>gi|26553466|ref|NP_757400.1| peroxiredoxin [Mycoplasma penetrans HF-2] >gi|26453472|dbj|BAC43804.1| peroxiredoxin [Mycoplasma penetrans HF-2] (160 aa)
Score = 722, Expect = 4.9e-75, Identities = 160/160 (100%), Positives = 160/160 (100%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ
  S:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
>gi|34558282|ref|NP_908097.1| alkyl hydroperoxide reductase subunit C [Wolinella succinogenes DSM 1740] >gi|34484001|emb|CAE10997.1| ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C [Wolinella succinogenes] (198 aa)
Score = 242, Expect = 2.1e-19, Identities = 51/158 (32%), Positives = 89/158 (56%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIAT 158
           ML+  K  NF + A  G  + + +++L KN GK+GT++FF   DF     SEII  +++ + F   G+N I +SVDS+ +H         +  I  +    V+D++K+I+RD+ VLF E  +L  +  IDK G +++     + + R+ID +++ + T
  S:     1 MLVTNKAPNFVATAVLGNNEIVSDFELYKNFGKSGTVVFFYPLDFTFVCPSEIIAFDKRLEEFQARGINVIGVSVDSQFSHFAWKNTAVKEGGIGQVRFPLVADLTKQIARDFDVLFNESVALRGSFLIDKDGTVRHAVINDLPLGRNIDEMIRMVDT 158
>gi|14029099|gb|AAK51148.1| 26,000 kDa protein [Helicobacter pylori] (198 aa)
Score = 238, Expect = 5.7e-19, Identities = 53/156 (33%), Positives = 88/156 (56%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  +S   V+DI+K ISRDY VLFEE  +L  +  IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLFEEAIALRGSFLIDKNMKVRHAVVNDLPLGRNADEMLRMV 156
>gi|54301415|gb|AAV33162.1| alkyl hydroperoxide reducatase [Helicobacter pylori] >gi|54301417|gb|AAV33163.1| alkyl hydroperoxide reducatase [Helicobacter pylori] >gi|58198721|gb|AAW66000.1| alkylhydroperoxide reductase [Helicobacter pylori] (198 aa)
Score = 237, Expect = 8.4e-19, Identities = 53/156 (33%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  +S   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|15612536|ref|NP_224189.1| putative peroxidase [Helicobacter pylori J99] >gi|7387493|sp|P56876|TSAA_HELPJ Probable peroxiredoxin (Thioredoxin reductase) (26 kDa antigen) >gi|499094|gb|AAA18984.1| M-r-26,000 >gi|4156103|gb|AAD07055.1| putative peroxidase [Helicobacter pylori J99] >gi|54301407|gb|AAV33158.1| alkyl hydroperoxide reducatase [Helicobacter pylori] (198 aa)
Score = 236, Expect = 1.0e-18, Identities = 53/156 (33%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  +S   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|58201189|gb|AAW66718.1| AhpC [Helicobacter pylori] (198 aa)
Score = 236, Expect = 1.1e-18, Identities = 53/156 (33%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  +S   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPVVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|19338954|gb|AAL86893.1|AF479023_1 putative alkyl hydroperoxide reductase [Helicobacter pylori] (196 aa)
Score = 236, Expect = 1.2e-18, Identities = 52/156 (33%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  ++   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|188528355|ref|YP_001911042.1| putative peroxidase [Helicobacter pylori Shi470] >gi|188144595|gb|ACD49012.1| putative peroxidase [Helicobacter pylori Shi470] (198 aa)
Score = 234, Expect = 1.6e-18, Identities = 52/156 (33%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  +  +S   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQVHFAWKNTPVEKGGVGQVSFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|34850275|emb|CAE47413.1| alkyl hydroperoxide reductase C22 [Helicobacter pylori] (181 aa)
Score = 234, Expect = 1.6e-18, Identities = 51/148 (34%), Positives = 84/148 (56%)
  Q:     9 NFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  +S   V+DI+K ISRDY VLFEE  +L  +  IDK   +++     + + R+ D +L+ +
  S:     8 DFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLFEEAIALRGSFLIDKNMKVRHAVVNDLPLGRNADEMLRMV 155
>gi|15646170|ref|NP_208354.1| alkyl hydroperoxide reductase (tsaA) [Helicobacter pylori 26695] >gi|2507172|sp|P21762|TSAA_HELPY Probable peroxiredoxin (Thioredoxin reductase) (26 kDa antigen) >gi|2314747|gb|AAD08603.1| alkyl hydroperoxide reductase (tsaA) [Helicobacter pylori 26695] (198 aa)
Score = 234, Expect = 1.6e-18, Identities = 52/156 (33%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  ++   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|54301409|gb|AAV33159.1| alkyl hydroperoxide reducatase [Helicobacter pylori] >gi|54301413|gb|AAV33161.1| alkyl hydroperoxide reducatase [Helicobacter pylori] >gi|54301421|gb|AAV33165.1| alkyl hydroperoxide reducatase [Helicobacter pylori] (198 aa)
Score = 234, Expect = 1.6e-18, Identities = 52/156 (33%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  ++   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|54301425|gb|AAV33167.1| alkyl hydroperoxide reducatase [Helicobacter pylori] (198 aa)
Score = 234, Expect = 1.6e-18, Identities = 52/156 (33%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  ++   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|54301431|gb|AAV33170.1| alkyl hydroperoxide reducatase [Helicobacter pylori] (198 aa)
Score = 234, Expect = 1.6e-18, Identities = 52/156 (33%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  ++   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|29150161|emb|CAD79624.1| alkyl hydroperoxide reductase C22 protein [Helicobacter pylori] >gi|29150179|emb|CAD79633.1| alkyl hydroperoxide reductase C22 protein [Helicobacter pylori] (181 aa)
Score = 233, Expect = 2.4e-18, Identities = 51/148 (34%), Positives = 83/148 (56%)
  Q:     9 NFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  +S   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     8 DFKAPAVLGNNEVDEHFELSKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 155
>gi|109948144|ref|YP_665372.1| alkyl hydroperoxide reductase [Helicobacter acinonychis str. Sheeba] >gi|109715365|emb|CAK00373.1| alkyl hydroperoxide reductase [Helicobacter acinonychis str. Sheeba] (198 aa)
Score = 233, Expect = 2.5e-18, Identities = 52/156 (33%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+GK+G +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  +S   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKSGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|83753829|pdb|1ZOF|A Chain A, Crystal Structure Of Alkyl Hydroperoxide-Reductase (Ahpc) From Helicobacter Pylori >gi|83753830|pdb|1ZOF|B Chain B, Crystal Structure Of Alkyl Hydroperoxide-Reductase (Ahpc) From Helicobacter Pylori >gi|83753831|pdb|1ZOF|C Chain C, Crystal Structure Of Alkyl Hydroperoxide-Reductase (Ahpc) From Helicobacter Pylori >gi|83753832|pdb|1ZOF|D Chain D, Crystal Structure Of Alkyl Hydroperoxide-Reductase (Ahpc) From Helicobacter Pylori >gi|83753833|pdb|1ZOF|E Chain E, Crystal Structure Of Alkyl Hydroperoxide-Reductase (Ahpc) From Helicobacter Pylori >gi|83753834|pdb|1ZOF|F Chain F, Crystal Structure Of Alkyl Hydroperoxide-Reductase (Ahpc) From Helicobacter Pylori >gi|83753835|pdb|1ZOF|G Chain G, Crystal Structure Of Alkyl Hydroperoxide-Reductase (Ahpc) From Helicobacter Pylori >gi|83753836|pdb|1ZOF|H Chain H, Crystal Structure Of Alkyl Hydroperoxide-Reductase (Ahpc) From Helicobacter Pylori >gi|83753837|pdb|1ZOF|I Chain I, Crystal Structure Of Alkyl Hydroperoxide-Reductase (Ahpc) From Helicobacter Pylori >gi|83753838|pdb|1ZOF|J Chain J, Crystal Structure Of Alkyl Hydroperoxide-Reductase (Ahpc) From Helicobacter Pylori (198 aa)
Score = 233, Expect = 2.5e-18, Identities = 52/156 (33%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           M++ +   +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  +S   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MVVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|29150163|emb|CAD79625.1| alkyl hydroperoxide reductase C22 protein [Helicobacter pylori] >gi|34850277|emb|CAE47414.1| alkyl hydroperoxide reductase C22 [Helicobacter pylori] >gi|34850279|emb|CAE47415.1| alkyl hydroperoxide reductase C22 [Helicobacter pylori] >gi|34850281|emb|CAE47416.1| alkyl hydroperoxide reductase C22 [Helicobacter pylori] (181 aa)
Score = 232, Expect = 2.7e-18, Identities = 51/148 (34%), Positives = 83/148 (56%)
  Q:     9 NFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  +S   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     8 DFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 155
>gi|29150187|emb|CAD79637.1| alkyl hydroperoxide reductase C22 protein [Helicobacter pylori] (181 aa)
Score = 232, Expect = 2.9e-18, Identities = 51/148 (34%), Positives = 83/148 (56%)
  Q:     9 NFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  +S   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     8 DFKAPAVLGNNEVDEHFELSKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 155
>gi|29150177|emb|CAD79632.1| alkyl hydroperoxide reductase C22 protein [Helicobacter pylori] (181 aa)
Score = 232, Expect = 3.0e-18, Identities = 51/148 (34%), Positives = 83/148 (56%)
  Q:     9 NFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  +S   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     8 DFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHTVINDLPLGRNADEMLRMV 155
>gi|54301419|gb|AAV33164.1| alkyl hydroperoxide reducatase [Helicobacter pylori] (198 aa)
Score = 232, Expect = 3.3e-18, Identities = 52/156 (33%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+GK+G +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  +S   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKSGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|29150169|emb|CAD79628.1| alkyl hydroperoxide reductase C22 protein [Helicobacter pylori] (181 aa)
Score = 231, Expect = 4.3e-18, Identities = 50/148 (33%), Positives = 83/148 (56%)
  Q:     9 NFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  ++   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     8 DFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 155
>gi|54301429|gb|AAV33169.1| alkyl hydroperoxide reducatase [Helicobacter pylori] (198 aa)
Score = 231, Expect = 4.3e-18, Identities = 51/156 (32%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+GK+G +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  ++   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKSGAILFFWPKDFTFVCPTEIIAFDKRVKDFQERGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|54301427|gb|AAV33168.1| alkyl hydroperoxide reducatase [Helicobacter pylori] (198 aa)
Score = 230, Expect = 4.5e-18, Identities = 51/156 (32%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+G++G +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  +S   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGRSGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|29150183|emb|CAD79635.1| alkyl hydroperoxide reductase C22 protein [Helicobacter pylori] (181 aa)
Score = 230, Expect = 4.9e-18, Identities = 50/148 (33%), Positives = 83/148 (56%)
  Q:     9 NFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  ++   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     8 DFKAPAVLGNNEVDEHFELSKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 155
>gi|54301403|gb|AAV33156.1| alkyl hydroperoxide reducatase [Helicobacter pylori] (198 aa)
Score = 230, Expect = 5.2e-18, Identities = 51/156 (32%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+GK+G +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  ++   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKSGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIRVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|29150171|emb|CAD79629.1| alkyl hydroperoxide reductase C22 protein [Helicobacter pylori] >gi|29150185|emb|CAD79636.1| alkyl hydroperoxide reductase C22 protein [Helicobacter pylori] (181 aa)
Score = 230, Expect = 5.6e-18, Identities = 50/148 (33%), Positives = 83/148 (56%)
  Q:     9 NFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  ++   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     8 DFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 155
>gi|54301411|gb|AAV33160.1| alkyl hydroperoxide reducatase [Helicobacter pylori] (198 aa)
Score = 230, Expect = 5.7e-18, Identities = 51/156 (32%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+GK+G +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  ++   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKSGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|29150165|emb|CAD79626.1| alkyl hydroperoxide reductase C22 protein [Helicobacter pylori] >gi|29150173|emb|CAD79630.1| alkyl hydroperoxide reductase C22 protein [Helicobacter pylori] >gi|29150175|emb|CAD79631.1| alkyl hydroperoxide reductase C22 protein [Helicobacter pylori] >gi|29150181|emb|CAD79634.1| alkyl hydroperoxide reductase C22 protein [Helicobacter pylori] (181 aa)
Score = 229, Expect = 6.0e-18, Identities = 50/148 (33%), Positives = 83/148 (56%)
  Q:     9 NFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  ++   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     8 DFKAPAVLGNNEVDEHFELSKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 155
>gi|34850269|emb|CAE47410.1| alkyl hydorperoxide reductase C22 [Helicobacter pylori] >gi|34850271|emb|CAE47411.1| alkyl hydroperoxide reductase C22 [Helicobacter pylori] >gi|34850273|emb|CAE47412.1| alkyl hydroperoxide reductase C22 [Helicobacter pylori] (181 aa)
Score = 229, Expect = 6.4e-18, Identities = 49/148 (33%), Positives = 83/148 (56%)
  Q:     9 NFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +F + A  G  +   +++L+KN+GKNG +LFF  +DF     +EII  +++ ++F   G N + +S+DSE  H        +K  I  ++   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     8 DFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVVGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 155
>gi|15791702|ref|NP_281525.1| antioxidant, AhpC/Tsa family [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57237385|ref|YP_178398.1| anti-oxidant AhpCTSA family protein [Campylobacter jejuni RM1221] >gi|86149230|ref|ZP_01067462.1| antioxidant, AhpC/Tsa family [Campylobacter jejuni subsp. jejuni CF93-6] >gi|86151190|ref|ZP_01069405.1| antioxidant, AhpC/Tsa family [Campylobacter jejuni subsp. jejuni 260.94] >gi|86153707|ref|ZP_01071910.1| alkyl hydroperoxide reducatase [Campylobacter jejuni subsp. jejuni HB93-13] >gi|88597454|ref|ZP_01100689.1| antioxidant, AhpC/Tsa family [Campylobacter jejuni subsp. jejuni 84-25] >gi|121613748|ref|YP_001000044.1| anti-oxidant AhpCTSA family protein [Campylobacter jejuni subsp. jejuni 81-176] >gi|148926429|ref|ZP_01810112.1| alkyl hydroperoxide reductase [Campylobacter jejuni subsp. jejuni CG8486] >gi|153951156|ref|YP_001398615.1| anti-oxidant AhpCTSA family protein [Campylobacter jejuni subsp. doylei 269.97] >gi|157414631|ref|YP_001481887.1| antioxidant, AhpC/Tsa family [Campylobacter jejuni subsp. jejuni 81116] >gi|167005001|ref|ZP_02270759.1| alkyl hydroperoxide reductase [Campylobacter jejuni subsp. jejuni 81-176] >gi|4105264|gb|AAD02329.1| alkyl hydroperoxide reductase subunit C [Campylobacter jejuni] >gi|57166189|gb|AAW34968.1| antioxidant, AhpC/Tsa family [Campylobacter jejuni RM1221] >gi|85840588|gb|EAQ57845.1| antioxidant, AhpC/Tsa family [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85841537|gb|EAQ58784.1| antioxidant, AhpC/Tsa family [Campylobacter jejuni subsp. jejuni 260.94] >gi|85842668|gb|EAQ59880.1| alkyl hydroperoxide reducatase [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87250100|gb|EAQ73058.1| antioxidant, AhpC/Tsa family [Campylobacter jejuni subsp. jejuni 81-176] >gi|88190515|gb|EAQ94489.1| antioxidant, AhpC/Tsa family [Campylobacter jejuni subsp. jejuni 84-25] >gi|112359699|emb|CAL34485.1| alkyl hydroperoxide reductase [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|145844592|gb|EDK21698.1| alkyl hydroperoxide reductase [Campylobacter jejuni subsp. jejuni CG8486] >gi|152938602|gb|ABS43343.1| antioxidant, AhpC/Tsa family [Campylobacter jejuni subsp. doylei 269.97] >gi|157385595|gb|ABV51910.1| alkyl hydroperoxide reductase [Campylobacter jejuni subsp. jejuni 81116] (198 aa)
Score = 229, Expect = 6.7e-18, Identities = 45/158 (28%), Positives = 90/158 (56%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIAT 158
           M++ +K ++F + A  G  + + +++L KN+G  G ++FF  +DF     SEII  ++++Q F N G+  I IS D+E +H        ++  I  +    V+D++K+I+R++ VL+ E  +L  +  +D  G +++     + + R+ID +L+ + T
  S:     1 MIVTKKALDFTAPAVLGNNEIVQDFNLYKNIGPKGAVVFFYPKDFTFVCPSEIIAFDKRYQEFKNRGIEVIGISGDNEFSHFAWKNTPVNQGGIGQVKFPLVADLTKQIARNFDVLYAEAVALRGSFLLDADGTVRHAVVNDLPLGRNIDEMLRMVDT 158
>gi|78777972|ref|YP_394287.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfurimonas denitrificans DSM 1251] >gi|78498512|gb|ABB45052.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfurimonas denitrificans DSM 1251] (198 aa)
Score = 228, Expect = 8.5e-18, Identities = 51/160 (31%), Positives = 87/160 (54%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ML+  +  +F + A       + N+ L++N GK GT+LFF   DF     SEII  + + + F +  VN I +SVDS+ +H    +   +   I  +    V+D++K+ISRDY VLF E  +L  +  ID KG++++     + + R+ID +++ +   Q
  S:     1 MLVTNQAPDFSATAVLADGSIVENFKLSENFGKKGTVLFFYPLDFTFVCPSEIIAFSHRIEEFKSRDVNVIGVSVDSQFSHFAWRETPVNSGGIGRIKYPLVADLTKQISRDYDVLFGESVALRGSFLIDGKGVVRHAVINDLPLGRNIDEMIRMVDAMQ 160
>gi|54301401|gb|AAV33155.1| alkyl hydroperoxide reducatase [Helicobacter pylori] >gi|54301405|gb|AAV33157.1| alkyl hydroperoxide reducatase [Helicobacter pylori] (198 aa)
Score = 228, Expect = 8.9e-18, Identities = 50/156 (32%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+G++G +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  ++   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGRSGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|108563937|ref|YP_628253.1| alkyl hydroperoxide reductase [Helicobacter pylori HPAG1] >gi|107837710|gb|ABF85579.1| alkyl hydroperoxide reductase [Helicobacter pylori HPAG1] (198 aa)
Score = 228, Expect = 9.2e-18, Identities = 50/156 (32%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+G++G +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  ++   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGRSGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|54301423|gb|AAV33166.1| alkyl hydroperoxide reducatase [Helicobacter pylori] (198 aa)
Score = 227, Expect = 1.1e-17, Identities = 50/156 (32%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F + A  G  +   +++L+KN+G++G +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  ++   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     1 MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGRSGAILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 156
>gi|29150167|emb|CAD79627.1| alkyl hydroperoxide reductase C22 protein [Helicobacter pylori] (181 aa)
Score = 225, Expect = 1.8e-17, Identities = 49/148 (33%), Positives = 83/148 (56%)
  Q:     9 NFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +F + A  G  +   +++L+KN+GK+G +LFF  +DF     +EII  +++ ++F   G N I +S+DSE  H        +K  I  ++   V+DI+K ISRDY VLFEE  +L     IDK   +++     + + R+ D +L+ +
  S:     8 DFKAPAVLGNNEVDEHFELSKNLGKSGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMV 155
>gi|57168472|ref|ZP_00367606.1| antioxidant, AhpC/Tsa family VC0731 [Campylobacter coli RM2228] >gi|57020280|gb|EAL56954.1| antioxidant, AhpC/Tsa family VC0731 [Campylobacter coli RM2228] (198 aa)
Score = 225, Expect = 2.2e-17, Identities = 44/158 (27%), Positives = 90/158 (56%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIAT 158
           M++ +K ++F + A  G  + + +++L KN+G  G ++FF  +DF     SEII  ++++Q F N G+  I IS D+E +H        ++  I  +    V+D++K+I+R++ VL+ E  +L  +  +D  G +++     + + R+ID +++ + T
  S:     1 MIVTKKALDFTAPAVLGNNEIVEDFNLYKNIGPKGAVVFFYPKDFTFVCPSEIIAFDKRYQEFKNRGIEVIGISGDNEFSHFAWKNTPVNQGGIGQVKFPLVADLTKQIARNFDVLYAEAVALRGSFLLDADGTVRHAVVNDLPLGRNIDEMIRMVDT 158
>gi|57241472|ref|ZP_00369418.1| AhpC/TSA family family [Campylobacter lari RM2100] >gi|57017808|gb|EAL54584.1| AhpC/TSA family family [Campylobacter lari RM2100] (198 aa)
Score = 224, Expect = 2.5e-17, Identities = 45/158 (28%), Positives = 90/158 (56%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIAT 158
           M++ +K I+F + A  G    + +++L KN+G  G ++FF  +DF     SEII  ++++Q+F + G+  I +S D+E +H        ++  I  +    V+D++K+I+R++ VLF E  +L  +  +D  G I++     + + R+ID +++ + T
  S:     1 MIVTKKAIDFTAPAVLGNNQIVEDFNLYKNIGPKGAVVFFYPKDFTFVCPSEIIAFDKRYQDFKDRGIEVIGVSCDNEFSHFAWKNMPVNQGGIGQVKFPLVADLTKQIARNFDVLFGEAVALRGSFLLDADGTIRHAVINDLPLGRNIDEMIRMVDT 158
>gi|154149007|ref|YP_001406571.1| 2-cys peroxiredoxin BAS1 [Campylobacter hominis ATCC BAA-381] >gi|153805016|gb|ABS52023.1| 2-cys peroxiredoxin BAS1 [Campylobacter hominis ATCC BAA-381] (198 aa)
Score = 224, Expect = 2.7e-17, Identities = 48/158 (30%), Positives = 86/158 (54%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIAT 158
           ML+ +K  NF + A  G    + +++L KN+G  G ++FF  +DF     SEII  + ++Q+F + G+  I IS D+E +H        +K  I  +    V+DI+K+I+R + VL+    +L  +  +DK G +++       + R+ID +L+ + T
  S:     1 MLVTKKAPNFTATAVLGDNKIVDDFNLYKNLGPKGAVVFFYPKDFTFVCPSEIIAFDHRYQDFKDRGIEVIGISTDNEFSHLAWKNTPINKGGIGQIKYPLVADITKDIARSFDVLYANAVALRGSFLLDKDGTVRHMVLNDDALGRNIDEMLRMVDT 158
>gi|152992346|ref|YP_001358067.1| AhpC/TSA family peroxiredoxin [Sulfurovum sp. NBC37-1] >gi|151424207|dbj|BAF71710.1| peroxiredoxin, AhpC/Tsa family [Sulfurovum sp. NBC37-1] (198 aa)
Score = 222, Expect = 4.9e-17, Identities = 47/156 (30%), Positives = 85/156 (54%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +K  +F + A       + +++L  N+G+ G +LFF   DF     SEII  + + + F   G+N I +SVDS+ +H    +   ++  I  ++   V+D++K+ISRDY VL +E  +L  +  ID  G I++     + + R+ D +L+ +
  S:     1 MLVTKKAPDFTATAVLADGSIVDDFNLMDNLGEKGAVLFFYPLDFTFVCPSEIIAFSHRAEEFKKRGINIIGVSVDSQFSHFAWRETPVEQGGIGRINFPLVADLTKQISRDYDVLLDEAVALRGSFLIDADGTIRHAVINDLPLGRNEDEMLRMV 156
>gi|152990141|ref|YP_001355863.1| AhpC/TSA family peroxiredoxin [Nitratiruptor sp. SB155-2] >gi|151422002|dbj|BAF69506.1| peroxiredoxin, AhpC/Tsa family [Nitratiruptor sp. SB155-2] (199 aa)
Score = 221, Expect = 5.5e-17, Identities = 52/156 (33%), Positives = 84/156 (53%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +K  +F + A         N++L +N+G+ G +LFF   DF     SEII  + +   F   G+N I  SVDS  TH        +K  I N+    V+D++K+I++DY VL EE G +L  +  IDK G I++     + + R+ID +++ +
  S:     1 MLVTKKAPDFTAPAVMPDNTINENFNLYENIGEKGAVLFFYPLDFTFVCPSEIIAFDHRLDEFKKRGINVIGCSVDSHYTHLAWKNTPVEKGGIGNIRYPLVADLTKQIAKDYDVLLEEAGVALRGSFLIDKDGTIRHCVINDLPLGRNIDEMIRMV 157
>gi|157736550|ref|YP_001489233.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant [Arcobacter butzleri RM4018] >gi|157738098|ref|YP_001490782.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant [Arcobacter butzleri RM4018] >gi|157698404|gb|ABV66564.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant [Arcobacter butzleri RM4018] >gi|157699952|gb|ABV68112.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant [Arcobacter butzleri RM4018] (198 aa)
Score = 220, Expect = 7.4e-17, Identities = 48/156 (30%), Positives = 85/156 (54%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +K  +F + A       + N++L +N+G+ G +LFF   DF     SEII  +++   F   G+N I  SVDS+ +H    +   +   I  +    V+D++K+IS+DY VLF E  +L  +  IDK G I++     + + R++D +++ +
  S:     1 MLVTKKAPDFTATAVLADGQIVENFNLYENIGEKGAILFFWPLDFTFVCPSEIIAFSKRTDEFKARGINVIGCSVDSQFSHFAWRETAVENGGIGRVKFPMVADLNKQISKDYDVLFGESVALRGSFLIDKDGTIRHAVINDLPLGRNVDEMIRMV 156
>gi|57506047|ref|ZP_00371970.1| antioxidant, AhpC/Tsa family, authentic frameshift [Campylobacter upsaliensis RM3195] >gi|57015655|gb|EAL52446.1| antioxidant, AhpC/Tsa family, authentic frameshift [Campylobacter upsaliensis RM3195] (198 aa)
Score = 215, Expect = 2.6e-16, Identities = 44/158 (27%), Positives = 88/158 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIAT 158
           M++ +K ++F + A  G  + + +++L KN+G  G ++FF  +DF     SEII  ++++  F   G+  I IS D+E +H        ++  I  +    V+D++K+I+R++ VLF E  +L  +  +D  G +++     + + R+ID +L+ + T
  S:     1 MIVTKKALDFTAPAVLGNNEIVNDFNLYKNIGSKGAVVFFYPKDFTFVCPSEIIAFDKRYDEFKKRGIEVIGISGDNEFSHFAWKNTPINQGGIGQVKFPLVADLTKQIARNFDVLFAEAVALRGSFLLDADGTVRHAVINDLPLGRNIDEMLRMVDT 158
>gi|193810557|emb|CAQ41751.1| 2-Cys peroxiredoxin, putative [Plasmodium knowlesi strain H] (195 aa)
Score = 213, Expect = 4.7e-16, Identities = 56/158 (35%), Positives = 87/158 (55%)
  Q:     3 IGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +G++   F ++A  G  +S    +L++ +GK   LL+F   DF     SEII L++    F    V  +  SVDS+ TH    K  ++K  I N+    +SDISK ISRDY VLF++  SL + + IDK GI+++    ++ + R +D IL+ I   Q
  S:     5 VGKEAPFFRAEAVFGD-NSFGEVNLSQFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFHERNVELLGCSVDSKYTHLAWKKTPREKGGIGNIKHTLLSDISKSISRDYNVLFDDSVSLRAFVLIDKNGIVQHLLVNNLALGRSVDEILRIIDALQ 161
>gi|118411118|ref|YP_874512.1| putative peroxiredoxin ycf42 [Thalassiosira pseudonana] >gi|116739865|gb|ABK20735.1| putative peroxiredoxin ycf42 [Thalassiosira pseudonana] (211 aa)
Score = 213, Expect = 4.8e-16, Identities = 44/134 (32%), Positives = 77/134 (57%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+   GK   LLFF   +F P S +E+I L+ +   F  L    + +S+DS  +H Q +   + +  + N++   +SD+S+ I++DY VL EEG  LP    IDK+GII+Y++  ++   R ++ +L+ + + Q
  S:    29 LSDYRGKKYVLLFFYPANFTPVSPTELINLSDRISEFRKLSTQILAVSIDSPFSHLQSLLLSRKEGGLANLNYPLISDLSQTITKDYKVLTEEGLGLPGVFIIDKEGIIQYYTVNNLLCSRSVNELLRILESIQ 162
>gi|32267043|ref|NP_861075.1| alkyl hydroperoxide reductase TsaA [Helicobacter hepaticus ATCC 51449] >gi|32263095|gb|AAP78141.1| alkyl hydroperoxide reductase TsaA [Helicobacter hepaticus ATCC 51449] (198 aa)
Score = 209, Expect = 1.4e-15, Identities = 47/156 (30%), Positives = 87/156 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+ +   +F ++A         +++L KN+GKNG ++FF  +DF     SEII  +++ ++F   GV  I +S+DS+  H        ++  I  ++   VSDI+K+ISRDY VLF    +L  +  IDK  ++++     + + R++D +++ +
  S:     1 MLVTKPAPDFTAEAIKADGTFEDSFNLYKNIGKNGAVVFFWPKDFTFVCPSEIIAFDKRVKDFEARGVKVIGVSIDSKEVHFAWRNVPVNQGGIGAVTFPMVSDITKQISRDYDVLFNGAVALRGSFLIDKNKVVRHAVINDLPLGRNVDEMIRMV 156
>gi|157164012|ref|YP_001466308.1| 2-cys peroxiredoxin BAS1, (Thiol-specific antioxidant protein) [Campylobacter concisus 13826] >gi|112800854|gb|EAT98198.1| antioxidant, AhpC/Tsa family [Campylobacter concisus 13826] (199 aa)
Score = 208, Expect = 1.9e-15, Identities = 44/158 (27%), Positives = 88/158 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIAT 158
           ML+ +K  +F + A  G    + +++L KN+G+ G ++FF   DF     SEII  ++++  F + G+  I +S D++ +H    +   +K  I  +    V+D++K I+R + VL E+ G +L  +  +DK G +++     + + R+ID +++ + T
  S:     1 MLVTKKAPDFTAAAVLGNNQIVNDFNLYKNIGEKGAVVFFYPMDFTFVCPSEIIAFDKRYDEFKSRGIEVIAVSCDNQFSHFAWKETPVNKGGIGKVRFPIVADMTKSIARGFDVLLEDAGVALRGSFLLDKDGTVRHAVINDLPLGRNIDEMIRMVDT 159
>gi|72392463|ref|XP_847032.1| tryparedoxin peroxidase [Trypanosoma brucei TREU927] >gi|11066203|gb|AAG28496.1|AF196570_1 tryparedoxin peroxidase [Trypanosoma brucei] >gi|62358970|gb|AAX79420.1| tryparedoxin peroxidase [Trypanosoma brucei] >gi|70803062|gb|AAZ12966.1| tryparedoxin peroxidase [Trypanosoma brucei] (226 aa)
Score = 207, Expect = 2.4e-15, Identities = 44/124 (35%), Positives = 68/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  +  H  F  L    I +S DS  +H   V+  + K  +  M +  +SD +KEISRDY VL EE G SL +   ID KGI+++ +   + V R++D +L+ +  +Q
  S:    69 VLFFYPLDFTFVCPTEIVSFSDSHAEFEKLNTQVIAVSCDSHFSHLAWVETPRKKGGLGEMKIPLLSDFTKEISRDYGVLVEEQGLSLRALFVIDDKGILRHVTINDLPVGRNVDEVLRVVQAFQ 193
>gi|154175542|ref|YP_001408847.1| membrane protein [Campylobacter curvus 525.92] >gi|112803678|gb|EAU01022.1| membrane protein [Campylobacter curvus 525.92] (199 aa)
Score = 206, Expect = 3.0e-15, Identities = 45/158 (28%), Positives = 88/158 (55%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIAT 158
           ML+ +K  +F + A  G    + +++L KN+G+ GT++FF   DF     SEII  ++++  F   G+  I +S D++ +H    +   +K  I  +    V+D++K I+R + VL E+ G +L  +  +DK G +++     + + R+ID +++ + T
  S:     1 MLVTKKAPDFTAAAVLGNNQIVNDFNLYKNIGEKGTVVFFYPMDFTFVCPSEIIAFDKRYDEFKARGIEVIGVSCDNQFSHFAWKETPVNKGGIGKVRFPIVADMTKSIARGFDVLLEDAGVALRGSFLLDKDGTVRHAVINDLPLGRNIDEMIRMVDT 159
>gi|77979422|ref|ZP_00834841.1| COG0450: Peroxiredoxin [Yersinia intermedia ATCC 29909] (200 aa)
Score = 205, Expect = 4.0e-15, Identities = 47/160 (29%), Positives = 82/160 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F + A  G  + + N++L K++     +LFF   DF     SE+I  + +++ F   GV  + +S DSE  H    K   DK  I  +    V+DI +EI + Y +   E G +L  +  IDK GI++      + + R+ID +++T+   Q
  S:     2 VLVTRQAPDFTAAAVLGSGEIVENFNLKKHLNGRPAVLFFWPMDFTFVCPSELIAFDHRYEEFQKRGVEVVGVSFDSEFVHNAWRKTPVDKGGIGEVKYPMVADIKREIQKAYGIEHPEAGVALRGSFLIDKNGIVRSQIVNDLPIGRNIDEMIRTVDALQ 162
>gi|50120056|ref|YP_049223.1| peroxidase [Pectobacterium atrosepticum SCRI1043] >gi|49610582|emb|CAG74027.1| probable peroxidase [Erwinia carotovora subsp. atroseptica SCRI1043] (200 aa)
Score = 205, Expect = 4.4e-15, Identities = 46/160 (28%), Positives = 82/160 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F + A  G  + + N++L K++     ++FF   DF     SE+I  + ++  F   GV  + +S DSE  H    K   DK  I  +    V+DI +EI + Y +   E G +L  +  IDK G++++     + + R+ID +L+T+   Q
  S:     2 VLVTRQAPDFTAAAVLGSGEIVENFNLKKHINGKAAVIFFWPMDFTFVCPSELIAFDHRYAEFKKRGVEVVGVSFDSEFVHNAWRKTPVDKGGIGEVQYAMVADIKREIQKAYGIEHPEAGVALRGSFLIDKNGVVRHQVVNDLPLGRNIDEMLRTVDALQ 162
>gi|16123356|ref|NP_406669.1| putative alkyl hydroperoxide reductase subunit c [Yersinia pestis CO92] >gi|22124895|ref|NP_668318.1| peroxidase [Yersinia pestis KIM] >gi|45440586|ref|NP_992125.1| putative alkyl hydroperoxide reductase subunit c [Yersinia pestis biovar Microtus str. 91001] >gi|51595275|ref|YP_069466.1| putative alkyl hydroperoxide reductase subunit C [Yersinia pseudotuberculosis IP 32953] >gi|108808680|ref|YP_652596.1| putative alkyl hydroperoxide reductase subunit c [Yersinia pestis Antiqua] >gi|108811058|ref|YP_646825.1| alkyl hydroperoxide reductase subunit c [Yersinia pestis Nepal516] >gi|145600088|ref|YP_001164164.1| alkyl hydroperoxide reductase subunit c [Yersinia pestis Pestoides F] >gi|149364960|ref|ZP_01886995.1| putative alkyl hydroperoxide reductase subunit c [Yersinia pestis CA88-4125] >gi|153947559|ref|YP_001402086.1| anti-oxidant AhpCTSA family protein [Yersinia pseudotuberculosis IP 31758] >gi|162420648|ref|YP_001607730.1| anti-oxidant AhpCTSA family protein [Yersinia pestis Angola] >gi|165926641|ref|ZP_02222473.1| antioxidant, AhpC/TSA family [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936007|ref|ZP_02224577.1| antioxidant, AhpC/TSA family [Yersinia pestis biovar Orientalis str. IP275] >gi|166011015|ref|ZP_02231913.1| antioxidant, AhpC/TSA family [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213044|ref|ZP_02239079.1| antioxidant, AhpC/TSA family [Yersinia pestis biovar Antiqua str. B42003004] >gi|167399186|ref|ZP_02304710.1| antioxidant, AhpC/TSA family [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167421473|ref|ZP_02313226.1| antioxidant, AhpC/TSA family [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423298|ref|ZP_02315051.1| antioxidant, AhpC/TSA family [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167469946|ref|ZP_02334650.1| antioxidant, AhpC/TSA family protein [Yersinia pestis FV-1] >gi|170025484|ref|YP_001721989.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Yersinia pseudotuberculosis YPIII] >gi|186894292|ref|YP_001871404.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Yersinia pseudotuberculosis PB1/+] >gi|21957730|gb|AAM84569.1|AE013702_8 putative peroxidase [Yersinia pestis KIM] >gi|45435443|gb|AAS61002.1| putative alkyl hydroperoxide reductase subunit c [Yersinia pestis biovar Microtus str. 91001] >gi|51588557|emb|CAH20165.1| putative alkyl hydroperoxide reductase subunit C [Yersinia pseudotuberculosis IP 32953] >gi|108774706|gb|ABG17225.1| alkyl hydroperoxide reductase subunit c [Yersinia pestis Nepal516] >gi|108780593|gb|ABG14651.1| putative alkyl hydroperoxide reductase subunit c [Yersinia pestis Antiqua] >gi|115348835|emb|CAL21789.1| putative alkyl hydroperoxide reductase subunit c [Yersinia pestis CO92] >gi|145211784|gb|ABP41191.1| alkyl hydroperoxide reductase subunit c [Yersinia pestis Pestoides F] >gi|149291373|gb|EDM41447.1| putative alkyl hydroperoxide reductase subunit c [Yersinia pestis CA88-4125] >gi|152959054|gb|ABS46515.1| antioxidant, AhpC/TSA family [Yersinia pseudotuberculosis IP 31758] >gi|162353463|gb|ABX87411.1| antioxidant, AhpC/TSA family [Yersinia pestis Angola] >gi|165916152|gb|EDR34759.1| antioxidant, AhpC/TSA family [Yersinia pestis biovar Orientalis str. IP275] >gi|165921569|gb|EDR38766.1| antioxidant, AhpC/TSA family [Yersinia pestis biovar Orientalis str. F1991016] >gi|165990015|gb|EDR42316.1| antioxidant, AhpC/TSA family [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205831|gb|EDR50311.1| antioxidant, AhpC/TSA family [Yersinia pestis biovar Antiqua str. B42003004] >gi|166960392|gb|EDR56413.1| antioxidant, AhpC/TSA family [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167051690|gb|EDR63098.1| antioxidant, AhpC/TSA family [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057468|gb|EDR67214.1| antioxidant, AhpC/TSA family [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752018|gb|ACA69536.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Yersinia pseudotuberculosis YPIII] >gi|186697318|gb|ACC87947.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Yersinia pseudotuberculosis PB1/+] (200 aa)
Score = 201, Expect = 1.1e-14, Identities = 46/160 (28%), Positives = 82/160 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F + A  G  + + N++L K++     +LFF   DF     SE+I  + +++ F   GV  + +S DSE  H    K   DK  I  +    V+DI +EI + Y +   + G +L  +  IDK GI++      + + R+ID +++T+   Q
  S:     2 VLVTRQAPDFTAAAVLGNGEIVENFNLKKHLNGRPAVLFFWPMDFTFVCPSELIAFDHRYEEFQKRGVEVVGVSFDSEFVHNAWRKTPVDKGGIGEVKYPMVADIKREIQKAYGIEHPDAGVALRGSFLIDKNGIVRSQIVNDLPIGRNIDEMIRTVDALQ 162
>gi|77974339|ref|ZP_00829880.1| COG0450: Peroxiredoxin [Yersinia frederiksenii ATCC 33641] >gi|123443378|ref|YP_001007352.1| putative alkyl hydroperoxide reductase subunit c [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122090339|emb|CAL13206.1| putative alkyl hydroperoxide reductase subunit c [Yersinia enterocolitica subsp. enterocolitica 8081] (200 aa)
Score = 199, Expect = 1.9e-14, Identities = 45/160 (28%), Positives = 82/160 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F + A  G  + + N++L K++     +LFF   DF     SE+I  + +++ F   GV  + +S DSE  H    K   DK  I  +    V+DI +EI + Y +   + G +L  +  IDK G++++     + + R+ID +L+ +   Q
  S:     2 VLVTRQAPDFTAAAVLGSGEIVENFNLKKHLNGRPAVLFFWPMDFTFVCPSELIAFDHRYEEFQKRGVEVVGVSFDSEFVHNAWRKTPVDKGGIGEVKYPMVADIKREIQKAYGIEHPDAGVALRGSFLIDKNGVVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|110590544|pdb|2H66|A Chain A, The Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin >gi|110590545|pdb|2H66|B Chain B, The Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin >gi|110590546|pdb|2H66|C Chain C, The Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin >gi|110590547|pdb|2H66|D Chain D, The Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin >gi|110590548|pdb|2H66|E Chain E, The Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin >gi|110590549|pdb|2H66|F Chain F, The Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin >gi|110590550|pdb|2H66|G Chain G, The Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin >gi|110590551|pdb|2H66|H Chain H, The Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin >gi|110590552|pdb|2H66|I Chain I, The Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin >gi|110590553|pdb|2H66|J Chain J, The Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin >gi|116668043|pdb|2I81|A Chain A, Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin, Reduced >gi|116668044|pdb|2I81|B Chain B, Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin, Reduced >gi|116668045|pdb|2I81|C Chain C, Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin, Reduced >gi|116668046|pdb|2I81|D Chain D, Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin, Reduced >gi|116668047|pdb|2I81|E Chain E, Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin, Reduced (213 aa)
Score = 199, Expect = 2.2e-14, Identities = 54/158 (34%), Positives = 84/158 (53%)
  Q:     3 IGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +G++   F ++A  G  +S    +LT+ +GK   LL+F   DF     SEII L++    F    V  +  SVDS+ TH    K    K  I N+    +SDI+K IS+DY VLF++  SL + + ID  GI+++    ++ + R +D IL+ I   Q
  S:    23 VGKEAPFFKAEAVFGD-NSFGEVNLTQFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFHERNVELLGCSVDSKYTHLAWKKTPLAKGGIGNIKHTLLSDITKSISKDYNVLFDDSVSLRAFVLIDMNGIVQHLLVNNLAIGRSVDEILRIIDAIQ 179
>gi|118411034|ref|YP_874429.1| putative peroxiredoxin ycf42 [Phaeodactylum tricornutum] >gi|116739781|gb|ABK20652.1| putative peroxiredoxin ycf42 [Phaeodactylum tricornutum] (203 aa)
Score = 197, Expect = 3.6e-14, Identities = 39/134 (29%), Positives = 79/134 (58%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+   GK   +L F   +F   S +E++ELN +   F  L    + ISVDS  +H Q + + +++  + +++   +SD+S+ I+ +Y +L ++G+SLP    IDK+GI++Y++  ++   R ++ +L+ + + Q
  S:    29 LSDYHGKKYVVLIFYPSNFTAVSPTELVELNNRITEFKKLSTQILAISVDSPFSHLQFLLSKRNQGGLEHLNYPLISDLSQTITSNYKLLTKDGFSLPGVFIIDKEGIVQYYTVNNLLCGRSVNELLRILQSLQ 162
>gi|156100549|ref|XP_001616002.1| 2-Cys peroxiredoxin, putative [Plasmodium vivax SaI-1] >gi|148804876|gb|EDL46275.1| 2-Cys peroxiredoxin, putative [Plasmodium vivax] (195 aa)
Score = 197, Expect = 4.0e-14, Identities = 54/158 (34%), Positives = 84/158 (53%)
  Q:     3 IGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +G++   F ++A  G  +S    +LT+ +GK   LL+F   DF     SEII L++    F    V  +  SVDS+ TH    K    K  I N+    +SDI+K IS+DY VLF++  SL + + ID  GI+++    ++ + R +D IL+ I   Q
  S:     5 VGKEAPFFKAEAVFGD-NSFGEVNLTQFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFHERNVELLGCSVDSKYTHLAWKKTPLAKGGIGNIKHTLLSDITKSISKDYNVLFDDSVSLRAFVLIDMNGIVQHLLVNNLAIGRSVDEILRIIDAIQ 161
>gi|11467494|ref|NP_043640.1| ORF204 [Odontella sinensis] >gi|1351769|sp|P49537|YCF42_ODOSI Putative peroxiredoxin ycf42 (Thioredoxin reductase) >gi|1185189|emb|CAA91672.1| ORF204, homologous to Porphyra ORF199 [Odontella sinensis] (204 aa)
Score = 196, Expect = 5.0e-14, Identities = 42/134 (31%), Positives = 78/134 (58%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+   GK   +LFF   +F   S +E++ L+ +   F  L    + ISVDS  +H Q +   +++  + +++   VSD+++ I+RDY VL +EG + P    IDK+GII+Y++  ++   R+I+ +L+ + + Q
  S:    29 LSDYRGKKYVILFFYPANFTAISPTELMLLSDRISEFRKLSTQILAISVDSPFSHLQYLLCNREEGGLEDLNYPLVSDLTQTITRDYQVLTDEGLAFPGLFIIDKEGIIQYYTVNNLLCGRNINELLRILESIQ 162
>gi|82539442|ref|XP_724109.1| thioredoxin peroxidase 1 [Plasmodium yoelii yoelii str. 17XNL] >gi|23478642|gb|EAA15674.1| thioredoxin peroxidase 1 [Plasmodium yoelii yoelii] >gi|28201169|dbj|BAC56717.1| 2-Cys peroxiredoxin [Plasmodium yoelii] (195 aa)
Score = 196, Expect = 5.0e-14, Identities = 51/159 (32%), Positives = 84/159 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ++G +  +F ++A  G  ++     L+  +GK   LL+F   DF     SEII L++   +F    V  +  SVDS+ TH    K    +  I N+    +SDISK I+R Y VLF E  +L + + IDK+G++++    ++ + R +D IL+ I   Q
  S:     4 IVGNQAPSFKAEAVFGD-NTFGEVSLSDFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDSFKERNVELLGCSVDSKFTHLAWKKTPLSQGGIGNIKHTLISDISKSIARSYDVLFNESVALRAFVLIDKQGVVQHLLVNNLALGRSVDEILRLIDALQ 161
>gi|119775229|ref|YP_927969.1| alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen [Shewanella amazonensis SB2B] >gi|119767729|gb|ABM00300.1| alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen [Shewanella amazonensis SB2B] (201 aa)
Score = 194, Expect = 6.8e-14, Identities = 45/160 (28%), Positives = 81/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GRK  +F + A  G  + + N++LT  +     ++FF   DF     SE+I  + + + F   GV  I +S+DS+ +H        DK  I  +    V+D+  EI + Y V   E G +   +  IDK+G++++     + + R++D +L+ I   Q
  S:     3 VLVGRKAPDFTAAAVLGSGEIVDNFNLTAAIKGKAAVVFFYPLDFTFVCPSELIAFDHRMEEFTKRGVEVIGVSIDSQFSHNAWRNTPVDKGGIGPVKYTLVADVKHEICQAYDVEHPEAGVAFRGSFLIDKEGMVRHQVVNDLPLGRNVDEMLRMIDALQ 163
>gi|77956920|ref|ZP_00820993.1| COG0450: Peroxiredoxin [Yersinia bercovieri ATCC 43970] >gi|77962934|ref|ZP_00826749.1| COG0450: Peroxiredoxin [Yersinia mollaretii ATCC 43969] (200 aa)
Score = 194, Expect = 7.5e-14, Identities = 44/160 (27%), Positives = 81/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F + A  G  + + N++L K++     +LFF   DF     SE+I  + +++ F   GV  + +S DSE  H    K   D   I  +    V+DI +EI + Y +   + G +L  +  IDK G++++     + + R+ID +L+ +   Q
  S:     2 VLVTRQAPDFTAAAVLGSGEIVENFNLKKHLNGRPAVLFFWPMDFTFVCPSELIAFDHRYEEFQKRGVEVVGVSFDSEFVHNAWRKTPVDNGGIGEVKYPMVADIKREIQKAYGIEHPDAGVALRGSFLIDKNGVVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|42520597|ref|NP_966512.1| anti-oxidant AhpCTSA family protein [Wolbachia endosymbiont of Drosophila melanogaster] >gi|42410336|gb|AAS14446.1| antioxidant, AhpC/Tsa family [Wolbachia endosymbiont of Drosophila melanogaster] (199 aa)
Score = 194, Expect = 7.8e-14, Identities = 49/159 (30%), Positives = 82/159 (51%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+ +  I+F + +     + + ++ L+K +     +LFF   DF     +E+I LN +   F   GV  I ISVDS+ +H +      +   I  +S   VSDI K ISRDY VL+++  +L +T  ID K I+++ S     + R+ID  ++ +   Q
  S:     3 LVTKSAIDFTASSVLSDGEIVDDFCLSKRIKNKYAVLFFYPLDFTFVCPTELISLNNRINEFAKRGVKVIGISVDSKFSHYKWRNTPVNDGGIGEISYTLVSDIKKSISRDYGVLYDDSIALRATFVIDDKFIVRHQSINDFSLGRNIDEFVRIVDAIQ 161
>gi|37527763|ref|NP_931108.1| alkyl hydroperoxide reductase, small subunit (antioxidant) [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36787199|emb|CAE16279.1| alkyl hydroperoxide reductase, small subunit (antioxidant) [Photorhabdus luminescens subsp. laumondii TTO1] (200 aa)
Score = 194, Expect = 7.8e-14, Identities = 44/160 (27%), Positives = 81/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F + A  G  + + N++L K++     ++FF   DF     SE+I  + +++ F   GV  I +S DSE  H    K   D+  I  +    V+D  +EI + Y +   E G +L  +  IDK G++++     + + R+ID +L+ +   Q
  S:     2 VLVTRQAPDFTAAAVLGNGEIVGNFNLKKHLNGKPAVIFFWPMDFTFVCPSELIAFDHRYEEFKKRGVEVIGVSFDSEFVHNAWRKTPVDQGGIGEVKYAMVADTKREIQKSYGIEHPEAGVALRGSFLIDKNGVVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|145411496|gb|ABP68406.1| mitochondrial tryparedoxin peroxidase [Leishmania donovani] (226 aa)
Score = 193, Expect = 9.0e-14, Identities = 48/146 (32%), Positives = 78/146 (53%)
  Q:    15 YSGKT---DSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +SGK     +I + ++    GK   +LFF   DF     +EII  + +H +F  L    + +S DS  +H   V   + K  +  M +  ++D S EI+RDY VL EE G +L     IDKKGI+++ +   + V R++D  L+ +  +Q
  S:    45 FSGKAVVNGAIKDINMNDYKGKY-IVLFFYPMDFTFVCPTEIIAFSDRHADFEKLNTQVVAVSCDSVYSHLAWVNTPRKKGGLGEMHIPVLADKSMEIARDYGVLIEESGIALRGLFIIDKKGILRHSTINDLPVGRNVDEALRVLEAFQ 193
>gi|119389031|pdb|2C0D|A Chain A, Structure Of The Mitochondrial 2-Cys Peroxiredoxin From Plasmodium Falciparum >gi|119389032|pdb|2C0D|B Chain B, Structure Of The Mitochondrial 2-Cys Peroxiredoxin From Plasmodium Falciparum (221 aa)
Score = 193, Expect = 9.4e-14, Identities = 48/155 (30%), Positives = 86/155 (55%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           L+ +K  NF ++  + K + I+N DL+  +G+    L F   ++     +EIIE N+  ++F N  V  + ISVDS  +H        +K  I N+    VSDI+K+IS++Y VL++  ++L     IDK G +++ +   + + R++  +L+TI
  S:    26 LVTKKAYNFTAQGLN-KNNEIINVDLSSFIGQKYCCLLFYPLNYTFVCPTEIIEFNKHIKDFENKNVELLGISVDSVYSHLAWKNMPIEKGGIGNVEFTLVSDINKDISKNYNVLYDNSFALRGLFIIDKNGCVRHQTVNDLPIGRNVQEVLRTI 179
>gi|109158138|pdb|2H01|A Chain A, Py00414- Plasmodium Yoelii Thioredoxin Peroxidase I (192 aa)
Score = 193, Expect = 9.4e-14, Identities = 47/134 (35%), Positives = 72/134 (53%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+  +GK   LL+F   DF     SEII L++   +F    V  +  SVDS+ TH    K    +  I N+    +SDISK I+R Y VLF E  +L + + IDK+G++++    ++ + R +D IL+ I   Q
  S:    25 LSDFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDSFKERNVELLGCSVDSKFTHLAWKKTPLSQGGIGNIKHTLISDISKSIARSYDVLFNESVALRAFVLIDKQGVVQHLLVNNLALGRSVDEILRLIDALQ 158
>gi|58699211|ref|ZP_00374018.1| antioxidant, AhpC/Tsa family, [Wolbachia endosymbiont of Drosophila ananassae] >gi|58534270|gb|EAL58462.1| antioxidant, AhpC/Tsa family, [Wolbachia endosymbiont of Drosophila ananassae] (199 aa)
Score = 193, Expect = 9.5e-14, Identities = 48/155 (30%), Positives = 82/155 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           L+ +  I+F + +     + + ++ L+K +     +LFF   DF     +E+I LN +   F   GV  I ISVDS+ +H +      +   I  +S   VSDI K ISRDY VL+++  +L +T  ID K I+++ S   + + R+ID  ++ +
  S:     3 LVTKSAIDFTASSVLSDGEIVDDFCLSKRIKNKYAVLFFYPLDFTFVCPTELISLNNRITEFAKRGVEVIGISVDSKFSHYKWRNTPVNDGGIGEISYTLVSDIKKSISRDYGVLYDDSIALRATFVIDDKFIVRHQSINDLPLGRNIDEFVRIV 157
>gi|124805845|ref|XP_001350554.1| thioredoxin peroxidase [Plasmodium falciparum 3D7] >gi|13357166|gb|AAK20024.1|AF225978_1 thioredoxin peroxidase 2 [Plasmodium falciparum] >gi|23496678|gb|AAN36234.1|AE014846_33 thioredoxin peroxidase [Plasmodium falciparum 3D7] (216 aa)
Score = 193, Expect = 1.1e-13, Identities = 48/155 (30%), Positives = 86/155 (55%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           L+ +K  NF ++  + K + I+N DL+  +G+    L F   ++     +EIIE N+  ++F N  V  + ISVDS  +H        +K  I N+    VSDI+K+IS++Y VL++  ++L     IDK G +++ +   + + R++  +L+TI
  S:    21 LVTKKAYNFTAQGLN-KNNEIINVDLSSFIGQKYCCLLFYPLNYTFVCPTEIIEFNKHIKDFENKNVELLGISVDSVYSHLAWKNMPIEKGGIGNVEFTLVSDINKDISKNYNVLYDNSFALRGLFIIDKNGCVRHQTVNDLPIGRNVQEVLRTI 174
>gi|61619796|gb|AAX47429.1| mitochondrial tryparedoxin peroxidase [Leishmania amazonensis] (226 aa)
Score = 192, Expect = 1.3e-13, Identities = 48/146 (32%), Positives = 78/146 (53%)
  Q:    15 YSGKT---DSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +SGK     +I + ++    GK   +LFF   DF     +EII  + +H +F  L    + +S DS  +H   V   + K  +  M +  ++D S EI+RDY VL EE G +L     IDKKGI+++ +   + V R++D  L+ +  +Q
  S:    45 FSGKAVVNGAIKDINMNDYKGKY-IVLFFYPMDFTFVCPTEIIAFSDRHADFEKLNTQVVAVSCDSVYSHLAWVNTPRKKGGLGEMHIPVLADKSMEIARDYGVLIEESGIALRGLFIIDKKGILRHSTINDLPVGRNVDEALRVLEAFQ 193
>gi|3328221|gb|AAC78473.1| thioredoxin peroxidase [Secale cereale] (258 aa)
Score = 192, Expect = 1.4e-13, Identities = 44/159 (27%), Positives = 84/159 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F ++A   +    +N  L+  +GK   +LFF   DF     +EI   + +H+ F  +    + +SVDS  +H   V+  +    + ++    VSD++K IS+ + VL  ++G +L     IDK+G+I++ +  ++ + R +D  L+T+   Q
  S:    66 LVGNKAPDFAAEAVFDQ--EFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHEEFEKINTEILGVSVDSVFSHLAWVQTERKSGGLGDLKYPLVSDVTKSISKSFGVLIPDQGIALRGLFMIDKEGVIQHSTINNLGIGRSVDETLRTLQALQ 223
>gi|146086967|ref|XP_001465682.1| peroxidoxin [Leishmania infantum JPCM5] >gi|16751316|gb|AAL25846.1| putative mitochondrial peroxiredoxin [Leishmania infantum] >gi|134069782|emb|CAM68108.1| peroxidoxin; tryparedoxin peroxidase [Leishmania infantum] (226 aa)
Score = 192, Expect = 1.4e-13, Identities = 42/124 (33%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + +H +F  L    + +S DS  +H   V   + K  +  M +  ++D S EI+RDY VL EE G +L     IDKKGI+++ +   + V R++D  L+ +  +Q
  S:    69 VLFFYPMDFTFVCPTEIIAFSDRHADFEKLNTQVVAVSCDSVYSHLAWVNTPRKKGGLGEMHIPVLADKSMEIARDYGVLIEESGIALRGLFIIDKKGILRHSTINDLPVGRNVDEALRVLEAFQ 193
>gi|32475263|ref|NP_868257.1| peroxiredoxin 2 [Rhodopirellula baltica SH 1] >gi|32445804|emb|CAD78535.1| peroxiredoxin 2 [Rhodopirellula baltica SH 1] (198 aa)
Score = 191, Expect = 1.5e-13, Identities = 42/137 (30%), Positives = 75/137 (54%)
  Q:    24 NYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ++ L+   GK   LLFF   DF     +EII  + + ++F +LGVN + +S+DS  TH       +++  I   +   V+D++K+ISRDY VL + G +L     ID++G++++     + + R +D  L+ +   Q
  S:    26 DFKLSDYKGKY-VLLFFWPLDFTFVCPTEIIAFSDRAKDFEDLGVNIVGVSIDSHFTHLAWTNTPRNEGGIGKTAYPLVADLNKQISRDYDVLLDGGVALRGLFLIDQEGVVRHQVVNDLPLGRSVDEALRMVKALQ 161
>gi|189347189|ref|YP_001943718.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobium limicola DSM 245] >gi|189341336|gb|ACD90739.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobium limicola DSM 245] (195 aa)
Score = 191, Expect = 1.6e-13, Identities = 50/160 (31%), Positives = 84/160 (52%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GRK   F  +A +G +  + +  LT   GK   +LFF   DF     +E+    +K   F    V  I  SVDS+ +H   ++  K+   I  ++   +SDI+K +SRDY VL E+ G SL     IDK+G++++     + + R++D +L+ +   Q
  S:     3 VLVGRKAPEFNVEAVTGGSQFVDSCKLTDYRGKY-VVLFFYPLDFTFVCPTELHAFQEKLDEFAKRNVEVIGCSVDSKFSHHAWLRTPKNLGGIEGVTYTLLSDINKTVSRDYDVLAEDAGVSLRGLFLIDKEGVVRHQVVNDLGLGRNVDEVLRMVDALQ 162
>gi|1076722|pir||S49173 hypothetical protein - barley (fragment) (242 aa)
Score = 191, Expect = 1.6e-13, Identities = 44/159 (27%), Positives = 84/159 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F ++A   +    +N  L+  +GK   +LFF   DF     +EI   + +H+ F  +    + +SVDS  +H   V+  +    + ++    VSD++K IS+ + VL  ++G +L     IDK+G+I++ +  ++ + R +D  L+T+   Q
  S:    19 LVGNKAPDFAAEAVFDQ--EFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHEEFEKINTEILGVSVDSVFSHLAWVQTERKSGGLGDLKYPLVSDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETLRTLQALQ 176
>gi|157869550|ref|XP_001683326.1| peroxidoxin; tryparedoxin peroxidase [Leishmania major] >gi|68126391|emb|CAJ03825.1| peroxidoxin; tryparedoxin peroxidase [Leishmania major] (226 aa)
Score = 191, Expect = 1.9e-13, Identities = 42/124 (33%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + +H +F  L    + +S DS  +H   V   + K  +  M +  ++D S EI+RDY VL EE G +L     IDKKGI+++ +   + V R++D  L+ +  +Q
  S:    69 VLFFYPMDFTFVCPTEIIAFSDRHADFEKLNTQVVAVSCDSVYSHLAWVNTPRKKGGLGEMHIPVLADKSMEIARDYGVLIEESGIALRGLFIIDKKGILRHSTINDLPVGRNVDEALRVLEAFQ 193
>gi|157369301|ref|YP_001477290.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Serratia proteamaculans 568] >gi|157321065|gb|ABV40162.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Serratia proteamaculans 568] (200 aa)
Score = 190, Expect = 2.2e-13, Identities = 43/160 (26%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F + A  G  + + N++  K++     +LFF   DF     SE+I  + +++ F   GV  + +S DSE  H    K   +   I  +    V+DI +EI + Y +   E G +L  +  IDK G+++      + + R+ID +++T+   Q
  S:     2 VLVTRQAPDFTAAAVLGSGEIVENFNFKKHLNGKPAVLFFWPMDFTFVCPSELIAFDHRYEEFQKRGVEVVGVSFDSEFVHNAWRKTPVENGGIGEVKYAMVADIKREIQKAYGIEHPEAGVALRGSFLIDKDGVVRAQVVNDLPIGRNIDEMIRTVDALQ 162
>gi|58584824|ref|YP_198397.1| peroxiredoxin [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|58419140|gb|AAW71155.1| Peroxiredoxin [Wolbachia endosymbiont strain TRS of Brugia malayi] (204 aa)
Score = 190, Expect = 2.3e-13, Identities = 48/155 (30%), Positives = 81/155 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           L+ +  INF + A     + + ++ L++++     +L F   DF     +E+I LN +   F    V  I ISVDS+ +H Q  K       I  +S   VSDI K ISRDY VL+++  +L +T  ID K I+++ S   + + R++D  ++ +
  S:     8 LVTKSAINFTAPAVLPNGEIVDDFCLSEHIKGKYAILLFYPLDFTFVCPTELISLNNRISEFAKRDVEVIGISVDSKFSHYQWRKTSVSNGGIGEISYTLVSDIKKSISRDYGVLYDDSIALRATFVIDDKFIVRHQSINDMPLGRNMDEFIRIV 162
>gi|73998671|ref|XP_535031.2| PREDICTED: similar to Thioredoxin-dependent peroxide reductase, mitochondrial precursor (Peroxiredoxin 3) (Antioxidant protein 1) (AOP-1) (MER5 protein homolog) (HBC189) (PRX III) isoform 1 [Canis familiaris] (257 aa)
Score = 190, Expect = 2.5e-13, Identities = 39/124 (31%), Positives = 68/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K + F ++  + + +SVDS  TH   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    97 VLFFYPLDFTFVCPTEIVAFSDKAKEFHDVNCDVVAVSVDSHFTHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGPGIALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 221
>gi|24215509|ref|NP_712990.1| 2-Cys thioredoxin peroxidase [Leptospira interrogans serovar Lai str. 56601] >gi|45657102|ref|YP_001188.1| peroxiredoxin [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|24196646|gb|AAN50008.1|AE011446_4 2-Cys thioredoxin peroxidase [Leptospira interrogans serovar Lai str. 56601] >gi|45600339|gb|AAS69825.1| peroxiredoxin [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (193 aa)
Score = 189, Expect = 2.8e-13, Identities = 52/152 (34%), Positives = 76/152 (50%)
  Q:     9 NFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +F ++A  GK   I    L+   GK   +LFF   DF     +EIIE + K   F  LG   + +SVDS  TH       K +  I  +    ++D++K ISRDY VL E G +L  T  ID  G+I+  +   + V R+ID  ++ I  +Q
  S:    10 DFKAEAVLGK--EIKEIKLSDYKGK-WVVLFFYPLDFTFVCPTEIIEYDNKLAEFKKLGTEVLGVSVDSAFTHLAWKNTPKKEGGIGEIKYPLIADLTKSISRDYNVLTEGGVALRGTFIIDPAGVIRQATINDLPVGRNIDEAIRLIKAFQ 158
>gi|113460621|ref|YP_718687.1| AhpC/TSA family protein [Haemophilus somnus 129PT] >gi|112822664|gb|ABI24753.1| AhpC/TSA family protein [Haemophilus somnus 129PT] (200 aa)
Score = 189, Expect = 2.9e-13, Identities = 42/160 (26%), Positives = 83/160 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F + A  G  + +  ++L +++     ++FF   DF     SE+I  + +++ F +  V  I +S+DSE TH        D   I  +    V+DI  EI++ Y +   E G +L ++  IDK+G++++     + + R+ID +L+ +   Q
  S:     2 VLVTRQAPDFTAAAVLGNGEIVEKFNLKQHIAGKAAVVFFYPMDFTFVCPSELIAFDHRYKEFQDRNVEIIGVSIDSEFTHNAWRNTPVDNGGIGQVQYALVADIKHEIAKAYGIEHPEAGVALRASFLIDKEGVVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|70942786|ref|XP_741518.1| 2-Cys peroxiredoxin [Plasmodium chabaudi chabaudi] >gi|56519947|emb|CAH76376.1| 2-Cys peroxiredoxin, putative [Plasmodium chabaudi] (152 aa)
Score = 189, Expect = 3.1e-13, Identities = 50/149 (33%), Positives = 81/149 (54%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDID 150
           ++G +  +F ++A  G  +S     L+  +GK   LL+F   DF     SEII L++  ++F    V  +  SVDS+ TH    K    +  I N+    +SDISK I+RDY VLF E  +L + + IDK+GI+++    ++ + R +D
  S:     4 IVGSQAPHFKAEAVFGD-NSFGEVSLSDYIGKKYILLYFYPLDFTFVCPSEIIALDKALESFKERNVELLGCSVDSKFTHLAWKKTPLQQGGIGNIRHTLLSDISKSIARDYDVLFNESVALRAFVLIDKQGIVQHLLVNNLALGRSVD 151
>gi|124809308|ref|XP_001348542.1| 2-Cys peroxiredoxin [Plasmodium falciparum 3D7] >gi|7677316|gb|AAF67110.1|AF225977_1 thioredoxin peroxidase 1 [Plasmodium falciparum] >gi|10180978|gb|AAG14354.1|AF294426_1 2-Cys peroxiredoxin [Plasmodium falciparum] >gi|23497438|gb|AAN36981.1|AE014822_16 2-Cys peroxiredoxin [Plasmodium falciparum 3D7] >gi|8809674|dbj|BAA97121.1| 2-Cys peroxiredoxin [Plasmodium falciparum] (195 aa)
Score = 189, Expect = 3.2e-13, Identities = 46/130 (35%), Positives = 69/130 (53%)
  Q:    31 MGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +GK   LL+F   DF     SEII L++    F    V  I  SVDS+ TH    K    K  I N+    +SDI+K ISR Y VLF +  SL + + IDK+G++++    ++ + R ++ +L+ I   Q
  S:    32 IGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFKERNVELIGCSVDSKYTHLAWKKTPLTKGGIGNIQHTLISDITKSISRSYNVLFGDSVSLRAFVLIDKQGVVQHLLVNNLAIGRSVEEVLRIIDAVQ 161
>gi|188534667|ref|YP_001908464.1| Putative alkyl hydroperoxide reductase subunit C [Erwinia tasmaniensis] >gi|188029709|emb|CAO97588.1| Putative alkyl hydroperoxide reductase subunit C [Erwinia tasmaniensis] (200 aa)
Score = 188, Expect = 4.1e-13, Identities = 43/160 (26%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R   +F + A  G  + + N++  K+     T++FF   DF     SE+I  ++++  F   GV  I +S DSE  H    K   DK  I  +    V+DI +EI + + +   E G +L  +  ID+ G++++     + + R++D +L+ +   Q
  S:     2 VLVTRPAPDFTAAAVLGNGEIVENFNFKKHTAGKATVVFFWPMDFTFVCPSELIAFDKRYAEFQKRGVEVIGVSFDSEFVHNAWRKTPVDKGGIGEVQYAMVADIKREIQKAWGIEHPEAGVALRGSFLIDQAGVVRHQVVNDLPLGRNVDEMLRMVDALQ 162
>gi|54309736|ref|YP_130756.1| Ahp/CTSA family anti-oxidant protein [Photobacterium profundum SS9] >gi|46914174|emb|CAG20954.1| putative antioxidant, AhpC/Tsa family [Photobacterium profundum SS9] (205 aa)
Score = 188, Expect = 4.1e-13, Identities = 43/160 (26%), Positives = 83/160 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR   +F + A  G  + + +Y+L +N+     ++FF   DF     SE+I  ++++ +F + GV  I IS+DS+ +H      L +   I  +    ++D   EI + Y V   E G +   +  IDK+G++++     + + R+ID +L+ +   Q
  S:     7 VLVGRPAPDFTAAAVLGNGEIVDSYNLFENIKGKAAVIFFYPLDFTFVCPSELIAFDKRYADFQSKGVEVIGISIDSQFSHNAWRNTLVEDGGIGEVQYPLIADTKHEICKAYDVEHPEAGVAFRGSFLIDKEGMVRHQVVNDLPLGRNIDEMLRMVDALQ 167
>gi|90410850|ref|ZP_01218865.1| putative antioxidant, AhpC/Tsa family protein [Photobacterium profundum 3TCK] >gi|90328481|gb|EAS44779.1| putative antioxidant, AhpC/Tsa family protein [Photobacterium profundum 3TCK] (201 aa)
Score = 188, Expect = 4.2e-13, Identities = 42/160 (26%), Positives = 83/160 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR   +F + A  G  + + +Y+L +N+     ++FF   DF     SE+I  ++++ +F + GV  I +S+DS+ +H      L +   I  +    ++D   EI + Y V   E G +   +  IDK+G++++     + + R+ID +L+ +   Q
  S:     3 VLVGRPAPDFTAAAVLGNGEIVDSYNLIENIKGKAAVIFFYPLDFTFVCPSELIAFDKRYADFQSKGVEVIGVSIDSQFSHNAWRNTLVEDGGIGEVQYPLIADTKHEICKAYDVEHPEAGVAFRGSFLIDKEGMVRHQVVNDLPLGRNIDEMLRMVDALQ 163
>gi|71408703|ref|XP_806739.1| tryparedoxin peroxidase, putative [Trypanosoma cruzi strain CL Brener] >gi|70870571|gb|EAN84888.1| tryparedoxin peroxidase, putative [Trypanosoma cruzi] (226 aa)
Score = 188, Expect = 4.2e-13, Identities = 43/139 (30%), Positives = 73/139 (52%)
  Q:    22 ILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           I +  L    GK   LLF+   DF     +EI   +     F  +    + +S DS+ +H   +   ++K  +  MS+  +SD++KEI+RDY VL EE G SL     ID KGI+++ +   + V R+++ +L+ +  +Q
  S:    55 IQDISLNDYKGKYVVLLFY-PMDFTFVCPTEITAFSDAQAEFDKINTQVVAVSCDSQYSHLAWINTPRNKGGLGEMSIPVLSDLTKEIARDYGVLIEEQGISLRGLFIIDDKGILRHITVNDLPVGRNVEEVLRVVQAFQ 193
>gi|4388655|emb|CAA06923.1| peroxiredoxin [Trypanosoma cruzi] (226 aa)
Score = 187, Expect = 4.7e-13, Identities = 43/139 (30%), Positives = 73/139 (52%)
  Q:    22 ILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           I +  L    GK   LLF+   DF     +EI   +     F  +    + +S DS+ +H   +   ++K  +  MS+  +SD++KEI+RDY VL EE G SL     ID KGI+++ +   + V R+++ +L+ +  +Q
  S:    55 IQDISLNDYKGKYVVLLFY-PMDFTFVCPTEITAFSDAQAEFDKINTQVVAVSCDSQYSHLAWINTPRNKGGLGEMSIPVLSDLTKEIARDYGVLIEEQGISLRGLFIIDDKGILRHITVNDLPVGRNVEEVLRVVQAFQ 193
>gi|118475037|ref|YP_891456.1| alkyl hydroperoxide reductase TsaA [Campylobacter fetus subsp. fetus 82-40] >gi|118414263|gb|ABK82683.1| alkyl hydroperoxide reductase TsaA [Campylobacter fetus subsp. fetus 82-40] (198 aa)
Score = 187, Expect = 5.2e-13, Identities = 40/143 (27%), Positives = 76/143 (53%)
  Q:    16 SGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIAT 158
           +G+ D   N++L KN+G  G ++FF  +DF     SEII  + +++ F   G+  I +S D+E  H    +       I  +    V+D+ KE ++ + VLF+E  +L  +  +DK G +++     + + R+ID +++ + T
  S:    18 NGQIDE--NFELYKNIGSKGAVVFFYPKDFTFVCPSEIIAFDHRYKEFKERGIEVIGVSCDNEYCHFAWRETDVKCGGIGRVQFPLVADLKKEWAKGFDVLFDEAVALRGSFLLDKDGTVRHAVINDLPLGRNIDEMVRMVDT 158
>gi|154337704|ref|XP_001562236.1| peroxidoxin [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134062125|emb|CAM36512.1| peroxidoxin; tryparedoxin peroxidase [Leishmania braziliensis] (226 aa)
Score = 186, Expect = 5.8e-13, Identities = 41/124 (33%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + ++  F  L    I +S DSE +H   V   + K  +  M +  ++D S EI+RDY VL E  G +L     IDKKG +++ +   + V R++D +L+ +  +Q
  S:    69 VLFFYPMDFTFVCPTEIIAFSDRYLEFEKLNTQVIAVSCDSEYSHLAWVNTPRKKGGLGEMKIPVLADKSMEIARDYGVLIESAGIALRGLFVIDKKGTLRHSTINDLPVGRNVDEVLRVVEAFQ 193
>gi|49082744|gb|AAT50772.1| PA0848 [synthetic construct] (200 aa)
Score = 186, Expect = 5.8e-13, Identities = 43/160 (26%), Positives = 82/160 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ ++  +F + A  G    +  + L+   GK   +LFF   DF     SEII  N +   F  LGV  + +S+DS+ TH        +K  I  +    V+D+  EI+R Y +  E+G +L ++  ID+ G++++    ++ + R++D +++ +   Q
  S:     3 VLVNKQAPDFTAAAVLGDGSIVDAFQLSSLRGKY-VVLFFWPLDFTFVCPSEIIAHNNRMDKFRELGVEVVGVSIDSQFTHHAWRSTPVEKGGIGAVEFTMVADVKHEITRAYGIEHEDGVALRASFLIDRAGVVQHQVVNNLPLGREVDEMVRLVEALQ 161
>gi|15596045|ref|NP_249539.1| alkyl hydroperoxide reductase [Pseudomonas aeruginosa PAO1] >gi|107100305|ref|ZP_01364223.1| hypothetical protein PaerPA_01001330 [Pseudomonas aeruginosa PACS2] >gi|116048771|ref|YP_792429.1| alkyl hydroperoxide reductase [Pseudomonas aeruginosa UCBPP-PA14] >gi|194550184|ref|YP_002085213.1| hypothetical protein PACG_05391 [Pseudomonas aeruginosa C3719] >gi|194556118|ref|YP_002091146.1| hypothetical protein PA2G_06022 [Pseudomonas aeruginosa 2192] >gi|9946744|gb|AAG04237.1|AE004519_8 probable alkyl hydroperoxide reductase [Pseudomonas aeruginosa PAO1] >gi|115583992|gb|ABJ10007.1| probable alkyl hydroperoxide reductase [Pseudomonas aeruginosa UCBPP-PA14] >gi|126171130|gb|EAZ56641.1| hypothetical protein PACG_05391 [Pseudomonas aeruginosa C3719] >gi|126198511|gb|EAZ62574.1| hypothetical protein PA2G_06022 [Pseudomonas aeruginosa 2192] (199 aa)
Score = 186, Expect = 5.8e-13, Identities = 43/160 (26%), Positives = 82/160 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ ++  +F + A  G    +  + L+   GK   +LFF   DF     SEII  N +   F  LGV  + +S+DS+ TH        +K  I  +    V+D+  EI+R Y +  E+G +L ++  ID+ G++++    ++ + R++D +++ +   Q
  S:     3 VLVNKQAPDFTAAAVLGDGSIVDAFQLSSLRGKY-VVLFFWPLDFTFVCPSEIIAHNNRMDKFRELGVEVVGVSIDSQFTHHAWRSTPVEKGGIGAVEFTMVADVKHEITRAYGIEHEDGVALRASFLIDRAGVVQHQVVNNLPLGREVDEMVRLVEALQ 161
>gi|183601030|ref|ZP_02962523.1| hypothetical protein PROSTU_04651 [Providencia stuartii ATCC 25827] >gi|188019368|gb|EDU57408.1| hypothetical protein PROSTU_04651 [Providencia stuartii ATCC 25827] (200 aa)
Score = 186, Expect = 6.2e-13, Identities = 42/160 (26%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F + A  G  + + N++L  ++     ++FF   DF     SE+I  + +++ F   GV  I +S DSE  H    K   D   I  +    V+D+ +EI + Y +   E G +L  +  +DK G++++     + + R+ID +L+ +   Q
  S:     2 VLVTRQAPDFTAAAVLGNGEIVDNFNLKNHLNGRPAVIFFWPMDFTFVCPSELIAFDHRYEEFKKRGVEVIGVSFDSEFVHNAWRKTPVDNGGIGEVKYPMVADVKREIMKAYGIEHPEAGVALRGSFLVDKNGVVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|6680690|ref|NP_031478.1| peroxiredoxin 3 [Mus musculus] >gi|126986|sp|P20108|PRDX3_MOUSE Thioredoxin-dependent peroxide reductase, mitochondrial precursor (Perioredoxin-3) (PRX III) (Antioxidant protein 1) (AOP-1) (Protein MER5) >gi|309436|gb|AAA39524.1| housekeeping protein >gi|7546837|gb|AAF63705.1| peroxiredoxin III [Mus musculus] >gi|12832440|dbj|BAB22108.1| unnamed protein product [Mus musculus] >gi|13542859|gb|AAH05626.1| Prdx3 protein [Mus musculus] >gi|148669902|gb|EDL01849.1| peroxiredoxin 3 [Mus musculus] (257 aa)
Score = 186, Expect = 6.4e-13, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SDI+K+ISRDY VL E  G +L     ID  G++K+ S   + V R ++  L+ +  +Q
  S:    97 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNITLLSDITKQISRDYGVLLESAGIALRGLFIIDPNGVVKHLSVNDLPVGRSVEETLRLVKAFQ 221
>gi|126273047|ref|XP_001367972.1| PREDICTED: similar to Aop1_Human, MER5(Aop1_Mouse)-like protein [Monodelphis domestica] (256 aa)
Score = 186, Expect = 6.6e-13, Identities = 39/124 (31%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    I +SVDS+ +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    96 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVIAVSVDSQFSHLAWINTPRKSGGLGHMNIALLSDLTKQISRDYGVLLEGPGLALRGLFIIDPNGVIKHMSINDLPVGRSVEETLRLVKAFQ 220
>gi|157146981|ref|YP_001454300.1| hypothetical protein CKO_02758 [Citrobacter koseri ATCC BAA-895] >gi|157084186|gb|ABV13864.1| hypothetical protein CKO_02758 [Citrobacter koseri ATCC BAA-895] (200 aa)
Score = 186, Expect = 6.7e-13, Identities = 42/160 (26%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F + A  G  + + N++  ++     T+LFF   DF     SE+I  +++++ F   GV  + +S DSE  H        DK  I  +    V+D+ +EI + Y +   E G +L  +  ID  G++++     + + R+ID +L+ +   Q
  S:     2 VLVTRQAPDFTAAAVLGSGEIVENFNFKQHTNGKATVLFFWPMDFTFVCPSELIAFDKRYEEFQARGVEVVGVSFDSEFVHNAWRNTPVDKGGIGAVKYAMVADVKREIQKAYGIEHPEAGVALRGSFLIDANGVVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|2499477|sp|Q96468|BAS1_HORVU 2-Cys peroxiredoxin BAS1, chloroplast precursor (Thiol-specific antioxidant protein) >gi|861010|emb|CAA84396.1| bas1 protein [Hordeum vulgare subsp. vulgare] (210 aa)
Score = 186, Expect = 6.8e-13, Identities = 44/159 (27%), Positives = 84/159 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F ++A   +    +N  L+  +GK   +LFF   DF     +EI   + +H+ F  +    + +SVDS  +H   V+  +    + ++    VSD++K IS+ + VL  ++G +L     IDK+G+I++ +  ++ + R +D  L+T+   Q
  S:    19 LVGNKAPDFAAEAVFDQ--EFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHEEFEKINTEILGVSVDSVFSHLAWVQTERKSGGLGDLKYPLVSDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETLRTLQALQ 176
>gi|114690183|ref|XP_521269.2| PREDICTED: similar to Aop1_Human, MER5(Aop1_Mouse)-like protein isoform 3 [Pan troglodytes] >gi|114690185|ref|XP_001142221.1| PREDICTED: similar to Aop1_Human, MER5(Aop1_Mouse)-like protein isoform 2 [Pan troglodytes] (256 aa)
Score = 186, Expect = 6.9e-13, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    96 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYSVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 220
>gi|68075607|ref|XP_679723.1| 2-Cys peroxiredoxin [Plasmodium berghei strain ANKA] >gi|56500534|emb|CAH95442.1| 2-Cys peroxiredoxin, putative [Plasmodium berghei] (194 aa)
Score = 186, Expect = 6.9e-13, Identities = 51/159 (32%), Positives = 85/159 (53%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ++G +  +F ++A  G  ++     L+  +GK   LL+F   DF     SEII L++  ++F    V  +  SVDS+ TH    K    +  I N+    +SDISK I+R Y VLF E  +L + + IDK+G++++    ++ + R +D IL+ I   Q
  S:     4 IVGNQAPSFKAEAVFGD-NNFGEVSLSDFIGKKYILLYFYPLDFTFVCPSEIIALDKALESFKERNVELLGCSVDSKFTHLAWKKTPLSQGGIGNIKHTLISDISKSIARSYDVLFNESVALRAFVLIDKQGVVQHL-LNNLALGRSVDEILRLIDALQ 160
>gi|2829687|sp|P80602|BAS1_WHEAT 2-Cys peroxiredoxin BAS1, chloroplast precursor (Thiol-specific antioxidant protein) >gi|1805351|dbj|BAA19099.1| Thiol-specific antioxidant protein [Triticum aestivum] (210 aa)
Score = 186, Expect = 7.4e-13, Identities = 44/159 (27%), Positives = 84/159 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F ++A   +    +N  L+  +GK   +LFF   DF     +EI   + +H+ F  +    + +SVDS  +H   V+  +    + ++    VSD++K IS+ + VL  ++G +L     IDK+G+I++ +  ++ + R +D  L+T+   Q
  S:    19 LVGNKAPDFAAEAVFDQ--EFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHEEFEKINTEILGVSVDSVFSHLAWVQTERKSGGLGDLKYPLVSDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETLRTLRALQ 176
>gi|170718946|ref|YP_001784113.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haemophilus somnus 2336] >gi|168827075|gb|ACA32446.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haemophilus somnus 2336] (200 aa)
Score = 185, Expect = 7.8e-13, Identities = 41/160 (25%), Positives = 83/160 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F + A  G  + +  ++L +++     ++FF   DF     SE+I  + +++ F +  V  I +S+DSE TH        D   I  +    V+DI  +I++ Y +   E G +L ++  IDK+G++++     + + R+ID +L+ +   Q
  S:     2 VLVTRQAPDFTAAAVLGNGEIVEKFNLKQHIAGKAAVVFFYPMDFTFVCPSELIAFDHRYKEFQDRNVEIIGVSIDSEFTHNAWRNTPVDNGGIGQVQYALVADIKHDIAKAYGIEHPEAGVALRASFLIDKEGVVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|126173967|ref|YP_001050116.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS155] >gi|153000259|ref|YP_001365940.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS185] >gi|160874892|ref|YP_001554208.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS195] >gi|125997172|gb|ABN61247.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS155] >gi|151364877|gb|ABS07877.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS185] >gi|160860414|gb|ABX48948.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS195] (201 aa)
Score = 185, Expect = 8.2e-13, Identities = 43/160 (26%), Positives = 81/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR+  +F + A  G  + + +++LT  +     ++FF   DF     SE+I  + + + F   GV  I +S+DS+ TH        +K  I  +    V+D+  EI + Y V   E G +   +  IDK+G++++     + + R++D +L+ I   Q
  S:     3 VLVGRQAPDFTAAAVLGSGEIVDSFNLTAAIKGKPAVVFFYPLDFTFVCPSELIAFDHRMEEFTKRGVEVIGVSIDSQFTHNAWRNTPVEKGGIGQVKYTLVADVKHEICKAYDVEHPEAGVAFRGSFLIDKEGMVRHQVVNDLPLGRNVDEMLRMIDALQ 163
>gi|145636415|ref|ZP_01792083.1| probable peroxiredoxin [Haemophilus influenzae PittHH] >gi|148827266|ref|YP_001292019.1| peroxiredoxin [Haemophilus influenzae PittGG] >gi|145270240|gb|EDK10175.1| probable peroxiredoxin [Haemophilus influenzae PittHH] >gi|148718508|gb|ABQ99635.1| probable peroxiredoxin [Haemophilus influenzae PittGG] (200 aa)
Score = 185, Expect = 8.4e-13, Identities = 40/160 (25%), Positives = 81/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F S A  G  + + N++  K++     ++FF   DF     SE+I  + +++ F   GV  + +S+DS+ TH        +   I  +     +D+  EI++ Y +   E G +L ++  IDK G++++     + + R+ID +L+ +   Q
  S:     2 VLVTRQAPDFTSSAVLGNGEIVDNFNFKKHIAGKAAVIFFYPLDFTFVCPSELIAFDHRYEEFKKRGVEVVGVSIDSQFTHNAWRNTPTENGGIGQVKYALAADVKHEIAQAYGIEHPEAGVALRASFLIDKNGVVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|194042134|ref|XP_001928552.1| PREDICTED: similar to antioxidant protein isoform 2 [Sus scrofa] (243 aa)
Score = 185, Expect = 8.5e-13, Identities = 39/124 (31%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    83 VLFFYPLDFTFVCPTEIIAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGPGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 207
>gi|194042132|ref|XP_001928549.1| PREDICTED: similar to antioxidant protein isoform 1 [Sus scrofa] (261 aa)
Score = 185, Expect = 8.5e-13, Identities = 39/124 (31%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:   101 VLFFYPLDFTFVCPTEIIAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGPGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 225
>gi|167627852|ref|YP_001678352.1| AhpC/TSA family peroxiredoxin [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167597853|gb|ABZ87851.1| peroxiredoxin of the AhpC/TSA family [Francisella philomiragia subsp. philomiragia ATCC 25017] (199 aa)
Score = 185, Expect = 8.7e-13, Identities = 43/160 (26%), Positives = 79/160 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+G+K   F + A  G  + + +YD  K M     ++ F   DF     SE+I L+++      LGV  + +S+DS  TH        ++  I  +    V+DI++EI + Y V  E G +   T  IDK G++++     + + R++D +++ +   Q
  S:     2 VLVGKKAPLFNAPAVLGTGEIVDSYDFAKAMQGKYAVVVFYPLDFTFVCPSELIALDKRTAKLKELGVEVVSVSIDSHFTHNAWRNTPINEGGIGPVKYTMVADINQEIVKAYDVQSEGGMAFRGTFLIDKSGVVRHQVVNDLPLGRNMDEVIRMVEALQ 161
>gi|149040547|gb|EDL94585.1| peroxiredoxin 3 [Rattus norvegicus] (257 aa)
Score = 185, Expect = 8.7e-13, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    97 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNITLLSDLTKQISRDYGVLLESAGIALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 221
>gi|27806083|ref|NP_776857.1| peroxiredoxin 3 [Bos taurus] >gi|2507170|sp|P35705|PRDX3_BOVIN Thioredoxin-dependent peroxide reductase, mitochondrial precursor (Peroxiredoxin-3) (Antioxidant protein 1) (AOP-1) (Protein SP-22) >gi|1127011|dbj|BAA11511.1| antioxidant protein [Bos taurus] >gi|74267970|gb|AAI03010.1| Peroxiredoxin 3 [Bos taurus] (257 aa)
Score = 185, Expect = 8.8e-13, Identities = 39/124 (31%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    97 VLFFYPLDFTFVCPTEIIAFSDKASEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGPGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 221
>gi|15602660|ref|NP_245732.1| TsaA [Pasteurella multocida subsp. multocida str. Pm70] >gi|12721099|gb|AAK02879.1| TsaA [Pasteurella multocida subsp. multocida str. Pm70] (200 aa)
Score = 185, Expect = 9.2e-13, Identities = 41/160 (25%), Positives = 83/160 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F + A  G  + + N++  +++     ++FF   DF     SE+I  + +++ F   GV  + IS+DSE +H    K   +   I  +    V+DI  EI++ + +   E G +L ++  IDK G++++     + + R+ID +L+ +   Q
  S:     2 VLVTRQAPDFTAAAVLGNGEIVDNFNFKQHIAGKAAVVFFYPLDFTFVCPSELIAFDHRYEEFQKRGVEVVGISIDSEFSHNAWRKTPVENGGIGEVKYALVADIKHEIAQAFGIEHPEAGVALRASFLIDKDGVVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|119569781|gb|EAW49396.1| peroxiredoxin 3, isoform CRA_a [Homo sapiens] (225 aa)
Score = 184, Expect = 9.8e-13, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    65 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 189
>gi|32483377|ref|NP_054817.2| peroxiredoxin 3 isoform b [Homo sapiens] (238 aa)
Score = 184, Expect = 9.8e-13, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    78 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 202
>gi|114633017|ref|XP_001153938.1| PREDICTED: peroxiredoxin 3 isoform 1 [Pan troglodytes] (239 aa)
Score = 184, Expect = 9.8e-13, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    79 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 203
>gi|114633019|ref|XP_001154135.1| PREDICTED: peroxiredoxin 3 isoform 2 [Pan troglodytes] (257 aa)
Score = 184, Expect = 9.8e-13, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    96 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 220
>gi|75070966|sp|Q5REY3|PRDX3_PONAB Thioredoxin-dependent peroxide reductase, mitochondrial precursor (Peroxiredoxin-3) >gi|55725787|emb|CAH89674.1| hypothetical protein [Pongo abelii] (256 aa)
Score = 184, Expect = 9.8e-13, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    96 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 220
>gi|54696872|gb|AAV38808.1| peroxiredoxin 3 [synthetic construct] >gi|54696874|gb|AAV38809.1| peroxiredoxin 3 [synthetic construct] >gi|61366442|gb|AAX42860.1| peroxiredoxin 3 [synthetic construct] >gi|61366450|gb|AAX42861.1| peroxiredoxin 3 [synthetic construct] (257 aa)
Score = 184, Expect = 9.8e-13, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    96 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 220
>gi|14250063|gb|AAH08435.1| Peroxiredoxin 3 [Homo sapiens] (256 aa)
Score = 184, Expect = 9.8e-13, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    96 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 220
>gi|5802974|ref|NP_006784.1| peroxiredoxin 3 isoform a precursor [Homo sapiens] >gi|114633015|ref|XP_001154193.1| PREDICTED: peroxiredoxin 3 isoform 3 [Pan troglodytes] >gi|2507171|sp|P30048|PRDX3_HUMAN Thioredoxin-dependent peroxide reductase, mitochondrial precursor (Peroxiredoxin-3) (PRX III) (Antioxidant protein 1) (AOP-1) (Protein MER5 homolog) (HBC189) >gi|682748|dbj|BAA08389.1| Aop1_Human, MER5(Aop1_Mouse)-like protein [Homo sapiens] >gi|12803699|gb|AAH02685.1| Peroxiredoxin 3 [Homo sapiens] >gi|13937905|gb|AAH07062.1| Peroxiredoxin 3 [Homo sapiens] >gi|16307049|gb|AAH09601.1| Peroxiredoxin 3 [Homo sapiens] >gi|18203832|gb|AAH21691.1| Peroxiredoxin 3 [Homo sapiens] >gi|18490861|gb|AAH22373.1| Peroxiredoxin 3 [Homo sapiens] >gi|37747400|gb|AAH59169.1| Peroxiredoxin 3 [Homo sapiens] >gi|47496635|emb|CAG29340.1| PRDX3 [Homo sapiens] >gi|54696876|gb|AAV38810.1| peroxiredoxin 3 [Homo sapiens] >gi|55958647|emb|CAI15802.1| peroxiredoxin 3 [Homo sapiens] >gi|61356647|gb|AAX41269.1| peroxiredoxin 3 [synthetic construct] >gi|82583664|gb|ABB84468.1| peroxiredoxin 3 [Homo sapiens] >gi|114205468|gb|AAI11398.1| Peroxiredoxin 3 [Homo sapiens] >gi|119569782|gb|EAW49397.1| peroxiredoxin 3, isoform CRA_b [Homo sapiens] >gi|119569784|gb|EAW49399.1| peroxiredoxin 3, isoform CRA_b [Homo sapiens] >gi|189053735|dbj|BAG35987.1| unnamed protein product [Homo sapiens] (256 aa)
Score = 184, Expect = 9.8e-13, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    96 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 220
>gi|116328653|ref|YP_798373.1| peroxiredoxin [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116330690|ref|YP_800408.1| peroxiredoxin [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116121397|gb|ABJ79440.1| Peroxiredoxin [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116124379|gb|ABJ75650.1| Peroxiredoxin [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (193 aa)
Score = 184, Expect = 1.0e-12, Identities = 51/152 (33%), Positives = 77/152 (50%)
  Q:     9 NFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +F ++A  GK   I    L+   GK   +LFF   DF     +EIIE + K   F  LG   + +SVDS  TH       K +  I ++    ++D++K ISRDY VL + G +L  T  ID  G+I+  +   + V R+ID  ++ I  +Q
  S:    10 DFKAEAVLGK--EIKEIKLSDYKGK-WVVLFFYPLDFTFVCPTEIIEYDNKLPEFKKLGAEILGVSVDSAFTHLAWKNTPKKEGGIGDIKYPLIADLTKSISRDYNVLTDGGVALRGTFIIDPAGLIRQATINDLPVGRNIDEAIRLIKAFQ 158
>gi|78101145|pdb|1ZYE|A Chain A, Crystal Strucutre Analysis Of Bovine Mitochondrial Peroxiredoxin Iii >gi|78101146|pdb|1ZYE|B Chain B, Crystal Strucutre Analysis Of Bovine Mitochondrial Peroxiredoxin Iii >gi|78101147|pdb|1ZYE|C Chain C, Crystal Strucutre Analysis Of Bovine Mitochondrial Peroxiredoxin Iii >gi|78101148|pdb|1ZYE|D Chain D, Crystal Strucutre Analysis Of Bovine Mitochondrial Peroxiredoxin Iii >gi|78101149|pdb|1ZYE|E Chain E, Crystal Strucutre Analysis Of Bovine Mitochondrial Peroxiredoxin Iii >gi|78101150|pdb|1ZYE|F Chain F, Crystal Strucutre Analysis Of Bovine Mitochondrial Peroxiredoxin Iii >gi|78101151|pdb|1ZYE|G Chain G, Crystal Strucutre Analysis Of Bovine Mitochondrial Peroxiredoxin Iii >gi|78101152|pdb|1ZYE|H Chain H, Crystal Strucutre Analysis Of Bovine Mitochondrial Peroxiredoxin Iii >gi|78101153|pdb|1ZYE|I Chain I, Crystal Strucutre Analysis Of Bovine Mitochondrial Peroxiredoxin Iii >gi|78101154|pdb|1ZYE|J Chain J, Crystal Strucutre Analysis Of Bovine Mitochondrial Peroxiredoxin Iii >gi|78101155|pdb|1ZYE|K Chain K, Crystal Strucutre Analysis Of Bovine Mitochondrial Peroxiredoxin Iii >gi|78101156|pdb|1ZYE|L Chain L, Crystal Strucutre Analysis Of Bovine Mitochondrial Peroxiredoxin Iii (220 aa)
Score = 184, Expect = 1.0e-12, Identities = 39/124 (31%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    60 VLFFYPLDFTFVCPTEIIAFSDKASEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGPGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 184
>gi|152986372|ref|YP_001350016.1| alkyl hydroperoxide reductase [Pseudomonas aeruginosa PA7] >gi|150961530|gb|ABR83555.1| probable alkyl hydroperoxide reductase [Pseudomonas aeruginosa PA7] (199 aa)
Score = 184, Expect = 1.1e-12, Identities = 42/160 (26%), Positives = 83/160 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ ++  +F + A  G    + ++ L+   GK   +LFF   DF     SEII  N +   F  LGV  + +S+DS+ TH        +K  I  +    V+D+  EI+R Y +  ++G +L ++  ID+ G++++    ++ + R++D +++ +   Q
  S:     3 VLVNKQAPDFNAAAVLGDGSIVDSFQLSSLRGKY-VVLFFWPLDFTFVCPSEIIAHNNRMDKFRELGVEVVGVSIDSQFTHHAWRSTPVEKGGIGAVEFTMVADVKHEITRAYGIEHDDGVALRASFLIDRAGVVQHQVVNNLPLGREVDEMVRLVEALQ 161
>gi|62183806|gb|AAX73294.1| mitochondrial peroxiredoxin [Leishmania donovani] (226 aa)
Score = 184, Expect = 1.1e-12, Identities = 41/124 (33%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + +H +F  L    + +S DS  +H       + K  +  M +  ++D S EI+RDY VL EE G +L     IDKKGI+++ +   + V R++D  L+ +  +Q
  S:    69 VLFFYPMDFTFVCPTEIIAFSDRHADFEKLNTQVVAVSCDSVYSHLAWGNTPRKKGGLGEMHIPVLADKSMEIARDYGVLIEESGIALRGLFIIDKKGILRHSTINDLPVGRNVDEALRVLEAFQ 193
>gi|149689640|ref|XP_001493666.1| PREDICTED: similar to antioxidant protein isoform 1 [Equus caballus] (256 aa)
Score = 184, Expect = 1.1e-12, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    97 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIPLLSDLTKQISRDYGVLLEGAGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 221
>gi|149689642|ref|XP_001493688.1| PREDICTED: similar to antioxidant protein isoform 2 [Equus caballus] (245 aa)
Score = 184, Expect = 1.1e-12, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    86 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIPLLSDLTKQISRDYGVLLEGAGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 210
>gi|123496272|ref|XP_001326926.1| tryparedoxin peroxidase, putative [Trichomonas vaginalis G3] >gi|121909848|gb|EAY14703.1| tryparedoxin peroxidase, putative [Trichomonas vaginalis G3] (196 aa)
Score = 184, Expect = 1.1e-12, Identities = 50/160 (31%), Positives = 79/160 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ML+G K  +F ++A    TD      L    GK   +LF    DF     +EIIE + K + F  LG   I +SVDS  TH   +   +    I ++    + D+  +IS+ Y    EE G+ L  T+ ID +GI+++      +V R++D I++ +  YQ
  S:     1 MLVGNKAPSFKAEAVFPDTD-FKKVSLDSYKGK-WLVLFAWPLDFTFVCPTEIIEFSNKFEEFKKLGCEVIGMSVDSNFTHLAWINTPRKDGGIGSLQYPIIGDLGAKISKAYGFYMEEAGHDLRGTVIIDPQGIVRHIQMNHPDVGRNVDEIIRLVKAYQ 159
>gi|118395270|ref|XP_001029987.1| AhpC/TSA family protein [Tetrahymena thermophila SB210] >gi|89284270|gb|EAR82324.1| AhpC/TSA family protein [Tetrahymena thermophila SB210] (203 aa)
Score = 184, Expect = 1.1e-12, Identities = 49/158 (31%), Positives = 81/158 (51%)
  Q:     3 IGRKYIN-----FFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE----GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + + +IN     F + A+ G   +I    L + +GK   LLFF   DF     +EII  +   + F  +    +  S+DS   H +  K  + +  + NM +  ++D+SK+IS DY VL  E    G +   T  ID KG I++ S   + V R+ID  ++ +  +Q
  S:     1 MSKAFINKPAPAFTTTAWDGSVKTI---SLDQYLGK-WVLLFFYPFDFTFVCPTEIISFSDAAETFRKMNCEVLGCSIDSHFVHAEWCKKPRKEGGLGNMQIPLLADVSKQISSDYGVLITEGDAKGAAYRGTFIIDPKGNIRHISINDLPVGRNIDEYIRLVQAFQ 163
>gi|190570611|ref|YP_001974969.1| antioxidant, AhpC/Tsa family [Wolbachia pipientis] >gi|190356883|emb|CAQ54259.1| antioxidant, AhpC/Tsa family [Wolbachia pipientis] (199 aa)
Score = 184, Expect = 1.2e-12, Identities = 46/155 (29%), Positives = 82/155 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           L+ +  I+F + A       + ++ L+K++     +LFF   DF     +E+I  + K ++F    V  I IS+DS+ +H +      +   I  +S + VSDI K ISRDY VL+++  +L +T  ID K ++++ S     + R+ID  ++ I
  S:     3 LVTKSAIDFTASAVLASGKIVDDFCLSKHIKDKYAVLFFYPLDFTFVCPTELISFSNKIEDFSKRDVEVIGISIDSKFSHYKWRNTPVNDGGIGEVSYNLVSDIKKSISRDYGVLYDDSIALRATFVIDDKFVVRHQSINDFPLGRNIDEFIRII 157
>gi|116783966|gb|ABK23163.1| unknown [Picea sitchensis] (282 aa)
Score = 184, Expect = 1.3e-12, Identities = 43/159 (27%), Positives = 83/159 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F ++A   +    +   L++ +GK   +LFF   DF     +EI   + +H  F  L    + +S+DS  +H   V+  +    + ++    +SD++K IS+ Y VL  ++G +L     IDK+G+I++ +  ++ + R +D  L+T+   Q
  S:    90 LVGNKAPDFEAEAVFDQ--EFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEILGVSIDSVFSHLAWVQTDRKAGGLGDLKYPLISDVTKGISKAYNVLIADQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETLRTLQALQ 247
>gi|90086421|dbj|BAE91763.1| unnamed protein product [Macaca fascicularis] (256 aa)
Score = 183, Expect = 1.3e-12, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    96 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGPGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 220
>gi|109090692|ref|XP_001097248.1| PREDICTED: peroxiredoxin 3 isoform 1 [Macaca mulatta] (238 aa)
Score = 183, Expect = 1.3e-12, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    78 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGPGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 202
>gi|109090694|ref|XP_001097349.1| PREDICTED: peroxiredoxin 3 isoform 2 [Macaca mulatta] (272 aa)
Score = 183, Expect = 1.3e-12, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:   112 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGPGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 236
>gi|109090690|ref|XP_001097456.1| PREDICTED: peroxiredoxin 3 isoform 3 [Macaca mulatta] (256 aa)
Score = 183, Expect = 1.3e-12, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    96 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGPGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 220
>gi|154252753|ref|YP_001413577.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Parvibaculum lavamentivorans DS-1] >gi|154156703|gb|ABS63920.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Parvibaculum lavamentivorans DS-1] (201 aa)
Score = 183, Expect = 1.3e-12, Identities = 43/160 (26%), Positives = 83/160 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+G++  +F + A     D + +++L   +  +  L+FF   DF     SEI+  + +   F  + V  I +SVDS+ TH        +   +  +    V+D++K+I+RDY VL E +G +L  T  ID++G++++     + + R+ D  L+ +   Q
  S:     3 VLVGKQAPDFTAAAVLPDGDIVEDFNLRNYLNGSYGLVFFYPLDFTFVCPSEILAYSNRVPKFEAMNVKVIAVSVDSQFTHAAWRNTAPNDGGLGPVKFPMVADMTKQIARDYDVLIEKDGVALRGTFLIDREGVVRHQLVNDLPLGRNADEALRMVDALQ 163
>gi|123382138|ref|XP_001298652.1| tryparedoxin peroxidase, putative [Trichomonas vaginalis G3] >gi|121879283|gb|EAX85722.1| tryparedoxin peroxidase, putative [Trichomonas vaginalis G3] (196 aa)
Score = 183, Expect = 1.5e-12, Identities = 50/160 (31%), Positives = 79/160 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ML+G K  +F ++A    TD      L    GK   +LF    DF     +EIIE + K + F  LG   + +SVDS  TH   +   +    I ++    + D+  +IS+ Y    EE G+ L  T+ ID +GII++      +V R++D I++ +  YQ
  S:     1 MLVGNKAPSFKAQAVFPDTD-FKEVSLDSYKGK-WLVLFAWPLDFTFVCPTEIIEFSNKFEEFKKLGCEVLGMSVDSNFTHLAWINTPRKDGGIGSLQYPIIGDLGAKISKAYGFYMEEAGHDLRGTVIIDPQGIIRHVQMNHPDVGRNVDEIIRLVKAYQ 159
>gi|118597399|sp|Q9Z0V6|PRDX3_RAT Thioredoxin-dependent peroxide reductase, mitochondrial precursor (Peroxiredoxin-3) (PRX-3) (PRx III) (257 aa)
Score = 183, Expect = 1.6e-12, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    97 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNITLLSDLTKQISRDYGVLLESAGIALRGLFIIDPNGVIKHLSVNDLPVGRSVEEPLRLVKAFQ 221
>gi|11968132|ref|NP_071985.1| peroxiredoxin 3 [Rattus norvegicus] >gi|4336877|gb|AAD17992.1| PRx III [Rattus norvegicus] (257 aa)
Score = 183, Expect = 1.6e-12, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    97 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNITLLSDLTKQISRDYGVLLESAGIALRGLFIIDPNGVIKHLSVNDLPVGRSVEEPLRLVKAFQ 221
>gi|145631197|ref|ZP_01786971.1| single-strand DNA-binding protein [Haemophilus influenzae 22.4-21] >gi|144983295|gb|EDJ90786.1| single-strand DNA-binding protein [Haemophilus influenzae R3021] (200 aa)
Score = 182, Expect = 1.7e-12, Identities = 40/160 (25%), Positives = 81/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F S A     + + N++  K++     ++FF   DF     SE+I  + +++ F   GV  + +S+DS+ TH        +   I  +    V+D+  EI++ Y +   E G +L ++  IDK G++++     + + R+ID +L+ +   Q
  S:     2 VLVTRQAPDFTSSAVLSNGEIVDNFNFKKHIAGKAAVIFFYPLDFTFVCPSELIAFDHRYEEFKKRGVEVVGVSIDSQFTHNAWRNTPTENGGIGQVKYALVADVKHEIAQAYGIEHPEAGVALRASFLIDKNGVVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|161504412|ref|YP_001571524.1| hypothetical protein SARI_02523 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160865759|gb|ABX22382.1| hypothetical protein SARI_02523 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (200 aa)
Score = 182, Expect = 1.9e-12, Identities = 42/160 (26%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F + A  G  + +  ++  ++     T+LFF   DF     SE+I  +++++ F   GV  + +S DSE  H        DK  I  +    V+D+ +EI + Y +   +EG +L  +  ID  GI+++     + + R+ID +L+ +   Q
  S:     2 VLVTRQAPDFTAAAVLGNGEIVDKFNFKQHTNGKTTVLFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEFVHNAWRNTPVDKGGIGPVKYAMVADVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|16759380|ref|NP_454997.1| peroxidase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16763782|ref|NP_459397.1| putative thiol-alkyl hydroperoxide reductase [Salmonella typhimurium LT2] >gi|29142849|ref|NP_806191.1| peroxidase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56414443|ref|YP_151518.1| peroxidase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62179014|ref|YP_215431.1| putative thiol - alkyl hydroperoxide reductase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161615414|ref|YP_001589379.1| hypothetical protein SPAB_03185 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167543425|ref|ZP_02338999.1| hypothetical protein Sentent_09121 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167551791|ref|ZP_02345544.1| hypothetical protein Sentente_14963 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167558903|ref|ZP_02351912.1| hypothetical protein Sententeri_18934 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167992248|ref|ZP_02573346.1| hypothetical protein Sententer_01000012_0100012420 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168221968|ref|ZP_02647200.1| hypothetical protein Senterenterica_16336 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168226955|ref|ZP_02652186.1| hypothetical protein Sententeric_14355 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168232372|ref|ZP_02657430.1| hypothetical protein Sententerica_15423 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168237513|ref|ZP_02662571.1| hypothetical protein Senteenterica_15111 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168240221|ref|ZP_02665153.1| hypothetical protein Senterienterica_01180 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168261169|ref|ZP_02683142.1| hypothetical protein Salmentericaenterica_08779 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168465488|ref|ZP_02699370.1| peroxiredoxin-2 [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168476055|ref|ZP_02705078.1| hypothetical protein Salmoentericaenterica_15436 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168818991|ref|ZP_02830991.1| hypothetical protein Salentericaenterica_06365 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194442811|ref|YP_002039643.1| peroxiredoxin-2 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194449301|ref|YP_002044436.1| peroxiredoxin-2 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194471022|ref|ZP_03077006.1| peroxiredoxin-2 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194737766|ref|YP_002113434.1| peroxiredoxin-2 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|25285289|pir||AB0552 probable peroxidase [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16418906|gb|AAL19356.1| putative thiol - alkyl hydroperoxide reductase [Salmonella typhimurium LT2] >gi|16501671|emb|CAD08858.1| probable peroxidase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29138481|gb|AAO70051.1| probable peroxidase [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56128700|gb|AAV78206.1| probable peroxidase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62126647|gb|AAX64350.1| putative thiol - alkyl hydroperoxide reductase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161364778|gb|ABX68546.1| hypothetical protein SPAB_03185 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194401474|gb|ACF61696.1| peroxiredoxin-2 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194407605|gb|ACF67824.1| peroxiredoxin-2 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194457386|gb|EDX46225.1| peroxiredoxin-2 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194713268|gb|ACF92489.1| peroxiredoxin-2 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195631770|gb|EDX50290.1| peroxiredoxin-2 [Salmonella enterica subsp. enterica serovar Newport str. SL317] (200 aa)
Score = 182, Expect = 1.9e-12, Identities = 42/160 (26%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F + A  G  + +  ++  ++     T+LFF   DF     SE+I  +++++ F   GV  + +S DSE  H        DK  I  +    V+D+ +EI + Y +   +EG +L  +  ID  GI+++     + + R+ID +L+ +   Q
  S:     2 VLVTRQAPDFTAAAVLGSGEIVDKFNFKQHTNGKTTVLFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEFVHNAWRNTPVDKGGIGPVKYAMVADVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|123974738|ref|XP_001330099.1| thioredoxin peroxidase [Trichomonas vaginalis G3] >gi|34542000|gb|AAQ74891.1| thioredoxin peroxidase [Trichomonas vaginalis] >gi|121895915|gb|EAY01083.1| thioredoxin peroxidase [Trichomonas vaginalis G3] (196 aa)
Score = 182, Expect = 2.1e-12, Identities = 48/160 (30%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDY-LVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ML+G+    F S A    TD      L +  GK   +LF    DF     +EIIE + K++ F  +G   + +SVDS  TH   +   + +  +  +    + D+  +I++DY   + E G++L  T  ID +GII++      +V R++D IL+ +  YQ
  S:     1 MLVGKPAPAFKSTAVFPDTD-FKEVSLEQYKGK-WLVLFSYPLDFTFVCPTEIIEFSNKYEEFKKIGCEVLGLSVDSVFTHLAWINTPRKEGGLGEIKYPLIGDLGGKIAKDYGFYMCEAGHTLRGTAIIDPEGIIRHVQMNHPDVGRNVDEILRLVKAYQ 159
>gi|146310533|ref|YP_001175607.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Enterobacter sp. 638] >gi|145317409|gb|ABP59556.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Enterobacter sp. 638] (200 aa)
Score = 182, Expect = 2.1e-12, Identities = 42/160 (26%), Positives = 79/160 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R   +F + A  G  + + N++  ++     T+LFF   DF     SE+I  +++++ F   GV  + +S DSE  H        DK  I  +    V+DI +EI + Y +   + G +L  +  ID  GI+++     + + R++D +L+ +   Q
  S:     2 VLVTRPAPDFTAAAVLGNGEIVENFNFKQHTNGKATVLFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEFVHNAWRNTPVDKGGIGAVKYAMVADIKREIQQAYGIEHPDAGVALRGSFLIDANGIVRHQVVNDLPLGRNVDEMLRMVDALQ 162
>gi|195391538|ref|XP_002054417.1| GJ22817 [Drosophila virilis] >gi|194152503|gb|EDW67937.1| GJ22817 [Drosophila virilis] (233 aa)
Score = 181, Expect = 2.5e-12, Identities = 40/124 (32%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  +++ + F ++    + +SVDS  +H       +    +  +    +SD++K+IS DY VL E EG SL  T  ID KG+++ +S   + V R +D IL+ I  +Q
  S:    72 VLFFYPLDFTFVCPTEIVAFSERIKEFQDINTEVVGVSVDSHFSHLTWCNVDRKNGGVGKLQYPLLSDLTKKISADYGVLLEREGISLRGTFIIDPKGVLRQYSINDLPVGRSVDEILRLIKAFQ 196
>gi|156404129|ref|XP_001640260.1| predicted protein [Nematostella vectensis] >gi|156227393|gb|EDO48197.1| predicted protein [Nematostella vectensis] (196 aa)
Score = 181, Expect = 2.5e-12, Identities = 48/150 (32%), Positives = 75/150 (50%)
  Q:    11 FSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           FS     K    ++  L+   GK   +LFF   DF     +EII  + +   F  +    I  SVDSE +H       + K  I N+++  +SD++K+IS+DY VL E +G +L     ID KGI++  +   + V R +D  L+ I  +Q
  S:    13 FSGTAVNKHGEFIDLKLSDYKGKY-VVLFFYPLDFTFVCPTEIIAFSDRVDEFKAINCEVIACSVDSEYSHLAWTNVPRKKGGIGNINIPILSDLTKQISKDYGVLLEDQGVALRGLFIIDDKGILRQITINDLPVGRSVDETLRLIQAFQ 162
>gi|118359822|ref|XP_001013149.1| Thioredoxin-dependent peroxide reductase, mitochondrial precursor, putative [Tetrahymena thermophila SB210] >gi|89294916|gb|EAR92904.1| Thioredoxin-dependent peroxide reductase, mitochondrial precursor, putative [Tetrahymena thermophila SB210] (205 aa)
Score = 181, Expect = 2.5e-12, Identities = 47/152 (30%), Positives = 77/152 (50%)
  Q:     9 NFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTI-NNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +F   AY  K+ S     L    GK   LLFF   DF     +EII+ +   + F       I  S+DS  THQ  V+  + +  +  ++ +  +SD++K ISRDY VL E G +L  +  ID K ++++ S   + V R+++  L+ +  +Q
  S:    14 HFKGAAYCPKSKSFKQVSLEDYKGKY-LLLFFYPLDFTFVCPTEIIQFSNHAKKFNETNCEVIGCSIDSHYTHQAYVQRPRSEGGLGEDLQISLLSDLTKNISRDYGVLTEGGIALRGSFIIDDKQVLRHTSVNDLPVGRNVEEYLRLVQAFQ 165
>gi|194698132|gb|ACF83150.1| unknown [Zea mays] (260 aa)
Score = 181, Expect = 2.7e-12, Identities = 41/159 (25%), Positives = 84/159 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F ++A   +    +N  L+  +GK   +LFF   DF     +EI   + +++ F  L    + +S+DS  +H   V+  +    + ++    +SD++K IS+ + VL  ++G +L     IDK+G+I++ +  ++ + R +D  ++T+   Q
  S:    68 LVGNKAPDFEAEAVFDQ--EFINVKLSDYIGKKYVVLFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEVLGVSIDSVFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKAFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQ 225
>gi|149453537|ref|XP_001518434.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus] (251 aa)
Score = 180, Expect = 3.0e-12, Identities = 39/124 (31%), Positives = 65/124 (52%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + K   F ++    + +SVDS   H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    91 VLFFYPLDFTFVCPTEIIAFSDKANEFHDVNCEVVAVSVDSHFCHLAWINTPRKSGGLGHMNIAVMSDLTKQISRDYGVLLEGPGLALRGLFIIDPNGVIKHLSINDLPVGRSVEETLRLVKAFQ 215
>gi|145483021|ref|XP_001427533.1| hypothetical protein GSPATT00030773001 [Paramecium tetraurelia strain d4-2] >gi|124394615|emb|CAK60135.1| unnamed protein product [Paramecium tetraurelia] (209 aa)
Score = 180, Expect = 3.0e-12, Identities = 35/124 (28%), Positives = 70/124 (56%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE------GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + + ++F  +G     +SVDS  +H +  +  +++  + +M +  ++D+ K IS DY VL ++      G +   T  +DK G+++++S   + V R++D  L+ +  +Q
  S:    38 VLFFYPLDFTFVCPTEIIAFSDRVEDFRKIGCEVAAVSVDSHFSHMKYCQTPRNQGGLGDMQIPLIADLGKTISADYGVLIDDPQDGDFGVAFRGTFIVDKNGVLRHYSVNDLPVGRNVDETLRLVQAFQ 167
>gi|62896877|dbj|BAD96379.1| peroxiredoxin 3 isoform a precursor variant [Homo sapiens] (256 aa)
Score = 180, Expect = 3.2e-12, Identities = 38/124 (30%), Positives = 65/124 (52%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V R ++  L+ +   Q
  S:    96 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKALQ 220
>gi|118093103|ref|XP_426543.2| PREDICTED: similar to Prdx3 protein [Gallus gallus] (286 aa)
Score = 180, Expect = 3.3e-12, Identities = 39/124 (31%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS   H   +   +    +  M++  +SD++K+ISRDY VL E  G +L     ID  GIIK+ S   + V R ++  L+ +  +Q
  S:   126 VLFFYPLDFTFVCPTEIVAFSNKANEFHDVNCEVVAVSVDSHFCHLAWINTPRKSGGLGKMNIPVLSDLTKQISRDYGVLLEGPGIALRGLFIIDPNGIIKHLSINDLPVGRSVEETLRLVKAFQ 250
>gi|115446541|ref|NP_001047050.1| Os02g0537700 [Oryza sativa (japonica cultivar-group)] >gi|75323389|sp|Q6ER94|BAS1_ORYSJ 2-Cys peroxiredoxin BAS1, chloroplast precursor (Thiol-specific antioxidant protein) >gi|50251981|dbj|BAD27915.1| putative thioredoxin peroxidase [Oryza sativa Japonica Group] >gi|50252657|dbj|BAD28826.1| putative thioredoxin peroxidase [Oryza sativa Japonica Group] >gi|67904930|emb|CAJ01693.1| 2-Cys peroxiredoxin [Oryza sativa (japonica cultivar-group)] >gi|113536581|dbj|BAF08964.1| Os02g0537700 [Oryza sativa (japonica cultivar-group)] (261 aa)
Score = 180, Expect = 3.6e-12, Identities = 41/159 (25%), Positives = 83/159 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F ++A   +    +N  L+  +GK   +LFF   DF     +EI   + ++  F  L    + +S+DS  +H   V+  +    + ++    +SD++K IS+ + VL  ++G +L     IDK+G+I++ +  ++ + R +D  ++T+   Q
  S:    69 LVGNKAPDFDAEAVFDQ--EFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYDEFEKLNTEILGVSIDSVFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQ 226
>gi|114052210|ref|NP_001040464.1| thioredoxin peroxidase [Bombyx mori] >gi|95102998|gb|ABF51440.1| thioredoxin peroxidase [Bombyx mori] (227 aa)
Score = 179, Expect = 3.9e-12, Identities = 35/124 (28%), Positives = 65/124 (52%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +E+I  + K ++F  +    I +S DSE +H   +   +    +  M +  ++D  K+IS+DY VL ++G++L     ID+ G +++ S   + V R +D  L+ +  +Q
  S:    67 VLFFYPLDFTFVCPTELIAFSDKAKDFAGIDCQVIGVSTDSEFSHLAWINTPRKDGGLGKMEIPLLADYKKQISKDYDVLLDDGFALRGLFIIDRNGTLRHMSVNDLPVGRSVDETLRLVKAFQ 190
>gi|157346136|emb|CAO15833.1| unnamed protein product [Vitis vinifera] (273 aa)
Score = 179, Expect = 4.1e-12, Identities = 43/159 (27%), Positives = 84/159 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F ++A   +    +   L++ +GK   +LFF   DF     +EI   + +++ F  L    + +S+DS  +H   V+  +    + ++    VSD++K IS+ Y VL  ++G +L     IDK+GII++ +  ++ + R +D  ++T+   Q
  S:    81 LVGNKAPDFEAEAVFDQ--EFIKVTLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEILGVSIDSVFSHLAWVQTDRKSGGLGDLKYPLVSDVTKSISKSYDVLIPDQGVALRGLFIIDKEGIIQHATINNLAIGRSVDETMRTLQALQ 238
>gi|147789752|emb|CAN67408.1| hypothetical protein [Vitis vinifera] (273 aa)
Score = 179, Expect = 4.1e-12, Identities = 43/159 (27%), Positives = 84/159 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F ++A   +    +   L++ +GK   +LFF   DF     +EI   + +++ F  L    + +S+DS  +H   V+  +    + ++    VSD++K IS+ Y VL  ++G +L     IDK+GII++ +  ++ + R +D  ++T+   Q
  S:    81 LVGNKAPDFEAEAVFDQ--EFIKVTLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEILGVSIDSVFSHLAWVQTDRKSGGLGDLKYPLVSDVTKSISKSYDVLIPDQGVALRGLFIIDKEGIIQHATINNLAIGRSVDETMRTLQALQ 238
>gi|68073987|ref|XP_678908.1| thioredoxin peroxidase [Plasmodium berghei strain ANKA] >gi|56499521|emb|CAH98935.1| thioredoxin peroxidase, putative [Plasmodium berghei] (207 aa)
Score = 179, Expect = 4.2e-12, Identities = 44/146 (30%), Positives = 79/146 (54%)
  Q:    11 FSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           F+     K + I+N  L+  +GK    LFF   ++     +E+IE N+  ++F    V  + ISVDS  +H        +K  I N++   VSDI+KEIS++Y VL++  ++L     ID +G I++ +   + + R+++ +L+ I
  S:    21 FTAQRVNKNNEIINVQLSSYIGKKYCCLFFYPLNYTFVCPTEVIEFNKHVKSFEEKNVELLGISVDSVYSHMAWKNMPIEKGGIGNINFTLVSDINKEISKNYNVLYDNSFALRGLFIIDLEGKIRHKTVNDLSIGRNVNEVLRVI 166
>gi|145549033|ref|XP_001460196.1| hypothetical protein GSPATT00025534001 [Paramecium tetraurelia strain d4-2] >gi|124428025|emb|CAK92799.1| unnamed protein product [Paramecium tetraurelia] (188 aa)
Score = 179, Expect = 4.2e-12, Identities = 35/124 (28%), Positives = 69/124 (55%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE------GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   D      +EII  + + + F  +G     +SVDS  +H +  +  +++  + +M +  ++DI+K IS DY VL ++      G +   T  +DK G+++++S   + V R++D  L+ +  +Q
  S:    18 VLFFYPLDSTFVCPTEIIAFSDRAEEFRKIGCEVAAVSVDSRFSHMKYCQTPRNQGGLGDMQIPLIADIAKTISADYGVLIDDPQDGDFGVAFRGTFIVDKNGVLRHYSVNDLPVGRNVDETLRLVQAFQ 147
>gi|120599227|ref|YP_963801.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella sp. W3-18-1] >gi|124549550|ref|ZP_01707728.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella putrefaciens 200] >gi|146292699|ref|YP_001183123.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella putrefaciens CN-32] >gi|120559320|gb|ABM25247.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella sp. W3-18-1] >gi|124507834|gb|EAY51948.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella putrefaciens 200] >gi|145564389|gb|ABP75324.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella putrefaciens CN-32] (201 aa)
Score = 179, Expect = 4.2e-12, Identities = 42/160 (26%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR   +F + A  G  + + +++LT  +     ++FF   DF     SE+I  + + + F   GV  I +S+DS+ TH        +K  I  +    V+D+  EI + Y V   + G +   +  IDK+G++++     + + R++D +L+ I   Q
  S:     3 VLVGRPAPDFTAAAVLGSGEIVDSFNLTAAIKGKPAVVFFYPLDFTFVCPSELIAFDHRMEEFTKRGVEVIGVSIDSQFTHNAWRNTPVEKGGIGQVKYTLVADVKHEICKAYDVEHPDAGVAFRGSFLIDKEGMVRHQVVNDLPLGRNVDEMLRMIDALQ 163
>gi|113970711|ref|YP_734504.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella sp. MR-4] >gi|114047940|ref|YP_738490.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella sp. MR-7] >gi|117920982|ref|YP_870174.1| alkyl hydroperoxide reductase/Thiol specific antioxidant/Mal allergen [Shewanella sp. ANA-3] >gi|113885395|gb|ABI39447.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella sp. MR-4] >gi|113889382|gb|ABI43433.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella sp. MR-7] >gi|117613314|gb|ABK48768.1| alkyl hydroperoxide reductase/Thiol specific antioxidant/Mal allergen [Shewanella sp. ANA-3] (201 aa)
Score = 179, Expect = 4.2e-12, Identities = 42/160 (26%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR   +F + A  G  + + +++LT  +     ++FF   DF     SE+I  + + + F   GV  I +S+DS+ TH        +K  I  +    V+D+  +I + Y V   E G +   +  IDK+G++++     + + R++D +L+ I   Q
  S:     3 VLVGRPAPDFTAAAVLGSGEIVDSFNLTAAIKGKPAVVFFYPLDFTFVCPSELIAFDHRMEEFTKRGVEVIGVSIDSQFTHNAWRNTPVEKGGIGQVKYTLVADVKHDICKAYDVEHPEAGVAFRGSFLIDKEGMVRHQVVNDLPLGRNVDEMLRMIDALQ 163
>gi|92115076|ref|YP_575004.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chromohalobacter salexigens DSM 3043] >gi|91798166|gb|ABE60305.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chromohalobacter salexigens DSM 3043] (200 aa)
Score = 179, Expect = 4.4e-12, Identities = 44/156 (28%), Positives = 84/156 (53%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G    + ++ L++  GK   ++FF   DF     SEII  + +   F  LGV  I +S+DS+ TH    K   DK  I  +    V+D+  EI++ + +   E G +L ++  ID+ G++++    ++ + R++D +L+ +
  S:     3 VLVGRQVPDFEAAAVLGDGTIVEDFKLSETNGKL-RVVFFWPLDFTFVCPSEIIAHDNRLAQFRELGVEVIGVSIDSQFTHHAWRKTPHDKGGIGEVGFPIVADVKHEITQAFGIEHPEAGVALRASFLIDEDGVVQHQVVNNLPLGRNVDEMLRMV 158
>gi|152968927|ref|YP_001334036.1| putative thiol - alkyl hydroperoxide reductase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150953776|gb|ABR75806.1| putative thiol - alkyl hydroperoxide reductase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (200 aa)
Score = 179, Expect = 4.7e-12, Identities = 41/160 (25%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F + A  G  + +  ++  ++     T+LFF   DF     SE+I  +++++ F   GV  + +S DSE  H        D+  I  +    V+DI +EI + Y +   +EG +L  +  ID  G++++     + + R+ID +L+ +   Q
  S:     2 VLVTRQAPDFTAAAVLGNGEIVEKFNFKQHTNGKPTVLFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEFVHNAWRNTPVDQGGIGPVKYAMVADIKREIQKAYGIEHPDEGVALRGSFLIDANGVVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|56416720|ref|YP_153794.1| thioredoxin peroxidase 1 [Anaplasma marginale str. St. Maries] >gi|56387952|gb|AAV86539.1| thioredoxin peroxidase 1 [Anaplasma marginale str. St. Maries] (207 aa)
Score = 179, Expect = 4.8e-12, Identities = 47/155 (30%), Positives = 81/155 (52%)
  Q:     2 LIGRKYINFFSKAY--SGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           L+ ++ I+F +KA    GK   + + +L+K++     +LFF  +DF     +EI+ L+ +   F    V  I IS DSE  H        ++  I  +S   V+D S  IS  Y VL+    +L +T+ ID+  I+++ S   + + R+ID +L+ I
  S:     8 LVTKEAIDFAAKAVMSDGK---VCDLNLSKHIAGKCAVLFFYPRDFTFVCPTEILSLHSRVPKFTARNVEVIGISTDSEFAHSHWRNTPVEQGGIGMVSFPLVADDSHTISESYGVLYGGKVALRATVIIDEDFIVRHHSVNDLPIGRNIDEVLRII 161
>gi|187931825|ref|YP_001891810.1| peroxiredoxin of the AhpC/TSA family [Francisella tularensis subsp. mediasiatica FSC147] >gi|187712734|gb|ACD31031.1| peroxiredoxin of the AhpC/TSA family [Francisella tularensis subsp. mediasiatica FSC147] (199 aa)
Score = 178, Expect = 4.9e-12, Identities = 42/160 (26%), Positives = 77/160 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+G+K   F + A  G  + + +YD  K +     ++ F   DF     SE+I L+++      LGV  + +S+DS  TH        +   I  +    V+DI++EI + Y V    G +   T  IDK G+++Y     + + R++D +++ +   Q
  S:     2 VLVGKKAPLFNAPAVLGNGEIVDSYDFAKAIQGKYAIVVFYPLDFTFVCPSELIALDKRTAKLKELGVEVVSVSIDSHFTHNAWRNTPINDGGIGPVKYTMVADINQEIVKAYDVQAAGGMAFRGTFLIDKSGVVRYQVVNDLPLGRNMDEVIRMVEALQ 161
>gi|145533765|ref|XP_001452627.1| hypothetical protein GSPATT00002630001 [Paramecium tetraurelia strain d4-2] >gi|124420326|emb|CAK85230.1| unnamed protein product [Paramecium tetraurelia] (205 aa)
Score = 178, Expect = 4.9e-12, Identities = 44/160 (27%), Positives = 85/160 (53%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE------GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           M + ++   F + AY  K    ++    KN      +LFF   DF     +EII+ + + + F   G + + +SVDS+ +H +  K  ++   +  M    +SD+S+EIS+ Y V+ ++      G +   T  ID KGI++++S   + V R++D +L+ +  ++
  S:     1 MKVRKQAPQFTASAYFNKQFKRISLSDYKN---RYVVLFFYPLDFTFVCPTEIIQFSDRVEEFKANGCDILGVSVDSQFSHMKYCKQTRNNGGLGEMQFPLISDLSQEISKKYGVIIDDSEDPDFGVAFRGTFIIDGKGILRHYSINDLPVGRNVDEVLRLVQAFK 163
>gi|145515131|ref|XP_001443468.1| hypothetical protein GSPATT00039111001 [Paramecium tetraurelia strain d4-2] >gi|124410851|emb|CAK76071.1| unnamed protein product [Paramecium tetraurelia] (332 aa)
Score = 178, Expect = 5.0e-12, Identities = 36/124 (29%), Positives = 70/124 (56%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE------GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + + + F  +G     +SVDS  +H +  +  +++  + +M +  ++DI+K IS DY VL ++      G +   T  +DK G+++++S   + V R++D  L+ +  +Q
  S:   162 VLFFYPLDFTFVCPTEIIAFSDRAEEFRKIGCEVAAVSVDSRFSHMKYCQTPRNQGGLGDMQIPLIADIAKTISADYGVLIDDPQDGDFGVAFRGTFIVDKNGVLRHYSVNDLPVGRNVDETLRLVQAFQ 291
>gi|71896087|ref|NP_001025608.1| prdx3 protein [Xenopus tropicalis] >gi|60551816|gb|AAH91062.1| Prdx3 protein [Xenopus tropicalis] (243 aa)
Score = 178, Expect = 5.0e-12, Identities = 39/124 (31%), Positives = 63/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS   H       +    +  M++  +SD++K+ISRDY VL E  G +L     ID  GIIK+ S   + V R ++  L+ +  +Q
  S:    84 VLFFYPLDFTFVCPTEIVAFSNKANEFHDVNCEVVAVSVDSHFCHLAWTNTPRKSGGLGQMNIPLLSDLNKQISRDYGVLLETPGIALRGLFIIDPNGIIKHMSVNDLPVGRSVEETLRLVKAFQ 208
>gi|168010546|ref|XP_001757965.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162690842|gb|EDQ77207.1| predicted protein [Physcomitrella patens subsp. patens] (282 aa)
Score = 178, Expect = 5.0e-12, Identities = 40/134 (29%), Positives = 72/134 (53%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L++ +GK   +LFF   DF     +EI   + ++  F  L    I +S DS  +H   ++  +    + ++    VSDI+K+ISR + VL  E+G +L     IDK+G+I++ +  ++ + R +D  L+T+   Q
  S:   113 LSEYIGKKYVVLFFYPLDFTFVCPTEITAFSDRYSEFEKLSTEVIGVSTDSVFSHLAWIQTDRKAGGLGDLHYPIVSDITKKISRSFNVLIPEQGIALRGLFIIDKQGVIQHATVNNLGIGRSVDETLRTLQAVQ 247
>gi|46132967|ref|ZP_00155972.2| COG0450: Peroxiredoxin [Haemophilus influenzae R2866] >gi|68248736|ref|YP_247848.1| peroxiredoxin [Haemophilus influenzae 86-028NP] >gi|68056935|gb|AAX87188.1| probable peroxiredoxin [Haemophilus influenzae 86-028NP] (202 aa)
Score = 178, Expect = 5.1e-12, Identities = 39/160 (24%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F S A     + + N++  K++     ++FF   DF     SE+I  + +++ F   GV  + +S+DS+ TH        +   I  +     +D+  EI++ Y +   E G +L ++  IDK G++++     + + R+ID +L+ +   Q
  S:     4 VLVTRQAPDFTSSAVLSNGEIVDNFNFKKHIAGKAAVIFFYPLDFTFVCPSELIAFDHRYEEFKKRGVEVVGVSIDSQFTHNAWRNTPTENGGIGQVKYALAADVKHEIAQAYGIEHPEAGVALRASFLIDKNGVVRHQVVNDLPLGRNIDEMLRMVDALQ 164
>gi|145628985|ref|ZP_01784784.1| uridine kinase [Haemophilus influenzae 22.1-21] >gi|145640003|ref|ZP_01795601.1| probable peroxiredoxin [Haemophilus influenzae PittII] >gi|45511540|gb|AAS67289.1| TsaA [Haemophilus influenzae] >gi|144978488|gb|EDJ88211.1| uridine kinase [Haemophilus influenzae 22.1-21] >gi|145270890|gb|EDK10809.1| probable peroxiredoxin [Haemophilus influenzae PittII] (200 aa)
Score = 178, Expect = 5.3e-12, Identities = 39/160 (24%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F S A     + + N++  K++     ++FF   DF     SE+I  + +++ F   GV  + +S+DS+ TH        +   I  +     +D+  EI++ Y +   E G +L ++  IDK G++++     + + R+ID +L+ +   Q
  S:     2 VLVTRQAPDFTSSAVLSNGEIVDNFNFKKHIAGKAAVIFFYPLDFTFVCPSELIAFDHRYEEFKKRGVEVVGVSIDSQFTHNAWRNTPTENGGIGQVKYALAADVKHEIAQAYGIEHPEAGVALRASFLIDKNGVVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|52425576|ref|YP_088713.1| AhpC protein [Mannheimia succiniciproducens MBEL55E] >gi|52307628|gb|AAU38128.1| AhpC protein [Mannheimia succiniciproducens MBEL55E] (200 aa)
Score = 178, Expect = 5.3e-12, Identities = 39/160 (24%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F S A  G  + + N++  +++     ++FF   DF     SE+I  + +++ F   GV  + +S+DS+ TH        D+  I  +     +D   EI++ Y +   E G +L ++  ID  G++++     + + R+ID +L+ +   Q
  S:     2 VLVTRQAPDFTSAAVLGNGEIVDNFNFKQHIAGKPAVIFFYPLDFTFVCPSELIAFDHRYEEFKKRGVEVVGVSIDSQFTHNAWRNTAVDQGGIGQVQYALAADTKHEIAKAYGIEHPEAGVALRASFLIDANGVVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|124515015|gb|EAY56526.1| Peroxiredoxin [Leptospirillum sp. Group II UBA] (200 aa)
Score = 178, Expect = 5.6e-12, Identities = 47/155 (30%), Positives = 78/155 (50%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILN--YDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           LIG+   +F + A     D+ +N  + L + +  +  +LFF   DF     +EII  + + Q F   GV  + +SVDS  TH    K    +  I  +    VSD++K ISR Y VL  E  +L  T  ID+K ++++     + + R+ID  ++ +
  S:     4 LIGQLAPDFTASAV--MPDNAINEKFSLHEYLAGSTGILFFWPLDFTFVCPTEIIAFDHRLQTFEEKGVKIVGVSVDSAYTHLAWKKTPTGEGGIGPVRFPVVSDLTKSISRSYGVLLNESVALRGTFLIDRKAVVRHMVVNDLPLGRNIDEAVRMV 158
>gi|73979031|ref|XP_853872.1| PREDICTED: similar to Thioredoxin-dependent peroxide reductase, mitochondrial precursor (Peroxiredoxin 3) (Antioxidant protein 1) (AOP-1) (MER5 protein homolog) (HBC189) (PRX III) [Canis familiaris] (257 aa)
Score = 178, Expect = 5.9e-12, Identities = 37/124 (29%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K + F ++  + + +SVDS  TH   +   +   ++ +M++  +SD++K+I RDY +L E  G +L     ID  G+IK+ S   + V R ++  L  +  +Q
  S:    97 VLFFYPLDFTFVCPTEIVAFSDKAKEFHDVNCDVVAVSVDSHFTHLAWINTPQKNGSLGHMNIALLSDLTKQIPRDYGMLLEGPGIALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLCLVKAFQ 221
>gi|118398387|ref|XP_001031522.1| AhpC/TSA family protein [Tetrahymena thermophila SB210] >gi|89285852|gb|EAR83859.1| AhpC/TSA family protein [Tetrahymena thermophila SB210] (226 aa)
Score = 177, Expect = 6.5e-12, Identities = 40/124 (32%), Positives = 69/124 (55%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE----GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           LLFF   DF     +EII  +     F  +    +  S+DS   H + V+  K +  + ++++  +SD++K++S+DY VL ++    G +   T  IDKKGII++ S   + V R+ID  L+ +  +Q
  S:    59 LLFFYPFDFTFVCPTEIISFSDAQPLFKKINCQVLGCSIDSHFVHSEWVQTPKKRGGLGSINIPLLSDMNKQMSKDYGVLIDDGDNRGAAYRGTFIIDKKGIIRHLSINDLPVGRNIDEYLRLVEAFQ 186
>gi|183220748|ref|YP_001838744.1| Alkyl hydroperoxide reductase subunit C [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189910849|ref|YP_001962404.1| Peroxiredoxin [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167775525|gb|ABZ93826.1| Peroxiredoxin [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167779170|gb|ABZ97468.1| Alkyl hydroperoxide reductase subunit C [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (197 aa)
Score = 177, Expect = 7.2e-12, Identities = 49/148 (33%), Positives = 77/148 (52%)
  Q:    13 KAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE----GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           KA +   DS     L+   GK   +LFF   DF     +EIIE + K ++F  +G   + +SVDSE +H    K  K +  I  +    ++D +KEI++ + VL E     G +L  T  ID +GII+  +   + V R+I+  L+ I  +Q
  S:    12 KATAVIGDSFKEIKLSDYKGK-WVVLFFYPLDFTFVCPTEIIEYDAKLEDFKKIGAEVLGVSVDSEFSHLAWKKTPKKEGGIGEIKYPLIADKTKEIAKSFGVLIESGPDAGVALRGTFIIDPQGIIRQATVNDLPVGRNIEEALRLIKAFQ 162
>gi|123449270|ref|XP_001313356.1| thioredoxin peroxidase [Trichomonas vaginalis G3] >gi|23095909|emb|CAD47838.1| thioredoxin peroxidase [Trichomonas vaginalis] >gi|121895236|gb|EAY00427.1| thioredoxin peroxidase [Trichomonas vaginalis G3] (196 aa)
Score = 177, Expect = 7.3e-12, Identities = 47/160 (29%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDY-LVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ML+G+    F  +A    TD      L +  GK   +LF    DF     +EIIE + K++ F  +G   + +SVDS  TH   +   + +  +  +    + D+  +I+++Y   + E G++L  T  ID +GII++      +V R++D IL+ I  YQ
  S:     1 MLVGKPAPAFKGQAVFPDTD-FKEVSLEQYKGK-WLVLFSYPLDFTFVCPTEIIEFSNKYEEFKKIGCEVLGLSVDSVFTHLAWINTPRKEGGLGEIKYPLIGDLGAKIAKEYGFYMCEAGHTLRGTAIIDPEGIIRHVQMNHPDVGRNVDEILRLIKAYQ 159
>gi|91793445|ref|YP_563096.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella denitrificans OS217] >gi|91715447|gb|ABE55373.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella denitrificans OS217] (201 aa)
Score = 177, Expect = 7.5e-12, Identities = 42/160 (26%), Positives = 79/160 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR   +F + A  G  + + +++L+  +     ++FF   DF     SE+I  + +   F + GV  I +S+DS+ TH        DK  I  +    V+D+  EI + Y V   E G +   +  +DK+G +++     + + R++D +L+ I   Q
  S:     3 VLVGRPAPDFTAAAVLGNGEIVDSFNLSTAIKGKPAVIFFYPLDFTFVCPSELIAFDHRMAEFTSRGVEVIGVSIDSQFTHNAWRNTPVDKGGIGQVKYTLVADVKHEICKAYDVEHPEAGVAFRGSFLVDKEGQVRHQVVNDLPLGRNVDEMLRMIDALQ 163
>gi|195110699|ref|XP_001999917.1| GI22813 [Drosophila mojavensis] >gi|193916511|gb|EDW15378.1| GI22813 [Drosophila mojavensis] (233 aa)
Score = 176, Expect = 8.3e-12, Identities = 39/124 (31%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  +++ + F ++    + +SVDS  +H       +    +  +    +SDI+K+IS DY VL + EG SL  T  ID KG+++ +S   + V R +D +L+ I  +Q
  S:    72 VLFFYPLDFTFVCPTEIVAFSERIKEFQDINTEVVGVSVDSHFSHLTWCNVDRKNGGVGKLKYPLLSDITKKISADYGVLLDKEGISLRGTFIIDPKGVLRQYSINDLPVGRSVDEVLRLIKAFQ 196
>gi|149200564|ref|ZP_01877572.1| thiolredoxin peroxidase [Lentisphaera araneosa HTCC2155] >gi|149136336|gb|EDM24781.1| thiolredoxin peroxidase [Lentisphaera araneosa HTCC2155] (193 aa)
Score = 176, Expect = 8.3e-12, Identities = 46/160 (28%), Positives = 81/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+G++  +F  KA  G+ + I N+ L++  GK   +LFF   DF     +E+     K   F   GV  + +S DS  +H   +   K++  I  +    VSD +K IS DY VL   G +L     IDK+G++++    ++ + R++D  ++ +   Q
  S:     3 VLVGKQAPDFSEKAVKGQ-EVIENFSLSQFKGKY-VVLFFYPLDFTFVCPTELHAFEAKRAEFEAKGVEVVGVSTDSWFSHLAWLNTPKNQGGIEGVGYPIVSDFNKTISADYDVLLGGGMALRGLFLIDKEGVVQHQVVNNLPLGRNVDEAIRMVDALQ 160
>gi|67083335|gb|AAY66603.1| thioredoxin-dependent peroxide reductase [Ixodes scapularis] (233 aa)
Score = 176, Expect = 8.6e-12, Identities = 36/124 (29%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + +   F  +    + +SVDS  +H       + +  +  M++  +SD +K+I+RDY VL E+ G +L     ID KG+++  +   + V R +D  L+ +  +Q
  S:    74 VLFFYPLDFTFVCPTEIIAFSDRADEFRKINTELVAVSVDSHFSHLAWTNTPRKQGGLGKMNIPLLSDFNKQIARDYGVLLEDAGLALRGLFIIDPKGVVRQITVNDLPVGRSVDETLRLVKAFQ 198
>gi|192910848|gb|ACF06532.1| thioredoxin peroxidase [Elaeis guineensis] (288 aa)
Score = 176, Expect = 8.9e-12, Identities = 40/159 (25%), Positives = 83/159 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G +  +F ++A   +    +N  L+  +GK   +LFF   DF     +EI   + ++  F  L    + +S+DS  +H   V+  +    + ++    +SD++K IS+ + VL  ++G +L     IDK+G+I++ +  ++ + R +D  ++T+   Q
  S:    81 LVGNRAPDFEAEAVFDQ--EFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYSEFEQLNTEILGVSIDSVFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHCTINNLAIGRSVDETMRTLQALQ 238
>gi|157122266|gb|EDO66406.1| hypothetical protein FTAG_00282 [Francisella tularensis subsp. holarctica FSC022] (199 aa)
Score = 176, Expect = 8.9e-12, Identities = 41/160 (25%), Positives = 78/160 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+G+K   F + A  G  + + +YD  K +     ++ F   DF     SE+I L+++      LGV  + +S+DS  TH        +  +I  +    V+DI++EI + Y V    G +   T  IDK G++++     + + R++D +++ +   Q
  S:     2 VLVGKKAPLFNAPAVLGNGEIVDSYDFAKAIQGKYAIVVFYPLDFTFVCPSELIALDKRTAKLKELGVEVVSVSIDSHFTHNAWRNTPINDGSIGPVKYTMVADINQEIVKAYDVQAAGGMAFRGTFLIDKSGVVRHQVVNDLPLGRNMDEVIRMVEALQ 161
>gi|116059461|emb|CAL55168.1| thioredoxin peroxidase (ISS) [Ostreococcus tauri] (230 aa)
Score = 176, Expect = 9.7e-12, Identities = 33/124 (26%), Positives = 68/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + +++ F  L    + +SVDS+ +H   ++  ++   + +++   VSD+ +EI   Y VL+E+G +L     ID++G+I++++  +    R++D  L+ +   Q
  S:    72 VLFFYPLDFTFVCPTEITAFSDRYEEFAKLNTEVLGVSVDSKFSHLAWLQTDRNDGGLGDLAYPLVSDLKREICESYDVLYEDGTALRGLYIIDREGVIQHYTCNNAPFGRNVDECLRVLQAIQ 195
>gi|15604195|ref|NP_220710.1| thioredoxin peroxidase 1 (tdpX1) [Rickettsia prowazekii str. Madrid E] >gi|3860887|emb|CAA14787.1| THIOREDOXIN PEROXIDASE 1 (tdpX1) [Rickettsia prowazekii] (200 aa)
Score = 176, Expect = 1.0e-11, Identities = 47/156 (30%), Positives = 73/156 (46%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           + +G+   +F +KA     +    + L+     +  +LFF   DF     SEII  + K   F       I +SVDS  +H        +K  +  +    VSDI+K+IS  Y VL E+G +L  T  IDK  I+++     + + RDI+  LK I
  S:     3 VFVGKTAPDFTAKAIMPNNNIDDKFKLSDYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERRTKVIAVSVDSHFSHLAWKNTPHNKGGLGQVQFPMVSDITKDISSKYNVLNEDGIALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVI 158
>gi|67083703|gb|AAY66786.1| mitochondrial truncated thioredoxin-dependent peroxide reductase precursor [Ixodes scapularis] (233 aa)
Score = 176, Expect = 1.0e-11, Identities = 36/124 (29%), Positives = 63/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + +   F  +    + +SVD   +H       + +  +  M++  +SD +K+I+RDY VL EE G +L     ID KG+++  +   + V R +D  L+ +  +Q
  S:    74 VLFFYPLDFTLVCPTEIIAFSDRADEFRKINTELVAVSVDPHFSHLAWTNTPRKQGGLGKMNIPLLSDFNKQIARDYGVLLEEAGLALRGLFIIDPKGVVRQITVNDLPVGRSVDETLRLVKAFQ 198
>gi|195055989|ref|XP_001994895.1| GH17487 [Drosophila grimshawi] >gi|193892658|gb|EDV91524.1| GH17487 [Drosophila grimshawi] (231 aa)
Score = 176, Expect = 1.0e-11, Identities = 39/124 (31%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  +++   F ++    + +SVDS  +H       +    +  +    +SDI+K+IS DY VL + EG SL  T  ID KG+++ +S   + V R +D +L+ I  +Q
  S:    70 VLFFYPLDFTFVCPTEIVAFSERINEFQDINAEVVGVSVDSHFSHLTWCNVDRKNGGVGKLKYPLLSDITKKISADYDVLLDNEGISLRGTFIIDPKGVLRQYSINDLPVGRSVDEVLRLIKAFQ 194
>gi|50539996|ref|NP_001002468.1| peroxiredoxin 2 [Danio rerio] >gi|49900827|gb|AAH76347.1| Peroxiredoxin 2 [Danio rerio] >gi|157886060|emb|CAP09310.1| peroxiredoxin 1 [Danio rerio] (197 aa)
Score = 176, Expect = 1.1e-11, Identities = 39/124 (31%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  +++   F  +GV  I  S DS  +H   +   + +  + +M++  V+D+++ ISRDY VL E EG +      ID KGI++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSERAAEFRKIGVELIAASTDSHFSHLAWINTPRKQGGLGSMNIPLVADLTQSISRDYGVLKEDEGIAYRGLFVIDDKGILRQITINDLPVGRSVDETLRLVQAFQ 163
>gi|11119229|gb|AAG30570.1|AF311863_1 2-Cys peroxiredoxin [Brassica napus] (270 aa)
Score = 176, Expect = 1.1e-11, Identities = 43/159 (27%), Positives = 84/159 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F ++A   +    +   L++ +GK   +LF    DF     +EI   + +++ F  L    + +SVDS  +H   V+  +    + +++   VSDI+K IS+ + VL  ++G +L     IDKKG+I++ +  ++ + R +D  ++T+   Q
  S:    78 LVGNKAPDFEAEAVFDQ--EFIKVKLSEYIGKKYVILFLYPLDFTFVCPTEITAFSDRYEEFEKLNTEVLGVSVDSVFSHLAWVQTERKSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLFIIDKKGVIQHSTINNLGIGRSVDETMRTLQALQ 235
>gi|73986497|ref|XP_542042.2| PREDICTED: similar to Peroxiredoxin 2 (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) (PRP) (Natural killer cell enhancing factor B) (NKEF-B) isoform 1 [Canis familiaris] >gi|73986499|ref|XP_867426.1| PREDICTED: similar to Peroxiredoxin 2 (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) (PRP) (Natural killer cell enhancing factor B) (NKEF-B) isoform 2 [Canis familiaris] (198 aa)
Score = 176, Expect = 1.1e-11, Identities = 36/124 (29%), Positives = 68/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  ++  ++F  LG   + +SVDS+ TH   +   + +  +  +++  V+D+++ +S DY VL E EG +      ID KG+++  +   + V R +D +L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSEHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLVADVTRSLSEDYGVLKEDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEVLRLVQAFQ 163
>gi|51892064|ref|YP_074755.1| 2-cys peroxiredoxin [Symbiobacterium thermophilum IAM 14863] >gi|51855753|dbj|BAD39911.1| 2-cys peroxiredoxin [Symbiobacterium thermophilum IAM 14863] (179 aa)
Score = 175, Expect = 1.1e-11, Identities = 40/124 (32%), Positives = 65/124 (52%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   N + Q F +     + +SVDS  +H+  +K  K++  +  ++    SDI+KE+SR Y VL  EEG +L     ID  GI++Y       + R++D +L+ +   Q
  S:    37 ILFFYPADFTFVCPTEITAFNDRVQEFQDANCEILGVSVDSVYSHRAWIKTPKEEGGLGPVNYPLASDITKEVSRAYGVLIEEEGVALRGLFIIDPDGIVRYQVVHDNNIGRNVDEVLRVLEALQ 161
>gi|51473523|ref|YP_067280.1| thioredoxin peroxidase I [Rickettsia typhi str. Wilmington] >gi|51459835|gb|AAU03798.1| thioredoxin peroxidase I [Rickettsia typhi str. Wilmington] (200 aa)
Score = 175, Expect = 1.2e-11, Identities = 46/156 (29%), Positives = 73/156 (46%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           + +G+   +F +KA     +    + L+     +  +LFF   DF     SEII  + K   F       I +SVDS  +H        +K  +  +    +SDI+K+IS  Y VL E+G +L  T  IDK  I+++     + + RDI+  LK I
  S:     3 VFVGKTAPDFTAKAIMPNNNIDDKFKLSDYAAGDNVVLFFYPLDFTFVCPSEIIAFHNKLGEFTERRTKVIAVSVDSHFSHLAWKNTPHNKGGLGQIQFPMISDITKDISSKYNVLNEDGIALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVI 158
>gi|125539780|gb|EAY86175.1| hypothetical protein OsI_007408 [Oryza sativa (indica cultivar-group)] (276 aa)
Score = 175, Expect = 1.2e-11, Identities = 40/155 (25%), Positives = 82/155 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           L+G K  +F ++A   +    +N  L+  +GK   +LFF   DF     +EI   + ++  F  L    + +S+DS  +H   V+  +    + ++    +SD++K IS+ + VL  ++G +L     IDK+G+I++ +  ++ + R +D  ++T+
  S:    71 LVGNKAPDFDAEAVFDQ--EFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYDEFEKLNTEILGVSIDSVFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTL 224
>gi|83315146|ref|XP_730667.1| thioredoxin peroxidase 2 [Plasmodium yoelii yoelii str. 17XNL] >gi|23490460|gb|EAA22232.1| thioredoxin peroxidase 2 [Plasmodium yoelii yoelii] (215 aa)
Score = 175, Expect = 1.3e-11, Identities = 44/146 (30%), Positives = 79/146 (54%)
  Q:    11 FSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           F+     K + I+N  L+  +GK    LFF   ++     +E+IE N+  ++F    V  + ISVDS  +H        +K  I N++   VSDI+KEIS++Y VL++  ++L     ID +G I++ +   + + R+++ +L+ I
  S:    29 FTAQGVNKNNEIINVQLSSYIGKKYCCLFFYPLNYTFVCPTEVIEFNKHVKSFEEKNVELLGISVDSVYSHIAWKNMPIEKGGIGNINFTLVSDINKEISKNYNVLYDNSFALRGLFIIDLEGKIRHKTVNDLSIGRNVNEVLRVI 174
>gi|70951732|ref|XP_745083.1| thioredoxin peroxidase [Plasmodium chabaudi chabaudi] >gi|56525292|emb|CAH74582.1| thioredoxin peroxidase, putative [Plasmodium chabaudi] (215 aa)
Score = 175, Expect = 1.3e-11, Identities = 44/146 (30%), Positives = 78/146 (53%)
  Q:    11 FSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           F+     K + I+N  L+  +GK    LFF   ++     +E+IE N+  ++F    V  + ISVDS  +H        +K  I N++   VSDI+KEIS++Y VL+   ++L     ID +G I++ +   + + R+++ +L+ I
  S:    29 FTAQGINKNNEIINVQLSSYIGKKYCCLFFYPLNYTFVCPTEVIEFNKHVKSFEEKNVELLGISVDSVYSHMAWKNMPIEKGGIGNINFTLVSDITKEISKNYNVLYNNSFALRGLFIIDLEGKIRHKTVNDLSIGRNVNEVLRVI 174
>gi|196005671|ref|XP_002112702.1| expressed hypothetical protein [Trichoplax adhaerens] >gi|190584743|gb|EDV24812.1| expressed hypothetical protein [Trichoplax adhaerens] (246 aa)
Score = 175, Expect = 1.3e-11, Identities = 38/124 (30%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + +   F  +    +  S DS+ TH   VK  + +  + +M +  +SDI+ +I+RDY V  E EG++L     ID KGI++  +   + V R +D  L+ +  +Q
  S:    84 VFFFYPMDFTFVCPTEIIAFSDRVSEFHAINAEVVACSTDSKFTHLAWVKTTRKQGGLGSMKIPLLSDITHQIARDYGVYLEKEGHALRGLFIIDDKGILRQITMNDLPVGRSVDETLRLVQAFQ 208
>gi|7339568|emb|CAB82860.1| 2-Cys-peroxiredoxin [Riccia fluitans] (275 aa)
Score = 175, Expect = 1.4e-11, Identities = 38/134 (28%), Positives = 73/134 (54%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L++ +GK   +LFF   DF     +EI   + KH+ F  L    I +S DS  +H   ++  +    + ++    VSD++K+I+ D+ VL  ++G +L     IDK+G+I++ +  ++ + R ++  L+T+   Q
  S:   106 LSEYIGKRYVVLFFYPLDFTFVCPTEITAFSDKHEEFEKLNTEVIGVSTDSVFSHLAWIQTDRKSGGLGDLKYPLVSDLTKKIAEDFGVLIPDQGIALRGLFIIDKEGVIQHATINNLAIGRSVEETLRTLQAVQ 240
>gi|159477024|ref|XP_001696611.1| 2-cys peroxiredoxin, chloroplastic [Chlamydomonas reinhardtii] >gi|11120591|gb|AAG30934.1|AF312025_1 thioredoxin peroxidase [Chlamydomonas reinhardtii] >gi|11995218|emb|CAC19676.1| peroxiredoxin [Chlamydomonas reinhardtii] >gi|158282836|gb|EDP08588.1| 2-cys peroxiredoxin, chloroplastic [Chlamydomonas reinhardtii] (235 aa)
Score = 174, Expect = 1.4e-11, Identities = 38/134 (28%), Positives = 73/134 (54%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+K  GK   +LFF   DF     +EI   + +++ F ++    + +SVDS+ TH   ++  + +  + +++   V+D+ KEIS+ Y VL E+G SL     IDK+G++++ +  ++   R +D   + +   Q
  S:    68 LSKYRGKY-VVLFFYPLDFTFVCPTEITAFSDRYKEFKDINTEVLGVSVDSQFTHLAWIQTDRKEGGLGDLAYPLVADLKKEISKAYGVLTEDGISLRGLFIIDKEGVVQHATINNLAFGRSVDETKRVLQAIQ 200
>gi|147906188|ref|NP_001086130.1| MGC83969 protein [Xenopus laevis] >gi|49256209|gb|AAH74236.1| MGC83969 protein [Xenopus laevis] (251 aa)
Score = 174, Expect = 1.5e-11, Identities = 38/124 (30%), Positives = 63/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + +   F ++    + +SVDS   H       +    +  M++  +SD++K+ISRDY VL E  G +L     ID  GIIK+ S   + V R ++  L+ +  +Q
  S:    92 VLFFYPLDFTFVCPTEIVAFSNEANEFHDVNCEVVAVSVDSHFCHLAWTNTPRKSGGLGQMNIPLLSDLNKQISRDYGVLLETAGIALRGLFIIDPNGIIKHMSVNDLPVGRSVEETLRLVKAFQ 216
>gi|163751266|ref|ZP_02158494.1| antioxidant, AhpC/Tsa family protein [Shewanella benthica KT99] >gi|161328980|gb|EDQ00054.1| antioxidant, AhpC/Tsa family protein [Shewanella benthica KT99] (201 aa)
Score = 174, Expect = 1.5e-11, Identities = 43/160 (26%), Positives = 79/160 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GRK  +F + A  G  + + +++L +      T++FF   DF     SE+I  + + + F   GV  I +S+DS+ TH         +  I  +    V+D+  EI + Y V   E G +   +  IDK+G +++     + + R++D +L+ I   Q
  S:     3 VLVGRKAPDFTAAAVLGNGEIVDSFNLAEATKGKPTVVFFYPLDFTFVCPSELIAFDHRMEEFKKRGVEVIGVSIDSQFTHNAWRNTPVAEGGIGPVKYTLVADVKHEICKAYGVEHPEAGVAFRGSFLIDKEGTVRHQVVNDLPLGRNVDEMLRMIDALQ 163
>gi|114562632|ref|YP_750145.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella frigidimarina NCIMB 400] >gi|114333925|gb|ABI71307.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella frigidimarina NCIMB 400] >gi|149675684|dbj|BAF64721.1| alkyl hydroperoxide reductase [Shewanella livingstonensis] (201 aa)
Score = 174, Expect = 1.6e-11, Identities = 41/160 (25%), Positives = 77/160 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR   +F + A  G  + +  ++L   +     ++FF   DF     SE+I  + + + F   GV  I +S+DS+ TH        DK  I  +    V+D+  EI + Y V   E G +   +  +DK+G +++     + + R++D +++ I   Q
  S:     3 VLVGRPAPDFTAAAVLGSGEIVDTFNLATAIKGKPAVIFFYPLDFTFVCPSELIAFDHRMEEFTKRGVEVIGVSIDSQFTHNAWRNTPVDKGGIGQVKYTLVADVKHEICKAYDVEHPEAGVAFRGSFLVDKEGQVRHQVVNDLPLGRNVDEMIRMIDALQ 163
>gi|85058620|ref|YP_454322.1| putative peroxidase [Sodalis glossinidius str. 'morsitans'] >gi|84779140|dbj|BAE73917.1| putative peroxidase [Sodalis glossinidius str. 'morsitans'] (200 aa)
Score = 174, Expect = 1.6e-11, Identities = 41/160 (25%), Positives = 81/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F + A  G  + + N++L  ++     ++FF   DF     SE+I  ++++  F   GV  I +S DSE  H    +   DK  I  +    V+DI +EI + Y +   + G +L  +  IDK G++++     + + R++D +++ +   Q
  S:     2 VLVTRQAPDFTAAAVLGNGEIVDNFNLKSHIQGKPAVIFFWPMDFTFVCPSELIAFDKRYAEFQKRGVEIIGVSFDSEFVHNAWRQVPTDKGGIGPVQYPMVADIKREIIKAYGIEHSDAGVALRGSFLIDKDGLVRHQVVNDLPLGRNVDEMMRMVDALQ 162
>gi|109897722|ref|YP_660977.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pseudoalteromonas atlantica T6c] >gi|109700003|gb|ABG39923.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pseudoalteromonas atlantica T6c] (201 aa)
Score = 174, Expect = 1.6e-11, Identities = 41/156 (26%), Positives = 78/156 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+ R   +F + A  G  D + N+ L++ +     +LFF   DF     SE+I  ++++  F   GV  I +S+DS+ TH        +   I  +    V+D+  EI + Y V   E G +   +  ID++G++++     + + R+ID +L+ +
  S:     3 VLVSRPAPDFTAAAVLGNGDIVENFTLSEAIKGQKAVLFFYPLDFTFVCPSELIAFDKRYDEFKKRGVEVIGVSIDSQFTHNAWRNTAINDGGIGKVKYAMVADVKHEICQAYDVEHPEAGVAFRGSFLIDEEGVVRHQVVNDLPLGRNIDDMLRMV 159
>gi|3121825|sp|O24364|BAS1_SPIOL 2-Cys peroxiredoxin BAS1, chloroplast precursor (Thiol-specific antioxidant protein) >gi|1498247|emb|CAA63910.1| bas1 protein [Spinacia oleracea] (265 aa)
Score = 174, Expect = 1.6e-11, Identities = 42/159 (26%), Positives = 83/159 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F ++A   +    +   L+  +GK   +LFF   DF     +EI   + +H  F  L    + +SVDS  +H   V+  +    + +++   +SD++K IS+ + VL  ++G +L     IDK+G+I++ +  ++ + R +D  ++T+   Q
  S:    74 LVGNKAPDFEAEAVFDQ--EFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQ 231
>gi|193811376|emb|CAQ42104.1| thioredoxin peroxidase, putative [Plasmodium knowlesi strain H] (216 aa)
Score = 174, Expect = 1.6e-11, Identities = 44/139 (31%), Positives = 75/139 (53%)
  Q:    18 KTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           K + I+N  L+  +GK    L F   ++     +EIIE N+  ++F    V  + ISVDS  +H        +K  I N++   VSD++KEIS+ Y VL+E  ++L     ID +G +++ +   + + R +D +L+TI
  S:    36 KNNEIINVQLSSYIGKKYCCLLFYPLNYTFVCPTEIIEFNKHVKSFEEKNVELLGISVDSVYSHLAWKNMPIEKGGIGNVNFTLVSDLNKEISKMYNVLYENSFALRGLFIIDLQGKVRHQTVNDLPLGRSVDEVLRTI 174
>gi|15640750|ref|NP_230380.1| anti-oxidant AhpCTSA family protein [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121728598|ref|ZP_01681618.1| antioxidant, AhpC/Tsa family [Vibrio cholerae V52] >gi|147673354|ref|YP_001216220.1| anti-oxidant AhpCTSA family protein [Vibrio cholerae O395] >gi|153216124|ref|ZP_01950279.1| antioxidant, AhpC/Tsa family [Vibrio cholerae 1587] >gi|153220754|ref|ZP_01951865.1| antioxidant, AhpC/Tsa family [Vibrio cholerae MAK 757] >gi|153802823|ref|ZP_01957409.1| antioxidant, AhpC/Tsa family [Vibrio cholerae MZO-3] >gi|153818825|ref|ZP_01971492.1| antioxidant, AhpC/Tsa family [Vibrio cholerae NCTC 8457] >gi|153823126|ref|ZP_01975793.1| antioxidant, AhpC/Tsa family [Vibrio cholerae B33] >gi|153829409|ref|ZP_01982076.1| antioxidant, AhpC/Tsa family [Vibrio cholerae 623-39] >gi|194533581|ref|YP_002068997.1| antioxidant, AhpC/Tsa family [Vibrio cholerae MO10] >gi|194536586|ref|YP_002071744.1| antioxidant, AhpC/Tsa family [Vibrio cholerae RC385] >gi|9655175|gb|AAF93896.1| antioxidant, AhpC/Tsa family [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121629106|gb|EAX61550.1| antioxidant, AhpC/Tsa family [Vibrio cholerae V52] >gi|124114439|gb|EAY33259.1| antioxidant, AhpC/Tsa family [Vibrio cholerae 1587] >gi|124120318|gb|EAY39061.1| antioxidant, AhpC/Tsa family [Vibrio cholerae MAK 757] >gi|124121648|gb|EAY40391.1| antioxidant, AhpC/Tsa family [Vibrio cholerae MZO-3] >gi|125619633|gb|EAZ48160.1| antioxidant, AhpC/Tsa family [Vibrio cholerae MO10] >gi|126510607|gb|EAZ73201.1| antioxidant, AhpC/Tsa family [Vibrio cholerae NCTC 8457] >gi|126519343|gb|EAZ76566.1| antioxidant, AhpC/Tsa family [Vibrio cholerae B33] >gi|146315237|gb|ABQ19776.1| antioxidant, AhpC/Tsa family [Vibrio cholerae O395] >gi|148875129|gb|EDL73264.1| antioxidant, AhpC/Tsa family [Vibrio cholerae 623-39] >gi|150421380|gb|EDN13662.1| antioxidant, AhpC/Tsa family [Vibrio cholerae RC385] >gi|150424315|gb|EDN16252.1| antioxidant, AhpC/Tsa family [Vibrio cholerae AM-19226] (207 aa)
Score = 174, Expect = 1.7e-11, Identities = 39/156 (25%), Positives = 80/156 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GRK  +F + A  G  + + N++  +       ++FF   DF     SE+I  + ++++F+  GV  I +S+DS+ +H        +   I  +    V+D+  EI + Y V   E G +   +  ID++G++++     + + R+ID +L+ +
  S:     8 VLVGRKAPDFTAAAVLGNGEIVDNFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRYEDFLAKGVEVIGVSIDSQFSHNAWRNTAVENGGIGQVKYPLVADVKHEICKAYDVEHPEAGVAFRGSFLIDEEGMVRHQVVNDLPLGRNIDEMLRMV 164
>gi|157828322|ref|YP_001494564.1| thioredoxin peroxidase 1 [Rickettsia rickettsii str. 'Sheila Smith'] >gi|157800803|gb|ABV76056.1| thioredoxin peroxidase 1 [Rickettsia rickettsii str. 'Sheila Smith'] (200 aa)
Score = 174, Expect = 1.7e-11, Identities = 46/156 (29%), Positives = 72/156 (46%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           + +G+   +F +KA     +    + L+     +  +LFF   DF     SEII  + K   F       + +SVDS  +H        +K  +  +    VSDI K+IS  Y VL E+G +L  T  IDK  I+++     + + RDI+  LK I
  S:     3 VFVGKTAPDFTAKAIMPNNNIDDKFKLSNYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERRTKVVAVSVDSHFSHLAWKNTPHNKGGLGQVQFPMVSDIKKDISSKYNVLNEDGVALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVI 158
>gi|34580622|ref|ZP_00142102.1| thioredoxin peroxidase 1 [Rickettsia sibirica 246] >gi|28262007|gb|EAA25511.1| thioredoxin peroxidase 1 [Rickettsia sibirica 246] (200 aa)
Score = 174, Expect = 1.7e-11, Identities = 46/156 (29%), Positives = 72/156 (46%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           + +G+   +F +KA     +    + L+     +  +LFF   DF     SEII  + K   F       + +SVDS  +H        +K  +  +    VSDI K+IS  Y VL E+G +L  T  IDK  I+++     + + RDI+  LK I
  S:     3 VFVGKTAPDFTAKAIMPNNNIDDKFKLSNYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERRTKVVAVSVDSHFSHLAWKNTPHNKGGLGQVQFPMVSDIKKDISSKYNVLNEDGVALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVI 158
>gi|145558858|sp|Q9C5R8|BAS1B_ARATH 2-Cys peroxiredoxin BAS1-like, chloroplast precursor (2-Cys peroxiredoxin B) (2-Cys Prx B) (Thiol-specific antioxidant protein B) >gi|9758409|dbj|BAB08951.1| 2-cys peroxiredoxin-like protein [Arabidopsis thaliana] (271 aa)
Score = 174, Expect = 1.8e-11, Identities = 43/159 (27%), Positives = 85/159 (53%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F ++A   +    +   L++ +GK   +LFF   DF     +EI   + +++ F  L    + +SVDS  +H   V+  +    + +++   VSDI+K IS+ + VL  ++G +L     IDK+G+I++ +  ++ + R +D  ++T+   Q
  S:    79 LVGNKAPDFEAEAVFDQ--EFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQ 236
>gi|195453286|ref|XP_002073721.1| GK12986 [Drosophila willistoni] >gi|194169806|gb|EDW84707.1| GK12986 [Drosophila willistoni] (233 aa)
Score = 174, Expect = 1.8e-11, Identities = 38/124 (30%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  +++ + F ++    + +SVDS  +H       +    +  ++   +SD++K+IS DY VL + EG SL  T  ID  GI++ +S   + V R +D +L+ I  +Q
  S:    72 VLFFYPLDFTFVCPTEIVAFSERIKEFQDINTEVVGVSVDSHFSHLSWCNVDRKNGGVGQLNYPLLSDLTKKISTDYDVLLDKEGISLRGTFIIDPNGILRQYSVNDLPVGRSVDEVLRLIKAFQ 196
>gi|21553667|gb|AAM62760.1| 2-cys peroxiredoxin-like protein [Arabidopsis thaliana] (271 aa)
Score = 174, Expect = 1.8e-11, Identities = 43/159 (27%), Positives = 85/159 (53%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F ++A   +    +   L++ +GK   +LFF   DF     +EI   + +++ F  L    + +SVDS  +H   V+  +    + +++   VSDI+K IS+ + VL  ++G +L     IDK+G+I++ +  ++ + R +D  ++T+   Q
  S:    79 LVGNKAPDFEAEAVFDQ--EFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQ 236
>gi|18415155|ref|NP_568166.1| 2-cys peroxiredoxin, chloroplast, putative [Arabidopsis thaliana] >gi|11908048|gb|AAG41453.1|AF326871_1 putative 2-cys peroxiredoxin protein [Arabidopsis thaliana] >gi|12642866|gb|AAK00375.1|AF339693_1 putative 2-cys peroxiredoxin protein [Arabidopsis thaliana] >gi|15451082|gb|AAK96812.1| 2-cys peroxiredoxin-like protein [Arabidopsis thaliana] >gi|20148349|gb|AAM10065.1| 2-cys peroxiredoxin-like protein [Arabidopsis thaliana] (273 aa)
Score = 174, Expect = 1.8e-11, Identities = 43/159 (27%), Positives = 85/159 (53%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F ++A   +    +   L++ +GK   +LFF   DF     +EI   + +++ F  L    + +SVDS  +H   V+  +    + +++   VSDI+K IS+ + VL  ++G +L     IDK+G+I++ +  ++ + R +D  ++T+   Q
  S:    81 LVGNKAPDFEAEAVFDQ--EFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQ 238
>gi|73998673|ref|XP_865127.1| PREDICTED: similar to Thioredoxin-dependent peroxide reductase, mitochondrial precursor (Peroxiredoxin 3) (Antioxidant protein 1) (AOP-1) (MER5 protein homolog) (HBC189) (PRX III) isoform 2 [Canis familiaris] (260 aa)
Score = 174, Expect = 1.8e-11, Identities = 40/124 (32%), Positives = 69/124 (55%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSL---PS--TIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K + F ++  + + +SVDS  TH   +   +    + +M++  +SD++K+ISRDY VL   G+ L   PS     ID  G+IK+ S   + V R ++  L+ +  +Q
  S:    97 VLFFYPLDFTFVCPTEIVAFSDKAKEFHDVNCDVVAVSVDSHFTHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVL-SAGFVLQGSPSLGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQ 224
>gi|89256340|ref|YP_513702.1| AhpC/Tsa family protein [Francisella tularensis subsp. holarctica] >gi|115314788|ref|YP_763511.1| peroxiredoxin [Francisella tularensis subsp. holarctica OSU18] >gi|156502417|ref|YP_001428482.1| anti-oxidant AhpCTSA family protein [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167010827|ref|ZP_02275758.1| AhpC/Tsa family protein [Francisella tularensis subsp. holarctica FSC200] >gi|89144171|emb|CAJ79435.1| AhpC/Tsa family protein [Francisella tularensis subsp. holarctica LVS] >gi|115129687|gb|ABI82874.1| probable peroxiredoxin [Francisella tularensis subsp. holarctica OSU18] >gi|134253487|gb|EBA52581.1| ahpC/TSA family protein [Francisella tularensis subsp. holarctica 257] >gi|156253020|gb|ABU61526.1| antioxidant, AhpC/Tsa family [Francisella tularensis subsp. holarctica FTNF002-00] (199 aa)
Score = 173, Expect = 1.9e-11, Identities = 41/160 (25%), Positives = 77/160 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+G+K   F + A  G  + + +YD  K +     ++ F   DF     SE+I L+++      LGV  + +S+DS  TH        +   I  +    V+DI++EI + Y V    G +   T  IDK G++++     + + R++D +++ +   Q
  S:     2 VLVGKKAPLFNAPAVLGNGEIVDSYDFAKAIQGKYAIVVFYPLDFTFVCPSELIALDKRTAKLKELGVEVVSVSIDSHFTHNAWRNTPINDGGIGPVKYTMVADINQEIVKAYDVQAAGGMAFRGTFLIDKSGVVRHQVVNDLPLGRNMDEVIRMVEALQ 161
>gi|157136354|ref|XP_001663718.1| peroxiredoxins, prx-1, prx-2, prx-3 [Aedes aegypti] >gi|108869991|gb|EAT34216.1| peroxiredoxins, prx-1, prx-2, prx-3 [Aedes aegypti] (232 aa)
Score = 173, Expect = 1.9e-11, Identities = 40/124 (32%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + + Q F +L    + +SVDS  +H   V   + +  +  M    ++D++K+IS DY VL EE G SL     ID  G+++  +   + V R +D  L+ I  +Q
  S:    71 VLFFYPLDFTFVCPTEIIAFSDRIQEFRDLNTEVVGVSVDSHFSHLAWVNTPRKQGGLGKMEYPLLADLTKKISADYGVLLEEAGISLRGLFIIDPNGVVRQITINDLPVGRSVDETLRLIKAFQ 195
>gi|125773251|ref|XP_001357884.1| GA19159-PA [Drosophila pseudoobscura] >gi|195158357|ref|XP_002020058.1| GL13701 [Drosophila persimilis] >gi|54637618|gb|EAL27020.1| GA19159-PA [Drosophila pseudoobscura] >gi|194116827|gb|EDW38870.1| GL13701 [Drosophila persimilis] (233 aa)
Score = 173, Expect = 1.9e-11, Identities = 39/124 (31%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  +++ + F ++    + +SVDS  +H       +    +  ++   +SD++K IS DY VL E EG SL  T  ID  GI++ +S   + V R +D +L+ I  +Q
  S:    72 VLFFYPLDFTFVCPTEIVAFSERIKEFQDINAEVLGVSVDSHFSHLTWCNVDRKNGGVGQLNYPLLSDLTKTISADYDVLLEKEGISLRGTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQ 196
>gi|15892374|ref|NP_360088.1| thioredoxin peroxidase 1 [Rickettsia conorii str. Malish 7] >gi|165933031|ref|YP_001649820.1| thioredoxin peroxidase [Rickettsia rickettsii str. Iowa] >gi|167471580|ref|ZP_02336284.1| thioredoxin peroxidase [Rickettsia africae ESF-5] >gi|15619523|gb|AAL02989.1| thioredoxin peroxidase 1 [EC:1.6.4.-] [Rickettsia conorii str. Malish 7] >gi|165908118|gb|ABY72414.1| thioredoxin peroxidase [Rickettsia rickettsii str. Iowa] (202 aa)
Score = 173, Expect = 1.9e-11, Identities = 46/156 (29%), Positives = 72/156 (46%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           + +G+   +F +KA     +    + L+     +  +LFF   DF     SEII  + K   F       + +SVDS  +H        +K  +  +    VSDI K+IS  Y VL E+G +L  T  IDK  I+++     + + RDI+  LK I
  S:     5 VFVGKTAPDFTAKAIMPNNNIDDKFKLSNYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERRTKVVAVSVDSHFSHLAWKNTPHNKGGLGQVQFPMVSDIKKDISSKYNVLNEDGVALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVI 160
>gi|16331338|ref|NP_442066.1| thiol-specific antioxidant protein [Synechocystis sp. PCC 6803] >gi|3123075|sp|Q55624|Y755_SYNY3 Putative peroxiredoxin sll0755 (Thioredoxin reductase) >gi|1001510|dbj|BAA10136.1| thiol-specific antioxidant protein [Synechocystis sp. PCC 6803] (200 aa)
Score = 173, Expect = 2.0e-11, Identities = 40/120 (33%), Positives = 65/120 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +LFF   DF     +EII  + +H  F  L    + ISVDSE +H   ++  +    I N++   VSD+ KEIS+ Y VL  + G +L     ID++GI++Y +  ++   R +D  L+ +
  S:    38 VLFFYPLDFTFVCPTEIIAFSDRHSEFTALDTEVVGISVDSEFSHLAWIQTERKMGGIGNINYPLVSDLKKEISQAYNVLEPDAGIALRGLFIIDREGILQYATVNNLSFGRSVDETLRVL 158
>gi|148225827|ref|NP_001089616.1| hypothetical protein LOC734674 [Xenopus laevis] >gi|71051182|gb|AAH99274.1| MGC116466 protein [Xenopus laevis] (251 aa)
Score = 173, Expect = 2.0e-11, Identities = 39/124 (31%), Positives = 62/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS   H       +    +  M++  +SD++K ISRDY VL E  G +L     ID  GIIK+ S   + V R ++  L+ +  +Q
  S:    92 VLFFYPLDFTFVCPTEIVAFSNKANEFHDVNCEVVAVSVDSHFCHLAWTNTPRKNGGLGKMNIPLLSDLNKLISRDYGVLLEAAGIALRGLFIIDPNGIIKHMSVNDLPVGRSVEETLRLVKAFQ 216
>gi|118497565|ref|YP_898615.1| AhpC/TSA family peroxiredoxin [Francisella tularensis subsp. novicida U112] >gi|118423471|gb|ABK89861.1| peroxiredoxin of the AhpC/TSA family [Francisella tularensis subsp. novicida U112] >gi|151570653|gb|EDN36307.1| hypothetical protein FTCG_00497 [Francisella tularensis subsp. novicida GA99-3549] >gi|151572099|gb|EDN37753.1| AhpC/Tsa family protein [Francisella tularensis subsp. novicida GA99-3548] (199 aa)
Score = 173, Expect = 2.0e-11, Identities = 41/160 (25%), Positives = 77/160 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+G+K   F + A  G  + + +YD  K +     ++ F   DF     SE+I L+++      LGV  + +S+DS  TH        +   I  +    V+DI++EI + Y V    G +   T  IDK G++++     + + R++D +++ +   Q
  S:     2 VLVGKKAPLFNAPAVLGNGEIVDSYDFAKAIQGKYAVVVFYPLDFTFVCPSELIALDKRTAKLKELGVEVVSVSIDSHFTHNAWRNTPINDGGIGPVKYTMVADINQEIVKAYDVQAAGGMAFRGTFLIDKSGVVRHQVVNDLPLGRNMDEVIRMVEALQ 161
>gi|74272711|gb|ABA01151.1| chloroplast thioredoxin peroxidase [Chlamydomonas incerta] (235 aa)
Score = 173, Expect = 2.1e-11, Identities = 38/134 (28%), Positives = 73/134 (54%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+K  GK   +LFF   DF     +EI   + +++ F ++    + +SVDS+ TH   ++  + +  + +++   V+D+ KEIS+ Y VL E+G SL     IDK+G++++ +  ++   R +D   + +   Q
  S:    68 LSKYRGKY-VVLFFYPLDFTFVCPTEITAFSDRYKEFKDINTEVLGVSVDSQFTHLAWIQTDRKEGGLGDLNYPLVADLKKEISKAYGVLTEDGISLRGLFIIDKEGVVQHATINNLAFGRSVDETKRVLQAIQ 200
>gi|67458924|ref|YP_246548.1| thioredoxin peroxidase 1 [Rickettsia felis URRWXCal2] >gi|67004457|gb|AAY61383.1| Thioredoxin peroxidase 1 [Rickettsia felis URRWXCal2] (202 aa)
Score = 173, Expect = 2.1e-11, Identities = 46/156 (29%), Positives = 72/156 (46%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           + +G+   +F +KA     +    + L+     +  +LFF   DF     SEII  + K   F       + +SVDS  +H        +K  +  +    VSDI K+IS  Y VL E+G +L  T  IDK  I+++     + + RDI+  LK I
  S:     5 VFVGKTAPDFTAKAIMPNNNIDEKFKLSDYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERRTKVVAVSVDSHFSHLAWKNTPHNKGGLGQVQFPMVSDIKKDISSKYNVLNEDGVALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVI 160
>gi|53759099|gb|AAU93339.1| antioxidant [Aeromonas hydrophila] (200 aa)
Score = 173, Expect = 2.2e-11, Identities = 43/159 (27%), Positives = 76/159 (47%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+GR   +F + A  G    + +++L  ++     +LFF   DF     SE+I  + + + F   GV  I +S+DSE +H        +   I  +    V+DI  EI + Y V   E G +   +  IDK G++++     + + R+ID +L+ +   Q
  S:     3 LVGRPAPDFTAAAVLGNGQIVDSFNLASHIKGKAAVLFFYPLDFTFVCPSELIAFDHRLEEFNKRGVEVIGVSIDSEFSHNAWRNTKIEDGGIGPVKYPLVADIKHEICKAYDVEHPEAGVAFRGSFLIDKNGVVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|15229806|ref|NP_187769.1| 2-cys peroxiredoxin, chloroplast (BAS1) [Arabidopsis thaliana] >gi|14916972|sp|Q96291|BAS1A_ARATH 2-Cys peroxiredoxin BAS1, chloroplast precursor (2-Cys peroxiredoxin A) (2-Cys Prx A) (Thiol-specific antioxidant protein A) >gi|6041816|gb|AAF02131.1|AC009918_3 putative 2-cys peroxiredoxin [Arabidopsis thaliana] >gi|11762140|gb|AAG40348.1|AF324996_1 AT3g11630 [Arabidopsis thaliana] >gi|12322892|gb|AAG51430.1|AC008153_3 putative 2-cys peroxiredoxin BAS1 precursor (thiol-specific antioxidant protein); 114724-116472 [Arabidopsis thaliana] >gi|16930449|gb|AAL31910.1|AF419578_1 AT3g11630/T19F11_3 [Arabidopsis thaliana] >gi|19310515|gb|AAL84991.1| AT3g11630/T19F11_3 [Arabidopsis thaliana] (266 aa)
Score = 173, Expect = 2.2e-11, Identities = 42/159 (26%), Positives = 83/159 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F ++A   +    +   L+  +GK   +LFF   DF     +EI   + +H  F  L    + +SVDS  +H   V+  +    + +++   +SD++K IS+ + VL  ++G +L     IDK+G+I++ +  ++ + R +D  ++T+   Q
  S:    74 LVGNKAPDFEAEAVFDQ--EFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQ 231
>gi|127512445|ref|YP_001093642.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella loihica PV-4] >gi|126637740|gb|ABO23383.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella loihica PV-4] (201 aa)
Score = 173, Expect = 2.2e-11, Identities = 42/160 (26%), Positives = 79/160 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR   +F + A  G  + + ++ L++ +     ++FF   DF     SE+I  + + + F   GV  I +S+DS+ TH        DK  I  +    V+D+  +I + Y V   E G +   +  IDK+G +++     + + R++D +L+ I   Q
  S:     3 VLVGRPAPDFTAAAVLGNGEIVDSFTLSEAIKGKPAVVFFYPLDFTFVCPSELIAFDHRMEEFKKRGVEVIGVSIDSQFTHNAWRNTPVDKGGIGQVQYTLVADVKHDICKAYDVEHPEAGVAFRGSFLIDKEGQVRHQVVNDLPLGRNVDEMLRMIDALQ 163
>gi|157964408|ref|YP_001499232.1| thioredoxin peroxidase 1 [Rickettsia massiliae MTU5] >gi|157844184|gb|ABV84685.1| Thioredoxin peroxidase 1 [Rickettsia massiliae MTU5] (202 aa)
Score = 173, Expect = 2.2e-11, Identities = 46/156 (29%), Positives = 72/156 (46%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           + +G+   +F +KA     +    + L+     +  +LFF   DF     SEII  + K   F       + +SVDS  +H        +K  +  +    VSDI K+IS  Y VL E+G +L  T  IDK  I+++     + + RDI+  LK I
  S:     5 VFVGKTAPDFTAKAIMPNNNIDDQFKLSDYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERRTKVVAVSVDSHFSHLAWKNTPHNKGGLGQVQFPMVSDIKKDISSKYNVLNEDGIALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVI 160
>gi|84569882|gb|ABC59223.1| natural killer cell enhancement factor [Cyprinus carpio] (197 aa)
Score = 173, Expect = 2.2e-11, Identities = 38/124 (30%), Positives = 65/124 (52%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  +++   F  +G   I  S DS  +H   +   + +  + +M++  V+D+++ ISRDY VL E EG +      ID KGI++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSERAAEFRKIGCEVIAASTDSHFSHLAWINTPRKQGGLGSMNIPLVADLTQSISRDYGVLKEDEGLAYRGLFVIDDKGILRQITINDLPVGRSVDETLRLVQAFQ 163
>gi|195536261|ref|ZP_03079268.1| antioxidant, AhpC/TSA family protein [Francisella tularensis subsp. novicida FTE] >gi|194372738|gb|EDX27449.1| antioxidant, AhpC/TSA family protein [Francisella tularensis subsp. novicida FTE] (204 aa)
Score = 173, Expect = 2.4e-11, Identities = 41/160 (25%), Positives = 77/160 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+G+K   F + A  G  + + +YD  K +     ++ F   DF     SE+I L+++      LGV  + +S+DS  TH        +   I  +    V+DI++EI + Y V    G +   T  IDK G++++     + + R++D +++ +   Q
  S:     7 VLVGKKAPLFNAPAVLGNGEIVDSYDFAKAIQGKYAVVVFYPLDFTFVCPSELIALDKRTAKLKELGVEVVSVSIDSHFTHNAWRNTPINDGGIGPVKYTMVADINQEIVKAYDVQAAGGMAFRGTFLIDKSGVVRHQVVNDLPLGRNMDEVIRMVEALQ 166
>gi|156103111|ref|XP_001617248.1| thioredoxin peroxidase2, putative [Plasmodium vivax SaI-1] >gi|148806122|gb|EDL47521.1| thioredoxin peroxidase2, putative [Plasmodium vivax] (216 aa)
Score = 173, Expect = 2.4e-11, Identities = 43/139 (30%), Positives = 75/139 (53%)
  Q:    18 KTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           K + I+N  L+  +GK    L F   ++     +EIIE N+  ++F    V  + ISVDS  +H        +K  I N++   VSDI+KEI++ Y VL+E  ++L     +D +G +++ +   + + R +D +L+TI
  S:    36 KNNEIINVQLSSYIGKKYCCLLFYPLNYTFVCPTEIIEFNKHVKSFEEKNVELLGISVDSVYSHLAWKNMPIEKGGIGNVNFTLVSDINKEIAKMYDVLYENSFALRGLFIVDLQGKVRHQTVNDLPLGRSVDEVLRTI 174
>gi|91776042|ref|YP_545798.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylobacillus flagellatus KT] >gi|91710029|gb|ABE49957.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylobacillus flagellatus KT] (200 aa)
Score = 172, Expect = 2.5e-11, Identities = 43/160 (26%), Positives = 78/160 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+G+   +F + A  G      +++L +++     ++FF   DF     SE+I  + + + F   G+  I +S+DS  TH        DK  I  +    V+DI  EI++ Y V  + G +   +  I+K+GII +     + + RDID +L+ +   Q
  S:     3 VLVGKPAPDFTAAAVLGDNSIKEDFNLYEHIKGKPAVIFFYPLDFTFVCPSELIAFDHRLEEFKARGIEVIGVSIDSHFTHLAWKNTPVDKGGIGKVGYPLVADIRHEIAKAYDVESDGGVAYRGSFLINKEGIIVHQVVNDLPLGRDIDEMLRMVDALQ 162
>gi|157803935|ref|YP_001492484.1| thioredoxin peroxidase 1 [Rickettsia canadensis str. McKiel] >gi|157785198|gb|ABV73699.1| thioredoxin peroxidase 1 [Rickettsia canadensis str. McKiel] (200 aa)
Score = 172, Expect = 2.5e-11, Identities = 46/156 (29%), Positives = 72/156 (46%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           + +G+   +F +KA     +    + L+     +  +LFF   DF     SEII  + K   F       + +SVDS  +H        +K  +  +    VSDI K+IS  Y VL E+G +L  T  IDK  I+++     + + RDI+  LK I
  S:     3 VFVGKTAPDFTAKAIMPNNNIDDKFKLSDYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERLTKVVAVSVDSHFSHLAWKNTPHNKGGLGQIQFPMVSDIKKDISSKYNVLNEDGVALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVI 158
>gi|21912927|emb|CAC84143.2| thioredoxin peroxidase [Nicotiana tabacum] (271 aa)
Score = 172, Expect = 2.5e-11, Identities = 42/159 (26%), Positives = 84/159 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G +  +F ++A   +    +   L++ +GK   +LFF   DF     +EI   + ++  F  L    + +SVDS  +H   V+  +    + +++   +SD++K IS+ Y VL  ++G +L     IDK+G+I++ +  ++ + R +D  L+T+   Q
  S:    79 LVGNQAPDFEAEAVFDQ--EFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYGEFEKLNTEILGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSYNVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETLRTLQALQ 236
>gi|88608779|ref|YP_506441.1| anti-oxidant AhpCTSA family protein [Neorickettsia sennetsu str. Miyayama] >gi|88600948|gb|ABD46416.1| antioxidant, AhpC/Tsa family [Neorickettsia sennetsu str. Miyayama] (200 aa)
Score = 172, Expect = 2.5e-11, Identities = 44/155 (28%), Positives = 75/155 (48%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           L+G+K  +F +KA         +++L + +     +LFF   DF     +EII  + +   F+      + +SVDS  +H            I ++    VSDI+K ISRDY VL ++  +L  T  ID   +I+      + V R++D +L+T+
  S:     4 LVGKKAFDFTAKAVLKNGSFCDDFNLQRELSGKYGVLFFYPLDFTFVCPTEIIAFSNRIPAFIERNAVVVGVSVDSHFSHFAWRSLPVKDGGIGSIGYTLVSDITKSISRDYQVLLDDAVALRGTFIIDPNFVIRVAHVNDLNVGRNVDEVLRTL 158
>gi|22298997|ref|NP_682244.1| thioredoxin peroxidase [Thermosynechococcus elongatus BP-1] >gi|22295179|dbj|BAC09006.1| thioredoxin peroxidase [Thermosynechococcus elongatus BP-1] (197 aa)
Score = 172, Expect = 2.8e-11, Identities = 37/124 (29%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + ++  F  L    + +SVDS+ +H    +  +    + ++    VSD+ K+IS  Y VL EEG +L     IDK+GII++ +  ++   R +D  L+ +   Q
  S:    38 VLFFYPLDFTFVCPTEIVAFSDRYDEFAKLNTEILGVSVDSQFSHLAWTQTDRKAGGVGDLKYPLVSDLKKDISTAYNVLTEEGVALRGLFIIDKEGIIQHATINNLAFGRSVDETLRVLQAIQ 161
>gi|13265490|gb|AAG40040.2|AF324689_1 AT5g06290 [Arabidopsis thaliana] (271 aa)
Score = 172, Expect = 2.9e-11, Identities = 43/159 (27%), Positives = 84/159 (52%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F ++A   +    +   L++ +GK   +LFF   DF     +EI   + +++ F  L    + +SVDS  +H   V+  +    + +++   VSDI+K IS+ + VL  ++G +L     IDK+G+I++    ++ + R +D  ++T+   Q
  S:    79 LVGNKAPDFEAEAVFDQ--EFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSPINNLGIGRSVDETMRTLQALQ 236
>gi|90994464|ref|YP_536954.1| hypothetical protein 199 [Porphyra yezoensis] >gi|122225821|sp|Q1XDL4|YCF42_PORYE Putative peroxiredoxin ycf42 (Thioredoxin reductase) >gi|90819028|dbj|BAE92397.1| unnamed protein product [Porphyra yezoensis] (199 aa)
Score = 172, Expect = 3.1e-11, Identities = 40/124 (32%), Positives = 65/124 (52%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + K+  F  L    + +SVDSE +H   ++  ++   + ++S   VSD+ KEIS  Y VL  +G +L     ID KGII+Y +  ++E  R ++  L+ +   Q
  S:    41 VLFFYPLDFTFVCPTEITAFSDKYNAFSELNTEVLGVSVDSEYSHLAWLQTDRESGGLGDLSYPLVSDLKKEISAAYNVLNSDGVALRGLFIIDPKGIIQYSTINNLEFGRSVEETLRVLQAIQ 164
>gi|145551454|ref|XP_001461404.1| hypothetical protein GSPATT00026354001 [Paramecium tetraurelia strain d4-2] >gi|124429238|emb|CAK94031.1| unnamed protein product [Paramecium tetraurelia] (230 aa)
Score = 172, Expect = 3.1e-11, Identities = 48/159 (30%), Positives = 76/159 (47%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE------GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+ R+   FFS              L+   GK   LLF+   DF     +E++  +     F  LG   + IS DS  TH   +K  +++  + ++ +  ++DISK+IS+ Y VL E+      G SL     IDKKG+++        V R +D  L+ I  +Q
  S:    31 LMPRQKAPFFSATAVTPDLKFQKISLSDYQGKYVVLLFYPF-DFTYVCPTELVAFSNAIDQFRALGAEVLGISTDSHFTHLAWLKTPRNQGGVGDLQIPLLADISKKISKAYGVLVEDELDELYGASLRGLFIIDKKGLVRTLQINDAPVGRSVDETLRLIQAFQ 194
>gi|167623614|ref|YP_001673908.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella halifaxensis HAW-EB4] >gi|167353636|gb|ABZ76249.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella halifaxensis HAW-EB4] (201 aa)
Score = 171, Expect = 3.3e-11, Identities = 41/156 (26%), Positives = 77/156 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR   +F + A  G  + I  ++L++ +     ++FF   DF     SE+I  + +   F   GV  I +S+DS+ TH        DK  I  +    V+D+  EI + Y V   E G +   +  IDK+G +++     + + R++D +++ +
  S:     3 VLVGRPAPDFTAAAVLGNGEIIDTFNLSEAIKGKTAVVFFYPLDFTFVCPSELIAFDHRMDEFKKRGVEVIGVSIDSQFTHNAWRNTPVDKGGIGQVQYTLVADVKHEICKAYDVEHPEAGVAFRGSFLIDKEGQVRHQVVNDLPLGRNVDEMIRMV 159
>gi|46580652|ref|YP_011460.1| anti-oxidant AhpCTSA family protein [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120602042|ref|YP_966442.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|30721747|gb|AAP34254.1| alkyl hydroperoxide reductase C [Desulfovibrio vulgaris] >gi|46450071|gb|AAS96720.1| antioxidant, AhpC/Tsa family [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120562271|gb|ABM28015.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfovibrio vulgaris subsp. vulgaris DP4] (204 aa)
Score = 171, Expect = 3.5e-11, Identities = 46/160 (28%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFS--KAYS---GKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+G+K   FF   K +S   G  + + ++D  K       ++FF   DF     SE+I  + + + F    V  I +S+DS+ TH        DK  I  +    V+DI  E++R Y V  E G +   +  ID+ G++++    ++ + RDID +L+ +   Q
  S:     3 VLVGKK-APFFEGGKTFSAVLGNGEVVDDFDFAKVTEGKYAVVFFYPLDFTFVCPSELIAFDHRLEAFRQRNVEVIGVSIDSQFTHAAWRNTPVDKGGIGPVGYPLVADIQHELARAYDVESEGGVAFRGSFLIDRAGVVQHQVVNNLPLGRDIDEMLRVVDALQ 166
>gi|11995220|emb|CAC19677.1| peroxiredoxin [Chlamydomonas reinhardtii] (199 aa)
Score = 171, Expect = 3.9e-11, Identities = 38/134 (28%), Positives = 73/134 (54%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+K  GK   +LFF   DF     +EI   + +++ F ++    + +SVDS+ TH   ++  + +  + +++   V+D+ KEIS+ Y VL E+G SL     IDK+G++++ +  ++   R +D   + +   Q
  S:    32 LSKYRGKY-VVLFFYPLDFTFVCPTEITAFSDRYKEFKDINTEVLGVSVDSQFTHLAWIQTDRKEGGLGDLAYPLVADLKKEISKAYGVLTEDGISLRGLFIIDKEGVVQHATINNLAFGRSVDETKRVLQAIQ 164
>gi|119478309|ref|ZP_01618340.1| antioxidant, AhpC/Tsa family protein [marine gamma proteobacterium HTCC2143] >gi|119448649|gb|EAW29894.1| antioxidant, AhpC/Tsa family protein [marine gamma proteobacterium HTCC2143] (174 aa)
Score = 171, Expect = 4.0e-11, Identities = 40/160 (25%), Positives = 75/160 (46%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+G+   +F   A  G  + + N++L   +     L+FF   DF     SE++ ++ +   F  LGV  I +S+DS  TH+       +   I  +S    +DI+ +I R Y V  + G +      ID+ G+++  +   + + R+ D  ++ I   Q
  S:     3 VLVGKPAPDFTCSAVLGSGEMVDNFNLADTIKGKVGLVFFYPLDFSIICPSELLAVDHRMDTFKKLGVEVIGVSIDSHFTHKAWRNTAVNDGGIGKVSYTLAADINHDICRAYDVQSDGGMAFRGAFIIDQNGVVRSQTVNDLPLGRNFDEFIRVIEALQ 162
>gi|195135294|ref|XP_002012069.1| GI16636 [Drosophila mojavensis] >gi|193918333|gb|EDW17200.1| GI16636 [Drosophila mojavensis] (243 aa)
Score = 171, Expect = 4.0e-11, Identities = 39/139 (28%), Positives = 73/139 (52%)
  Q:    22 ILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           I+   L++ +GK   LLF+   DF     +EII  + +   F  +    I  SVDS  TH   +   + +  + N+ +  +SD++ +IS+DY V  EE G++L     ID++G+++  +   + V R +D  ++ +  +Q
  S:    70 IVQLSLSQYLGKYVVLLFY-PLDFTFVCPTEIIAFSDRIAEFRKINTEVIAASVDSHFTHLAWINTPRKEGGLGNVKIPLLSDLTHKISKDYGVYLEEVGHTLRGLFIIDQRGVLRQITMNDLPVGRSVDETIRLVQAFQ 208
>gi|194681473|emb|CAR40312.1| putative alkyl hydroperoxide reductase [Proteus mirabilis HI4320] (200 aa)
Score = 170, Expect = 4.4e-11, Identities = 42/160 (26%), Positives = 79/160 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ RK  +F + A  G  + + +++L   +     ++FF   DF     SE+I  + + + F   GV  I +S+DSE  H    K   D   I  +    V+DI  +I + Y +   E G +L  +  IDK+G++++     + + R+ID +++ +   Q
  S:     2 VLVTRKAPDFTAAAVLGNGEIVNDFNLHSFIKGKPAVIFFWPMDFTFVCPSELIAFDHRFEEFQKRGVEIIGVSMDSEFVHNAWRKTAIDDGGIGEVRYPMVADIKHDIIKAYGIEHPEAGVALRGSFLIDKEGVVRHQVVNDLPLGRNIDEMIRMVDALQ 162
>gi|196242121|ref|ZP_03140878.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cyanothece sp. PCC 7425] >gi|196213803|gb|EDY08465.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cyanothece sp. PCC 7425] (198 aa)
Score = 170, Expect = 4.5e-11, Identities = 39/124 (31%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + ++  F ++    + +SVDSE +H    +  +    + +++   VSDI KEIS  Y VL E G SL     IDK G+I++ +  ++   R +D  L+T+   Q
  S:    40 VLFFYPLDFTFVCPTEITAFSDRYSEFSSINTEILGVSVDSEFSHLAWTQTDRKSGGVGDLNYPLVSDIKKEISAAYNVLTEGGISLRGLFIIDKDGVIQHATINNLAFGRSVDETLRTLQAIQ 163
>gi|157825578|ref|YP_001493298.1| thioredoxin peroxidase 1 [Rickettsia akari str. Hartford] >gi|157799536|gb|ABV74790.1| Thioredoxin peroxidase 1 [Rickettsia akari str. Hartford] (200 aa)
Score = 170, Expect = 4.6e-11, Identities = 45/156 (28%), Positives = 72/156 (46%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           + +G+   +F +KA     +    + L+     +  +LFF   DF     SEII  + K   F       + +SVDS  +H        +K  +  +    VSDI K+IS  Y VL E+ ++L  T  IDK  I+++     + + RDI+  LK I
  S:     3 VFVGKTAPDFTAKAIMPNNNIDEKFKLSDYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERRTKVVAVSVDSHFSHLAWKNTPHNKGGLGQVQFPMVSDIKKDISSKYNVLNEDCFALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVI 158
>gi|123459140|ref|XP_001316602.1| thioredoxin peroxidase, putative [Trichomonas vaginalis G3] >gi|121899313|gb|EAY04379.1| thioredoxin peroxidase, putative [Trichomonas vaginalis G3] (195 aa)
Score = 170, Expect = 4.6e-11, Identities = 47/160 (29%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDY-LVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ML+G+    F ++A    TD      L +  GK   +LF    DF     +EIIE + K + F  LG   + +SVDS  TH   +   +    +  +    ++D+  +IS+ Y   + E+G++L  T  ID +GII++      +V R++D I++ +  YQ
  S:     1 MLVGKPAPAFQTEAVFPDTD-FKQVSLEQYKGK-WLVLFSYPLDFTFVCPTEIIEFSNKIEEFKKLGCEVLGLSVDSCFTHLAWINTPRKDGGLGEIKYPLLADLGAKISKQYGWYMEEDGHTLRGTAIIDPQGIIRHIQMNHPDVGRNVDEIIRLVKAYQ 159
>gi|118485938|gb|ABK94814.1| unknown [Populus trichocarpa] (269 aa)
Score = 170, Expect = 4.7e-11, Identities = 37/138 (26%), Positives = 73/138 (52%)
  Q:    23 LNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +N  L+  +GK   +LFF   DF     +EI   + +H+ F  +    + +S+DS  +H   V+  +    + ++    +SD++K IS+ Y VL  ++G +L     IDK+G+I++ +  ++ + R +D   +T+   Q
  S:    96 INVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHEEFEQINTEVLGVSIDSVFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSYGVLIPDQGVALRGLFIIDKEGVIQHSTINNLAIGRSVDETKRTLQALQ 234
>gi|86609696|ref|YP_478458.1| anti-oxidant AhpCTSA family protein [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86558238|gb|ABD03195.1| antioxidant, AhpC/Tsa family [Synechococcus sp. JA-2-3B'a(2-13)] (202 aa)
Score = 170, Expect = 4.8e-11, Identities = 42/134 (31%), Positives = 68/134 (50%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+   GK   +LFF   DF     +EI   + ++ +F  L    + +SVDSE +H   ++  +    +  +    VSD+ KEIS  Y VL  E G +L     IDK+GII++ +  ++   R +D  L+T+   Q
  S:    31 LSDYRGKKYVVLFFYPLDFTFVCPTEITAFSDRYDDFAKLDTEILGVSVDSEYSHLAWIQTDRKAGGVGELRYPLVSDLKKEISAAYNVLDPEAGVALRGLFIIDKEGIIQHATINNLAFGRSVDETLRTLQAIQ 165
>gi|194775671|ref|XP_001967843.1| GF15932 [Drosophila ananassae] >gi|190628992|gb|EDV44409.1| GF15932 [Drosophila ananassae] (234 aa)
Score = 170, Expect = 4.8e-11, Identities = 38/124 (30%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  +++ + F ++    + +SVDS  +H       +    +  ++   +SD++K+IS DY VL + EG SL  T  ID  GI++ +S   + V R +D +L+ I  +Q
  S:    73 VLFFYPLDFTFVCPTEIVAFSERIKEFHDINAEVLGVSVDSHFSHLTWCNVDRKSGGVGQLNYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQ 197
>gi|1498198|emb|CAA63909.1| 2-Cys peroxiredoxin bas1 [Arabidopsis thaliana] >gi|1783308|emb|CAA71503.1| 2-Cys peroxiredoxin [Arabidopsis thaliana] (265 aa)
Score = 170, Expect = 5.0e-11, Identities = 43/159 (27%), Positives = 81/159 (50%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F  KA +      +   L+   GK   +LFF   DF     +EI   + +H  F  L    + +SVDS  +H   V+  +    + +++   +SD++K IS+ + VL  ++G +L     IDK+G+I++ +  ++ + R +D  ++T+   Q
  S:    74 LVGNKAPDF--KAEAVFDQEFIKVKLSDYNGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQ 231
>gi|189501532|ref|YP_001957249.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Candidatus Amoebophilus asiaticus 5a2] >gi|189496973|gb|ACE05520.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Candidatus Amoebophilus asiaticus 5a2] (213 aa)
Score = 170, Expect = 5.0e-11, Identities = 50/153 (32%), Positives = 83/153 (54%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-------EEGYS---LP----STIFIDKKGIIKYFSTGSVEVKRDIDSILK 154
           +IG+K   F + A    T+ + ++ L + +GK   + FF  +DF     +E+I        F   GV  +  S D+E TH   +   +++  I  ++   V+DI+K IS +Y VL        E G+S   LP     T FIDK+GII++ S   + + R+I  +L+
  S:     3 MIGKKAPVFRAPAVINGTEIVQDFSLAQYLGKKEVIFFFYPKDFTFVCPTELIAFQNALGEFEQKGVAIVGCSTDTEETHIAWLNTPRNQGGIMGVTYPIVADIAKTISANYGVLGGEWEYDEEGGFSFSGLPVAYRGTFFIDKQGIIRHESINELSLGRNIAELLR 169
>gi|157962395|ref|YP_001502429.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella pealeana ATCC 700345] >gi|157847395|gb|ABV87894.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella pealeana ATCC 700345] (201 aa)
Score = 170, Expect = 5.0e-11, Identities = 40/156 (25%), Positives = 77/156 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR   +F + A  G  + +  ++L++ +     ++FF   DF     SE+I  + +   F   GV  I +S+DS+ TH        DK  I  +    V+D+  EI + Y V   E G +   +  IDK+G +++     + + R++D +++ +
  S:     3 VLVGRPAPDFTAAAVLGNGEIVDTFNLSEAIKGKTAVVFFYPLDFTFVCPSELIAFDHRMDEFKKRGVEVIGVSIDSQFTHNAWRNTPVDKGGIGQVQYTLVADVKHEICKAYDVEHPEAGVAFRGSFLIDKEGQVRHQVVNDLPLGRNVDEMIRMV 159
>gi|78187352|ref|YP_375395.1| thiolredoxin peroxidase [Pelodictyon luteolum DSM 273] >gi|78167254|gb|ABB24352.1| thiolredoxin peroxidase [Pelodictyon luteolum DSM 273] (196 aa)
Score = 170, Expect = 5.3e-11, Identities = 47/160 (29%), Positives = 82/160 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GRK   F  +A +G  + + +  L+   GK   +LFF   DF     +E+    +K   F    V  I  SVDS+ +H   ++  +++  I  ++   +SD++K +S DY VL E  G SL     IDK GI+++     + + R++D +L+ +   Q
  S:     3 VLVGRKAPEFNVEAVAGGREFVDSCKLSDFSGKY-VILFFYPLDFTFVCPTELHAFQEKLDEFKKRNVEVIGCSVDSKFSHFAWLQTPRNRGGIEGVTYTLLSDLNKTVSTDYDVLAEGAGVSLRGLFLIDKAGIVRHQVVNDLGLGRNVDEVLRMVDALQ 162
>gi|73984367|ref|XP_850180.1| PREDICTED: similar to Thioredoxin-dependent peroxide reductase, mitochondrial precursor (Peroxiredoxin 3) (Antioxidant protein 1) (AOP-1) (MER5 protein homolog) (HBC189) (PRX III) [Canis familiaris] (269 aa)
Score = 169, Expect = 5.5e-11, Identities = 36/124 (29%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF    F     +EI+  + K + F ++  + + +SVDS  TH   +  L+   ++ +M++  +SD++K+ISR+Y VL E  G +L      D  G+IK+ S   + V R ++  L  +  + 
  S:   109 VLFFYPLHFTFVCPTEIVAFSDKAKEFHDVNCDVVAVSVDSHFTHLAWINALQKNGSLGHMNIALLSDLTKQISREYGVLLEGPGIALRGLFITDPNGVIKHLSVNDLPVGRSVEETLCLVKAFH 233
>gi|189183182|ref|YP_001936967.1| thioredoxin peroxidase 1 [Orientia tsutsugamushi str. Ikeda] >gi|189179953|dbj|BAG39733.1| thioredoxin peroxidase 1 [Orientia tsutsugamushi str. Ikeda] (200 aa)
Score = 169, Expect = 5.8e-11, Identities = 40/156 (25%), Positives = 80/156 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           + +G+   +F + A   K +    ++L   +     +LFF   +F     +EII  N ++  F+      I ISVDS   H+       +K  I ++    VSDI+K+IS+ Y VL ++G ++ +T  ID++ ++++ +   + + R+++  L+ I
  S:     3 IFVGKSACDFTAPAVLPKNNINEKFNLKHELDGRKAVLFFYPLNFTFVCPTEIIAFNNRYGEFLKRNTEVIGISVDSHFCHKAWKLTPYNKGGIGDIQFPLVSDINKDISKTYNVLNQDGVAVRATFIIDQEFVLRHVTINDLSIGRNVEESLRII 158
>gi|194900414|ref|XP_001979752.1| GG16768 [Drosophila erecta] >gi|190651455|gb|EDV48710.1| GG16768 [Drosophila erecta] (234 aa)
Score = 169, Expect = 6.1e-11, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  +++ + F ++    + +SVDS  +H       +    +  +    +SD++K+IS DY VL + EG SL  T  ID  GI++ +S   + V R +D +L+ I  +Q
  S:    73 VLFFYPLDFTFVCPTEIVAFSERIKEFHDINTEVLGVSVDSHFSHLTWCNVDRKSGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQ 197
>gi|195358979|ref|XP_002045273.1| GM16948 [Drosophila sechellia] >gi|195570115|ref|XP_002103054.1| GD20225 [Drosophila simulans] >gi|194127538|gb|EDW49581.1| GM16948 [Drosophila sechellia] >gi|194198981|gb|EDX12557.1| GD20225 [Drosophila simulans] (234 aa)
Score = 169, Expect = 6.5e-11, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  +++ + F ++    + +SVDS  +H       +    +  +    +SD++K+IS DY VL + EG SL  T  ID  GI++ +S   + V R +D +L+ I  +Q
  S:    73 VLFFYPLDFTFVCPTEIVAFSERIKEFHDINTEVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQ 197
>gi|119357674|ref|YP_912318.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobium phaeobacteroides DSM 266] >gi|119355023|gb|ABL65894.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobium phaeobacteroides DSM 266] (196 aa)
Score = 169, Expect = 6.6e-11, Identities = 46/160 (28%), Positives = 81/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GRK   F  +A +G +  +    L+   GK   +LFF   DF     +E+     K   F    V  I  SVDS+ +H   ++  +++  I  ++   +SDI+K +S DY VL +  G SL     ID++G++++     + + R++D +L+ I   Q
  S:     3 VLVGRKAPEFCVEAVTGGSRFVDACRLSDYAGKY-VVLFFYPLDFTFVCPTELHAFQDKLDEFTKRNVEVIGCSVDSKFSHFAWLQTPRNRGGIEGVTYTLLSDINKTVSSDYDVLVDGAGISLRGLFLIDREGVVRHQVVNDLGLGRNVDEVLRMIDALQ 162
>gi|156085072|ref|XP_001610019.1| thioredoxin peroxidase-like protein [Babesia bovis] >gi|154797271|gb|EDO06451.1| thioredoxin peroxidase-like protein [Babesia bovis] (197 aa)
Score = 169, Expect = 6.7e-11, Identities = 47/158 (29%), Positives = 72/158 (45%)
  Q:     3 IGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +G+   NF  +A     +S     L+   GK    LFF   DF     +EI+  N     F    V  +  SVDS+  H       +DK  I N+    ++DI+K +   Y VL  EEG +L     IDKKGI+++    ++ + R +  +L+ I   Q
  S:     4 VGQPAPNFRCEAVM-PDNSFKEISLSDYAGKKYVCLFFYPLDFTFVCPTEIVAFNDAMAQFEARNVQILACSVDSKFAHVTWRNTPRDKGGIGNVMFPVLTDITKTVCDAYEVLIPEEGVALRGLFLIDKKGIVQHLQINNLPLGRSVTEVLRIIDALQ 161
>gi|145340570|ref|XP_001415395.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144575618|gb|ABO93687.1| predicted protein [Ostreococcus lucimarinus CCE9901] (192 aa)
Score = 168, Expect = 7.2e-11, Identities = 42/134 (31%), Positives = 68/134 (50%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+  +GK   ++FF   DF     +EI   N +   F  L    I +S DSE +H       +++  +  M +  VSD +KEIS  Y VLFE+ G +L     ID +GI++  +  ++ V R +D  L+ +  +Q
  S:    26 LSDYLGKY-CVVFFYPLDFTFVCPTEITAFNDRADEFEALNTKVIAVSTDSEYSHLAWTMMERERGGLGAMRIPIVSDRTKEISAKYGVLFEDRGIALRGLFIIDDEGIVQQITMNNLPVGRSVDETLRLVRAFQ 159
>gi|194336184|ref|YP_002017978.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pelodictyon phaeoclathratiforme BU-1] >gi|194308661|gb|ACF43361.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pelodictyon phaeoclathratiforme BU-1] (196 aa)
Score = 168, Expect = 7.3e-11, Identities = 45/160 (28%), Positives = 83/160 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GRK  +F   A    +  + +  L+   GK   +LFF   DF     +E+    +K Q F +  V  I  SVDS+ +H   ++  + +  I  ++   +SD++K +S DY VL E  G +L     IDK+G++++    ++ + R++D +L+ +   Q
  S:     3 VLVGRKAPDFDVAAVVNGSQFVDSCKLSDYKGKY-VVLFFYPLDFTFVCPTELHAFQEKLQEFRDRNVELIGCSVDSKFSHYAWIRTPRSQGGIEGVTYTLLSDLNKTVSADYDVLLEGAGIALRGLFLIDKEGVVQHQVVNNLPLGRNVDEVLRLVDALQ 162
>gi|145299771|ref|YP_001142612.1| alkyl hydroperoxide reductase subunit C [Aeromonas salmonicida subsp. salmonicida A449] >gi|142852543|gb|ABO90864.1| alkyl hydroperoxide reductase subunit C [Aeromonas salmonicida subsp. salmonicida A449] (200 aa)
Score = 168, Expect = 7.3e-11, Identities = 39/160 (24%), Positives = 77/160 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR   +F + A  G    + +++L  ++     +LFF   DF     SE+I  + +++ F   GV  I +S+DS+ +H        +   I  +    ++D+  EI + Y V   E G +   +  ID  G++++     + + R+ID +L+ +   Q
  S:     2 VLVGRPAPDFTAAAVLGNGQIVDSFNLASHIKGKAAVLFFYPLDFTFVCPSELIAFDHRYEEFQKRGVEVIGVSIDSQFSHNAWRNTKVEDGGIGQVKYPLIADVKHEICKAYDVEHPEAGVAFRGSFLIDSHGMVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|194213066|ref|XP_001915062.1| PREDICTED: similar to Peroxiredoxin 2 [Equus caballus] (198 aa)
Score = 168, Expect = 7.4e-11, Identities = 35/124 (28%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  ++  ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D+++ +S DY VL E EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSEHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRSLSHDYGVLKEDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQ 163
>gi|148232668|ref|NP_001085918.1| MGC82793 protein [Xenopus laevis] >gi|49118952|gb|AAH73532.1| MGC82793 protein [Xenopus laevis] (267 aa)
Score = 168, Expect = 7.7e-11, Identities = 34/124 (27%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  M +  +SD++ +IS+DY V  E +G++L     ID KG+++  +   + V R +D  L+ +  +Q
  S:   108 VFFFYPLDFTFVCPTEIIAFGDRIEEFRSINTEVVACSVDSQFTHLAWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVYLEDQGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQ 232
>gi|148234128|ref|NP_001088817.1| hypothetical protein LOC496089 [Xenopus laevis] >gi|56269242|gb|AAH87512.1| LOC496089 protein [Xenopus laevis] (268 aa)
Score = 168, Expect = 7.7e-11, Identities = 34/124 (27%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  M +  +SD++ +IS+DY V  E +G++L     ID KG+++  +   + V R +D  L+ +  +Q
  S:   109 VFFFYPLDFTFVCPTEIIAFGDRIEEFRSINTEVVACSVDSQFTHLAWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVYLEDQGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQ 233
>gi|55742316|ref|NP_001006812.1| peroxiredoxin 4 [Xenopus tropicalis] >gi|49898976|gb|AAH76692.1| Peroxiredoxin 4 [Xenopus tropicalis] >gi|89269080|emb|CAJ83798.1| peroxiredoxin 4 [Xenopus tropicalis] (271 aa)
Score = 168, Expect = 7.7e-11, Identities = 34/124 (27%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  M +  +SD++ +IS+DY V  E +G++L     ID KG+++  +   + V R +D  L+ +  +Q
  S:   112 VFFFYPLDFTFVCPTEIIAFGDRIEEFRSINTEVVACSVDSQFTHLAWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVYLEDQGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQ 236
>gi|196259133|ref|ZP_03157665.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cyanothece sp. PCC 7822] >gi|196199870|gb|EDX94693.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cyanothece sp. PCC 7822] (197 aa)
Score = 168, Expect = 7.8e-11, Identities = 41/124 (33%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + ++  F N+    + +SVDSE +H   ++  +    I ++    VSDI KEIS  Y VL  E G +L     IDK+G+I++ +  ++   R +D  L+T+   Q
  S:    38 VLFFYPLDFTFVCPTEIIAFSDRYDEFKNINTEVLGVSVDSEFSHLAWIQTERKDGGIGDIVYPIVSDIKKEISTAYNVLDPEAGVALRGLFIIDKEGVIQHATINNLSFGRSVDETLRTLKAIQ 162
>gi|186902634|ref|ZP_02975576.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cyanothece sp. PCC 7424] >gi|186690252|gb|EDU14886.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cyanothece sp. PCC 7424] (197 aa)
Score = 168, Expect = 7.8e-11, Identities = 40/124 (32%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + +++ F  +    + +SVDSE +H   ++  +    I +++   VSDI KEIS  Y VL  E G +L     IDK+G+I++ +  ++   R +D  L+T+   Q
  S:    38 VLFFYPLDFTFVCPTEIIAFSDRYEEFKKINTEVLGVSVDSEFSHLAWIQTDRKSGGIGDIAYPLVSDIKKEISTAYNVLDPEAGVALRGLFIIDKEGVIQHSTINNLSFGRSVDETLRTLKAIQ 162
>gi|193697661|ref|XP_001949571.1| PREDICTED: similar to peroxiredoxins, prx-1, prx-2, prx-3 [Acyrthosiphon pisum] (245 aa)
Score = 168, Expect = 7.9e-11, Identities = 37/124 (29%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EI+  N + + F  +  N +  SVDS  TH   V   +    + N+S+  +SD++ +IS+DY V   + G+SL     ID +GI++  +   + V R +D  L+ +  +Q
  S:    84 VFFFYPLDFTFVCPTEILAFNDRIEEFRRIDANVVAASVDSHFTHLAWVNTPRKDGGLGNLSIPLLSDMTHKISKDYGVYLSDVGHSLRGLFIIDNRGILRQITMNDLPVGRSVDETLRLVQAFQ 208
>gi|123385230|ref|XP_001299092.1| tryparedoxin peroxidase, putative [Trichomonas vaginalis G3] >gi|121879854|gb|EAX86162.1| tryparedoxin peroxidase, putative [Trichomonas vaginalis G3] (196 aa)
Score = 168, Expect = 7.9e-11, Identities = 44/160 (27%), Positives = 79/160 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ML+G++  +F ++A     D        KN      +LF    DF     +EIIE + K+  F  +G   + +SVDS  +H       + +  +  ++   +SD+  +I++ Y    EE G+ L  T+ ID +GI+++      +V R++D IL+ +  YQ
  S:     1 MLVGKEAPDFTAQAVLPDGD--FKEISRKNYNGGWLVLFSYPLDFTFVCPTEIIEFSNKYAEFKKIGCEVLGMSVDSVYSHLAWRNTPRKEGGLGEINYPLISDLGGKIAKSYGFYIEEAGHDLRGTVIIDPQGIVRHVQMNHPDVGRNVDEILRLVKAYQ 159
>gi|17738015|ref|NP_524387.1| Peroxiredoxin 5037 CG5826-PA [Drosophila melanogaster] >gi|11935114|gb|AAG41976.1|AF311747_1 thioredoxin peroxidase 3 [Drosophila melanogaster] >gi|23171565|gb|AAF55431.2| CG5826-PA [Drosophila melanogaster] >gi|29335975|gb|AAO74686.1| SD08737p [Drosophila melanogaster] (234 aa)
Score = 168, Expect = 8.0e-11, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  +++ + F ++    + +SVDS  +H       +    +  +    +SD++K+IS DY VL + EG SL  T  ID  GI++ +S   + V R +D +L+ I  +Q
  S:    73 VLFFYPLDFTFVCPTEIVAFSERIKEFHDINTEVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQ 197
>gi|190610718|gb|ACE80210.1| natural killer enhancing factor [Psetta maxima] (197 aa)
Score = 168, Expect = 8.0e-11, Identities = 38/124 (30%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EI+  + + + F ++G   I  SVDS  +H   +   + +  +  M +  V+D++K ISRDY VL E +G +      ID KGI++  +   + V R +D  L+ I  +Q
  S:    39 VFFFYPLDFTFVCPTEIVAFSDRAEEFRSMGCEVIGCSVDSHFSHLAWINTPRKQGGLGTMKIPLVADLTKTISRDYGVLKEGDGIAYRGLFVIDDKGILRQITINDLPVGRSVDESLRLIQAFQ 163
>gi|83309763|ref|YP_420027.1| peroxiredoxin [Magnetospirillum magneticum AMB-1] >gi|82944604|dbj|BAE49468.1| Peroxiredoxin [Magnetospirillum magneticum AMB-1] (207 aa)
Score = 168, Expect = 8.3e-11, Identities = 38/136 (27%), Positives = 67/136 (49%)
  Q:    25 YDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ++L   +  +  ++FF   DF     SEI+  + + + F       I +SVDS  TH        DK  + N+    V+D++K+I++ Y VL   G +L  T  IDK G+++     ++ + R++D  L+ I   Q
  S:    34 FNLKSYLAGSYGIVFFYPLDFTFVCPSEILAHDHRVKAFAERNTKVIAVSVDSHFTHLAWKNTPVDKGGLGNVQFPMVADLTKDIAKSYGVLLPGGVALRGTFVIDKNGVVQSAHVNNLPLGRNVDEALRLIDALQ 169
>gi|46200747|ref|ZP_00056418.2| COG0450: Peroxiredoxin [Magnetospirillum magnetotacticum MS-1] (207 aa)
Score = 168, Expect = 8.3e-11, Identities = 38/136 (27%), Positives = 67/136 (49%)
  Q:    25 YDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ++L   +  +  ++FF   DF     SEI+  + + + F       I +SVDS  TH        DK  + N+    V+D++K+I++ Y VL   G +L  T  IDK G+++     ++ + R++D  L+ I   Q
  S:    34 FNLKSYLAGSYGIVFFYPLDFTFVCPSEILAHDHRVKAFAERNTKVIAVSVDSHFTHLAWKNTPVDKGGLGNVQFPMVADLTKDIAKSYGVLLPGGVALRGTFVIDKNGVVQSAHVNNLPLGRNVDEALRLIDALQ 169
>gi|195497394|ref|XP_002096080.1| GE25263 [Drosophila yakuba] >gi|194182181|gb|EDW95792.1| GE25263 [Drosophila yakuba] (234 aa)
Score = 168, Expect = 8.4e-11, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  +++ + F ++    + +SVDS  +H       +    +  +    +SD++K+IS DY VL + EG SL  T  ID  GI++ +S   + V R +D +L+ I  +Q
  S:    73 VLFFYPLDFTFVCPTEIVAFSERIKEFHDINTEVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQ 197
>gi|156377225|ref|XP_001630757.1| predicted protein [Nematostella vectensis] >gi|156217784|gb|EDO38694.1| predicted protein [Nematostella vectensis] (251 aa)
Score = 168, Expect = 8.4e-11, Identities = 36/124 (29%), Positives = 65/124 (52%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  +    +  SVDS  TH   + + + +  + N+    +SDI+ ++S+DY VL E EG++L     ID KG+++  +   + V R +D  L+ +  +Q
  S:    87 VFFFYPLDFTFVCPTEIIAFSDRIEEFRAINTEVVGCSVDSVFTHLAWINSPRKEGGLGNLKYPLLSDINHQVSKDYGVLLENEGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQ 211
>gi|145350122|ref|XP_001419466.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144579698|gb|ABO97759.1| predicted protein [Ostreococcus lucimarinus CCE9901] (220 aa)
Score = 168, Expect = 8.7e-11, Identities = 33/124 (26%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + +++ F  L    +  SVDS+ +H   ++  ++   + +++   VSD+ +EI+  Y VL+E+G +L     ID++G+I++ +  +    R +D  L+ +   Q
  S:    62 VLFFYPLDFTFVCPTEITAFSDRYEEFAKLNTEVLGCSVDSKFSHLAWLQTDRNDGGLGDLAYPLVSDLKREITEAYDVLYEDGTALRGLYIIDREGVIQHSTVNNAPFGRSVDETLRVLQAIQ 185
>gi|195375271|ref|XP_002046425.1| GJ12891 [Drosophila virilis] >gi|194153583|gb|EDW68767.1| GJ12891 [Drosophila virilis] (244 aa)
Score = 168, Expect = 8.9e-11, Identities = 39/139 (28%), Positives = 73/139 (52%)
  Q:    22 ILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           I+   L++ +GK   LLF+   DF     +EII  + +   F  +    I  SVDS  TH   +   + +  + ++ +  +SD++ +IS+DY V  EE G++L     ID++G+++  +   + V R +D  L+ +  +Q
  S:    71 IVQLSLSQYLGKYVVLLFY-PLDFTFVCPTEIIAFSDRIAEFRKIKTEVIAASVDSHFTHLAWINTPRKEGGLGSVKIPLLSDLTHKISKDYGVYLEESGHALRGLFIIDQRGVLRQITMNDLPVGRSVDETLRLVQAFQ 209
>gi|157374987|ref|YP_001473587.1| alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen [Shewanella sediminis HAW-EB3] >gi|157317361|gb|ABV36459.1| alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen [Shewanella sediminis HAW-EB3] (201 aa)
Score = 167, Expect = 9.3e-11, Identities = 42/160 (26%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR   +F + A  G  + + +++L++ +    T++FF   DF     SE+I  + + + F   GV  I +S+DS+ TH         +  I  +    V+D+  EI + Y V   E G +   +  IDK+G +++     + + R++D +L+ I   Q
  S:     3 VLVGRPAPDFTAAAVLGNGEIVDSFNLSEAIQGKPTVVFFYPLDFTFVCPSELIAFDHRIEEFKKRGVEVIGVSIDSQFTHNAWRNTPVAEGGIGPVQYTLVADVKHEICKAYDVEHPEAGVAFRGSFLIDKEGQVRHQVVNDLPLGRNVDEMLRMIDALQ 163
>gi|93211500|gb|ABF01135.1| natural killer enhancing factor [Scophthalmus maximus] (197 aa)
Score = 167, Expect = 9.3e-11, Identities = 38/124 (30%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EI+  + + + F ++G   I  SVDS  +H   +   + +  +  M +  V+D++K ISRDY VL E +G +      ID KGI++  +   + V R +D  L+ I  +Q
  S:    39 VFFFYPLDFTFVCPTEIVAFSDRAEEFRSMGCEVIGCSVDSHFSHLAWINTPRKQGGLGTMKIPLVADLTKTISRDYGVLKEDDGIAYRGLFVIDDKGILRQITINDLPVGRSVDESLRLIQAFQ 163
>gi|117618902|ref|YP_856052.1| alkyl hydroperoxide reductase TsaA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117560309|gb|ABK37257.1| alkyl hydroperoxide reductase TsaA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (200 aa)
Score = 167, Expect = 9.7e-11, Identities = 42/160 (26%), Positives = 76/160 (47%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR   +F + A  G    + +++L  ++     +LFF   DF     SE+I  + + + F    V  I +S+DSE +H        +   I  +    V+DI  EI + Y V   E G +   +  IDK G++++     + + R+ID +L+ +   Q
  S:     2 VLVGRPAPDFTAAAVLGNGQIVDSFNLASHIKGKAAVLFFYPLDFTFVCPSELIAFDHRLEEFNKRSVEVIGVSIDSEFSHNAWRNTKIEDGGIGPVKYPLVADIKHEICKAYDVEHPEAGVAFRGSFLIDKNGVVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|152978806|ref|YP_001344435.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Actinobacillus succinogenes 130Z] >gi|150840529|gb|ABR74500.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Actinobacillus succinogenes 130Z] (200 aa)
Score = 167, Expect = 9.7e-11, Identities = 38/160 (23%), Positives = 79/160 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F S A  G  + + N++  +++     ++FF   DF     SE+I  + ++  F   GV  + +S+DS+ +H        D+  I  +     +D   EI++ Y +   E G +L ++  ID  G++++     + + R+ID +L+ +   Q
  S:     2 VLVTRQAPDFTSAAVLGNGEIVENFNFKQHIAGKPAVIFFYPLDFTFVCPSELIAFDHRYAEFQKRGVEVVGVSIDSQYSHNAWRNTPVDQGGIGPVKYALAADTKHEIAKAYGIEHPEAGVALRASFLIDANGVVRHQVVNDLPLGRNIDEMLRMVDALQ 162
>gi|90407333|ref|ZP_01215519.1| putative antioxidant, AhpC/Tsa family protein [Psychromonas sp. CNPT3] >gi|90311616|gb|EAS39715.1| putative antioxidant, AhpC/Tsa family protein [Psychromonas sp. CNPT3] (200 aa)
Score = 167, Expect = 1.0e-10, Identities = 42/160 (26%), Positives = 78/160 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ +K  +F + A  G  + + +++  +       ++FF   DF     SE+I  +++   F   GV  I IS+DS+ +H        +   I  +    V+D+  EI + Y V F E G +L  +  IDK G++++     + + RDID +L+ +   Q
  S:     2 VLVTKKAPDFTAAAVLGNGEIVDSFNFAEFTKGKEAVVFFYPLDFTFVCPSELIAFDKRFGEFQARGVEVIGISIDSQFSHNAWRNTAINDGGIGAVQYPLVADVKHEICQAYGVEFAEAGVALRGSFLIDKNGVVRHQVVNDLPLGRDIDEMLRMVDALQ 162
>gi|138894584|ref|YP_001125037.1| 2-cys peroxiredoxin [Geobacillus thermodenitrificans NG80-2] >gi|196247807|ref|ZP_03146509.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geobacillus sp. G11MC16] >gi|134266097|gb|ABO66292.1| 2-cys peroxiredoxin [Geobacillus thermodenitrificans NG80-2] >gi|196212591|gb|EDY07348.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geobacillus sp. G11MC16] (187 aa)
Score = 167, Expect = 1.0e-10, Identities = 43/134 (32%), Positives = 71/134 (52%)
  Q:    27 LTKNMGKNG--TLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L +NM KNG  T+LFF   DF     +EI  ++ ++  F +L    I +S DS  +H+  +   +++  I  +     +D ++++SRDY VL  EEG +L     ID  G +KY       + RD+D +L+ +   Q
  S:    29 LEENM-KNGKWTVLFFYPLDFTFVCPTEITAISDRYHEFEDLNAVVIGVSTDSVYSHKAWMNVPRNQNGIGQIKYPLAADRTQQVSRDYGVLIEEEGVALRGLFIIDPDGELKYAVIHHNNIGRDVDEVLRVLQALQ 164
>gi|126325578|ref|XP_001366408.1| PREDICTED: similar to MGC82793 protein [Monodelphis domestica] (279 aa)
Score = 167, Expect = 1.0e-10, Identities = 35/124 (28%), Positives = 63/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F  +    +  SVDS+ TH   +   + +  +  M +  +SD++ +IS+DY V  E+ G++L     ID KGI++  +   + V R +D  L+ +  +Q
  S:   120 VFFFYPLDFTFVCPTEIIAFGDRIEEFRAINTEVVACSVDSQFTHLAWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITMNDLPVGRSVDETLRLVQAFQ 244
>gi|77359788|ref|YP_339363.1| peroxiredoxin 2 (thioredoxin peroxidase 1) (thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) (PRP) [Pseudoalteromonas haloplanktis TAC125] >gi|76874699|emb|CAI85920.1| peroxiredoxin 2 (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) (PRP) [Pseudoalteromonas haloplanktis TAC125] (201 aa)
Score = 167, Expect = 1.0e-10, Identities = 40/156 (25%), Positives = 79/156 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  + + +Y+L + +     ++FF   DF     SE+I  +++++ F   GV  I +S+DS+ +H            I  +    V+DI  EI + Y V   E G +   +  ID++G +++     + + R+ID +L+ +
  S:     3 VLVGRQAPDFTAAAVLGNGEIVDSYNLHEKIKGKKAVIFFYPLDFTFVCPSELIAFDKRYEEFQKRGVEVIGVSIDSQFSHNAWRNTAVADGGIGKVKYALVADIKHEICKAYDVEHPEAGVAFRGSFLIDEEGNVRHQVVNDLPLGRNIDEMLRMV 159
>gi|148284626|ref|YP_001248716.1| thioredoxin peroxidase 1 [Orientia tsutsugamushi str. Boryong] >gi|146740065|emb|CAM80190.1| thioredoxin peroxidase 1 [Orientia tsutsugamushi Boryong] (200 aa)
Score = 167, Expect = 1.1e-10, Identities = 40/156 (25%), Positives = 79/156 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           + +G+   +F + A   K +    ++L   +     +LFF   +F     +EII  N ++  F+      I ISVDS   H+       +K  I ++    VSDI+K+IS+ Y VL + G ++ +T  ID++ ++++ +   + + R+++  L+ I
  S:     3 IFVGKSACDFTAPAVLPKNNINEKFNLKHELDGRKAVLFFYPLNFTFVCPTEIIAFNNRYGEFLKRNTEVIGISVDSHFCHKAWKLTPYNKGGIGDIQFPLVSDINKDISKTYNVLNQAGVAVRATFIIDQEFVLRHVTINDLSIGRNVEESLRII 158
>gi|195012352|ref|XP_001983600.1| GH15986 [Drosophila grimshawi] >gi|193897082|gb|EDV95948.1| GH15986 [Drosophila grimshawi] (243 aa)
Score = 167, Expect = 1.1e-10, Identities = 38/139 (27%), Positives = 72/139 (51%)
  Q:    22 ILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           I+   L++ +GK   LLF+   DF     +EII  + +   F  +    I  SVDS  TH   +   + +  + N+ +  +SD++ +IS+DY V  E  G++L     ID++G+++  +   + V R +D  ++ +  +Q
  S:    70 IVQLSLSQYLGKYVVLLFY-PLDFTFVCPTEIIAFSDRIAEFKKIKTEVIAASVDSHFTHLAWINTPRKEGGLGNVKIPLLSDLTHKISKDYGVYLEASGHALRGLFIIDQRGVLRQITMNDLPVGRSVDETIRLVQAFQ 208
>gi|91090021|ref|XP_967356.1| PREDICTED: similar to peroxiredoxins, prx-1, prx-2, prx-3 [Tribolium castaneum] (233 aa)
Score = 167, Expect = 1.1e-10, Identities = 42/141 (29%), Positives = 70/141 (49%)
  Q:    20 DSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           D      L+   GK   L+F+   DF     +E+I L++++ +F NL    I  S+DS  +H   +   + +  +  +    +SDI+K I+RDY VL E EG +L     ID  GI++  +   + + R +D  L+ I   Q
  S:    57 DGFKEIQLSDYKGKYVVLVFY-PLDFTFVCPTELIALDERYDDFKNLNAEVIGCSIDSHFSHLGWMNTKRSEGGLGKLRYPLLSDINKTIARDYDVLLEKEGIALRGLFIIDPNGILRQITVNDLPIGRSVDEALRLIEAIQ 197
>gi|21685578|gb|AAM74564.1| antioxidant protein [Mus musculus] (254 aa)
Score = 166, Expect = 1.2e-10, Identities = 36/124 (29%), Positives = 62/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +        + +M++  +SDI+K+ISRDY VL E          ID  G++K+ S   + V R ++  L+ +  +Q
  S:    97 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINT--PNGGLGHMNITLLSDITKQISRDYGVLLESAGIALGLFIIDPNGVVKHLSVNDLPVGRSVEETLRLVKAFQ 218
>gi|148226847|ref|NP_001082894.1| hypothetical protein LOC570477 [Danio rerio] >gi|126631647|gb|AAI34157.1| Zgc:162938 protein [Danio rerio] (260 aa)
Score = 166, Expect = 1.2e-10, Identities = 34/124 (27%), Positives = 63/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + +   F  +    +  SVDS+ TH   +   + +  +  M +  +SD++ +IS+DY V  E +G++L     ID KG+++  +   + V R +D  L+ +  +Q
  S:   101 VFFFYPLDFTFVCPTEIIAFSDRVHEFQAINAEVVACSVDSQFTHLAWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVFLEDQGHTLRGLFIIDGKGVLRQITMNDLPVGRSVDETLRLVQAFQ 225
>gi|75070821|sp|Q5RC63|PRDX2_PONAB Peroxiredoxin-2 >gi|55727787|emb|CAH90647.1| hypothetical protein [Pongo abelii] (177 aa)
Score = 166, Expect = 1.3e-10, Identities = 34/124 (27%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + + ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D+++ +S DY VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSNRAEDFHKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQ 163
>gi|170727086|ref|YP_001761112.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella woodyi ATCC 51908] >gi|169812433|gb|ACA87017.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella woodyi ATCC 51908] (201 aa)
Score = 166, Expect = 1.3e-10, Identities = 42/160 (26%), Positives = 79/160 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR   +F + A  G  + + +++L + +    T++FF   DF     SE+I  + + + F   GV  I +S+DS+ TH         +  I  +    V+D+  EI + Y V   E G +   +  IDK+G +++     + + R++D +L+ I   Q
  S:     3 VLVGRPAPDFTAAAVLGNGEIVDSFNLAEAIKGKPTVVFFYPLDFTFVCPSELIAFDHRIEEFKKRGVEVIGVSIDSQFTHNAWRNTPVAEGGIGPVQYTLVADVKHEICKAYDVEHPEAGVAFRGSFLIDKEGQVRHQVVNDLPLGRNVDEMLRMIDALQ 163
>gi|47027073|gb|AAT08751.1| 2-cys peroxiredoxin-like protein [Hyacinthus orientalis] (196 aa)
Score = 166, Expect = 1.4e-10, Identities = 37/134 (27%), Positives = 73/134 (54%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L++ +GK   +LFF   DF     +EI   + ++  F  +    + +SVDS  +H   V+  +    + +++   VSD++K IS+ Y VL  ++G +L     IDK+G+I++ +  ++ + R +D  ++T+   Q
  S:    27 LSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYSEFEKVNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDVTKSISKSYGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQ 161
>gi|126322777|ref|XP_001362118.1| PREDICTED: similar to Peroxiredoxin-2 (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) (PRP) (Natural killer cell-enhancing factor B) (NKEF-B) [Monodelphis domestica] (198 aa)
Score = 166, Expect = 1.4e-10, Identities = 35/124 (28%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ++FF   DF     +EII  + +  +F  LG   + +SVDS+ TH   +   + +  +  + +  ++D+++ ++RDY VL E EG +      ID KGI++  +   + V R +D  L+ +  +Q
  S:    39 IIFFYPLDFTFVCPTEIIAFSDRVSDFHQLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLKIPLLADVTRNLARDYGVLKEDEGIAYRGLFIIDAKGIVRQITVNDLPVGRSVDETLRLVQAFQ 163
>gi|48477799|ref|YP_023505.1| putative peroxiredoxin [Picrophilus torridus DSM 9790] >gi|56749758|sp|Q6L140|TDXH2_PICTO Probable peroxiredoxin 2 >gi|48430447|gb|AAT43312.1| hypothetical peroxiredoxin [Picrophilus torridus DSM 9790] (201 aa)
Score = 166, Expect = 1.5e-10, Identities = 42/128 (32%), Positives = 73/128 (57%)
  Q:    33 KNGTLLFFIH-QDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           KN  +L F H  DF P  T+E IE ++++ +F  L V  I +SVDS  +H + +K++ +K  I  +    ++DI+KEI+R+Y ++ E  G ++     ID    +++      E  R+ID IL+++   Q
  S:    27 KNKWVLLFSHPADFTPICTTEFIEFSRRYNDFKELNVELIGLSVDSLQSHIEWLKDIYEKFGI-EIQFPVIADINKEIAREYNLIDENAGNTVRGVFIIDPNQTVRWMIYYPAETGRNIDEILRSVKALQ 155
>gi|47227198|emb|CAG00560.1| unnamed protein product [Tetraodon nigroviridis] (261 aa)
Score = 166, Expect = 1.5e-10, Identities = 34/124 (27%), Positives = 63/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + +   F  +    +  SVDS+ TH   +   + +  +  M +  +SD++ +IS+DY V  E +G++L     ID KG+++  +   + V R +D  L+ +  +Q
  S:   102 VFFFYPLDFTFVCPTEIIAFSDRVHEFHAINTEVVACSVDSQFTHLAWINTARKQGGLGPMKVPLLSDLTHQISKDYGVYLEDQGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQ 226
>gi|32189392|ref|NP_005800.3| peroxiredoxin 2 isoform a [Homo sapiens] >gi|109123561|ref|XP_001109159.1| PREDICTED: peroxiredoxin 2 isoform 4 [Macaca mulatta] >gi|109123563|ref|XP_001109216.1| PREDICTED: peroxiredoxin 2 isoform 5 [Macaca mulatta] >gi|114675617|ref|XP_524127.2| PREDICTED: peroxiredoxin 2 [Pan troglodytes] >gi|2507169|sp|P32119|PRDX2_HUMAN Peroxiredoxin-2 (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) (PRP) (Natural killer cell-enhancing factor B) (NKEF-B) >gi|118597354|sp|Q2PFZ3|PRDX2_MACFA Peroxiredoxin-2 >gi|12653365|gb|AAH00452.1| Peroxiredoxin 2 [Homo sapiens] >gi|12804327|gb|AAH03022.1| Peroxiredoxin 2 [Homo sapiens] >gi|24659879|gb|AAH39428.1| Peroxiredoxin 2 [Homo sapiens] >gi|47496659|emb|CAG29352.1| PRDX2 [Homo sapiens] >gi|49456535|emb|CAG46588.1| PRDX2 [Homo sapiens] >gi|60818622|gb|AAX36471.1| peroxiredoxin 2 [synthetic construct] >gi|61362999|gb|AAX42317.1| peroxiredoxin 2 [synthetic construct] >gi|77744389|gb|ABB02182.1| peroxiredoxin 2 [Homo sapiens] >gi|84579087|dbj|BAE72977.1| hypothetical protein [Macaca fascicularis] >gi|119604715|gb|EAW84309.1| peroxiredoxin 2, isoform CRA_b [Homo sapiens] >gi|123997455|gb|ABM86329.1| peroxiredoxin 2 [synthetic construct] >gi|157928986|gb|ABW03778.1| peroxiredoxin 2 [synthetic construct] (198 aa)
Score = 166, Expect = 1.5e-10, Identities = 34/124 (27%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + + ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D+++ +S DY VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQ 163
>gi|145357502|ref|XP_001422957.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144583201|gb|ABP01316.1| predicted protein [Ostreococcus lucimarinus CCE9901] (197 aa)
Score = 166, Expect = 1.5e-10, Identities = 33/124 (26%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + +++ F  L    +  SVDS+ +H   ++  ++   + +++   VSD+ +EI+  Y VL+E+G +L     ID++G+I++ +  +    R +D  L+ +   Q
  S:    39 VLFFYPLDFTFVCPTEITAFSDRYEEFAKLNTEVLGCSVDSKFSHLAWLQTDRNDGGLGDLAYPLVSDLKREITEAYDVLYEDGTALRGLYIIDREGVIQHSTVNNAPFGRSVDETLRVLQAIQ 162
>gi|157885981|emb|CAP09410.1| novel protein similar to vertebrate peroxiredoxin 3 (PRDX3) [Danio rerio] (281 aa)
Score = 166, Expect = 1.6e-10, Identities = 35/124 (28%), Positives = 63/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  TH       +    +  + +  ++D++K++SRDY VL E  G +L     ID  GI+++ S   + V R ++  L+ +  +Q
  S:   122 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCAVVGVSVDSHFTHLAWTNTPRKSGGLGKIQIPLLADLTKQVSRDYGVLLEGPGIALRGLFIIDPNGIVRHMSVNDLPVGRSVEETLRLVKAFQ 246
>gi|60688276|gb|AAH91544.1| Prdx3 protein [Danio rerio] (250 aa)
Score = 166, Expect = 1.6e-10, Identities = 35/124 (28%), Positives = 63/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  TH       +    +  + +  ++D++K++SRDY VL E  G +L     ID  GI+++ S   + V R ++  L+ +  +Q
  S:    91 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCAVVGVSVDSHFTHLAWTNTPRKSGGLGKIQIPLLADLTKQVSRDYGVLLEGPGIALRGLFIIDPNGIVRHMSVNDLPVGRSVEETLRLVKAFQ 215
>gi|50897513|gb|AAT85819.1| putative thioredoxin peroxidase 3 [Glossina morsitans morsitans] (236 aa)
Score = 165, Expect = 1.6e-10, Identities = 43/124 (34%), Positives = 68/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKT--INNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  +++ + F  L    + +SVDS  +H  LV    D+K   +  ++   +SDI+K+IS  Y VL E +G SL  T  ID  G ++ +S   + V R +D +L+ I  +Q
  S:    75 VLFFYPLDFTFVCPTEIISFSERIKEFKELNAEVVGVSVDSHFSH--LVWAXVDRKAGGLGGLNYPLLSDITKQISEKYGVLLESQGISLRGTFIIDPNGNVRQYSINDLPVGRSVDEVLRLIKAFQ 199
>gi|115899553|ref|XP_784460.2| PREDICTED: similar to thioredoxin peroxidase [Strongylocentrotus purpuratus] >gi|115972635|ref|XP_001177338.1| PREDICTED: similar to thioredoxin peroxidase [Strongylocentrotus purpuratus] (248 aa)
Score = 165, Expect = 1.6e-10, Identities = 35/124 (28%), Positives = 65/124 (52%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L F   DF     +EII  + +   F  +    + ISVDS+ TH   +   + +  +  + L  +SD++ +I++DY VL E+ G++L     ID KG+++  +   + V R +D  L+ +  +Q
  S:    80 VLVFYPLDFTFVCPTEIIAFSDRVDEFRAINTEVVAISVDSQFTHLAWINTPRTQGGLGPIKLPILSDLTHQIAKDYGVLLEDLGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQ 204
>gi|11465738|ref|NP_053882.1| hypothetical protein PopuCp087 [Porphyra purpurea] >gi|1723344|sp|P51272|YCF42_PORPU Putative peroxiredoxin ycf42 (Thioredoxin reductase) >gi|1276738|gb|AAC08158.1| ORF199 [Porphyra purpurea] (199 aa)
Score = 165, Expect = 1.6e-10, Identities = 39/124 (31%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + K+ +F  L    + +SVDSE +H   ++  ++   + ++    VSD+ KEIS  Y VL   G +L     ID KGII+Y +  ++E  R ++  L+ +   Q
  S:    41 ILFFYPLDFTFVCPTEITAFSDKYSDFSELNTEILGVSVDSEYSHLAWLQTDRESGGLGDLEYPLVSDLKKEISIAYNVLNSGGVALRGLFIIDPKGIIQYSTVNNLEFGRSVEETLRVLQAIQ 164
>gi|60654143|gb|AAX29764.1| peroxiredoxin 2 [synthetic construct] (199 aa)
Score = 165, Expect = 1.6e-10, Identities = 34/124 (27%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + + ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D+++ +S DY VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQ 163
>gi|1617118|emb|CAA57764.1| TSA [Homo sapiens] (164 aa)
Score = 165, Expect = 1.6e-10, Identities = 34/124 (27%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + + ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D+++ +S DY VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:     5 VLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQ 129
>gi|15131688|emb|CAC48323.1| 2-Cys peroxiredoxin [Pisum sativum] (263 aa)
Score = 165, Expect = 1.7e-10, Identities = 38/134 (28%), Positives = 71/134 (52%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L++ +GK   +LFF   DF     +EI   + +H  F  +    + +SVDS  +H   V++ +    + ++    VSD++K IS  Y VL  ++G +L     IDK+G+I++ +  ++ + R +D   +T+   Q
  S:    94 LSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRHAEFDAINTEILGVSVDSVFSHLAWVQSDRKSGGLGDLKYPLVSDVTKSISESYGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETKRTLQALQ 228
>gi|109123569|ref|XP_001108992.1| PREDICTED: peroxiredoxin 2 isoform 1 [Macaca mulatta] (176 aa)
Score = 165, Expect = 1.7e-10, Identities = 34/124 (27%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + + ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D+++ +S DY VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQ 163
>gi|57239076|ref|YP_180212.1| putative peroxiredoxin (26 kDa antigen) [Ehrlichia ruminantium str. Welgevonden] >gi|58579019|ref|YP_197231.1| putative peroxiredoxin (26 kDa antigen) [Ehrlichia ruminantium str. Welgevonden] >gi|58617078|ref|YP_196277.1| putative peroxiredoxin (26 kDa antigen) [Ehrlichia ruminantium str. Gardel] >gi|57161155|emb|CAH58068.1| putative peroxiredoxin [Ehrlichia ruminantium str. Welgevonden] >gi|58416690|emb|CAI27803.1| Probable peroxiredoxin (26 kDa antigen) [Ehrlichia ruminantium str. Gardel] >gi|58417645|emb|CAI26849.1| Probable peroxiredoxin (26 kDa antigen) [Ehrlichia ruminantium str. Welgevonden] (205 aa)
Score = 165, Expect = 1.7e-10, Identities = 45/155 (29%), Positives = 77/155 (49%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           LI ++ I+F +KA     D I  ++L + +     +L F  +DF     +EII L+ +   F+      I IS DSE  H        +K  I+ +S   ++D S  IS +Y VL+    +L +T  ID   I+++ S   + + R++D +L+ I
  S:     3 LITKQAIDFTAKAVM-PDDKICEFNLKQYISGKYAILVFYPRDFTFVCPTEIISLHNRIPQFIEKNTEIIGISTDSEFCHSHWRNISVNKGGIDKISFPLIADDSHSISNNYGVLYNNSIALRATFIIDDHFIVRHQSINDLPIGRNVDELLRII 156
>gi|60835754|gb|AAX37153.1| peroxiredoxin 2 [synthetic construct] (199 aa)
Score = 165, Expect = 1.7e-10, Identities = 34/124 (27%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + + ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D+++ +S DY VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQ 163
>gi|150392012|ref|YP_001322061.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Alkaliphilus metalliredigens QYMF] >gi|149951874|gb|ABR50402.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Alkaliphilus metalliredigens QYMF] (179 aa)
Score = 165, Expect = 1.8e-10, Identities = 36/124 (29%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI  +N++  +F  L  + +  S DSE +H+  +   +D+  +  +S    SD++++++RDY +L  EEG +L     ID +GI++Y     + V R ++  L+ +   Q
  S:    39 VLFFYPLDFTFVCPTEITGINERLVDFGRLNASVLGASTDSEHSHKAWINAAQDQGGLGKLSFPLASDMTQKVARDYGILIEEEGIALRGLFIIDPEGILRYSVVHDLNVGRSVEETLRVLQGLQ 163
>gi|153207542|ref|ZP_01946225.1| antioxidant, AhpC/Tsa family [Coxiella burnetii 'MSU Goat Q177'] >gi|165918351|ref|ZP_02218437.1| antioxidant, AhpC/Tsa family [Coxiella burnetii RSA 334] >gi|120576510|gb|EAX33134.1| antioxidant, AhpC/Tsa family [Coxiella burnetii 'MSU Goat Q177'] >gi|165918001|gb|EDR36605.1| antioxidant, AhpC/Tsa family [Coxiella burnetii RSA 334] (200 aa)
Score = 165, Expect = 1.8e-10, Identities = 44/160 (27%), Positives = 74/160 (46%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR+  +F   A     D + N++L + +     L+FF   DF     SE+I L++   +F    V  I +S+DS+ TH        +K  I  +     SD++  I R Y V    G +L     IDK+GI++      + + R I  +L+ +   Q
  S:     3 VLVGREAPDFTVPAVLANGDIVENFNLAEAIQNKYGLVFFYPLDFTFVCPSELIALDKAIADFQKRRVEVIGVSIDSQFTHNAWRNTPVEKGGIGPVRYPLASDVTHSICRSYGVEHVAGVALRGAFLIDKQGIVRSQIVNDLPLGRSIPELLRLVDALQ 162
>gi|29654995|ref|NP_820687.1| anti-oxidant AhpCTSA family protein [Coxiella burnetii RSA 493] >gi|154707314|ref|YP_001423722.1| anti-oxidant AhpCTSA family protein [Coxiella burnetii Dugway 5J108-111] >gi|161831417|ref|YP_001597528.1| anti-oxidant AhpCTSA family protein [Coxiella burnetii RSA 331] >gi|29542264|gb|AAO91201.1| antioxidant, AhpC/Tsa family [Coxiella burnetii RSA 493] >gi|154356600|gb|ABS78062.1| antioxidant, AhpC/Tsa family [Coxiella burnetii Dugway 5J108-111] >gi|161763284|gb|ABX78926.1| antioxidant, AhpC/Tsa family [Coxiella burnetii RSA 331] (200 aa)
Score = 165, Expect = 1.8e-10, Identities = 44/160 (27%), Positives = 74/160 (46%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR+  +F   A     D + N++L + +     L+FF   DF     SE+I L++   +F    V  I +S+DS+ TH        +K  I  +     SD++  I R Y V    G +L     IDK+GI++      + + R I  +L+ +   Q
  S:     3 VLVGREAPDFTVPAVLANGDIVENFNLAEAIQNKYGLVFFYPLDFTFVCPSELIALDKAIADFQKRRVEVIGVSIDSQFTHNAWRNTPVEKGGIGPVRYPLASDVTHSICRSYGVEHVAGVALRGAFLIDKQGIVRSQIVNDLPLGRSIPELLRLVDALQ 162
>gi|126305670|ref|XP_001363120.1| PREDICTED: similar to proliferation associated gene (pag) [Monodelphis domestica] (199 aa)
Score = 165, Expect = 1.9e-10, Identities = 49/158 (31%), Positives = 75/158 (47%)
  Q:     3 IGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           IGR   NF + A         +  L+   GK   +LFF   DF     +EII  + + + F  L    I  SVDS   H   V  +K +  +  +++  VSD  + I++DY VL  +EG S      ID+KGI++  +   + V R +D  L+ I  +Q
  S:     8 IGRPAPNFRATAVM-PDQQFKDISLSDYRGKY-VVLFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTVKKQGGLGPVNIPLVSDAKRTIAQDYGVLKADEGISFRGLFIIDEKGILRQITINDLPVGRSVDETLRLIQAFQ 164
>gi|85713235|ref|ZP_01044261.1| Peroxiredoxin, AhpC/Tsa family protein [Idiomarina baltica OS145] >gi|85692930|gb|EAQ30902.1| Peroxiredoxin, AhpC/Tsa family protein [Idiomarina baltica OS145] (201 aa)
Score = 165, Expect = 1.9e-10, Identities = 39/156 (25%), Positives = 75/156 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GRK  +F + A  G  + + ++  +  +     +LFF   DF     SE+I  +++   F   GV  I +S+DS+ TH        +   I  +    V+D+   I + Y V   E G +   +  ID+ G++++     + + R+ID +L+ +
  S:     3 VLVGRKAPDFTAAAVMGSGEIVEDFKFSDAIKGKKAVLFFYPLDFTFVCPSELIAFDKRLDEFKKRGVEVIGVSIDSQFTHSAWRNTATEDGGIGQVKYPLVADVRHSICKAYDVEHPEAGVAFRGSFLIDEDGVVRHQVVNDLPLGRNIDEMLRMV 159
>gi|168703058|ref|ZP_02735335.1| thioredoxin peroxidase [Gemmata obscuriglobus UQM 2246] (198 aa)
Score = 165, Expect = 1.9e-10, Identities = 41/136 (30%), Positives = 68/136 (50%)
  Q:    25 YDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           Y L+   GK  T+LFF   DF     +EII  + +   F       + +SVDS+ +H   ++  + K  +  +    V+D++K IS DY VL E  G +L     ID KGII++ +   + + R +D  ++ +   Q
  S:    26 YKLSSTRGKY-TILFFYPLDFTFVCPTEIIAFSDRIAEFEKRNCQVVGVSVDSQYSHLAWIETPRAKGGLGELKYPLVADLTKTISTDYGVLLEGAGVALRGLFLIDTKGIIRHITINDLPLGRSVDEAIRVLDALQ 161
>gi|148227074|ref|NP_001085414.1| MGC83078 protein [Xenopus laevis] >gi|48734656|gb|AAH72318.1| MGC83078 protein [Xenopus laevis] (202 aa)
Score = 165, Expect = 2.0e-10, Identities = 41/134 (30%), Positives = 70/134 (52%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+  +GK   +LFF   DF     +EII  +   ++F  +    I +SVDS+ TH    K  + +  +  +++  VSD++  I++DY VL EE G +      ID KGI++  +   + V R +D  L+ +  +Q
  S:    34 LSDYLGKY-VVLFFYPLDFTFVCPTEIIAFSNHAEDFKKINCQLIAVSVDSQFTHLAWTKVPRKEGGLGPVNIPLVSDLTHSIAKDYGVLKEEDGVAYRGLFIIDGKGILRQITINDLPVGRSVDETLRLVQAFQ 167
>gi|9955007|pdb|1QMV|A Chain A, Thioredoxin Peroxidase B From Red Blood Cells >gi|9955008|pdb|1QMV|B Chain B, Thioredoxin Peroxidase B From Red Blood Cells >gi|9955009|pdb|1QMV|C Chain C, Thioredoxin Peroxidase B From Red Blood Cells >gi|9955010|pdb|1QMV|D Chain D, Thioredoxin Peroxidase B From Red Blood Cells >gi|9955011|pdb|1QMV|E Chain E, Thioredoxin Peroxidase B From Red Blood Cells >gi|9955012|pdb|1QMV|F Chain F, Thioredoxin Peroxidase B From Red Blood Cells >gi|9955013|pdb|1QMV|G Chain G, Thioredoxin Peroxidase B From Red Blood Cells >gi|9955014|pdb|1QMV|H Chain H, Thioredoxin Peroxidase B From Red Blood Cells >gi|9955015|pdb|1QMV|I Chain I, Thioredoxin Peroxidase B From Red Blood Cells >gi|9955016|pdb|1QMV|J Chain J, Thioredoxin Peroxidase B From Red Blood Cells (197 aa)
Score = 165, Expect = 2.0e-10, Identities = 34/124 (27%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + + ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D+++ +S DY VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    38 VLFFYPLDFTFVXPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQ 162
>gi|88607183|ref|YP_505241.1| anti-oxidant AhpCTSA family protein [Anaplasma phagocytophilum HZ] >gi|88598246|gb|ABD43716.1| antioxidant, AhpC/Tsa family [Anaplasma phagocytophilum HZ] (203 aa)
Score = 165, Expect = 2.0e-10, Identities = 44/155 (28%), Positives = 74/155 (47%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           L+ +  I+F ++A       + +  L+K++     +LFF  +DF     +EI+ L+ +   F       I IS DSE  H        +K  I  +S   V+D S  IS  Y +LF    SL  TI ID+  ++++ S   + + R++D  L+ I
  S:     7 LVTKPAIDFTARAVMSD-GKMCDLTLSKHVAGKYAVLFFYPRDFTFVCPTEILSLHSRIPQFSEQNAEVIAISTDSEFAHSHWRNTPLEKGGIGMVSFPLVADDSHSISESYGMLFAGKVSLRGTIIIDENFVVRHQSINDLPIGRNVDEFLRII 160
>gi|56460903|ref|YP_156184.1| AhpC/TSA family peroxiredoxin [Idiomarina loihiensis L2TR] >gi|56179913|gb|AAV82635.1| Peroxiredoxin, AhpC/Tsa family [Idiomarina loihiensis L2TR] (201 aa)
Score = 165, Expect = 2.0e-10, Identities = 39/156 (25%), Positives = 77/156 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GRK  +F + A  G  + + ++ L+  +     ++FF   DF     SE+I  +++   F   GV  I +S+DS+ TH        D   I  +    V+D+   I + Y V   + G +   +  ID++G++++     + + R+ID +L+ +
  S:     3 VLVGRKAPDFTAAAVLGSGEIVEDFKLSDAIKGKKAVVFFYPLDFTFVCPSELIAFDKRLDEFKKRGVEVIGVSIDSQFTHSAWRNTSTDAGGIGQVKYPLVADVRHSICKAYDVEHPQAGVAFRGSFLIDEEGMVRHQVVNDLPLGRNIDEMLRMV 159
>gi|119113794|ref|XP_310704.3| thioredoxin-dependent peroxidase (AGAP000396-PA) [Anopheles gambiae str. PEST] >gi|116130529|gb|EAA06406.3| thioredoxin-dependent peroxidase (AGAP000396-PA) [Anopheles gambiae str. PEST] (234 aa)
Score = 164, Expect = 2.1e-10, Identities = 35/124 (28%), Positives = 59/124 (47%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + +   F  L    + +SVDS  +H   +   +    +  +    ++D++K IS DY VL  +G SL     ID  G+++  +   + V R +D  L+ I  +Q
  S:    73 VLFFYPLDFTFVCPTEIIAFSDRINEFRELNTEVVGVSVDSHFSHLAWINTPRKAGGLGKLEYPLLADLTKRISADYGVLLPDGISLRGLFIIDPAGVVRQITINDLPVGRSVDETLRLIKAFQ 196
>gi|156550783|ref|XP_001606643.1| PREDICTED: similar to peroxiredoxins, prx-1, prx-2, prx-3 [Nasonia vitripennis] (248 aa)
Score = 164, Expect = 2.2e-10, Identities = 38/134 (28%), Positives = 71/134 (52%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           LT+  GK   + FF   DF     +EI+  + + + F  L V  +  SVDS  TH   +   + +  + N+ +  +SD++ +I++DY V  ++ G++L +   ID KGI++  +   + V R +D  L+ +  +Q
  S:    79 LTQFKGKY-LVFFFYPLDFTFVCPTEILAFSDRVEEFRKLNVEVVAASVDSHFTHLAWINTPRKEGGLENIRIPLLSDLTHKIAKDYGVYLDDLGHTLRALFIIDGKGILRQITMNDLPVGRSVDETLRLVQAFQ 212
>gi|150006768|ref|YP_001301511.1| thioredoxin peroxidase [Parabacteroides distasonis ATCC 8503] >gi|149935192|gb|ABR41889.1| thioredoxin peroxidase [Parabacteroides distasonis ATCC 8503] (210 aa)
Score = 164, Expect = 2.2e-10, Identities = 47/159 (29%), Positives = 81/159 (50%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPS--------------TIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           LIG+K   F + A     + I ++ L + +GK   ++FF   DF     +E+    QK Q F    V  +  SVDS+ +H   +   K+K  I+ ++   VSD SK IS ++ VL  +  +  S                 IDK+G+I+++    + + R++D  L+ +   Q
  S:     4 LIGKKAPEFHAPAVVNGNEIIEDFSLEQYVGKKYVVMFFYPMDFTFVCPTELHAFQQKLQEFERRNVAVVGCSVDSQFSHFAWLNQDKNKGGIHGVTYPLVSDFSKTISENFGVLAADYITNESGELISRGNPVAYRGLFLIDKEGLIRHYVINDLPLGRNVDEALRMVDALQ 176
>gi|91203633|emb|CAJ71286.1| strongly similar to peroxiredoxin (thioredoxin peroxidase) [Candidatus Kuenenia stuttgartiensis] (177 aa)
Score = 164, Expect = 2.3e-10, Identities = 48/159 (30%), Positives = 77/159 (48%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ++G K+ +F    Y GK                  +LFF   DF     +EI E ++K  +F +L      +S+DS  +H+  +K+L        ++   +SDI+KE+SR Y VL E+ G +L  T  ID +G IKY     + V R ++ IL+ +   Q
  S:    21 VVGEKFEDFSLDNYKGKW----------------VVLFFYPLDFTFICPTEITEFSKKDGDFKSLNAQVFGVSIDSVFSHKAWLKDL------GKLNYPLLSDITKEVSRKYGVLIEDKGIALRGTFIIDPEGKIKYQLVHDLGVGRSVEEILRVLNALQ 158
>gi|86605254|ref|YP_474017.1| anti-oxidant AhpCTSA family protein [Synechococcus sp. JA-3-3Ab] >gi|86553796|gb|ABC98754.1| antioxidant, AhpC/Tsa family [Synechococcus sp. JA-3-3Ab] (202 aa)
Score = 164, Expect = 2.3e-10, Identities = 41/134 (30%), Positives = 66/134 (49%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+   GK   +LFF   DF     +EI   + ++  F  L    + +SVDSE +H   ++  +    +  +    VSD+ KEIS  Y VL    G +L     IDK+GII++ +  ++   R +D  L+T+   Q
  S:    31 LSDYRGKKYVVLFFYPLDFTFVCPTEITAFSDRYDEFAKLDTEILGVSVDSEYSHLAWIQTDRKAGGVGELRYPLVSDLKKEISAAYNVLDPAAGVALRGLFIIDKEGIIQHATINNLAFGRSVDETLRTLQAIQ 165
>gi|126660237|ref|ZP_01731353.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cyanothece sp. CCY0110] >gi|126618476|gb|EAZ89229.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cyanothece sp. CCY0110] (199 aa)
Score = 164, Expect = 2.3e-10, Identities = 36/124 (29%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +E+I  + +++ F  +    + +SVDSE +H   ++  + +  + +++   VSD+ KEIS  Y VL  + G +L     IDK+G+I+Y +  ++   R +   L+T+   Q
  S:    40 VLFFYPLDFTFVCPTEVIAFSDRYEEFAKINTELLAVSVDSEFSHLAWIQTPRTEGGVGDIAYPLVSDLKKEISTAYNVLDPDSGVALRGLFIIDKEGVIQYSTVNNLSFGRSVTETLRTLKAIQ 164
>gi|149589559|ref|XP_001509414.1| PREDICTED: similar to LOC496089 protein, partial [Ornithorhynchus anatinus] (221 aa)
Score = 164, Expect = 2.5e-10, Identities = 34/124 (27%), Positives = 63/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    +   F  +    +  SVDS+ TH   +   + +  +  M +  +SD++++IS+DY V  E+ G++L     ID KG+++  +   + V R +D  L+ +  +Q
  S:    62 VFFFYPLDFTFVCPTEIIAFGDRIAEFRAINTEVVACSVDSQFTHLAWINTPRKQGGLGPMKIPLLSDLTRQISKDYGVYLEDLGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQ 186
>gi|145482827|ref|XP_001427436.1| hypothetical protein GSPATT00030676001 [Paramecium tetraurelia strain d4-2] >gi|124394517|emb|CAK60038.1| unnamed protein product [Paramecium tetraurelia] (230 aa)
Score = 164, Expect = 2.5e-10, Identities = 47/159 (29%), Positives = 76/159 (47%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE------GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+ R+   FFS              L+   GK   LLF+   DF     +E++  +     F  LG   + IS DS  TH   +K  +++  + ++ +  ++DISK+IS+ Y VL E+      G SL     IDKKG+++        V R ++  L+ I  +Q
  S:    31 LLPRQRAPFFSAIAVTPDLKFQKISLSDYSGKYIVLLFYPF-DFTYVCPTELVAFSNAIDQFRALGAEILGISTDSHFTHLAWLKTPRNQGGVGDLQIPLLADISKKISKAYGVLVEDELDELYGASLRGLFIIDKKGLVRTMQINDAPVGRSVEETLRLIQAFQ 194
>gi|150384572|ref|ZP_01923257.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Victivallis vadensis ATCC BAA-548] >gi|150259018|gb|EDM96266.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Victivallis vadensis ATCC BAA-548] (196 aa)
Score = 164, Expect = 2.5e-10, Identities = 34/131 (25%), Positives = 67/131 (51%)
  Q:    30 NMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           N+     +LFF   DF     +E++  +   + F  L    + +SVDSE +H    +  + K  I  +    VSD +KEISR+Y +L     +L     ID++G++++ +   + + R+++ +L+ + + Q
  S:    29 NLRGKYVVLFFYPMDFTFVCPTELVAFDNAIEKFKALNAELVSVSVDSEYSHYAWKQIERSKGGIGKLRYPMVSDFTKEISRNYGILLNNSVALRGLFVIDREGVVRHETVNDLPLGRNVEEVLRVLKSLQ 159
>gi|60830247|gb|AAX36919.1| peroxiredoxin 2 [synthetic construct] (199 aa)
Score = 164, Expect = 2.6e-10, Identities = 34/124 (27%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + + ++F  LG   + +SVDS+ TH   +   + +  +  +++  + D+++ +S DY VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLGDVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQ 163
>gi|90414604|ref|ZP_01222577.1| putative antioxidant, AhpC/Tsa family protein [Photobacterium profundum 3TCK] >gi|90324320|gb|EAS40889.1| putative antioxidant, AhpC/Tsa family protein [Photobacterium profundum 3TCK] (200 aa)
Score = 163, Expect = 2.7e-10, Identities = 38/156 (24%), Positives = 78/156 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  + + N++  +       ++FF   DF     SE+I  +++ ++F   GV  I +S+DS+ +H        +   I  +    ++DI  EI + Y V   E G +   +  ID+ G++++     + + R+ID +L+ +
  S:     2 VLVGRQAPDFTAAAVLGNGEIVDNFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDKRFEDFQAKGVEVIGVSIDSQFSHNAWRNTAIEDGGIGQVKYPLIADIKHEICKAYDVEHPEAGVAFRGSFLIDEDGLVRHQVVNDLPLGRNIDEMLRMV 158
>gi|74006605|ref|XP_548896.2| PREDICTED: similar to Peroxiredoxin 4 (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Antioxidant enzyme AOE372) (AOE37-2) isoform 1 [Canis familiaris] (272 aa)
Score = 163, Expect = 2.7e-10, Identities = 34/124 (27%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G++L     ID KGI++  +   + V R +D  L+ +  +Q
  S:   113 VFFFYPLDFTFVCPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIKIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQ 237
>gi|74006607|ref|XP_859371.1| PREDICTED: similar to peroxiredoxin 4 isoform 3 [Canis familiaris] (257 aa)
Score = 163, Expect = 2.7e-10, Identities = 34/124 (27%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G++L     ID KGI++  +   + V R +D  L+ +  +Q
  S:    98 VFFFYPLDFTFVCPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIKIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQ 222
>gi|62901916|gb|AAY18909.1| thioredoxin peroxidase 1-like [synthetic construct] (222 aa)
Score = 163, Expect = 2.8e-10, Identities = 34/124 (27%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + + ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D+++ +S DY VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    63 VLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQ 187
>gi|194749238|ref|XP_001957046.1| GF24261 [Drosophila ananassae] >gi|190624328|gb|EDV39852.1| GF24261 [Drosophila ananassae] (244 aa)
Score = 163, Expect = 2.9e-10, Identities = 39/139 (28%), Positives = 72/139 (51%)
  Q:    22 ILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           I+   L++ +GK   LLF+   DF     +EII  + +   F  +    I ISVDS  TH   +   + +  + N+ +  +SD++ +IS+DY V  E  G++L     ID+ G+++  +   + V R +D  ++ +  +Q
  S:    70 IVQLSLSQYLGKYVVLLFY-PLDFTFVCPTEIIAFSDRIAEFRKINTEVIGISVDSHFTHLAWINTPRKEGGLGNVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQ 208
>gi|159137835|gb|ABW88997.1| 2-Cys peroxiredoxin [Thunnus maccoyii] (197 aa)
Score = 163, Expect = 3.0e-10, Identities = 35/124 (28%), Positives = 65/124 (52%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EI+  + + + F ++G   I  S+DS  +H   +   + +  + +M +  ++D++K ISRDY VL E +G +      ID KGI++  +   + V R +D  L+ +  +Q
  S:    39 VFFFYPLDFTFVCPTEIVAFSDRAEEFRSIGCEVIGCSIDSHFSHLAWINTPRKQGGLGSMKIPLIADLTKTISRDYGVLKEDDGIAYRGLFVIDDKGILRQITINDLPVGRSVDETLRLVQAFQ 163
>gi|123993847|gb|ABM84525.1| peroxiredoxin 4 [synthetic construct] (271 aa)
Score = 163, Expect = 3.0e-10, Identities = 34/124 (27%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G++L     ID KGI++  +   + V R +D  L+ +  +Q
  S:   112 VFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQ 236
>gi|109130180|ref|XP_001087492.1| PREDICTED: similar to Peroxiredoxin-4 (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Antioxidant enzyme AOE372) (AOE37-2) [Macaca mulatta] (271 aa)
Score = 163, Expect = 3.0e-10, Identities = 34/124 (27%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G++L     ID KGI++  +   + V R +D  L+ +  +Q
  S:   112 VFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQ 236
>gi|60834541|gb|AAX37099.1| peroxiredoxin 4 [synthetic construct] (272 aa)
Score = 163, Expect = 3.0e-10, Identities = 34/124 (27%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G++L     ID KGI++  +   + V R +D  L+ +  +Q
  S:   112 VFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQ 236
>gi|49456297|emb|CAG46469.1| PRDX4 [Homo sapiens] (271 aa)
Score = 163, Expect = 3.0e-10, Identities = 34/124 (27%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G++L     ID KGI++  +   + V R +D  L+ +  +Q
  S:   112 VFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQ 236
>gi|5453549|ref|NP_006397.1| thioredoxin peroxidase [Homo sapiens] >gi|3024727|sp|Q13162|PRDX4_HUMAN Peroxiredoxin-4 (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Antioxidant enzyme AOE372) (AOE37-2) >gi|799381|gb|AAB95175.1| antioxidant enzyme AOE37-2 [Homo sapiens] >gi|13177646|gb|AAH03609.1| Peroxiredoxin 4 [Homo sapiens] >gi|13937985|gb|AAH07107.1| Peroxiredoxin 4 [Homo sapiens] >gi|16876997|gb|AAH16770.1| Peroxiredoxin 4 [Homo sapiens] >gi|49456371|emb|CAG46506.1| PRDX4 [Homo sapiens] >gi|119619402|gb|EAW98996.1| peroxiredoxin 4 [Homo sapiens] >gi|123996703|gb|ABM85953.1| peroxiredoxin 4 [synthetic construct] (271 aa)
Score = 163, Expect = 3.0e-10, Identities = 34/124 (27%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G++L     ID KGI++  +   + V R +D  L+ +  +Q
  S:   112 VFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQ 236
>gi|149635578|ref|XP_001510098.1| PREDICTED: similar to peroxiredoxin 2 [Ornithorhynchus anatinus] (347 aa)
Score = 163, Expect = 3.1e-10, Identities = 36/124 (29%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  ++    F  L    + +SVDS+ TH   +   ++   +  M++  ++D++  I+ DY VL E EG +      ID KGI++  +   + V R ++ IL+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSENASAFRQLNCEVLGVSVDSQFTHLAWINTPRNTGGLGTMNIPLLADLTHSIATDYGVLKEDEGIAYRGLFIIDNKGIVRQITINDLPVGRSVEEILRLVQAFQ 163
>gi|32491236|ref|NP_871490.1| hypothetical protein WGLp487 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|25166443|dbj|BAC24633.1| ahpC [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (199 aa)
Score = 163, Expect = 3.2e-10, Identities = 42/156 (26%), Positives = 79/156 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           ML+  K+I+F + A     + + N++L+  +    ++LFF   +F     SE+I  +++   F N  V  + +S+D+  +HQ           I  +    VSDI + I + Y V   E G +L ++  IDK GI+++     + + RDI+ +++ I
  S:     1 MLVANKFIDFTAPAILSNGEIVQNFNLSNYIKNKVSVLFFWPMNFTFVCPSELIAFDKRFFEFKNRNVKLVGVSLDTVYSHQAWRSTSTKLGGIGEVRYPMVSDIKRNIMKSYNVEHPEIGVALRASFLIDKAGIVRHQIINDLPIGRDINEMIRVI 157
>gi|94676826|ref|YP_589022.1| anti-oxidant AhpCTSA family protein [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|94219976|gb|ABF14135.1| antioxidant, AhpC/TSA family [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (200 aa)
Score = 163, Expect = 3.4e-10, Identities = 42/160 (26%), Positives = 78/160 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+ R+  +F + A  G    I N++    +     ++FF   DF     SE+I  ++++  F    V  + +S DSE  H        DK  IN +    V+D+ +EI + Y +   + G +L ++  IDK GI+++     + + R+ID I++ +   Q
  S:     2 VLVTRQAPDFTAAAILGSGKIINNFNFKNYIKGQHAIIFFWPMDFTFVCPSELIAFDKRYLEFQKRRVKIVGVSCDSEFVHNAWRLVPPDKGGINQVQYPMVADVKREIIKAYDIEHPDIGVALRASFLIDKDGIVRHQIVNDLPLGRNIDDIIRMVDALQ 162
>gi|160877873|pdb|2Z9S|A Chain A, Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXIN I, Cys52ser Mutant >gi|160877874|pdb|2Z9S|B Chain B, Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXIN I, Cys52ser Mutant >gi|160877875|pdb|2Z9S|C Chain C, Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXIN I, Cys52ser Mutant >gi|160877876|pdb|2Z9S|D Chain D, Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXIN I, Cys52ser Mutant >gi|160877877|pdb|2Z9S|E Chain E, Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXIN I, Cys52ser Mutant >gi|160877878|pdb|2Z9S|F Chain F, Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXIN I, Cys52ser Mutant >gi|160877879|pdb|2Z9S|G Chain G, Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXIN I, Cys52ser Mutant >gi|160877880|pdb|2Z9S|H Chain H, Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXIN I, Cys52ser Mutant >gi|160877881|pdb|2Z9S|I Chain I, Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXIN I, Cys52ser Mutant >gi|160877882|pdb|2Z9S|J Chain J, Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXIN I, Cys52ser Mutant (199 aa)
Score = 163, Expect = 3.4e-10, Identities = 40/124 (32%), Positives = 62/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF   S +EII  + + + F  L    I  SVDS   H   +   K +  +  M++  VSD  + I++DY VL  +EG S      ID KGI++  +   + V R +D IL+ +  +Q
  S:    40 VFFFYPLDFTFVSPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQ 164
>gi|194227734|ref|XP_001916326.1| PREDICTED: similar to Peroxiredoxin-4 (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Antioxidant enzyme AOE372) (AOE37-2) [Equus caballus] (272 aa)
Score = 163, Expect = 3.5e-10, Identities = 34/124 (27%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G++L     ID KGI++  +   + V R +D  L+ +  +Q
  S:   113 VFFFYPLDFTFVCPTEIIAFGDRIEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQ 237
>gi|119487744|ref|ZP_01621253.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Malallergen [Lyngbya sp. PCC 8106] >gi|119455577|gb|EAW36714.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Malallergen [Lyngbya sp. PCC 8106] (198 aa)
Score = 162, Expect = 3.5e-10, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + + + F  L    + +SVDSE +H   +++ +    + ++    VSDI K+IS  Y VL  E G +L     IDK+G+I++ +  ++   R++D  L+T+   Q
  S:    39 VLFFYPLDFTFVCPTEITAFSDRAEEFTKLNTQILGVSVDSEFSHLAWIQSDRKSGGVGDLKYPLVSDIKKDISAAYNVLDPEAGIALRGLFIIDKEGVIQHATINNLAFGRNVDETLRTLQAIQ 163
>gi|65301457|ref|NP_001013478.2| peroxiredoxin 3 [Danio rerio] >gi|62204368|gb|AAH92846.1| Peroxiredoxin 3 [Danio rerio] (250 aa)
Score = 162, Expect = 3.5e-10, Identities = 35/124 (28%), Positives = 62/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + K   F ++    + +SVDS  TH       +    +  + +  ++D++K++SRDY VL E  G +L     ID  GI+++ S   + V R +   L+ +  +Q
  S:    91 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCAVVGVSVDSHFTHLAWTNTPRKSGGLGKIQIPLLADLTKQVSRDYGVLLEGPGIALRGLFIIDPNGIVRHMSVNDLPVGRSVGETLRLVKAFQ 215
>gi|115644435|ref|XP_786503.2| PREDICTED: similar to thioredoxin peroxidase [Strongylocentrotus purpuratus] >gi|115958268|ref|XP_001176440.1| PREDICTED: similar to thioredoxin peroxidase [Strongylocentrotus purpuratus] (197 aa)
Score = 162, Expect = 3.6e-10, Identities = 39/151 (25%), Positives = 68/151 (45%)
  Q:    10 FFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +F       T   ++  L+   GK   + FF   DF     +EI+  + +   F  +G   +  S DS   H       K    +  + +  +SD+S +I+RDY ++ E EG SL     ID KG ++  +   + V R +D +L+ +  +Q
  S:    13 YFEGTAVSTTGEFVDVKLSDYKGKY-LVFFFYPLDFTFVCPTEILAFSDRSDEFTKIGCEVLAASCDSHFCHLAWTNTTKKLGGVGQLKIPLLSDMSGKIARDYGIMIEKEGISLRGLFIIDDKGTLRQITINDLPVGRSVDEVLRLVQAFQ 163
>gi|21672464|ref|NP_660531.1| alkyl hydroperoxide reductase subunit C [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|25091461|sp|Q8K9W0|TSAA_BUCAP Probable peroxiredoxin (Thioredoxin reductase) >gi|21623080|gb|AAM67742.1| alkyl hydroperoxide reductase subunit C [Buchnera aphidicola str. Sg (Schizaphis graminum)] (198 aa)
Score = 162, Expect = 3.6e-10, Identities = 46/155 (29%), Positives = 72/155 (46%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           L+ +K  NF + A       + N+DL K      T+LFF   DF     SEIIE N+  + F    V  + +S+DS   HQ       +   I  +    VSDI  EI + Y +   E   +L ++  ID+  II++     +   R+ID +++ I
  S:     3 LVTQKAPNFIAPAILKNGKIMNNFDLKKYSNGQITVLFFWPMDFTFVCPSEIIEFNKTFEAFEKRNVKIVGVSIDSVFVHQAWQNTFPENGGIGKIKFPMVSDIKHEIQKSYHIEHPELNIALRASFLIDENWIIRHQVVNDLPFGRNIDEMIRMI 158
>gi|13541930|ref|NP_111618.1| putative peroxiredoxin [Thermoplasma volcanium GSS1] >gi|23822256|sp|Q979N7|TDXH_THEVO Probable peroxiredoxin >gi|14325361|dbj|BAB60265.1| hydroperoxide reductase [Thermoplasma volcanium GSS1] (203 aa)
Score = 162, Expect = 3.8e-10, Identities = 37/124 (29%), Positives = 70/124 (56%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           LLF    DF P  T+E I   +++++F  LGV  I +S+DS  +H   ++++K+   I ++    ++DI KE++R+Y ++ E+ G ++     ID   I+++      E  R+I+ I++ I   Q
  S:    32 LLFSHPGDFTPVCTTEFIAFTERYEDFQKLGVELIGLSIDSVFSHIAWIRDIKEHFGI-DIPFPIIADIDKEVAREYNLIDEKSGATVRGVFIIDPNQIVRWMIYYPAETGRNIEEIIRVIKALQ 155
>gi|67923821|ref|ZP_00517282.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Crocosphaera watsonii WH 8501] >gi|67854320|gb|EAM49618.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Crocosphaera watsonii WH 8501] (199 aa)
Score = 162, Expect = 3.8e-10, Identities = 36/124 (29%), Positives = 68/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +E+I  +++++ F  +    + +SVDSE +H   ++  + +  + +++   VSD+ K+IS  Y VL  E G +L     IDK+GII++ +  ++   R +   L+T+   Q
  S:    40 ILFFYPLDFTFVCPTEVIAFSERYEEFSKINTEILAVSVDSEFSHLAWIQTPRTEGGVGDVAYPLVSDLKKDISNAYNVLDPESGVALRGLFIIDKEGIIQHSTINNLSFGRSVSETLRTLKAIQ 164
>gi|39998336|ref|NP_954287.1| thioredoxin peroxidase [Geobacter sulfurreducens PCA] >gi|39985282|gb|AAR36637.1| thioredoxin peroxidase [Geobacter sulfurreducens PCA] (201 aa)
Score = 162, Expect = 3.9e-10, Identities = 40/124 (32%), Positives = 60/124 (48%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     SEI+  N+K   F       I +SVDS+ TH        +   I N+    V+D+ KEI+  Y VLFE  G +L     ID KG++++     + + R +D  L+ +   Q
  S:    39 VLFFYPLDFTFVCPSEILAFNKKLDQFKAKNCEVIGVSVDSKFTHMAWKNTPVENGGIGNIQYPLVADLKKEIATQYGVLFEGAGVALRGLFLIDTKGVVRHAVINDLPLGRSVDEALRMVDALQ 163
>gi|89072674|ref|ZP_01159239.1| putative antioxidant, AhpC/Tsa family protein [Photobacterium sp. SKA34] >gi|90579392|ref|ZP_01235202.1| putative antioxidant, AhpC/Tsa family protein [Vibrio angustum S14] >gi|89051494|gb|EAR56948.1| putative antioxidant, AhpC/Tsa family protein [Photobacterium sp. SKA34] >gi|90440225|gb|EAS65406.1| putative antioxidant, AhpC/Tsa family protein [Vibrio angustum S14] (203 aa)
Score = 162, Expect = 3.9e-10, Identities = 37/156 (23%), Positives = 78/156 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  + + N++  +       ++FF   DF     SE+I  +++ ++F   GV  I +S+DS+ +H        +   I  +    ++D+  EI + Y V   E G +   +  ID+ G++++     + + R+ID +L+ +
  S:     2 VLVGRQAPDFTAAAVLGNGEIVDNFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDKRFEDFQAKGVEVIGVSIDSQFSHNAWRNTAVEDGGIGQVKYPLIADVKHEICKAYDVEHPEAGVAFRGSFLIDEDGLVRHQVVNDLPLGRNIDEMLRMV 158
>gi|194865248|ref|XP_001971335.1| GG14898 [Drosophila erecta] >gi|190653118|gb|EDV50361.1| GG14898 [Drosophila erecta] (242 aa)
Score = 162, Expect = 4.1e-10, Identities = 38/139 (27%), Positives = 72/139 (51%)
  Q:    22 ILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           I+   L++ +GK   LLF+   DF     +EII  + +   F  +    I +SVDS  TH   +   + +  + N+ +  +SD++ +IS+DY V  E  G++L     ID+ G+++  +   + V R +D  ++ +  +Q
  S:    69 IVKLSLSQYLGKYVVLLFY-PLDFTFVCPTEIIAFSDRIAEFKKIKTEVIGVSVDSHFTHLAWINTPRKEGGLGNVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQ 207
>gi|126697354|gb|ABO26634.1| thioredoxin peroxidase 1 [Haliotis discus discus] (251 aa)
Score = 162, Expect = 4.1e-10, Identities = 34/124 (27%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + +   F  +    +  SVDS+ TH   +   +D+  +  +++  +SDI+ +IS+ Y V  E+ G++L     ID KG+++  +   + V R +D  L+ +  +Q
  S:    87 VFFFYPLDFTFVCPTEIIAFSDRVAEFRKINTEVVACSVDSQFTHLAWINTPRDQGGLGAINIPLLSDITHDISKAYGVYLEDLGHTLRGLFIIDNKGVLRQITMNDLPVGRSVDETLRLVQAFQ 211
>gi|11558242|emb|CAC17803.1| peroxiredoxin [Phaseolus vulgaris] >gi|11558244|emb|CAC17804.1| peroxiredoxin [Phaseolus vulgaris] (260 aa)
Score = 162, Expect = 4.2e-10, Identities = 37/134 (27%), Positives = 71/134 (52%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+  +GK   +LFF   DF     +EI   + ++  F  L    + +SVDS  +H   V+  +    + +++   +SD++K IS+ Y VL  ++G +L     IDK+G+I++ +  ++ + R +D   +T+   Q
  S:    91 LSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYAEFEALNTEILGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSYDVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETKRTLQALQ 225
>gi|172037323|ref|YP_001803824.1| thioredoxin peroxidase [Cyanothece sp. ATCC 51142] >gi|171698777|gb|ACB51758.1| thioredoxin peroxidase [Cyanothece sp. ATCC 51142] (199 aa)
Score = 162, Expect = 4.2e-10, Identities = 35/124 (28%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +E+I  + +++ F  +    + +SVDSE +H   ++  + +  + +++   VSD+ KEIS  Y +L  E G +L     IDK+G+I++ +  ++   R +   L+T+   Q
  S:    40 VLFFYPLDFTFVCPTEVIAFSDRYEEFAKINTEILAVSVDSEFSHLAWIQTPRTEGGVGDIAYPLVSDLKKEISTAYNILDPESGVALRGLFIIDKEGVIQHATINNLSFGRSVTETLRTLKAIQ 164
>gi|194044822|ref|XP_001927404.1| PREDICTED: similar to peroxiredoxin 4 [Sus scrofa] (272 aa)
Score = 162, Expect = 4.3e-10, Identities = 34/124 (27%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G++L     ID KGI++  +   + V R +D  L+ +  +Q
  S:   113 VFFFYPLDFTFVCPTEIIAFGDRIEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQ 237
>gi|27363920|ref|NP_759448.1| peroxiredoxin [Vibrio vulnificus CMCP6] >gi|37678923|ref|NP_933532.1| peroxiredoxin [Vibrio vulnificus YJ016] >gi|27360037|gb|AAO08975.1|AE016798_135 Peroxiredoxin [Vibrio vulnificus CMCP6] >gi|37197664|dbj|BAC93503.1| peroxiredoxin [Vibrio vulnificus YJ016] (202 aa)
Score = 162, Expect = 4.3e-10, Identities = 37/156 (23%), Positives = 78/156 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  + + N++  +       ++FF   DF     SE+I  + ++++F   GV  I +S+DS+ +H        +   I  +    ++D+  EI + Y V   E G +   +  ID+ G++++     + + R+ID +L+ +
  S:     2 VLVGRQAPDFTAAAVLGNGEIVDNFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRYEDFKAKGVEVIGVSIDSQFSHNAWRNTPVENGGIGQVKYPLIADVKHEICQAYDVEHPEAGVAFRGSFLIDEDGLVRHQVVNDLPLGRNIDEMLRMV 158
>gi|88860465|ref|ZP_01135103.1| peroxiredoxin 2 [Pseudoalteromonas tunicata D2] >gi|88817663|gb|EAR27480.1| peroxiredoxin 2 [Pseudoalteromonas tunicata D2] (201 aa)
Score = 161, Expect = 4.7e-10, Identities = 39/156 (25%), Positives = 79/156 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  + + +Y+L + +     ++FF   DF     SE+I  +++ + F   GV  I +S+DS+ +H        ++  I  +    V+D+  EI + Y V   E G +   +  ID+ G +++     + + R+ID +L+ +
  S:     3 VLVGRQAPDFTAAAVLGNGEIVDSYNLHETIKGKKAVIFFYPLDFTFVCPSELIAFDKRFEEFQKRGVEVIGVSIDSQFSHNAWRNTPVNQGGIGPVKYALVADVKHEICQAYDVEHPEAGVAFRGSFLIDEAGNVRHQVVNDLPLGRNIDEMLRMV 159
>gi|38051985|gb|AAH60567.1| Prdx3 protein [Rattus norvegicus] (247 aa)
Score = 161, Expect = 4.8e-10, Identities = 35/109 (32%), Positives = 58/109 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEV 145
           +LFF   DF     +EI+  + K   F ++    + +SVDS  +H   +   +    + +M++  +SD++K+ISRDY VL E  G +L     ID  G+IK+ S   + V
  S:    97 VLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNITLLSDLTKQISRDYGVLLESAGIALRGLFIIDPNGVIKHLSVNDLPV 206
>gi|67591681|ref|XP_665587.1| thioredoxin peroxidase [Cryptosporidium hominis TU502] >gi|126645720|ref|XP_001388054.1| thioredoxin peroxidase-like protein [Cryptosporidium parvum Iowa II] >gi|51951320|gb|AAU15129.1| thioredoxin peroxidase-like protein [Cryptosporidium parvum] >gi|54656347|gb|EAL35358.1| thioredoxin peroxidase [Cryptosporidium hominis] >gi|126117142|gb|EAZ51242.1| thioredoxin peroxidase-like protein [Cryptosporidium parvum Iowa II] (196 aa)
Score = 161, Expect = 5.0e-10, Identities = 39/124 (31%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   +F     SEI+  NQ  ++F  LGV  + +SVDS+ +H    +   ++  I  ++   +SD S  IS++Y VL  EEG +L     IDK+G+++      + + R ++  L+ I   Q
  S:    37 VLFFYPLNFTFVCPSEILAFNQAQKDFEKLGVQLLAVSVDSQYSHAAWRRTPLEQGGIGPVNFPLISDSSHSISKNYGVLLEEEGIALRGLFIIDKEGVVRSEVIYDLPLGRSVEETLRVIDALQ 161
>gi|115712104|ref|XP_794871.2| PREDICTED: similar to mitochondrial truncated thioredoxin-dependent peroxide reductase precursor [Strongylocentrotus purpuratus] >gi|115973522|ref|XP_001191584.1| PREDICTED: similar to mitochondrial truncated thioredoxin-dependent peroxide reductase precursor [Strongylocentrotus purpuratus] (264 aa)
Score = 161, Expect = 5.0e-10, Identities = 33/124 (26%), Positives = 63/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + +   F  +    +  S+DS  +H   +   + +  +  M +  +SD+ K+I+ DY VL ++ G +L     ID +G++++ S   + V R +D  L+ +  +Q
  S:   105 VLFFYPLDFTFVCPTEIIAFSDRADEFGAINTEVVAASIDSHFSHLAWINTPRKQGGLGPMKIPLLSDMKKQIAEDYGVLLKDAGVALRGLFLIDPEGVVRHMSINDLPVGRSVDETLRLVKAFQ 229
>gi|78224377|ref|YP_386124.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geobacter metallireducens GS-15] >gi|78195632|gb|ABB33399.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geobacter metallireducens GS-15] (201 aa)
Score = 161, Expect = 5.1e-10, Identities = 41/124 (33%), Positives = 60/124 (48%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     SEI+  N+K   F       I +SVDS+ TH        +   I N+    VSD+ KEI+  + VLFE  G +L     ID KGI+++     + + R +D  L+ +   Q
  S:    39 ILFFYPLDFTFVCPSEILAFNKKLDQFKAKNCEVIGVSVDSKFTHLAWKNTKVEDGGIGNIQYPLVSDLKKEIATQFGVLFENGGVALRGLFLIDTKGIVRHAVINDLPLGRSVDEALRMLDALQ 163
>gi|113954600|ref|YP_730530.1| thioredoxin peroxidase [Synechococcus sp. CC9311] >gi|113881951|gb|ABI46909.1| thioredoxin peroxidase [Synechococcus sp. CC9311] (192 aa)
Score = 161, Expect = 5.1e-10, Identities = 37/124 (29%), Positives = 69/124 (55%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + ++ +F +     + ISVDS+ +H   ++  +++  I +++   VSD+ KEIS  Y VL + EG +L     ID +G+I + +  ++ V R++D  L+ +  +Q
  S:    32 VLFFYPLDFTFVCPTEITAFSDRYSDFSSKNTEVLGISVDSQFSHLAWIQTARNQGGIGDINYPLVSDLKKEISTAYNVLDDAEGVALRGLFIIDPEGVIMHATINNLPVGRNVDETLRVLQAFQ 156
>gi|81917543|sp|Q9JKY1|PRDX1_CRIGR Peroxiredoxin-1 (Thioredoxin peroxidase 2) (TPX-2) >gi|6942233|gb|AAF32369.1| thioredoxin peroxidase II [Cricetulus griseus] (199 aa)
Score = 161, Expect = 5.2e-10, Identities = 39/124 (31%), Positives = 61/124 (49%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  L    I  SVDS   H   +   K +  +  M++  VSD  + I++DY VL  +EG S      ID KGI++  +   + V R +D IL+ +  +Q
  S:    40 VFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQ 164
>gi|110597729|ref|ZP_01386013.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobium ferrooxidans DSM 13031] >gi|110340636|gb|EAT59116.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobium ferrooxidans DSM 13031] (196 aa)
Score = 161, Expect = 5.3e-10, Identities = 46/160 (28%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GRK  +F   A    +  + +  L+   GK   +LFF   DF     +E+    +K   F    V  I  SVDS+ +H   ++  + +  I  ++   +SDI+K IS DY VL E  G +L     IDK+G++++     + + R++D +L+ +   Q
  S:     3 VLVGRKAPDFDVAAVVNGSQFVDSCKLSLYHGKY-VVLFFYPLDFTFVCPTELHAFQEKLDEFKKRNVELIGCSVDSKFSHFAWLQTPRSRGGIQGVTYTLLSDINKTISADYDVLLEGAGIALRGLFLIDKEGVVRHQVVNDLPLGRNVDEVLRLVDALQ 162
>gi|27904673|ref|NP_777799.1| peroxiredoxin 2 [Buchnera aphidicola str. Bp (Baizongia pistaciae)] >gi|38605261|sp|Q89AS1|TSAA_BUCBP Probable peroxiredoxin (Thioredoxin reductase) >gi|27904070|gb|AAO26904.1| peroxiredoxin 2 [Buchnera aphidicola str. Bp (Baizongia pistaciae)] (199 aa)
Score = 161, Expect = 5.6e-10, Identities = 45/148 (30%), Positives = 70/148 (47%)
  Q:     9 NFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +F + A S   D I N++  +      ++LFF   DF     SEII  NQ+   F    V  I +S+DS   H      L     I+ ++   VSD+ +EI R Y +   + G +L +T  IDK  II++ +   +   R+I   L+ I
  S:    10 DFTASAISCNGDIINNFNFKEFTNNQTSILFFWPMDFTFVCPSEIIAFNQELSKFKKRNVKLIGVSIDSVYVHHAWRNTLSHNGQIDKINFTMVSDLKREIQRSYGIEHPQLGVALRATFLIDKNRIIRHQTINDLPFGRNISETLRMI 158
>gi|28897354|ref|NP_796959.1| anti-oxidant AhpCTSA family protein [Vibrio parahaemolyticus RIMD 2210633] >gi|91225164|ref|ZP_01260386.1| antioxidant, AhpC/Tsa family protein [Vibrio alginolyticus 12G01] >gi|153838066|ref|ZP_01990733.1| antioxidant, AhpC/Tsa family [Vibrio parahaemolyticus AQ3810] >gi|28805566|dbj|BAC58843.1| antioxidant, AhpC/Tsa family [Vibrio parahaemolyticus RIMD 2210633] >gi|91190107|gb|EAS76378.1| antioxidant, AhpC/Tsa family protein [Vibrio alginolyticus 12G01] >gi|149748533|gb|EDM59392.1| antioxidant, AhpC/Tsa family [Vibrio parahaemolyticus AQ3810] (203 aa)
Score = 161, Expect = 5.7e-10, Identities = 38/156 (24%), Positives = 77/156 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  + + N++  +       ++FF   DF     SE+I  + +  +F   GV  I +S+DS+ +H        +   I  +    V+D+  EI + Y V   E G +   +  ID++G++++     + + R+ID +L+ +
  S:     2 VLVGRQAPDFTAAAVLGNGEIVENFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRLADFQAKGVEVIGVSIDSQFSHNAWRNTAIEDGGIGQVKYPLVADVKHEICKAYDVEHPEAGVAFRGSFLIDEEGVVRHQVVNDLPLGRNIDEMLRMV 158
>gi|157674503|gb|ABV60347.1| putative peroxiredoxin [Lutzomyia longipalpis] (248 aa)
Score = 161, Expect = 5.8e-10, Identities = 34/124 (27%), Positives = 63/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EI+  + + + F  +    I  SVDS  TH   +   + +  +  + +  +SD+S +IS+DY V  E+ G++L     ID +GI++  +   + V R +D  L+ +  +Q
  S:    89 VFFFYPLDFTFVCPTEILAFSDRVEEFRKINTEVIACSVDSHFTHLAWINTPRKEGGLGKIKIPLLSDLSHKISKDYGVYLEDLGHTLRGLFIIDHRGILRQITMNDLPVGRSVDETLRLVQAFQ 213
>gi|196177630|gb|EDX72634.1| Redoxin superfamily [Microcoleus chthonoplastes PCC 7420] (197 aa)
Score = 161, Expect = 5.9e-10, Identities = 39/124 (31%), Positives = 65/124 (52%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ++FF   DF     +EI   + +   F  +G   + ISVDSE +H   ++  +    + +++   VSDI KEIS  Y VL  + G +L     IDK GII+  +  ++   R++D +L+T+   Q
  S:    38 VIFFYPLDFTFVCPTEITAFSDRFSEFKEVGTQVLGISVDSEFSHLAWIQTDRKSGGVGDLNYPLVSDIKKEISTAYNVLDPDAGVALRGLFIIDKDGIIQQSTINNLSFGRNVDEVLRTLKAIQ 162
>gi|195492824|ref|XP_002094156.1| GE20352 [Drosophila yakuba] >gi|194180257|gb|EDW93868.1| GE20352 [Drosophila yakuba] (242 aa)
Score = 161, Expect = 5.9e-10, Identities = 38/139 (27%), Positives = 72/139 (51%)
  Q:    22 ILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           I+   L++ +GK   LLF+   DF     +EII  + +   F  +    I +SVDS  TH   +   + +  + N+ +  +SD++ +IS+DY V  E  G++L     ID+ G+++  +   + V R +D  ++ +  +Q
  S:    69 IVKLSLSQYLGKYVVLLFY-PLDFTFVCPTEIIAFSDRIAEFKKIKTEVIGVSVDSHFTHLAWINTPRKEGGLGNVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQ 207
>gi|195429068|ref|XP_002062586.1| GK16580 [Drosophila willistoni] >gi|194158671|gb|EDW73572.1| GK16580 [Drosophila willistoni] (248 aa)
Score = 160, Expect = 6.0e-10, Identities = 38/139 (27%), Positives = 71/139 (51%)
  Q:    22 ILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           I+   L++ +GK   LLF+   DF     +EII  + +   F  +    I  SVDS  TH   +   + +  + ++ +  +SD++ +IS+DY V  E  G++L     ID+ G+++  +   + V R +D  L+ +  +Q
  S:    75 IVQLSLSQYLGKYVVLLFY-PLDFTFVCPTEIIAFSDRIAEFRKINTEVIAASVDSHFTHLAWINTPRKEGGLGSVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQTGLLRQITMNDLPVGRSVDETLRLVQAFQ 213
>gi|73666957|ref|YP_302973.1| alkyl hydroperoxide reductase/thiol specific antioxidant/ Mal allergen [Ehrlichia canis str. Jake] >gi|72394098|gb|AAZ68375.1| Alkyl hydroperoxide reductase/ Thiolspecificantioxidant/ Mal allergen [Ehrlichia canis str. Jake] (205 aa)
Score = 160, Expect = 6.0e-10, Identities = 46/155 (29%), Positives = 76/155 (49%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           LI ++ I+F +KA     D I  ++L + +     +L F  +DF     +EII L+ +   F+      I IS DSE  H        +K  I+ +S   ++D S  IS  Y VL     +L +T  ID K I+++ S   + + R++D +L+ I
  S:     3 LITKQAIDFTAKAVM-PDDKICEFNLKEYVNGKCAILVFYPRDFTFVCPTEIISLHNRIPQFMEKNTEIIGISTDSEFCHSHWRNVSVNKGGIDKISFPLIADDSHFISSSYGVLHNNSIALRATFIIDDKFIVRHQSINDLPIGRNVDELLRII 156
>gi|77164396|ref|YP_342921.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosococcus oceani ATCC 19707] >gi|76882710|gb|ABA57391.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosococcus oceani ATCC 19707] (199 aa)
Score = 160, Expect = 6.1e-10, Identities = 39/137 (28%), Positives = 71/137 (51%)
  Q:    24 NYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           N+ L+   G+   +LFF   DF     SEI+  N + ++F   GV  I +SVDS+ +H            I  +    V+D+S +I+R Y V   +G +L ++  IDK G++++    ++ + RD++ +L+ +   Q
  S:    26 NFRLSDARGQY-VVLFFYPLDFTFVCPSEILAHNNRLEDFKERGVEVIGVSVDSQYSHYAWRNTPVVDGGIGAIGFPLVADLSHDITRAYGVEHPDGVALRASFLIDKNGVVQHQVVNNLPLGRDVEEMLRVVDALQ 161
>gi|123295852|emb|CAM23141.1| peroxiredoxin 4 [Mus musculus] (229 aa)
Score = 160, Expect = 6.2e-10, Identities = 33/124 (26%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G++L     ID KG+++  +   + V R +D  L+ +  +Q
  S:    98 VFFFYPLDFTFVCPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKGVLRQITLNDLPVGRSVDETLRLVQAFQ 222
>gi|149042395|gb|EDL96102.1| peroxiredoxin 4, isoform CRA_a [Rattus norvegicus] (281 aa)
Score = 160, Expect = 6.2e-10, Identities = 33/124 (26%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G++L     ID KG+++  +   + V R +D  L+ +  +Q
  S:   122 VFFFYPLDFTFVCPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKGVLRQITLNDLPVGRSVDETLRLVQAFQ 246
>gi|148708896|gb|EDL40843.1| peroxiredoxin 4, isoform CRA_a [Mus musculus] (285 aa)
Score = 160, Expect = 6.2e-10, Identities = 33/124 (26%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G++L     ID KG+++  +   + V R +D  L+ +  +Q
  S:   126 VFFFYPLDFTFVCPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKGVLRQITLNDLPVGRSVDETLRLVQAFQ 250
>gi|148708897|gb|EDL40844.1| peroxiredoxin 4, isoform CRA_b [Mus musculus] (216 aa)
Score = 160, Expect = 6.2e-10, Identities = 33/124 (26%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G++L     ID KG+++  +   + V R +D  L+ +  +Q
  S:    57 VFFFYPLDFTFVCPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKGVLRQITLNDLPVGRSVDETLRLVQAFQ 181
>gi|83594229|ref|YP_427981.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodospirillum rubrum ATCC 11170] >gi|83577143|gb|ABC23694.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodospirillum rubrum ATCC 11170] (204 aa)
Score = 160, Expect = 6.6e-10, Identities = 41/155 (26%), Positives = 74/155 (47%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           L GR   +F + A       + ++ L   +     L+FF   DF     SEI+  + +   F       + ISVDS+ +H    K    +  +  +    V+DISK I+R + VL E G +L ++  +D+ GI+++ +   + + R++D  L+ I
  S:     8 LTGRPVPDFTAPAVLADNSIVEDFCLKDYLAGFYGLIFFYPLDFTFVCPSEILAHDHRLPAFAAKEAKVVAISVDSQYSHLAWKKTPIAEGGLGPIGFPMVADISKAIARSFGVLLETGVALRASFLVDRGGIVRHQTVNDLPLGRNVDETLRMI 162
>gi|71028056|ref|XP_763671.1| thioredoxin peroxidase 1 [Theileria parva strain Muguga] >gi|68350625|gb|EAN31388.1| thioredoxin peroxidase 1, putative [Theileria parva] (198 aa)
Score = 160, Expect = 6.6e-10, Identities = 36/130 (27%), Positives = 66/130 (50%)
  Q:    31 MGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +GK   +LFF   DF     +EI+  N     F    V  +  SVDS+  H       +DK  +  +    ++D++KE++  Y VL ++ G SL     IDKKG++++    ++ + R+++ +L+ +   Q
  S:    32 LGKKYVVLFFYPLDFTFVCPTEIVAFNDAVAQFEQRNVQLLACSVDSKYCHLAWRNTPRDKAGVGQVKFPMLADMTKEVASSYGVLLDDLGISLRGLFLIDKKGVLQHSLVNNLPLGRNVNEVLRLVDALQ 162
>gi|149037813|gb|EDL92173.1| rCG51106, isoform CRA_b [Rattus norvegicus] (181 aa)
Score = 160, Expect = 6.7e-10, Identities = 34/124 (27%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  +   ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D++K +S++Y VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQ 163
>gi|34849738|gb|AAH58481.1| Peroxiredoxin 2 [Rattus norvegicus] >gi|149037815|gb|EDL92175.1| rCG51106, isoform CRA_d [Rattus norvegicus] (198 aa)
Score = 160, Expect = 6.8e-10, Identities = 34/124 (27%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  +   ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D++K +S++Y VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQ 163
>gi|8394432|ref|NP_058865.1| peroxiredoxin 2 [Rattus norvegicus] >gi|549132|sp|P35704|PRDX2_RAT Peroxiredoxin-2 (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) >gi|514254|gb|AAA19959.1| thiol-specific antioxidant >gi|632720|gb|AAB32034.1| TSA=thiol-specific antioxidant [rats, brain, Peptide, 198 aa] (198 aa)
Score = 160, Expect = 6.8e-10, Identities = 34/124 (27%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  +   ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D++K +S++Y VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQ 163
>gi|6435547|pdb|1QQ2|A Chain A, Crystal Structure Of A Mammalian 2-Cys Peroxiredoxin, Hbp23. >gi|6435548|pdb|1QQ2|B Chain B, Crystal Structure Of A Mammalian 2-Cys Peroxiredoxin, Hbp23. (199 aa)
Score = 160, Expect = 7.0e-10, Identities = 39/124 (31%), Positives = 62/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  L    I  SVDS  +H   +   K +  +  M++  VSD  + I++DY VL  +EG S      ID KGI++  +   + V R +D IL+ +  +Q
  S:    40 VFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFSHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQ 164
>gi|16082572|ref|NP_394414.1| putative peroxiredoxin [Thermoplasma acidophilum DSM 1728] (203 aa)
Score = 160, Expect = 7.4e-10, Identities = 37/124 (29%), Positives = 68/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           LLF    DF P  T+E I   +++++F  LGV  + +S+DS  +H   ++++K+   I  +    ++DI KE++R Y ++ E+ G ++     ID   I+++      E  R+ID I++ I   Q
  S:    32 LLFSHPGDFTPVCTTEFIAFTERYKDFQALGVELLGLSIDSVYSHIAWIRDIKEHFGI-EIPFPIIADIDKEVARQYNLIDEKSGATVRGVFIIDPNQIVRWMIYYPAETGRNIDEIIRVIKALQ 155
>gi|27806085|ref|NP_776858.1| peroxiredoxin 4 [Bos taurus] >gi|22095987|sp|Q9BGI2|PRDX4_BOVIN Peroxiredoxin-4 (Prx-IV) >gi|12407849|gb|AAG53660.1|AF305563_1 peroxiredoxin 4 [Bos taurus] >gi|81673557|gb|AAI09825.1| Peroxiredoxin 4 [Bos taurus] (274 aa)
Score = 160, Expect = 7.4e-10, Identities = 33/124 (26%), Positives = 65/124 (52%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    +   F ++    +  SVDS+ TH   +   + +  + ++++  ++D++ +IS+DY V  E+ G++L     ID KGI++  +   + V R +D  L+ +  +Q
  S:   115 VFFFYPLDFTFVCPTEIIAFGDRIDEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGSINIPLLADLNHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQ 239
>gi|66821043|ref|XP_644052.1| peroxiredoxin [Dictyostelium discoideum AX4] >gi|21240672|gb|AAM44383.1| Peroxiredoxin 4 [Dictyostelium discoideum] >gi|28828367|gb|AAO51015.1| similar to Rattus norvegicus (Rat). PRx IV [Dictyostelium discoideum] >gi|60472369|gb|EAL70322.1| peroxiredoxin [Dictyostelium discoideum AX4] (205 aa)
Score = 160, Expect = 7.5e-10, Identities = 34/119 (28%), Positives = 64/119 (53%)
  Q:    38 LFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           LFF   DF     +EII  +   + F   G   +  S+DS  TH   +   + +  +  +++  +SD++ +IS+DY V  EE G+++  +I IDK+G+++  +     V R +D  ++T+
  S:    46 LFFYPLDFTFVCPTEIIAFSNAAEEFKKAGCELVGCSIDSPFTHLAWINTPRKEGGLGGINIPLLSDLTHQISKDYGVYIEEDGHTIRGSILIDKEGLVRVITMNDNPVGRSVDEAIRTL 165
>gi|158285485|ref|XP_308336.4| thioredoxin-dependent peroxidase (AGAP007543-PA) [Anopheles gambiae str. PEST] >gi|157020015|gb|EAA03983.5| thioredoxin-dependent peroxidase (AGAP007543-PA) [Anopheles gambiae str. PEST] (258 aa)
Score = 160, Expect = 7.6e-10, Identities = 33/124 (26%), Positives = 62/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EI+  + +   F  L    I  S+DS  TH   +   + +  +  +++  VSDI+  IS+DY V  ++ G++L     ID +G+++  +   + V R +D  L+ +  +Q
  S:    99 VFFFYPLDFTFVCPTEILAFSDRVNEFKKLNAEVIAASIDSHFTHLAWINTPRKEGGLGKINIPLVSDITHSISKDYGVFLDDLGHTLRGLFIIDDRGVLRQITMNDLPVGRSVDETLRLVQAFQ 223
>gi|81914708|sp|Q8K3U7|PRDX2_CRIGR Peroxiredoxin-2 >gi|22324906|gb|AAM95673.1| peroxiredoxin 2 [Cricetulus griseus] (198 aa)
Score = 160, Expect = 7.6e-10, Identities = 34/124 (27%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  +   ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D+++ +S +Y VL  +EG +      ID KGI++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSNHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRSLSENYGVLKTDEGIAYRGLFIIDAKGILRQITVNDLPVGRSVDEALRLVQAFQ 163
>gi|14285790|sp|Q9HJL3|TDXH2_THEAC Probable peroxiredoxin 2 >gi|10640269|emb|CAC12083.1| peroxiredoxin related protein [Thermoplasma acidophilum] (199 aa)
Score = 160, Expect = 7.6e-10, Identities = 37/124 (29%), Positives = 68/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           LLF    DF P  T+E I   +++++F  LGV  + +S+DS  +H   ++++K+   I  +    ++DI KE++R Y ++ E+ G ++     ID   I+++      E  R+ID I++ I   Q
  S:    28 LLFSHPGDFTPVCTTEFIAFTERYKDFQALGVELLGLSIDSVYSHIAWIRDIKEHFGI-EIPFPIIADIDKEVARQYNLIDEKSGATVRGVFIIDPNQIVRWMIYYPAETGRNIDEIIRVIKALQ 151
>gi|149243259|pdb|2PN8|A Chain A, Crystal Structure Of Human Peroxiredoxin 4 (Thioredoxin Peroxidase) >gi|149243260|pdb|2PN8|B Chain B, Crystal Structure Of Human Peroxiredoxin 4 (Thioredoxin Peroxidase) >gi|149243261|pdb|2PN8|C Chain C, Crystal Structure Of Human Peroxiredoxin 4 (Thioredoxin Peroxidase) >gi|149243262|pdb|2PN8|D Chain D, Crystal Structure Of Human Peroxiredoxin 4 (Thioredoxin Peroxidase) >gi|149243263|pdb|2PN8|E Chain E, Crystal Structure Of Human Peroxiredoxin 4 (Thioredoxin Peroxidase) >gi|149243264|pdb|2PN8|F Chain F, Crystal Structure Of Human Peroxiredoxin 4 (Thioredoxin Peroxidase) >gi|149243265|pdb|2PN8|G Chain G, Crystal Structure Of Human Peroxiredoxin 4 (Thioredoxin Peroxidase) >gi|149243266|pdb|2PN8|H Chain H, Crystal Structure Of Human Peroxiredoxin 4 (Thioredoxin Peroxidase) >gi|149243267|pdb|2PN8|I Chain I, Crystal Structure Of Human Peroxiredoxin 4 (Thioredoxin Peroxidase) >gi|149243268|pdb|2PN8|J Chain J, Crystal Structure Of Human Peroxiredoxin 4 (Thioredoxin Peroxidase) (211 aa)
Score = 160, Expect = 7.6e-10, Identities = 34/124 (27%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G++L     ID KGI++  +   + V R +D  L+ +  +Q
  S:    52 VFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQ 176
>gi|193213224|ref|YP_001999177.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobaculum parvum NCIB 8327] >gi|193086701|gb|ACF11977.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobaculum parvum NCIB 8327] (195 aa)
Score = 159, Expect = 7.8e-10, Identities = 44/160 (27%), Positives = 83/160 (51%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEG-YSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR   +F ++A    +  + +  L+   GK   +LFF   DF     +E+    +K + F    V  +  SVDS+ +H   +   ++K  I  ++   +SDI+K I++DY VL  +G  +L     IDK+GI+++     + + R+ID +++ +   Q
  S:     3 VLVGRPAPDFNAEAVVNGSTFVDSCQLSAYRGKY-VVLFFYPLDFTFVCPTELHAFEEKLEEFKKRNVEVLGCSVDSKFSHFAWLNTPRNKGGIQGVTYPLISDINKTIAKDYDVLTADGSVALRGLFLIDKEGIVRHQVVNDLGLGRNIDEVIRIVDALQ 162
>gi|194375974|dbj|BAG57331.1| unnamed protein product [Homo sapiens] (183 aa)
Score = 159, Expect = 8.0e-10, Identities = 34/122 (27%), Positives = 65/122 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIAT 158
           +LFF   DF     +EII  + + ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D+++ +S DY VL  +EG +      ID KG+++  +   + V R +D  L+   T
  S:    39 VLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLAVT 161
>gi|47220267|emb|CAG03301.1| unnamed protein product [Tetraodon nigroviridis] >gi|84569642|gb|ABC59169.1| natural killer enhancing factor B [Tetraodon nigroviridis] (198 aa)
Score = 159, Expect = 8.2e-10, Identities = 35/124 (28%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EI+  + + Q+F ++    I  S+DS  TH   +   + +  +  M +  V+D++K IS+DY VL E +G +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    39 VFFFYPLDFTFVCPTEIVAFSDRVQDFRSINCEVIGCSIDSHFTHLAWINTPRKEGGLGEMKIPLVADLTKSISKDYGVLKEDDGIAYRGLFVIDDKGVLRQITVNDLPVGRSVDETLRLVQAFQ 163
>gi|169190831|ref|ZP_02850737.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Paenibacillus sp. JDR-2] >gi|169002493|gb|EDS49377.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Paenibacillus sp. JDR-2] (182 aa)
Score = 159, Expect = 8.8e-10, Identities = 45/159 (28%), Positives = 73/159 (45%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+GR   +F     +G         L    GK   +LFF   DF     +EI  L+   + F  L    + +SVDS+ +H+  +    +   +  ++    +DI+K ++RDY VL  EEG +L     ID +G +KY      +V R +D  L+ +   Q
  S:     5 LVGRPAPDFKMDTATGDGKDFGTASLADYKGK-WLVLFFYPLDFTFVCPTEITALSLASEQFKALNTEVLGVSVDSKHSHRAWINTPVNDNGLGELNFPLAADITKSVARDYGVLIEEEGVALRGLYIIDPEGEVKYQVVNHNDVGRSVDETLRVLQALQ 163
>gi|16923958|ref|NP_476455.1| peroxiredoxin 1 [Rattus norvegicus] >gi|2499470|sp|Q63716|PRDX1_RAT Peroxiredoxin-1 (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Heme-binding 23 kDa protein) (HBP23) >gi|1060977|dbj|BAA06275.1| heme-binding 23 kDa protein (HBP23) [Rattus norvegicus] >gi|34849851|gb|AAH58450.1| Peroxiredoxin 1 [Rattus norvegicus] >gi|56789700|gb|AAH88118.1| Peroxiredoxin 1 [Rattus norvegicus] >gi|149035583|gb|EDL90264.1| rCG50201 [Rattus norvegicus] (199 aa)
Score = 159, Expect = 8.8e-10, Identities = 39/124 (31%), Positives = 61/124 (49%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  L    I  SVDS   H   +   K +  +  M++  VSD  + I++DY VL  +EG S      ID KGI++  +   + V R +D IL+ +  +Q
  S:    40 VFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQ 164
>gi|16758274|ref|NP_445964.1| peroxiredoxin 4 [Rattus norvegicus] >gi|4336879|gb|AAD17993.1| PRx IV [Rattus norvegicus] >gi|37590233|gb|AAH59122.1| Peroxiredoxin 4 [Rattus norvegicus] (273 aa)
Score = 159, Expect = 8.9e-10, Identities = 33/124 (26%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G++L     ID KG+++  +   + V R +D  L+ +  +Q
  S:   114 VFFFYPLDFTFVCPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKGVLRQITLNDLPVGRSVDETLRLVQAFQ 238
>gi|7948999|ref|NP_058044.1| peroxiredoxin 4 [Mus musculus] >gi|3024715|sp|O08807|PRDX4_MOUSE Peroxiredoxin-4 (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Antioxidant enzyme AOE372) >gi|2104955|gb|AAB57846.1| antioxidant enzyme AOE372 [Mus musculus] >gi|12836669|dbj|BAB23758.1| unnamed protein product [Mus musculus] >gi|13097150|gb|AAH03349.1| Peroxiredoxin 4 [Mus musculus] >gi|18044557|gb|AAH19578.1| Peroxiredoxin 4 [Mus musculus] >gi|74138647|dbj|BAE27143.1| unnamed protein product [Mus musculus] >gi|74212680|dbj|BAE31074.1| unnamed protein product [Mus musculus] >gi|123295850|emb|CAM23139.1| peroxiredoxin 4 [Mus musculus] (274 aa)
Score = 159, Expect = 8.9e-10, Identities = 33/124 (26%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII    + + F ++    +  SVDS+ TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G++L     ID KG+++  +   + V R +D  L+ +  +Q
  S:   115 VFFFYPLDFTFVCPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKGVLRQITLNDLPVGRSVDETLRLVQAFQ 239
>gi|46204795|ref|ZP_00209561.1| COG0450: Peroxiredoxin [Magnetospirillum magnetotacticum MS-1] (128 aa)
Score = 159, Expect = 9.0e-10, Identities = 37/123 (30%), Positives = 61/123 (49%)
  Q:    38 LFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +FF    F     SEI+  + + + F     N I +SVDS  TH        DK  + N+    V+D++K+I++ Y VL   G +L  T  IDK G+++     ++ + R++D  L+ I   Q
  S:     1 MFFYPLYFNFVCPSEILAHDHRVKAFAERNTNVIAVSVDSHFTHLAWKNTPVDKGGLGNVQFPMVADLTKDIAKSYGVLLPGGVALRGTFVIDKNGVVQSAHVNNLPLGRNVDEALRLIDALQ 123
>gi|15598725|ref|NP_252219.1| putative peroxidase [Pseudomonas aeruginosa PAO1] >gi|107103041|ref|ZP_01366959.1| hypothetical protein PaerPA_01004110 [Pseudomonas aeruginosa PACS2] >gi|116051528|ref|YP_789636.1| putative peroxidase [Pseudomonas aeruginosa UCBPP-PA14] >gi|152986134|ref|YP_001347002.1| putative peroxidase [Pseudomonas aeruginosa PA7] >gi|194547438|ref|YP_002082466.1| hypothetical protein PACG_02440 [Pseudomonas aeruginosa C3719] >gi|194553174|ref|YP_002088201.1| hypothetical protein PA2G_02923 [Pseudomonas aeruginosa 2192] >gi|9949678|gb|AAG06917.1|AE004773_6 probable peroxidase [Pseudomonas aeruginosa PAO1] >gi|115586749|gb|ABJ12764.1| putative alkyl hydroperoxide reductase subunit [Pseudomonas aeruginosa UCBPP-PA14] >gi|126168384|gb|EAZ53895.1| hypothetical protein PACG_02440 [Pseudomonas aeruginosa C3719] >gi|126195567|gb|EAZ59630.1| hypothetical protein PA2G_02923 [Pseudomonas aeruginosa 2192] >gi|150961292|gb|ABR83317.1| probable peroxidase [Pseudomonas aeruginosa PA7] (200 aa)
Score = 159, Expect = 9.0e-10, Identities = 41/160 (25%), Positives = 75/160 (46%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+G+K  +F   A  G  + + ++ L++ +     L+FF   DF     SE+I L+ +   F    V  I +S+DS  TH        DK  I  +     +D   EI++ Y V  + G +      IDK+G+++      + + R++D +L+ +   Q
  S:     3 VLVGKKAPDFNVAAVLGNGEIVESFTLSEAIKGKYGLVFFYPLDFTFVCPSELIALDHRIPEFQARNVEVIGVSIDSHFTHNAWRNTPVDKGGIGAVKYTLAADTKHEIAKAYDVESDGGVAFRGAFLIDKEGVVRSQIVNDLPLGRNMDELLRLVDALQ 162
>gi|148747558|ref|NP_035693.3| peroxiredoxin 2 [Mus musculus] >gi|2499469|sp|Q61171|PRDX2_MOUSE Peroxiredoxin-2 (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) >gi|1354328|gb|AAB01941.1| thioredoxin peroxidase >gi|1568575|emb|CAA57566.1| putative TSA, thiol specific antioxidant [Mus musculus] >gi|12805153|gb|AAH02034.1| Prdx2 protein [Mus musculus] >gi|12842613|dbj|BAB25666.1| unnamed protein product [Mus musculus] >gi|26353250|dbj|BAC40255.1| unnamed protein product [Mus musculus] >gi|51980699|gb|AAH81454.1| Prdx2 protein [Mus musculus] >gi|148679031|gb|EDL10978.1| mCG5911 [Mus musculus] (198 aa)
Score = 159, Expect = 9.3e-10, Identities = 34/124 (27%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  +   ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D++K +S++Y VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQ 163
>gi|12846252|dbj|BAB27093.1| unnamed protein product [Mus musculus] (198 aa)
Score = 159, Expect = 9.3e-10, Identities = 34/124 (27%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  +   ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D++K +S++Y VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQ 163
>gi|3603241|gb|AAC35744.1| type II peroxiredoxin 1 [Mus musculus] (198 aa)
Score = 159, Expect = 9.4e-10, Identities = 34/124 (27%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  +   ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D++K +S++Y VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQ 163
>gi|72382192|ref|YP_291547.1| thioredoxin peroxidase [Prochlorococcus marinus str. NATL2A] >gi|124025740|ref|YP_001014856.1| thioredoxin peroxidase [Prochlorococcus marinus str. NATL1A] >gi|72002042|gb|AAZ57844.1| thioredoxin peroxidase [Prochlorococcus marinus str. NATL2A] >gi|123960808|gb|ABM75591.1| thioredoxin peroxidase [Prochlorococcus marinus str. NATL1A] (198 aa)
Score = 159, Expect = 9.7e-10, Identities = 36/124 (29%), Positives = 65/124 (52%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + ++ +F +     + +SVDS+ TH   ++  +++  I +++   VSD+ +EI + Y VL E+G +      I+  GII + +     V R+ID  L+ +  YQ
  S:    40 VLFFYPLDFTFVCPTEITAFSDRYSDFSSKNTEVLGVSVDSKFTHLAWIQTPRNEGGIGDINYPLVSDLKREICQSYNVLNEDGEADRGLFIINPSGIIMHSTINKAPVGRNIDETLRVLQAYQ 163
>gi|440308|gb|AAA50465.1| enhancer protein (198 aa)
Score = 159, Expect = 9.8e-10, Identities = 33/124 (26%), Positives = 65/124 (52%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + + ++F  LG   + +SVDS+  H   +   + +  +  +++  + D+++ +S DY VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFNHLAWINTPRKEGGLGPLNIPLLGDVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQ 163
>gi|21674312|ref|NP_662377.1| thiolredoxin peroxidase [Chlorobium tepidum TLS] >gi|21647485|gb|AAM72719.1| thiolredoxin peroxidase [Chlorobium tepidum TLS] (195 aa)
Score = 159, Expect = 9.8e-10, Identities = 45/160 (28%), Positives = 80/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEG-YSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR   +F + A    +  + +  L+   GK   +LFF   DF     +E+    +K   F    V  +  SVDS+ +H   +   + K  I  ++   +SDI+K I++DY VL  +G  +L     IDK+GI+++     + + R+ID +L+ +   Q
  S:     3 VLVGRPAPDFNAAAVVNGSTFVDSCQLSAYRGKY-VVLFFYPLDFTFVCPTELHAFQEKLDEFKKRNVEVLGCSVDSKFSHFAWLNTPRSKGGIQGVTYPLISDINKTIAKDYDVLTPDGSVALRGLFLIDKEGIVRHQVVNDLGIGRNIDEVLRIVDALQ 162
>gi|118084001|ref|XP_416800.2| PREDICTED: similar to MGC82793 protein isoform 2 [Gallus gallus] (265 aa)
Score = 159, Expect = 1.0e-09, Identities = 34/124 (27%), Positives = 63/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  +    +  SVDS+ TH   +   + +  +  M +  +SD++ +IS+DY V  E +G++L     ID K I++  +   + V R +D  L+ +  +Q
  S:   106 VFFFYPLDFTFVCPTEIIAFSDRIEEFRAINTEVVACSVDSKFTHLAWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVYLEDQGHALRGLFIIDDKRILRQITMNDLPVGRSVDETLRLVQAFQ 230
>gi|118084003|ref|XP_001234000.1| PREDICTED: similar to MGC82793 protein isoform 1 [Gallus gallus] (265 aa)
Score = 159, Expect = 1.0e-09, Identities = 34/124 (27%), Positives = 63/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  +    +  SVDS+ TH   +   + +  +  M +  +SD++ +IS+DY V  E +G++L     ID K I++  +   + V R +D  L+ +  +Q
  S:   106 VFFFYPLDFTFVCPTEIIAFSDRIEEFRAINTEVVACSVDSKFTHLAWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVYLEDQGHALRGLFIIDDKRILRQITMNDLPVGRSVDETLRLVQAFQ 230
>gi|119627382|gb|EAX06977.1| peroxiredoxin 1, isoform CRA_b [Homo sapiens] (188 aa)
Score = 158, Expect = 1.0e-09, Identities = 39/124 (31%), Positives = 60/124 (48%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  L    I  SVDS   H   V   K +  +  M++  VSD  + I++DY VL  +EG S      ID KGI++  +   + V R +D  L+ +  +Q
  S:    40 VFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQ 164
>gi|167460213|gb|ABZ80828.1| peroxiredoxin [Penaeus monodon] (245 aa)
Score = 158, Expect = 1.0e-09, Identities = 33/124 (26%), Positives = 60/124 (48%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EI+  N + + F  +    +  S+DS  TH       +    +  + +  +SDI+ +IS+DY V  E +G +L     ID KG+++  +   + V R +D  L+ +  +Q
  S:    85 VFFFYPLDFTFVCPTEILAFNDRVEEFRKMNTEVVACSIDSHFTHLAWTNTPRKDGGLGKLKIPLLSDITHKISQDYGVYLEDQGIALRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQ 209
>gi|119471587|ref|ZP_01614001.1| peroxiredoxin 2 [Alteromonadales bacterium TW-7] >gi|119445530|gb|EAW26816.1| peroxiredoxin 2 [Alteromonadales bacterium TW-7] (201 aa)
Score = 158, Expect = 1.1e-09, Identities = 38/156 (24%), Positives = 78/156 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  + + +Y+L + +     ++FF   DF     SE+I  +++ + F   GV  I +S+DS+ +H            I  +    V+D+  EI + Y V   E G +   +  ID++G +++     + + R+ID +++ +
  S:     3 VLVGRQAPDFTAAAVLGNGEIVDSYNLHETIKGKKAVIFFYPLDFTFVCPSELIAFDKRFEEFKKRGVEVIGVSIDSQFSHNAWRNTPVADGGIGKVQYALVADVKHEICKAYDVEHPEAGVAFRGSFLIDEEGNVRHQVVNDLPLGRNIDEMIRMV 159
>gi|119509654|ref|ZP_01628800.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Malallergen [Nodularia spumigena CCY9414] >gi|119465673|gb|EAW46564.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Malallergen [Nodularia spumigena CCY9414] (203 aa)
Score = 158, Expect = 1.1e-09, Identities = 38/124 (30%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + +++ F  +    + +SVDSE +H   ++  +    + +++   VSDI KEIS  Y VL    G +L     IDK GII++ +  ++   R +D  L+T+   Q
  S:    44 VLFFYPLDFTFVCPTEITAFSDRYEEFKKVNTEVLGVSVDSEFSHLAWIQTERKSGGVGDLNYPLVSDIKKEISATYNVLDPAAGIALRGLFIIDKDGIIQHSTVNNLAFGRSVDETLRTLQALQ 168
>gi|59712582|ref|YP_205358.1| alkyl hydroperoxide reductase, C22 subunit [Vibrio fischeri ES114] >gi|59480683|gb|AAW86470.1| alkyl hydroperoxide reductase, C22 subunit [Vibrio fischeri ES114] (202 aa)
Score = 158, Expect = 1.1e-09, Identities = 38/156 (24%), Positives = 76/156 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  + + N++  +       ++FF   DF     SE+I  + + ++F   GV  I +S+DS+ +H        +   I  +    V+D+  EI + Y V   E G +   +  ID  G++++     + + R+ID +L+ +
  S:     2 VLVGRQAPDFTAAAVLGNGEIVDNFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRLEDFQAKGVEVIGVSIDSQFSHNAWRNTAIEDGGIGQVKYPLVADVKHEICKAYDVEHPEAGVAFRGSFLIDADGLVRHQVVNDLPLGRNIDEMLRMV 158
>gi|118482812|gb|ABK93322.1| unknown [Populus trichocarpa] (263 aa)
Score = 158, Expect = 1.2e-09, Identities = 35/134 (26%), Positives = 71/134 (52%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L++ +G    +LFF   DF     +EI   + +++ F  +    + +SVDS  +H   V+  +    + ++    +SD++K IS+ Y VL  ++G +L     IDK+G+I++ +  ++ + R +D   +T+   Q
  S:    94 LSEYIGNKYVVLFFYPLDFTFVCPTEITAFSDRYEEFKQINTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSYGVLIPDQGVALRGLFIIDKEGVIQHSTINNLAIGRSVDETKRTLQALQ 228
>gi|170048401|ref|XP_001852614.1| peroxiredoxin-2 [Culex quinquefasciatus] >gi|167870535|gb|EDS33918.1| peroxiredoxin-2 [Culex quinquefasciatus] (232 aa)
Score = 158, Expect = 1.2e-09, Identities = 37/124 (29%), Positives = 62/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + + ++F  L    + +SVDS  +H       +    +  +    ++D++K+IS DY VL EE G SL     ID  G+++  +   + V R +D  L+ I  +Q
  S:    71 VLFFYPLDFTFVCPTEIIAFSDRIKDFHALNAEVVGVSVDSHFSHLAWCNTPRKSGGLGKLEYPLLADLTKKISADYGVLLEEAGISLRGLFIIDPNGVVRQVTINDLPVGRSVDETLRLIKAFQ 195
>gi|153834645|ref|ZP_01987312.1| antioxidant, AhpC/Tsa family [Vibrio harveyi HY01] >gi|156973352|ref|YP_001444259.1| hypothetical protein VIBHAR_01039 [Vibrio harveyi ATCC BAA-1116] >gi|148868957|gb|EDL68011.1| antioxidant, AhpC/Tsa family [Vibrio harveyi HY01] >gi|156524946|gb|ABU70032.1| hypothetical protein VIBHAR_01039 [Vibrio harveyi ATCC BAA-1116] (202 aa)
Score = 158, Expect = 1.2e-09, Identities = 38/156 (24%), Positives = 76/156 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  + + N++  +       ++FF   DF     SE+I  + +  +F   GV  I +S+DS+ +H        +   I  +    V+D+  EI + Y V   E G +   +  ID+ G++++     + + R+ID +L+ +
  S:     2 VLVGRQAPDFTAAAVLGNGEIVENFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRLADFQAKGVEVIGVSIDSQFSHNAWRNTAIEDGGIGQVKYPLVADVKHEICKAYDVEHPEAGVAFRGSFLIDEDGLVRHQVVNDLPLGRNIDEMLRMV 158
>gi|158319348|ref|YP_001511855.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Alkaliphilus oremlandii OhILAs] >gi|158139547|gb|ABW17859.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Alkaliphilus oremlandii OhILAs] (179 aa)
Score = 158, Expect = 1.2e-09, Identities = 34/124 (27%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ++FF   DF     +EI  ++++   F  L    + +S DSE +H+  +   +DK  +  ++    SD ++ ++RDY +L  EEG +L     ID +G+++Y     + V R +D  L+ +   Q
  S:    39 VMFFYPLDFTFVCPTEITAISKRVAEFNKLNAEILGVSTDSEHSHKAWINAAQDKGGLGQITFPLASDRTQSVARDYGILIEEEGIALRGLFIIDPEGVLRYSVVHDLNVGRSVDETLRVLQGLQ 163
>gi|23394396|gb|AAN31487.1| thioredoxin peroxidase [Phytophthora infestans] (208 aa)
Score = 158, Expect = 1.2e-09, Identities = 34/124 (27%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF----EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + +   F  L    I  S+DS+ TH   +   + K  + +M++  V+D+ K++   Y VL     +EG +      IDK+G+++  +   + + R++D +L+ I  +Q
  S:    36 VLFFYPMDFTFVCPTEICAFSDRADEFKKLNTQVIGCSIDSKFTHLAWINTPRKKGGLGDMNIPLVADVKKDLCSKYEVLVSEGDDEGVAFRGLFIIDKEGVLRQITINDLPIGRNVDEVLRLIEAFQ 163
>gi|88798850|ref|ZP_01114432.1| Peroxiredoxin [Reinekea sp. MED297] >gi|88778330|gb|EAR09523.1| Peroxiredoxin [Reinekea sp. MED297] (207 aa)
Score = 158, Expect = 1.2e-09, Identities = 41/160 (25%), Positives = 74/160 (46%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLV-------LFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GRK  +F + A  G    +  ++    +     L+FF   DF     SE+I L+ +      LGV  I +SVDS  TH        +K  I  +    V D++ +I + + V        +  G +  ++  IDK G+++        + R+ID +++ +   Q
  S:     3 VLLGRKAPDFTAPAVLGDGQIVDEFNFADTIKDKYALVFFYPLDFTFVCRSELIALDHRVDRLKELGVEVIAVSVDSHFTHNAWRNTAVNKGGIGEVKYTMVGDMNHDICKAFGVESIGGDSYYPAGVAFRASFVIDKSGVVRAQHMNDEPIGRNIDELVRVVEALQ 169
>gi|125979671|ref|XP_001353868.1| GA11781-PA [Drosophila pseudoobscura] >gi|54640852|gb|EAL29603.1| GA11781-PA [Drosophila pseudoobscura] (243 aa)
Score = 158, Expect = 1.2e-09, Identities = 37/139 (26%), Positives = 71/139 (51%)
  Q:    22 ILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           I+   L++ +GK   LLF+   DF     +EII  + +   F  +    I  SVDS  TH   +   + +  + ++ +  +SD++ +IS+DY V  E  G++L     ID+ G+++  +   + V R +D  ++ +  +Q
  S:    70 IVKLSLSQYLGKYVVLLFY-PLDFTFVCPTEIIAFSDRISEFRKIKTEVIAASVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQAGVLRQITMNDLPVGRSVDETIRLVQAFQ 208
>gi|885932|gb|AAA69475.1| peroxidase (198 aa)
Score = 158, Expect = 1.3e-09, Identities = 34/124 (27%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  +   ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D++K +S++Y VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLAPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQ 163
>gi|46576851|sp|Q9NL98|PRDX_ASCSU Peroxiredoxin (AsPrx) (Thioredoxin peroxidase) >gi|6855466|dbj|BAA90476.1| thioredoxin peroxidase [Ascaris suum] (195 aa)
Score = 158, Expect = 1.3e-09, Identities = 37/124 (29%), Positives = 62/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  ++    F  LGV  +  S DS+ +H   +   + +  +  M +  +SD + +ISRDY VL E +G +      ID KGI++  +   + V R +   L+ +  +Q
  S:    37 VLFFYPMDFTFVCPTEIIAFSEHVGEFKKLGVEVLAASTDSQFSHLAWINTPRKQGGLGEMKIPIISDNNHQISRDYGVLKEDDGIAYRGLFIIDPKGILRQITVNDLPVGRSVTETLRLVQAFQ 161
>gi|87124628|ref|ZP_01080476.1| thioredoxin peroxidase [Synechococcus sp. RS9917] >gi|86167507|gb|EAQ68766.1| thioredoxin peroxidase [Synechococcus sp. RS9917] (200 aa)
Score = 158, Expect = 1.3e-09, Identities = 34/124 (27%), Positives = 69/124 (55%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + ++ +F +     + +SVDS+ +H   ++  +++  + +++   V+D+ KEI+  Y VL  EEG +L     ID +G+I + +  ++ V R++D  L+ +  +Q
  S:    40 VLFFYPLDFTFVCPTEITAFSDRYADFSSKNTEVLGVSVDSQFSHLAWIQTPRNQGGLGDIAYPLVADLKKEIASAYNVLDEEEGVALRGLFIIDPEGVIMHATINNLPVGRNVDETLRVLQAFQ 164
>gi|5457310|emb|CAB48391.1| peroxiredoxin [Globodera rostochiensis] (199 aa)
Score = 158, Expect = 1.3e-09, Identities = 46/149 (30%), Positives = 76/149 (51%)
  Q:    12 SKAYSGK------TDSILNYD-----LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           SKA+ GK       D+++N D     L    GK   +LFF   DF     +EII  + +   F  +    I  S DS+ +H + +   +    +  M +  ++D + +ISRDY VL EE G +      ID KGI++  +   + V R +D  L+ +  ++
  S:     5 SKAFIGKPAPKFSADAVVNGDFKTISLDDYKGKY-VVLFFYPLDFTFVCPTEIIAFSDRADEFKKIDTQLIACSTDSKFSHLEWINKPRKHGGLGEMKIPVLADTNHKISRDYGVLMEEAGIAFRGLFIIDDKGILRQITINDLPVGRSVDETLRLVQAFK 164
>gi|195337004|ref|XP_002035123.1| GM14524 [Drosophila sechellia] >gi|194128216|gb|EDW50259.1| GM14524 [Drosophila sechellia] (242 aa)
Score = 157, Expect = 1.3e-09, Identities = 37/139 (26%), Positives = 72/139 (51%)
  Q:    22 ILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           I+   L++ +GK   LLF+   DF     +EII  + +   F  +    I +SVDS  TH   +   + +  + ++ +  +SD++ +IS+DY V  E  G++L     ID+ G+++  +   + V R +D  ++ +  +Q
  S:    69 IVKLSLSQYLGKYVVLLFY-PLDFTFVCPTEIIAFSDRIAEFKKIKTEVIGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQ 207
>gi|163728670|ref|ZP_02136153.1| alkyl hydroperoxide reductase C22 protein [Vibrio fischeri MJ11] >gi|161398149|gb|EDQ22435.1| alkyl hydroperoxide reductase C22 protein [Vibrio fischeri MJ11] (202 aa)
Score = 157, Expect = 1.3e-09, Identities = 38/156 (24%), Positives = 76/156 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  + + N++  +       ++FF   DF     SE+I  + + ++F   GV  I +S+DS+ +H        +   I  +    V+D+  EI + Y V   E G +   +  ID  G++++     + + R+ID +L+ +
  S:     2 VLVGRQAPDFTAAAVLGNGEIVDNFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRLEDFQAKGVEVIGVSIDSQFSHNAWRNTAIEDGGIGQVKYPLVADVKHEICKAYDVDHPEAGVAFRGSFLIDADGLVRHQVVNDLPLGRNIDEMLRMV 158
>gi|113474135|ref|YP_720196.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Trichodesmium erythraeum IMS101] >gi|110165183|gb|ABG49723.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Trichodesmium erythraeum IMS101] (199 aa)
Score = 157, Expect = 1.4e-09, Identities = 38/124 (30%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + +++ F  L    + +SVDSE +H   ++  +    I +++   +SDI KEIS  Y VL  E G +L     ID++GII++ +  +    R++D  ++T+   Q
  S:    39 VLFFYPLDFTFVCPTEITAFSDRYKEFELLNTEILGVSVDSEFSHLAWIQTDRKSGGIGDLNYPLLSDIKKEISTAYNVLDLEAGIALRGLFIIDREGIIQHATVNNFAFGRNVDEAIRTLQAIQ 163
>gi|78188676|ref|YP_379014.1| thiolredoxin peroxidase [Chlorobium chlorochromatii CaD3] >gi|78170875|gb|ABB27971.1| thiolredoxin peroxidase [Chlorobium chlorochromatii CaD3] (196 aa)
Score = 157, Expect = 1.4e-09, Identities = 43/160 (26%), Positives = 81/160 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GRK   F   A    +  + +  L+   GK   +LFF   DF     +E+    +K + F    V  +  S+DS+ +H   ++  + +  I  ++   +SDI+K ++ DY VL E EG +L     ID+ G++++    ++ + R++D +L+ I   Q
  S:     3 VLVGRKAPEFDVAAVVNGSQFVDSCKLSDFKGKY-VVLFFYPLDFTFVCPTELHAFQEKIEEFKKRNVEVLGCSIDSKFSHFAWLRTPRSQGGIEGVTYTLLSDINKTVAADYDVLLEDEGVALRGLFLIDRDGVVQHQVINNLSLGRNVDEVLRLIDALQ 162
>gi|54307930|ref|YP_128950.1| Ahp/CTSA family anti-oxidant protein [Photobacterium profundum SS9] >gi|46912356|emb|CAG19148.1| putative antioxidant, AhpC/Tsa family [Photobacterium profundum SS9] (205 aa)
Score = 157, Expect = 1.4e-09, Identities = 37/156 (23%), Positives = 78/156 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  + + +++  +       ++FF   DF     SE+I  +++ ++F   GV  I +S+DS+ +H        +   I  +    ++DI  EI + Y V   E G +   +  ID+ G++++     + + R+ID +L+ +
  S:     7 VLVGRQAPDFTAAAVLGNGEIVDSFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDKRFEDFQAKGVEVIGVSIDSQFSHNAWRNTAIEDGGIGQVKYPLIADIKHEICKAYDVEHPEAGVAFRGSFLIDEDGLVRHQVVNDLPLGRNIDEMLRMV 163
>gi|195450397|ref|XP_002072479.1| GK20591 [Drosophila willistoni] >gi|194168564|gb|EDW83465.1| GK20591 [Drosophila willistoni] (196 aa)
Score = 157, Expect = 1.4e-09, Identities = 39/134 (29%), Positives = 70/134 (52%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           LT+  G+   LLF+   DF     +E+   + + Q F N+G + I  S DS   H   ++  + +  +  M +  ++D S +IS+DY VL E  G ++     ID++G+I+  +   V V R++D  L+ +  +Q
  S:    28 LTEFRGRYVVLLFY-PADFSFVCPTELHAFSDRAQEFRNVGCDIIACSTDSHYVHCAWMQQSRKQGGLGEMDIPLLADKSMKISKDYGVLDELTGLAMRGLFIIDREGMIRQITINDVGVGRNVDEALRLVQAFQ 161
>gi|17864676|ref|NP_525002.1| thioredoxin peroxidase 2 CG1274-PA, isoform A [Drosophila melanogaster] >gi|24656348|ref|NP_728793.1| thioredoxin peroxidase 2 CG1274-PB, isoform B [Drosophila melanogaster] >gi|195587334|ref|XP_002083420.1| GD13721 [Drosophila simulans] >gi|7230428|gb|AAF42986.1|AF167099_1 thioredoxin peroxidase 2 [Drosophila melanogaster] >gi|12744787|gb|AAK06769.1|AF321614_1 secretable thioredoxin peroxidase [Drosophila melanogaster] >gi|7292296|gb|AAF47704.1| CG1274-PA, isoform A [Drosophila melanogaster] >gi|16768228|gb|AAL28333.1| GH25379p [Drosophila melanogaster] >gi|23095360|gb|AAN12225.1| CG1274-PB, isoform B [Drosophila melanogaster] >gi|194195429|gb|EDX09005.1| GD13721 [Drosophila simulans] (242 aa)
Score = 157, Expect = 1.4e-09, Identities = 37/139 (26%), Positives = 72/139 (51%)
  Q:    22 ILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           I+   L++ +GK   LLF+   DF     +EII  + +   F  +    I +SVDS  TH   +   + +  + ++ +  +SD++ +IS+DY V  E  G++L     ID+ G+++  +   + V R +D  ++ +  +Q
  S:    69 IVKLSLSQYLGKYVVLLFY-PLDFTFVCPTEIIAFSDRIAEFKKIKTEVIGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQ 207
>gi|84996017|ref|XP_952730.1| peroxiredoxin 1, putative [Theileria annulata] >gi|65303727|emb|CAI76104.1| peroxiredoxin 1, putative [Theileria annulata] (198 aa)
Score = 157, Expect = 1.5e-09, Identities = 36/130 (27%), Positives = 65/130 (50%)
  Q:    31 MGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +GK   +LFF   DF     +EI+  N     F    V  +  SVDS+  H       +DK  +  +    +SD++KE++  Y VL ++ G +L     IDKKG++++    ++ + R ++ +L+ +   Q
  S:    32 LGKKYVVLFFYPLDFTFVCPTEIVAFNDAVAQFEQRNVQLLACSVDSKYCHLAWRNTPRDKAGVGQVKFPMLSDMTKEVATSYGVLVDDAGLALRGLFLIDKKGVLQHSLVNNLPLGRSVNEVLRLVDALQ 162
>gi|163802450|ref|ZP_02196343.1| antioxidant, AhpC/Tsa family protein [Vibrio campbellii AND4] >gi|159173751|gb|EDP58566.1| antioxidant, AhpC/Tsa family protein [Vibrio campbellii AND4] (202 aa)
Score = 157, Expect = 1.5e-09, Identities = 38/156 (24%), Positives = 76/156 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  + + N++  +       ++FF   DF     SE+I  + +  +F   GV  I +S+DS+ +H        +   I  +    V+D+  EI + Y V   E G +   +  ID+ G++++     + + R+ID +L+ +
  S:     2 VLVGRQAPDFTAAAVLGNGEIVDNFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRLADFQAKGVEVIGVSIDSQFSHNAWRNTAIEDGGIGQVKYPLVADVKHEICKAYDVEHPEAGVAFRGSFLIDEDGLVRHQVVNDLPLGRNIDEMLRMV 158
>gi|91205530|ref|YP_537885.1| thioredoxin peroxidase 1 [Rickettsia bellii RML369-C] >gi|91069074|gb|ABE04796.1| Thioredoxin peroxidase 1 [Rickettsia bellii RML369-C] (210 aa)
Score = 157, Expect = 1.6e-09, Identities = 43/156 (27%), Positives = 70/156 (44%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           + +G+   +F + A     +    + L++    +  +LFF   DF     SEII  + K   F       + +SVDS  +H         K  +  +    VSD+ KEIS  Y VL + G SL  T  ID+  ++++     + + RDI+  LK I
  S:    13 VFVGKTAPDFTATAIMPNNNVEGEFTLSRYAKGHKIILFFYPLDFTFVCPSEIIAFHNKLGEFTERNTKVVSVSVDSHFSHLAWKNTPHSKGGLGQVQFPMVSDLKKEISSMYNVLNDGGISLRGTFLIDEDFVVRHMLVNDLPIGRDINYTLKVI 168
>gi|55824562|gb|AAV66401.1| peroxiredoxin 1 [Macaca fascicularis] (188 aa)
Score = 157, Expect = 1.7e-09, Identities = 38/124 (30%), Positives = 60/124 (48%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  L    I  SVDS   H   +   K +  +  M++  VSD  + I++DY VL  +EG S      ID KGI++  +   + V R +D  L+ +  +Q
  S:    35 VFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQ 159
>gi|68171710|ref|ZP_00545066.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ehrlichia chaffeensis str. Sapulpa] >gi|88658172|ref|YP_507536.1| anti-oxidant AhpCTSA family protein [Ehrlichia chaffeensis str. Arkansas] >gi|67998866|gb|EAM85562.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ehrlichia chaffeensis str. Sapulpa] >gi|88599629|gb|ABD45098.1| antioxidant, AhpC/Tsa family [Ehrlichia chaffeensis str. Arkansas] (205 aa)
Score = 157, Expect = 1.7e-09, Identities = 45/155 (29%), Positives = 75/155 (48%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           LI ++ I+F +KA     D I  ++L + +     +L F  +DF     +EII L+ +   F+      I IS DSE  H        +K  I+ +S   ++D S  IS  Y VL     +L +T  ID   I+++ S   + + R++D +L+ I
  S:     3 LITKQAIDFTAKAVM-PDDKICEFNLKEYVSGKYAILIFYPRDFTFVCPTEIISLHNRIPQFIEKNTEIIGISTDSEFCHSHWRNISINKGGIDKISFPLIADDSHFISNSYGVLHNNSIALRATFVIDDNFIVRHQSINDLPIGRNVDELLRII 156
>gi|4505591|ref|NP_002565.1| peroxiredoxin 1 [Homo sapiens] >gi|32455264|ref|NP_859047.1| peroxiredoxin 1 [Homo sapiens] >gi|32455266|ref|NP_859048.1| peroxiredoxin 1 [Homo sapiens] >gi|55586231|ref|XP_513123.1| PREDICTED: peroxiredoxin 1 isoform 6 [Pan troglodytes] >gi|114556242|ref|XP_001156454.1| PREDICTED: peroxiredoxin 1 isoform 2 [Pan troglodytes] >gi|114556244|ref|XP_001156515.1| PREDICTED: peroxiredoxin 1 isoform 3 [Pan troglodytes] >gi|114556246|ref|XP_001156568.1| PREDICTED: peroxiredoxin 1 isoform 4 [Pan troglodytes] >gi|114556248|ref|XP_001156623.1| PREDICTED: peroxiredoxin 1 isoform 5 [Pan troglodytes] >gi|548453|sp|Q06830|PRDX1_HUMAN Peroxiredoxin-1 (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Proliferation-associated gene protein) (PAG) (Natural killer cell-enhancing factor A) (NKEF-A) >gi|287641|emb|CAA48137.1| proliferation associated gene (pag) [Homo sapiens] >gi|13937907|gb|AAH07063.1| Peroxiredoxin 1 [Homo sapiens] >gi|18204954|gb|AAH21683.1| Peroxiredoxin 1 [Homo sapiens] >gi|47115241|emb|CAG28580.1| PRDX1 [Homo sapiens] >gi|54696346|gb|AAV38545.1| peroxiredoxin 1 [Homo sapiens] >gi|55959886|emb|CAI13095.1| peroxiredoxin 1 [Homo sapiens] >gi|61357509|gb|AAX41397.1| peroxiredoxin 1 [synthetic construct] >gi|82583658|gb|ABB84465.1| peroxiredoxin 1 [Homo sapiens] >gi|119627380|gb|EAX06975.1| peroxiredoxin 1, isoform CRA_a [Homo sapiens] >gi|119627381|gb|EAX06976.1| peroxiredoxin 1, isoform CRA_a [Homo sapiens] >gi|119627383|gb|EAX06978.1| peroxiredoxin 1, isoform CRA_a [Homo sapiens] >gi|119627384|gb|EAX06979.1| peroxiredoxin 1, isoform CRA_a [Homo sapiens] >gi|119627385|gb|EAX06980.1| peroxiredoxin 1, isoform CRA_a [Homo sapiens] >gi|119627386|gb|EAX06981.1| peroxiredoxin 1, isoform CRA_a [Homo sapiens] >gi|119627387|gb|EAX06982.1| peroxiredoxin 1, isoform CRA_a [Homo sapiens] >gi|123992995|gb|ABM84099.1| peroxiredoxin 1 [synthetic construct] >gi|123999925|gb|ABM87471.1| peroxiredoxin 1 [synthetic construct] (199 aa)
Score = 157, Expect = 1.7e-09, Identities = 39/124 (31%), Positives = 60/124 (48%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  L    I  SVDS   H   V   K +  +  M++  VSD  + I++DY VL  +EG S      ID KGI++  +   + V R +D  L+ +  +Q
  S:    40 VFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQ 164
>gi|50897523|gb|AAT85824.1| putative thioredoxin peroxidase 1 [Glossina morsitans morsitans] (194 aa)
Score = 156, Expect = 1.7e-09, Identities = 40/134 (29%), Positives = 65/134 (48%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           LT   GK   +LFF   DF     +EI+  + +   F N+G   I  S DS+ TH   V   + +  +  + +  ++D S +I+R+Y VL EE G        IDK  I++  +   + V R +D  L+ +  +Q
  S:    26 LTDYRGKY-VVLFFYPLDFTFVCPTEIVAFSDRADEFRNIGCEVIACSTDSQYTHLAWVNTPRRQGGLGELDIPLLADKSMKIAREYGVLNEETGIPFRGLFIIDKNQILRQITINDLPVGRSVDETLRLVQAFQ 159
>gi|71906203|ref|YP_283790.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dechloromonas aromatica RCB] >gi|71845824|gb|AAZ45320.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dechloromonas aromatica RCB] (221 aa)
Score = 156, Expect = 1.7e-09, Identities = 46/160 (28%), Positives = 76/160 (47%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+G++  +F + A  G  + I    L+   GK   +LFF   DF     SE+I  + + + F   GV  I +S+DS+ TH         +  I  +    V+D+  EI R Y V  E  G +L  +  IDK G + +     + + R+ID +L+ +   Q
  S:    25 VLVGKQAPDFTATAVYGNNE-IKELKLSSFKGKP-VVLFFYPLDFTFVCPSELIAFDHRLEEFKQRGVEVIGVSIDSQFTHLAWKNTAVKEGGIGPVGYPLVADVKHEICRAYDVELEAAGVALRGSFLIDKNGTVMHQVVNMLPLGRNIDEMLRMVDALQ 183
>gi|158335840|ref|YP_001517014.1| 2-cys peroxiredoxin, putative [Acaryochloris marina MBIC11017] >gi|158306081|gb|ABW27698.1| 2-cys peroxiredoxin, putative [Acaryochloris marina MBIC11017] (202 aa)
Score = 156, Expect = 1.7e-09, Identities = 37/124 (29%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ++FF   DF     +EI   + ++  F +L    + ISVDSE +H    +  +    + +++   VSDI KEIS  Y VL  + G +L     IDK+G++++ +  ++   R++D  L+T+   Q
  S:    43 VIFFYPLDFTFVCPTEITAFSDRYDAFKDLNTEVLGISVDSEFSHLAWTQTDRKSGGVGDLNYPLVSDIKKEISTAYNVLDPDAGVALRGLFIIDKEGVVQHATINNLAFGRNVDETLRTLQAIQ 167
>gi|123437746|ref|XP_001309666.1| tryparedoxin peroxidase, putative [Trichomonas vaginalis G3] >gi|121891402|gb|EAX96736.1| tryparedoxin peroxidase, putative [Trichomonas vaginalis G3] (194 aa)
Score = 156, Expect = 1.7e-09, Identities = 43/160 (26%), Positives = 79/160 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTK----NMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDY-LVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           ML+G++  +F       + + +LN D  K    +      +LF    DF     +EIIE + K + F  LG   + +SVDS  TH       + +  +  +    +SD++  +S  Y   +  EG++L  T+ ID +GI+++      +V R++  I++ +  YQ
  S:     1 MLVGQQAPDF-------ELEGVLNGDFKKYKLADYKGKWLVLFSYPLDFTFVCPTEIIEFSNKLEEFKKLGAEVLGLSVDSVFTHLAWQNTPRKEGGLGEIHYPLLSDLTHAVSEAYGFYMKSEGHTLRGTVIIDPEGIVRHVQMNHPDVGRNVTEIIRLVKAYQ 158
>gi|196008113|ref|XP_002113922.1| hypothetical protein TRIADDRAFT_27372 [Trichoplax adhaerens] >gi|190582941|gb|EDV23012.1| hypothetical protein TRIADDRAFT_27372 [Trichoplax adhaerens] (195 aa)
Score = 156, Expect = 1.8e-09, Identities = 42/152 (27%), Positives = 79/152 (51%)
  Q:     9 NFFSKAY-SGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           NF +KA   GK   I    L+  +GK   +LFF   DF     +EII  +++ ++F +     I  S D+E +H   +   + +  + +M++  ++D +  +++DY VL E +G +L     ID KGI++  +   + V R +D  ++ +  +Q
  S:    12 NFAAKAVVDGKFKDI---KLSDYLGKY-LVLFFYPMDFTFVCPTEIIAFSERVEDFRSRNCEVIACSTDTEFSHLAWINQPRKEGGLGSMNIPILADPTHTLAKDYGVLLEDQGIALRGLFIIDGKGILRQITVNDLPVGRSVDETIRLVEAFQ 161
>gi|149191579|ref|ZP_01869825.1| antioxidant, AhpC/Tsa family protein [Vibrio shilonii AK1] >gi|148834597|gb|EDL51588.1| antioxidant, AhpC/Tsa family protein [Vibrio shilonii AK1] (202 aa)
Score = 156, Expect = 1.8e-09, Identities = 38/156 (24%), Positives = 75/156 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  D + N++  +       ++FF   DF     SE+I  + +  +F   G   I +S+DS+ +H        +   I  +    V+D+  EI + Y V   E G +   +  ID+ G++++     + + R+ID +L+ +
  S:     2 VLVGRQAPDFTAAAVLGNGDIVENFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRLADFQAKGCEVIGVSIDSQFSHNAWRNTAIEDGGIGQVKYPLVADVKHEICQAYDVEHPEAGVAFRGSFLIDEDGLVRHQVVNDLPLGRNIDEMLRMV 158
>gi|67083289|gb|AAY66580.1| thioredoxin peroxidase [Ixodes scapularis] (251 aa)
Score = 156, Expect = 1.9e-09, Identities = 36/124 (29%), Positives = 62/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  L    I  SVDS  TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G+SL     ID KG ++  +   + V R +D  L+ +  +Q
  S:    90 VFFFYPLDFTFVCPTEIIAFSDRVKEFKALNAEVIACSVDSPFTHLAWINTPRKQGGLGPIKIPLLSDLTHQISKDYGVYLEDLGHSLRGLFIIDDKGKLRQITMNDLPVGRSVDETLRLVQAFQ 214
>gi|51209959|ref|YP_063623.1| thiol-specific antioxidant protein [Gracilaria tenuistipitata var. liui] >gi|50657713|gb|AAT79698.1| thiol-specific antioxidant protein [Gracilaria tenuistipitata var. liui] (226 aa)
Score = 156, Expect = 1.9e-09, Identities = 41/134 (30%), Positives = 72/134 (53%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+  +GK   LLF+   DF     +EI   +  ++   +L    + ISVDSE +H   ++  +D   + +++   VSD++K+IS  Y VL EEG +L     +D++GII+Y    +++  R I   ++T+   Q
  S:    59 LSDYLGKYVILLFY-PLDFTFVCPTEITAFSDSYKEIQSLNTEVLGISVDSEYSHLAWLQMERDIGGLGDLNYPLVSDLTKQISASYNVLTEEGKALRGLFIVDQQGIIQYSLVNNLDFGRSISETIRTLKAIQ 191
>gi|157827246|ref|YP_001496310.1| thioredoxin peroxidase 1 [Rickettsia bellii OSU 85-389] >gi|157802550|gb|ABV79273.1| Thioredoxin peroxidase 1 [Rickettsia bellii OSU 85-389] (210 aa)
Score = 156, Expect = 1.9e-09, Identities = 43/156 (27%), Positives = 70/156 (44%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           + +G+   +F + A     +    + L++    +  +LFF   DF     SEII  + K   F       + +SVDS  +H         K  +  +    VSD+ KEIS  Y VL + G SL  T  ID+  ++++     + + RDI+  LK I
  S:    13 VFVGKTAPDFTATAIMPNNNVEGEFTLSRYAKGHKIILFFYPLDFTFVCPSEIIAFHNKLGEFTERNTKVVSVSVDSHFSHLAWKNTPHSKGGLGQVQFPMVSDLKKEISSMYNVLNDGGISLRGTFLIDEDFVVRHMLVNDLPIGRDINYTLKII 168
>gi|194540307|ref|YP_002075348.1| antioxidant, AhpC/TSA family [Vibrio sp. Ex25] >gi|151938862|gb|EDN57696.1| antioxidant, AhpC/TSA family [Vibrio sp. Ex25] (260 aa)
Score = 156, Expect = 1.9e-09, Identities = 38/156 (24%), Positives = 77/156 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  + + N++  +       ++FF   DF     SE+I  + +  +F   GV  I +S+DS+ +H        +   I  +    V+D+  EI + Y V   E G +   +  ID++G++++     + + R+ID +L+ +
  S:    59 VLVGRQAPDFTAAAVLGNGEIVENFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRLADFQAKGVEVIGVSIDSQFSHNAWRNTAIEDGGIGQVKYPLVADVKHEICKAYDVEHPEAGVAFRGSFLIDEEGVVRHQVVNDLPLGRNIDEMLRMV 215
>gi|148239454|ref|YP_001224841.1| AhpC/TSA family peroxiredoxin [Synechococcus sp. WH 7803] >gi|147847993|emb|CAK23544.1| Peroxiredoxin, AhpC/TSA family [Synechococcus sp. WH 7803] (200 aa)
Score = 156, Expect = 2.0e-09, Identities = 34/124 (27%), Positives = 69/124 (55%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + ++ +F +     + +SVDS+ +H   ++  +++  + +++   V+D+ KEI+  Y VL  EEG +L     ID +G+I + +  ++ V R++D  L+ +  +Q
  S:    40 VLFFYPLDFTFVCPTEITAFSDRYADFSSKNTEVLGVSVDSQFSHLAWIQTPRNQGGLGDINYPLVADLKKEIASAYNVLDDEEGVALRGLFIIDPEGVIMHATINNLPVGRNVDETLRVLQAFQ 164
>gi|189053217|dbj|BAG34839.1| unnamed protein product [Homo sapiens] (199 aa)
Score = 156, Expect = 2.0e-09, Identities = 39/124 (31%), Positives = 60/124 (48%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  L    I  SVDS   H   V   K +  +  M++  VSD  + I++DY VL  +EG S      ID KGI++  +   + V R +D  L+ +  +Q
  S:    40 VFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQ 164
>gi|170051146|ref|XP_001861632.1| peroxiredoxin-4 [Culex quinquefasciatus] >gi|167872509|gb|EDS35892.1| peroxiredoxin-4 [Culex quinquefasciatus] (252 aa)
Score = 156, Expect = 2.0e-09, Identities = 33/124 (26%), Positives = 62/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EI+  + +   F  L    I  S+DS  TH   +   + +  +  +++  VSDI+  I++DY V  ++ G++L     ID +GI++  +   + V R +D  L+ +  +Q
  S:    93 VFFFYPLDFTFVCPTEILAFSDRVSEFKKLNAEVIAASIDSHFTHLAWINTPRKEGGLGKINIPLVSDITHSIAKDYGVYLDDLGHTLRGLFIIDDRGILRQITMNDLPVGRSVDETLRLVQAFQ 217
>gi|165975069|gb|ABY76309.1| thioredoxin peroxidase [Ixodes ricinus] (251 aa)
Score = 156, Expect = 2.0e-09, Identities = 36/124 (29%), Positives = 62/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  L    I  SVDS  TH   +   + +  +  + +  +SD++ +IS+DY V  E+ G+SL     ID KG ++  +   + V R +D  L+ +  +Q
  S:    90 VFFFYPLDFTFVCPTEIIAFSDRVKEFKALNAEVIACSVDSPFTHLAWINTPRKQGGLGPIKIPLLSDLTHQISKDYGVYLEDLGHSLRGLFIIDDKGKLRQITMNDLPVGRSVDETLRLVQAFQ 214
>gi|126696350|ref|YP_001091236.1| thioredoxin peroxidase [Prochlorococcus marinus str. MIT 9301] >gi|126543393|gb|ABO17635.1| thioredoxin peroxidase [Prochlorococcus marinus str. MIT 9301] (194 aa)
Score = 156, Expect = 2.1e-09, Identities = 34/124 (27%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + ++Q+F  L    + +SVDS+  H   ++  +++  I +++   VSD+ +EI + Y VL ++G +      I+ +GI+ + +     V R++D  L+ +  YQ
  S:    36 VLFFYPLDFTFVCPTEITAFSDRYQDFSALNTEILGVSVDSKHCHLAWIQTPRNEGGIGDINYPLVSDLKREICQAYNVLNDDGEADRGLFLINPEGIVMHTTVNKAPVGRNVDETLRILQGYQ 159
>gi|157105671|ref|XP_001648972.1| peroxiredoxins, prx-1, prx-2, prx-3 [Aedes aegypti] >gi|108868966|gb|EAT33191.1| peroxiredoxins, prx-1, prx-2, prx-3 [Aedes aegypti] (257 aa)
Score = 156, Expect = 2.1e-09, Identities = 33/124 (26%), Positives = 63/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EI+  + + + F  L    I  S+DS  TH   +   + +  +  +++  VSDI+  I++DY V  ++ G++L     ID +GI++  +   + V R +D  L+ +  +Q
  S:    96 VFFFYPLDFTFVCPTEILAFSDRVKEFKKLNAEVIAASIDSHFTHLAWINTPRKEGGLGKINIPLVSDITHSIAKDYGVYLDDLGHTLRGLFIIDDRGILRQITMNDLPVGRSVDETLRLVQAFQ 220
>gi|2499471|sp|Q90384|TDX_CYNPY Peroxiredoxin (Thioredoxin peroxidase) (Thioredoxin-dependent peroxide reductase) (Animal blastomere protein, 25 kDa) (ABP-25) >gi|520853|dbj|BAA07054.1| animal blastomere protein [Cynops pyrrhogaster] (200 aa)
Score = 156, Expect = 2.1e-09, Identities = 37/124 (29%), Positives = 59/124 (47%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  +    I  SVDS   H       + +  + +M +  V+D  + IS+DY VL E EG S      ID KGI++  +   + V R +D  L+ +  +Q
  S:    40 VFFFYPLDFTFVCPTEIIAFSDRAEEFRKINCELIAASVDSHFCHLAWTNTSRKEGGLGSMKIPLVADTKRTISQDYGVLKEDEGISFRGLFIIDDKGILRQITINDLPVGRSVDETLRLVQAFQ 164
>gi|55959887|emb|CAI13096.1| peroxiredoxin 1 [Homo sapiens] (171 aa)
Score = 156, Expect = 2.2e-09, Identities = 39/124 (31%), Positives = 60/124 (48%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  L    I  SVDS   H   V   K +  +  M++  VSD  + I++DY VL  +EG S      ID KGI++  +   + V R +D  L+ +  +Q
  S:    40 VFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQ 164
>gi|21592588|gb|AAM64537.1| putative 2-cys peroxiredoxin BAS1 precursor (thiol-specific antioxidant protein) [Arabidopsis thaliana] (266 aa)
Score = 155, Expect = 2.3e-09, Identities = 40/159 (25%), Positives = 81/159 (50%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L+G K  +F ++A   +    +   L+  +GK   +LFF   DF     +EI   + +H  F  L    + +SVDS  +H   V+  +    + +++   +S  +K IS+ + VL  ++G +L     IDK+G+I++ +  ++ + + +D  ++T+   Q
  S:    74 LVGNKAPDFEAEAVFDQ--EFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISYFTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGQSVDETMRTLQALQ 231
>gi|56477933|ref|YP_159522.1| peroxiredoxin [Azoarcus sp. EbN1] >gi|56313976|emb|CAI08621.1| predicted peroxiredoxin [Azoarcus sp. EbN1] (199 aa)
Score = 155, Expect = 2.3e-09, Identities = 41/160 (25%), Positives = 74/160 (46%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+G++  +F + A  G  + I +   ++       +LFF   DF     SE+I  + +   F   GV  + +S+DS+ TH        +   I  +    V+D   EI R Y V  E G +   +  IDK G++++     + + R+ID +L+ +   Q
  S:     3 VLVGKQAPDFAAAAVLGD-NQIQDITFSQFTKGKYAVLFFYPLDFTFVCPSELIAFDHRLDEFKKRGVEVLGVSIDSQFTHLAWKNTPVNSGGIGQVQYPMVADTKHEICRAYDVESEGGVAFRGSFLIDKAGVVRHQVVNDLPLGRNIDEMLRMVDALQ 161
>gi|61619791|gb|AAX47428.1| cytosolic tryparedoxin peroxidase [Leishmania amazonensis] (199 aa)
Score = 155, Expect = 2.3e-09, Identities = 34/124 (27%), Positives = 63/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   +F P   +E+I  +     F  L  + I  S DSE  H Q     + K  +  M++  ++D +K I+R Y VL E +G +      ID +G+++  +   + V R+++ +L+ +  +Q
  S:    40 VLFFYPLNFTPVCPTEVIAFSDNVARFNELSCDVIACSTDSEYAHLQWTLQDRKKGGLGTMAIPILADKTKSIARAYGVLAEAQGVAYRGLFIIDPRGVLRQITVNDMPVGRNVEEVLRLLEAFQ 164
>gi|145548200|ref|XP_001459781.1| hypothetical protein GSPATT00025118001 [Paramecium tetraurelia strain d4-2] >gi|124427607|emb|CAK92384.1| unnamed protein product [Paramecium tetraurelia] (201 aa)
Score = 155, Expect = 2.4e-09, Identities = 45/151 (29%), Positives = 75/151 (49%)
  Q:    10 FFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           F + A++   ++I    LT   GK   LLFF   +F     +EII+ ++  + F       +  SVDS  +H + VK  K    +  + +  +SD++K+IS DY VL + G SL  T  ID    +++ S     V R++D  L+ +  +Q
  S:    14 FKTNAWNATKNAIEQVQLTDFKGKY-LLLFFYPLNFTFVCPTEIIQFSKLAKQFRENNCEVLGCSVDSVFSHAEYVKKPKADGGLGGLDILLLSDLTKQISSDYGVLTDSGLSLRGTFLIDGNQNLRHASINDAPVGRNVDEYLRLLQAFQ 163
>gi|73977959|ref|XP_532599.2| PREDICTED: similar to peroxiredoxin 1 [Canis familiaris] (199 aa)
Score = 155, Expect = 2.4e-09, Identities = 38/124 (30%), Positives = 60/124 (48%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  L    I  SVDS   H   +   K +  +  M++  VSD  + I++DY VL  +EG S      ID KGI++  +   + V R +D  L+ +  +Q
  S:    40 VFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQ 164
>gi|91077388|ref|XP_975268.1| PREDICTED: similar to putative peroxiredoxin [Tribolium castaneum] (243 aa)
Score = 155, Expect = 2.5e-09, Identities = 32/124 (25%), Positives = 62/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EI+  + + Q F ++    +  SVDS  TH   +   + +  +  + +  +SD++  IS+ Y V  E+ G++L     ID KG+++  +   + V R +D  L+ +  +Q
  S:    85 VFFFYPLDFTFVCPTEILAFSDRIQEFRDINTEVVACSVDSHFTHLAWINTPRKEGGLGKVKIPLLSDLNHSISKSYGVFLEDLGHTLRGLFIIDTKGVLRQITMNDLPVGRSVDETLRLVQAFQ 209
>gi|124495008|gb|ABN13585.1| thioredoxin peroxidase [Artemia franciscana] (245 aa)
Score = 155, Expect = 2.5e-09, Identities = 37/124 (29%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVK-NLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EI+  N +   F    V  +  SVDS  TH  L +   K K  +  +++  +SDI+ ++++DY V  E+ G+SL     ID KG+++  +   + V R +D  L+ +  +Q
  S:    83 VFFFYPLDFTFVCPTEILAFNDRLAEFEANNVAVVACSVDSHFTHLALDEYQPKGKGGLGPLNIPLLSDITHKVAKDYGVFLEDAGHSLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQ 208
>gi|149693696|ref|XP_001496084.1| PREDICTED: similar to peroxiredoxin 1 [Equus caballus] (199 aa)
Score = 155, Expect = 2.5e-09, Identities = 38/124 (30%), Positives = 60/124 (48%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  L    I  SVDS   H   +   K +  +  M++  VSD  + I++DY VL  +EG S      ID KGI++  +   + V R +D  L+ +  +Q
  S:    40 VFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQ 164
>gi|109003875|ref|XP_001102188.1| PREDICTED: similar to peroxiredoxin 1 isoform 2 [Macaca mulatta] >gi|109003878|ref|XP_001102281.1| PREDICTED: similar to peroxiredoxin 1 isoform 3 [Macaca mulatta] >gi|109003881|ref|XP_001102380.1| PREDICTED: similar to peroxiredoxin 1 isoform 4 [Macaca mulatta] >gi|109003884|ref|XP_001102473.1| PREDICTED: similar to peroxiredoxin 1 isoform 5 [Macaca mulatta] >gi|109003888|ref|XP_001102571.1| PREDICTED: similar to peroxiredoxin 1 isoform 6 [Macaca mulatta] >gi|109003891|ref|XP_001102655.1| PREDICTED: similar to peroxiredoxin 1 isoform 7 [Macaca mulatta] >gi|109003894|ref|XP_001102742.1| PREDICTED: similar to peroxiredoxin 1 isoform 8 [Macaca mulatta] >gi|109003897|ref|XP_001102834.1| PREDICTED: similar to peroxiredoxin 1 isoform 9 [Macaca mulatta] (199 aa)
Score = 155, Expect = 2.6e-09, Identities = 38/124 (30%), Positives = 60/124 (48%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  L    I  SVDS   H   +   K +  +  M++  VSD  + I++DY VL  +EG S      ID KGI++  +   + V R +D  L+ +  +Q
  S:    40 VFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQ 164
>gi|56541226|gb|AAH86783.1| Prdx2 protein [Mus musculus] (198 aa)
Score = 155, Expect = 2.7e-09, Identities = 34/124 (27%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  +   ++F  LG   + +SVDS+ TH   +   + +  +  +++  ++D+ K +S++Y VL  +EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    39 VLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVIKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQ 163
>gi|17232133|ref|NP_488681.1| peroxiredoxin [Nostoc sp. PCC 7120] >gi|75908245|ref|YP_322541.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Anabaena variabilis ATCC 29413] >gi|17133778|dbj|BAB76340.1| peroxiredoxin [Nostoc sp. PCC 7120] >gi|75701970|gb|ABA21646.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Anabaena variabilis ATCC 29413] (203 aa)
Score = 155, Expect = 2.7e-09, Identities = 38/124 (30%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + +++ F  L    + +SVDSE +H   ++  +    + +++   VSDI KE+S  Y VL    G +L     IDK GII++ +  ++   R +D  L+T+   Q
  S:    44 VLFFYPLDFTFVCPTEITAFSDRYEEFKKLNTEILGVSVDSEFSHLAWIQTDRKSGGVGDLNYPLVSDIKKEVSDAYNVLDPAAGIALRGLFIIDKDGIIQHATINNLAFGRSVDETLRTLQAIQ 168
>gi|193627310|ref|XP_001947930.1| PREDICTED: similar to SJCHGC01281 protein isoform 1 [Acyrthosiphon pisum] >gi|193627312|ref|XP_001948034.1| PREDICTED: similar to SJCHGC01281 protein isoform 2 [Acyrthosiphon pisum] (239 aa)
Score = 155, Expect = 2.7e-09, Identities = 37/124 (29%), Positives = 61/124 (49%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +E++  +     F  +GVN +  S DS  +H   V   +    +  +    +SD +KEI++ Y VL E +G  L     ID KGII+  +   + V R +D +L+ +  +Q
  S:    79 VLFFYPLDFTFVCPTELVSFSDHIDEFKKIGVNIVGCSCDSHFSHLAFVNTPRKHGGLGGLCYPLLSDYNKEIAKAYDVLIEPDGIPLRGLFIIDPKGIIRQITINDLPVGRSVDEVLRLVQAFQ 203
>gi|148981290|ref|ZP_01816350.1| alkyl hydroperoxide reductase C22 protein [Vibrionales bacterium SWAT-3] >gi|145960922|gb|EDK26250.1| alkyl hydroperoxide reductase C22 protein [Vibrionales bacterium SWAT-3] (202 aa)
Score = 155, Expect = 2.8e-09, Identities = 38/156 (24%), Positives = 75/156 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  + + N++  +       ++FF   DF     SE+I  + + ++F   GV  I +S+DS+ +H            I  +    V+D+  EI + Y V   E G +   +  ID  G++++     + + R+ID +L+ +
  S:     2 VLVGRQAPDFTAAAVLGNGEIVDNFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRLEDFQAKGVEVIGVSIDSQFSHNAWRNTAIADGGIGQVKYPLVADVKHEICKAYDVEHPEAGVAFRGSFLIDADGLVRHQVVNDLPLGRNIDEMLRMV 158
>gi|196002974|ref|XP_002111354.1| expressed hypothetical protein [Trichoplax adhaerens] >gi|190585253|gb|EDV25321.1| expressed hypothetical protein [Trichoplax adhaerens] (246 aa)
Score = 155, Expect = 2.8e-09, Identities = 38/124 (30%), Positives = 63/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTH-QQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + + + F  L    I  S+DSE +H      + KD     N+++  ++DI+K+IS DY VL +  G SL     ID  G ++  +   + V R +D  L+ +  +Q
  S:    87 VLFFYPMDFTFVCPTEILAFSDRAKEFEELNTQVIACSIDSEYSHLAWTTASRKDGGLGGNLNIPLLADITKKISNDYGVLLQNAGISLRGLFIIDGNGTLRQATVNDLPVGRSVDETLRLVKAFQ 212
>gi|123968546|ref|YP_001009404.1| thioredoxin peroxidase [Prochlorococcus marinus str. AS9601] >gi|123198656|gb|ABM70297.1| thioredoxin peroxidase [Prochlorococcus marinus str. AS9601] (194 aa)
Score = 155, Expect = 2.8e-09, Identities = 33/124 (26%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + ++Q+F  L    + +SVDS+  H   ++  +++  I +++   VSD+ +EI + Y VL ++G +      I+ +G++ + +     V R++D  L+ +  YQ
  S:    36 VLFFYPLDFTFVCPTEITAFSDRYQDFSALNTEILGVSVDSKHCHLAWIQTPRNEGGIGDINYPLVSDLKREICQAYNVLNDDGEADRGLFLINPEGVVMHTTVNKAPVGRNVDETLRILQGYQ 159
>gi|71282444|ref|YP_270148.1| anti-oxidant AhpCTSA family protein [Colwellia psychrerythraea 34H] >gi|71148184|gb|AAZ28657.1| antioxidant, AhpC/Tsa family [Colwellia psychrerythraea 34H] (201 aa)
Score = 155, Expect = 2.8e-09, Identities = 37/160 (23%), Positives = 79/160 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR+  +F + A  G  + + ++ L++ +     ++FF   DF     SE++  + + + F + GV  I +S+DS+ +H        +   I  +    V+D   EI + Y V   E G +   +  ID++G +++     + + RD+D +++ +   Q
  S:     3 VLVGRQAPDFTAAAVLGSGEIVDSFTLSEAINGKKAVVFFYPLDFTFVCPSELLAFDHRMEEFKSRGVEVIGVSIDSQFSHNAWRNTPVNDGGIGPVQYTLVADTKHEICKAYDVEHPEAGVAFRGSFLIDEEGNVRHQVINDLPLGRDVDEMIRMVDALQ 163
>gi|150392296|ref|YP_001322345.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Alkaliphilus metalliredigens QYMF] >gi|149952158|gb|ABR50686.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Alkaliphilus metalliredigens QYMF] (167 aa)
Score = 155, Expect = 2.9e-09, Identities = 44/124 (35%), Positives = 68/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVI--SVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE--GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF P  ++EI ELN+    F  L  N IV+  + DS  TH+         K+I+ +S   +SD  K++S  Y VL +E  G +L     ID +G ++Y S  ++ V R++  IL+ +A  Q
  S:    31 VLFFYPLDFTPVUSTEIPELNRNLPAFQRL--NSIVLGANTDSVPTHEAWA------KSIDGVSFPLLSDYDKKLSEKYEVLVKEAGGIALRGLFIIDPQGDLQYISVNNLAVGRNVGEILRVLAACQ 150
>gi|158905299|gb|ABW82472.1| peroxiredoxin 1 [Macropus eugenii] (199 aa)
Score = 154, Expect = 3.0e-09, Identities = 38/124 (30%), Positives = 61/124 (49%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  + + + F  L    I  SVDS   H   V  +K    +  +++  +SD  + I++DY +L E EG S      ID KGI++  +   + V R +D  L+ +  +Q
  S:    40 VLFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTVKKNGGLGAVNIPLMSDPKRTIAQDYGILKEDEGISFRGLFIIDDKGILRQITINDLPVGRSVDETLRLVQAFQ 164
>gi|194334393|ref|YP_002016253.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Prosthecochloris aestuarii DSM 271] >gi|194312211|gb|ACF46606.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Prosthecochloris aestuarii DSM 271] (196 aa)
Score = 154, Expect = 3.0e-09, Identities = 43/160 (26%), Positives = 78/160 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR+  +F   A       + +  L+   GK   +LFF   DF     +E+     +   F +  V  +  SVDS+ +H   +   + +  I  ++   +SDI+KE ++ Y VL E EG S      ID++GI++Y     + + R++D +L+ +   Q
  S:     3 VLVGREAPDFSLDAVVDGGKMVDSCKLSDYRGKY-VVLFFYPLDFTFVCPTELHAFQDRIDEFRHKNVEVMACSVDSKFSHHAWLNTPRSQGGIQGVTYTLLSDINKEAAKAYDVLAEAEGVSYRGLFLIDREGIVRYQVVNDLGLGRNVDEVLRMVEALQ 162
>gi|159030269|emb|CAO91164.1| unnamed protein product [Microcystis aeruginosa PCC 7806] (199 aa)
Score = 154, Expect = 3.0e-09, Identities = 37/124 (29%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + +   F ++    + +SVDSE  H   ++  +    + +++   VSD+ KEIS  Y VL  + G SL     IDK+G+I++ +  ++   R +D  L+T+   Q
  S:    40 VLFFYPLDFTFVCPTEITAFSDRVSEFSSINTQILGVSVDSEFAHLAWIQTERKSGGVGDVAYPLVSDLKKEISTAYNVLDPDAGVSLRGLFIIDKEGVIQHATINNLSFGRSVDETLRTLKAIQ 164
>gi|166366324|ref|YP_001658597.1| thioredoxin peroxidase [Microcystis aeruginosa NIES-843] >gi|166088697|dbj|BAG03405.1| thioredoxin peroxidase [Microcystis aeruginosa NIES-843] (199 aa)
Score = 154, Expect = 3.1e-09, Identities = 37/124 (29%), Positives = 64/124 (51%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + +   F ++    + +SVDSE  H   ++  +    + +++   VSD+ KEIS  Y VL  + G SL     IDK+G+I++ +  ++   R +D  L+T+   Q
  S:    40 VLFFYPLDFTFVCPTEITAFSDRVSEFSSINTEILGVSVDSEFAHLAWIQTERKSGGVGDVAYPLVSDLKKEISTAYNVLDPDAGVSLRGLFIIDKEGVIQHATINNLSFGRSVDETLRTLKAIQ 164
>gi|78779328|ref|YP_397440.1| thioredoxin peroxidase [Prochlorococcus marinus str. MIT 9312] >gi|78712827|gb|ABB50004.1| thioredoxin peroxidase [Prochlorococcus marinus str. MIT 9312] (194 aa)
Score = 154, Expect = 3.1e-09, Identities = 33/124 (26%), Positives = 67/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + ++Q+F ++    + +SVDS+  H   ++  +++  I +++   VSD+ +EI + Y VL ++G +      I+ +GI+ + +     V R++D  L+ +  YQ
  S:    36 VLFFYPLDFTFVCPTEITAFSDRYQDFSSIDAEILGVSVDSKHCHLAWIQTPRNEGGIGDINYPLVSDLKREICQAYNVLNDDGEADRGLFLINPEGIVMHTTVNKAPVGRNVDETLRILQGYQ 159
>gi|189499810|ref|YP_001959280.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobium phaeobacteroides BS1] >gi|189495251|gb|ACE03799.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobium phaeobacteroides BS1] (196 aa)
Score = 154, Expect = 3.1e-09, Identities = 45/160 (28%), Positives = 79/160 (49%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+GR+   F  +A +     + +  L+   GK   +LFF   DF     +E+     + + F +  V  +  SVDS+ +H   +K  + +  I  ++   +SDI+K  S+ Y VL E EG S      IDK GI++Y     + + R++D +L+ +   Q
  S:     3 VLVGREAPEFDLEAVAEGAKFVDSCKLSDFRGKY-VVLFFYPLDFTFVCPTELHAFQDRLEEFRHKNVEVLACSVDSKFSHLAWLKTPRKQGGIEGVTYTLLSDINKVASKAYDVLAEKEGVSYRGLFLIDKDGIVRYQVVNDLGLGRNVDEVLRMVEALQ 162
>gi|177666160|ref|ZP_02941956.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cyanothece sp. PCC 8801] >gi|196245218|ref|ZP_03143942.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cyanothece sp. PCC 8802] >gi|172074844|gb|EDT60261.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cyanothece sp. PCC 8801] >gi|196206747|gb|EDY01542.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cyanothece sp. PCC 8802] (199 aa)
Score = 154, Expect = 3.2e-09, Identities = 36/124 (29%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + +++ F  +    + +SVDSE +H   ++  + +  + +++   VSDI +EIS  Y VL  + G +L     IDK+G I++ +  ++   R +D  L+T+   Q
  S:    40 VLFFYPLDFTFVCPTEITAFSDRYEEFTKINTEVLGVSVDSEFSHLAWIQTDRKEGGVGDVAYPLVSDIKREISIAYNVLDPDAGVALRGLFIIDKEGYIQHSTINNLSFGRSVDETLRTLKAIQ 164
>gi|90075488|dbj|BAE87424.1| unnamed protein product [Macaca fascicularis] (195 aa)
Score = 154, Expect = 3.2e-09, Identities = 38/124 (30%), Positives = 60/124 (48%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  L    I  SVDS L H   +   K +  +  M++  V D  + I++DY VL  +EG S      ID KGI++  +   + V R +D  L+ +  +Q
  S:    36 VFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHLCHLAWINTPKKQGGLGPMNIPLVPDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQ 160
>gi|61806512|ref|NP_001013489.1| hypothetical protein LOC541344 [Danio rerio] >gi|60552803|gb|AAH91459.1| Zgc:110343 [Danio rerio] >gi|182889368|gb|AAI65000.1| Zgc:110343 protein [synthetic construct] (199 aa)
Score = 154, Expect = 3.2e-09, Identities = 39/124 (31%), Positives = 60/124 (48%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  +   + F  +    I  SVDS   H    K  + +  +  M++  V+D  + IS+DY VL E EG +      ID KGI++  +   + V R ID  L+ +  +Q
  S:    40 VLFFYPLDFTFVCPTEIIAFSDAAEGFRKINCEIIGASVDSHFCHLAWTKTPRKQGGLGPMNVPLVADTLRSISKDYGVLKEDEGIAYRGLFIIDDKGILRQITINDLPVGRSIDETLRLVQAFQ 164
>gi|18152531|emb|CAD20737.1| thioredoxin peroxidase [Ostertagia ostertagi] (193 aa)
Score = 154, Expect = 3.2e-09, Identities = 44/159 (27%), Positives = 80/159 (50%)
  Q:     2 LIGRKYINFFSKA-YSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
            IG+   +F +KA Y+G     ++  L+   GK  T+LFF   DF     +EII  + + + F  +    +  S DS  +H   +   +    + +M++  ++D + +I++DY VL E EG +      ID KGI++  +   + V R +D  L+ +  +Q
  S:     2 FIGKPAPDFATKAVYNG---DFIDVKLSDYKGKY-TVLFFYPLDFTFVCPTEIIAFSDRVEEFKKIDAAVLACSXDSVFSHLAWINTPRKMGGLGDMNIPVLADTNHQIAKDYGVLKEDEGIAYRGLFIIDPKGILRQITVNDLPVGRSVDETLRLVQAFQ 158
>gi|156083230|ref|XP_001609099.1| antioxidant, AhpC/TSA family [Babesia bovis T2Bo] >gi|154796349|gb|EDO05531.1| antioxidant, AhpC/TSA family [Babesia bovis] (254 aa)
Score = 154, Expect = 3.3e-09, Identities = 38/153 (24%), Positives = 78/153 (50%)
  Q:     2 LIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILK 154
           L+GR++ +F + A      +I  +D +     +  LL F   DF     SE++  + +   F   G+  + IS+DS  +H   ++    K  +  + +  VSDIS+ IS+ + +L  +G++  +++ IDK G +++ +   + + R +D  L+
  S:    62 LVGREFPDFKTSAVI--NGNITEFDASAYFRDSYALLVFYPLDFTFVCPSELLGFSARLPEFEQRGIKVVGISIDSVFSHLAWLQMDLKKGGVQGLKIPLVSDISRSISKSFGLLRSDGFAQRASVLIDKTGKVRHTAVFDLGIGRSVDETLR 212
>gi|56751802|ref|YP_172503.1| thioredoxin peroxidase [Synechococcus elongatus PCC 6301] >gi|56686761|dbj|BAD79983.1| thioredoxin peroxidase [Synechococcus elongatus PCC 6301] (201 aa)
Score = 154, Expect = 3.3e-09, Identities = 35/124 (28%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + ++ +F  L    + +SVDS+ +H   ++  + +  + +++   V+D+ KEIS  Y VL   EG +L     IDK+G+I++ +  ++   R +D  L+ +   Q
  S:    42 VLFFYPLDFTFVCPTEITAFSDRYADFSALNTEILGVSVDSQFSHLAWIQTSRKEGGLGDLAYPLVADLKKEISTAYNVLDPAEGIALRGLFIIDKEGVIQHATINNLAFGRSVDETLRVLQAIQ 166
>gi|27232101|gb|AAG25678.2|AF305718_1 peroxiredoxin [Toxoplasma gondii] (196 aa)
Score = 154, Expect = 3.5e-09, Identities = 40/134 (29%), Positives = 67/134 (50%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVK-NLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L++  GK   +LFF   DF     SEI+  ++ H  F   G   + +SVDS+  H       LKD   I  +S   ++D+S +++ DY VL  EG +      IDK+G++++    ++ + R  D  L+ +   Q
  S:    29 LSQFKGKKYVVLFFYPFDFTFVCPSEILAFHRLHGEFEKRGCQLLGVSVDSKFVHNAWRNVELKDGG-IGKISFPLLADVSHKMAEDYGVLHPEGMAFRGLFLIDKEGVLQHCVINNLPLGRSADEALRMLDALQ 162
>gi|149907723|ref|ZP_01896470.1| alkyl hydroperoxide reductase C22 protein [Moritella sp. PE36] >gi|149809393|gb|EDM69322.1| alkyl hydroperoxide reductase C22 protein [Moritella sp. PE36] (200 aa)
Score = 154, Expect = 3.5e-09, Identities = 37/156 (23%), Positives = 75/156 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  + + N++  +       ++FF   DF     SE+I  + + + F   GV  I +S+DS+ +H        +   I  +    V+D+  +I + Y V   E G +   +  ID  G++++     + + R+ID +L+ +
  S:     2 VLVGRQAPDFTAAAVLGNGEIVDNFNFAEFTKGKSAVVFFYPLDFTFVCPSELIAFDHRLEEFQKRGVEVIGVSIDSQFSHNAWRNTSIEDGGIGPVKYPLVADVKHDICQAYGVEHPEAGVAFRGSFLIDTNGVVRHQVVNDLPLGRNIDEMLRMV 158
>gi|27807469|ref|NP_777188.1| peroxiredoxin 2 [Bos taurus] >gi|22095988|sp|Q9BGI3|PRDX2_BOVIN Peroxiredoxin-2 >gi|12407847|gb|AAG53659.1|AF305562_1 peroxiredoxin 2 [Bos taurus] >gi|74353992|gb|AAI02352.1| PRDX2 protein [Bos taurus] (199 aa)
Score = 154, Expect = 3.5e-09, Identities = 33/124 (26%), Positives = 65/124 (52%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI+  + +   F  L    + +SVDS+ TH   +   + +  +  +++  ++D+++++S DY VL E EG +      ID KG+++  +   + V R +D  L+ +  +Q
  S:    40 VLFFYPLDFTFVCPTEIVAFSDRAAEFHKLNCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRKLSSDYGVLKEDEGIAYRGLFVIDGKGVLRQVTINDLPVGRSVDEALRLVQAFQ 164
>gi|83647673|ref|YP_436108.1| peroxiredoxin [Hahella chejuensis KCTC 2396] >gi|83635716|gb|ABC31683.1| Peroxiredoxin [Hahella chejuensis KCTC 2396] (200 aa)
Score = 154, Expect = 3.6e-09, Identities = 39/160 (24%), Positives = 72/160 (45%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +L+G+   +F   A       +  Y L++ +     L+FF   DF     SE+I L+ + + F   GV  I +S+DS  TH        DK  I  +     +D++ EI + + V    G +      IDK G+++      + + R++D +++ +   Q
  S:     3 VLVGKPAPDFTVPAVLADGQIVDEYKLSEAIKGKYALIFFYPLDFTFVCPSELIALDHRVEQFKERGVEVIGVSIDSHFTHNAWRNTPVDKGGIGPVKYTLAADLNHEICKAFDVESAGGVAFRGAFLIDKDGVVRSQIVNDLPLGRNVDELIRLVDALQ 162
>gi|54288811|gb|AAV31765.1| tryparedoxin peroxidase 2 [Leishmania guyanensis] (199 aa)
Score = 154, Expect = 3.6e-09, Identities = 38/124 (30%), Positives = 63/124 (50%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII+ ++  + F  L    I  SVDSE  H Q     + K  +  M +  ++D +K I R Y VL E +G +      ID KGI++  +   + V R+++ +L+ +  +Q
  S:    40 VLFFYPLDFTFVCPTEIIQFSENIKRFSELDCEVIACSVDSEYAHLQWTLQERKKGGLGPMEIPMLADKTKCICRAYGVLDEKQGVAYRGLFIIDPKGILRQITINDMPVGRNVEEVLRLLEAFQ 164
>gi|15615228|ref|NP_243531.1| 2-cys peroxiredoxin [Bacillus halodurans C-125] >gi|10175286|dbj|BAB06384.1| 2-cys peroxiredoxin [Bacillus halodurans C-125] (183 aa)
Score = 154, Expect = 3.6e-09, Identities = 39/134 (29%), Positives = 66/134 (49%)
  Q:    27 LTKNMGKNG-TLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           L +NM  +  T+LFF   DF     +EI  L+ ++  F +L    I +S D+  TH+  +   +D   + ++     +D + E+SR+Y VL  EEG +L     I  +G + Y       + RD+D  L+ +   Q
  S:    30 LEENMKNDKWTVLFFYPMDFTFVCPTEITSLSDRYDEFEDLDAEVIGVSTDTIHTHKAWINTSRDDNGLGDLKYPLAADTNHEVSREYGVLIEEEGIALRGLFIISPEGELMYSVVNHNNIGRDVDETLRVLQALQ 165
>gi|81301118|ref|YP_401326.1| thioredoxin peroxidase [Synechococcus elongatus PCC 7942] >gi|31339390|gb|AAP49028.1| thioredoxin-peroxidase [Synechococcus sp. PCC 7942] >gi|81169999|gb|ABB58339.1| thioredoxin peroxidase [Synechococcus elongatus PCC 7942] (198 aa)
Score = 154, Expect = 3.6e-09, Identities = 35/124 (28%), Positives = 66/124 (53%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + ++ +F  L    + +SVDS+ +H   ++  + +  + +++   V+D+ KEIS  Y VL   EG +L     IDK+G+I++ +  ++   R +D  L+ +   Q
  S:    39 VLFFYPLDFTFVCPTEITAFSDRYADFSALNTEILGVSVDSQFSHLAWIQTSRKEGGLGDLAYPLVADLKKEISTAYNVLDPAEGIALRGLFIIDKEGVIQHATINNLAFGRSVDETLRVLQAIQ 163
>gi|196157544|ref|YP_002127033.1| antioxidant, AhpC/Tsa family protein [Alteromonas macleodii 'Deep ecotype'] >gi|88773728|gb|EAR04990.1| antioxidant, AhpC/Tsa family protein [Alteromonas macleodii 'Deep ecotype'] >gi|196113323|gb|ACG67039.1| antioxidant, AhpC/Tsa family protein [Alteromonas macleodii 'Deep ecotype'] (201 aa)
Score = 154, Expect = 3.6e-09, Identities = 36/156 (23%), Positives = 79/156 (50%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR   +F + A  G  + + ++ L++ +     ++FF   DF     SE+I  +++   F   GV  I +S+DS+ +H        ++  I  +    V+D+  +I + Y V   E+G +   +  ID+ G++++     + + R++D +L+ +
  S:     3 VLVGRPAPDFTAAAVLGSGEIVDSFTLSEAIKGKKAVVFFYPLDFTFVCPSELIAFDKRFDEFKKRGVEVIGVSIDSQFSHNAWRNTPVNQGGIGPVKYTLVADVKHDICQAYDVEHPEDGVAFRGSFLIDEAGMVRHQVVNDLPLGRNVDEMLRMV 159
>gi|192361205|ref|YP_001981563.1| probable peroxidase [Cellvibrio japonicus Ueda107] >gi|190687370|gb|ACE85048.1| probable peroxidase [Cellvibrio japonicus Ueda107] (200 aa)
Score = 154, Expect = 3.7e-09, Identities = 35/156 (22%), Positives = 74/156 (47%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+G+K  +F + A     + +  ++          ++FF   DF     SE++  + + + F    V  I +S+DS+ TH        ++  I  +    V+D+  EI++ Y V   +G +   T  ID++G+++      + + R+ID  ++T+
  S:     3 VLVGKKAPDFTAAAVLASGEIVDGFNFAAATKGKKAVVFFYPLDFTFVCPSELLAFDHRVEEFKKRNVEVIGVSIDSQFTHNAWRNTPVNEGGIGPVKYTLVADVKHEIAKAYDVESADGVAFRGTFIIDEQGVVRSQIVNDLPIGRNIDETIRTV 158
>gi|123230137|emb|CAM16507.1| peroxiredoxin 1 [Mus musculus] (176 aa)
Score = 154, Expect = 3.7e-09, Identities = 37/124 (29%), Positives = 60/124 (48%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + +   F  L    I  SVDS   H   +   K +  +  M++  +SD  + I++DY VL  +EG S      ID KGI++  +   + V R +D I++ +  +Q
  S:    40 VFFFYPLDFTFVCPTEIIAFSDRADEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQ 164
>gi|195435598|ref|XP_002065767.1| GK19651 [Drosophila willistoni] >gi|194161852|gb|EDW76753.1| GK19651 [Drosophila willistoni] (196 aa)
Score = 153, Expect = 3.9e-09, Identities = 38/134 (28%), Positives = 69/134 (51%)
  Q:    27 LTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           LT+  G+   LLF+   DF     +E+   + + Q F N+G + I  S DS   H   ++  +    +  M +  ++D S +IS+DY VL E  G ++     ID++G+++  +   V V R++D  L+ +  +Q
  S:    28 LTEFRGRYVVLLFY-PADFSFVCPTELHAFSDRAQEFRNVGCDIIACSTDSHYVHCAWMQQSRKHGGLGEMDIPLLADKSMKISKDYGVLDELTGLAMRGLFIIDREGMVRQITINDVGVGRNVDEALRLVQAFQ 161
>gi|187608635|ref|NP_001120185.1| hypothetical protein LOC100145226 [Xenopus tropicalis] >gi|156230721|gb|AAI52139.1| Zgc:110343 protein [Danio rerio] >gi|166796428|gb|AAI59299.1| Unknown (protein for MGC:180616) [Xenopus tropicalis] (201 aa)
Score = 153, Expect = 3.9e-09, Identities = 39/124 (31%), Positives = 60/124 (48%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EII  +   + F  +    I  SVDS   H    K  + +  +  M++  V+D  + IS+DY VL E EG +      ID KGI++  +   + V R ID  L+ +  +Q
  S:    40 VLFFYPLDFTFVCPTEIIAFSDAAEEFRKINCEIIGASVDSHFCHLAWTKTPRKQGGLGPMNVPLVADTLRSISKDYGVLKEDEGIAYRGLFIIDDKGILRQITINDLPVGRSIDETLRLVQAFQ 164
>gi|86145571|ref|ZP_01063901.1| alkyl hydroperoxide reductase C22 protein [Vibrio sp. MED222] >gi|85836542|gb|EAQ54668.1| alkyl hydroperoxide reductase C22 protein [Vibrio sp. MED222] (202 aa)
Score = 153, Expect = 4.0e-09, Identities = 37/156 (23%), Positives = 75/156 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  + + N++  +       ++FF   DF     SE+I  + + ++F   GV  I +S+DS+ +H            I  +    ++D+  EI + Y V   E G +   +  ID  G++++     + + R+ID +L+ +
  S:     2 VLVGRQAPDFTAAAVLGNGEIVDNFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRLEDFQAKGVEVIGVSIDSQFSHNAWRNTAIADGGIGQVKYPLIADVKHEICKAYDVEHPEAGVAFRGSFLIDADGLVRHQVVNDLPLGRNIDEMLRMV 158
>gi|84393921|ref|ZP_00992663.1| alkyl hydroperoxide reductase C22 protein [Vibrio splendidus 12B01] >gi|84375471|gb|EAP92376.1| alkyl hydroperoxide reductase C22 protein [Vibrio splendidus 12B01] (202 aa)
Score = 153, Expect = 4.0e-09, Identities = 37/156 (23%), Positives = 75/156 (48%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLF-EEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+GR+  +F + A  G  + + N++  +       ++FF   DF     SE+I  + + ++F   GV  I +S+DS+ +H            I  +    ++D+  EI + Y V   E G +   +  ID  G++++     + + R+ID +L+ +
  S:     2 VLVGRQAPDFTAAAVLGNGEIVDNFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRLEDFQAKGVEVIGVSIDSQFSHNAWRNTAIADGGIGQVKYPLIADVKHEICKAYDVEHPEAGVAFRGSFLIDADGLVRHQVVNDLPLGRNIDEMLRMV 158
>gi|15616801|ref|NP_240013.1| alkyl hydroperoxide reductase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11387169|sp|P57279|TSAA_BUCAI Probable peroxiredoxin (Thioredoxin reductase) >gi|25285282|pir||C84951 alkyl hydroperoxide reductase [imported] - Buchnera sp. (strain APS) >gi|10038864|dbj|BAB12899.1| alkyl hydroperoxide reductase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (197 aa)
Score = 153, Expect = 4.1e-09, Identities = 42/156 (26%), Positives = 70/156 (44%)
  Q:     1 MLIGRKYINFFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTI 156
           +L+ +   NF + A       +  +DL K      T+LFF   DF     SEIIE N+ H  F    V  + +S+DS   HQ     L     I  ++   VSD+  +I + Y +     G +L ++  ID   II++     +   R+I  +++ +
  S:     2 VLVTQNAPNFIAPAILKNNQIVEQFDLKKYSNGQSTVLFFWPMDFTFVCPSEIIEFNKLHSEFKKRNVKIVGVSIDSVYVHQAWQNTLPKNGGIGKINFPMVSDVKHDIQKSYGIQHPNLGIALRASFLIDSNWIIRHQVVNDLPFGRNITDMIRMV 158
>gi|88808708|ref|ZP_01124218.1| thioredoxin peroxidase [Synechococcus sp. WH 7805] >gi|88787696|gb|EAR18853.1| thioredoxin peroxidase [Synechococcus sp. WH 7805] (199 aa)
Score = 153, Expect = 4.1e-09, Identities = 32/124 (25%), Positives = 68/124 (54%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +LFF   DF     +EI   + ++ +F +     + +SVDS+ +H   ++  +++  I +++   V+D++KEI   + +L +EG +L     ID  G+I + +  ++ V R++D  L+ +  +Q
  S:    40 VLFFYPLDFTFVCPTEITAFSDRYADFSSKNCEILGVSVDSKFSHLAWIQTPRNQGGIGDINYPLVADLNKEIGNAFNILDDEGKALRGLYLIDPDGVIVHATINNLPVGRNVDETLRLLQAFQ 163
>gi|66773956|sp|Q5E947|PRDX1_BOVIN Peroxiredoxin-1 >gi|59858511|gb|AAX09090.1| peroxiredoxin 1 [Bos taurus] >gi|151556396|gb|AAI48010.1| Peroxiredoxin 1 [Bos taurus] (199 aa)
Score = 153, Expect = 4.2e-09, Identities = 37/124 (29%), Positives = 60/124 (48%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  L    I  SVDS   H   +   K +  +  M++  +SD  + I++DY VL  +EG S      ID KGI++  +   + V R +D  L+ +  +Q
  S:    40 VFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDETLRLVQAFQ 164
>gi|145496881|ref|XP_001434430.1| hypothetical protein GSPATT00036166001 [Paramecium tetraurelia strain d4-2] >gi|124401556|emb|CAK67033.1| unnamed protein product [Paramecium tetraurelia] (201 aa)
Score = 153, Expect = 4.5e-09, Identities = 45/151 (29%), Positives = 76/151 (50%)
  Q:    10 FFSKAYSGKTDSILNYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           F + A++   ++I +  LT   GK   LLFF   +F     +EII+ ++  + F       +  SVDS  +H + VK  K    +  + +  +SD++K+IS DY VL + G SL  T  ID    +++ S     V R++D  L+ +  +Q
  S:    14 FKTNAWNPIKNAIESVQLTDFKGKY-LLLFFYPLNFTFVCPTEIIQFSKLAKQFREHNCEVLGCSVDSVFSHAEYVKKPKADGGLGGLDILLLSDLTKQISSDYGVLTDSGLSLRGTFLIDGNQNLRHASINDAPVGRNVDEYLRLLQAFQ 163
>gi|159465035|ref|XP_001690737.1| peroxiredoxin [Chlamydomonas reinhardtii] >gi|158270361|gb|EDO96214.1| peroxiredoxin [Chlamydomonas reinhardtii] (185 aa)
Score = 153, Expect = 4.8e-09, Identities = 33/123 (26%), Positives = 64/123 (52%)
  Q:    38 LFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEE-GYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           LFF  +DF     +EII  + + + F       I  S D+E TH   ++  +++  +  M +  ++D +K+IS  Y VL E+ G +L     I+ +G++++ +   + + R +D  L+T+   Q
  S:    28 LFFYPKDFTFVCPTEIIAFSDRAKEFAAANCQLIAASTDTEETHLAWIRTPRNRGGLGYMQIPILADTTKDISARYGVLIEKLGVALRGLFIINPQGVVQHVTINDLPIGRSVDEALRTLQAIQ 151
>gi|63002583|gb|AAY25400.1| natural killer enhancing factor [Paralichthys olivaceus] (198 aa)
Score = 153, Expect = 5.0e-09, Identities = 40/135 (29%), Positives = 65/135 (48%)
  Q:    26 DLTKNMGKNGTLLFFIHQ-DFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFE-EGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           DLT +  +   ++FF +  DF     +EII  +   + F  +G   I  SVDS  +H       + +  +  M +  VSD  + IS DY VL E EG +      ID KGI++  +   + V R ++  L+ +  +Q
  S:    28 DLTLSNYRGKYVVFFFYPLDFTFVCPTEIIAFSDAAEQFRKIGCEVIAASVDSHFSHFAWTNTPRKQGGLGTMKIPLVSDTRRTISTDYGVLKEDEGIAYRGLFIIDDKGILRQITINDLPVGRSVEETLRLVQAFQ 164
>gi|144898700|emb|CAM75564.1| alkyl hydroperoxide reducatase [Magnetospirillum gryphiswaldense MSR-1] (206 aa)
Score = 152, Expect = 5.1e-09, Identities = 34/137 (24%), Positives = 66/137 (48%)
  Q:    24 NYDLTKNMGKNGTLLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVLFEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           +++L   +  +  L+FF   DF     SEI+  + + +         + +SVDS  TH        DK  + N+    V+D++K I++ Y VL  +  +L  +  IDK G ++     ++ + R++D +L+ +   Q
  S:    32 SFNLKSYLAGSYGLVFFYPLDFTFVCPSEILAHDHRVKALAEKNCKVVAVSVDSHFTHLAWKNTAIDKGGLGNVQFPMVADLTKSIAKSYGVLINDAVALRGSFLIDKAGNVQVAHVNNLPLGRNVDEMLRLVDALQ 168
>gi|164519504|pdb|2RII|A Chain A, Crystal Structure Of Human Peroxiredoxin I In Complex With Sulfiredoxin >gi|164519505|pdb|2RII|B Chain B, Crystal Structure Of Human Peroxiredoxin I In Complex With Sulfiredoxin (199 aa)
Score = 152, Expect = 5.2e-09, Identities = 39/124 (31%), Positives = 60/124 (48%)
  Q:    37 LLFFIHQDFYPTSTSEIIELNQKHQNFVNLGVNPIVISVDSELTHQQLVKNLKDKKTINNMSLDFVSDISKEISRDYLVL-FEEGYSLPSTIFIDKKGIIKYFSTGSVEVKRDIDSILKTIATYQ 160
           + FF   DF     +EII  + + + F  L    I  SVDS   H   V   K +  +  M++  VSD  + I++DY VL  +EG S      ID KGI++  +   + V R +D  L+ +  +Q
  S:    40 VFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNSQVIGASVDSHFEHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQ 164