, Helicobacter Pylori Thioredoxin Reductase Reduced By Sodium Dithionite In Complex With Nadp+ >gi|151567917|pdb|2Q0L|B Chain B, Helicobacter Pylori Thioredoxin Reductase Reduced By Sodium Dithionite In Complex With Nadp+ >gi|2313959|gb|AAD07875.1| thioredoxin reductase (trxB) [Helicobacter pylori 26695] (311 aa)
Score = 207, Expect = 1.1e-14, Identities = 78/303 (25%), Positives = 150/303 (49%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN----KTLTIKHKET--EKEQTLPFDYVLVQYGQISSPINIELLNQINK--EKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           D AI+GGG  G+ A   +    + + ++ +K   GGQ   +  +  I ++P   E+ S       +Q  +EQ      L  ++  +   +  +    +   +  +F AK +I+A+G    +P++  I  E   S +    +      +   YKNK++ VLGGGD+AVE A Y     I   V +IHRR+ +R +   ++    N+ ++ L   +++  + +     +L+IK+  T  ++E  +P  ++ V Y   ++ +  E  + + K  E G  V+D + KTN++ ++A GD   F   P  ++ A ++   A
  S:     3 DCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQ---ITGSSEIENYPGVKEVVSG---LDFMQPWQEQ-CFRFGLKHEMTAVQRVSKKDSHFVILAEDGKTFEAKSVIIATGG---SPKRTGIKGE---SEYWGKGVSTCATCDGFFYKNKEVAVLGGGDTAVEEAIYLA--NICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTATNEKRELVVPGFFIFVGYDVNNAVLKQEDNSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIF--APKQVVCAASDGATA 300
>gi|167730621|emb|CAO81533.1| Thioredoxin reductase [Candidatus Cloacamonas acidaminovorans] (310 aa)
Score = 207, Expect = 1.2e-14, Identities = 75/311 (24%), Positives = 146/311 (46%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI-DLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           +YDV I+G G  G+ A+  S    L ++++E+   +GGQ   +   + + ++P F E  S   +   + +  E   +  + D ++  +  + + +    + ET +N +  K +I  +G     PR+L +   E      + Y    +  +Y++K + V+GGGDSA+E   +         V +IHRR+E R+   + +   +N  ++ +   ++     N   + L +  ++T     +P D V +  G +  P N  L ++I  +   +VI D   +TN+  IYA GD      +   ++TA ++   A W   K
  S:     1 MYDVIIIGAGPAGLSAAIYSARSGLKTVVLER-GLIGGQ---INVTEDVENYPGFAESISGYELTDRMHRQAEHFGAEFR-DEEVTALGMEGLCK----IIETTENKYRTKAVIFCTGA---YPRRLNVPGEEKFTGHGVSYCATCDGALYRDKIVAVIGGGDSAIEEGIFLTH--FARKVIVIHRRDELRAQKIIQERAFQNPKIEFVWNSVVQEIRGNTRVQELEVYSRKTNSLSVIPVDGVFIYVGIL--PNNKLLESRIELDSAGFVITDDFMQTNVPGIYAAGDIRKKVLR--QVVTATSDGAIAGWSAEK 298
>gi|182626003|ref|ZP_02953766.1| thioredoxin-disulfide reductase [Clostridium perfringens D str. JGS1721] >gi|177908710|gb|EDT71221.1| thioredoxin-disulfide reductase [Clostridium perfringens D str. JGS1721] (312 aa)
Score = 206, Expect = 1.4e-14, Identities = 84/317 (26%), Positives = 161/317 (50%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLS-KNNILQKLNYEIIDF--NESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ-IN-KEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           M+++++  D+ I+G G  G+ ++  ++   L+++++E  + +GGQ    Y    + ++P F EI  +D+  + IQ   E   + I     I N++ +   +    + ET    +  K +I+A+G     P+KL I   P +S +    +HY    +  +Y+++ + V+GGG++A+E A Y     I   V +I R + +R+ +  ++  S K NI    N++++D    E  +   IK+ +T +E+ +  + V   +G I +     +  + IN KE G    D N +TN+K +Y  GD      +   I TA ++   A  H  K
  S:     1 MDKEIKELDLIIIGAGPAGLTSAIYASRAKLSTLVLED-NLVGGQVRSTYT---VENYPGFTEITGNDLADR-IQAQAEACGAIIDEFDFIENVSLKDDEK----IIETGDYIYKPKAVIIATGA---TPKKLPI---PSESKYLGKGVHYCAVCDGAVYQDEVVAVIGGGNAALEEALYL--SNIVKKVIVIRRYDYFRAEAKTLEAASNKENIEIMYNWDLVDVLGGEFVEAARIKNTKTGEEKEIAINGV---FGYIGTEPKTSMFREYINVKENGYIEGDENMRTNVKGVYVAGDVREKMFR--QITTAVSDGTIAALHAEK 304
>gi|15894156|ref|NP_347505.1| thioredoxine reductase [Clostridium acetobutylicum ATCC 824] >gi|15023764|gb|AAK78845.1|AE007602_6 Thioredoxine reductase [Clostridium acetobutylicum ATCC 824] (308 aa)
Score = 206, Expect = 1.4e-14, Identities = 83/285 (29%), Positives = 145/285 (50%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSK-NNILQKLNYEI--IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQIN--KEKGKYVIDLNQKTNIKNIYAIGD 290
           +I D+ I+G G  G+ A   S+   L+ I++E +  +GGQ  E      I +FP F  I  +D+  K+ Q++ E+  + I    +  NIT   + + E  + ET+   +  K +I+A+G+ S   R L +  E  +    IHY    +  +Y  K I+V+GGG+SA++ A +    K   N+ ++HR  + R+     D L K NN+   LN +I  ++   S + + +++ +T ++ +L  D + V  G +      EL        E G    + N +TNIK ++A GD
  S:     5 KILDLVIIGAGPAGLTAGIYSSRAKLDFIILENE-LVGGQIRE---TPSIENFPGFDSISGADLADKM-QEHAEKAGAVID---EFGNITSVKLTDTEKII-ETSDTIYKPKSVIIATGSKS---RPLPVPEEKKLRGKGIHYCELCDGAMYDGKDIVVVGGGNSAIDAAIFLT--KYAKNLTVVHRSEKLRAEMRSQDELFKHNNVKLLLNTQIKHVEGENSIENIVLENSKTGEKSSLKADAIFVYIGTMP---KTELFKDFIDLTELGHIKTNENLETNIKGVFAAGD 278
>gi|108563236|ref|YP_627552.1| thioredoxin reductase [Helicobacter pylori HPAG1] >gi|107837009|gb|ABF84878.1| thioredoxin reductase [Helicobacter pylori HPAG1] (311 aa)
Score = 206, Expect = 1.5e-14, Identities = 78/303 (25%), Positives = 149/303 (49%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN----KTLTIKHKETE--KEQTLPFDYVLVQYGQISSPINIELLNQINK--EKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           D AI+GGG  G+ A   +    + + ++ +K   GGQ   +  +  I ++P   E+ S       +Q  +EQ      L  ++  +   +  +    +   +  +F AK +I+A+G    +P++  I  E   S +    +      +   YKNK++ VLGGGD+AVE A Y     I   V +IHRR+ +R +   ++    N+ ++ L   +++  + +     +L+IK+  T   +E  +P  ++ V Y   ++ +  E  + + K  E G  V+D + KTN++ ++A GD   F   P  ++ A ++   A
  S:     3 DCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQ---ITGSSEIENYPGVKEVVSG---LDFMQPWQEQ-CFRFGLKHEMTAVQRVSKKDSHFVILAEDGKTFEAKSVIIATGG---SPKRTGIKGE---SEYWGKGVSTCATCDGFFYKNKEVAVLGGGDTAVEEAIYLA--NICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTATNETRELVVPGFFIFVGYDVNNAVLKQEDNSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIF--APKQVVCAASDGATA 300
>gi|70727126|ref|YP_254040.1| thioredoxine reductase [Staphylococcus haemolyticus JCSC1435] >gi|68447850|dbj|BAE05434.1| thioredoxine reductase [Staphylococcus haemolyticus JCSC1435] (313 aa)
Score = 206, Expect = 1.5e-14, Identities = 76/283 (26%), Positives = 139/283 (49%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNK----EQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           YDVAI+G G  G+ A+  ++  NL++++IE +   GGQ   +   + + +FP F  I   D+  K+ +  K    E +  +I+   D  +     +  +E+           A+ +I+++G      +K+ +  E  +    + Y    +   +KNK + V+GGGDSAVE   +    K  + V I+HRR+E R+   + D   KN+ +  + ++ +   NE +    ++T+   +   E+TL  D V +  G    P+    +N  I  + G  V + N  T +  I+A GD
  S:     6 YDVAIIGAGPAGMTAAVYASRANLSTVMIE-RGMPGGQ---MANTEEVENFPGFEMITGPDLSTKMFEHAKKFGAEYQYGDIKSIEDKGDYKEINLGNKEI----------TARAVIISTGA---EYKKIGVPGEQELGGRGVSYCAVCDGAFFKNKNLFVIGGGDSAVEEGAFLT--KFADKVTIVHRRDELRAQKILQDRAFKNDKIDFIWSHTLKSINEKDGKVGSVTLVSTKDASEETLDADGVFIYIGM--KPLTAPFVNLGITNDMGYIVTEDNMSTKVPGIFAAGD 277
>gi|145297084|ref|YP_001139905.1| hypothetical protein cgR_2980 [Corynebacterium glutamicum R] >gi|140847004|dbj|BAF56003.1| hypothetical protein [Corynebacterium glutamicum R] (317 aa)
Score = 206, Expect = 1.6e-14, Identities = 79/306 (25%), Positives = 151/306 (49%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLD-TDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI--DLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           +I+DVAI+G G  G  A+  +   +LN I+ E   Y G     L     + +FP F + I   ++++ +  Q  E+  +++ ++  D +++T      ++L++     + ++A+ +IL+ G+    PR L +  E  +    +      +   ++++ I V+GGGDSA+E A +    K   +V I+HRR E+R+S+ M++   KN     +  K   E+I+ +     L +    T ++  L    + V  G    P +  L  Q+  +   YV+  + + +TN+  ++A GD    Y +    ITA     RA
  S:    11 KIHDVAIIGSGPAGYTAAVYAARADLNPIMFEGYEYGG----SLMTTTDVENFPGFEKGILGPELMENMRAQ-AERFGTDMHMELVDRVDLTGDI---KKLWV---GDDEYHARAVILSMGSA---PRYLGVKGEQELLGRGVSACATCDGFFFRDQDIAVIGGGDSAMEEATFLT--KFARSVTIVHRREEFRASAIMLERAQKNEKIRFVTNKTVEEVIEADGKVSGLKLNDTVTGEDSVLDVTAMFVAIGH--DPRSEILAGQVEVDPSNYVLVQEPSTRTNLDGVFAAGDLVDSYYQ--QAITAAGSGCRA 305
>gi|18311422|ref|NP_563356.1| thioredoxin-disulfide reductase [Clostridium perfringens str. 13] >gi|110799292|ref|YP_697128.1| thioredoxin-disulfide reductase [Clostridium perfringens ATCC 13124] >gi|110801661|ref|YP_699698.1| thioredoxin-disulfide reductase [Clostridium perfringens SM101] >gi|168206834|ref|ZP_02632839.1| thioredoxin-disulfide reductase [Clostridium perfringens E str. JGS1987] >gi|168211238|ref|ZP_02636863.1| thioredoxin-disulfide reductase [Clostridium perfringens B str. ATCC 3626] >gi|168214729|ref|ZP_02640354.1| thioredoxin-disulfide reductase [Clostridium perfringens CPE str. F4969] >gi|168217933|ref|ZP_02643558.1| thioredoxin-disulfide reductase [Clostridium perfringens NCTC 8239] >gi|169344137|ref|ZP_02865120.1| thioredoxin-disulfide reductase [Clostridium perfringens C str. JGS1495] >gi|18146106|dbj|BAB82146.1| thioredoxin reductase [Clostridium perfringens str. 13] >gi|110673939|gb|ABG82926.1| thioredoxin-disulfide reductase [Clostridium perfringens ATCC 13124] >gi|110682162|gb|ABG85532.1| thioredoxin-disulfide reductase [Clostridium perfringens SM101] >gi|169297748|gb|EDS79847.1| thioredoxin-disulfide reductase [Clostridium perfringens C str. JGS1495] >gi|170661770|gb|EDT14453.1| thioredoxin-disulfide reductase [Clostridium perfringens E str. JGS1987] >gi|170710772|gb|EDT22954.1| thioredoxin-disulfide reductase [Clostridium perfringens B str. ATCC 3626] >gi|170713819|gb|EDT26001.1| thioredoxin-disulfide reductase [Clostridium perfringens CPE str. F4969] >gi|182380048|gb|EDT77527.1| thioredoxin-disulfide reductase [Clostridium perfringens NCTC 8239] (312 aa)
Score = 206, Expect = 1.6e-14, Identities = 84/317 (26%), Positives = 161/317 (50%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLS-KNNILQKLNYEIIDF--NESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ-IN-KEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           M+++++  D+ I+G G  G+ ++  ++   L+++++E  + +GGQ    Y    + ++P F EI  +D+  + IQ   E   + I     I N++ +   +    + ET    +  K +I+A+G     P+KL I   P +S +    +HY    +  +Y+++ + V+GGG++A+E A Y     I   V +I R + +R+ +  ++  S K NI    N++++D    E  +   IK+ +T +E+ +  + V   +G I +     +  + IN KE G    D N +TN+K +Y  GD      +   I TA ++   A  H  K
  S:     1 MDKEIKELDLIIIGAGPAGLTSAIYASRAKLSTLVLED-NLVGGQVRSTYT---VENYPGFTEITGNDLADR-IQAQAEACGAIIDEFDFIENVSLKDDEK----IIETGDYIYKPKAVIIATGA---TPKKLPI---PSESKYLGKGVHYCAVCDGAVYQDEVVAVVGGGNAALEEALYL--SNIVKKVIVIRRYDYFRAEAKTLEAASNKENIEIMYNWDLVDVLGGEFVEAARIKNTKTGEEKEIAINGV---FGYIGTEPKTSMFREYINVKENGYIEGDENMRTNVKGVYVAGDVREKMFR--QITTAVSDGTIAALHAEK 304
>gi|149182584|ref|ZP_01861055.1| probable thioredoxin reductase [Bacillus sp. SG-1] >gi|148849720|gb|EDL63899.1| probable thioredoxin reductase [Bacillus sp. SG-1] (350 aa)
Score = 206, Expect = 1.6e-14, Identities = 81/305 (26%), Positives = 155/305 (50%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRR-----NEYRSSSFM---IDCL---SKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYG-------QISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           +DV I+GGG  G+++S  S    + + +IE +  LGG+ + +YP K I+D         + +I +L++Q     N  + L+  I++I+  +  +    L   + N   +K +I+A G+G   P+KL I   +  +   +HY++    + +K++ +++ GGG+SA++WAN  V   +   V +  R+     +E + +  M    DCL   S + ++ K   ++ID  E      + +  T +   L  D V++ +G          S +NI++++    E          +++I  I+A GD      K N I  A  +A  A+
  S:     7 FDVTIIGGGPAGLYSSFYSGLREMKTKIIEFQPQLGGK-IHVYPEKMIWDVGGLIPTPGAKLIDQLVEQGL-TFNPEVVLNEKIVSISKNS--DGHFLLKAASGNVHVSKTVIIAVGSGILQPQKLNIEGADRFEISNLHYTVK-SLKYFKDRTVIISGGGNSAIDWANELV--PVAKQVYLTCRKGQLSGHEAQVTQLMNSPADCLLNTSISKLIAKDGEDMIDRVE------LLNNVTGETSHLSVDDVIINHGFDQDTSLLKDSELNIKMMHDFYIEGST-----TGESSIPGIFAAGDILKHEGKLNLIAGAFQDAANAV 312
>gi|14591219|ref|NP_143295.1| thioredoxin reductase [Pyrococcus horikoshii OT3] >gi|3257849|dbj|BAA30532.1| 336aa long hypothetical thioredoxin reductase [Pyrococcus horikoshii OT3] (336 aa)
Score = 205, Expect = 1.9e-14, Identities = 81/293 (27%), Positives = 144/293 (49%)
  Q:     3 EDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFE---------TNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTL--PFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFY 295
           ++ +++DV I+G G  G  A+  +  F L++I+I K   LGG    +     I ++P F E I  S++ KK+  Q K +    + +D  I       I+  E   +E          N   + AK II+A G     PRKL   N P +  F    + Y    +  ++  K+++V+GGG++A++ A Y     I   V ++HRR+++R+   + D   +  I   LN  + +   +NK  ++  K  +  +T+    D V +  G       ++ L  I  E G   +D+  +T +  I+A GD T+ +
  S:    19 DESKVWDVIIIGAGPAGYTAAIYAARFGLDTIIITKD--LGGN---MAITDLIENYPGFPEGISGSELSKKMYDQVK-KYGVEVIIDEVI------RIDPAECAYYEGPCNFVVKTANGKEYKAKTIIIAVGA---EPRKL---NVPGEKEFTGRGVSYCATCDGPLFVGKEVIVVGGGNTALQEALYL--HSIGVKVTLVHRRDKFRADKILQDRFKQAGIPAILNTVVTEIKGTNKVESVVLKNVKTGETVEKKVDGVFIFIGYEPKTDFVKHLG-ITDEYGYIPVDMYMRTKVPGIFAAGDITNVF 306
>gi|153813092|ref|ZP_01965760.1| hypothetical protein RUMOBE_03500 [Ruminococcus obeum ATCC 29174] >gi|149830894|gb|EDM85984.1| hypothetical protein RUMOBE_03500 [Ruminococcus obeum ATCC 29174] (307 aa)
Score = 205, Expect = 1.9e-14, Identities = 89/312 (28%), Positives = 156/312 (50%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKN-NILQKLNYEI--IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKE-KGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           MNE+  +YD+ IVGGG GG  ++  +     ++I++EK S  GGQ M L     I ++P F        + + +Q+  E+  +  +   ++ N+        +L   ET+   +  K +++A+G    NPR+L +  E  +    + Y  + +   YK+K ++V+GGG+SAV  ++  +  +I   V I+HRR+  R++    D L K  NI  + N  +  + + E    + +K   T +E  +  D + V  G+   P    L NQI  + KG  V   N +T+I  +YA+GD      +   I+TA A+   A+
  S:     1 MNEN-HVYDMIIVGGGPGGYTSALYAARAGFDTIVLEKLS-AGGQ-MSLTWQ--IDNYPGFENGIDGFSLAEKMQKQAEKFGAKSEY-AEVFNMDLTG----KLKRVETSSGIYIGKTVVIATGA---NPRELGLAKEKELIGHGVAYCASCDGMFYKDKIVVVVGGGNSAV--SDAVLLSRIAKKVIIVHRRDTLRATKIYHDQLMKTENIEFRWNNTVNELIYGERLTGVRLKDTVTGEENIIECDGLFVSIGR--KPTTDFLDNQIELDNKGYIVAGENTETSIPGVYAVGDVRTKLLR--QIVTAVADGAMAV 298
>gi|188527329|ref|YP_001910016.1| thioredoxin reductase [Helicobacter pylori Shi470] >gi|188143569|gb|ACD47986.1| thioredoxin reductase [Helicobacter pylori Shi470] (311 aa)
Score = 205, Expect = 2.0e-14, Identities = 78/303 (25%), Positives = 149/303 (49%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN----KTLTIKHKETE--KEQTLPFDYVLVQYGQISSPINIELLNQINK--EKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           D AI+GGG  G+ A   +    + + ++ +K   GGQ   +  +  I ++P   E+ S       +Q  +EQ      L  ++  +   +  +    +   +  +F AK +I+A+G    +P++  I  E   S +    +      +   YKNK++ VLGGGD+AVE A Y     I   V +IHRR+ +R +   ++    N+ ++ L   +++  + +     +L+IK+  T   +E  +P  ++ V Y   ++ +  E  + + K  E G  V+D + KTN++ ++A GD   F   P  ++ A ++   A
  S:     3 DCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQ---ITGSSEIENYPGVKEVVSG---LDFMQPWQEQ-CFRFGLKHEMTAVQRVSKKDSHFVILAEDGKTFEAKSVIIATGG---SPKRTGIKGE---SEYWGKGVSTCATCDGFFYKNKEVAVLGGGDTAVEEAIYLA--NICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTATNETRELIVPGFFIFVGYDVNNAVLKQEDGSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIF--APKQVVCAASDGATA 300
>gi|14520939|ref|NP_126414.1| thioredoxin reductase [Pyrococcus abyssi GE5] >gi|5458156|emb|CAB49645.1| trxB thioredoxin reductase [Pyrococcus abyssi GE5] (345 aa)
Score = 204, Expect = 2.2e-14, Identities = 76/293 (25%), Positives = 140/293 (47%)
  Q:     3 EDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFE---------TNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTL--PFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFY 295
           ++ +++DV I+G G  G  A+  +  F L++I+I K   LGG    +     I ++P F E I  S++ K++ +  K       +   D++      I+  E   +E          N   +  K II+A G     PRKL +  E       + Y    +  ++  K+++V+GGG++A++ A Y     I   V ++HRR+++R+   + D L +  I   LN  + +   +NK  ++  K  +  +T     D V +  G       ++ L  I  E G   +D+  +T +  I+A GD T+ +
  S:    28 DESKVWDVIIIGAGPAGYTAAIYAARFGLDTIIITKD--LGGN---MAITDLIENYPGFPEGISGSELAKRMYEHVK-------KYGVDVIFDEVVRIDPAECAYYEGPCQFEVKTANGKEYKGKTIIIAVGA---EPRKLHVPGEKEFTGRGVSYCATCDGPLFVGKEVIVVGGGNTALQEALYL--HSIGVKVTLVHRRDKFRADKILQDRLKQAGIPTILNTVVTEIRGTNKVESVVLKNVKTGETFEKKVDGVFIFIGYEPKTDFVKHLG-ITDEYGYIKVDMYMRTKVPGIFAAGDITNVF 315
>gi|189485015|ref|YP_001955956.1| thioredoxin reductase [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170286974|dbj|BAG13495.1| thioredoxin reductase [uncultured Termite group 1 bacterium phylotype Rs-D17] (302 aa)
Score = 203, Expect = 3.0e-14, Identities = 81/305 (26%), Positives = 158/305 (51%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCF------FEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNL----ETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI-DLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           IYDV I+GGG  G+ A+  ++   L +++IEK    GGQ   +     + ++P F      FE+         ++  K+ ++   ++  D +    Q ++++ +    T  +++  K +I+A+G  +   +K+ I   P +S F+   ++     +   Y++K +LV+GGGDSA+E A Y    K   NV ++HRR++ R++  + + +  +     I   +  EI   ++S + +TI + +T + + L  D V V  G I    N   L+ +  +K  Y+I D +  T+   I+A GD      +   ++TA ++  +A
  S:     2 IYDVIIIGGGPAGLSAAIYASRARLKTLIIEKTG-CGGQ---MTTTDLLENYPGFNGGINGFELA--------VKLEKQARDFGAEIIYDEVGAIEQGLSKKVI----TANSAYETKTVIIAAGTYA---KKMNI---PGESEFMGRGVSFCAVCDAPFYRDKNVLVVGGGDSAIEEAAYI--SKFAKNVTVVHRRDKLRAAKILQERMKLHPNISVIYDSVPKEIFG-SDSVEKVTITNVKTNESKGLIIDGVFVFTGLIP---NTLFLSGVALDKTGYIITDEDMNTSSTGIFACGDIRKKQLR--QVVTAASDGAQA 291
>gi|167405317|ref|ZP_02310075.1| thioredoxin-disulfide reductase [Listeria monocytogenes FSL J2-003] (319 aa)
Score = 203, Expect = 3.3e-14, Identities = 73/290 (25%), Positives = 132/290 (45%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKL-EINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M  + +  DV I+G G  G+ A+  ++  +L++++IE+    GGQ   +     + ++P F  I   D+  K++   K+        D        + ++ +E         ++ A+ II+A+G      RKL     E +    + Y    +   +KN++++V+GGGDSAVE   Y    +  + V I+HRR++ R+   + D   K+     I      EI+   +      +       E  +P D V +  G +  P+    LN  I  ++G  V D   +TN+  I+A GD
  S:     1 MASEEKFNDVIIIGAGPAGMTAALYTSRADLDTLMIER-GVPGGQ---MVNTAEVENYPGFDSILGPDLSDKMLSGAKQFGAEYAYGDIK------EVVDGKEFKTVTAGSKTYKARAIIIATGA---EHRKLGAAGEEELSGRGVSYCAVCDGAFFKNRELIVVGGGDSAVEEGTYLT--RYADKVTIVHRRDKLRAQQILQDRAFKDEKVDFIWNSTVEEIVGDGKKVTGAKLVSTVDGSESIMPVDGVFIYVGLV--PLTKAFLNLGITDDEGYIVTDEEMRTNLPGIFAAGD 279
>gi|116490632|ref|YP_810176.1| thioredoxin reductase [Oenococcus oeni PSU-1] >gi|116091357|gb|ABJ56511.1| Thioredoxin reductase [Oenococcus oeni PSU-1] (313 aa)
Score = 203, Expect = 3.6e-14, Identities = 79/283 (27%), Positives = 135/283 (47%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNK----EQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNI---LQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           YDV I+G G  G+  +T ++  NL+ ++I K  Y GGQ   +     + ++P F  I   D+ +K+   +     E     +Q            I+  +     T+   + AK +I+ASG      R + +  E       + Y    +   +KN++I+V+GGGDSAVE A+Y     +  +V I+HRR++ R+S          +NI     K   EII  +E    + +  K + +E  +  + V +  G   +   +E L  ++ EKG  + D N +T +  IYA+GD
  S:     5 YDVVIIGAGPAGMTTATYASRANLSVMMINKGIY-GGQ---MNDTAEVENYPAFDSILGPDLAEKMYASSTRFGAEYTFGEVQ----------NVIDHGKTKTIVTDDEQYEAKVVIVASGA---THRHIGVPGEDKYSGRGVSYCAVCDGAFFKNEQIVVIGGGDSAVEEASYLA--NLAKDVTIVHRRDQLRASRIAQKRAFDTDNIDFSWNKRTEEIIGDDEKVTGVKVLDKISNQESVIKTNGVFIYVGIDPNTQGLENLGILD-EKGWVLTDDNMQTKVPGIYAVGD 276
>gi|56964802|ref|YP_176533.1| thioredoxin reductase [Bacillus clausii KSM-K16] >gi|56911045|dbj|BAD65572.1| thioredoxin reductase [Bacillus clausii KSM-K16] (316 aa)
Score = 202, Expect = 3.9e-14, Identities = 77/284 (27%), Positives = 136/284 (47%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           IYDV I G G  G+ A+  ++  NLN++++E +   GGQ   +   + + ++P F  I   D+  K+ +  K+   +    D        + I+E +          + AK +I+++G      +KL I  E  +    + Y    +   +K ++++V+GGGDSAVE A Y    +    V I+HRR++ R+   + D    N     I  K+  EI + +     +T+K  +T +   +  D V V  G +  P+N  + N  I  E+G  V +   +T +  I+A GD
  S:     6 IYDVIIAGAGPAGMTAAVYTSRANLNTLMLE-RGMPGGQ---MANTEDVENYPGFDHILGPDLSNKMFEHAKKFGAAYAYGDIK------EIIDEGDTKRVIAGSKEYRAKAVIVSTGA---EYKKLGIPGEQELSGRGVSYCAVCDGAFFKERELIVVGGGDSAVEEAVYLT--RFAKKVTIVHRRDQLRAQKILQDRAFNNPKVDFIWNKVVTEINEKDGKVGGVTLKDTKTGEVSNMEADGVFVYIGML--PLNESVQNLGITNEEGYIVTNEEMETKVPGIFAAGD 278
>gi|157364456|ref|YP_001471223.1| thioredoxin reductase [Thermotoga lettingae TMO] >gi|157315060|gb|ABV34159.1| thioredoxin reductase [Thermotoga lettingae TMO] (313 aa)
Score = 202, Expect = 3.9e-14, Identities = 90/311 (28%), Positives = 154/311 (49%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTIN-EQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTL---TIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINK--EKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNT--IITACAEAVRALWHISKN 318
           YD+  +GGG   + A+  +    L S+L+ +K   GGQ   L    +I ++  F  I+  ++ +K+    KE   S   L T+ LN     +N E    + +T +    ++ +++A+G    +P+KLE+  E    +  I Y    +   +K+K + V+GGGD+A+  A Y    KI  +V +IHRR++ R+   + D    N  ++     +++    +K L    +++ +T +   L  D V +  G    P N EL+  I K  E+G    D   +TNI  +YAIGD      K N   IITA ++   A  H ++N
  S:    15 YDIVTIGGGPAALSAAVYAKRAGL-SVLVVEKVLEGGQ---LNLTTYIDNYLGFPNIEGQELARKM----KEHAES---LQTEFLNNHVIELNVENSEMIIKTEERIVKSRVVMIATGA---DPKKLEVPGEREFLAKGISYCATCDGYFFKDKDVAVIGGGDTALNDALYL--SKIAKSVTVIHRRDKLRAVKILQDKAFSNGKIKFAFDNVVERFHGDKKLERIVLRNVKTGQISELKVDGVFIAIGL--KP-NSELVKDIVKIDEQGYIFTDEWMQTNIPRLYAIGDVR----KKNVRQIITAVSDGAIAAIHAAEN 311
>gi|15611831|ref|NP_223482.1| thioredoxin reductase [Helicobacter pylori J99] >gi|7388343|sp|Q9ZL18|TRXB_HELPJ Thioredoxin reductase (TRXR) >gi|4155329|gb|AAD06343.1| THIOREDOXIN REDUCTASE [Helicobacter pylori J99] (311 aa)
Score = 202, Expect = 4.0e-14, Identities = 80/303 (26%), Positives = 148/303 (48%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN----KTLTIKHKET--EKEQTLPFDYVLVQYGQISSPINIELLNQINK-------EKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           D AI+GGG  G+ A   +    + + ++ +K   GGQ   +  +  I ++P   E+ S       +Q  +EQ      L  ++  I   +       +   +  +F AK +I+A+G    +P++  I  E   S +    +      +   YKNK++ VLGGGD+AVE A Y     I   V +IHRR+ +R +   ++    N+ ++ L   +++  + +     +L+IK+  T  ++E  +P  ++ V Y      +N  +L Q +        E G  V+D + KTN++ ++A GD   F   P  ++ A ++   A
  S:     3 DCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQ---ITGSSEIENYPGVKEVVSG---LDFMQPWQEQ-CFRFGLKHEMTAIQRVSKKGSHFVILAEDGKTFEAKSVIIATGG---SPKRTGIKGE---SEYWGKGVSTCATCDGFFYKNKEVAVLGGGDTAVEEAIYLA--NICKKVYLIHRRDGFRCAPITLEHAKNNSKIEFLTPYVVEEIKGDASGVSSLSIKNTATNEKRELVVPGLFIFVGYD-----VNNAVLKQEDNSMLCECDEYGSIVVDFSMKTNVQGLFAAGDIRIF--APKQVVCAASDGATA 300
>gi|32265985|ref|NP_860017.1| thioredoxin reductase TrxB [Helicobacter hepaticus ATCC 51449] >gi|32262034|gb|AAP77083.1| thioredoxin reductase TrxB [Helicobacter hepaticus ATCC 51449] (311 aa)
Score = 202, Expect = 4.5e-14, Identities = 77/306 (25%), Positives = 155/306 (50%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF---IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNK----TLTIKHKETEKEQTLPFD--YVLVQYGQISSPINIELLNQIN-------KEKGKYVIDLNQKTNIKNIYAIGDA-----THFYCKPNTIITACAEAVRALWH 314
           D+AI+GGG  G+ A   +    + ++++ +K   GGQ   +  +  I ++P   +I S     + ++  +EQ      L   +  ++  T      ++ +T+ +   AK +I  +G    +P++  +  E  D  +   I      +   YK+++++VLGGGD+A+E A Y    +I + V ++HRRNE+R++   I+ + KN+ +  +   +++  + +K    ++ IKH ++   + +P    ++ V Y      +N   L Q +        E G   +DL+ KT+++ ++A GD          C      TA  +A+  L H
  S:     3 DLAIIGGGPAGLSAGLYATRGGIKNVVLFEKGMPGGQ---ITGSSEIENYPGVKDIVSG---MEFMEPWQEQ-CFRFGLTHKMSEVSQITKKNDIFYIHQTDGSIDEAKAVIFCAGG---SPKRANLKGE--DEFWGRGISTCATCDGFFYKDQEVIVLGGGDTALEEAVYL--SRICSKVHLVHRRNEFRAAPSTIEHVKKNDKIHIVTPAVVEEIKGDKSGVTSVLIKHTDSNTNEEIPVMGIFIFVGYN-----VNTATLKQDDGSMLCECDEYGSIKVDLSMKTSVEGLFAAGDVRTLAPKQVVCAAGDGATAALQAIAYLEH 310
>gi|19554280|ref|NP_602282.1| thioredoxin reductase [Corynebacterium glutamicum ATCC 13032] >gi|62391937|ref|YP_227339.1| thioredoxin reductase [Corynebacterium glutamicum ATCC 13032] >gi|21325863|dbj|BAC00484.1| Thioredoxin reductase [Corynebacterium glutamicum ATCC 13032] >gi|41223084|emb|CAF19029.1| THIOREDOXIN REDUCTASE [Corynebacterium glutamicum ATCC 13032] (317 aa)
Score = 202, Expect = 4.7e-14, Identities = 79/306 (25%), Positives = 152/306 (49%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLD-TDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI--DLNQKTNIKNIYAIGDA--THFYCKPNTIITACAEAVRA 311
           +I+DVAI+G G  G  A+  +   +LN I+ E   Y G     L     + +FP F + I   ++++ +  Q  E+  +++ ++  D +++T      ++L++     + ++A+ +IL+ G+    PR L +  E  +    +      +   ++++ I V+GGGDSA+E A +    K   +V I+HRR E+R+S+ M++   KN     +  K   E+I+ +     L +    T ++  L    + V  G    P +  L  Q+  +   YV+  + + +TN+  ++A GD   +H+       ITA     RA
  S:    11 KIHDVAIIGSGPAGYTAAVYAARADLNPIMFEGYEYGG----SLMTTTDVENFPGFEKGILGPELMENMRAQ-AERFGTDMHMELVDRVDLTGDI---KKLWV---GDDEYHARAVILSMGSA---PRYLGVKGEQELLGRGVSACATCDGFFFRDQDIAVIGGGDSAMEEATFLT--KFARSVTIVHRREEFRASAIMLERAQKNEKIRFVTNKTVEEVIEADGKVSGLKLNDTVTGEDSVLDVTAMFVAIGH--DPRSEILAGQVEVDPSNYVLVQEPSTRTNLDGVFAAGDLVDSHY----QQAITAAGSGCRA 305
>gi|172058413|ref|YP_001814873.1| thioredoxin reductase [Exiguobacterium sibiricum 255-15] >gi|171990934|gb|ACB61856.1| thioredoxin reductase [Exiguobacterium sibiricum 255-15] (320 aa)
Score = 201, Expect = 5.9e-14, Identities = 78/285 (27%), Positives = 139/285 (48%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELF-LFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESNKT---LTIKHKETEKEQTLPFDYVLVQYGQISSPIN--IELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +IYDV I+G G  G+ A+  ++  NL++++IE +   GGQ   +   + I ++P +  I   D+ +K+   +K         D        ++I +   F     +   ++A+ II+ASG      +K+ +   E +    + Y    +   +K K++ V+GGGDSAVE   Y    +    V I+HRR E R+   +      N  +  + N+ +   NE N     + + + +T +  T P D V +  G   +PI   ++ L  +N ++G  V +   +TNIK I+A GD
  S:     7 KIYDVIIIGAGPAGMTAALYASRANLSTLMIE-RGIPGGQ---MANTEDIENYPGYDSILGPDLSQKMFDHSKAFGAEYAYGDV-------RSIEDGPAFKTVHAHNKDYHARAIIIASGA---QYKKIGVPGEEELGGRGVSYCAVCDGAFFKEKELFVIGGGDSAVEEGVYLT--RFAKKVTIVHRREELRAQKILQKRAFDNPKIDFIWNHTVKQINEDNGKVGGIELINTKTAETTTYPIDGVFIYIGM--NPITGYVQDLGILN-DQGYVVTNEAMETNIKGIFAAGD 280
>gi|73661839|ref|YP_300620.1| putative thioredoxin reductase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72494354|dbj|BAE17675.1| putative thioredoxin reductase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (343 aa)
Score = 201, Expect = 6.3e-14, Identities = 89/299 (29%), Positives = 158/299 (52%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDF------PCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDF--NESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVID--LNQKTNIKNIYAIGDATHFYCKPNTIITACAE 307
           DV I+GGG  G+FAS  S    +   +I+ +  LGG+ M +YP K I+D       PCF  I+  D +K+ +    E     + L+  +++I  + I EQ+ F  ET+K N F +K +I+A G G  NP++L+I + E      +HY +    + +K+K +L+ G G+SA++WAN         +V +I+R+ + +    M + L + N+ +  N  I     +E+    + + +++ ET +     FD V++ +G       +E  +       +Y I    N  T+I  +YA GD  +   K + I +A ++
  S:     3 DVIIIGGGPAGLFASFYSGLRGMRVRIIDIQDKLGGK-MHVYPEKIIWDIGGLAPKPCFEVIQ--DTVKQGLHFEPE-----VNLEERVIDI--RKI-EQQHFEVETDKGNVFSSKSVIIAIGGGIINPKQLDIKDAERYKLTNLHYVVQ-SLKKFKDKHVLISGAGNSALDWANDL--SGYAKSVTLIYRKADIKGYEVMKEKLEQLNVKKLPNTHIHQLIGDETQTQIEQVILENIETGEHTVKSFDDVIISHGFDRENTLLEQSSAKVDMFNEYSIKGFGNTATSIDGLYACGDIIYHEAKAHLIASAFSD 302
>gi|159040798|ref|YP_001540050.1| thioredoxin reductase [Caldivirga maquilingensis IC-167] >gi|157919633|gb|ABW01060.1| thioredoxin reductase [Caldivirga maquilingensis IC-167] (343 aa)
Score = 201, Expect = 6.4e-14, Identities = 71/285 (24%), Positives = 139/285 (48%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYV-IDLNQKTNIKNIYAIGD 290
           ++ D  I+GGG  G+ A+  +  F L++++I ++  +GGQ   +    ++ D+  +  I   D++ K  +++    N  I +D+    +   TI+     +   + + F ++ +I+A G      RKL +  E       + Y    +  ++K+K + V+GGGDSA   A    E      V +IHRR+  R+     D L KN+ +  +   ++   + +K L    ++  +T +   LP D + ++ G    P+    +  ++ +K  Y+ ++   +TNIK IYA GD
  S:    30 KVLDTVIIGGGPAGLSAAMYAARFGLSTVVITEE--IGGQ---VGKAGWVEDYLGYVRITGPDLVNKF-EEHVRYYNVPILIDS----VERITISNDLFKVTTVSGDEFTSRTVIIAVGE---RRRKLNVPGEDKYSGKGVSYCAPCDAPLFKDKVVAVVGGGDSAASSALLLTE--YATKVYLIHRRSSLRAQPIYQDLLLKNSKITIIWNTVVKELKGDKVLKSAILQRTDTGELMELPIDGIFIEIGA-EPPVEFFKVIGLDLDKNGYINVNTMMETNIKGIYAAGD 303
>gi|167215170|ref|ZP_02285477.1| thioredoxin-disulfide reductase [Listeria monocytogenes FSL R2-503] >gi|167218280|ref|ZP_02287916.1| thioredoxin-disulfide reductase [Listeria monocytogenes FSL J1-175] (317 aa)
Score = 200, Expect = 6.5e-14, Identities = 72/282 (25%), Positives = 129/282 (45%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKL-EINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           DV I+G G  G+ A+  ++  +L++++IE+    GGQ   +     + ++P F  I   D+  K++   K+        D        + ++ +E         ++ A+ II+A+G      RKL     E +    + Y    +   +KN++++V+GGGDSAVE   Y    +  + V I+HRR++ R+   + D   K+     I      EI+   +      +       E  +P D V +  G +  P+    LN  I  ++G  V D   +TN+  I+A GD
  S:     7 DVIIIGAGPAGMTAALYTSRADLDTLMIER-GVPGGQ---MVNTAEVENYPGFDSILGPDLSDKMLSGAKQFGAEYAYGDIK------EVVDGKEFKTVTAGSKTYKARAIIIATGA---EHRKLGAAGEEELSGRGVSYCAVCDGAFFKNRELIVVGGGDSAVEEGTYLT--RYADKVTIVHRRDKLRAQQILQDRAFKDEKVDFIWNSTVEEIVGDGKKVTGAKLVSTVDGSESIMPVDGVFIYVGLV--PLTKAFLNLGITDDEGYIVTDEEMRTNLPGIFAAGD 277
>gi|148256830|ref|YP_001241415.1| putative thioredoxin reductase, FAD/NAD(P)-binding [Bradyrhizobium sp. BTAi1] >gi|146409003|gb|ABQ37509.1| Putative thioredoxin reductase, FAD/NAD(P)-binding [Bradyrhizobium sp. BTAi1] (342 aa)
Score = 199, Expect = 8.6e-14, Identities = 52/203 (25%), Positives = 105/203 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID 203
           M+E ++  DV I+G G  G+FA       ++ + LI+    +GGQ  ELYP K IYD P    +    +  +L++Q K   +    L   +  +  + I +    +       F  K +++A+G GSF P++  +   E  +   + Y++  + E +++K ++++GGGDSA++W        +   + ++HRR+++R++   ++
  S:     1 MSEAIKT-DVLIIGAGPCGLFAVFELGLLDIKAHLIDILDKVGGQCAELYPEKPIYDIPGVPMVTGQGLTDQLMEQIKP-FSPTFHLGEMVEKV--EKIGDPGFRVTTDAGKVFECKVVVIAAGGGSFQPKRPPVPGIEAYEGTSVFYAVR-KMEQFRDKNVVIVGGGDSALDWTLNL--HPLAKRITLVHRRDDFRAAPHSVE 197
>gi|167767705|ref|ZP_02439758.1| hypothetical protein CLOSS21_02240 [Clostridium sp. SS2/1] >gi|167710444|gb|EDS21023.1| hypothetical protein CLOSS21_02240 [Clostridium sp. SS2/1] (306 aa)
Score = 199, Expect = 1.0e-13, Identities = 76/313 (24%), Positives = 151/313 (48%)
  Q:     5 LRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEI---IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINK-EKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           ++IYD+ I+G G  G+ A+  +    L+ ++IEK+   GGQ ++ Y    + ++P   +    D+  K  +  KE    +I  +   +    +    +E+ L   N ++   + IILA+G        +E   E +    + Y    +   ++NK   V+GGG+ A+E A +    ++   V +IHRR+E+R +  + D + KN+ ++ L   I   ID +E  + L I+  +   ++ L  D + +  G  + P +  L  +++  EKG  +   +  TNI  I+A GD      +   ++TA ++    ++ + +
  S:     1 MKIYDLVIIGSGPAGMSAAIYAQRAMLDFVMIEKEYMPGGQVVQTYE---VDNYPGIPKTNGMDLGLKFSEHAKELGAKSITAEVKEIYADEEI---KEIML--KNGDTLKTRTIILATG-AVHQTLGIE-GEEKLKGMGVSYCATCDGAFFRNKVTAVVGGGNVALEDAIFL--SRMCKKVYLIHRRDEFRGAKILQDEVKKNDKIEILWNTIVTKIDGDEVVEGLHIQDVDNHVDKLLDVDGIFIAVG--TKPASELLSGKLSTDEKGYIIAGEDGVTNIPGIFAAGDGRSKNLR--QVVTAVSDGANCVYSVER 301
>gi|23099924|ref|NP_693390.1| thioredoxin reductase (NADPH) [Oceanobacillus iheyensis HTE831] >gi|22778155|dbj|BAC14425.1| thioredoxin reductase (NADPH) (general stress protein) [Oceanobacillus iheyensis HTE831] (315 aa)
Score = 199, Expect = 1.1e-13, Identities = 75/290 (25%), Positives = 144/290 (49%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEIN-NEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY------EIIDFNESN-KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M+E+ ++YDV I G G  G+ A+  ++  NL+++++E+    GGQ   +   + + ++P F  I   D+  K+ +  K+   +    D        +  +  E  L +     +Y + +I+A+G      +KL I   E +    + Y    +   +KN+ ++V+GGGDSAVE   Y    +  N V I+HRR+  R+   + D    N   +K+++      E I+  +    ++T+K+ +T +      + V +  G +  P+N   L+  I  ++G    + N +T+I  I+A GD
  S:     1 MSEE-KMYDVIIAGAGPAGMTAAVYASRANLDTLMLER-GIPGGQ---MANTEDVENYPGFDNILGPDLSNKMFEHAKKFGAAYAYGDIK------EVEDHGEYKLIKAGSKEYYTRSLIIATGA---QYKKLGIEGEEALSGRGVSYCAVCDGAFFKNRNLVVIGGGDSAVEEGIYLT--RFANKVTIVHRRDNLRAQKIIQDRAFDN---EKIDFIWDTVAETINGTDGKVSSVTLKNTKTNEVNNFDAEGVFIYIGMV--PLNQAFLSLGITNDEGYIATNENMETSIPGIFAAGD 278
>gi|187605471|ref|ZP_02991666.1| thioredoxin reductase [Exiguobacterium sp. AT1b] >gi|187482481|gb|EDU20490.1| thioredoxin reductase [Exiguobacterium sp. AT1b] (317 aa)
Score = 199, Expect = 1.1e-13, Identities = 90/290 (31%), Positives = 144/290 (49%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNK----EQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQK--LNYEIIDF--NESNKTL--------------TIKHKETEKEQTLPFDYVLVQYGQISSPIN--IELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M E+ +IYDV I+G G  G+ A+  ++  NL++++IE +   GGQ   +   + I ++P +  I   D+ +K+   +K    E    ++Q  +D          E E  +   +   + A+ IILASG      +K+ +   E +    + Y    +   +K K + V+GGGDSAVE   +    +  N V I+HRR+E R+            ILQK   + E IDF  N + K +              TI   ET+ E     D V +  G   +PI   ++ L  I  E+G  V +   +TNI  I+A GD
  S:     1 MTEE-KIYDVIIIGAGPAGMTAALYASRANLSTLMIE-RGIPGGQ---MANTEDIENYPGYDSILGPDLSQKMFDHSKAFGAEYAYGDVQRISD----------ETEYKIVHAHNRDYKARAIILASGA---QYKKIGVPGEEELGGRGVSYCAVCDGAFFKGKDLFVIGGGDSAVEEGVFLT--RFANKVTIVHRRDELRA----------QKILQKRAFDNEKIDFIWNHTLKEITEKDGKVGGARLVSTIDGTETDHE----IDGVFIYIGM--NPITGFVQDLG-ITNEQGYIVTNEAMETNIPGIFAAGD 278
>gi|118726535|ref|ZP_01575159.1| thioredoxin reductase [Clostridium cellulolyticum H10] >gi|118664083|gb|EAV70721.1| thioredoxin reductase [Clostridium cellulolyticum H10] (308 aa)
Score = 198, Expect = 1.1e-13, Identities = 79/289 (27%), Positives = 146/289 (50%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI-DLNQKTNIKNIYAIGDATHFYCK 297
           DV I+GGG  G  A+  S+   L++++IEK  + GGQ   +     + ++P F E I   D+  ++ +Q +  K   + L+ ++L +   +  ++     +T  N+F +K IIL+ G    +P+ L +   E      + Y    +   ++ K + V+GGGD+A E A Y    +    V IIHRR+  R++  + + L  NN ++     +++  E     + L IK+ +T ++ ++  D + V  G   +P N  + +++   K  YVI D   +TNI  ++A GD    Y +
  S:     3 DVIIIGGGPAGYTAALYSSRAQLDTLVIEKM-FSGGQ---MATTDVMENYPGFEEPIGGPDLALRMEKQAR--KFGTVVLNDEVLELELDSPIKK----VKTKNNTFESKTIILSMGA---SPKMLGLPKEEKFRGSGVSYCAVCDGAFFRGKTVAVVGGGDTAAEDALYLA--RFCPKVYIIHRRDTMRATKILQNELCCNNRIEFFWDSVVEEIEGQFGVEGLKIKNIKTGEKSSIDVDGLFVAIGL--NPNNSLVKDKLELTKEGYVITDDRMRTNIPGVFAAGDLREKYLR 280
>gi|116617716|ref|YP_818087.1| thioredoxin reductase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096563|gb|ABJ61714.1| Thioredoxin reductase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (317 aa)
Score = 198, Expect = 1.2e-13, Identities = 69/290 (23%), Positives = 150/290 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTIN-EQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQ-KLNYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M+E+L+ YDV ++G G  G+ A+T ++  NL+ +++++  Y GGQ   +     + ++P F  I   D+ +K+        +S+ Q   +    + ++I  E    +  T+  ++ AK II+A+G+   +   L++  E       + Y    +   ++++ +LV+GGGDSA+E   Y     +  +V ++HRR++ R+   + +    N+ ++ + + E++     +  +T   + + +T +++ +    V +  G  ++    E LN I   +G  V D   +T+I  ++A+GD
  S:     1 MSEELKEYDVVVIGAGPAGMTAATYASRANLSVLMLDRGIY-GGQ---MNNTAEVENYPGFDSILGPDLAEKMY-------SSSTQFGAEYGFGSVESIEVEDYRKIIHTDMGTYAAKAIIIATGSEHIH---LDVTGEDKYQGRGVSYCAVCDGAFFRDEDVLVIGGGDSAIEEGLYLT--NLAKSVTVLHRRDKLRAQQIIQNRAFDNSKMKFEWHTEVVAITGDDDKVTGVDVINNQTNEKRHIDASGVFIYVGLKANTQGFENLN-ITDPEGWIVTDDKMQTSIPGVFAVGD 279
>gi|152977376|ref|YP_001376893.1| thioredoxin reductase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152026128|gb|ABS23898.1| thioredoxin reductase [Bacillus cereus subsp. cytotoxis NVH 391-98] (318 aa)
Score = 198, Expect = 1.3e-13, Identities = 78/290 (26%), Positives = 136/290 (46%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M+E+ +IYDV I+G G  G+ A+  ++  NL+++++E +   GGQ   +   + + ++P +  I   D+  K+ +  K+        D        + I+ +E       K  + A+ II+ASG      +KL +  E  +    + Y    +   +K K+++V+GGGDSAVE   Y    +  + V IIHRR+  R+   + D   +N  +  + N+ +   NE N    ++TI    T +E     D V V  G +        L  I  E G    +   +T +  I+A GD
  S:     1 MSEE-KIYDVIIIGAGPAGMTAAVYTSRANLSTLMLE-RGIPGGQ---MANTEEVENYPGYESILGPDLSNKMFEHAKKFGAEYAYGDVK------EVIDGKEYKTIIAGKKEYKARAIIIASGA---EYKKLGVPGEKELGGRGVSYCAVCDGAFFKEKELVVIGGGDSAVEEGVYLT--RFASKVTIIHRRDALRAQKILQDRAFQNEKIDFIWNHTVKQINEENGKVGSVTIVDVNTGEETEFKADGVFVYIGMLPLSKPFAALG-ITNENGYIETNERMETKVPGIFAAGD 278
>gi|140037|sp|P23160|R34K_CLOPA 34.2 kDa protein in rubredoxin operon (ORF A) >gi|144906|gb|AAA23276.1| product homologous to E.coli thioredoxin reductase: J.Biol.Chem. (1988) 263:9015-9019, and to F52a protein of alkyl hydroperoxide reductase from S.typhimurium: J.Biol.Chem. (1990) 265:10535-10540; open reading frame A (308 aa)
Score = 198, Expect = 1.3e-13, Identities = 83/282 (29%), Positives = 144/282 (51%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDIL-NITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYV-IDLNQKTNIKNIYAIGD 290
           D+ I+G G  G+ A+  +    LN++++E +  +GGQ  E Y    + +FP F  I  +D+  K+     E+  ++I ++ D   NI    +++ E  + ET    +  K +I+A+G  S   R+L I   E +    IHY    +  +Y+ K ++V+GGG+SAVE A +    K   N+ I+H+ +  ++  +  D L K+     I       I+  NE  K + +++ +T+++  L  D V V  G    P      + IN  K  Y+  D N +TNIK ++A GD
  S:     8 DLVIIGAGPAGLTAAIYAIRAKLNTLVLENE-LVGGQIRETYT---VENFPGFNVISGADLADKM-----EEHAASIGVNIDQFSNIEKIKLSDDEKII-ETEDVIYKVKALIIATGAKS---RRLPIPEEEKLHGKVIHYCELCDGALYQGKDLVVVGGGNSAVEAAIFLT--KYARNITIVHQFDYLQAQKYSQDELFKHKNVKIIWDSEIRNIVGENEIEK-IVVENVKTKQKTELKADGVFVYIGY--EPKTELFKDSININKWGYIETDENMETNIKGVFAAGD 278
>gi|77414483|ref|ZP_00790632.1| thioredoxin reductase [Streptococcus agalactiae 515] >gi|77159462|gb|EAO70624.1| thioredoxin reductase [Streptococcus agalactiae 515] (304 aa)
Score = 198, Expect = 1.3e-13, Identities = 78/284 (27%), Positives = 140/284 (49%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKT----LTIKHKETEKEQTLPFDYVLVQYG-QISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +YD  I+G G GG+ A+  +   NL   LIE+ +  GGQ   +     I ++P +  I   ++  K+ +  ++ +  +I        I  +  N+ ++    T   S+ AK +ILA+G  + N        E   S  + Y    +   ++++ +LV+GGGDSAVE A +  +     +V IIHRR++ R+   + D    N  ++ +   ++   + N+     +T+++ +T +   +PF  V +  G +  S +  EL   I  E G  + D N KT+I  +YAIGD
  S:     1 MYDTLIIGSGPGGMTAALYAARSNLKVGLIEQGA-PGGQ---MNNTAEIENYPGYDHISGPELSMKMYEPLEKFEVEHI------YGIVQRVENDGDVKRVITEDESYEAKTVILATG--AKNSLLGVPGEEEYTSRGVSYCAVCDGAFFRDQDLLVVGGGDSAVEEAVFLTQ--FAKSVTIIHRRDQLRAQKVLQDRAFANEKIKFVWDSVVKEIKGNEIKVSGVTVENLKTGEISEMPFGGVFIYVGLKPHSSMVSEL--GITDETGWVLTDTNMKTSIPGLYAIGD 273
>gi|73663262|ref|YP_302043.1| thioredoxin reductase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72495777|dbj|BAE19098.1| thioredoxin reductase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (314 aa)
Score = 197, Expect = 1.6e-13, Identities = 82/283 (28%), Positives = 137/283 (48%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETN--KNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETE------------KEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +D+AI+G G  G+ A+  ++  NL++++IE+    GGQ   +   + + +FP F  +   D+  K+ +  K +  +  Q   DI +I      E +    E N       A  +I+++G      +K+ +  E  +    + Y    +   +K KK+ V+GGGDSAVE   +    K  ++V I+HRR+E R+   + D   KN        E IDF  S+   TI  K+ +             EQTL  D V +  G    P+ +   +  I  E G  + + +  T+I  IYA GD
  S:     7 FDIAIIGAGPAGMTAAVYASRANLSTVMIER-GMPGGQ---MANTEEVENFPGFEMVTGPDLSTKMFEHAK-KFGAQYQYG-DIKSI------EDKGAYKEVNLGNKVITAHAVIISTGA---EYKKIGVPGEQELGGRGVSYCAVCDGAFFKGKKLFVIGGGDSAVEEGTFLT--KFADSVTIVHRRDELRAQKILQDRAFKN--------EKIDFIWSHTLKTINDKDGKVGSVTLESTKDGSEQTLDADGVFIYIGM--KPLTVPFQDLGITNEVGYVLTNEDMSTSIPGIYAAGD 278
>gi|38257103|ref|NP_940765.1| thioredoxin reductase [Staphylococcus warneri] >gi|38142396|dbj|BAD01000.1| thioredoxin reductase [Staphylococcus warneri] (317 aa)
Score = 197, Expect = 1.6e-13, Identities = 73/283 (25%), Positives = 138/283 (48%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +DVAI+G G  G+ A+   +  NL++++IE+    GGQ   +   + + +FP F  +   D+  K+ +  K +  +  Q   DI ++     ++ +  +         A+ +I+++G      +K+ +  E  +    + Y    +   +K KK+ V+GGGDSAVE   +    K  +NV I+HRR E R+   + D   KN+ +  + ++ +   N+ +    ++T++  +   EQTL  D V +  G    P+    L+  I  + G    + +  T +  IYA GD
  S:     7 FDVAIIGAGPAGMTAAVYVSRANLSTVMIER-GMPGGQ---MANTEEVENFPGFEMVTGPDLSTKMFEHAK-KFGAQYQYG-DIKSVE----DKGDYKVINLGNKEITARAVIISTGA---EYKKIGVPGEQDLGGRGVSYCAVCDGAFFKGKKLFVIGGGDSAVEEGTFLT--KFADNVTIVHRREELRAQKILQDRAFKNDKIDFIWSHTLKTINDKDGKVGSVTLESTKDGSEQTLDADGVFIYIGM--KPLTTPFLDLGITNDVGYIETNEDMSTKVSGIYAAGD 278
>gi|15923754|ref|NP_371288.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus Mu50] >gi|15926441|ref|NP_373974.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus N315] >gi|21282455|ref|NP_645543.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus MW2] >gi|49485636|ref|YP_042857.1| putative thioredoxin reductase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57650105|ref|YP_185703.1| thioredoxin-disulfide reductase [Staphylococcus aureus subsp. aureus COL] >gi|87161001|ref|YP_493449.1| thioredoxin-disulfide reductase [Staphylococcus aureus subsp. aureus USA300] >gi|88194546|ref|YP_499342.1| thioredoxin reductase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148267224|ref|YP_001246167.1| thioredoxin reductase [Staphylococcus aureus subsp. aureus JH9] >gi|150393273|ref|YP_001315948.1| thioredoxin reductase [Staphylococcus aureus subsp. aureus JH1] >gi|151220944|ref|YP_001331766.1| thioredoxin reductase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156979092|ref|YP_001441351.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus Mu3] >gi|161509033|ref|YP_001574692.1| thioredoxin-disulfide reductase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727624|ref|ZP_02759901.1| thioredoxin-disulfide reductase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|54039788|sp|P66011|TRXB_STAAW Thioredoxin reductase (TRXR) >gi|54039789|sp|P99101|TRXB_STAAN Thioredoxin reductase (TRXR) >gi|54042095|sp|P66010|TRXB_STAAM Thioredoxin reductase (TRXR) >gi|81649736|sp|Q6GB66|TRXB_STAAS Thioredoxin reductase (TRXR) >gi|81694972|sp|Q5HHQ4|TRXB_STAAC Thioredoxin reductase (TRXR) >gi|6434033|emb|CAB60740.1| thioredoxine reductase [Staphylococcus aureus] >gi|13700655|dbj|BAB41952.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus N315] >gi|14246533|dbj|BAB56926.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus Mu50] >gi|21203892|dbj|BAB94591.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus MW2] >gi|32468851|emb|CAA11546.2| thioredoxin reductase [Staphylococcus aureus] >gi|49244079|emb|CAG42505.1| putative thioredoxin reductase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57284291|gb|AAW36385.1| thioredoxin-disulfide reductase [Staphylococcus aureus subsp. aureus COL] >gi|87126975|gb|ABD21489.1| thioredoxin-disulfide reductase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202104|gb|ABD29914.1| thioredoxin reductase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740293|gb|ABQ48591.1| thioredoxin reductase [Staphylococcus aureus subsp. aureus JH9] >gi|149945725|gb|ABR51661.1| thioredoxin reductase [Staphylococcus aureus subsp. aureus JH1] >gi|150373744|dbj|BAF67004.1| thioredoxin reductase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156721227|dbj|BAF77644.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus Mu3] >gi|160367842|gb|ABX28813.1| thioredoxin-disulfide reductase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (311 aa)
Score = 196, Expect = 1.9e-13, Identities = 73/283 (25%), Positives = 136/283 (48%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +D+AI+G G  G+ A+  ++  NL +++IE+    GGQ   +   + + +FP F  I   D+  K+ +  K  K   +    DI ++     ++ E  +         AK +I+A+G      +K+ +  E  +    + Y    +   +KNK++ V+GGGDSAVE   +    K  + V I+HRR+E R+   + D   KN+ +  + ++ +   NE +    ++T+   +   E+T   D V +  G    P+     +  I  + G  V   +  T++  I+A GD
  S:     6 FDIAIIGAGPAGMTAAVYASRANLKTVMIER-GIPGGQ---MANTEEVENFPGFEMITGPDLSTKMFEHAK--KFGAVYQYGDIKSVE----DKGEYKVINFGNKELTAKAVIIATGA---EYKKIGVPGEQELGGRGVSYCAVCDGAFFKNKRLFVIGGGDSAVEEGTFLT--KFADKVTIVHRRDELRAQRILQDRAFKNDKIDFIWSHTLKSINEKDGKVGSVTLTSTKDGSEETHEADGVFIYIGM--KPLTAPFKDLGITNDVGYIVTKDDMTTSVPGIFAAGD 277
>gi|88604277|ref|YP_504455.1| glutaredoxin [Methanospirillum hungatei JF-1] >gi|88189739|gb|ABD42736.1| glutaredoxin [Methanospirillum hungatei JF-1] (391 aa)
Score = 196, Expect = 2.0e-13, Identities = 88/305 (28%), Positives = 154/305 (50%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILN--------ITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNL----ETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDF--NESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           ++DV IVG G  G+ A+      NL +++I     +GGQ +E +    I ++  +  I   D++ K  +Q +E +   I+++ D +N         + +T+++QE          +  K IIL+ G     PRKL +  E     FI   L++    +  I+K K + V+GGG+SA+  A       I   V +I R +    + +      K NI+    YE+ +   ++    + I ++ET +++TL  D +  + G I +   +E L ++N +K + VID+N +T+   I+A GD T    K   II AC E  +A
  S:    91 MFDVIIVGAGPAGLTAALYCVRKNLKTLMISPD--IGGQALESWN---IENYMGYRMITGDDLMAKFEEQIRELE---IRIELDQVNSLLPTSGGFSVKTVSDQE----------YKGKTIILSQGK---KPRKLGVARE---EEFIGRGLSVCATCDGPIFKEKVVGVVGGGNSALTTA--LEMSGIAKEVHLIVRSSIRADAVYTSQYAQKQNIITHTGYEVTELIGDDRLSGIIITNRETGEKKTLKLDGLFTEIGWIPNTSFVEGLLKLNDQK-EIVIDINCRTSAPGIFAAGDVTSIAGK--QIIIACGEGAKA 380
>gi|82750469|ref|YP_416210.1| thioredoxin reductase [Staphylococcus aureus RF122] >gi|82656000|emb|CAI80405.1| thioredoxin reductase [Staphylococcus aureus RF122] (311 aa)
Score = 196, Expect = 2.0e-13, Identities = 72/283 (25%), Positives = 136/283 (48%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +D+AI+G G  G+ A+  ++  NL +++IE+    GGQ   +   + + +FP F  I   D+  K+ +  K  K   +    DI ++     ++ E  +         AK +I+A+G      +K+ +  E  +    + Y    +   +KNK++ V+GGGDSAVE   +    K  + + I+HRR+E R+   + D   KN+ +  + ++ +   NE +    ++T+   +   E+T   D V +  G    P+     +  I  + G  V   +  T++  I+A GD
  S:     6 FDIAIIGAGPAGMTAAVYASRANLKTVMIER-GIPGGQ---MANTEEVENFPGFEMITGPDLSTKMFEHAK--KFGAVYQYGDIKSVE----DKGEYKVINFGNKELTAKAVIIATGA---EYKKIGVPGEQELGGRGVSYCAVCDGAFFKNKRLFVIGGGDSAVEEGTFLT--KFADKITIVHRRDELRAQRILQDRAFKNDKIDFIWSHTLKSINEKDGKVGSVTLTSTKDGSEETHEVDGVFIYIGM--KPLTAPFKDLGITNDVGYIVTKDDMTTSVPGIFAAGD 277
>gi|25029489|ref|NP_739543.1| putative thioredoxin reductase [Corynebacterium efficiens YS-314] >gi|23494778|dbj|BAC19743.1| putative thioredoxin reductase [Corynebacterium efficiens YS-314] (313 aa)
Score = 196, Expect = 2.0e-13, Identities = 80/309 (25%), Positives = 149/309 (48%)
  Q:     3 EDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLD-TDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI--DLNQKTNIKNIYAIGDA--THFYCKPNTIITACAEAVRA 311
           E  +I+DVAI+G G  G  A+  +   +L  I+ E   Y G     L     + +FP F + I   ++++ +  Q  E+  ++++++  D +++T       ++       + + A+ +IL+ G+    PR L I  E  +    +      +   ++++ I V+GGGDSA+E A +    K   +V I+HRR E+R+S+ M++   KN     +  K   E+I+ +     L +K   T +   L    + V  G    P +  L+ Q+  +   YV+    + +TN+  ++A GD   +H+       ITA     RA
  S:     4 EQSKIHDVAIIGSGPAGYTAAIYAARADLKPIMFEGYEYGG----SLMTTTDVENFPGFQDGIMGPELMENMRAQ-AERFGTDLRMELVDRVDLT------GDIKKIWVGDDEYQARAVILSMGSA---PRYLGIPGEKELLGRGVSACATCDGFFFRDQDIAVIGGGDSAMEEATFLT--KFARSVTIVHRREEFRASAIMLERAQKNEKIRFVTNKTVEEVIENDGKVAGLKLKDTVTGELSDLDVTAMFVAIGH--DPRSEMLVGQVELDSSNYVVAEHPSTRTNVPGVFAAGDLVDSHY----QQAITAAGSGCRA 301
>gi|30265183|ref|NP_847560.1| thioredoxin reductase [Bacillus anthracis str. Ames] >gi|42784308|ref|NP_981555.1| thioredoxin reductase [Bacillus cereus ATCC 10987] >gi|47778397|ref|YP_022046.2| thioredoxin reductase [Bacillus anthracis str. 'Ames Ancestor'] >gi|65317129|ref|ZP_00390088.1| COG0492: Thioredoxin reductase [Bacillus anthracis str. A2012] >gi|165869991|ref|ZP_02214648.1| thioredoxin-disulfide reductase [Bacillus anthracis str. A0488] >gi|166984477|ref|ZP_02255823.1| thioredoxin-disulfide reductase [Bacillus cereus AH187] >gi|166996660|ref|ZP_02263120.1| thioredoxin-disulfide reductase [Bacillus cereus AH820] >gi|167635282|ref|ZP_02393597.1| thioredoxin-disulfide reductase [Bacillus anthracis str. A0442] >gi|167640534|ref|ZP_02398797.1| thioredoxin-disulfide reductase [Bacillus anthracis str. A0193] >gi|168162306|ref|ZP_02597539.1| thioredoxin-disulfide reductase [Bacillus cereus H3081.97] >gi|170688015|ref|ZP_02879228.1| thioredoxin-disulfide reductase [Bacillus anthracis str. A0465] >gi|170707776|ref|ZP_02898227.1| thioredoxin-disulfide reductase [Bacillus anthracis str. A0389] >gi|177652999|ref|ZP_02935326.1| thioredoxin-disulfide reductase [Bacillus anthracis str. A0174] >gi|190567821|ref|ZP_03020733.1| thioredoxin-disulfide reductase [Bacillus anthracis Tsiankovskii-I] >gi|196032713|ref|ZP_03100126.1| thioredoxin-disulfide reductase [Bacillus cereus W] >gi|196039603|ref|ZP_03106908.1| thioredoxin-disulfide reductase [Bacillus cereus NVH0597-99] >gi|196045739|ref|ZP_03112969.1| thioredoxin-disulfide reductase [Bacillus cereus 03BB108] >gi|30259860|gb|AAP29046.1| thioredoxin reductase [Bacillus anthracis str. Ames] >gi|42740239|gb|AAS44163.1| thioredoxin reductase [Bacillus cereus ATCC 10987] >gi|47552102|gb|AAT34521.2| thioredoxin reductase [Bacillus anthracis str. 'Ames Ancestor'] >gi|164714314|gb|EDR19834.1| thioredoxin-disulfide reductase [Bacillus anthracis str. A0488] >gi|167511577|gb|EDR86960.1| thioredoxin-disulfide reductase [Bacillus anthracis str. A0193] >gi|167529325|gb|EDR92077.1| thioredoxin-disulfide reductase [Bacillus anthracis str. A0442] >gi|170127333|gb|EDS96209.1| thioredoxin-disulfide reductase [Bacillus anthracis str. A0389] >gi|170668124|gb|EDT18874.1| thioredoxin-disulfide reductase [Bacillus anthracis str. A0465] >gi|172081774|gb|EDT66844.1| thioredoxin-disulfide reductase [Bacillus anthracis str. A0174] >gi|190561237|gb|EDV15210.1| thioredoxin-disulfide reductase [Bacillus anthracis Tsiankovskii-I] >gi|195994142|gb|EDX58097.1| thioredoxin-disulfide reductase [Bacillus cereus W] >gi|196023570|gb|EDX62247.1| thioredoxin-disulfide reductase [Bacillus cereus 03BB108] >gi|196029763|gb|EDX68365.1| thioredoxin-disulfide reductase [Bacillus cereus NVH0597-99] (318 aa)
Score = 196, Expect = 2.1e-13, Identities = 77/290 (26%), Positives = 144/290 (49%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQ--ISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M+E+ +IYDV I+G G  G+ A+  ++  NL+++++E +   GGQ   +   + + ++P +  I   D+  K+ +  K+        D        + I+ +E       K  + A+ II+ASG      +K+ +  E  +    + Y    +   +K K+++V+GGGDSAVE   +    +  + V I+HRR+  R+   + D   +N  +  + N+ I + NE+N    ++T+    + +E+ +  D V V  G   +S P  +EL   I  E G    +   +T +  I+A GD
  S:     1 MSEE-KIYDVIIIGAGPAGMTAAVYTSRANLSTLMLE-RGIPGGQ---MANTEDVENYPGYESILGPDLSNKMFEHAKKFGAEYAYGDVK------EVIDGKEYKTIIAGKKEYKARAIIVASGA---EYKKIGVPGETELGGRGVSYCAVCDGAFFKGKELVVIGGGDSAVEEGVFLT--RFASKVTIVHRRDTLRAQKILQDRAFQNEKVDFIWNHTIKEINEANGKVGSVTLVDVNSGEEKEVKTDGVFVYIGMLPLSKPF-VEL--GITNENGYLETNERMETKVPGIFAAGD 278
>gi|167937880|ref|ZP_02524955.1| Thioredoxin reductase [Bacillus cereus AH1134] >gi|168136161|ref|ZP_02579390.1| Thioredoxin reductase [Bacillus cereus B4264] (318 aa)
Score = 195, Expect = 2.6e-13, Identities = 77/290 (26%), Positives = 144/290 (49%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQ--ISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M+E+ +IYDV I+G G  G+ A+  ++  NL+++++E +   GGQ   +   + + ++P +  I   D+  K+ +  K+        D        + I+ +E       K  + A+ II+ASG      +K+ +  E  +    + Y    +   +K K+++V+GGGDSAVE   +    +  + V I+HRR+  R+   + D   +N  +  + N+ I + NE++    ++T+    + +E+ +  D V V  G   +S P  +EL   I  E G    +   +T I  I+A GD
  S:     1 MSEE-KIYDVVIIGAGPAGMTAAVYTSRANLSTLMLE-RGIPGGQ---MANTEDVENYPGYESILGPDLSNKMFEHAKKFGAEYAYGDVK------EVIDGKEYKTIIAGKKEYKARAIIVASGA---EYKKIGVPGETELGGRGVSYCAVCDGAFFKGKELIVIGGGDSAVEEGVFLT--RFASKVTIVHRRDTLRAQKILQDRAFQNEKVDFIWNHTIKEINEASGKVGSVTLVDVNSGEEKEVKTDGVFVYIGMLPLSKPF-VEL--GITNENGYLETNERMETKIPGIFAAGD 278
>gi|68537188|ref|YP_251893.1| hypothetical protein jk2093 [Corynebacterium jeikeium K411] >gi|68264787|emb|CAI38275.1| trxB [Corynebacterium jeikeium K411] (344 aa)
Score = 195, Expect = 2.7e-13, Identities = 78/306 (25%), Positives = 153/306 (50%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDF--NESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI--DLNQKTNIKNIYAIGDA--THFYCKPNTIITACAEAVRA 311
           +++DV I+G G  G  A+  +    LN ++ E   Y GG  M+      + +FP F + I   D+++++  Q +       Q D + +++T +    ++++ +      + A+ +ILA+G     PR L +  E  +    +      +   +K+K+I V+GGGDSA+E A++    K    V IIHRR+E+R+S  M +    N  ++ L N ++++   ++S +TL ++  +  +++ +  D + V  G    P       Q+  +   YV   + + +T++  ++A GD   +H+       ITA     RA
  S:    40 KVHDVIIIGSGPAGYTAAVYAARAELNPVVFEGVEY-GGLLMQ---TTEVENFPGFQKGIMGPDLMEEMRAQAERFGADLRQEDVEKVDLTGEI---KKVWAY---GEEYQARTVILATGAA---PRYLHVPGEQEMLGRGVSACATCDGFFFKDKQIAVIGGGDSAMEEADFLT--KFGETVTIIHRRDEFRASKIMEERARNNPKIKFLTNAKVVEVKGDKSVETLVVEDTQNGEQKDVAMDAMFVAIGH--DPRTAVFEGQVELQDNGYVKVEEPSTRTSLPGVFAAGDLVDSHY----QQAITAAGSGCRA 333
>gi|157738293|ref|YP_001490977.1| thioredoxin reductase [Arcobacter butzleri RM4018] >gi|114461681|gb|ABI75085.1| thioredoxin reductase [Arcobacter butzleri] >gi|157700147|gb|ABV68307.1| thioredoxin reductase [Arcobacter butzleri RM4018] (309 aa)
Score = 195, Expect = 2.9e-13, Identities = 76/284 (26%), Positives = 147/284 (51%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSS-DVIKKLIQQ-------NKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKN-NILQKLNYEIID-FNESNKT--LTIKHKETEKEQTLPFDYVLVQYGQ--ISSPI---NIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           + D+AI+GGG  G+ A   +    L ++++ +    GGQ   +  +  I ++P   EI S  D++ K  +Q       ++  +  N+  + DI  +T             ++K  + AK +++A+G+    PR+     E       I      +   YK K++ V+GGGDSA+E A Y    K+   V ++HRR+ YR++   ++ +    NI +  N  + + F +++    L +K  +T + + LP   V +  G+  +++P+   +   L  + +E G+ V+DL  +T++  +YA GD
  S:     1 MLDLAIIGGGPAGLTAGLYATRGGLKNVIMFEMGMPGGQ---ITSSSEIENYPGQVEIVSGMDLMMKWPEQCQRFGLKHEMAQVENVTKNGDIFKVT------------TSDKKEYEAKSVLIATGS---VPRRAGFKGENEFFGKGISTCATCDGFFYKGKEVAVVGGGDSAIEEAIYLA--KLCKKVYLVHRRDTYRAAPSTVEHMKHTENIEEVTNVSVEEVFGDASGVTGLKVKCNKTGEIRDLPTPGVFIFVGRDVLNAPLKQADGSFLCDV-RESGEVVVDLKMRTSVAGLYAAGD 281
>gi|20808290|ref|NP_623461.1| thioredoxin reductase [Thermoanaerobacter tengcongensis MB4] >gi|20516892|gb|AAM25065.1| Thioredoxin reductase [Thermoanaerobacter tengcongensis MB4] (308 aa)
Score = 195, Expect = 3.1e-13, Identities = 74/284 (26%), Positives = 144/284 (50%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQP-----MELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFI----HYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +YD  I+GGG  G+ A+  ++   LN+++ E +S +GGQ      +E YP           E     ++K++ +Q +      +  +   + ++      +++    T K  +  K +I+A+G       KL   N P +  FI     Y    + + + +  ++V+GGGDSAV+ A Y    K   NV IIHRR++ R++  + D   KN  ++ L   +++  E +   + + +++ +T + + +  D V +  G   S    + L +++ E+G  + D N +TNI+ ++A GD
  S:     4 LYDCLIIGGGPAGLSAAIYASRGKLNTVVFE-RSKIGGQAAITDDIENYPGS-------VEEATGPKIVKRMREQAESFGTCFVMEEVKKVELS------EKIKKVITTKGCYEGKTVIIATGAEHM---KL---NVPGEEEFIGKGVSYCATCDADFFTDLDVVVVGGGDSAVQEALYLT--KFAKNVTIIHRRDKLRANKCLQDKAFKNPKIKFLWDSVVERIEGDGIVEKVIVRNVKTGELKEVKTDGVFIFIGMKPSTEIFKGLIEMD-ERGYILTDENMRTNIEGVFAAGD 276
>gi|153939548|ref|YP_001390605.1| putative thioredoxin reductase [Clostridium botulinum F str. Langeland] >gi|152935444|gb|ABS40942.1| putative thioredoxin reductase [Clostridium botulinum F str. Langeland] (313 aa)
Score = 195, Expect = 3.2e-13, Identities = 85/290 (29%), Positives = 150/290 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN--KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINK--EKGKYVIDLNQKTNIKNIYAIGD 290
           MN++ R  D+ I+G G  G+ A+  +    LN ILIE    +GGQ    Y    + ++P F +I+ S  +  L+Q+      + I  + D++       NE+   + ET++  +    +I+++G  +   RKL I   P +S F    IHY    +  +Y+ K + V+GGG++A+E A +    K  + V +I R + ++     ++ +  N+ ++ L N++++D   SN      IK+ +T++E+ L  D V   +G I S    EL  +      KG    + N +TNIK +YA GD
  S:     1 MNKNNRNLDLMIIGAGPAGLSAAIYAARAKLNMILIE-NGIIGGQVRSSYT---VENYPGFKKIEGSR-LADLMQEQATDLGATID-EFDMVEKIQLNNNEK---IVETSEYIYKPTVLIISTGATA---RKLPI---PSESKFSGKGIHYCAICDGAMYEGKTVGVIGGGNAALEEALFLT--KFASKVYMIRRYDYFKGEKATLEEVENNSKIEILYNWDLVDVYGSNFVDKALIKNVKTKEEKELKLDGV---FGFIGSEPKTELFKEYISLTPKGYIKTNENMETNIKGVYAAGD 279
>gi|168142996|ref|ZP_02586225.1| Thioredoxin reductase [Bacillus cereus G9842] (318 aa)
Score = 194, Expect = 3.4e-13, Identities = 77/290 (26%), Positives = 144/290 (49%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQ--ISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M+E+ +IYDV I+G G  G+ A+  ++  NL+++++E +   GGQ   +   + + ++P +  I   D+  K+ +  K+        D        + I+ +E       K  + A+ II+ASG      +K+ +  E  +    + Y    +   +K K+++V+GGGDSAVE   +    +  + V I+HRR+  R+   + D   +N  +  + N+ I + NE++    ++T+    + +E+ +  D V V  G   +S P  +EL   I  E G    +   +T I  I+A GD
  S:     1 MSEE-KIYDVVIIGAGPAGMTAAVYTSRANLSTLMLE-RGIPGGQ---MANTEDVENYPGYESILGPDLSNKMFEHAKKFGAEYAYGDVK------EVIDGKEYKTIIAGKKEYKARAIIVASGA---EYKKIGVPGETELGGRGVSYCAVCDGAFFKEKELIVIGGGDSAVEEGVFLT--RFASKVTIVHRRDTLRAQKILQDRAFQNEKVDFIWNHTIKEINEASGKVGSVTLVDVNSGEEKEVKTDGVFVYIGMLPLSKPF-VEL--GITNENGYLETNERMETKIPGIFAAGD 278
>gi|116494455|ref|YP_806189.1| thioredoxin reductase [Lactobacillus casei ATCC 334] >gi|116104605|gb|ABJ69747.1| Thioredoxin reductase [Lactobacillus casei ATCC 334] (315 aa)
Score = 194, Expect = 3.7e-13, Identities = 71/283 (25%), Positives = 140/283 (49%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKL----IQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           YDV ++G G GG+ A+  ++  NL+ +++++  Y GGQ   +     + ++P F  I   D+ +K+     Q   E    N+        ++ Q  N   + L +T+++ + AK I++A+G      +KL +   E      + Y    +   +K++++ V+GGGDSA+E   Y  +  +   V +IHRR++ R+   +      N+ +  + N ++ +    +  +T    + KET +E  LP   V +  G +      + L  ++ E G    D + +T +  ++AIGD
  S:     5 YDVIVIGAGPGGMTAALYASRANLSVLMLDRGVY-GGQ---MNNTAEVENYPGFKSILGPDLGQKMYDGATQFGAEYAYGNV--------VSVQ--NRGAVKLVKTDEDEYEAKAIVIATGA---EHKKLGVPGEEAYSGRGVSYCAVCDGAFFKDRELAVIGGGDSAIEEGLYLTQ--MAKKVTVIHRRDQLRAQQIIQKRAFANDKMHFVWNAQVQEIQGDDMKVTGVKYRDKETGEEHVLPVAGVFIYVGIMPMTEAFQDLGVLD-EHGWIPTDEHMRTKVPGVFAIGD 276
>gi|163793756|ref|ZP_02187730.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [alpha proteobacterium BAL199] >gi|159180867|gb|EDP65384.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [alpha proteobacterium BAL199] (342 aa)
Score = 194, Expect = 3.7e-13, Identities = 73/300 (24%), Positives = 142/300 (47%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNK--------EQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDF----NESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           DV IVG G  G+FA       +L   L++     GGQ  ELYP K IYD P        ++ ++L++Q +         Q    ++   D     W+   +    +         +K I++A+G GSF P+K  I   +  +   + Y++    E ++ K++++ GGGDSA++W      + +  ++ ++HRR+E+R++   ++ +        ++ EI           +   +  K+ + E+ +  D +L  YG ++  +       +N  +    +D  + +T+   I+AIGD   +  K   I++   EA
  S:     9 DVTIVGAGPCGLFAVFELGLLDLKCHLVDILDRPGGQCAELYPEKPIYDIPAVPICTGQELTERLMEQIRPFDPVFHFSQMAEKLERTDDGY---WRMTTDVGTVI--------ESKVIVVAAGGGSFVPKKPPIKGIDAYEGTGVFYAVR-RMEQFRGKRLVIAGGGDSALDWTVNL--QPLAQSLTLVHRRDEFRAAPDTVNKMRALVASGAMSLEIAQIGGVEGTDGRLEAVILKDKDGERRVECDTLLAFYG-LTMKLGPVAEFGLNLHENLISVDTERFETSTPGIFAIGDINSYPGKLKLILSGFHEA 307
>gi|49187993|ref|YP_031246.1| thioredoxin reductase [Bacillus anthracis str. Sterne] >gi|49480378|ref|YP_039145.1| thioredoxin-disulfide reductase (thioredoxin reductase (NADPH)) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140407|ref|YP_086422.1| thioredoxin-disulfide reductase (thioredoxin reductase (NADPH)) [Bacillus cereus E33L] >gi|118480194|ref|YP_897345.1| thioredoxin-disulfide reductase [Bacillus thuringiensis str. Al Hakam] >gi|49181920|gb|AAT57296.1| thioredoxin reductase [Bacillus anthracis str. Sterne] >gi|49331934|gb|AAT62580.1| thioredoxin-disulfide reductase (thioredoxin reductase (NADPH)) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51973876|gb|AAU15426.1| thioredoxin-disulfide reductase (thioredoxin reductase (NADPH)) [Bacillus cereus E33L] >gi|118419419|gb|ABK87838.1| thioredoxin-disulfide reductase [Bacillus thuringiensis str. Al Hakam] (321 aa)
Score = 194, Expect = 3.7e-13, Identities = 75/285 (26%), Positives = 140/285 (49%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQ--ISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +IYDV I+G G  G+ A+  ++  NL+++++E +   GGQ   +   + + ++P +  I   D+  K+ +  K+        D        + I+ +E       K  + A+ II+ASG      +K+ +  E  +    + Y    +   +K K+++V+GGGDSAVE   +    +  + V I+HRR+  R+   + D   +N  +  + N+ I + NE+N    ++T+    + +E+ +  D V V  G   +S P  +EL   I  E G    +   +T +  I+A GD
  S:     8 KIYDVIIIGAGPAGMTAAVYTSRANLSTLMLE-RGIPGGQ---MANTEDVENYPGYESILGPDLSNKMFEHAKKFGAEYAYGDVK------EVIDGKEYKTIIAGKKEYKARAIIVASGA---EYKKIGVPGETELGGRGVSYCAVCDGAFFKGKELVVIGGGDSAVEEGVFLT--RFASKVTIVHRRDTLRAQKILQDRAFQNEKVDFIWNHTIKEINEANGKVGSVTLVDVNSGEEKEVKTDGVFVYIGMLPLSKPF-VEL--GITNENGYLETNERMETKVPGIFAAGD 281
>gi|78356250|ref|YP_387699.1| thioredoxin reductase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78218655|gb|ABB38004.1| thioredoxin reductase [Desulfovibrio desulfuricans G20] (305 aa)
Score = 193, Expect = 4.3e-13, Identities = 77/306 (25%), Positives = 149/306 (48%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE-------LFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNIL----QKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKY-VIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           R  D+ I+GGG  G+ A+  +   +LN  L+E+ S  GG     Y    + +FP +  I   ++++K+                D L +T + + E E       +   ET++  F A+ +ILA+G     P  L++   P     +H+    +   YK +++LV+GGG+SA + + Y +   +  ++ ++ + + + ++    D L +   +    Q + +++I  N+S K   ++H  +   +T+P D V V  GQ  SP N    + +    G Y V+D +  T++  +++ GD    + +   I TA A+   A
  S:     5 RQVDIVILGGGPAGMTAAIYAARASLNVALLEE-SVTGGLVNSTYT---VENFPSYPAIHGMELMQKMRDH------------VDSLGVTVEEVCEIESVSLAGQVKTVETDEAVFQARAVILATGR---KPVPLDV---PTGCEQVHHCAICDGAAYKGRRVLVVGGGNSAFDESLYMLGIGV-EHITLVEKMDRFFAAQSTQDTLLETGRVDARTQTVVHDLIVENDSLKAAVLEHTGSGVRETVPVDGVFVFLGQ--SPNNDLFRDVVTLSAGGYVVVDEHMATSVSGVFSAGDINEKHYR--QITTAMADGTVA 295
>gi|150017536|ref|YP_001309790.1| thioredoxin reductase [Clostridium beijerinckii NCIMB 8052] >gi|149904001|gb|ABR34834.1| thioredoxin reductase [Clostridium beijerinckii NCIMB 8052] (302 aa)
Score = 193, Expect = 4.4e-13, Identities = 79/282 (28%), Positives = 140/282 (49%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKE-------QKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEIN-NEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSS-SFMIDCLSKNNILQKLNYEIIDFNESNKT--LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI-DLNQKTNIKNIYAIGD 290
           D+ I+GGG   I A+  +    L+++++EK+ Y GGQ   +     + ++P F  I  S++   + +  K+       ++  +I++D DI  +              T  N++ +K IIL+ G     P+KL I+  E +    + Y    +   ++ K + V+GGGD+AVE A +    +I   V +I RR+  R++ S        NN+    N  +   N   K   + IK+ +  K   L  + V V  G  S P +  + + ++ +K  Y+I D + KTN+  I+AIGD
  S:     3 DIIIIGGGPAAITAALYAGRAGLDALMLEKQ-YEGGQ---IVTTNEVENYPGFRSITGSELANTMYEHAKDFGSIMKYEEVIDIKVDGDIKKVI-------------TGVNTYESKVIILSMGA---KPKKLGIDREEELTGKGVSYCATCDGGFFRKKVVAVVGGGDTAVEDALHL--SRIAEKVYVIVRRDSLRANKSAQKKLFETNNVEIIWNSGVTKLNGEEKLSGIEIKNNKDGKIDNLEVNGVFVAIG--SDPSSELVKDLVDLDKNDYIIADESCKTNVDGIFAIGD 272
>gi|161528180|ref|YP_001582006.1| thioredoxin reductase [Nitrosopumilus maritimus SCM1] >gi|160339481|gb|ABX12568.1| thioredoxin reductase [Nitrosopumilus maritimus SCM1] (334 aa)
Score = 193, Expect = 4.4e-13, Identities = 75/283 (26%), Positives = 137/283 (48%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEIN-NEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQ-KLNYEIIDF--NESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQK-TNIKNIYAIGD 290
           +DV I+G G  G  A    +    ++ LI      GGQ   L     + ++P F   I   D++ ++ +Q   Q+     +D + +++ ++    + L    T    +  + II+A+G    NPRKL +   E      + Y    +   ++N++++V+GGGDSAVE A +    K    V ++HRR+E R+S  M D    N  ++   +  ++D   ++  +   +K+ +T +E TL    + V  G    P      NQI+ +   YV+  N+  TN++ ++A GD
  S:    28 FDVVIIGAGPSGYTAGIYCSRAGYDT-LILSGILPGGQ---LVNTTEVENYPGFENGIMGPDLMIEMRKQC--QRMGTTIVDDEAVDVDFRRKPLKVL----TASEEYEGRAIIIATGA---NPRKLGLEGEETFGGKGVSYCATCDGPFFRNQELVVVGGGDSAVEEATFLT--KFATTVHLVHRRDELRASKVMQDRAHSNEKIKFHWDSAVVDIKGDQKMQQAVLKNLKTNEESTLDVGGLFVAIGH--EPNTKLFKNQIDLDDEGYVVLKNKTHTNVEGVFAAGD 299
>gi|167772842|ref|ZP_02444895.1| hypothetical protein ANACOL_04230 [Anaerotruncus colihominis DSM 17241] >gi|167664775|gb|EDS08905.1| hypothetical protein ANACOL_04230 [Anaerotruncus colihominis DSM 17241] (308 aa)
Score = 193, Expect = 4.6e-13, Identities = 76/283 (26%), Positives = 131/283 (46%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSK-NNILQKLNYEIIDFNESNKT-----LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYV-IDLNQKTNIKNIYAIGD 290
           YDV I+G G  G+ A+       L ++++E+  Y+ G  +   P   + ++P   +I   D+   L  Q  EQ  + +  +     +   ++  +E  +   +  ++ AK II+A+G      RKL +   E +    + Y    +   YK K  +V+GGG++AVE A Y     +   V I+HRR+ +R+   + D L K  NI    +   ++      T     L I+  +T +E+T+    V V  G +  P N     QI  +   Y+    +  TNI  +YA GD
  S:     4 YDVIIIGAGPAGLTAAIYVQRAGLRALVLEE--YVCGGQIANTPE--VENYPAVTKISGVDLSMNLYNQAVEQ-GAQVLFE----GVGSASLEGREKTVTTKSGRTYSAKAIIIANGAKR---RKLGVPGEEELAGKGVSYCATCDGGFYKGKTTVVVGGGNTAVEDALYLA--NLCERVHIVHRRDAFRAGRVLTDALQKRENITVHFDAVPVEVESDAATGMVSGLRIRSVKTNEEETISAQGVFVAVGLV--PDNGLFSGQITLDPAGYIAAGEDTHTNIPGVYAAGD 278
>gi|15899168|ref|NP_343773.1| thioredoxin reductase (trxB-3) [Sulfolobus solfataricus P2] >gi|13815721|gb|AAK42563.1| Thioredoxin reductase (trxB-3) [Sulfolobus solfataricus P2] (323 aa)
Score = 193, Expect = 4.6e-13, Identities = 82/304 (26%), Positives = 149/304 (49%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETN-KNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKN-NILQKLNYEI--IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYV-IDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           +DV IVG G     A+  S  + L +++I +    GGQ  E      + D+    EI++SD+IK     NK  +   + +   +L+I  +  N  + F+ +T  K  F A  +IL  G      RKL +   P +  F    I Y    +  ++KN+ + V+GGGDSA+E A   +    +  V +IHRR+ +++    ++ + K  N+   LN  +  I  ++  K + +++ +T + + L  + V ++ G    P +    N I  +   Y+ +D   +T++  ++A GD T  +     +ITA A+   A
  S:    16 FDVIIVGLGPAAYGAALYSARYMLKTLVIGETP--GGQLTEA---GIVDDYLGLIEIQASDMIKVF---NKHIEKYEVPV---LLDIVEKIENRGDEFVVKTKRKGEFKADSVILGIG---VKRRKLGV---PGEQEFAGRGISYCSVCDAPLFKNRVVAVIGGGDSALEGAE--ILSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLNSVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIG-FDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAGDCTSAWLGFRQVITAVAQGAVA 308
>gi|30023192|ref|NP_834823.1| thioredoxin reductase [Bacillus cereus ATCC 14579] >gi|29898752|gb|AAP12024.1| Thioredoxin reductase [Bacillus cereus ATCC 14579] (321 aa)
Score = 193, Expect = 5.0e-13, Identities = 75/285 (26%), Positives = 140/285 (49%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQ--ISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +IYDV I+G G  G+ A+  ++  NL+++++E +   GGQ   +   + + ++P +  I   D+  K+ +  K+        D        + I+ +E       K  + A+ II+ASG      +K+ +  E  +    + Y    +   +K K+++V+GGGDSAVE   +    +  + V I+HRR+  R+   + D   +N  +  + N+ I + NE++    ++T+    + +E+ +  D V V  G   +S P  +EL   I  E G    +   +T I  I+A GD
  S:     8 KIYDVVIIGAGPAGMTAAVYTSRANLSTLMLE-RGIPGGQ---MANTEDVENYPGYESILGPDLSNKMFEHAKKFGAEYAYGDVK------EVIDGKEYKTIIAGKKEYKARAIIVASGA---EYKKIGVPGETELGGRGVSYCAVCDGAFFKGKELIVIGGGDSAVEEGVFLT--RFASKVTIVHRRDTLRAQKILQDRAFQNEKVDFIWNHTIKEINEASGKVGSVTLVDVNSGEEKEVKTDGVFVYIGMLPLSKPF-VEL--GITNENGYLETNERMETKIPGIFAAGD 281
>gi|28377619|ref|NP_784511.1| thioredoxin reductase (NADPH) [Lactobacillus plantarum WCFS1] >gi|28270452|emb|CAD63354.1| thioredoxin reductase (NADPH) [Lactobacillus plantarum WCFS1] (312 aa)
Score = 193, Expect = 5.1e-13, Identities = 68/283 (24%), Positives = 141/283 (49%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQ-ELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPI-DSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           YDV I+G G  G+ A+  ++  NL+ +L+++  Y GGQ   +     I ++P F  +   D+ K + +       S  Q   +    + +++ ++ ++ +  T+ ++F  K +++ +G+     RKL +  E       + Y    +   ++NK ++V+GGGDSA+E   Y  +  + + V +IHRR++ R+   + D    N  ++ + N  + +    +K +T   + + +T ++  +  D V +  G   +PI     N  I  E G    + + +T +  I+A+GD
  S:     5 YDVIIIGAGPAGMTAALYASRANLSVLLLDRGIY-GGQ---MNNTAAIENYPGFKSVLGPDLAKDMYE-------SATQFGAEYAYGSVESVEDRGDVKIVTTDSDTFETKALVIGTGS---EYRKLGVTGEDTYGGRGVSYCAVCDGAFFRNKHVVVVGGGDSAIEEGTYLTQ--LADKVTVIHRRDQLRAQQILQDRAFANPKMEFVWNSNVTEIIGDDKKVTGVKVNNNKTGEDSEIAVDGVFIYVG--INPITKPFSNLGITDENGWIETNDHMETKVPGIFAVGD 276
>gi|27467465|ref|NP_764102.1| thioredoxine reductase [Staphylococcus epidermidis ATCC 12228] >gi|57866408|ref|YP_188025.1| thioredoxin-disulfide reductase [Staphylococcus epidermidis RP62A] >gi|38605280|sp|Q8CPY8|TRXB_STAES Thioredoxin reductase (TRXR) >gi|81675191|sp|Q5HQW4|TRXB_STAEQ Thioredoxin reductase (TRXR) >gi|27315008|gb|AAO04144.1|AE016745_243 thioredoxine reductase [Staphylococcus epidermidis ATCC 12228] >gi|57637066|gb|AAW53854.1| thioredoxin-disulfide reductase [Staphylococcus epidermidis RP62A] (310 aa)
Score = 193, Expect = 5.2e-13, Identities = 73/283 (25%), Positives = 138/283 (48%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNK----EQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +DVAI+G G  G+ A+  ++  NL +++IE+    GGQ   +   + + +FP F  I   D+  K+ +  K    E +  +I+   D  +     +  +E+           A  +I+++G      +K+ +  E  +    + Y    +   +KNK++ V+GGGDSAVE   +    K  + V I+HRR+E R+ + + +   KN+ +  + ++ +   NE +    ++T++  +   EQT   D V +  G    P+     N  I  + G  V   +  T ++ I+A GD
  S:     6 FDVAIIGAGPAGMTAAVYASRANLKTVMIER-GMPGGQ---MANTEEVENFPGFEMITGPDLSTKMFEHAKKFGAEYQYGDIKSVEDKGDYKVINLGNKEI----------TAHAVIISTGA---EYKKIGVPGEQELGGRGVSYCAVCDGAFFKNKRLFVIGGGDSAVEEGTFLT--KFADKVTIVHRRDELRAQNILQERAFKNDKVDFIWSHTLKTINEKDGKVGSVTLESTKDGAEQTYDADGVFIYIGM--KPLTAPFKNLGITNDAGYIVTQDDMSTKVRGIFAAGD 277
>gi|171914640|ref|ZP_02930110.1| thioredoxin reductase [Verrucomicrobium spinosum DSM 4136] (306 aa)
Score = 192, Expect = 5.6e-13, Identities = 83/303 (27%), Positives = 144/303 (47%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPM-ELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-----NYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLN-QKTNIKNIYAIGD-ATHFYCKPNTII-TACAEAVRA 311
           +V I+G G  G  A+  +   NL  +L+      G QP  +L     + +FP F E I   D++ K+ Q   E+  + I+  + +  +  +   E    L   +     ++ +I+A+G    +PR L + NE  +    +      +   Y+N  + V+GGGDSA E AN+    +  + V +IHRR E R+S  M D +  N  ++ +     +  + D     + +T+K+  T +E  L    V V  G +    N + LN  +  ++  Y++     +TNI  ++A GD A H Y +  T     CA A+ A
  S:     3 NVIIIGTGCAGYTAAIYTARANLTPLLLS-----GSQPGGQLTTTTDVENFPGFPEGIMGPDLMMKM-QAQAEKFGARIEY-SQVEKV--EKTPEGHFDLTMADGKVLQSRTVIVATGA---SPRHLGLPNEKSLIGRGLTSCATCDGAFYRNVPVAVIGGGDSAAEEANFLT--RFASTVYLIHRREELRASKIMADRVLANPKVKPIWNSTVSEYLTDEKGEMRAVTLKNLVTGEENELELKCVFVAIGHVP---NTQFLNGSVTTDENGYIVQTEGTRTNIPGLFAAGDVADHVYRQAITAAGQGCAAALEA 300
>gi|169826045|ref|YP_001696203.1| thioredoxin reductase [Lysinibacillus sphaericus C3-41] >gi|168990533|gb|ACA38073.1| Thioredoxin reductase [Lysinibacillus sphaericus C3-41] (314 aa)
Score = 192, Expect = 5.6e-13, Identities = 73/290 (25%), Positives = 138/290 (47%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M+E+ +IYDV I+G G  G+ A+  ++  NL++++IE +   GGQ   +   + + ++P F  I   ++  K+    K+        D        + I+ +E    ++    +  + II+ +G      +K+ +  E  +    + Y    +   +K K ++V+GGGDSAVE   Y    +  + V I+HRR++ R+   + D    N+ +  + N  + + NE+N    ++T++      E     D V V  G +      E L  +N + G  + + N +T I  I+A GD
  S:     1 MSEE-KIYDVVIIGAGPAGMTAAVYTSRANLSTLMIE-RGIPGGQ---MANTEEVENYPGFDTILGPELSTKMFDHAKKFGAEYAYGDVT------EIIDGEEFKTIKSGTKEYKTRAIIITTGA---EYKKMGVPGEKELGGRGVSYCAVCDGAFFKQKNLVVVGGGDSAVEEGVYLT--RFADKVTIVHRRDKLRAQKILQDRAFANDKIDFIWNATVKEINEANGKVGSVTLQSTVDGTESEFTTDGVFVYIGMLPLTKPFESLGILN-DAGYILTNDNMETTIPGIFAAGD 278
>gi|49483021|ref|YP_040245.1| putative thioredoxin reductase [Staphylococcus aureus subsp. aureus MRSA252] >gi|81651520|sp|Q6GIM7|TRXB_STAAR Thioredoxin reductase (TRXR) >gi|49241150|emb|CAG39828.1| putative thioredoxin reductase [Staphylococcus aureus subsp. aureus MRSA252] (311 aa)
Score = 192, Expect = 5.7e-13, Identities = 73/283 (25%), Positives = 135/283 (47%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +D+AI+G G  G+ A+  ++  NL +++IE+    GGQ   +   + + +FP F  I   D+  K+ +  K  K   +    DI ++     ++ E  +         AK +I+A+G      +K+ +  E  +    + Y    +   +KNK++ V+GGGDSAVE   +    K  + V I+HRR+E R+   + D   KN+ +  + ++ +   NE +    ++T+   +   E+T   D V +  G    P+     +  I  + G  V   +  T+   I+A GD
  S:     6 FDIAIIGAGPAGMTAAVYASRANLKTVMIER-GIPGGQ---MANTEEVENFPGFEMITGPDLSTKMFEHAK--KFGAVYQYGDIKSVE----DKGEYKVINFGNKELTAKAVIIATGA---EYKKIGVPGEQELGGRGVSYCAVCDGAFFKNKRLFVIGGGDSAVEEGTFLT--KFADKVTIVHRRDELRAQRILQDRAFKNDKIDFIWSHTLKSINEKDGKVGSVTLTSTKDGSEETHEADGVFIYIGM--KPLTAPFKDLGITNDVGYIVTKDDMTTSAPGIFAAGD 277
>gi|169334370|ref|ZP_02861563.1| hypothetical protein ANASTE_00769 [Anaerofustis stercorihominis DSM 17244] >gi|169259087|gb|EDS73053.1| hypothetical protein ANASTE_00769 [Anaerofustis stercorihominis DSM 17244] (306 aa)
Score = 192, Expect = 5.8e-13, Identities = 71/283 (25%), Positives = 144/283 (50%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYR-SSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           YDV I+G G  G+ A   ++   LN+++IE K+ +GGQ   +     I ++P   E+   ++++K+ +Q        +    +I++    ++ +++  +F  + +K  +  K  I+ASG+    P++L I  E       + Y    +   +   ++ V+GGGD+A++ A Y    K    V IIHRR+++R   S+     + + +   L++E ++    N  +T   +K+K+T +      D V +  G   +   ++ L +++ EKG  V D   +T++K ++  GD
  S:     3 YDVIIIGAGPAGLSAGLYASRSTLNTLIIE-KAVVGGQ---ITTTTEIENYPGASEVTGPELVEKMKEQ-------CLSFGANIVSDEVISVEKKDDGMFYVKGSKEEYIGKTCIIASGS---TPKELGIKGEREFRGMGVSYCATCDAGFFTGFEVCVVGGGDTALKEAIYLT--KFAKKVTIIHRRDQFRGGKSWEKKARANDKVHFLLSHEPVEILGENGMVTGIKVKNKKTGEVYDYKTDGVFMFVGHNPNSTLVKNLVEVD-EKGYIVTDNALQTSVKGLFVAGD 275
>gi|52082023|ref|YP_080814.1| thioredoxin reductase [Bacillus licheniformis ATCC 14580] >gi|52787411|ref|YP_093240.1| hypothetical protein BLi03728 [Bacillus licheniformis ATCC 14580] >gi|52005234|gb|AAU25176.1| thioredoxin reductase [Bacillus licheniformis ATCC 14580] >gi|52349913|gb|AAU42547.1| TrxB [Bacillus licheniformis DSM 13] (316 aa)
Score = 192, Expect = 5.8e-13, Identities = 72/290 (24%), Positives = 142/290 (48%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFM----IDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M+E+ ++YDV I+G G  G+ A+  ++  NL+++++E+    GGQ   +   + + ++P F  I   ++  K+ +  K+        D        + ++E +  + +     F A+ +I+ +G      +KL +  E  +    + Y    +   +KNK+++V+GGGDSAVE   Y    +  + V I+HRR++ R+ S +     D    + +  K   EI + +     +T+    T +E+    D V +  G +  P++    N  I  E+G  V +   +T ++ I+A GD
  S:     1 MSEE-KMYDVIIIGAGPAGMTAAVYTSRANLSTLMVER-GVPGGQ---MANTEDVENYPGFESILGPELSNKMFEHAKKFGAEYAYGDIK------EVVDEGDYKIVKAGSKEFKARAVIITAGA---EYKKLGVPGEKELGGRGVSYCAVCDGAFFKNKELVVVGGGDSAVEEGVYLT--RFASKVTIVHRRDKLRAQSILQARAFDNEKVDFLWNKTVKEIHEQDGKVGKVTLVDTVTGEEEEFRTDGVFIYIGML--PLSEPFKNLGITNEEGYIVTNEQMETKVEGIFAAGD 278
>gi|75759653|ref|ZP_00739737.1| Thioredoxin reductase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74492849|gb|EAO55981.1| Thioredoxin reductase [Bacillus thuringiensis serovar israelensis ATCC 35646] (321 aa)
Score = 192, Expect = 6.3e-13, Identities = 75/285 (26%), Positives = 140/285 (49%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQ--ISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +IYDV I+G G  G+ A+  ++  NL+++++E +   GGQ   +   + + ++P +  I   D+  K+ +  K+        D        + I+ +E       K  + A+ II+ASG      +K+ +  E  +    + Y    +   +K K+++V+GGGDSAVE   +    +  + V I+HRR+  R+   + D   +N  +  + N+ I + NE++    ++T+    + +E+ +  D V V  G   +S P  +EL   I  E G    +   +T I  I+A GD
  S:     8 KIYDVVIIGAGPAGMTAAVYTSRANLSTLMLE-RGIPGGQ---MANTEDVENYPGYESILGPDLSNKMFEHAKKFGAEYAYGDVK------EVIDGKEYKTIIAGKKEYKARAIIVASGA---EYKKIGVPGETELGGRGVSYCAVCDGAFFKEKELIVIGGGDSAVEEGVFLT--RFASKVTIVHRRDTLRAQKILQDRAFQNEKVDFIWNHTIKEINEASGKVGSVTLVDVNSGEEKEVKTDGVFVYIGMLPLSKPF-VEL--GITNENGYLETNERMETKIPGIFAAGD 281
>gi|153196468|ref|ZP_01940838.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes 10403S] >gi|127633929|gb|EBA23321.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes 10403S] (304 aa)
Score = 192, Expect = 6.9e-13, Identities = 63/264 (23%), Positives = 135/264 (51%)
  Q:    31 LNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF-IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTL---TIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKY--VIDLNQKTNIKNIYAIGDATHF 294
           + + +I+ +  +GG+    +P K I D      I   +++  L QQ  E  +  I     ++++T   + +    L   N +  ++K I++A+G+G+F   KLE  +   D PF IHY +    E +++K ++V GGG+SA++WA     E I   V +I+R  ++++    +  L  + +   +++EI +   +N  L   T+   +T+  +T+  + + + +G     +++  + +   ++  +  V+D   KT +  I+A GD+  +
  S:     1 MKTKIIDAEPAVGGKVRYFFPEKIIRDIGGIPAITGENLVANLKQQ-AETFHPTIVCSERVVDVT--KLADGTFQLTSHNGSIHFSKTIVIATGSGTFEVNKLEALHAE-DFPFAIHYDVK-NIEQFRDKVVVVSGGGNSAIDWAQTL--EPIAKQVHLIYRGEDFKAHEESVRELKNSRVEIHIHHEISELIGTNNQLTEITVCCNQTQTTKTIETEALFINHG---VKVDLGTMAEWGFKQADFGIVVDDEMKTTVPGIFACGDSATY 260
>gi|89097715|ref|ZP_01170603.1| thioredoxin reductase [Bacillus sp. NRRL B-14911] >gi|89087574|gb|EAR66687.1| thioredoxin reductase [Bacillus sp. NRRL B-14911] (319 aa)
Score = 191, Expect = 7.5e-13, Identities = 78/281 (27%), Positives = 136/281 (48%)
  Q:    10 VAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPM-ELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPID-SPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN-ILQKLNYEIID-FNESNKT--LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI--DLNQKTNIKNIYAIGD 290
           V I+G G  G+ A+      N+N ++IE     G QP  +L     + +FP F    +  ++   +  N  ++            +T    +++   +         A+ +IL++G  +   + L I  E  +    +      +   ++ KK+L++GGGDSA+E AN+    K  +NV I+HRR+E R+S  M D   +N  I  KLN   ++  +ES+K   L + + ET +E+ L  D + V  G    P    L +QI+ ++  Y+       +TNIK ++A GD
  S:     4 VVILGTGPAGLTAAIYLARANMNPVIIE-----GDQPGGQLTLTTEVENFPGF----TDGIMGPELMDNMRKQAERFGAVFKRGWVTEADFSKKPFRMKADGIGEIEAESVILSTGASA---KLLNIPGEKDNIGKGVSTCATCDGFFFRGKKVLIIGGGDSAMEEANFLT--KFADNVTIVHRRDELRASKIMQDRARENQKISWKLNRTPVEVLSESDKVTGLKVLNNETGEEEVLETDGIFVAIGH--RPNTGFLGSQIDLDESGYITVKPGTTETNIKGVFACGD 276
>gi|126649381|ref|ZP_01721622.1| thioredoxin reductase [Bacillus sp. B14905] >gi|126593706|gb|EAZ87629.1| thioredoxin reductase [Bacillus sp. B14905] (314 aa)
Score = 191, Expect = 7.8e-13, Identities = 73/290 (25%), Positives = 137/290 (47%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M+E+ +IYDV I+G G  G+ A+  ++  NL +++IE +   GGQ   +   + + ++P F  I   ++  K+    K+        D        + I+ +E    ++    +  + II+ +G      +K+ +  E  +    + Y    +   +K K ++V+GGGDSAVE   Y    +  + V I+HRR++ R+   + D    N+ +  + N  + + NE+N    ++T++      E     D V V  G +      E L  +N + G  + + N +T I  I+A GD
  S:     1 MSEE-KIYDVVIIGAGPAGMTAAVYTSRANLATLMIE-RGIPGGQ---MANTEEVENYPGFDTILGPELSTKMFDHAKKFGAEYAYGDVT------EIIDGEEFKTIKSGTKEYKTRAIIITTGA---EYKKMGVPGEKELGGRGVSYCAVCDGAFFKQKNLVVVGGGDSAVEEGVYLT--RFADKVTIVHRRDKLRAQKILQDRAFANDKIDFIWNATVKEINEANGKVGSVTLQSTVDGTESEFTTDGVFVYIGMLPLTKPFESLGILN-DAGYILTNDNMETTIPGIFAAGD 278
>gi|154687601|ref|YP_001422762.1| hypothetical protein RBAM_032010 [Bacillus amyloliquefaciens FZB42] >gi|154353452|gb|ABS75531.1| TrxB [Bacillus amyloliquefaciens FZB42] (317 aa)
Score = 191, Expect = 8.3e-13, Identities = 72/290 (24%), Positives = 136/290 (46%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFM-IDCLSKNNILQKLNYEIIDFNESNKT---LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M  + +IYDV I+G G  G+ A+  ++  NL++++IE +   GGQ   +   + + ++P F  I   ++  K+ +  K+        D        + ++ +E    +     + A+ I++++G      +K+ +  E  +    + Y    +   +KNK+++V+GGGDSAVE   Y    +  + V I+HRR++ R+ S +         I  K N  + + +E N     LT+    T +E+    D V +  G +      E L  I  E+G    +   +T +  I+A GD
  S:     1 MVSEEKIYDVIIIGAGPAGMTAAVYTSRANLSTLMIE-RGIPGGQ---MANTEDVENYPGFESILGPELSNKMFEHAKKFGAEYAYGDIK------EIVDGKEYKTVKAGSKEYKARAIVISAGA---EYKKIGVPGEKELGGRGVSYCAVCDGAFFKNKELVVVGGGDSAVEEGVYLT--RFASKVTIVHRRDKLRAQSILQARAFDNEKIDFKWNKTVKEIHEENGKVGRLTLVDTVTGEEEEFKADGVFIYIGMLPLSKPFENLG-ITNEEGYIETNAQMETKVPGIFAAGD 279
>gi|145219818|ref|YP_001130527.1| thioredoxin reductase [Prosthecochloris vibrioformis DSM 265] >gi|145205982|gb|ABP37025.1| thioredoxin reductase [Prosthecochloris vibrioformis DSM 265] (311 aa)
Score = 191, Expect = 8.7e-13, Identities = 81/311 (26%), Positives = 146/311 (46%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPM-ELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKN----NILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI--DLNQKTNIKNIYAIGDATHF-YCKPNTII-TACAEAVRA 311
           M  ++R  D+ I+G G  G  A+  +   NLN ++I+     G QP  +L     I +FP F E  +   +   ++    + N+     +    +T   ++ +   L   + +   A+ +I+A+G    N + L I +E       +      +   +++  + V+GGGD+A+E A Y    K  + V ++HRR E+RSS  M    SKN     +L +   EI+   +    + +KH ET + + LP D V +  G   +P       QI  +   Y++    + +T++  ++A GD   + Y +  T + T C  AV A
  S:     1 MEREVR--DIVIIGTGPAGYTAAIYTGRANLNPLVID-----GYQPGGQLMITSEIENFPGFPEGIAGPELMGRMRDQAAKFNAEFVFGS----VTEADLSRRPFCLTLEDGSEVLARSVIIATGA---NAKWLGIESEDRYRGRGVSACATCDGFFFRDSTVFVIGGGDTAMEEALYLT--KFASRVVLVHRREEFRSSKIMSLRASKNPKITTMLSRTVDEILGDGQKVTGIRLKHVETGELEELPCDGVFMAIGH--APNAQMFAGQIETDDYGYIVTKKASTETSVAGVFACGDVQDYTYRQAVTAVGTGCMAAVDA 303
>gi|15920765|ref|NP_376434.1| thioredoxin reductase [Sulfolobus tokodaii str. 7] >gi|15621548|dbj|BAB65543.1| 324aa long hypothetical thioredoxin reductase [Sulfolobus tokodaii str. 7] (324 aa)
Score = 191, Expect = 8.8e-13, Identities = 81/304 (26%), Positives = 150/304 (49%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL-SKNNILQKLNYEI--IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYV-IDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           +DV I+G G     A+  S  F L +++I +    GGQ  E      + D+     I+++D+IK L  ++ E+ N    +DT    + +      E  +    +  F A  II+A G      RKL   N P ++ F    + Y    +  ++KN+ ++V+GGGDSA+E A   +  +    V ++HRR+E+++    ++ +  K N+   LN  +  I  ++  + + +++ +T + + L  + V V+ G    P +    N +  +   Y+ +D   +TNI+ +YA GD T  +     IIT+ A+   A
  S:    17 FDVVIIGMGPAAYSAALYSARFMLKTLMIGETP--GGQLTEAGE---VDDYLGLIGIQAADMIK-LFNKHIEKYNVPAIMDT----VEYFRKENNEFIVKTKRRGEFKADAIIVAVG---VKRRKL---NVPGEAEFTGKGVSYCSVCDAPLFKNRPVVVVGGGDSALEGAE--ILSRYATKVYLVHRRDEFKAQPIYVESVKQKPNVEFILNSVVKEIKGDKIVRKVIVQNLKTNEIRELDVNGVFVEIG-FDPPTDFARQNGLEVDSHGYIKVDEWMRTNIEGVYAAGDCTGMWLGFRQIITSAAQGAVA 309
>gi|163942843|ref|YP_001647727.1| thioredoxin reductase [Bacillus weihenstephanensis KBAB4] >gi|163865040|gb|ABY46099.1| thioredoxin reductase [Bacillus weihenstephanensis KBAB4] (318 aa)
Score = 190, Expect = 9.4e-13, Identities = 75/290 (25%), Positives = 144/290 (49%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQ--ISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M+E+ +IYDV I+G G  G+ A+  ++  NL+++++E +   GGQ   +   + + ++P +  I   D+  K+ +  K+        D   +      I+ +E       K  + A+ II++SG      +K+ +  E  +    + Y    +   +K K+++V+GGGDSAVE   +    +  + V I+HRR+  R+   + D   +N  +  + N+ I + N++N    ++T+    + +EQ +  D V +  G   +S P  +EL   I  E G    +   +T +  I+A GD
  S:     1 MSEE-KIYDVIIIGAGPAGMTAAVYTSRANLSTLMLE-RGIPGGQ---MANTEDVENYPGYESILGPDLSNKMFEHAKKFGAEYAYGDVKAI------IDGKEYKTIIAGKKEYKARAIIVSSGA---EYKKIGVPGETELGGRGVSYCAVCDGAFFKGKELVVIGGGDSAVEEGVFLT--RFASKVTIVHRRDTLRAQKILQDRAFQNEKVDFIWNHTIKEINDANGKVGSVTLVDVNSGEEQEVKTDGVFIYIGMLPLSKPF-VEL--GITNENGYVETNERMETKVPGIFAAGD 278
>gi|191637840|ref|YP_001987006.1| Thioredoxin reductase [Lactobacillus casei] >gi|190712142|emb|CAQ66148.1| Thioredoxin reductase [Lactobacillus casei BL23] (317 aa)
Score = 190, Expect = 1.0e-12, Identities = 72/283 (25%), Positives = 142/283 (50%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKL----IQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESNKTLT-IKH----KETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           YDV ++G G GG+ A+  ++  NL+ +++++  Y GGQ   +     + ++P F  I   D+ +K+     Q   E    N+        ++ Q  N   + L +T+++ + AK I++A+G      +KL +   E      + Y    +   +K++++ V+GGGDSA+E   Y  +  +   V +IHRR++ R+   +      N+ +  + N ++ +    +  +T +K+    KET +E  LP   V +  G +      + L  ++ E G    D + +T +  ++AIGD
  S:     5 YDVIVIGAGPGGMTAALYASRANLSVLMLDRGVY-GGQ---MNNTAEVENYPGFKSILGPDLGQKMYDGATQFGAEYAYGNV--------VSVQ--NRGAVKLVKTDEDEYEAKAIVIATGA---EHKKLGVPGEEAYSGRGVSYCAVCDGAFFKDRELAVIGGGDSAIEEGLYLTQ--MAKKVTVIHRRDQLRAQQIIQKRAFANDKMHFVWNAQVQEIQGDDMKVTGVKYRDRDKETGEEHILPVAGVFIYVGIMPMTEAFQDLGVLD-EHGWIPTDEHMRTKVPGVFAIGD 278
>gi|144900449|emb|CAM77313.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Magnetospirillum gryphiswaldense MSR-1] (339 aa)
Score = 190, Expect = 1.0e-12, Identities = 56/190 (29%), Positives = 93/190 (48%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYS---------LNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSS 198
           DV +VG G  G+FA        L   +++    +GGQ   LYP K IYD P    I ++D+I +L Q      +    L   +  +      E       ++     AK +I+A+G+G+F P     N  P+D   ++                E ++ KK+++ GGGDSAV+WA    E  +  +V ++HRR ++R++
  S:     6 DVVVVGAGPAGLFAVFQCGMVRLKCHVVDALDAVGGQCAALYPEKPIYDVPAQPSILAADLIDQL-QAQAAPFSPTYHLGRQMTGLDKA---ESGWRCSLSDGTEIMAKVVIVAAGSGAFGP-----NRPPLDGLQVYEGQGQGRGVNYFVTRREDFRGKKVVIAGGGDSAVDWAISLSE--LAASVQVVHRRPKFRAA 193
>gi|160938629|ref|ZP_02085981.1| hypothetical protein CLOBOL_03524 [Clostridium bolteae ATCC BAA-613] >gi|158438328|gb|EDP16087.1| hypothetical protein CLOBOL_03524 [Clostridium bolteae ATCC BAA-613] (390 aa)
Score = 190, Expect = 1.1e-12, Identities = 73/291 (25%), Positives = 138/291 (47%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKN-SFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKN---NILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQK--TNIKNIYAIGDATHFYCK 297
           +YD+ IVGGG  G+ A+  +      ++L+EK SY GG+  + Y    I ++P       +D  + L++  +E    +  ++     +T     E + F+ ET +   F A+ +IL  G     PR+L I  E       + Y    + E +K K+I VLG GD A+E ++Y         + ++H       +    +   KN   + +     + I  ++  ++L +K+ +T +E  +  D + +  G +  P    + + ++ +K  Y I +N+K  TN+  +YA GD T  + +
  S:     4 VYDLIIVGGGPAGLSAAIYAGRSERRTLLLEKGSY-GGRINDTYE---IRNYPG----TKADSGQHLMELFREHAAGHPTVELKRTTVT-GVRKEDDTFIVETKRRGDFMARSVILDLGT---RPRELNIKGEKEFTGHGVAYCATCDAEFFKGKEIYVLGAGDQAIEESDYLTGFASKVTIVVLHEEGHLDCNEVAAEHAYKNPKIDFVWSSTVQEIKGSDHVESLVLKNVDTGRETEVKADGLFLFVGMV--PQTGLVKDMVDCDKAGY-IKVNEKMETNVPGLYAAGDCTQTFLR 286
>gi|85858088|ref|YP_460290.1| thioredoxin reductase [Syntrophus aciditrophicus SB] >gi|85721179|gb|ABC76122.1| thioredoxin reductase [Syntrophus aciditrophicus SB] (324 aa)
Score = 190, Expect = 1.1e-12, Identities = 78/310 (25%), Positives = 151/310 (48%)
  Q:     2 NEDLR-IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTIN--EQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDF-----------NESNKTLTIKH-KETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI-DLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           NE L+ +YD+ +VGGG  G+ A   +    L ++L+E +S +     ++     + ++P F E I   D++++   Q         +    IL    + I+    E ++     +++ A  +ILA+G    N R L +  E       + Y    +   Y++++++V+GGGD+AV+ A +    +    V I+HRR+  R++  + +        +   +E IDF            E  + + I++ K  EK + +P D   +  G   +P    +   +N ++  Y++ D   KT++K I+A GD      +   ++TAC +A  A
  S:     4 NESLKLVYDIIVVGGGPAGLTAGLYAARGGLKALLLEGESSVS----QITVTDLVENYPGFPEGINGYDLVERFRTQAG-------RFGLKILTEDIRAIDAGAAEHWIVSGRDSAYEALSVILATGA---NWRHLGVPGEAAFTGKGVSYCATCDGPFYRDREVVVVGGGDTAVQEALFLT--RFARKVTIVHRRDRLRATPILQE--------RAFAHERIDFAWDSVVEEIQGGEFVEGVRIRNLKNPEKSRIIPADGAFIFVGL--TPNTGFVRGLVNCDENGYILADAEMKTSVKGIFACGDCISKLLR--QVVTACGDAATA 303
>gi|124523816|ref|ZP_01697723.1| thioredoxin reductase [Bacillus coagulans 36D1] >gi|124495316|gb|EAY43037.1| thioredoxin reductase [Bacillus coagulans 36D1] (315 aa)
Score = 190, Expect = 1.2e-12, Identities = 73/290 (25%), Positives = 137/290 (47%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M+E+ +IYDV I+G G  G+ A+  ++  +L +++IE+    GGQ   +   + + ++P +  I   ++  K+ +  K+        D   + I      + +  + +    ++ A  +I+A+G      +KL +  E  +    + Y    +   +K K ++V+GGGDSAVE  NY    +  N V I+HRR++ R+   + D   KN  +  + N+ + + +E N     +T+       E+    D V +  G +      E L  I  E G  + +   +T I  I+A GD
  S:     1 MSEE-QIYDVIIIGAGPAGMTAAVYASRSDLKTLMIER-GVPGGQ---MVNTEEVENYPGYESILGPELSNKMFEHAKKFGAEYAYGDIKGIEI------DGDYKIVKAGAKAYKALAVIIATGA---QYKKLGVKGENELGGRGVSYCAVCDGAFFKGKDLVVVGGGDSAVEEGNYLT--RFANKVTIVHRRDQLRAQKILQDRAFKNEKIDFIWNHTVKEIHEENGKVGAVTLVSTVDGSEKPFKTDGVFIYIGMVPLTKPFENLG-ITNEAGYILTNEEMETKIPGIFAAGD 278
>gi|163789809|ref|ZP_02184246.1| thioredoxin-disulfide reductase [Carnobacterium sp. AT7] >gi|159875031|gb|EDP69098.1| thioredoxin-disulfide reductase [Carnobacterium sp. AT7] (317 aa)
Score = 190, Expect = 1.2e-12, Identities = 75/290 (25%), Positives = 137/290 (47%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILN--ITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIID--FNESNKTLTIKHK--ETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M  + +IYDV ++G G  G+ A+  ++  NL+++++E +   GGQ   +     I ++P F  I   ++  K+ + +K+        D   +   + ++TI           K  F  + II+A+G      RKL ++ E   +   + Y    +   ++NK+++V+GGGDSAVE   Y  +      V IIHRR+E R+   + D   KN  +  +    ++  + + NK   +K +   T + Q    D   +  G + +      L  I  E+G    +   +T+   I+AIGD
  S:     1 METEEKIYDVVVIGSGPAGMTAALYASRSNLSTLMLE-RGVPGGQ---MINTAEIENYPGFNSILGPELSDKMFEGSKQFGAEYAYADVQEIQQGVEYKTI--------IAGKKIFKTRSIIIATGA---EHRKLGVSGENEYNGRGVSYCAVCDGAFFRNKELVVVGGGDSAVEEGTYLTQ--FAKKVTIIHRRDELRAQKILQDRAFKNEKVDFIWDSTVENIYGDDNKVTGVKVRNVHTNEVQEYAADGAFIYVGILPNTDKFRDLG-ITDEEGWIQTNETMETSQPGIFAIGD 279
>gi|154149633|ref|YP_001403251.1| glutaredoxin [Candidatus Methanoregula boonei 6A8] >gi|153998185|gb|ABS54608.1| glutaredoxin [Candidatus Methanoregula boonei 6A8] (384 aa)
Score = 189, Expect = 1.3e-12, Identities = 85/304 (27%), Positives = 151/304 (49%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKN-SFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNL----ETEIYKNKKILVLGGGDSAVEWANYFVE-EKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDF--NESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           YDV IVG G GG+ A+       L ++++ +   +GGQ +E +    I ++  +  I   D++KK  +Q    +  +++L+ D +N       E+ LF+  T    S  AK +IL  G     PRKL + NE     ++   L++    +  ++K+KKI V+GGG+SA++ A   VE   I ++V+++ R        +        NI   L+ +I     +   + +TI   E + EQ +  D V ++ G   +    + L ++N +K + V+D++  T+   ++A GD T    K   II A  E  +A
  S:    85 YDVIIVGAGPGGLTAAVYCARKLLKTLVVSES--IGGQALESWA---IENYMGYRMITGEDLMKKFEEQ---VRTLDVRLELDRVN---GVTMEENLFVVTTVSGLSVKAKSLILTPGK---QPRKLGVENE---EKYLGRGLSICSTCDGPLFKDKKIAVVGGGNSALQTA---VEMSSIASSVSLLVRSTIKADPVYAKKLEGLKNITVHLHTQITALAGDPFLQHITIA-TEGQGEQRIDVDGVFIEVGWTPNTEIFDGLVELNGKK-EIVVDVDGHTSRPGVFAAGDVTS--VKSKQIIIAAGEGAKA 372
>gi|168178683|ref|ZP_02613347.1| putative thioredoxin reductase [Clostridium botulinum NCTC 2916] >gi|182670753|gb|EDT82727.1| putative thioredoxin reductase [Clostridium botulinum NCTC 2916] (313 aa)
Score = 189, Expect = 1.3e-12, Identities = 84/290 (28%), Positives = 149/290 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN--KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINK--EKGKYVIDLNQKTNIKNIYAIGD 290
           MN+  +  D+ I+G G  G+ A+  +    LN ILIE    +GGQ    Y    + ++P F +I+ S  +  L+Q+      + I  + D++       NE+   + ET++  +    +I+++G  +   RKL I   P +S F    IHY    +  +Y+ K + V+GGG++A+E A +    K  + V +I R + ++     ++ +  N+ ++ L N++++D   SN      IK+ +T++E+ L  D V   +G I S    EL  +      KG    + N +TNIK +YA GD
  S:     1 MNKKNKNLDLMIIGAGPAGLSAAIYAARAKLNMILIEN-GIIGGQVRSSYT---VENYPGFKKIEGSR-LADLMQEQATDLGATID-EFDMVEKIQLNNNEK---IVETSEYIYKPTVLIISTGATA---RKLPI---PSESKFSGKGIHYCAICDGAMYEGKTVGVIGGGNAALEEALFLT--KFASKVYMIRRYDYFKGEKATLEEVENNSKIEILYNWDLVDVYGSNFVDKALIKNVKTKEEKELKLDGV---FGFIGSEPKTELFKEYISLTPKGYIKTNENMETNIKGVYAAGD 279
>gi|170761349|ref|YP_001786642.1| putative thioredoxin reductase [Clostridium botulinum A3 str. Loch Maree] >gi|169408338|gb|ACA56749.1| putative thioredoxin reductase [Clostridium botulinum A3 str. Loch Maree] (313 aa)
Score = 189, Expect = 1.4e-12, Identities = 84/290 (28%), Positives = 149/290 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN--KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINK--EKGKYVIDLNQKTNIKNIYAIGD 290
           MN+  +  D+ I+G G  G+ A+  +    LN ILIE    +GGQ    Y    + ++P F +I+ S  +  L+Q+      + I  + D++       NE+   + ET++  +    +I+++G  +   RKL I   P +S F    IHY    +  +Y+ K + V+GGG++A+E A +    K  + V +I R + ++     ++ +  N+ ++ L N++++D   SN      IK+ +T++E+ L  D V   +G I S    EL  +      KG    + N +TNIK +YA GD
  S:     1 MNKKNKNLDLMIIGAGPAGLSAAIYAARAKLNMILIEN-GIIGGQVRSSYT---VENYPGFKKIEGSR-LADLMQEQATDLGATID-EFDMVEKIQLNNNEK---IVETSEYIYKPTVLIISTGATA---RKLPI---PSESKFSGKGIHYCAICDGAMYEGKTVGVIGGGNAALEEALFLT--KFASKVYMIRRYDYFKGEKATLEEVENNSKIEILYNWDLVDVYGSNFVDKALIKNVKTKEEKELKLDGV---FGFIGSEPKTELFKEYISLTPKGYIKTNENMETNIKGVYAAGD 279
>gi|78044856|ref|YP_361186.1| thioredoxin-disulfide reductase [Carboxydothermus hydrogenoformans Z-2901] >gi|77996971|gb|ABB15870.1| thioredoxin-disulfide reductase [Carboxydothermus hydrogenoformans Z-2901] (307 aa)
Score = 189, Expect = 1.5e-12, Identities = 81/283 (28%), Positives = 135/283 (47%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL----NYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           YDV I+G G  G+ A+  S    L+++ IEK S  GGQ         I ++P F   I   ++  ++ +Q K  +    +L  ++  I     +     + +T K +F AK +I+ASG     P+ L    E    S  + Y    +   Y+   ++V+GGGDSAVE A Y    K  + V ++HRR+  R++  + +    N  L+ L      EII  +   K + +K+  T +      D + +  G   +   ++ L  ++ E+G  + D N +TNI  IYA GD
  S:     4 YDVIIIGAGPAGLSAALYSARSKLSTLYIEKLS-TGGQAAT---TDEIENYPGFAHGISGPELTAQMEEQAK--RFGAKKLLAEVKGIELAGADR----IVKTTKGNFVAKVVIIASGAA---PKLLGCPGEQEFRSRGVSYCATCDAAFYEGANVMVVGGGDSAVEEACYLT--KFADKVTLVHRRDTLRATKVLQERAFANEKLEILWNTVVEEIIGTDVVEK-VRLKNVVTGEVFEREIDGIFIYVGLKPNTEFVKGLVNLD-EQGYIITDENMRTNIPGIYAAGD 275
>gi|22536478|ref|NP_687329.1| thioredoxin reductase [Streptococcus agalactiae 2603V/R] >gi|25010358|ref|NP_734753.1| hypothetical protein gbs0284 [Streptococcus agalactiae NEM316] >gi|76788424|ref|YP_329018.1| thioredoxin-disulfide reductase [Streptococcus agalactiae A909] >gi|76798689|ref|ZP_00780912.1| thioredoxin-disulfide reductase [Streptococcus agalactiae 18RS21] >gi|77405001|ref|ZP_00782102.1| thioredoxin reductase [Streptococcus agalactiae H36B] >gi|77408206|ref|ZP_00784951.1| thioredoxin reductase [Streptococcus agalactiae COH1] >gi|77410647|ref|ZP_00787007.1| thioredoxin reductase [Streptococcus agalactiae CJB111] >gi|22533309|gb|AAM99201.1|AE014205_2 thioredoxin reductase [Streptococcus agalactiae 2603V/R] >gi|23094710|emb|CAD45929.1| unknown [Streptococcus agalactiae NEM316] >gi|76563481|gb|ABA46065.1| thioredoxin-disulfide reductase [Streptococcus agalactiae A909] >gi|76585970|gb|EAO62505.1| thioredoxin-disulfide reductase [Streptococcus agalactiae 18RS21] >gi|77163362|gb|EAO74313.1| thioredoxin reductase [Streptococcus agalactiae CJB111] >gi|77173221|gb|EAO76345.1| thioredoxin reductase [Streptococcus agalactiae COH1] >gi|77176440|gb|EAO79208.1| thioredoxin reductase [Streptococcus agalactiae H36B] (304 aa)
Score = 188, Expect = 1.6e-12, Identities = 77/284 (27%), Positives = 139/284 (48%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKT----LTIKHKETEKEQTLPFDYVLVQYG-QISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +YD  I+G G GG+ A+  +   NL   LIE+ +  GGQ   +     I ++P +  I   ++  K+ +  ++ +  +I        I  +  N+ ++    T   S+ AK +ILA+G  + N        E   S  + Y    +   ++++ +LV+GGGDSAVE A +  +     +V IIHRR++ R+   + D    N  ++ +   ++   + N+     +T+++ +T +   + F  V +  G +  S +  EL   I  E G  + D N KT+I  +YAIGD
  S:     1 MYDTLIIGSGPGGMTAALYAARSNLKVGLIEQGA-PGGQ---MNNTAEIENYPGYDHISGPELSMKMYEPLEKFEVEHI------YGIVQRVENDGDVKRVITEDESYEAKTVILATG--AKNSLLGVPGEEEYTSRGVSYCAVCDGAFFRDQDLLVVGGGDSAVEEAVFLTQ--FAKSVTIIHRRDQLRAQKVLQDRAFANEKIKFVWDSVVKEIKGNEIKVSGVTVENLKTGEISEMTFGGVFIYVGLKPHSSMVSEL--GITDETGWVLTDTNMKTSIPGLYAIGD 273
>gi|171326664|ref|ZP_02915118.1| thioredoxin reductase [Geobacillus sp. WCH70] >gi|171087348|gb|EDT33750.1| thioredoxin reductase [Geobacillus sp. WCH70] (315 aa)
Score = 188, Expect = 1.6e-12, Identities = 72/290 (24%), Positives = 135/290 (46%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M+E+ +IYDV I G G  G+ A+  ++  NL++++IE +   GGQ   +   + + ++P +  I   ++  K+ +  K+        +        + I+ +           + A+ +I+A+G      +KL +  E       + Y    +   +K K ++V+GGGDSAVE   Y    +  N V I+HRR++ R+   + D    N  +  + N+ +   N  +    ++T+ H +T +E+  P D V +  G +      E L  I  E G    +   +T +  I+A GD
  S:     1 MSEE-KIYDVIIAGAGPAGMTAAVYTSRANLSTLMIE-RGVPGGQ---MVNTEDVENYPGYENILGPELATKMFEHAKKFGAEYAYGEVK------EIIDGEAYKTVVVGDKQYKARAVIIATGA---EYKKLGVPGEAEFSGRGVSYCAVCDGAFFKGKNLVVVGGGDSAVEEGIYLT--RFANKVTIVHRRDQLRAQKILQDRAFANEKIDFIWNHTVKQINGKDGKVNSVTLVHTQTGEEREFPCDGVFIYIGMLPLSKPFESLG-ITNENGYIETNELMETKVPGIFAAGD 278
>gi|149194157|ref|ZP_01871255.1| thioredoxin-disulfide reductase [Caminibacter mediatlanticus TB-2] >gi|149136110|gb|EDM24588.1| thioredoxin-disulfide reductase [Caminibacter mediatlanticus TB-2] (303 aa)
Score = 188, Expect = 1.7e-12, Identities = 80/284 (28%), Positives = 141/284 (49%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSS--------DVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT-IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +YDV I+GGG  G+ A   ++     ++L+EK +  GGQ   +  +  I ++P   ++KS         +  KK   + K ++   +++             E   F   T+ N + AK +I+A+G+    P+K     E       + Y    +   YK+K + V+GGGD+A+E A Y    +I   V +IHRRN++R++      + +N  ++ +   I+     NK L  I   + +KE  L  D V V  G   +   I+ L ++N E G+  ++L  +T++K +YA GD
  S:     1 MYDVIIIGGGPAGLSAGIYTSRLGGKTLLLEKLT-PGGQ---ITLSSEIENYPGICDVKSGVELMACWPNQAKKFGCEIKSEEAKELRI-------------ENGKFRIITSNNKYKAKAVIVATGS---TPKKAGFEGEDKFIGRGVSYCAVCDGFFYKDKVVAVIGGGDTALEEALYL--SQIAKKVYLIHRRNKFRAAPITQKKVFENEKIEIIYNAIVKKAYGNKFLEGIILLQKDKEIDLKVDGVFVFVGMKVNNELIKDLVELN-EYGEVKVNLKMETSLKGLYAAGD 271
>gi|38234906|ref|NP_940673.1| thioredoxin reductase [Corynebacterium diphtheriae NCTC 13129] >gi|38201171|emb|CAE50895.1| thioredoxin reductase [Corynebacterium diphtheriae] (314 aa)
Score = 188, Expect = 1.8e-12, Identities = 72/284 (25%), Positives = 142/284 (50%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKE-------QKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT-IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI--DLNQKTNIKNIYAIGD 290
           I+DVAI+G G  G  A+  +    L  I+ E   Y G     L     + +FP F E I   ++++ + +Q ++       +  + ++L+ DI  I W  +++QE          F A+ +ILA+G+    PR L +  E  +    +      +   +++  I V+GGGDSA+E A++    K  + V+I+HRR+E+R+S+ M++    N  ++ +  + +     + T++ ++  +T   +T   D   +       P +    + +  +   YV+    + KTN+  ++A+GD
  S:     9 IHDVAIIGSGPAGYTAALYAARAELKPIVFEGIEYGG----SLMTTTEVENFPGFPEGIMGPELMQNMREQAEKFGAELRMELVTKVELEGDIKKI-W--VDDQE----------FQARTVILATGSA---PRYLGVEGEQTLLGRGVSACATCDGFFFRDHHIAVIGGGDSAMEEADFLT--KFGSKVSIVHRRDEFRASAIMLERAKNNPKIEFVTNKTVSKVLGDTTVSGLELTDTVTGETSVLDATAMFVAIGHDPRSAMFRDVVTTDAAGYVVVEHPSTKTNVPGVFAVGD 282
>gi|116749144|ref|YP_845831.1| thioredoxin reductase [Syntrophobacter fumaroxidans MPOB] >gi|116698208|gb|ABK17396.1| thioredoxin reductase [Syntrophobacter fumaroxidans MPOB] (311 aa)
Score = 188, Expect = 1.9e-12, Identities = 76/284 (26%), Positives = 141/284 (49%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQ-----KNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESN-KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYV-IDLNQKTNIKNIYAIGD 290
           IYD+AI+GGG  G+ A   +    L  IL+E+  + GGQ   L   + + ++P F E   +  + +LI     +     +N+ +   TD+L        ++ + +         AK +++ASG    +P KL +  E       + Y    +   Y+N+++ V+GGGD+A+E A Y    K  + V +IHRR++ R++  + +   +N+    IL  +  EI    E     LTI+  +  K   LP + V +  G    P +  +  +++++   ++  D   KT++  ++A GD
  S:     6 IYDIAIIGGGPAGLTAGLYAARARLKVILLERMGF-GGQ---LLTYEKVDNYPGFPEGIGAFGLSELISAQALKFGLVTRNAEV---TDLL-------VDEPIKVVRLADAELLAKTVVIASGA---SPNKLGVRGESEYTGRGVSYCAVCDAPFYRNQEVAVVGGGDTAIEEAIYLT--KFASRVHVIHRRDQLRATRIIQERALQNDRISFILSSVVTEIKGSGEQGVDRLTIREAKGTKIDELPVNGVFIFVG--IQPNSGFVPTEVDRDVFGFIRTDQEMKTSVPGVFAAGD 280
>gi|18977794|ref|NP_579151.1| thioredoxin reductase [Pyrococcus furiosus DSM 3638] >gi|18893541|gb|AAL81546.1| thioredoxin reductase; (trxB) [Pyrococcus furiosus DSM 3638] (356 aa)
Score = 188, Expect = 2.0e-12, Identities = 74/290 (25%), Positives = 141/290 (48%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFE---------TNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTL--PFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFY 295
           +++DV I+G G  G  A+  +  F L++++I K   LGG  M L     I ++P F E I  +++ K++ +Q +       +   D++      I+  E   +E          N   + ++ +I+A G     PRKL   N P +  F    + Y    +  ++  K+++V+GGG++A++ A Y     I   V ++HRR+++R+   + D   +  I   LN  + +    +K  ++  K  +  +T     D V +  G       ++ L  I  E G   +D+  +T +  I+A GD T+ +
  S:    42 KVWDVIIIGAGPAGYTAAIYAARFGLDTLIITKD--LGGN-MAL--TDLIENYPGFPEGISGAELSKRMYEQVR-------KYGVDVIFDEVVRIDPAECAYYEGPCKFTIKTANGMEYKSRTVIIAVGA---EPRKL---NVPGEKEFTGRGVSYCATCDGPLFVGKEVIVVGGGNTALQEALYL--HSIGVKVTLVHRRDKFRADKILQDRFREAGIPAILNTVVTEIRGKDKVESVVLKNVKTGETFEKKVDGVFIFIGYEPKTDFVKHLG-ITDEYGYIKVDMYMRTKVPGIFAAGDITNVF 326
>gi|81428133|ref|YP_395132.1| thioredoxin reductase [Lactobacillus sakei subsp. sakei 23K] >gi|78609774|emb|CAI54820.1| Thioredoxin reductase [Lactobacillus sakei subsp. sakei 23K] (306 aa)
Score = 187, Expect = 2.2e-12, Identities = 73/283 (25%), Positives = 140/283 (49%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQ-ELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESNK---TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           YDV ++G G GG+ A+  ++  NL+ +++++  Y GGQ   +     + ++P F  I   ++ +K+         S  Q   +    T  +I ++ E  L  T++  F A+ +I+A+G+     +K+ I  E       + Y    +   +KNK+++V+GGGDSA+E   Y  +  + + V +IHRR++ R+   + D    N+ +  + N ++      +K    +T   KE+ + + +P   V +  G    P+     +  I  E G    D +  T++  I+AIGD
  S:     5 YDVIVIGAGPGGMTAALYASRSNLSVLMLDRGIY-GGQ---MNNTAEVENYPGFKSILGPELGEKMYA-------SATQFGAEYGYGTVNSIEDKGEFKLVHTDEGDFQARAVIIATGS---EHKKVGIPGEDEYGGRGVSYCAVCDGAFFKNKEVVVIGGGDSAIEEGLYLTQ--LASKVTVIHRRDQLRAQKILQDRAFVNDKMAFVWNAQVKTIEGDDKKVAAVTYVDKESGETKGVPASGVFIYVG--IDPMTSAFKDLGILTEAGWVKTDDHMATSVPGIFAIGD 276
>gi|28210559|ref|NP_781503.1| thioredoxin reductase [Clostridium tetani E88] >gi|28202996|gb|AAO35440.1| thioredoxin reductase [Clostridium tetani E88] (315 aa)
Score = 187, Expect = 2.3e-12, Identities = 85/321 (26%), Positives = 167/321 (52%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELL-NQIN-KEKGKYVIDLNQKTNIKNIYAIGD--ATHFYCKPNTIITACAE----AVRALWHISKNKKD 321
           MN++ +I D+ I+G G  G+ A+  ++   L+ I++E +  +GGQ    Y    I ++P F  I   +++ K+     +      + D     I +  + E+E  L ET +  +  K +I+A+G   + P  +    +      IH+    + E Y+NK I+V+GGG+SA+E A +    +   N+ ++H+ + ++    + D +  N+ ++ L N +I +    NK   + ++  +T+++  +  D + V  G +    N +L  + IN  E+G  + D + KTNI+ ++A GD  A  F      ++TA A+    A+ A  +ISK +++
  S:     1 MNKEEKILDLVIIGSGPAGLTAAIYASRMKLDFIVLENE-LVGGQIRSTYS---IENYPGFRSISGEELVNKIYDHAVDLGAKIDEFD----EIQYIKLTEEEK-LIETYEYIYKPKAVIIAAG-AKYRPLPIP-EEKKYHGNGIHHCELCDGEFYQNKSIMVVGGGNSALEGAIFL--SRYAKNITMVHQLDYFQGEKSLQDEVFNNSKIKILWNTDIKNAFGENKLEEVLVEDLKTKEQYKINVDGIFVYIGMVP---NTDLYKDYINLNERGYIIADESTKTNIEGVFAAGDVRAKQF----RQLVTANADGAVAALSAEKYISKKRRE 312
>gi|134097530|ref|YP_001103191.1| thioredoxin reductase [Saccharopolyspora erythraea NRRL 2338] >gi|133910153|emb|CAM00266.1| thioredoxin reductase [Saccharopolyspora erythraea NRRL 2338] (327 aa)
Score = 187, Expect = 2.5e-12, Identities = 73/308 (23%), Positives = 144/308 (46%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQE--LFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDF--NESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHIS 316
           D+ +VG G  G+FA+  + +  ++  +++     GGQ   +YP K IYD   F E++  D++  L++Q  +           +L    + ++E E  L +    + S  A  +++ +G G F PR L   ++ +    +H+   L    +  + ++V+GGGDSA +WA       +  +V ++HRR  +R+ + ++D +    +    + E+ +   +++           ++ Q LP   V+   G  +    IE    +  EK    +D   +T+ + +YA GD   +  K   I T   EA  A+ +I+
  S:     9 DLLVVGAGPTGLFAAYYAGFRGMSVAVVDALPEPGGQVTAMYPEKMIYDVAGFPEVRGRDLVDALVRQAAQYD------PVYLLGRHAEKLSEVEGGLLVDVGERESVRAGAVLVTAGIGEFTPRPLPAADDWLGRGVVHFIPELGA--HSGQDVVVVGGGDSAFDWA--LALHPVARSVTLVHRRARFRAHAGLVDKVRGLGVPLITDAEVAEIRGDDAGPHEVELALAGDRRQVLPAQAVVAALGFTADLGPIESWG-LELEKRTIRVDSTMRTSRERVYAAGDVAAYPGKVKLIATGFGEAATAVNNIA 309
>gi|168183112|ref|ZP_02617776.1| putative thioredoxin reductase [Clostridium botulinum Bf] >gi|182673868|gb|EDT85829.1| putative thioredoxin reductase [Clostridium botulinum Bf] (313 aa)
Score = 186, Expect = 3.0e-12, Identities = 85/290 (29%), Positives = 148/290 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN--KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ--KTNIKNIYAIGD 290
           MN+  +  D+ I+G G  G+ A+  +    LN ILIE    +GGQ    Y    I ++P F +I+ S  +  L+Q+      + I  + D++       NE+   + ET++  +    +I+++G  +   RKL I   P +S F    IHY    +  +Y+ K + V+GGG++A+E A +    K  + V +I R + ++     ++ +  N  ++ L N++++D   SN      IK+ +T++E+ L  D V   +G I S    EL  +      K  I  N+  +TNIK +YA GD
  S:     1 MNKKNKNLDLMIIGAGPAGLSAAIYAARAKLNMILIEN-GIIGGQVRSSYT---IENYPGFKKIEGSR-LADLMQEQATDLGATID-EFDMVEKIQLNNNEK---IVETSEYIYKPTVLIISTGATA---RKLPI---PSESKFSGKGIHYCAICDGAMYEGKTVGVIGGGNAALEEALFLT--KFASKVYMIRRYDYFKGEKATLEEVENNPKIEILYNWDLVDVYGSNFVDKALIKNVKTKEEKELKLDGV---FGFIGSEPKTELFKEYISLTPKGYIKTNESMETNIKGVYAAGD 279
>gi|116629953|ref|YP_815125.1| thioredoxin reductase [Lactobacillus gasseri ATCC 33323] >gi|116095535|gb|ABJ60687.1| Thioredoxin reductase [Lactobacillus gasseri ATCC 33323] (311 aa)
Score = 186, Expect = 3.0e-12, Identities = 69/283 (24%), Positives = 138/283 (48%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKH--KETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           YDV ++G G GG+ A+  +   NL  +++++  Y GGQ   +     I ++P F +I+  ++ +K+ Q      N+  +     +    Q  N++   + +T+   + A  +++A+  G+ +        E      + Y    +   ++++ + V+GGGDSA++   Y  +     +V +IHRR++ R+ + +     +N+    I      EI+   +SNK   +K+  KET +E+ +    V +  G        + L  I  E+G  + D N +T +K I+A+GD
  S:     7 YDVIVIGAGPGGLTAALYAARANLKVVILDRGIY-GGQ---MNNTAGIDNYPGFVDIQGPELGEKMYQT---AMNAGAEFAYGDVQKIEQDGNQK---IIKTDSGEYEAAAVVIAT--GAVHKHLGVAGEEEYAGKGVSYCAVCDAAFFRDEDVAVIGGGDSAIQEGLYLAQS--AKSVTVIHRRDQLRAKAELQKKAFENDKMKFIWNAQTEEIV--GDSNKVTAVKYKDKETGEEKEVKVAGVFIYVGIQPQTAAFKDLG-ITDEQGWILTDNNMRTKVKGIFALGD 278
>gi|183222355|ref|YP_001840351.1| Alkyl hydroperoxide reductase subunit F [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189912402|ref|YP_001963957.1| Alkyl hydroperoxide reductase, large subunit [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167777078|gb|ABZ95379.1| Alkyl hydroperoxide reductase, large subunit [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167780777|gb|ABZ99075.1| Alkyl hydroperoxide reductase subunit F [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (519 aa)
Score = 186, Expect = 3.1e-12, Identities = 79/305 (25%), Positives = 145/305 (47%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNK-NSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL----NYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           IYDV ++GGG  G+ A+  +    L +++I  +  LGGQ  +    + I   P     +   V+   +++N+ +K  N+++         Q I + +  +   N      +K +IL++G       K    N P +  F    + Y  + +   +K+K + V+GGG+S VE A       I  +V ++   ++  +   ++D ++ +  ++ L      EI    +    LT K + TE+  T+P D V VQ G + +   ++ L   N+  G+ ++D   KTN+  I+A GD T+   K   II A  E  +A
  S:   216 IYDVTVIGGGPSGVTAAVYAARKGLRTLVIADR--LGGQVKDTLGIENIISIPYTTGPELIHVLADQLEKNQIKKKENVRV---------QKIEQGQTKIIHLNTGEKILSKTVILSTG------AKWRELNVPGEKEFVGKGVAYCPHCDGPFFKDKDVAVIGGGNSGVEAA--LDLSGIVKSVTLVEFGDKLNADKVLLDKVASSPNIKTLVKAQTTEIQTGVDKVTGLTYKDRNTEQVSTIPLDGVFVQIGLVPNSSFVKDLVATNR-FGEILVDEKCKTNVDGIFACGDVTNTPYK--QIIIAMGEGAKA 507
>gi|21673671|ref|NP_661736.1| thioredoxin reductase [Chlorobium tepidum TLS] >gi|21646791|gb|AAM72078.1| thioredoxin reductase [Chlorobium tepidum TLS] (311 aa)
Score = 186, Expect = 3.1e-12, Identities = 81/311 (26%), Positives = 148/311 (47%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPM-ELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIID--FNESNKTLTIKHKETEKEQTLPF--DYVLVQYGQISSPINIELLNQINKEKGKYVI--DLNQKTNIKNIYAIGDATHF-YCKPNTII-TACAEAVRA 311
           M++D+R  DV I+G G  G  ++  +   NL  ++IE     G QP  +L     I +FP F E I   +++ ++ +Q      +   ++    +IT   ++     L   N     A+ +I+A+G    N + L I +E       +      +   ++N ++ V+GGGD+A+E A Y    K  + V ++HRR E+R+S  M    SKN  +  +  +++D    +  K   I+ K  +  +      D V +  G    P       Q++ +   Y++  D + +T++K ++A GD   F Y +  T + T C  A+ A
  S:     1 MDKDIR--DVVIIGTGPAGYTSAIYTGRANLKPLVIE-----GPQPGGQLMITTDIENFPGFPEGIPGPELMGRMREQA-----ARFGVEFQFGSITEVDVSRSPFSLMLDNGQEILARTLIIATGA---NAKWLGIESEEKYRGRGVSACATCDGFFFRNCRVFVVGGGDTAMEEALYLT--KFASEVVLVHRREEFRASKIMSLRASKNEKITTMLNQVVDEILGDDMKVTGIRLKNVKTGELTEHACDGVFIAIGH--EPNAKLFKGQLDMDDYGYILTKDHSTETSVKGVFACGDVQDFTYRQAVTAVGTGCMAAIEA 303
>gi|170757512|ref|YP_001780879.1| putative thioredoxin reductase [Clostridium botulinum B1 str. Okra] >gi|169122724|gb|ACA46560.1| putative thioredoxin reductase [Clostridium botulinum B1 str. Okra] (313 aa)
Score = 186, Expect = 3.2e-12, Identities = 82/290 (28%), Positives = 147/290 (50%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN--KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINK--EKGKYVIDLNQKTNIKNIYAIGD 290
           MN+  +  D+ I+G G  G+ A+  +    LN ILIE    +GGQ    Y    I ++P F +I+ +  +  L+Q+      + I  + D++       NE+   + ET++  +    +I+++G  +   RKL I +E       IHY    +  +Y+ K + V+GGG++A+E A +    K  + V +I R + ++     ++ +  N+ ++ L N++++D   SN      IK+ +T++E+ L  D V   +G I S    EL  +      KG    + N +TNIK +YA GD
  S:     1 MNKKNKNLDLMIIGAGPAGLSAAIYAARAKLNMILIEN-GIIGGQVRSSYT---IENYPGFKKIEGNR-LADLMQEQATDLGATID-EFDMVEKIQLNNNEK---IVETSEYIYKPTVLIISTGATA---RKLPIPSEGKFSGKGIHYCAICDGAMYEGKTVGVIGGGNAALEEALFLT--KFASKVYMIRRYDYFKGEKATLEEVENNSKIEILYNWDLVDVYGSNFVDKALIKNVKTKEEKELKLDGV---FGFIGSEPKTELFKEYISLTPKGYIRTNENMETNIKGVYAAGD 279
>gi|153811145|ref|ZP_01963813.1| hypothetical protein RUMOBE_01536 [Ruminococcus obeum ATCC 29174] >gi|149832643|gb|EDM87727.1| hypothetical protein RUMOBE_01536 [Ruminococcus obeum ATCC 29174] (307 aa)
Score = 186, Expect = 3.3e-12, Identities = 74/311 (23%), Positives = 148/311 (47%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCL-SKNNILQKLNYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           IYD+AI+G G  GI A+  +    LN+I +++K   GGQ ++ Y    + ++P    I   D+ + +      +K         +L++T    +E E+ +  T KN ++A+ +I+A G      R L I   E +    + Y    +   ++   + V+GGG+ AVE A   +  +    V ++HRR+E R+   + D L + +N+    +   +     +K   L +++ +T++E+ +  D V +  G +      + L +++ E G  +   +  T+   I+A GD      +   ++TA A+   A+  + +
  S:     5 IYDLAILGAGPAGICAAIYATRAKLNTIWLDRKFVQGGQIVDTYE---VDNYPGLPGITGLDLGEAM--AGHAEKLGLKPKREPVLSVT----DEGEIKVIRTKKNEYHARAVIIACGA---THRHLGIPGEEELGGMGVSYCATCDAAFFQEGTVAVVGGGNVAVEDA--ILLSRTCKKVYLVHRRDELRAEKILQDSLFACHNVELVWDSVPVSVEGEDKVTALKVRNVKTDEEKEISVDGVFIAVGIVPGSGKFKDLVKMD-ESGYIIAGEDGVTSTPGIFAAGDIRTKNLR--QVVTAVADGANAVASVQR 302
>gi|163842267|ref|YP_001626672.1| thioredoxin reductase [Renibacterium salmoninarum ATCC 33209] >gi|162955743|gb|ABY25258.1| thioredoxin reductase [Renibacterium salmoninarum ATCC 33209] (334 aa)
Score = 185, Expect = 3.6e-12, Identities = 72/284 (25%), Positives = 134/284 (47%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNILQKLNYEI--IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           + DV I+G G  G  A+  +   NL  ++I      GG   EL     + +FP F E +   D++  L QQ  E+  + I+ D    ++T  +++ +   +      S+ A+ +I+++G+     R+L +++E  +    + +    +   +K+K I+V+GGGDSA+E A +    +    V +IHRR+  R+S  M D   S + I    N E+  ID       + + +  T ++  LP   + V  G        + +  +  E    V   + KT++  ++A GD
  S:    27 VRDVIIIGSGPAGYTAAIYTARANLKPLMIAGSVTAGG---ELMNTTDVENFPGFPEGVMGPDLMDNL-QQQAERFGTQIEYD----DVTEVSLDGEIKTVRTGAGQSYSARSVIVSTGSAY---RELGLDDEKRLSGHGVSWCATCDGFFFKDKDIVVVGGGDSAMEEATFLT--RFARTVTVIHRRDSLRASKIMQDRAFSNDKIKFIWNTEVYGIDGEAKANGVKLNNLVTGEKSELPATGIFVAIGNYPRVDLFKGVLDLTTEGTIAVAGRSSKTSLTGVFAAGD 302
>gi|16080532|ref|NP_391359.1| thioredoxin reductase [Bacillus subtilis subsp. subtilis str. 168] >gi|3123300|sp|P80880|TRXB_BACSU Thioredoxin reductase (TRXR) (General stress protein 35) (GSP35) >gi|1945648|emb|CAB08055.1| hypothetical protein [Bacillus subtilis] >gi|2635992|emb|CAB15484.1| thioredoxin reductase [Bacillus subtilis subsp. subtilis str. 168] (316 aa)
Score = 185, Expect = 4.1e-12, Identities = 73/290 (25%), Positives = 138/290 (47%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFM----IDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M+E+ +IYDV I+G G  G+ A+  ++  NL++++IE +   GGQ   +   + + ++P F  I   ++  K+ +  K+        D        + I+ +E  + +     + A+ +I+A+G      +K+ +  E  +    + Y    +   +K K+++V+GGGDSAVE   Y    +  + V I+HRR++ R+ S +     D    + +  K   EI + N     +T+    T +E     D V +  G +      E L  I  E+G    +   +T ++ I+A GD
  S:     1 MSEE-KIYDVIIIGAGPAGMTAAVYTSRANLSTLMIE-RGIPGGQ---MANTEDVENYPGFESILGPELSNKMFEHAKKFGAEYAYGDIK------EVIDGKEYKVVKAGSKEYKARAVIIAAGA---EYKKIGVPGEKELGGRGVSYCAVCDGAFFKGKELVVVGGGDSAVEEGVYLT--RFASKVTIVHRRDKLRAQSILQARAFDNEKVDFLWNKTVKEIHEENGKVGNVTLVDTVTGEESEFKTDGVFIYIGMLPLSKPFENLG-ITNEEGYIETNDRMETKVEGIFAAGD 278
>gi|114328670|ref|YP_745826.1| ferredoxin--NAD(P)(+) reductase [Granulibacter bethesdensis CGDNIH1] >gi|114316844|gb|ABI62904.1| ferredoxin--NAD(P)(+) reductase [Granulibacter bethesdensis CGDNIH1] (408 aa)
Score = 185, Expect = 4.3e-12, Identities = 83/303 (27%), Positives = 144/303 (47%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPID-------SPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYR----SSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKET--------EKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           DVAI+G G  G+FA+       L ++LI+    +GGQ   LYP K IYD P    I   D+I  L +Q        + L   +  +T     + +  L  +  ++  A+ ++LA+G G+F P     N  P+D       S  + Y +    E ++ + +++ GGGDSAV+WA       I   + ++HRR ++R    S + +    +   +   + Y++     +   L++    T        E +  LPF  + +  G I+          +  E+    ID ++ +TN+  I+AIGD   +  K   I+   +EA  A
  S:    79 DVAIIGAGPAGLFAAFELGMLRLRAVLIDALQEVGGQCAALYPEKPIYDIPAHPAISGGDLITALERQIAPFDMPRL-LSRRVETLTG---TQGDFTLTTSAGDTVCARAVVLAAGAGAFGP-----NRPPLDGLEAFEASGAVQYYVR-RREDFRGRSVVIAGGGDSAVDWA--LALRGIAARIFVVHRRAKFRAAPESLAQLEQAAAAGEVELVVPYQLHGLQGAEGVLSVVEVATLDGEIRRLEADCLLPFFGLSMDLGPIAEW-------GLALERHHITIDPSRCETNVPGIFAIGDVATYPGKLKLILQGFSEAAMA 382
>gi|15806980|ref|NP_295705.1| thioredoxin reductase [Deinococcus radiodurans R1] >gi|193885178|pdb|2Q7V|A Chain A, Crystal Structure Of Deinococcus Radiodurans Thioredoxin Reductase >gi|193885179|pdb|2Q7V|B Chain B, Crystal Structure Of Deinococcus Radiodurans Thioredoxin Reductase >gi|6459771|gb|AAF11534.1|AE002036_5 thioredoxin reductase [Deinococcus radiodurans R1] (325 aa)
Score = 185, Expect = 4.4e-12, Identities = 74/287 (25%), Positives = 138/287 (48%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID---CLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQK--TNIKNIYAIGDATHF 294
           YDV I+GGG  G+ A+  +    L+++++EK    GGQ   +  ++ + +FP F E  +   + + + Q  E+  + +++D ++  +     +    F        + AK +ILA+G    +PRKL I   P +  F    +      +   YK KK++V+GGGD+AVE   +    K  + V +IHRR+  R++           K   +     E I   +S   + +++ +T +   L  D V +  G +  P    + + ++     YV D+  +  TNI  ++A GD + +
  S:     9 YDVVIIGGGPAGLTAAIYTGRAQLSTLILEK-GMPGGQ---IAWSEEVENFPGFPEPIAGMELAQRMHQQAEKFGAKVEMD-EVQGVQHDATSHPYPFTVRGYNGEYRAKAVILATGA---DPRKLGI---PGEDNFWGKGVSTCATCDGFFYKGKKVVVIGGGDAAVEEGMFLT--KFADEVTVIHRRDTLRANKVAQARAFANPKMKFIWDTAVEEIQGADSVSGVKLRNLKTGEVSELATDGVFIFIGHV--PNTAFVKDTVSLRDDGYV-DVRDEIYTNIPMLFAAGDVSDY 288
>gi|148379239|ref|YP_001253780.1| putative thioredoxin reductase [Clostridium botulinum A str. ATCC 3502] >gi|153933809|ref|YP_001383611.1| putative thioredoxin reductase [Clostridium botulinum A str. ATCC 19397] >gi|153936452|ref|YP_001387160.1| putative thioredoxin reductase [Clostridium botulinum A str. Hall] >gi|148288723|emb|CAL82806.1| thioredoxin reductase [Clostridium botulinum A str. ATCC 3502] >gi|152929853|gb|ABS35353.1| putative thioredoxin reductase [Clostridium botulinum A str. ATCC 19397] >gi|152932366|gb|ABS37865.1| putative thioredoxin reductase [Clostridium botulinum A str. Hall] (313 aa)
Score = 184, Expect = 4.6e-12, Identities = 81/290 (27%), Positives = 147/290 (50%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN--KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINK--EKGKYVIDLNQKTNIKNIYAIGD 290
           MN+  +  D+ I+G G  G+ A+  +    LN ILIE    +GGQ    Y    + ++P F +I+ +  +  L+Q+      + I  + D++       NE+   + ET++  +    +I+++G  +   RKL I +E       IHY    +  +Y+ K + V+GGG++A+E A +    K  + V +I R + ++     ++ +  N+ ++ L N++++D   SN      IK+ +T++E+ L  D V   +G I S    EL  +      KG    + N +TNIK +YA GD
  S:     1 MNKKNKNLDLMIIGAGPAGLSAAIYAARAKLNMILIEN-GIIGGQVRSSYT---VENYPGFKKIEGNR-LADLMQEQATDLGATID-EFDMVEKIQLNNNEK---IVETSEYIYKPTVLIISTGATA---RKLPIPSEGKFSGKGIHYCAICDGAMYEGKTVGVIGGGNAALEEALFLT--KFASKVYMIRRYDYFKGEKATLEEVENNSKIEILYNWDLVDVYGSNFIDKALIKNVKTKEEKELKLDGV---FGFIGSEPKTELFKEYISLTPKGYIKTNENMETNIKGVYAAGD 279
>gi|116751291|ref|YP_847978.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Syntrophobacter fumaroxidans MPOB] >gi|116700355|gb|ABK19543.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Syntrophobacter fumaroxidans MPOB] (548 aa)
Score = 184, Expect = 5.0e-12, Identities = 79/312 (25%), Positives = 140/312 (44%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIK--HKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKE---KGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISKNKK 320
           D+ IVGGG  G+ A   +    L + ++E    LGGQ   +     + ++P F  +    ++  L+    E   + I     +L I        +     T +  F  + +ILA+G      +KL +  E  +    + Y    +  ++K KK++V+GGG+SA   A Y     I   V ++HRR+ +R+   +   +  NNI    + E+ +     +   ++  + +T + QT+P D V +  G   SP  +EL  +   E    G    D + +TNI  IY+ GD    Y     I+TA ++   A   + ++ K
  S:   239 DLVIVGGGPAGLTAGIYAVRSGLRTAVVEAGQ-LGGQ---VAATPIVENYPGFTRVPGKTLVDILVSHALEY--TEIFQGEKVLEII-----RGDPLEVRTTRRKFLTRAVILATGA---EYKKLGVPGEARLAGRGVSYCATCDGPLFKGKKVIVVGGGNSAATEALYL--HNIGVGVTMVHRRDTFRAQEHLTRNVLGNNIPVFWDTEVKEIRGKERVSEVELFNGKTGRTQTVPTDGVFIAVGY--SP-TVELALKAGVEITPDGFIKHDSHHRTNIPGIYSAGDVEGGY---KQIVTAMSQGTEAALSVFEDLK 534
>gi|193212529|ref|YP_001998482.1| thioredoxin reductase [Chlorobaculum parvum NCIB 8327] >gi|193086006|gb|ACF11282.1| thioredoxin reductase [Chlorobaculum parvum NCIB 8327] (311 aa)
Score = 184, Expect = 5.1e-12, Identities = 82/311 (26%), Positives = 148/311 (47%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPM-ELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPI-DSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIID--FNESNKTLTIKHKETEKEQTLPF--DYVLVQYGQISSPINIELLNQINKEKGKYVIDL--NQKTNIKNIYAIGDATHF-YCKPNTII-TACAEAVRA 311
           M++D+R  DV I+G G  G  A+  +   NL  ++IE     G QP  +L     I +FP F E I   +++ ++ +Q      +   ++    ++T   ++     L   + +   A+ II+A+G    N + L I +E       +      +   ++N ++ V+GGGD+A+E A Y    K  + V ++HRR E+R+S  M    SKN  +  +  E++D    +  K   I+ K  +  +      D V V  G    P       Q++ +   Y++    + +T++K ++A GD   F Y +  T + T C  A+ A
  S:     1 MDKDIR--DVVIIGTGPAGYTAAIYTGRANLKPLVIE-----GHQPGGQLMITTDIENFPGFPEGIPGPELMGRMREQA-----ARFGVEFKFGSVTEADVSRSPFSLTLDDGSEILARTIIIATGA---NAKWLGIESEETYRGRGVSACATCDGFFFRNCRVFVVGGGDTAMEEALYLT--KFASEVVLVHRREEFRASKIMSLRASKNEKITTMLNEVVDEILGDGMKVTGIRLKNVKTGELTEHACDGVFVAIGH--EPNAKLFQGQLDMDDYGYILTKPHSTETSVKGVFACGDVQDFTYRQAVTAVGTGCMSAIEA 303
>gi|57234663|ref|YP_181286.1| thioredoxin-disulfide reductase [Dehalococcoides ethenogenes 195] >gi|57225111|gb|AAW40168.1| thioredoxin-disulfide reductase [Dehalococcoides ethenogenes 195] (306 aa)
Score = 183, Expect = 6.1e-12, Identities = 71/284 (25%), Positives = 135/284 (47%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNILQKLNYEIIDFN--ESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEK-GKYVIDLNQKTNIKNIYAIGD 290
           +YDV I+GGG  G+ A+  +    L +++IE ++++GGQ   +  ++ + ++P F E I   D+ +++  Q ++     I  +   LN        ++ F   T       + II+  G       KL +   E      + Y    +   Y +K +  +GGG+ A+  A +  E      V +IHRR  +R+ + ++D   SK NI   L+  I   N  +S ++L++ + +T+K   LP + + V  G    P    L   ++ +K G  +++   +T++  I   GD
  S:     5 LYDVIIIGGGPAGLTAALYTGRAKLKTLVIE-RAFIGGQ---ITRSEKVDNYPGFPEGITGFDLTQQMQIQAEKYGAEIISAEVTALN------KAKDSFELSTEAGKLSGRCIIICGGT---ERNKLGVPGEEEFSGRGVSYCATCDAPFYNDKVVAAVGGGNMAIYEALHLSE--FAKKVYLIHRRQGFRADAVLVDKAKSKGNIEMVLDTVITSINGKDSIQSLSLNNLKTQKTSDLPVNGLFVAVGL--QPNTAYLKGVVDMDKNGSILVNDQMETSVSGILCAGD 277
>gi|169174016|ref|ZP_02835960.1| thioredoxin reductase [Arthrobacter chlorophenolicus A6] >gi|169018256|gb|EDS64732.1| thioredoxin reductase [Arthrobacter chlorophenolicus A6] (325 aa)
Score = 183, Expect = 6.6e-12, Identities = 76/284 (26%), Positives = 135/284 (47%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKE-------QKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNILQKLNYEIIDFNESNKT--LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQIN-KEKGKYVID-LNQKTNIKNIYAIGD 290
           I DV IVG G  G  A   +   NL  +++      GG   EL     + ++P F E I   D++  +  Q +        ++ S ++L+  +  +T             T+    YA+ +IL++G+     RKL + NE  +    + Y    +   +K+ ++ V+GGGDSA E A +    K    V +I R ++ R+S  M D  L+   I  +   E++     +K   L ++ K+ E + T+P D + V  G  + P    + +Q++   +G   +D    KTN+  ++A GD
  S:    10 IRDVIIVGSGPAGYTAGIYTGRANLKPLIVAGMMEPGG---ELMKTTEVENYPGFPEGIDGPDLMANMESQAERFGAEILFEEASELELEGPVKKVT------------TTDGEVHYARTVILSTGSAH---RKLGLPNEDALSGHGVSYCATCDGSFFKDLEVAVVGGGDSAAEEALFLT--KFAKAVHLIVRGDQLRASKIMADRVLANPKISVEFETEVVGILGQDKLIGLILRSKDREYDYTVPADGLFVAIG--NDPRTALVASQLDLTAQGTVAVDGRTSKTNLPGVFAAGD 285
>gi|161507937|ref|YP_001577901.1| thioredoxin reductase [Lactobacillus helveticus DPC 4571] >gi|160348926|gb|ABX27600.1| Thioredoxin reductase [Lactobacillus helveticus DPC 4571] (307 aa)
Score = 183, Expect = 6.9e-12, Identities = 70/304 (23%), Positives = 141/304 (46%)
  Q:     5 LRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQ----KLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           ++ YD+ ++G G GG+ A+      NL   +I++  Y GGQ   +     + ++P F  I   D+ +K+ +   +Q    +  D   + +  Q        + + +     AK +I+A+G+ +   RKL I   E      + Y    +   +K++ + V+GGGDSA+    Y     +  +V +IHRR++ R+   +     KN  ++     +  EII        + + +K+T++++ +    V +  G + +    + L +I  ++G  + +   +T +  IYA+GD      K   I+TA  + 
  S:     1 MKEYDLVVIGAGPGGMTAAMYGARANLKVAMIDRGVY-GGQ---MNNTAEVENYPGFPSIMGPDLGEKMYKSATKQGVEFVYGDVQKIELDGQK------RIVKMDPEDITAKAVIIATGSTN---RKLGIPGEEEYSGRGVSYCAVCDGAFFKDENVAVVGGGDSAISEGLYLA--NLAKDVDVIHRRDQLRAERVLQTRAFKNPKMEFTWDSVPVEIIGDENKVTGVKVHNKKTDEDKVIDASGVFIYIGNVPNSEPFKEL-KITDDQGWIITNDQMETTVPGIYAVGDVRQ--KKLRQIVTAVGDG 291
>gi|73748383|ref|YP_307622.1| thioredoxin reductase [Dehalococcoides sp. CBDB1] >gi|73660099|emb|CAI82706.1| thioredoxin reductase [Dehalococcoides sp. CBDB1] (306 aa)
Score = 183, Expect = 7.0e-12, Identities = 74/284 (26%), Positives = 142/284 (50%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKL-IQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNILQKLNYEIIDFN--ESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEK-GKYVIDLNQKTNIKNIYAIGD 290
           +YDV I+GGG  G+ A+  +    L +++IE ++++GGQ   +  ++ + ++P F E I   D+ +++ IQ  K      +++ +  +N   +T +  E+    T       + II+  G       KLE+   E      + Y    +   Y +K + V+GGG+ A   A +  E      V +IHRR  +R+ + ++D   +K+NI   L+  +   N  +S ++L++ + +T K  TLP D + V  G    P    L   ++ +K G  +++   +T++  I + GD
  S:     5 LYDVIIIGGGPAGLTAALYTGRSKLKTLVIE-RAFVGGQ---ITRSEKVDNYPGFPEGITGFDLTQQMQIQAEK----YGVEITSAEVNAIHKTKDHFEVV---TETGGLSGRCIIICGGT---ERNKLEVPGEEEFSGRGVSYCATCDAPFYNDKVVAVVGGGNMAFYEALHLSE--FAKKVYLIHRRQGFRADAVLMDKAKNKSNIELVLDTVVTSINGQDSIQSLSLNNLKTLKTSTLPIDGLFVAVGL--QPNTTYLKGVVDMDKNGSILVNDQMETSVSGILSAGD 277
>gi|147669163|ref|YP_001213981.1| thioredoxin reductase [Dehalococcoides sp. BAV1] >gi|146270111|gb|ABQ17103.1| thioredoxin reductase [Dehalococcoides sp. BAV1] (306 aa)
Score = 182, Expect = 7.8e-12, Identities = 75/284 (26%), Positives = 142/284 (50%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKL-IQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNILQKLNYEIIDFN--ESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGD 290
           +YDV I+GGG  G+ A+  +    L +++IE ++++GGQ   +  ++ + ++P F E I   D+ +++ IQ  K      +++ +  +N   +T +  E+    T       + II+  G       KLE+   E      + Y    +   Y +K + V+GGG+ A   A +  E      V +IHRR  +R+ + ++D   +K+NI   L+  +   N  +S ++L++ + +T K  TLP D + V  G    P    L   ++ +K   ++  NQ +T++  I + GD
  S:     5 LYDVIIIGGGPAGLTAALYTGRSKLKTLVIE-RAFVGGQ---ITRSEKVDNYPGFPEGITGFDLTQQMQIQAEK----YGVEITSAEVNAIHKTKDHFEVV---TETGGLSGRCIIICGGT---ERNKLEVPGEEEFSGRGVSYCATCDAPFYNDKVVAVVGGGNMAFYEALHLSE--FAKKVYLIHRRQGFRADAVLMDKAKNKSNIELVLDTVVTSINGQDSIQSLSLNNLKTLKTSTLPIDGLFVAVGL--QPNTTYLKGVVDMDKNGSILVNNQMETSVSGILSAGD 277
>gi|182420127|ref|ZP_02951361.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium butyricum 5521] >gi|182376164|gb|EDT73751.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium butyricum 5521] (311 aa)
Score = 182, Expect = 8.2e-12, Identities = 89/317 (28%), Positives = 150/317 (47%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKF-IYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNILQKLNYEIIDFNESN--KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQIN-KEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           M ++++  D+ I+GGG  G+ A+  +    LN++L+E K  LGGQ      N F I ++P F  I+    +  L Q+   +  + I    D  ++  +    +E  + ET    +  K +I+A+G     PRKL I  E       IHY    +  +Y+ K I V+GGG++A+E A +    K    V +I R N ++    +ID   +   I   LN ++I+    +   ++ +K+        L  D V    G  + P   E+   +N  E+G  + + + +TNIK +YA GD      K   I TA ++   AL +  K
  S:     1 MVKEIKELDLIIIGGGPAGLTAAIYAGRAKLNTLLLENK-ILGGQ----VRNSFTIENYPGFKNIQGGK-LADLFQEQAAEFGAVI----DEFDLIEKIDLSEEEKVIETETFIYKPKAVIIATGA---IPRKLPIKGEKNFAGKGIHYCAVCDGAMYEGKNIAVVGGGNAALEEALFLT--KFAEKVYLIRRYNYFKGEQSVIDEVFNHPKIEVLLNEDVIEAKGQDFLNSVVLKNTLDGIVSELKVDAVFGYIG--TEPKTEEVKKYLNINEQGYIITNEDMETNIKGVYAAGDVRE--KKYRQITTAVSDGTIALLNAEK 304
>gi|18389302|emb|CAC86033.1| NADH oxidase/thioredoxin reductase [Sulfolobus solfataricus] (324 aa)
Score = 182, Expect = 8.4e-12, Identities = 82/304 (26%), Positives = 147/304 (48%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETN-KNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSS--FMIDCLSKNNILQKLNYEI--IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYV-IDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           +DV IVG G     A+  S  + L +++I +    GGQ  E      + D+    EI++SD+IK     NK  +   + +   +L+I  +  N  + F+ +T  K  F A  +IL  G      RKL +   P +  F    I Y    +  ++KN+ + V+GGGDSA+E A   +    +  V +IHRR+ ++     ++     K N+   LN  +  I  ++  K + +++ +T + + L  + V ++ G    P +    N I  +   Y+ +D   +T++  ++A GD T  +     +ITA A+   A
  S:    16 FDVIIVGLGPAAYGAALYSARYMLKTLVIGETP--GGQLTEA---GIVDDYLGLIEIQASDMIKVF---NKHIEKYEVPV---LLDIVEKIENRGDEFVVKTKRKGEFKADSVILGIG---VKRRKLGV---PGEQEFAGRGISYCSVCDAPLFKNRVVAVIGGGDSALEGAE--ILSSYSTKVYLIHRRDTFKGQQPIYVETVKKKPNVEFVLNSVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIG-FDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAGDCTSAWLGFRQVITAVAQGAVA 309
>gi|187780127|ref|ZP_02996600.1| hypothetical protein CLOSPO_03723 [Clostridium sporogenes ATCC 15579] >gi|187773752|gb|EDU37554.1| hypothetical protein CLOSPO_03723 [Clostridium sporogenes ATCC 15579] (313 aa)
Score = 182, Expect = 8.6e-12, Identities = 83/290 (28%), Positives = 148/290 (51%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN--KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINK--EKGKYVIDLNQKTNIKNIYAIGD 290
           MN+  +   + I+G G  G+ A+  +    LN ILIE    +GGQ    Y    I ++P F +I+ S  +  L+Q+      + I  + D++       NE+   + ET++  +    +I+++G  +   RKL I   P +S F    IHY    +  +Y+ K + V+GGG++A+E A +    K  + V +I R + ++     ++ +  N+ ++ L N++++D   SN      IK+ +T++E+ L  D +   +G I S    EL  +      KG    + N +TNIK +YA GD
  S:     1 MNKKNKNLHLMIIGAGPAGLSAAIYAARAKLNMILIEN-GIIGGQVRSSYT---IENYPGFKKIEGSR-LADLMQEQATDLGATID-EFDMVEKIQLNNNEK---IVETSEYIYKPTVLIISTGATA---RKLPI---PSESKFSGKGIHYCAICDGAMYEGKTVGVIGGGNAALEEALFLT--KFASKVYMIRRYDYFKGEKATLEEVENNSKIEILYNWDLVDVYGSNFVDKALIKNVKTKEEKELKLDGI---FGFIGSEPKTELFKEYISLTPKGYIKTNENMETNIKGVYAAGD 279
>gi|123445416|ref|XP_001311468.1| Pyridine nucleotide-disulphide oxidoreductase family protein [Trichomonas vaginalis G3] >gi|121893279|gb|EAX98538.1| Pyridine nucleotide-disulphide oxidoreductase family protein [Trichomonas vaginalis G3] (346 aa)
Score = 182, Expect = 8.9e-12, Identities = 87/313 (27%), Positives = 148/313 (47%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETN-KNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDF--NESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLN-QKTNIKNIYAIGDATHFYCKPNTII--TACAEAVRALWHISKNK 319
           +YDV I+G G  G  A+  S    L + L+     LGGQ   L     I +FP F     ++++ K+  Q +      I     I  +   T  ++     ET+  N++ A  II+A+G    NPR L + NE    +  +      +  +Y NK + V+GGGDSAV  + Y     I ++V +  R +E R+S+ M   L+K+ +    N EI  +   +    +  K+ +T + +      V +  GQ  +P   E   Q+  +K KY++  N  +T++K ++A GD  +   +       T C  A++A  +IS+ K
  S:    43 LYDVIILGSGPAGSTAALYSARAALKT-LVFHGHLLGGQ---LTTTTEIENFPGFTG-TGTNLVNKI--QTQATAAGAIYKKESITKVNLTTSPKR----IETDLGNAYLAHSIIIATGA---NPRFLSLKNEENFRNRGLCVCATCDGALYANKDVAVVGGGDSAVHESIYL--SNICSSVKLFVRSSELRASAAMKQVLAKSTVEVIYNTEIKGYLGQQFLTAVDTKNSKTGEVKRYKLSAVFLAIGQ--NPATKEFEGQLELDKNKYIVLKNGAETSVKGVFAAGDVANPEYRQAIYAAGTGCQAALQAEKYISQVK 344
>gi|42521987|ref|NP_967367.1| hypothetical protein Bd0373 [Bdellovibrio bacteriovorus HD100] >gi|39574517|emb|CAE78021.1| trxB [Bdellovibrio bacteriovorus HD100] (314 aa)
Score = 182, Expect = 9.6e-12, Identities = 83/311 (26%), Positives = 148/311 (47%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCF-FEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPI-DSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQK-----------TNIKNIYAIGDAT-HFYCKPNTII-TACAEAVRA 311
           M +D ++ +V I+G G  G+ ++  S+  NL  ++IE +   GGQ   L     + +FP F   I   D+I  + +Q +      I  +   ++ +      Q  F          AK II+++G  +   + L + +E +  +  +      +   ++N++I V+GGGD+A+E A +    +    V +IHRR+ +R+S  M+D   KN  ++ L N E+I+     K +T   IK       + LP   + +  G           ++ N +  K V+D+N+            TNI  ++A GD   H Y +  T   T C  A+ A
  S:     1 MTQDQKVENVIIIGSGPAGLTSAIYSSRANLEPLMIEGEE-AGGQ---LMTTTEVENFPGFDHGITGPDLITVMRKQAERFGTRFITRNVTKVDFS------QRPFKVWIGDKLHLAKSIIISTGASA---KYLGLPSEKVYANRGVSACATCDGAFFRNQEIGVVGGGDTAMEEAQFLT--RFATKVYLIHRRDHFRASKIMVDRALKNPKIEVLYNTEVIEVLGDGKGMTGAKIKGTLDGAVKELPITGLFLAIG-----------HKPNTDLFKGVLDMNETGYLITQPNTTYTNIPGVFAAGDVQDHVYRQAITAAGTGCMAAIDA 304
>gi|83591236|ref|YP_431245.1| thioredoxin reductase [Moorella thermoacetica ATCC 39073] >gi|83574150|gb|ABC20702.1| thioredoxin reductase [Moorella thermoacetica ATCC 39073] (304 aa)
Score = 182, Expect = 1.0e-11, Identities = 75/284 (26%), Positives = 139/284 (48%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYE------IIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ-KTNIKNIYAIGD 290
           +YD+ I+GGG  G+ A+       LN+IL+E  +  GGQ  +      I ++P F + I   D+  K  +Q  ++  + +++ T +  + +   N++ +    T+   + A+ +I+ASG    +PR L +  E  +    + Y    +   +++KK+ V+GGGDSAVE A +    +  + V IIHRR+  R++  + D    N    K++++       I   +   +L +K   T   +  PFD V +  G    P    L   +  +   Y++      T+I  ++A GD
  S:     2 VYDLMIIGGGPAGLTAALYGARGGLNTILLEMGA-PGGQAGQ---TDRIENYPGFPDGITGIDLAMKFAEQ-AQRFGARLEMTT-VREVDFSGANKKVI----TSNGEYEARAVIIASGA---HPRPLGVPGEAELRGRGVSYCATCDGAFFRDKKVAVVGGGDSAVEEALFLT--RFASQVTIIHRRDALRATRVIQDRARDN---PKISFQWNTVVNAIQGKDKVSSLQLKDVRTGALREEPFDGVFIFIGL--EPNTDFLGGALTLDPDGYIVTREDLATSIPGVFAAGD 274
>gi|120603735|ref|YP_968135.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|120563964|gb|ABM29708.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio vulgaris subsp. vulgaris DP4] (579 aa)
Score = 181, Expect = 1.0e-11, Identities = 65/282 (23%), Positives = 138/282 (48%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQT--LPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           D+ ++G G  G+ A+  +    L +++++K   +GGQ + + P   + ++P F +I    +++ L   +  ++ + I+ + ++ +I      E       T +N F A+ ++ A+G      RKL++  E       + Y  + +  +Y+ +K+ V+GGG +A+  A +     +   V +IHRR+ +R+   + D L++  I    N  + +     +   ++ ++T+  +T  +PFD V V  G + +      L    +  G   +D + +TNI  +YA GD
  S:   274 DLVVLGAGPAGLSAAIYAERSGLATVVLDK-GIVGGQ-VTVTP--VVENYPGFADIAGIKLVEVL--SSHARQYATIRENENVDDIKLGRRIE-----VHTPRNVFLARAVLFATGA---QWRKLDVPGEDRFYGKGVSYCASCDGFVYRGRKVAVVGGGSTALTDALHL--RNLGVEVTVIHRRDTFRAEKALQDSLTREGIPVIWNAVVEEVMGDTEVRGVRLRDTKTGETRDVPFDGVFVAIGHVPNSEQAADLGVDLEPDGSIKVDRHMRTNIPRVYAAGD 542
>gi|149181841|ref|ZP_01860331.1| thioredoxin-disulfide reductase (thioredoxin reductase (NADPH)) [Bacillus sp. SG-1] >gi|148850480|gb|EDL64640.1| thioredoxin-disulfide reductase (thioredoxin reductase (NADPH)) [Bacillus sp. SG-1] (316 aa)
Score = 181, Expect = 1.1e-11, Identities = 72/290 (24%), Positives = 141/290 (48%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNK----EQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M+E+ +IYDV IVG G  G+ A+  ++   L+++++E +   GGQ   +   + + ++P F  I   D+  K+ +  K    E    +I+          + ++ +E    +     + A+ +IL++G      +KL +  E  +    + Y    +   +K K ++V+GGGDSAVE   Y    +  N V I+HRR+E R+   + +    N+ +  + N+ + + N+ +    ++T+   E  +E+    D V +  G +  P+     +  I  + G    +   +T I  I+A GD
  S:     1 MSEE-KIYDVIIVGAGPAGMTAAVYTSRAALSTLMLE-RGIPGGQ---MANTEEVENYPGFDHILGPDLSNKMFEHAKAFGAEYAYGDIK----------EIVDGEEYKTIKAGSKEYKARAVILSTGA---EWKKLGVPGENELGGRGVSYCAVCDGAFFKGKDLVVVGGGDSAVEEGVYLT--RFANKVTIVHRRDELRAQKILQERAFNNDKVDFIWNHTVKEINDKDGKVGSVTLVSTENGEEKPFEADGVFIYIGML--PLTKPFRDLGITNDMGYIETNDRMETKIPGIFAAGD 278
>gi|125624390|ref|YP_001032873.1| TrxB1 protein [Lactococcus lactis subsp. cremoris MG1363] >gi|124493198|emb|CAL98163.1| TrxB1 protein [Lactococcus lactis subsp. cremoris MG1363] (308 aa)
Score = 181, Expect = 1.1e-11, Identities = 80/283 (28%), Positives = 135/283 (47%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQ-----PMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSK----NNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ--INKEKGKYVIDLNQKTNIKNIYAIGD 290
           YDV I+G G  G+ A+  +    + ++L+E+    GGQ      +E YP       P    +K ++ ++ L  +N     + I+   D   I              T  + F  K II+A+G    N RKLEI   E   +  + Y    +   ++N++ILV+GGGDSAVE A Y    +   +V I+HRR++ R+   +     K    N I   +  EI   ++  +++  K+ +T +     F  + +  G    P+  E ++   I  E G  + D + +TNI  I+A+GD
  S:     6 YDVVIIGSGPAGMTAAMYTARSEMKTLLLER-GVPGGQMNNTAEIENYPGYETIMGP-ELSMKMAEPLEGLGVENAYGFVTGIEDHGDYKKII-------------TEDDEFITKSIIIATGA---NHRKLEIPGEEEYGARGVSYCAVCDGAFFRNQEILVIGGGDSAVEEALYLT--RFGQSVTIMHRRDKLRAQEIIQQRAFKEEKINFIWDSVPMEIKGDDKKIQSVVYKNVKTGEVTEKAFGGIFIYVGL--DPV-AEFVSDLGITDEAGWIITDDHMRTNIPGIFAVGD 277
>gi|45358522|ref|NP_988079.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus maripaludis S2] >gi|44921280|emb|CAF30515.1| thioredoxin reductase [Methanococcus maripaludis S2] (300 aa)
Score = 181, Expect = 1.2e-11, Identities = 75/286 (26%), Positives = 144/286 (50%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRS-SSFMIDCLS-KNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN--QINKEKGKYV-IDLNQKTNIKNIYAIGDAT 292
           +YD+ I+GGG  G+ A   +    L+++ +EK++  GG+  E      + ++P F  IK  ++ +K  +  K  +   I  + + ++ +       + +   T   ++ AK I++ASG+     +K  +N +      + Y +  +   + NK+++VLG G SA+  A Y +++ I   + I+  R+E ++    M D ++  NN+   LN E I+     K   +K     KE+ +  D + + +G +    N E L+  +I   K K++  D N KT+++ IYA GD T
  S:     2 VYDLIIIGGGPAGLTAGIYAMRAKLSTLCLEKQNE-GGKIAEA---GIVENYPGFESIKGFELAQKFSEHAKHFELPIIHEEVEKIDTS------SKPYKVITKHETYEAKSIVIASGS---RYKKPGLNEDDFMGKGVCYCVMCDAFFFLNKEVIVLGRGTSAI-MAAYNLKD-IAKKITIVTDRSELKAVEKIMEDRMNLMNNLEIVLNAEPIEIVGKEKAEGVKVSIDGKEKIISADGIFISFGYVP---NTEFLDGSEIKLNKRKFIETDENCKTSVEGIYACGDVT 274
>gi|170017600|ref|YP_001728519.1| thioredoxin-disulfide reductase [Leuconostoc citreum KM20] >gi|169804457|gb|ACA83075.1| Thioredoxin-disulfide reductase [Leuconostoc citreum KM20] (322 aa)
Score = 180, Expect = 1.3e-11, Identities = 66/287 (22%), Positives = 143/287 (49%)
  Q:     4 DLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQ-ELFLFETNKNSFYAKKIILASGNGSFNPRKLEIN-NEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQ-KLNYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           DL+ YDV IVG G  G+ A+T ++  NL+ +++++  Y GGQ   +     + ++P F  I   D+ +K+         S+ Q   +    + +++  Q +  +  T+   +  K II+A+G+   +   L ++  E      + Y    +   ++++ +LV+GGGDSA+E   Y     +  +V ++HRR++ R+   + D    N  +  + + E++     ++ +T   + + +T++   +    + +  G +++    E LN I   +G  + +   +T I  ++A+GD
  S:     3 DLKRYDVIIVGAGPAGMTAATYASRANLSVLMLDRGIY-GGQ---MNNTADVENYPGFDTILGPDLAEKMYA-------SSTQFGAEYGFGSVESVELQGQDRIVHTDMGDYVTKAIIIATGSEHIH---LGVDGEEQYQGRGVSYCAVCDGAFFRDEDVLVIGGGDSAIEEGLYLT--NLAKSVTVLHRRDKLRAQQIIQDRAFDNEKMAFRWHTEVLKITGDDEKVTGVDVINNQTQEVSHIDASGIFIYVGLMANTQGFENLN-ITDSEGWILTNEKMETTIPGVFAVGD 278
>gi|89098782|ref|ZP_01171663.1| thioredoxin reductase [Bacillus sp. NRRL B-14911] >gi|89086458|gb|EAR65578.1| thioredoxin reductase [Bacillus sp. NRRL B-14911] (316 aa)
Score = 180, Expect = 1.4e-11, Identities = 72/290 (24%), Positives = 132/290 (45%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M E+ +IYDV I G G  G+ A+  ++  NL++++IE +   GGQ   +   + + ++P F  I   D+  K+    K+        D        + I+ +E          + A+ +I+ +G      +K+ +  E  +    + Y    +   +K K+++V+GGGDSAVE   Y    +    V I+HRR+E R+ + +      N  +  + N  + + NES     ++T+   E  +E+    D V +  G +      + L  I  E G    +   +T +  I+A GD
  S:     1 MTEE-KIYDVIIAGAGPAGMTAAVYTSRANLSTLMIE-RGVPGGQ---MANTEEVENYPGFDHILGPDLSTKMFDHAKKFGAEYAYGDIK------EIIDGEEYKTVVAGSKQYKARAVIITTGA---EYKKIGVPGEKELGGRGVSYCAVCDGAFFKGKELVVVGGGDSAVEEGVYLT--RFAEKVTIVHRRDELRAQAILQQRAFDNEKVDFIWNSTVKEINESEGKVGSVTLVSTENGEEREFKADGVFIYIGMVPLSKPFQSLG-ITNENGYIETNERMETKVPGIFAAGD 278
>gi|69248115|ref|ZP_00604630.1| Thioredoxin reductase [Enterococcus faecium DO] >gi|68194552|gb|EAN09045.1| Thioredoxin reductase [Enterococcus faecium DO] (308 aa)
Score = 180, Expect = 1.5e-11, Identities = 77/284 (27%), Positives = 132/284 (46%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSN---IQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTI----KHKETEKEQTLPFDYVLVQYG--QISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +YDV ++G G  G+ A+  ++  NL+ ++IE+ +  GGQ   +     I ++P F  I   D+  K+ +        N   I  D        + I E +         S+  K +I+A+G      RKL +   E      + Y    +   ++NK+++V+GGGDSAVE A Y  +    + V I+HRR+E R+   + D    N  +  +   ++D    N+ +      ++ +T  E  L  D V +  G   +++P     L     E G    D   KTN+  ++AIGD
  S:     1 MYDVIVIGAGPSGMTAALYASRSNLSVLMIEQGA-PGGQ---MNNTAEIENYPGFDSIMGPDLAYKMYESVSRFGTENAYGIVQDIKDHGSHKEVICEDK---------SYEGKTVIIATGCIH---RKLGVPGEEEFAGRGVSYCAVCDGAFFRNKRLVVIGGGDSAVEEAIYLTQ--FASEVVIVHRRDELRAQKIIQDRAFANEKISFMWDTVVDEIVGNEMVVTGVKARNVKTGNEFDLAADGVFIYVGLDPLTAPFREAGLTN---EAGWIPTDNEMKTNMPGVFAIGD 273
>gi|156937410|ref|YP_001435206.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ignicoccus hospitalis KIN4/I] >gi|156566394|gb|ABU81799.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ignicoccus hospitalis KIN4/I] (305 aa)
Score = 180, Expect = 1.6e-11, Identities = 74/300 (24%), Positives = 145/300 (48%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ--INKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           D  +VG G  G+ A+     + +  ++IE +  +    +  Y  K + ++P F   ++ ++ +    +  ++      ++ + +   W+   E +  +  T   + Y  K+++ +      PR+L I NE  D+P +HY +   T  +   K++V+GGGD+AV+ A    E      V I+HRR+++R+    I+ + +  +   LN    EII  +     L + HKE   E  LP D++++  G    P ++E +    +N    + ++D   +TN+K ++A GD T     P  I+ A A+ 
  S:     3 DALVVGAGPAGLTAAATLKQYGVEPLVIEAERVMA--TVYSYAWKPVENYPGFDGKRAIEIARAF--EEMQKFFGVEVVEKERVVKAWK---EGDKIVLGTQSGNEYEGKVLIIAIGILGKPRRLGIPNE--DAPNVHYIVKDPTA-FAGSKVVVVGGGDTAVDTATVLAESGA--QVTIVHRRDQFRAPMRSIERMVRAGVKMVLNSVPKEIIAKDGKATALVVTHKEG-GETVLPLDHLVISIG--FEPPDLEWVKSLGVNMRGKEILVDDKMRTNVKGVFAAGDITP---APKRILVAAAQG 289
>gi|187251013|ref|YP_001875495.1| thioredoxin reductase [Elusimicrobium minutum Pei191] >gi|186971173|gb|ACC98158.1| thioredoxin reductase [Elusimicrobium minutum Pei191] (309 aa)
Score = 180, Expect = 1.7e-11, Identities = 75/288 (26%), Positives = 134/288 (46%)
  Q:     5 LRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSK-NNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDAT 292
           ++  D+ ++G G  G+ A+       L+ +L+      GGQ ++      + ++P F E  S   +   + +  E+  + + + T+I +I     + +   L  T+ N + AK I++ASG     PR  E + E       I      +   +KNK ++V+GGG++A E   Y    KI N V ++HRR  +R++   ++ +    N+   LNY    F   +     L +K+   +  + LP   V V  G +     ++      +E G   ID + KTNI+ I+A GD T
  S:     1 MQTSDIIVIGNGPAGVTAAIYGVRAALD-VLVFAGPISGGQILQ---TNDMENYPGFIEPVSGYELMDKMHKQAERLGAKV-VHTEISSID---TSSKPFKLTATDGNIYAAKTIVIASG---VKPRWTEADGEDKYKGRGISSCATCDGMFFKNKDVVVIGGGNTAFEDVLYL--SKICNKVYLVHRREGFRAAQKTVEKVKACPNVEMVLNYTAESFEGDSLGLNALKVKNLNDQTVRELPCQGVFVAIGGVPQTAFLKNSGVELEEDGIIKIDESGKTNIEGIFAAGDCT 280
>gi|163812146|ref|ZP_02203824.1| thioredoxin reductase [Dehalococcoides sp. VS] >gi|157404182|gb|EDO70224.1| thioredoxin reductase [Dehalococcoides sp. VS] (306 aa)
Score = 179, Expect = 1.8e-11, Identities = 71/284 (25%), Positives = 134/284 (47%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNILQKLNYEIIDFN--ESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEK-GKYVIDLNQKTNIKNIYAIGD 290
           +YDV I+GGG  G+ A+  +    L +++IE ++++GGQ   +  ++ + ++P F E I   D+ +++  Q ++        +   LN        ++ F   T       + II+  G       KL +   E      + Y    +   Y +K +  +GGG+ A+  A +  E      V +IHRR  +R+ + +ID   SK NI   L+  I   N  +S ++L++ + +T+K   LP + + V  G    P    L   ++ +K G  +++   +T++  I   GD
  S:     5 LYDVIIIGGGPAGLTAALYTGRAKLKTLVIE-RAFIGGQ---ITRSEKVDNYPGFPEGITGFDLTQQMQIQAEKYGAEITSAEVTALN------KAKDSFEISTEAGKLSGRCIIICGGT---ERNKLGVPGEEEFSGRGVSYCATCDAPFYNDKVVAAVGGGNMAIYEALHLSE--FAKKVYLIHRRQGFRADAVLIDKAKSKGNIEMALDTVITAINGKDSIQSLSLNNLKTQKTSDLPVNGLFVAVGL--QPNTAYLKGVVDMDKNGSILVNDQMETSVSGILCAGD 277
>gi|160941027|ref|ZP_02088365.1| hypothetical protein CLOBOL_05920 [Clostridium bolteae ATCC BAA-613] >gi|158435976|gb|EDP13743.1| hypothetical protein CLOBOL_05920 [Clostridium bolteae ATCC BAA-613] (343 aa)
Score = 179, Expect = 1.9e-11, Identities = 79/311 (25%), Positives = 150/311 (48%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEI--------IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKP-NTIITACAEAVRALWHISK 317
           IYD+ I+G G  G+ A+  +    L+++++EK    GGQ +  Y    + ++P    I   D+  K  +++ ++  +   ++ ++LNI  Q   +  +       N++ A+ +ILA+G      RKL +   E +    + Y    +   ++NK   V+GGGD AVE A +    ++ + V +IHRRNE R++  +     + N+L   N E+        I+ +   K+L++ + +  +++ L    V +  G        E L  ++ + G      +  T+   I+A GD      KP   IITA A+   A+  + +
  S:    40 IYDLIIIGSGPAGLAAAVYAQRAKLDTLVVEKAMVSGGQVLTTYE---VDNYPGLPGIGGYDLGIKF-REHADRLGARF-VEDEVLNI--QDGGKGAIKGVVCQGNTYEARSLILATGAVH---RKLGVPGEEELAGAGVSYCATCDGAFFRNKVTAVIGGGDVAVEDAIFLA--RMCSKVYLIHRRNELRAAKSL-----QENLLSLDNVEVIWDTVADSINGDGMVKSLSLTNVKNGQKRELDVQGVFIAVGITPESRAFEGL--VDMDHGYIRAGEDTVTSAPGIFAAGDVR---TKPLRQIITAAADGANAITSVER 338
>gi|172041694|ref|YP_001801408.1| hypothetical protein cu2017 [Corynebacterium urealyticum DSM 7109] >gi|171852998|emb|CAQ05974.1| unnamed protein product [Corynebacterium urealyticum DSM 7109] (354 aa)
Score = 179, Expect = 1.9e-11, Identities = 80/306 (26%), Positives = 147/306 (48%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQL-DTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKN---NILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQIN-KEKGKYVIDL-NQKTNIKNIYAIGDA--THFYCKPNTIITACAEAVRA 311
           +I++V IVG G  G  A+  +    L  I+ E   + GG  M+      + +FP F + I+  +++ ++  Q  E+  +++++ D + +++T       E+     +   + A+ +ILA+G     PR L I  E  +    +      +   +K++KI ++GGGDSA+E A++    K    V +IHRR+E+R+S  M +   +N     L       +    +  +LT++   T + Q + FD + V  G    P       Q+  KE G   +D  +  T++  ++A GD   +H+       ITA     RA
  S:    45 KIHNVIIVGSGPAGYTAAIYAARAELEPIVFEGMDF-GGLLMQ---TTEVENFPGFAKGIQGPELMDEMRNQ-AERFGADLRMEDVEKMDLT------GEIKKVWVDGEEYQARAVILATGAA---PRYLNIPGEQEMIGRGVSACATCDGFFFKDRKIAIVGGGDSAMEEADFLT--KFGETVTLIHRRDEFRASKIMQERARQNPKIEFLMNSKVTAVHGESAVTSLTVEDTVTGESQEMEFDALFVAIGH--DPRVSVFEGQVELKEDGYVKVDEPSTATSLPGVFAAGDLVDSHY----QQAITAAGSGCRA 338
>gi|153951779|ref|YP_001397404.1| thioredoxin-disulfide reductase [Campylobacter jejuni subsp. doylei 269.97] >gi|152939225|gb|ABS43966.1| thioredoxin-disulfide reductase [Campylobacter jejuni subsp. doylei 269.97] (312 aa)
Score = 179, Expect = 2.0e-11, Identities = 82/306 (26%), Positives = 149/306 (48%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFL--FETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF---IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKT----LTIKHKETE-KEQTLPFDYVLVQYGQISSPINIELLNQIN-------KEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE-AVRAL 312
           + DVAI+GGG  G+ A   +    L ++++ +K   GGQ   +  +  I ++P   ++   D I  +   N  ++     L  +++ +     N    F    E  K    AK +I+ +G+    P++     E  D  F   +      +   YKNK++ VLGGGD+A+E A Y     I + V +IHRR+E+R++ F ++ + KN  ++ +    +D    +K     + +K K+   ++  +P  +  V        +  E+L Q +       +E G+  +DL  +TN+  ++A GD       P  +I A  + AV AL
  S:     1 MLDVAIIGGGPAGLSAGLYATRGGLKNVVMFEKGMPGGQ---ITSSSEIENYPGVAQVM--DGISFMAPWN--EQCMRFGLKHEMVGVEQILKNSDGSFTIKLEGGKTEL-AKAVIVCTGSA---PKRAGFKGE--DEFFGKGVSTCATCDGFFYKNKEVAVLGGGDTALEEALYLA--NICSKVYLIHRRDEFRAAPFTVEKVKKNKKIELITSASVDEVYGDKMGVTGVKVKLKDGSIRDLNVPGIFTFVGLN-----VRNEILKQDDGKFLCNMEEGGQVSVDLKMQTNVAGLFAAGDLRK--DAPKQVICAAGDGAVAAL 302
>gi|30721749|gb|AAP34255.1| alkyl hydroperoxide reductase F [Desulfovibrio vulgaris] (579 aa)
Score = 179, Expect = 2.1e-11, Identities = 65/282 (23%), Positives = 138/282 (48%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQT--LPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           D+ ++G G  G+ A+  +    L +++++K   +GGQ + + P   + ++P F +I    +++ L   +  ++ + I+ +  + +I      E       T +N F A+ ++ A+G      RKL++  E       + Y  + +  +Y+ +K+ V+GGG++A+  A +     +   V +IHRR+ +R+   + D L++  I    N  + +     +   ++ ++T+  +T  +PFD V V  G + +      L    +  G   +D + +TNI  +YA GD
  S:   274 DLLVLGAGPAGLSAAIYAERSGLATVVLDK-GIVGGQ-VTVTP--VVENYPGFADIAGIKLVEVL--SSHARQYATIRENEGVDDIKLGRRIE-----VHTPRNVFLARAVLFATGA---QWRKLDVPGEDRFYGKGVSYCASCDGFVYRGRKVAVVGGGNTALTDALHL--RNLGVEVTVIHRRDTFRAEKALQDSLTREGIPVIWNAVVEEVMGDTEVRGVRLRDTKTGETRDVPFDGVFVAIGHVPNSEQAADLGVDLEPDGSIKVDRHMRTNIPRVYAAGD 542
>gi|46578699|ref|YP_009507.1| AhpF family protein/thioredoxin reductase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|46448111|gb|AAS94766.1| AhpF family protein/thioredoxin reductase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] (661 aa)
Score = 179, Expect = 2.1e-11, Identities = 65/282 (23%), Positives = 138/282 (48%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQT--LPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           D+ ++G G  G+ A+  +    L +++++K   +GGQ + + P   + ++P F +I    +++ L   +  ++ + I+ +  + +I      E       T +N F A+ ++ A+G      RKL++  E       + Y  + +  +Y+ +K+ V+GGG++A+  A +     +   V +IHRR+ +R+   + D L++  I    N  + +     +   ++ ++T+  +T  +PFD V V  G + +      L    +  G   +D + +TNI  +YA GD
  S:   356 DLLVLGAGPAGLSAAIYAERSGLATVVLDK-GIVGGQ-VTVTP--VVENYPGFADIAGIKLVEVL--SSHARQYATIRENEGVDDIKLGRRIE-----VHTPRNVFLARAVLFATGA---QWRKLDVPGEDRFYGKGVSYCASCDGFVYRGRKVAVVGGGNTALTDALHL--RNLGVEVTVIHRRDTFRAEKALQDSLTREGIPVIWNAVVEEVMGDTEVRGVRLRDTKTGETRDVPFDGVFVAIGHVPNSEQAADLGVDLEPDGSIKVDRHMRTNIPRVYAAGD 624
>gi|77411176|ref|ZP_00787528.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus agalactiae CJB111] >gi|77162794|gb|EAO73753.1| pyridine nucleotide-disulphide oxidoreductase family protein [Streptococcus agalactiae CJB111] (189 aa)
Score = 178, Expect = 2.4e-11, Identities = 51/159 (32%), Positives = 84/159 (52%)
  Q:   154 EIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNK---TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           E +  K +++ GGGDSAV+WAN    +KI  +VAI+HRR+ +R+    +D L  + +     Y  I  N  ++   +L ++  + ++   LP D ++V +G  +S  N+   N   K     V  L + T  + +YAIGDA ++  K   I T   EA  A+
  S:     8 EQFAGKHVVICGGGDSAVDWANEL--DKIAASVAIVHRRDAFRAHEHSVDILKASGVRILTPYVPICLNGDSQRVSSLVVQKVKGDEVIELPLDNLIVSFGFSTSNKNLRYWNLDYKRSSINVSSLFETTQ-EGVYAIGDAANYPGKVELIATGYGEAPVAI 166
>gi|147677752|ref|YP_001211967.1| thioredoxin reductase [Pelotomaculum thermopropionicum SI] >gi|146273849|dbj|BAF59598.1| thioredoxin reductase [Pelotomaculum thermopropionicum SI] (306 aa)
Score = 178, Expect = 2.4e-11, Identities = 74/282 (26%), Positives = 142/282 (50%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELY-PNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTIN-EQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEI---IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINK--EKGKYVIDLNQKTNIKNIYAIGD 290
           ++ I+GGG  G+ A    +   L+++L+E+     G P  L      + ++P F E I   ++++K+ +Q +       +   +I+++  ++I  + + F  +T      A  +I+A+G     P+ L +  E       + Y    +   ++ KK+ V+GGGD+AV+ A +    K    V IIHRRNE R++  + +    N  ++ +   +   I  ++  +++T+K+ +  +E+ L  D V +  GQ   P N +L+  I    EKG  + D N  T+   +YA GD
  S:     5 ELVIIGGGPAGLSAGLYGSRAKLDTVLLER-----GIPGGLVISTDQVENYPGFPEGIGGFELMQKMEEQAR-------RFGLEIVSVNVESIRVDGKGFCVKTEDGELLAGAVIIATGA---QPQLLGVKGEEQYTGRGVSYCATCDGAFFRGKKVAVIGGGDAAVQEAIFLT--KFAEKVFIIHRRNELRATRAVQEKAFGNPKIEFVWDAVVSEISGSDLVESVTVKNVKNGEERDLQVDGVFIYVGQ--KP-NSDLVRDIVSLDEKGYIITDENMMTSQPGLYAAGD 275
>gi|51892210|ref|YP_074901.1| thioredoxin reductase [Symbiobacterium thermophilum IAM 14863] >gi|51855899|dbj|BAD40057.1| thioredoxin reductase [Symbiobacterium thermophilum IAM 14863] (314 aa)
Score = 178, Expect = 2.5e-11, Identities = 73/281 (25%), Positives = 130/281 (46%)
  Q:    10 VAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPID-SPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYV--IDLNQKTNIKNIYAIGD 290
           V I+G G  G+ A+  +   NL  ++IE     GGQ   L     + +FP F       ++   +  N  ++      +     +T    + +   +     +   A+ +I+A+G  +   + L I  E  +    + Y    +   Y+ KK+LV+GGGDSA+E AN+  +     +V ++HRR+E R+S  M +    N     +L  +  E++      K L ++ KET +E+ L  D + V  G    P    L  QI+ ++  Y+  I    +TN+  ++A GD
  S:     4 VVILGTGPAGLTAAIYTARANLQPLVIEGNE-PGGQ---LTTTTEVENFPGF----PDGIMGPELMDNMRRQAERFGAEFRRGYVTGVDFSRRPFRITVDETDVIEAEAVIIATGASA---KHLGIPGEDENIGRGVSYCATCDGFFYRGKKVLVVGGGDSAMEEANFLTK---FADVTVVHRRSELRASKIMQERARANPKISWVLNAVPVEVLADERGFKALKVRDKETGEERLLEADGMFVAIGH--KPNTDFLRGQIDMDELGYIKTIPGTAQTNVPGVFACGD 275
>gi|15669731|ref|NP_248544.1| thioredoxin reductase (trxB) [Methanocaldococcus jannaschii DSM 2661] >gi|41018442|sp|Q58931|TRXB_METJA Putative thioredoxin reductase (TRXR) >gi|1592167|gb|AAB99556.1| thioredoxin reductase (trxB) [Methanocaldococcus jannaschii DSM 2661] (301 aa)
Score = 178, Expect = 2.7e-11, Identities = 75/284 (26%), Positives = 135/284 (47%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSS-SFMIDCLSK-NNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKE---KGKYVIDLNQKTNIKNIYAIGD 290
           I+D  I+G G GG+ A   +    LN++ IEK++  GG+  E      + ++P F EI+  ++ +K   +N  +K     +  +++ I      ++  F   T  + +  K I++A+G     P+KL +N +      I Y    +   Y NK+++V+G    A+  A     + I   V +I  ++E +++ S M+D L + NN+    N + ++     +   +K     KE+ +  D + +  G +    N E L     E   KG    D N +TNI  IYA+GD
  S:     2 IHDTIIIGAGPGGLTAGIYAMRGKLNALCIEKEN-AGGRIAEA---GIVENYPGFEEIRGYELAEKF--KNHAEKFKLPIIYDEVIKIE----TKERPFKVITKNSEYLTKTIVIATGT---KPKKLGLNEDKFIGRGISYCTMCDAFFYLNKEVIVIGRDTPAIMSAINL--KDIAKKVIVITDKSELKAAESIMLDKLKEANNVEIIYNAKPLEIVGEERAEGVKISVNGKEEIIKADGIFISLGHVP---NTEFLKDSGIELDKKGFIKTDENCRTNIDGIYAVGD 272
>gi|124524258|ref|ZP_01697866.1| thioredoxin reductase [Bacillus coagulans 36D1] >gi|124495138|gb|EAY42894.1| thioredoxin reductase [Bacillus coagulans 36D1] (182 aa)
Score = 177, Expect = 3.2e-11, Identities = 45/147 (30%), Positives = 76/147 (51%)
  Q:     4 DLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINE--QELFLFETNKNSFYAKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLN 150
           D  +YDV I+GGG  G+FA+       +   +IE    LGGQ   LYP K+IYD     ++K+  +  +LI+Q  +         T +LN T Q + +  +  F  ET     ++K +++ +G G+  PR++E       ++  +HY +N
  S:     2 DETVYDVTIIGGGPVGLFAAFYGGLRQMKVKIIESMPQLGGQLAALYPEKYIYDVAGMPKVKAQSLADRLIEQAMQFH------PTIVLNETVQDVKKTGRGTFRIETGSGLHFSKTVLITAGIGACQPRRIEHEQASQYENKNLHYFVN 145
>gi|195953220|ref|YP_002121510.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Hydrogenobaculum sp. Y04AAS1] >gi|195932832|gb|ACG57532.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Hydrogenobaculum sp. Y04AAS1] (312 aa)
Score = 177, Expect = 3.5e-11, Identities = 79/306 (25%), Positives = 163/306 (53%)
  Q:    10 VAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPID-SPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITN---NVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIID-FNESNKTLT-IKHKETEKEQTLPFDYVLVQYGQISSPINIELL----NQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHI 315
           + I+GGG  G+ AS  +    ++ +L+ K   +GGQ   +  +  I ++  F  I   + +++LI+Q +  +   +  +     I ++ + E +  +  +N+ +  A+ +++ +G    + +KL +  E       + Y    +   YKNKK++V+GGG+S  E A     E++TN   ++ II   + +++   + + + KN  ++ L N+ +++ + + N  +T +K ++ +  +T  F+   V + +I +  N EL      ++NK  G+ +ID N +T++  +YA GD T+ + K   IITA  E  +AL  I
  S:     5 LVIIGGGPAGVAASIYAARKKMDFVLVTKD--IGGQ---ILTSGDIENYMGFKNIDGINFVQRLIEQLEYLEVYPLYAEV----IDFRALKEHDFSISLSNELTIKAENVLICTGA---DHKKLGVKGEQEGIGKGVSYCYTCDAPFYKNKKVIVVGGGNSGFEAA-----EQLTNYASSITIIEYTDRFKADESLQNKVLKNEKVKALTNHRVLEIYVDKNIGVTGVKLEDMKNGKTYDFETEGV-FVEIGTKPNTELFINTGIKLNKW-GEIIIDQNNRTSLLGVYAAGDCTNIFAK--QIITAAGEGAKALLSI 300
>gi|57241393|ref|ZP_00369339.1| thioredoxin reductase [Campylobacter lari RM2100] >gi|57017729|gb|EAL54505.1| thioredoxin reductase [Campylobacter lari RM2100] (313 aa)
Score = 177, Expect = 3.7e-11, Identities = 81/306 (26%), Positives = 148/306 (48%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFE-TNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF---IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEII-----DFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQIN-------KEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE-AVRAL 312
           + D+AI+GGG  G+ A   +    L ++++ +K   GGQ   +  +  I ++P   ++   D I  +   N  ++     L  +++ +   + N    F  +  N     AK +I+ +G+    PR+     E  D  F   +      +   YKNK++ VLGGGD+A+E A Y     I + V +IHRR+E+R++   ++ +  N+ ++ +   ++     D    NK     +  +++E  +P  +  V        +  E+L Q N       +E G+  +DL  +TNI  ++A GD       P  +I A  + AV AL
  S:     2 MLDLAIIGGGPAGLSAGLYATRGGLKNVVMFEKGTPGGQ---ITSSSEIENYPGVAQVL--DGISFMAPWN--EQCMRFGLKHEMIGVEQISKNTDGSFNIKLENGKVEQAKAVIVCTGS---TPRRAGFKGE--DEFFGKGVSTCATCDGFFYKNKEVAVLGGGDTALEEALYLA--NICSKVYLIHRRDEFRAAPSTVEKVRNNDKIELITNAVVDEVCGDNMGVNKVKIAFNDGSKRELDVPGIFTFVGLN-----VRNEILKQENGEFLCAMEEGGQVSVDLKMQTNIAGLFAAGDLRK--DAPKQVICAAGDGAVAAL 303
>gi|118575560|ref|YP_875303.1| thioredoxin reductase [Cenarchaeum symbiosum A] >gi|118194081|gb|ABK76999.1| thioredoxin reductase [Cenarchaeum symbiosum A] (323 aa)
Score = 177, Expect = 3.9e-11, Identities = 75/283 (26%), Positives = 132/283 (46%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQ-KLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QI-NKEKGKYVIDLNQKTNIKNIYAIGD 290
           YDV I+G G  G  A    +    ++ LI      GGQ   L     + +FP F   I   D++    +Q  E+  + I +D +++N+ ++       F   T++  + AK +I+ +G     PRKL +  E       + Y    +   +KN +++V+GGGDSA+E A +    K    V ++HRR E R+S  M +    +  ++  L YE+ +   + K   +     + E+ +    V V  G    P N EL   Q+   ++G  V+    +T++  ++A GD
  S:    25 YDVIIIGAGPAGYTAGIYCSRARRDT-LILSGILPGGQ---LVNTTDVENFPGFENGIMGPDLMINFRKQ-AERMGTTI-VDDEVVNVDFR----HRPFKVLTSEEEYEAKAVIVGTGA---TPRKLGVEGEKAFAGKGVSYCATCDGPFFKNMELVVVGGGDSAMEEATFLT--KFATTVHVVHRRKELRASKIMQERAHDDEKIRFHLGYEVKEIRGNGKVQQVVLASPDGEEQMDTGGVFVAIGH--DP-NTELFKGQLETDDQGYIVLKGASQTSVPGVFAAGD 294
>gi|158319990|ref|YP_001512497.1| thioredoxin reductase [Alkaliphilus oremlandii OhILAs] >gi|158140189|gb|ABW18501.1| thioredoxin reductase [Alkaliphilus oremlandii OhILAs] (314 aa)
Score = 176, Expect = 4.3e-11, Identities = 80/284 (28%), Positives = 139/284 (48%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDV-IKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY---------------EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI-DLNQKTNIKNIYAIGD 290
           I DV I+GGG  G+ A   +    + ++++EK+   GGQ   +     + ++P   E  +  + I ++++Q KE   +  + DT    IT   +N   + + +  K ++ AK II+ASG    NPR +    E  +    + Y    + + + + ++ V+GGGDSAVE A +    K    V I+HRR+E R++  + +   KN    K+N+               E + F         ++   E++ T    +V V Y     P        IN ++  Y+I D N KTN+  ++A GD
  S:     4 ILDVIIIGGGPAGLSAGLYAARAKMTTLILEKEK-AGGQ---IVSTAEVANYPGSMENATGPILIDRMLEQCKE-FGATFEKDT----ITEIDVN-GPIKVLKGEKATYQAKSIIIASGA---NPRPIGAPGERELIGKGVSYCATCDGDFFTDLEVFVIGGGDSAVEEAIFLT--KFARKVTIVHRRDELRAAKSIQEKAFKN---PKINFIWDSTVEEIKGDGIVESVVFRNLKTNEITEYMADEEDGTFGI-FVFVGY----IPATNIFKGIINMDETGYIITDDNMKTNVPGVFAAGD 282
>gi|159906078|ref|YP_001549740.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus maripaludis C6] >gi|159887571|gb|ABX02508.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus maripaludis C6] (300 aa)
Score = 176, Expect = 4.3e-11, Identities = 76/285 (26%), Positives = 141/285 (49%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRS-SSFMIDCLS-KNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ--INKEKGKYV-IDLNQKTNIKNIYAIGDAT 292
           YD+ I+GGG  G+ A   +    L+++ +EK++  GG+  E      + ++P F  IK  ++ +K  +  K  +   I  + + ++ +       + +   T    + AK I++ASG+     +K  +N +  +   + Y +  +   + NK+++VLG G SA+  A Y +++ I   + I+  R+E ++    M D ++  NN+    N E I+     K   +K     KE+ +  D + + +G +    N E L +  I   K K+V ID N KT++  IYA GD T
  S:     3 YDLIIIGGGPAGLTAGIYAMRAKLSTLCLEKENE-GGKIAEA---GIVENYPGFESIKGFELAQKFSEHAKHFELPIIHEEVEKIDTS------SKPYKVITKNEKYEAKSIVIASGS---RYKKPGLNEDDFNGKGVCYCVMCDAFFFLNKEVIVLGRGTSAI-MAAYNLKD-IAKKITIVTDRSELKAVEKIMEDRMNLMNNLEIVYNAEPIEIVGEEKAEGVKVSINGKEEIISADGIFISFGYVP---NTEFLEKSDIKLNKRKFVEIDENCKTSVDGIYACGDVT 274
>gi|194015733|ref|ZP_03054349.1| thioredoxin-disulfide reductase [Bacillus pumilus ATCC 7061] >gi|194013137|gb|EDW22703.1| thioredoxin-disulfide reductase [Bacillus pumilus ATCC 7061] (327 aa)
Score = 176, Expect = 4.4e-11, Identities = 69/285 (24%), Positives = 130/285 (45%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFM-IDCLSKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +IYD  I+G G  G+ A+  ++  NL++++IE+    GGQ   +   + + ++P F  I   ++  K+    K+        D        + ++ +E  + +     +  + +I+A+G      +K+    E  +    + Y    +   +KNK+++V+GGGDSAVE   Y    +  + V I+HRR++ R+ S +         I    N  +   NE N    ++T+    T +E+    D   +  G +      E L   NKE G    +   +T ++ I+A GD
  S:    16 KIYDTIIIGAGPAGMTAAVYTSRGNLSTLMIER-GIPGGQ---MANTEDVENYPGFESILGPELSNKMFDHAKKFGAEYAYGDIK------EIVDGEEYKIVKAGSKEYKGRSVIIAAGA---EYKKIGAPGEKELGGRGVSYCAVCDGAFFKNKELVVIGGGDSAVEEGVYLT--RFASKVTIVHRRDKLRAQSILQARAFDNEKIDFMWNKTVKQINEENGKVGSVTLIDTVTGEEEDFKTDGAFIYIGMLPLSKPFENLGITNKE-GYIETNERMETRVEGIFAAGD 289
>gi|125718663|ref|YP_001035796.1| thioredoxin reductase, putative [Streptococcus sanguinis SK36] >gi|125498580|gb|ABN45246.1| Thioredoxin reductase, putative [Streptococcus sanguinis SK36] (304 aa)
Score = 176, Expect = 4.4e-11, Identities = 76/284 (26%), Positives = 134/284 (47%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY------EIIDFNESNKT-LTIKHKETEKEQTLPFDYVLVQYG-QISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +YD  I+G G  G+ A+  +   NL   L+E+    GGQ   +     I ++P +  I   ++ +K+ +     +N  ++    +  +  +  +  +     T    F AK +I+ASG    N R L +   E  +S  + Y    +   ++++ +LV+GGGDSAVE A +    +   +V I+HRR+E R+   + D    N   +K+ +      E I  +E   T +T K+ +T +     F  + +  G    S    +L   I  E G  + D   KT++  IYA+GD
  S:     1 MYDTIIIGAGPAGMTAALYAARSNLKVALLER-GIPGGQ---MNNTADIENYPGYANISGPELAEKMFE---PLENLGVE---HLFGLVEKIEDRGDFKEIITEDERFEAKTVIIASGA---NHRHLGVPGEEDYNSRGVSYCAVCDGAFFRDEDLLVVGGGDSAVEEAIFLT--RFAKSVTIVHRRDELRAQKVLQDRAFAN---EKIRFVWDSVVESIHGDERKVTGVTFKNVKTGEVSQAEFGGIFIYVGLDPVSEFAADL--GITDEAGWILTDHQMKTSVAGIYAVGD 273
>gi|33240695|ref|NP_875637.1| thioredoxin reductase [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|33238223|gb|AAQ00290.1| Thioredoxin reductase [Prochlorococcus marinus subsp. marinus str. CCMP1375] (452 aa)
Score = 176, Expect = 4.6e-11, Identities = 81/286 (28%), Positives = 146/286 (51%)
  Q:     5 LRIYDVAIVGGGAGGIFASTISNYFNLNSILI---EKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNL------ETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNILQKLNYEIIDF--NESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIE---LLNQ---INKEKGKYVIDLNQKTNIKNIYAIGD 290
           + I ++ I+G G  G  A+  +   NL  +LI   E+    GGQ   L    F+ +FP F + I   D++  L  Q        ++LD + +++      +Q  F  +T   S  A+ +I+A+G  +    KL I NE   + F    ++        T  ++N+++ V+GGGDSA E A Y    K  ++V ++ R N+ ++S  M D  ++ + I      E+ID    E  +TL +K + T++E+T+    +    G   +   +E   L+NQ   I+ + G+       +T+I+ ++A GD
  S:     1 MSIENLVIIGSGPAGYTAAIYAARANLQPLLITGFERGGIPGGQ---LMTTTFVENFPGFPDGIMGPDLMDLLKAQAIRWGTKLLELDAEAIDL------KQNPFRVKTANQSIAAQALIIATGARA---NKLGIPNE---NKFWTRGISACAICDGATPQFRNEELAVVGGGDSACEEAVYLT--KYGSHVHLLIRSNQLKASKAMSDRVMANSQITVHWETELIDVEGKEWIETLKVKRRGTKQEETIKAKGLFYAIGHTPNADLLEGQLLINQNGYISTKSGR------PETSIEGVFAAGD 282
>gi|118431317|ref|NP_147693.2| thioredoxin reductase [Aeropyrum pernix K1] >gi|116062640|dbj|BAA80046.2| thioredoxin reductase [Aeropyrum pernix K1] (337 aa)
Score = 176, Expect = 4.7e-11, Identities = 81/288 (28%), Positives = 143/288 (49%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKN-------SNIQLDT-DILNITWQTINEQELFLFETNKN-SFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKK-ILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNILQKLNYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEK---GKYVIDLNQKTNIKNIYAIGDATHFY 295
           YD  IVG G  G+ A+  +  F ++++++     +GGQ   L    +I D+P    +++S    KL++  K           + +Q+ T D L+  W        FL   ++     A+ +ILA G+     RKL +  E  +    + Y    +  ++K K  ++V+GGGDSA+E A   +       V ++HRR  +R+  F ++    K NI   L+  + +    ++  ++ +K+K T +E+ L  D + ++ G  S P   EL   I  E    G  V+D   +T+I  I+A GD T  +
  S:    19 YDTVIVGAGPAGLSAAIYTTRFLMSTLIVSMD--VGGQ---LNLTNWIDDYPGMGGLEAS----KLVESFKSHAEMFGAKIVTGVQVKTVDRLDDGW--------FLVRGSRGLEVKARTVILAVGS---RRRKLGVPGEAELAGRGVSYCSVCDAPLFKGKDAVVVVGGGDSALEGA--LLLSGYVGKVYLVHRRQGFRAKPFYVEEARKKPNIEFILDSIVTEIRGRDRVESVVVKNKVTGEEKELRVDGIFIEIG--SEPPK-ELFEAIGLETDSMGNVVVDEWMRTSIPGIFAAGDCTSMW 298
>gi|195952997|ref|YP_002121287.1| thioredoxin reductase [Hydrogenobaculum sp. Y04AAS1] >gi|195932609|gb|ACG57309.1| thioredoxin reductase [Hydrogenobaculum sp. Y04AAS1] (312 aa)
Score = 176, Expect = 4.8e-11, Identities = 73/285 (25%), Positives = 140/285 (49%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQN-----KEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIH----YSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +IYD  IVGGG  G+ A        ++ IL+E KS LGGQ   +     + ++P F E I   ++  K   Q      K  +   I ++ D  NI    ++         N +   AK +I+ +G      R L++   P +  F++    Y    +  ++++  I V+GGGDSA + A +    +  + V +IHRR++ R+   + D +  N  ++ +  +++   + +    +L ++  +T +   L  D V +  G I +   ++ L +++ E G   ++ N +T++  I+A GD
  S:     6 KIYDCIIVGGGPAGLTAGLYCARAKMDVILLE-KSTLGGQ---IAITDLVENYPGFPEGISGKELTSKFKAQAERFGLKIHRQGVISVENDNDNIKILKLD---------NGSELRAKTVIITTGA---RMRTLDV---PGEKEFLNRGVSYCATCDGALFEDVPIAVVGGGDSATQEAIFLT--RFASKVYLIHRRDKLRAKPLLQDRVFSNPKIEFVPNKVVKAIQGSDFVNSLLLEDTKTGEHSILSVDGVFIFIGMIPATDIVKDLVELD-EYGYIKVNDNMETSVSGIFAAGD 281
>gi|169190765|ref|ZP_02850673.1| thioredoxin reductase [Paenibacillus sp. JDR-2] >gi|169002586|gb|EDS49468.1| thioredoxin reductase [Paenibacillus sp. JDR-2] (309 aa)
Score = 176, Expect = 4.8e-11, Identities = 79/284 (27%), Positives = 140/284 (49%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPID-SPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKN-NILQKLNYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKY--VIDLNQKTNIKNIYAIGD 290
           +Y   I+G G  G+ A+      N+  ++IE     GGQ   L     + +FP F E I   D++  +    K+ +    +  T  +N     ++E+   L    K  F  + II+++G  +   R L I  E  +    +      +   ++NKKI+V+GGGDSA+E AN+    +   NV +++RR+E R+S  M D    N  I   LN   ++   +   +T   +++  T +++T+  D V +  G   +P N + LN QI+ ++  Y  V   + +TN+  ++A GD
  S:     1 MYKSIIIGTGPAGLTAAIYLARANMKPLVIEGPE-PGGQ---LTTTTEVENFPGFPEGIMGPDLMANM---RKQAERFGAEFMTGWVNNV--DMSERPFKLQVEGKGEFVGETIIISTGASA---RWLGIPGEKDNIGRGVSTCATCDGFFFRNKKIVVIGGGDSAMEEANFLT--RFATNVELVNRRDELRASKIMQDRARGNEKISWSLNRTPLEVEANGMGVTGLKVRNNATGEDETIQTDGVFIAIGH--TP-NTKFLNGQIDTDEHGYIKVKPGSSETNVPGVFACGD 276
>gi|167463090|ref|ZP_02328179.1| thioredoxin reductase [Paenibacillus larvae subsp. larvae BRL-230010] (317 aa)
Score = 176, Expect = 4.8e-11, Identities = 84/316 (26%), Positives = 144/316 (45%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPID-SPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKN-NILQKLN---YEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI--DLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK-----NKKDW 322
           +Y   IVG G  G+ A+      N+N ++IE     GGQ   L     + +FP F + I   +++  +    K+ +    +  T  +N     ++E+   L          + +I+++G  +   + L I NE  +    +      +   ++ KKI+V+GGGDSA+E AN+    +    V ++HRRNE R+S  M D   +N  I+  LN    E++  +     L +K+ +T +E+ L  D + V  G   +P    L  QI  +   Y++      +TN   ++A GD      K    ITA      A     K     + +DW
  S:     1 MYKSIIVGTGPAGLTAAIYLARANMNLLVIEGPE-PGGQ---LTTTTEVENFPGFPQGIMGPELMDSM---RKQAERFGAEFRTGWVNSV--NLSERPFKLSVEGLGELITETLIISTGASA---KYLGILNEKENVGRGVSTCATCDGFFFRGKKIIVVGGGDSAMEEANFLT--RFATEVRVVHRRNELRASKIMQDRAKENEKIVWSLNRTPLEVVAGDRGVTGLKVKNNQTGEEELLETDGIFVAIGH--TPNTKFLGGQIETDDHGYIVVKPGTTETNTPGVFACGDVQD--TKYRQAITAAGSGCMAAMDCEKYLEGHSTQDW 311
>gi|150391327|ref|YP_001321376.1| thioredoxin reductase [Alkaliphilus metalliredigens QYMF] >gi|149951189|gb|ABR49717.1| thioredoxin reductase [Alkaliphilus metalliredigens QYMF] (315 aa)
Score = 176, Expect = 5.0e-11, Identities = 78/312 (25%), Positives = 154/312 (49%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFP-CFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSK--------NNILQKLN----YEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI-DLNQKTNIKNIYAIGDATHFYCKPNT---IITACAE----AVRALWHISKN 318
           +YDV I+GGG  G+ A   +    + ++++EK+   GGQ   +   + + ++P    +     ++ ++++Q  E   + I+ DT       +   E ++ +    KN+++AK II+A G    +PR L +  E  +    + Y    + + + + ++ V+GGGDSAVE A +    K    V I+HRR E R++  + +   K        N  ++++      E + F         +H   E++ T    ++ V Y     P        ++ ++  Y++ D N KTN+  ++  GD     C+  +   ++TA ++    AV+A  +I  N
  S:     4 VYDVVIIGGGPAGLSAGLYAARGKMTTLILEKEK-TGGQ---IATTEEVANYPGSITDATGPALVARMVEQCNE-FGAKIEKDT-----IKEVKLEGKIKILVGEKNTYHAKSIIVAPGA---SPRLLGVPGEKELTGKGVSYCATCDGDFFTDFEVFVIGGGDSAVEEAMFIT--KFARKVTIVHRREELRAAKSIQEKAFKHPKIDFIWNTTIKEIKGDGLVESVVFENLKTGEITEHHADEEDGTFGI-FMFVGY----IPQTDLFKGMLDMDRTGYIVTDDNMKTNVPGVFGAGD-----CRVKSLRQVVTAVSDGAIAAVQAEKYIENN 312
>gi|114567977|ref|YP_755131.1| thioredoxin-disulfide reductase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338912|gb|ABI69760.1| thioredoxin reductase (NADPH) [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (302 aa)
Score = 175, Expect = 5.6e-11, Identities = 76/305 (24%), Positives = 149/305 (48%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCF-FEIKSSDVIKKLIQQNKEQKNSNIQLD--TDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQ-KLNYEI--IDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDL-NQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           +YDV I+G G  G+ A+  ++   L ++++E  S  GG    +     I ++P F F +  +D+++    Q  E+  + ++++   D+ N +        +    TN   +  K +I+A G      R+LE++ E       + Y    +   ++   + V+GGGDSAV+ A Y     I + V +IHRR  +R++   ++ +  N  ++ KLN  +  ++ +   K+L +K+ +T +E+ L  + + V  G ++     EL   + + +  Y++   N  ++I  I+A GD      K   + TA  E   A
  S:     1 MYDVVIIGSGPAGLTAAIYTSRAKLKTLVLE-SSVFGGNAALI---DHIDNYPGFPFGVSGADLMENFRLQ-AERFGAELRMEEVMDLKNAS------GAIKTVVTNMQEYQTKSVIIAMGA---KRRELEVDGEKEYLGRGVSYCATCDGAFFQGTTVAVVGGGDSAVKEALYLT--GIASKVYLIHRREGFRANQTALEKMMNNEKIELKLNRVVKRVEGDALMKSLLLKNLKTGEEERLEVEGLFVSIGLVA---RTELFGGMLESREGYIVTSDNMMSSIPGIFAAGDVRA--KKERQVATAVGEGALA 292
>gi|196235318|ref|ZP_03134121.1| thioredoxin reductase [Thermus aquaticus Y51MC23] >gi|196220580|gb|EDY15196.1| thioredoxin reductase [Thermus aquaticus Y51MC23] (325 aa)
Score = 174, Expect = 7.1e-11, Identities = 74/283 (26%), Positives = 138/283 (48%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIID--FNESNKT-LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQK--TNIKNIYAIGD 290
           YDV I+GGG  G+ A   +    L ++++E K   GGQ   +   + + ++P F E  S   +   + +  E+  + I +D ++  +       +E FL    + ++ A+ +I+A+G    NPRKL++   P +  F    +      +   Y++K+++V+GGGD+AVE   +    K    V ++HRR+E R++        +N  +  L   ++     E   T + +K+ +T +E   P D V V  G    P N   L  + + +    I +  +  T++  I+A GD
  S:    18 YDVVIIGGGPAGLTAGIYAGRGGLKTVIVE-KGLPGGQ---IAQTEEVENYPGFPEGISGPELAGRMAKQAEKFGARIVMD-EVQGLE----RTEEGFLVRGFEGNYPARVVIIATGA---NPRKLQV---PGEEKFYGRGVSTCATCDAFFYRDKEVVVVGGGDAAVEEGLFLT--KFARKVTLVHRRDELRANKMAQARAFQNPKMHFLFSHVVTEILGEEQVTGVRLKNLKTGEEYVYPTDGVFVFIGH--EP-NTGFLRGVVELRPDGYIAVRDEVFTSVPGIFAAGD 289
>gi|134045821|ref|YP_001097307.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus maripaludis C5] >gi|132663446|gb|ABO35092.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methanococcus maripaludis C5] (301 aa)
Score = 174, Expect = 7.7e-11, Identities = 78/286 (27%), Positives = 141/286 (49%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTIN-EQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRS-SSFMIDCLS-KNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ--INKEKGKYV-IDLNQKTNIKNIYAIGDAT 292
           +YD+ I+GGG  G+ A   +    L+++ +EK++  GG+  E      + ++P F  IK  ++ +K  +  K       Q +  I++   + I+   + F   T    + AK I++ASG+     +K  +N +      + Y +  +   + NK+++VLG G SA+  A Y +++ I   + I+  R E ++    M D ++  NN+   LN E I+     K   +K     K++ +  D + + +G +    N E L +  I   K K++ ID N KT+   IYA GD T
  S:     2 VYDLIIIGGGPAGLTAGIYAMRAKLSTLCLEKENE-GGKIAEA---GVVENYPGFESIKGFELAQKFSEHAK-------QFELPIIHEEVEKIDTSSKPFKVITKNEQYEAKSIVIASGS---RYKKPGLNEDDFMGKGVCYCVMCDAFFFLNKEVIVLGRGTSAI-MAAYNLKD-IAKKITIVTDRPELKAVERIMEDRMNLMNNLEIVLNAEPIEIVGEEKAEGVKVSINGKKEIISADGIFISFGYVP---NTEFLEKSDIKLNKRKFIEIDKNCKTSADGIYACGDVT 274
>gi|146097055|ref|XP_001468025.1| dihydrolipoamide dehydrogenase [Leishmania infantum JPCM5] >gi|44804791|gb|AAS47708.1| dihydrolipoamide dehydrogenase [Leishmania major] >gi|134072391|emb|CAM71099.1| dihydrolipoamide dehydrogenase, putative [Leishmania infantum] (476 aa)
Score = 174, Expect = 8.0e-11, Identities = 77/289 (26%), Positives = 147/289 (50%)
  Q:     5 LRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMEL--YPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNIT----WQTINEQELFLFETNKNSFYAKKIILASGNGSF-NPRKLEIN-------------------NEPIDSPFIHY----------SLNLETEIYKNKKILVLGGGDSAVE----WANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESNKTLTIKHKETE-KEQTLPFDYVLVQYGQI--SSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATH 293
           L  YDV ++GGG GG  A+  +    L +  IEK+  LGG  + +   P+K +      +    ++       Q   +   N+ +D   +        + +     +LF+ NK ++Y        G GSF NP  +++                    +EP + PF+ +          +L+L+   +  KK++V+GGG   +E    WA    E  +    +      +   S  + D L K+  ++ + N +++    +  ++TI+ ++ + K QTL  D +L   G+   ++ +N E +N +  E+G   I+ + +TN+ N+YAIGD  +
  S:     9 LASYDVTVIGGGPGGYVAAIKAAQLGLKTACIEKRGALGGTCLNVGCIPSKALLHATHLYHDAHAN-----FAQYGLRGGENVTMDVSAMQAQKAKGVKALTGGVEYLFKKNKVTYY-------KGEGSFVNPNTIKVKGLDGKDETLESKKTIVATGSEPTELPFLPFDEKVVMSSTGALDLD---HVPKKMIVVGGGVIGLELGSVWARLGAEVTVVEFASRCAANTDADVSKALTDALVKHEKIKIMTNTKVVSGTNNGSSVTIEVEDKDGKHQTLEADALLCSVGRRPHTTGLNAEAIN-LQMERGFICINDHFETNVPNVYAIGDVVN 325
>gi|11065685|emb|CAC14297.1| thioredoxin reductase [Clostridium sticklandii] (314 aa)
Score = 174, Expect = 8.4e-11, Identities = 74/306 (24%), Positives = 139/306 (45%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFP-CFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHK--------ETEKEQTLPFDYVLVQYGQISSPINIELLNQIN--------KEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           +IYD+ I+G G  G+ A        +++++IEK    GGQ   +   + + ++P    +     +I ++ +Q  E     I+      + T       ++ + +  K  + AK +I+A+G    +P+KL+   E  +    + Y    + + +++ ++ V+GGGDSAVE A Y    K  + V I+HRR+  R++  + D    N          IDF   +    IK          E  K   L   +   ++G     +    + Q +         + G +V + N +TNI  ++A GD      +   ++TA A+   A
  S:     3 KIYDLVIIGAGPAGLSAGLYGARGKMSTLIIEKDK-TGGQ---IVTTEEVANYPGSIHDASGPSLIARMAEQADEFGTERIKDSIVDFDFT------GKIKILKGTKAEYQAKAVIVATGA---SPKKLDCPGEKELTGKGVSYCATCDADFFQDMEVFVVGGGDSAVEEAMYLT--KFASKVTIVHRRDSLRAAKSIQDKAFAN--------PKIDFKWDSVIKEIKGDGIVESVVFENTKTGELSEHFADEEFGTFGIFVFTGYIPQTDIFKDKVDMNQSGYFVTNQNMETNIPGVFAAGDCREKVLR--QVVTATADGAIA 301
>gi|157874347|ref|XP_001685657.1| dihydrolipoamide dehydrogenase, putative [Leishmania major] >gi|68128729|emb|CAJ08862.1| dihydrolipoamide dehydrogenase, putative [Leishmania major] (476 aa)
Score = 174, Expect = 8.5e-11, Identities = 77/289 (26%), Positives = 147/289 (50%)
  Q:     5 LRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMEL--YPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNIT----WQTINEQELFLFETNKNSFYAKKIILASGNGSF-NPRKLEIN-------------------NEPIDSPFIHY----------SLNLETEIYKNKKILVLGGGDSAVE----WANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESNKTLTIKHKETE-KEQTLPFDYVLVQYGQI--SSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATH 293
           L  YDV ++GGG GG  A+  +    L +  IEK+  LGG  + +   P+K +      +    ++       Q   +   N+ +D   +        + +     +LF+ NK ++Y        G GSF NP  +++                    +EP + PF+ +          +L+L+   +  KK++V+GGG   +E    WA    E  +    +      +   S  + D L K+  ++ + N +++    +  ++TI+ ++ + K QTL  D +L   G+   ++ +N E +N +  E+G   I+ + +TN+ N+YAIGD  +
  S:     9 LASYDVTVIGGGPGGYVAAIKAAQLGLKTACIEKRGALGGTCLNVGCIPSKALLHATHLYHDAHAN-----FAQYGLRGGENVTMDVSAMQAQKGKGVKALTGGVEYLFKKNKVTYY-------KGEGSFVNPNTIKVKGLDGKEETLESKKTIVATGSEPTELPFLPFDEKVVMSSTGALDLD---HVPKKMIVVGGGVIGLELGSVWARLGAEVTVVEFASRCAATTDADVSKALTDALVKHEKMKIMTNTKVVSGTNNGSSVTIEVEDKDGKHQTLEADALLCSVGRRPHTTGLNAEAIN-LQMERGFICINDHFETNVPNVYAIGDVVN 325
>gi|26554382|ref|NP_758316.1| thioredoxin reductase [Mycoplasma penetrans HF-2] >gi|26454392|dbj|BAC44720.1| thioredoxin reductase [Mycoplasma penetrans HF-2] (320 aa)
Score = 173, Expect = 9.0e-11, Identities = 64/286 (22%), Positives = 134/286 (46%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKE-------QKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATH 293
           +DV IVG G  G+ A+      NL     EK++  G    ++    F+ ++P F  +   D+     +Q  E        + + I+   DI ++            F  +  + YAK +I+A+G      +K+ + NE       + Y    +  +YK+K + V+GGG++A+E + Y  +  I + V +IHRR  +R+ + +++ +  N     +L  + +E +   ++   + IK+    +   +  D +    G + +   +E L   +   G  +++   +T+I  +++ GD  +
  S:    14 FDVLIVGAGPAGLTAALYCKRANLKVAFYEKETPGG----KVVKTSFVENYPGFTSVSGPDLAMNFFKQVSELGVKFIFGEVTKIRKVGDIFHV------------FSADGQARYAKAVIIATG---MTEKKIGVKNEAEYYGRGVSYCAICDAALYKDKPVAVIGGGNTALEESLYLAD--IVSKVYLIHRRQGFRADAMVVEKVKANKKIELVLDAIPHEFLGDGKTINGIIIKNVNDNRLLKINVDCIFPFIGFVPTNKMVEGLEITDPNTGFILVNEKMETSIPGLFSTGDVNN 290
>gi|153853545|ref|ZP_01994925.1| hypothetical protein DORLON_00914 [Dorea longicatena DSM 13814] >gi|149753700|gb|EDM63631.1| hypothetical protein DORLON_00914 [Dorea longicatena DSM 13814] (313 aa)
Score = 173, Expect = 9.1e-11, Identities = 83/316 (26%), Positives = 151/316 (47%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQ-----PMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESN---KTLTIKHKET---EKEQTLPFDYVLVQYGQISSPINIELL-NQINKEKGKYV-IDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISKNKKDW 322
           IYDV I+G G  G+ A   +    L++++IEK    GGQ      +E YP + +       E ++   + + + +  EQ  +    DT    IT   +N  E+ +    K+++ AK II+A+G  +   R +    E       I Y    +   + + ++ V GGGD+AVE A Y    K    V IIHRR+E R++  + +    N  +  L   +++    +   +T+T+K+ +T    K +  P D +   +G I    N  +  +++  +   Y+  D +  TN+  +YA GD      +   ++TA A+   A   + ++  D+
  S:     4 IYDVIILGAGPAGLSAGLYAGRSRLDTLIIEKGQ-AGGQIINTDEIENYPGQIV-------EGETGVSLVRRMYEQTEQFGAEHVRDT----ITDVELN-GEIKVLTGEKDTYQAKNIIIATGAYA---RPIGCKGEQEYKGRGISYCATCDANFFTDLEVYVAGGGDAAVEEALYLT--KFARKVTIIHRRDELRAAKSIQEKAFANPKIAFLWDSVVEEVSGDGLLQTMTVKNIKTGEFTKIEADPKDGLFGLFGFIGMIPNTGVFADKVETDDKGYIKTDEDMHTNVPGVYAAGDVRVKSLR--QVVTAVADGAIAAVQVERSISDY 313
>gi|83854805|ref|ZP_00948335.1| thioredoxin-disulfide reductase [Sulfitobacter sp. NAS-14.1] >gi|83842648|gb|EAP81815.1| thioredoxin-disulfide reductase [Sulfitobacter sp. NAS-14.1] (334 aa)
Score = 173, Expect = 9.7e-11, Identities = 73/281 (25%), Positives = 133/281 (47%)
  Q:    12 IVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF-IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKT------LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDL--NQKTNIKNIYAIGDAT 292
           I+G G  G  A   ++   LN IL++     GGQ   L     + ++P   E++  D+   +I+     K    ++  DI  IT   ++ +       +  ++ A  +ILA+G  +   + L +  E     F +      +   Y+N++I+V+GGG++AVE A +       + V +IHRR+E R+   +ID L KN  ++ L +  +D             + +KH ET +   +P   V V  G   +P N  + + +    G YV+    + +T++  ++A GD T
  S:    11 IIGSGPAGYTAGVYASRAMLNPILVQGIE-PGGQ---LTTTTEVENWPGDSEVQGPDL---MIRMQDHAKTMGTEIIGDI--ITDLDLSSRPFHAKGDSGTTYVADAVILATGARA---KWLGLETEEKFKGFGVSACATCDGFFYRNQEIVVIGGGNTAVEEALFLT--NFASKVTLIHRRDELRAEKILIDRLMKNPKIEPLWFHQLDEVYGTDAPLGVEGVKVKHVETGEITDIPCKGVFVAIGH--APANELVKDTLETHMGGYVVTKPDSTETSVPGVFAAGDLT 284
>gi|114770204|ref|ZP_01447742.1| thioredoxin-disulfide reductase [alpha proteobacterium HTCC2255] >gi|114549041|gb|EAU51924.1| thioredoxin-disulfide reductase [alpha proteobacterium HTCC2255] (313 aa)
Score = 173, Expect = 9.8e-11, Identities = 74/292 (25%), Positives = 141/292 (48%)
  Q:     4 DLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF-IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY-EIIDFNESNKTL-----TIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDL--NQKTNIKNIYAIGDAT-HFY 295
           D R   + I+G G  G  A+  ++   LN +L++     GGQ   L     + ++P   E++  D+   +I+     K    ++  DI  I+   ++++       +  ++    +ILA+G  +   + L +  E     F +      +   Y+ ++I+V+GGG++AVE A +       + V +IHRR+E+R    + D + KN  ++ L + E+++   ++  L      +KH +T +   LP   V V  G   +P N  + +Q+    G YV+    +  T+I  ++A GD T H Y
  S:     3 DTRHTKLLIIGSGPAGYTAAVYASRAMLNPVLVQGIE-PGGQ---LTTTTEVENWPGDTEVQGPDL---MIRMESHAKAMGTEIIGDI--ISDLDLSKRPFTAKGDSGTTYTCDAVILATGARA---KWLGLETEEKFKGFGVSACATCDGFFYRGQEIVVIGGGNTAVEEALFLT--NFASKVTLIHRRDEFRCEKILEDRMMKNEKIEPLYFHELVEVTGTDMPLGVEGIKVKHTKTGEITELPCKGVFVAIGH--APANELVKDQLETHMGGYVVTKPDSTSTSIPGVFAAGDLTDHIY 288
>gi|111226205|ref|YP_716999.1| thioredoxin reductase, FAD/NAD(P)-binding [Frankia alni ACN14a] >gi|111153737|emb|CAJ65495.1| thioredoxin reductase, FAD/NAD(P)-binding [Frankia alni ACN14a] (326 aa)
Score = 173, Expect = 1.1e-10, Identities = 75/287 (26%), Positives = 135/287 (47%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQT--LPFDYVLVQYGQISSPINIELLNQINKEKGKY--VIDLNQKTNIKNIYAIGDAT-HFY 295
           DV IVG G  G  A+  +   NL  ++ E     GG  M       + +FP F E ++  ++++KL QQ +      +  D   L++T    N +   +      +F A+ +I+A+G+     RKL + +E  +    +      +   +++  I V+GGGDSA+E A +    +   +V +IHRR++ R+S+ M +   S + I  + N ++ +    +K   ++ ++T   +T  L    + V  G    P    L  Q+  +   Y  V     KTN+  ++A GD   H Y
  S:     3 DVIIVGSGPAGYTAAIYTARANLRPLVFEGAVAAGGALMN---TTEVENFPGFPEGVQGPELMEKLRQQAERFGAELVADDVTELDLT---ANPK---VVRVEDQTFLARTVIVATGSAY---RKLGVEHEERLLGRGVSACATCDGFFFRDHDIAVVGGGDSAMEEATFLT--RFARSVTLIHRRDKLRASAIMQERAFSNDKIRFRWNADVAEILGEDKLTGVRLRDTVTGETDELEVTGLFVAIGH--EPRTELLRGQLELDDAGYVKVAHPTTKTNLDGVFACGDVVDHTY 281
>gi|58699669|ref|ZP_00374345.1| Pyridine nucleotide-disulphide oxidoreductase, putative [Wolbachia endosymbiont of Drosophila ananassae] >gi|58533815|gb|EAL58138.1| Pyridine nucleotide-disulphide oxidoreductase, putative [Wolbachia endosymbiont of Drosophila ananassae] (236 aa)
Score = 172, Expect = 1.3e-10, Identities = 65/209 (31%), Positives = 113/209 (54%)
  Q:    43 GGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNS-FYAKKIILASGNGSFNPRK------LEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVE-EKITNNVAIIHRRNEYRSSSFMIDCL----SKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYG 251
           GGQ   LYP K IYD P +  I +  +I++L++Q    K     L   +  I   + NE E F   T+  +    K +I+A+GNG F P +      LE  N+      + YS+N  ++ +++K I++ GGGDSA +W    VE  K+   + +IHRR E+R +    + L    S   I   + Y++ +    N    T+ +K+  +++++ +  D++L  +G
  S:     9 GGQCTALYPEKPIYDIPGYPVITAQKLIEQLMEQASPFK-PIYHLSQKVEKI---SNNEGENFTIITSIGTEVKCKAVIVAAGNGMFEPNRPPLSGILEYENKS-----VFYSVNKISD-FQDKTIVIAGGGDSAADWT---VELSKVAKKIYVIHRRKEFRCTPETRNKLESLESDGKIELVVPYQLHELAGGNGQLSTVIVKNIASKEDKEISADFLLPFFG 219
>gi|169188591|ref|ZP_02848653.1| thioredoxin reductase [Paenibacillus sp. JDR-2] >gi|169004585|gb|EDS51442.1| thioredoxin reductase [Paenibacillus sp. JDR-2] (308 aa)
Score = 172, Expect = 1.3e-10, Identities = 70/283 (24%), Positives = 132/283 (46%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPM-ELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFN---PRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKY--VIDLNQKTNIKNIYAIGD 290
           +   I+G G  G+ A+      NL  ++IE     G QP  +L     + +FP F +  +   +   +++  E+  + IQ       +T   ++++   L+        A  +IL++G  +     P ++E   + + +         +   ++NKKI+V+GGGD+A+E A +    +  + V ++HRR E R+S  M D   +N      L +   E+I   +    L +++  T +E+ L  D + +  G    P    L  QI  ++  Y  V+    +TN+  I+A GD
  S:     3 HQTVIIGTGPAGLTAAIYLARANLFPLIIE-----GSQPGGQLTTTTEVENFPGFPDGITGPELMDNMRKQAERFGARIQSGF----VTRVDVSKRPFTLYLEGGTEITADAVILSTGASAKMVGIPGEVENIGQGVST-----CATCDGFFFRNKKIIVIGGGDTAMEEAQFLT--RFASEVRLVHRREELRASKIMQDRARRNEKISWSLNETPLEVISGGKGVTGLKVRNNATGEEEVLETDGIFLAIGH--RPNTGFLGGQIQTDEHGYIEVVPGTSRTNVPGIFACGD 277
>gi|58337001|ref|YP_193586.1| thioredoxin reductase [Lactobacillus acidophilus NCFM] >gi|58254318|gb|AAV42555.1| thioredoxin reductase [Lactobacillus acidophilus NCFM] (308 aa)
Score = 172, Expect = 1.3e-10, Identities = 73/283 (25%), Positives = 139/283 (49%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKK----LIQQNKEQKNSNIQ---LDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDY--VLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           YDV ++G G GG+ A+  +   NLN +++++  Y GGQ   +     I ++P F E+K  ++ +K    L++   + K  N+Q   LD D          E+   + +T+   + A  +I+A+G    + R L +   E      + Y    +   +K++ ++V+GGGDSA+E   Y    ++  +V +IHRR++ R+   +      N     I      EI+   + N+   +K+ + E  +T       V +  G +      + L  +N E+G    + + +T +  I+A+GD
  S:     5 YDVIVIGAGPGGMTAALYATRANLNVLVLDRGPY-GGQ---MNNTDAIDNYPGFTEVKGPELSQKMYDTLMKFEPDYKYGNVQSVELDGD----------EK---VIKTDDEEYRAPVLIIATGA---DHRHLNVPGEEEYSGRGVSYCAVCDAAFFKDEDVVVVGGGDSAIEEGIYL--SQMAKSVTVIHRRDQLRAQPTLQKRAFANEKMKFIWNAQTEEIL--GDGNRVTGVKYLDKENGETKEVSAAGVFIYVGVLPQTEPFKKLGILN-EQGWIPTNEHMETKVSGIFALGD 276
>gi|154174477|ref|YP_001407512.1| thioredoxin-disulfide reductase [Campylobacter curvus 525.92] >gi|112803864|gb|EAU01208.1| thioredoxin-disulfide reductase [Campylobacter curvus 525.92] (312 aa)
Score = 172, Expect = 1.4e-10, Identities = 78/284 (27%), Positives = 135/284 (47%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQ----------PMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELF--LFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF---IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKT----LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINK--EKGKYVIDLNQKTNIKNIYAIGD 290
           + D+AI+GGG  G+ A   +    L ++++ +K   GGQ          P +  P +  +DF   +  + S                +  L     NI     N  + F  L E  K S  AK +I+A+G+    PR+     E  D  F   +      +   YKNK++ VLGGGD+A+E A Y     I + V +IHRR E+R++   +    +N  ++ +    I     +K+    L +  KE E++  +P  +  V     +  + +E  + I K  E G+  +DL  ++++  ++A GD
  S:     1 MLDLAIIGGGPAGLSAGLYATRGGLKNVVMFEKGEPGGQITSSSEIENYPGQKSPGESGFDFMSTWWAQCS----------------HFGLVHKWANIVGVRQNADKSFEILLEGGK-SEQAKAVIVATGS---VPRRAGFKGE--DEFFGRGVSTCATCDGFFYKNKEVAVLGGGDTAIEEAIYLA--NIASKVYVIHRREEFRAAPTTVQKARQNEKIEFITSATIKEAYGDKSGLNGLILNTKEGERDLKVPGVFTFVGLNVNNEILKLEDGSFICKMSEGGQVDVDLKMQSSVPGLFAAGD 281
>gi|168186591|ref|ZP_02621226.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium botulinum C str. Eklund] >gi|169295462|gb|EDS77595.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium botulinum C str. Eklund] (311 aa)
Score = 172, Expect = 1.4e-10, Identities = 75/290 (25%), Positives = 144/290 (49%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKN---NILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEK-GKYVIDLNQKTNIKNIYAIGD 290
           M+++ +  D+ I+G G  G+ AS  ++   L+++++E +  +GGQ  + Y    I ++P F  I   D+ KK+ +Q      S   +D     I+ +  N +++   ET  + + AK +I+ASG      R+L I  E       IHY    +  +Y  K I V+GGG+SA+    +    K    + I+H+ + +++   + D + +N   N++     +    N +   ++I++ +T++   LP + + V  G I  P      + I  +K G  + D   KTN++ ++A GD
  S:     1 MDKENKNIDILIIGAGPAGLTASIYTSRLKLSTLILEDE-IIGGQIRDAYT---IENYPGFTNISGVDLTKKMEEQ---ASASGAIIDEFDKIISIKLTNSEKII--ETENHIYNAKVVIIASGAKR---RELPIPEEKKFHGKGIHYCELCDGHMYDGKHIAVVGGGNSALLAVKFL--SKYAEKITIVHQLDYFQAEQKIQDEVFQNPKVNVIWNSEIKHALGNNNISKISIENVKTKETTKLPINGIFVYIGLI--PRTELFKDFITLDKFGNILADETTKTNVEGVFAAGD 279
>gi|163782898|ref|ZP_02177894.1| Thioredoxin reductase [Hydrogenivirga sp. 128-5-R1-1] >gi|159882019|gb|EDP75527.1| Thioredoxin reductase [Hydrogenivirga sp. 128-5-R1-1] (311 aa)
Score = 172, Expect = 1.4e-10, Identities = 73/281 (25%), Positives = 142/281 (50%)
  Q:    10 VAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY-------EIIDFNESNKT-LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYV-IDLNQKTNIKNIYAIGD 290
           V I+GG   G+ A+  +    LN +L     + GGQ M       + ++P F E I+  ++++K  QQ  E+  + I  + +++ + +++      F        + A+ +I+A+G     PR L + +E  +    + Y    +   YK++ ++V+GGGDSA+E A +        +V +IHRR++ R+S  M +   +N    K+N+       +I D NE   T + IK+ +T++   +  D V +  G    P     + Q+  +   Y+ +  + KT+++ ++A GD
  S:     7 VIIIGGACAGLTAAIYTARAKLNPLLFAGHMF-GGQLMM---TSEVENYPGFPEGIQGPELMEKFRQQ-AEKFGTRIVYE-NVIKVDFKS----RPFRVWAGGEEYAAESVIVATGA---RPRMLGLESEAMLMGKGVSYCAVCDGAFYKDRDVVVVGGGDSAMEEALHLTHH--AKSVTVIHRRDKLRASKIMQERAFEN---PKINFVWDSVVEDIYDVNEGRVTGVLIKNVKTKELSEIRCDGVFIAIGH--EPNTDVFVGQLTLDSHGYIKVHDHVKTSVEGVFAAGD 278
>gi|118443670|ref|YP_878447.1| thioredoxin reductase [Clostridium novyi NT] >gi|118134126|gb|ABK61170.1| thioredoxin reductase [Clostridium novyi NT] (311 aa)
Score = 172, Expect = 1.4e-10, Identities = 81/290 (27%), Positives = 142/290 (48%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKN---NIL--QKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQIN-KEKGKYVIDLNQKTNIKNIYAIGD 290
           M ++ +  D+ I+G G  G+ A+  ++   L ++++E +  +GGQ  + Y    I ++P F  I   D+ KK+ +Q         + D  I++I      +      ET  + + AK +I+ASG      R+L I  E       IHY    +  +Y  K I V+GGG+SA+   N+    K    + I+H+ + +++   + D + KN   NIL   ++ + I D + S   ++I++ +T++E  L  D + V  G I  P      + I   E G  + D   KTNI  ++A GD
  S:     1 MEKENKNIDILIIGAGPAGLTAAIYTSRLKLKTLVLEDE-IMGGQIRDAYT---IENYPGFINISGVDLTKKMEEQAIASGAIIDEFDK-IISIKLSNSTKT----VETEDHIYNAKVVIIASGAKR---RELPIPEEKKFHGKGIHYCELCDGHMYDGKHIAVVGGGNSALLAVNFL--SKYAEKITIVHQLDYFQAEKKVQDEVFKNPKVNILWNSEIKHAIGDNHISK--ISIENIKTKQETELSVDGIFVYIGFI--PRTDLFKDYITLDEFGNILADETTKTNIDGVFAAGD 279
>gi|83941327|ref|ZP_00953789.1| thioredoxin-disulfide reductase [Sulfitobacter sp. EE-36] >gi|83847147|gb|EAP85022.1| thioredoxin-disulfide reductase [Sulfitobacter sp. EE-36] (334 aa)
Score = 171, Expect = 1.5e-10, Identities = 73/281 (25%), Positives = 133/281 (47%)
  Q:    12 IVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF-IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKT------LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDL--NQKTNIKNIYAIGDAT 292
           I+G G  G  A   ++   LN IL++     GGQ   L     + ++P   E++  D+   +I+     K    ++  DI  IT   ++ +       +  ++ A  +ILA+G  +   + L +  E     F +      +   Y+N++I+V+GGG++AVE A +       + V +IHRR+E R+   +ID L KN  ++ L +  +D             + +KH ET +   +P   V V  G   +P N  + + +    G YV+    + +T++  ++A GD T
  S:    11 IIGSGPAGYTAGVYASRAMLNPILVQGIE-PGGQ---LTTTTEVENWPGDSEVQGPDL---MIRMQDHAKAMGTEIIGDI--ITDLDLSSRPFHAKGDSGTTYVADAVILATGARA---KWLGLETEEKFKGFGVSACATCDGFFYRNQEIVVIGGGNTAVEEALFLT--NFASKVTLIHRRDELRAEKILIDRLMKNPKIEPLWFHQLDEVYGTDAPLGVEGVKVKHVETGEITDIPCKGVFVAIGH--APANELVKDTLETHMGGYVVTKPDSTETSVPGVFAAGDLT 284
>gi|29375905|ref|NP_815059.1| thioredoxin reductase [Enterococcus faecalis V583] >gi|29343367|gb|AAO81129.1| thioredoxin reductase [Enterococcus faecalis V583] (304 aa)
Score = 171, Expect = 1.5e-10, Identities = 70/284 (24%), Positives = 130/284 (45%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEIN-NEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT--IKHKETEKEQTLPFD----YVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +YDV I+G G  G+ A+  ++  NL+ ++IE+ +  GGQ   +     + ++P F  I   ++  K+ +  ++    N         I     +         +  S+ AK +I+A+G      RKL +   E      + Y    +   +KNK+++V+GGGDSAVE A Y  +    + V I+HRR+E R+   + D    N  +  +   +++    N+ +   +K +  + ++    +    ++ V    ++ P        I  E G    D   +T I  +YAIGD
  S:     1 MYDVIIIGAGPAGMTAALYASRSNLSVLMIERGA-PGGQ---MNNTAEVENYPGFDSIMGPELAYKMYENVEKFGTENA------YGIVMGIEDHGSYKEVICDDKSYEAKAVIIATG---CEHRKLGVKGEEEFAGRGVSYCAVCDGAFFKNKRLVVVGGGDSAVEEAIYLTQ--FASEVVIVHRRDELRAQKIIQDRAFANEKISFVWDTVVEEIVGNEMVVTGVKARNVKTDEVSEIEANGVFIYVGLDPLTEPFKKA---GITNEAGWIETDQEMRTKIPGVYAIGD 273
>gi|188585109|ref|YP_001916654.1| thioredoxin reductase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349796|gb|ACB84066.1| thioredoxin reductase [Natranaerobius thermophilus JW/NM-WN-LF] (409 aa)
Score = 171, Expect = 1.6e-10, Identities = 67/305 (21%), Positives = 142/305 (46%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY------EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           ++DV I+GGG  G+ A   ++   L + ++EKK   GGQ    +    + ++P F E    D+ K L +  ++     ++ +   ++     ++     +       ++AK +I+A+G     PR L +  E       + Y    + + Y +++++V+G GD+AVE A Y         + ++H   +  ++  + +   +N    K++Y      E I  +E    + +K+ +T +   +  D V +  G I     IE   ++  E+G   ++   +T++  +Y+ GD    + +   ++TACA+   A
  S:     4 VFDVLIIGGGPAGLTAGIYASRSKLKTAILEKKRKPGGQMSTTWE---LENYPGFKEATGPDIAKSLSEHAEKFGCEFLKGEVKEID-----LHSNPKVVTSKKGEEYHAKSVIMATGA---EPRTLGLPGEHEFRGLGVGYCATCDADFYTDQEVIVIGSGDAAVEEAIYLTRFAKKVTIVVVHEEGKMDATKVIQERAFEN---PKIDYIWNSVVEEIKGDELVDRVVVKNIKTGETSEVKTDGVFIFVGTIPKTEFIEGQVELT-EQGYVKVNDQMETSVPGVYSAGDVNDKFLR--QVVTACADGAIA 298
>gi|120406996|ref|YP_956825.1| thioredoxin reductase [Mycobacterium vanbaalenii PYR-1] >gi|119959814|gb|ABM16819.1| thioredoxin reductase [Mycobacterium vanbaalenii PYR-1] (331 aa)
Score = 171, Expect = 1.6e-10, Identities = 76/311 (24%), Positives = 148/311 (47%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQK---NSNIQL-DTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF---IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLT---IKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQK--TNIKNIYAIGD-ATHFYCKPNTII-TACAEAVRA 311
           M     I+DV ++G G  G  A+  +    LN ++ E   + G     L     + ++P F   ++     +L+ + +EQ     +++++ D D +++T    +            +F A+ +ILA G  +   R L +  E  D+     +      +   ++++ I V+GGGDSA+E A +    +   +V +IHRR+E+R+S  M++    N  +  L    +   E +  +T   +++  T +E TLP   V V  G    P +  + +Q+  +   YV    +   T+++ ++A GD   H Y +  T   + CA ++ A
  S:     1 MTSSETIHDVIVIGSGPAGYTAAIYAARAQLNPLVFEGSQFGGA----LMTTTEVENYPGF---RNGITGPELMDEMREQALRFGADLRMEDVDAVDLTGPVKS------VTVGDETFRARAVILAMGAAA---RHLGVPGE--DTLLGMGVSTCATCDGFFFRDQDIAVVGGGDSAMEEATFLT--RFARSVTLIHRRDEFRASKIMLERAQANEKITFLTNTQVTAIEGDPKVTGIRLRNTATGEESTLPVTGVFVAVGH--DPRSELVRDQVEVDDAGYVKVQGRTTYTSVEGVFAAGDLVDHTYRQAITAAGSGCAASIDA 303
>gi|58039100|ref|YP_191064.1| thioredoxin reductase [Gluconobacter oxydans 621H] >gi|58001514|gb|AAW60408.1| Thioredoxin reductase [Gluconobacter oxydans 621H] (354 aa)
Score = 171, Expect = 1.7e-10, Identities = 84/300 (28%), Positives = 140/300 (46%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTD-ILNITWQTINEQE-LFLFETNK-NSFYAKKIILASGNGSFNPRKLEINNEPID-------SPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSS----SFMIDCLSKNNILQKLNYEIIDFNESN--------KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAEA 308
           DVAIVG G   +FA+       L+ +LI+    +GGQ   LYP K IYD P    I+   +I+ L QQ           D   +L    +T+  Q   F  +T + +   AK +I+A+G G+F P     N  P+D       +  + Y +    + +  K+++V GGGDSA++WA    E  +   V ++HRR+ +R +    S +   ++   I + + Y++   + ++         TL    +  E +  LPF      YG  +    I L           V     +++   I+AIGD   +  K   I+   +E 
  S:    25 DVAIVGAGPTALFAAFECGMLKLSCVLIDALDSVGGQCAALYPEKPIYDIPAHPAIEGGALIEALEQQIAP-------FDVPRLLGSRVETLEGQRGAFTLKTARGDVITAKAVIIAAGAGAFGP-----NRPPLDGLEAYERTGAVQYYVKKRAD-FTGKRVVVAGGGDSALDWALSLSE--VAAQVYLLHRRDRFRGAPETLSRIEQQIAAGKIEKVVPYQLHALHGTDGVLSTVEVTTLEGTSRHIEADALLPF------YGLSTDLGPIALWGLDTHRNTVPVTPATLESSTPGIFAIGDVATYPGKLKLILQGFSEG 325
>gi|15925362|ref|NP_372896.1| thioredoxin reductase [Staphylococcus aureus subsp. aureus Mu50] >gi|15927952|ref|NP_375485.1| hypothetical protein SA2162 [Staphylococcus aureus subsp. aureus N315] >gi|156980687|ref|YP_001442946.1| hypothetical protein SAHV_2356 [Staphylococcus aureus subsp. aureus Mu3] >gi|13702323|dbj|BAB43464.1| SA2162 [Staphylococcus aureus subsp. aureus N315] >gi|14248146|dbj|BAB58534.1| similar to thioredoxin reductase [Staphylococcus aureus subsp. aureus Mu50] >gi|156722822|dbj|BAF79239.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] (331 aa)
Score = 171, Expect = 1.7e-10, Identities = 73/292 (25%), Positives = 149/292 (51%)
  Q:    20 IFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFY-AKKIILASGNGSFNPRKLEINN-EPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNI----LQKLNYEIIDFNESN-KTLTIKHKETEKEQTLPFDYVLVQYG-QISSPINIELLNQINKEKGKYVIDL-NQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRA 311
           ++AS  +   +++  LI+ +S LGG+ M +YP K I+D          +++K  I+Q    K   + L+  +++I  +    +  F  ET     Y +K +I+A G G  NP++L++   E      +HY +      +K+K +L+ GGG++A++WA+     KI  +V +++R+ +      M   ++  N+      ++ Y + + +E++   + ++H E+    T+ FD V++ +G    + +  E  ++++      V    N  T+I  IYA GD  +   K + I +A ++   A
  S:     1 MYASFYAGLRDMSVRLIDVQSELGGK-MRIYPEKIIWDIGGIAPKPCHEILKDTIKQGLYFK-PEVHLNERVVDIRKKA---ERHFEVETEAGEIYTSKAVIIAIGAGIINPKQLDVKGVERYQLTNLHYVVQ-SYRRFKDKDVLISGGGNTALDWAHDIA--KIAKSVTVVYRKEDVSGHEAMKTLVTDLNVKLCPKTRIKYLVGNDDETHISEVVLEHVESGDRHTVKFDDVIISHGFDRCNTLLSETSSKLDMHDDCRVKGFGNTTTSIPGIYACGDIVYHDAKSHLIASAFSDGANA 293
>gi|116511757|ref|YP_808973.1| thioredoxin reductase [Lactococcus lactis subsp. cremoris SK11] >gi|116107411|gb|ABJ72551.1| Thioredoxin reductase [Lactococcus lactis subsp. cremoris SK11] (308 aa)
Score = 171, Expect = 1.7e-10, Identities = 78/283 (27%), Positives = 135/283 (47%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQ-----PMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSK----NNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ--INKEKGKYVIDLNQKTNIKNIYAIGD 290
           YDV I+G G  G+ A+  +    + ++L+E+    GGQ      +E YP       P    +K ++ ++ L  +N     ++I+   D   I              T  + F  K II+A+G    N RKLEI   E   +  + Y    +   ++N++ILV+GGGDSAVE A Y    +   +V I+HRR++ R+   +     K    N I   +  EI   ++  +++  K+ +T +     F  + +  G    P+  E ++   I    G  + D + +T+I  I+A+GD
  S:     6 YDVVIIGSGPAGMTAAMYTARSEMKTLLLER-GVPGGQMNNTAEIENYPGYETIMGP-ELSMKMAEPLEGLGVENAYGFVTDIEDHGDYKKII-------------TEDDEFITKSIIIATGA---NHRKLEIPGEEEYGARGVSYCAVCDGAFFRNQEILVIGGGDSAVEEALYLT--RFGQSVTIMHRRDKLRAQEIIQQRAFKEEKINFIWDSVPMEIKGDDKKIQSVVYKNVKTGEVTEKAFGGIFIYVGL--DPV-AEFVSDLGITDGAGWIITDDHMRTSIPGIFAVGD 277
>gi|15672922|ref|NP_267096.1| thioredoxin reductase [Lactococcus lactis subsp. lactis Il1403] >gi|12723876|gb|AAK05038.1|AE006328_6 thioredoxin reductase (EC 1.6.4.5) [Lactococcus lactis subsp. lactis Il1403] (308 aa)
Score = 171, Expect = 1.8e-10, Identities = 78/283 (27%), Positives = 133/283 (46%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQ-----PMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEI-NNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSK----NNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           YDV I+G G  G+ A+  +    + ++L+E +   GGQ      +E YP       P    +K ++ ++ L  +N     + I+   D   I              T  + F  K II+A+G    N RKLEI   E   +  + Y    +   ++N++ILV+GGGDSAVE A Y    +   +V I+HRR++ R+   +     K    N I   +  EI   ++  +++  K+ +T +     F  + +  G    P+     N  I  E G  + D + +T++  I+A+GD
  S:     6 YDVVIIGSGPAGMTAAMYTARSEMKTLLLE-RGVPGGQMNNTAEIENYPGYETIMGP-ELSMKMAEPLEGLGVENAYGFVTAIEDHGDYKKII-------------TEDDEFVTKSIIIATGA---NHRKLEIPGEEEYGARGVSYCAVCDGAFFRNQEILVIGGGDSAVEEALYLT--RFGQSVTIMHRRDKLRAQEIIQQRAFKEEKINFIWDSVPMEIKGDDKKVQSVVYKNVKTGEVTEKAFGGIFIYVGL--DPVAEFAGNLGITDEAGWIITDDHMRTSLPGIFAVGD 277
>gi|110680667|ref|YP_683674.1| thioredoxin-disulfide reductase [Roseobacter denitrificans OCh 114] >gi|109456783|gb|ABG32988.1| thioredoxin-disulfide reductase [Roseobacter denitrificans OCh 114] (325 aa)
Score = 171, Expect = 1.9e-10, Identities = 77/292 (26%), Positives = 141/292 (48%)
  Q:     4 DLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTIN-EQELFLFETNKNSFY-AKKIILASGNGSFNPRKLEINNEPIDSPF-IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIID--FNESN----KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDL--NQKTNIKNIYAIGDAT-HFY 295
           D R   V I+G G  G  A   ++   L  IL++     GGQ   L     + ++P   E++  D++ ++    K        + T+I+      +N EQ  F+ + +  + Y A  +ILA+G  +   + L + +E     F +      +   Y+ ++I V+GGG++AVE A +       + V ++HRR+E R+   +ID L KN  ++ L +  +D      N    + + ++H +T +   +P   V V  G   +P N  + + +    G YV+    + +T+I  ++A GD T H Y
  S:     3 DTRRTRVLIIGSGPAGYTAGVYASRAMLEPILVQGIE-PGGQ---LTTTTEVENWPGDSEVQGPDLMIRMQDHAK-------AMGTEIIGDIITDLNLEQRPFVAKGDSGTTYIADAVILATGARA---KWLGLPSEEKFKGFGVSACATCDGFFYRGQEIAVIGGGNTAVEEALFLT--NFASKVTLVHRRDELRAEKILIDRLMKNPKIEPLWFHELDEVVGTENPLGVEAIRVRHTKTSEITEIPAKGVFVAIGH--APANELVKDVLETHMGGYVVTKPDSTETSIPGVFAAGDLTDHIY 288
>gi|157693869|ref|YP_001488331.1| thioredoxin-disulfide reductase [Bacillus pumilus SAFR-032] >gi|157682627|gb|ABV63771.1| thioredoxin-disulfide reductase [Bacillus pumilus SAFR-032] (316 aa)
Score = 170, Expect = 1.9e-10, Identities = 69/290 (23%), Positives = 135/290 (46%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFM-IDCLSKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           M+E+ +IYD  I+G G  G+ A+  ++  NL++++IE+    GGQ   +   + + ++P F  I   ++  K+    K+        D        + ++ +E  + +     +  + +I+++G      +K+    E  +    + Y    +   +KNK+++V+GGGDSAVE   Y    +  + V I+HRR++ R+ S +         I    N  +   NE N    ++T+    T +++    D V +  G +      E L  I  E+G    +   +T ++ I+A GD
  S:     1 MSEE-KIYDTIIIGAGPAGMTAAVYTSRGNLSTLMIER-GIPGGQ---MANTEDVENYPGFESILGPELSNKMFDHAKKFGAEYAYGDIK------EIVDGEEYKIVKAGSKEYKGRSVIISAGA---EYKKIGAPGEKELGGRGVSYCAVCDGAFFKNKELVVIGGGDSAVEEGVYLT--RFASKVTIVHRRDKLRAQSILQARAFDNEKIDFMWNKTVKQINEENGKVGSVTLIDTVTGEKEDFKTDGVFIYIGMLPLSKPFENLG-ITNEEGYIETNERMETRVEGIFAAGD 278
>gi|57157161|dbj|BAD83614.1| thioredoxin reductase [Brevibacillus choshinensis] (319 aa)
Score = 170, Expect = 2.0e-10, Identities = 66/285 (23%), Positives = 136/285 (47%)
  Q:     6 RIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNK----EQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESNK--TLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +IYDV I G G  G+ A+  ++  N++++++E+    GGQ   +   + I ++P F  I   D+  K+ +  +    E     I+          +  +E       +    + AK +I+A+G      R L +  E  +    + Y    +   ++NK+++V+GGGDSAVE A +    +  + V I+HRR+++R+   +     +N  ++ + +  + +     K  ++ +++ +T +++    D V +  G      ++  L  I  E G  + D    T +K ++A GD
  S:     5 KIYDVIIAGAGPAGMTAAVYTSRANMSTLMLER-GIPGGQ---MANTEEIENYPGFTTILGPDLSTKMFEHAQAFGAEYAYGEIK----------EIRDEAPYKRVISGDKEYLAKSVIVATGA---EHRLLGVPGEKELSGRGVSYCAVCDGAFFRNKELVVVGGGDSAVEEAVFLT--RFASKVTIVHRRDQFRAQKILQKRAFENEKIEVIWDTAVKEIRGEGKVQSVLLENTKTGEQREFSTDGVFIYVGMDPLTESVRSLG-ITNEAGYVLTDEKMYTKVKGVFAAGD 277
>gi|50914752|ref|YP_060724.1| thioredoxin reductase [Streptococcus pyogenes MGAS10394] >gi|50903826|gb|AAT87541.1| Thioredoxin reductase [Streptococcus pyogenes MGAS10394] (305 aa)
Score = 170, Expect = 2.1e-10, Identities = 74/284 (26%), Positives = 131/284 (46%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKF-IYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPI-DSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +YD  I+G G  G+ A+  +   NL+  +IE+     G P     N F I ++P +  I   ++  K+ +  ++    NI        I  +  N  +     T   S+ AK +I+A+G      R L +  E    S  + Y    +   ++++ +LV+GGGDSAVE A Y  +      V ++HRR++ R+   + D    N+    I   +  EI   +     + I++ +T +     F  V +  G I     ++ L +I   +G  + D + +T+I  I+AIGD
  S:     1 MYDTLIIGSGPAGMTAALYAARSNLSVAIIEQ-----GAPGGQMNNTFDIENYPGYDHISGPELAMKMYEPLEKFNVENI------YGIVQKIENFGDYKCVLTEDASYEAKTVIIATGA---KYRVLGVPGEEYYTSRGVSYCAVCDGAFFRDQDLLVVGGGDSAVEEAIYLTQ--FAKKVTVVHRRDQLRAQKILQDRAFANDKVDFIWDSVVKEIKGNDIKVSNVLIENVKTGQVTDHAFGGVFIYVGMIPVTGMVKDL-KITDSEGWIITDDHMRTSIPGIFAIGD 273
>gi|57168681|ref|ZP_00367813.1| thioredoxin reductase [Campylobacter coli RM2228] >gi|57019962|gb|EAL56642.1| thioredoxin reductase [Campylobacter coli RM2228] (312 aa)
Score = 170, Expect = 2.5e-10, Identities = 81/306 (26%), Positives = 150/306 (49%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFL--FETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF---IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKT----LTIKHKETE-KEQTLPFDYVLVQYGQISSPINIELLNQIN-------KEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE-AVRAL 312
           + DVAI+GGG  G+ A   +    L ++++ +K   GGQ   +  +  I ++P   ++   D I  +   +  ++     L  +++ +   + NE   F    E  K    AK +I+ +G+    P++     E  D  F   +      +   YKNK++ VLGGGD+A+E A Y     I + V +IHRR+E+R++   ++ + KN  ++ +    ID    +K     + +K K+   ++  +P  +  V        +  E+L Q +       +E G+  ++L  +TN+  ++A GD       P  +I A  + AV AL
  S:     1 MLDVAIIGGGPAGLSAGLYTTRGGLKNVVMFEKGMPGGQ---IISSSEIENYPGVAQVM--DGISFMAPWS--EQCMRFGLKHEMVGVEQISKNEDGSFTIRLEGGKTEL-AKAVIVCTGSA---PKRAGFKGE--DEFFGKGVSTCATCDGFFYKNKEVAVLGGGDTALEEALYLA--NICSKVYLIHRRDEFRAAPSTVEKVKKNEKIELITSASIDEVYGDKMGVTGVKVKLKDGSIRDLNVPGIFTFVGLN-----VRNEILKQDDGKFLCNMEEGGQVSVNLKMQTNVPGLFAAGDLRK--DAPKQVICAAGDGAVAAL 302
>gi|149185800|ref|ZP_01864115.1| 4Fe-4S ferredoxin, iron-sulfur binding protein [Erythrobacter sp. SD-21] >gi|148830361|gb|EDL48797.1| 4Fe-4S ferredoxin, iron-sulfur binding protein [Erythrobacter sp. SD-21] (436 aa)
Score = 169, Expect = 2.7e-10, Identities = 71/246 (28%), Positives = 121/246 (49%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPC---------FFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEY-----RSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQI 253
           +D+AIVG G  GI A   +    L+ +L+++ S LGG   +    K +   P          F E++  ++I    Q   E+    I+   ++  +          F  ET+K    AK ++LA G     PR L++  E +  P + Y L ++ E Y   K+LV+GGGDSA+E A    E+  T  V + +R + +     ++ +  I+ + K  I Q+L  ++ +  E    LT +    +  +TL  DYV++  G I
  S:   172 HDIAIVGSGPAGISAGLGAIERKLDYVLLDQ-SDLGGTVAQFPRGKMVMTSPAELPIIGTVKFGEVQKEELIS-FWQGVVEKTGLQIRTGVNVEAVRKTATG----FRLETSKGDIEAKTVLLAIGRRG-TPRTLDVPGEKL--PKVVYRL-IDPEQYVGAKVLVVGGGDSALEAAIQIAEQSDT-KVTLSYRSDAFARARKKNRNRFIELVEKGVIEQRLKSQVAEIREDEVDLTTE----DGIETLANDYVIICVGGI 416
>gi|158521523|ref|YP_001529393.1| thioredoxin reductase [Desulfococcus oleovorans Hxd3] >gi|158510349|gb|ABW67316.1| thioredoxin reductase [Desulfococcus oleovorans Hxd3] (309 aa)
Score = 169, Expect = 2.9e-10, Identities = 71/283 (25%), Positives = 144/283 (50%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNL----ETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQ----KLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI-DLNQKTNIKNIYAIGD 290
           YD+ I+GGG  G+ A   +    LN++++EK +  GGQ +    + +I ++P F E I  +D++ ++  Q      S + +  +   IT   +++    L   +K +   K +I+ASG    +P +L   N P +  FI   ++     +   +++K +  +GGGD+AV+ + +    K    V +IHRR+  R++  + +   +N  ++     +  EI     + + +T+K+ +TE+ + L  D   +  G    P    L   ++ +KG +++ D    T++  ++A GD
  S:     6 YDLVIIGGGPAGLTAGIYAARARLNAVVVEKMA-AGGQVLT---SDWIENYPGFPEGISGADLMMRMSDQ-----ASRLGVALEYEEITAVDLSDPVKILSLGDK-TITCKAVIIASGA---SPSRL---NVPGEERFIGRGISFCATCDAPFFRDKVVAAVGGGDTAVQESLFLT--KFAKKVYLIHRRDALRATKILQERAFENKKIEFVWDSVVTEIGGGLTNVEKVTVKNVKTEETRDLAVDGCFMWVG--IHPNADFLAGAVDTDKGGFILTDQAMATSVPGVFAAGD 278
>gi|154502876|ref|ZP_02039936.1| hypothetical protein RUMGNA_00696 [Ruminococcus gnavus ATCC 29149] >gi|153796415|gb|EDN78835.1| hypothetical protein RUMGNA_00696 [Ruminococcus gnavus ATCC 29149] (300 aa)
Score = 169, Expect = 3.2e-10, Identities = 79/286 (27%), Positives = 135/286 (47%)
  Q:     5 LRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNE-PIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYF--VEEKITNNVAIIHRRNEYRS-SSFMIDCLSKNNILQKLNYEI--IDFNESNKTLTIKHKETEKEQTL--PFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +++YDV I+G G  GI A   +      ++++EK   +GG    +     +  +    E ++ +   K +++  E     I L T++  +    + E+ ++   T K  + AKK+ILA+G    +PRKL I  E  +    I  +   +   Y+ K + V+GG D AV+ A Y   V EK+T    IIH        + F        NI  +L+  +  +   E  ++L I  ++T   +T+  P   + V  G +    N EL N+I  + G    D N +T I  +YA+GD
  S:     1 MKMYDVIIIGAGPAGISAGIYAVSRGQKALILEKNQ-VGGLIRRV---SAVTHYAAIVEGETGESFAKRLRKQAENAGVEI-LKTEVKKVELTGV-EKRIY---TEKECYCAKKVILANGT---SPRKLGIPGEIELAGRGIGMNAAKDAMKYRGKHVYVIGGADGAVKEALYLAGVAEKVT----IIHFEETLGCIAQFQEKVAHTPNIELRLHARLHAVYGVEKVESLEILDEKTGAIETIEDPGCGIFVYVGTVP---NTELYNEIRLDNGFLTTDENMQTEIPGVYAVGD 275
>gi|94967507|ref|YP_589555.1| 4Fe-4S ferredoxin, iron-sulfur binding [Acidobacteria bacterium Ellin345] >gi|94549557|gb|ABF39481.1| 4Fe-4S ferredoxin, iron-sulfur binding [Acidobacteria bacterium Ellin345] (455 aa)
Score = 169, Expect = 3.2e-10, Identities = 75/244 (30%), Positives = 126/244 (51%)
  Q:     8 YDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIY-----DFPCFFEIKSSDVIKKLIQQ--NKEQKNSNIQLDT--DILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEY-----RSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQT---LPFDYVLVQYG 251
           YDV IVG G  GI AS  +   NLN + +E+   +GG  +  YP + +      DFP +      ++ K+ +    +K    ++ +  T   +L I+ Q   E   +   ++K+S+ A+ +ILA G  S  P KLE+  E +  P + Y L +E + Y++  ILV+GGGDSAVE A     +   N V I +R+  +     R++  + + L+   +    N  +++   S+  L       E+E T   +P  YV +  G
  S:   184 YDVVIVGAGPAGISASLRAIEQNLNYLTLEEGE-IGGT-VARYPRQKLVMTSPVDFPIYGRFNRVELSKEELVAFWSKVMHRADFKARTGEKVLGISLQ---EDGRYCVTSSKSSYKARSVILALGK-SGTPTKLEVPGENL--PKVMYRL-IEVDHYRDSDILVVGGGDSAVEAAMGLAAKG--NRVTISYRKTNFNRIKERNAQRIAEFLANGKLNALCNSRVLEIRHSSVLL-------EQEGTISEIPNHYVWIFAG 426
>gi|167038536|ref|YP_001666114.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167038722|ref|YP_001661707.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermoanaerobacter sp. X514] >gi|166852962|gb|ABY91371.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermoanaerobacter sp. X514] >gi|166857370|gb|ABY95778.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermoanaerobacter pseudethanolicus ATCC 33223] (407 aa)
Score = 169, Expect = 3.3e-10, Identities = 73/297 (24%), Positives = 139/297 (46%)
  Q:     1 MNEDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP--IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNIL---QKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQI--NKEKGKYVIDLNQKTNIKNIYAIGDATHFYCK 297
           M +    YDV ++GGG  G+ A+       L ++LIE KS +GG  +  Y ++ I ++P F E      + KL +Q  ++    I+L TD+  +      E++  +  T +  +YAK +I+A+G     PR      E   +    I +    +   Y +KK++++G GD+A+E   +  +     +V+++H      ++    +   KN  +        E  + NE  + + +K+ +T +   +  D   +  G +    N E+   +     KG  + + N +TNI  +YA+GD    + K
  S:     1 MEKKREYYDVVVIGGGPAGMTAAIYCGRARLKTLLIE-KSLVGG--LATYTSE-IENYPGFPEGIGGLELMKLFEQQTKRFGVQIKL-TDVKGLRI----EEDYKVVSTFRVDYYAKAVIIATGG---KPRLTGAKGEENFLYDKGISFCATCDAAYYTDKKVMIIGSGDAAIEEGIFLTKFAREVHVSVLHDEGIMDANKVAQEKALKNEKMIFHWNTMVEAFEGNERLERVVLKNLKTGELIPVDVDGCFLFIGYVP---NTEIFKGLIDMTPKGYIITNENMETNIDGVYAVGDVRDKFLK 289
>gi|71894175|ref|YP_278283.1| putative mercuric reductase [Mycoplasma synoviae 53] >gi|71850963|gb|AAZ43572.1| putative mercuric reductase [Mycoplasma synoviae 53] (459 aa)
Score = 168, Expect = 3.4e-10, Identities = 73/223 (32%), Positives = 111/223 (49%)
  Q:    68 DVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKN-SFYAKKIILASGNGSFNPRKLEINNEPIDSPFIHYS---LNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEY------RSSSFMIDCLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQ--KTNIKNIYAIGD 290
           + +KKL Q+N E  N N  +D  + +  + +  E E+ L    K     AK II+ +G+ S   RKL I      S F+ YS   LNL T     KK+LV+G G   +E+A+YF        V +    N++        S F++D L K  I  + N     F +    + +      K+    FD VL+  G+I + +N+ L N   K      I++N+  +TN+K IYAIGD
  S:    89 EFVKKLNQKNFELLNKNKNVDIYMGSAKFLSDYEVEVNLNSNKKKVKLTAKNIIIGTGSVS---RKLNIEGAA-KSRFVKYSNDILNLRT---LPKKLLVVGAGFIGLEFASYFA--NFGTQVTVAQYNNDFMPNEDKEDSKFILDTLKKQGIKFEFNTTCEKFKDLKSQVQVSLSNKTKKYKEKFDAVLISAGRIPNTLNLGLENTKIKVLDNKAIEVNKYLQTNVKGIYAIGD 314
>gi|154508258|ref|ZP_02043900.1| hypothetical protein ACTODO_00754 [Actinomyces odontolyticus ATCC 17982] >gi|153797892|gb|EDN80312.1| hypothetical protein ACTODO_00754 [Actinomyces odontolyticus ATCC 17982] (345 aa)
Score = 168, Expect = 3.8e-10, Identities = 77/309 (24%), Positives = 144/309 (46%)
  Q:     3 EDLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF----IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMID-CLSKNNILQKLNYEIIDFNESNKTLTIKHKETEKEQT--LPFDYVLVQYGQISSPINIELLNQINKEKGKYVI--DLNQKTNIKNIYAIGDAT-HFYCKPNTIITACAEAVRA 311
           E   ++DV IVG G  G  A+  +    L  I++  +   GG  M       + +FP F E I+  +++  + +Q  E+  ++++ + D++ +      E  +    T    FYA+ +ILA+G+      +    N P +  F    + Y    +   +K++++ V+GGGDSA+E A +       + V ++HRR+  R+S  M +  L+   I  + N  + +    +    ++   T    T  +  D V V  G +  P    L  Q+  ++  Y+   + + +T++  ++A GDA  H Y      ITA     RA
  S:    33 EGATVHDVVIVGSGPAGYTAAVYTARAGLAPIVLAGQLAAGGALMN---TTEVENFPGFPEGIQGPELMDNMREQ-AEKFGADVRYE-DVVAVNL----EGNVKAVATEDEVFYARAVILATGS------EYRHMNVPGEDEFSGRGVSYCATCDGFFFKDRRLAVIGGGDSAMEEATFLT--NFASEVVVVHRRDALRASRVMAERALNNPKISFEWNATVDEVLGDDAVTGLRLVSTVDGSTREIAVDGVFVAIGHL--PRTGFLRGQVALDEAGYITVDEPSTRTSVAGVFACGDAVDHTY---RQAITAAGSGCRA 330
>gi|119962276|ref|YP_949864.1| thioredoxin-disulfide reductase [Arthrobacter aurescens TC1] >gi|119949135|gb|ABM08046.1| thioredoxin-disulfide reductase [Arthrobacter aurescens TC1] (308 aa)
Score = 168, Expect = 3.8e-10, Identities = 79/282 (28%), Positives = 129/282 (45%)
  Q:     9 DVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKE-------QKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESNKTLTIKHKE----TEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           DV IVG G  G  A+  +   N+  +LI      GG   EL     + ++P F E I   D+++   +Q          +  + + LD DI  +T  T              +F AK IIL++G+     R+L + NE  +    + +    +   +K++ I V+GGGDSA+E A +    K   +V ++HRR+  ++S  M D    +  ++ + N  + D    +K   +K K     TE E  L    V V  G       I+    +  E    V   + +TNIK ++A GD
  S:     3 DVIIVGSGPAGYTAAVYTARANMKPLLIAGSVTAGG---ELMNTTDVENYPGFPEGIMGPDLMENFEKQAARFGTEIQFEDVTELDLDGDIKTVTIGT------------GETFQAKAIILSTGSAY---RELGLANEKRLSGHGVSWCATCDGFFFKDQDIAVIGGGDSAMEEALFLT--KFAKSVTVVHRRDTLKASKIMGDRAQAHEKIKFVWNTAVEDVLGGDKVTGLKLKNLVDGTESE--LAVTGVFVAIGNDPRTDLIKGKVDLTPEGTIAVEGRSSRTNIKGVFAAGD 276
>gi|77917732|ref|YP_355547.1| thioredoxin reductase [Pelobacter carbinolicus DSM 2380] >gi|77543815|gb|ABA87377.1| thioredoxin reductase [Pelobacter carbinolicus DSM 2380] (308 aa)
Score = 168, Expect = 3.8e-10, Identities = 67/284 (23%), Positives = 137/284 (48%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQ-----PMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQ----KLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           ++DV I+GGG  G+ A   ++  +L ++L+E    +GGQ      +E YP      FP    +   +++++  +  +E     +Q +   LN      ++ E+     +  +  A+ +I+A+G     PRKL I  E  +    + Y    +   ++N  + V+GGGD+A E A +    +  + V ++HRR+  R++  + + +  N+ ++     +  +++  N     L IK+K +  +  L  + V    G I     +  +  +N E G  + D   +T++  ++A GD
  S:     5 LFDVLIIGGGPAGLTAGLYTSRADLKTVLVESM-MVGGQVITTTKIENYPG-----FPG--GVDGPELMQRFHEHCQEYGLQIMQGEVQQLN------DKGEVKEVVVDGKAIKARTVIVATGA---EPRKLGIPGEKELVGRGVSYCATCDGAFFRNVPVAVVGGGDTAAEEALFL--SRFASKVYLVHRRDALRATRILQERIFANDKIEVVWDSVPEQVLSDNRGVNGLEIKNKVSGDKSVLELEGVFFAIGVIPKANFLAEILDLNPE-GYILTDAECRTSMPGVFAAGD 278
>gi|167213132|ref|ZP_02283439.1| thioredoxin-disulfide reductase [Listeria monocytogenes LO28] (300 aa)
Score = 168, Expect = 4.1e-10, Identities = 66/269 (24%), Positives = 121/269 (44%)
  Q:    22 ASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKL-EINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNN----ILQKLNYEIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQKTNIKNIYAIGD 290
           A+  ++  +L++++IE+    GGQ   +     + ++P F  I   D+  K++   K+        D        + ++ +E         ++ A+ II+A+G      RKL     E +    + Y    +   +KN++++V+GGGDSAVE   Y    +  + V I+HRR++ R+   + D   K+     I      EI+   +      +       E  +P D V +  G +  P+    LN  I  ++G  V D   +TN+  I+A GD
  S:     3 AALYTSRADLDTLMIER-GVPGGQ---MVNTAEVENYPGFDSILGPDLSDKMLSGAKQFGAEYAYGDIK------EVVDGKEFKTVTAGSKTYKARAIIIATGA---EHRKLGAAGEEELSGRGVSYCAVCDGAFFKNRELIVVGGGDSAVEEGTYLT--RYADKVTIVHRRDKLRAQQILQDRAFKDEKVDFIWNSTVEEIVGDGKKVTGAKLVSTVDGSESIMPVDGVFIYVGLV--PLTKAFLNLGITDDEGYIVTDEEMRTNLPGIFAAGD 260
>gi|58700154|ref|ZP_00374664.1| Pyridine nucleotide-disulphide oxidoreductase, putative [Wolbachia endosymbiont of Drosophila ananassae] >gi|58533328|gb|EAL57817.1| Pyridine nucleotide-disulphide oxidoreductase, putative [Wolbachia endosymbiont of Drosophila ananassae] (270 aa)
Score = 168, Expect = 4.2e-10, Identities = 69/218 (31%), Positives = 118/218 (54%)
  Q:   100 NEQELFLFETNKNS-FYAKKIILASGNGSFNPRK------LEINNEPIDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVE-EKITNNVAIIHRRNEYRSSSFMIDCL----SKNNILQKLNYEIIDFNESN---KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQ--INKEKGKYVID-LNQKTNIKNIYAIGDATHFYCKPNTIITACAEAVRALWHISK 317
           NE E F   T+  +    K +I+A+GNG F P +      LE  N+ +      YS+N  ++ +++K I++ GGGDSA +W    VE  K+   + +IHRR E+R +    + L    S   I   + Y++ +    N    T+ +K+  +++E+ +  D++L  +G     +N+  +N   I  E  + V+D    KT+   IYAIGD   +  K   I++  AE+  A + I K
  S:    23 NEGENFTIITSIGTEVKCKAVIVAAGNGMFEPNRPPLSGILEYENKSV-----FYSVNKISD-FQDKTIVIAGGGDSAADWT---VELSKVAKKIYVIHRRKEFRCTPETRNKLESLESDGKIELVVPYQLHELAGGNGQLSTVIVKNIASKEEKEISADFLLPFFGL---SMNLGPINNWGIQLEHSRIVVDPATLKTSRDRIYAIGDIAIYSGKLKLILSGFAESAMACYDIYK 246
>gi|57237154|ref|YP_178166.1| thioredoxin-disulfide reductase [Campylobacter jejuni RM1221] >gi|148926316|ref|ZP_01810000.1| thioredoxin reductase [Campylobacter jejuni subsp. jejuni CG8486] >gi|57165958|gb|AAW34737.1| thioredoxin-disulfide reductase [Campylobacter jejuni RM1221] >gi|145844708|gb|EDK21813.1| thioredoxin reductase [Campylobacter jejuni subsp. jejuni CG8486] (312 aa)
Score = 167, Expect = 4.3e-10, Identities = 81/306 (26%), Positives = 148/306 (48%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFL--FETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF---IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIIDFNESNKT----LTIKHKETE-KEQTLPFDYVLVQYGQISSPINIELLNQIN-------KEKGKYVIDLNQKTNIKNIYAIGDATHFYCKPNTIITACAE-AVRAL 312
           + DVAI+GGG  G+ A   +    L ++++ +K   GGQ   +  +  I ++P   ++   D I  +   N  ++     L  +++ +     N    F    E  K    AK +I+ +G+    P+K     E  D  F   +      +   YKNK++ VLGGGD+A+E A Y     I + V +IHRR+E+R++   ++ + KN  ++ +    +D    +K     + +K K+   ++  +P  +  V        +  E+L Q +       +E G+  +DL  +T++  ++A GD       P  +I A  + AV AL
  S:     1 MLDVAIIGGGPAGLSAGLYATRGGLKNVVMFEKGMPGGQ---ITSSSEIENYPGVAQVM--DGISFMTPWN--EQCMRFGLKHEMVGVEQILKNSDGSFTIKLEGGKTEL-AKAVIVCTGSA---PKKAGFKGE--DKFFGKGVSTCATCDGFFYKNKEVAVLGGGDTALEEALYLA--NICSKVYLIHRRDEFRAAPSTVEKVKKNEKIELITSASVDEVYGDKMGVTGVKVKLKDGSIRDLNVPGIFTFVGLN-----VRNEILKQDDGKFLCNMEEGGQVSVDLKMQTSVAGLFAAGDLRK--DAPKQVICAAGDGAVAAL 302
>gi|89210941|ref|ZP_01189323.1| Thioredoxin reductase [Halothermothrix orenii H 168] >gi|89159487|gb|EAR79153.1| Thioredoxin reductase [Halothermothrix orenii H 168] (364 aa)
Score = 167, Expect = 4.3e-10, Identities = 76/301 (25%), Positives = 157/301 (52%)
  Q:    12 IVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPM-ELYPNKFIYDFPCFFE-IKSSDVIKKLIQQNKEQKNSNIQLDTDIL-NITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEP-IDSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKL-NYEIIDFNESNKT--LTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLN-QINKEKGKYVIDLNQ-KTNIKNIYAIGDATHFYCKPNTIITACAEAVRAL 312
           I+GGG  G+ A+  +    LN ++I     +G +P  ++     I ++P F E I   D+++K+I+Q ++    +++L  +++ N+ +        +  +T+   + A  II+A+G    +PRKL +  E       I Y    +   +K++++ V+GGGD A+E ANY       + V +IHRR+++R +  + D +  N+ ++ L + E+ +    NK   L +++ +T +E  L  + V   +  +    N +L   Q+  +   Y+I  ++  T+ + I+A GD    + +   + +A + A+ A+
  S:    64 IIGGGPAGLTAAIYAARAGLNPMVI-----VGPEPGGQITTTSEIENYPGFPEGITGFDLMQKVIEQAQK---FDVRLQYEVVENVDFN----NSPYNIKTDGGEYQADSIIIATGA---SPRKLGLEKEEDFIGKGISYCATCDGAFFKDQEVAVVGGGDVALEEANYLT--NFCSKVYLIHRRDQFRGTKILGDRVKNNSKVEILWDTEVRELLGGNKVEGLLVENNKTGEETRL--ENVKALFIAVGYKPNTDLFKGQLEVDDRGYIITNDRLMTSKEGIFAAGDVQDPHYR-QVVTSAASGAIAAM 353
>gi|146319391|ref|YP_001199103.1| hypothetical protein SSU05_1737 [Streptococcus suis 05ZYH33] >gi|146321594|ref|YP_001201305.1| hypothetical protein SSU98_1747 [Streptococcus suis 98HAH33] >gi|145690197|gb|ABP90703.1| unknown protein [Streptococcus suis 05ZYH33] >gi|145692400|gb|ABP92905.1| unknown protein [Streptococcus suis 98HAH33] (305 aa)
Score = 167, Expect = 4.4e-10, Identities = 76/284 (26%), Positives = 131/284 (46%)
  Q:     7 IYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQ-ELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPI-DSPFIHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNY-------EIIDFNESNKTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVIDLNQKTNIKNIYAIGD 290
           +YD  ++G G  G+ A+  +   NL   L+E+  Y GGQ   +     I ++P +  I    + +K+ +  +       +   D +  T   I E+ ++    T       K ++LA G      R L I  E   +S  + Y    +   ++ +K+LV+GGGDSAVE A +  +     +V I+HRR++ R+   + D    N   +K+N+       EI   +   +++ IK+ +TE+   L F  V +  G       +  L  I  E G  + +   +T    IYAIGD
  S:     1 MYDTVVIGAGPAGMTAALYAGRSNLKVALLERGIY-GGQ---MNNTAEIENYPGYDHISGPALAEKMFEPLE-------KFGVDHIFGTLVRIEEEGQIKKVITEDGVLETKTVVLAMGA---KHRLLGIPGEDTYNSRGVSYCAVCDGAFFRGQKLLVVGGGDSAVEEALFLTQ--FAESVTIVHRRDQLRAQKVIQDRAFAN---EKINFIWDSVVEEIKGDDLRVQSVVIKNVKTEEVSELDFGGVFIYVGLDPMTDTVADLG-ITDEAGWVITNEKMETTQSGIYAIGD 273
>gi|126739890|ref|ZP_01755581.1| thioredoxin-disulfide reductase [Roseobacter sp. SK209-2-6] >gi|126719122|gb|EBA15833.1| thioredoxin-disulfide reductase [Roseobacter sp. SK209-2-6] (313 aa)
Score = 167, Expect = 4.6e-10, Identities = 74/289 (25%), Positives = 139/289 (48%)
  Q:     4 DLRIYDVAIVGGGAGGIFASTISNYFNLNSILIEKKSYLGGQPMELYPNKFIYDFPCFFEIKSSDVIKKLIQQNKEQKNSNIQLDTDILNITWQTINEQELFLFETNKNSFYAKKIILASGNGSFNPRKLEINNEPIDSPF-IHYSLNLETEIYKNKKILVLGGGDSAVEWANYFVEEKITNNVAIIHRRNEYRSSSFMIDCLSKNNILQKLNYEIID--FNESN----KTLTIKHKETEKEQTLPFDYVLVQYGQISSPINIELLNQINKEKGKYVI--DLNQKTNIKNIYAIGDAT 292
           D R   V I+G G  G  A   ++   L  IL++     GGQ   L     + ++P F E++  D++ K+ Q++ +     I  D     IT    + +       +  ++ A  +ILA+G  +   + L + +E     F +      +   Y+ ++I+V+GGG++AVE A +       + V +IHRR+E R+   +ID L KN+ ++ L +  ++      N    + + +K+ +T + + +P   V V  G   +P N  + + +    G YV     + +T++  I+A GD T
  S:     3 DTRHTKVLIIGSGPAGYTAGVYASRAMLEPILVQGIE-PGGQ---LTTTTEVENYPGFTEVQGPDLMIKM-QEHAQAMGCEIIGDI----ITSLDTSARPFTAKGDSGTTYTADAVILATGARA---KWLGLESEEKFKGFGVSACATCDGFFYRGQEIVVIGGGNTAVEEALFLT--NFASKVTLIHRRDELRAEKILIDRLMKNDKIEPLWFHTLEEVVGTENPLGVEGVVVKNVQTGETKEIPCKGVFVAIGH--APANELVKDDLELHNGGYVSVKPGSTETSVPGIFAAGDLT 284