>gi|26553593|ref|NP_757527.1| methyltransferase [Mycoplasma penetrans HF-2] >gi|26453599|dbj|BAC43931.1| predicted methyltransferase [Mycoplasma penetrans HF-2] (282 aa)
Score = 1240, Expect = 1.6e-134, Identities = 282/282 (100%), Positives = 282/282 (100%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRKNCF 282
           MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRKNCF
  S:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRKNCF 282
>gi|12044908|ref|NP_072718.1| tetrapyrrole (corrin/porphyrin) methylase protein [Mycoplasma genitalium G37] >gi|1351471|sp|P47302|Y056_MYCGE UPF0011 protein MG056 >gi|1045730|gb|AAC71273.1| tetrapyrrole (corrin/porphyrin) methylase protein [Mycoplasma genitalium G37] >gi|166079073|gb|ABY79691.1| tetrapyrrole (corrin/porphyrin) methylase protein [synthetic Mycoplasma genitalium JCVI-1.0] (277 aa)
Score = 466, Expect = 7.9e-45, Identities = 123/275 (44%), Positives = 180/275 (65%)
  Q:     3 KKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQ-------FINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQI--INGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           K L +VATPIGNI+EISE A   L +  + FCED+R ++K+L+LLNI  + K F   N   EKQ       FI +F     + CL+SDAGYP LSDPG  +IN  I  N +++I  INGPS+LM  LI SGF ++ +LF GFL+H +N  ++ L+  +N+  TI+ FE+VHR+++TL+ +K +F N+ ++ I RELTK++E+ Y  + +      IT KGEFVI+IDN     +++   +  Y VY  E++KL+  G K K AC  ++ K  LKS+ LY  + +
  S:     2 KTLKVVATPIGNIQEISERAKKALQDCEVLFCEDSRVTRKMLDLLNIDCKQKKFVINNSFKEKQNLTFAEEFITNF-----KCCLVSDAGYPSLSDPGNEMINWIISKNKEIRIEVINGPSALMCGLITSGFKTTPLLFLGFLSHKQNQLKNYLSTYQNQKSTIVFFEAVHRLENTLETVKNVFKNN-DVFIGRELTKLHESHYWFNTSENTLPDITLKGEFVIVIDNQNINHQTLSSNQ--YLVY--EIKKLMDIGVKLKDACNYLAKKMHLKSSMLYTLFHE 275
>gi|13507810|ref|NP_109759.1| hypothetical protein MPN071 [Mycoplasma pneumoniae M129] >gi|2496279|sp|P75046|Y071_MYCPN UPF0011 protein MG056 homolog >gi|1673738|gb|AAB95732.1| hypothetical protein MPN_071 [Mycoplasma pneumoniae M129] (276 aa)
Score = 455, Expect = 1.6e-43, Identities = 113/273 (41%), Positives = 174/273 (63%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEY-C-LLSDAGYPILSDPGFLLINLFIKNNWD---VQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYR-SSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYL--NELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           L ++ATPIGNI+E+S      LT   + FCEDTR +KKLL LL I   NK F   N   EKQ ++      ++Y C L+SDAGYP +SDPG +L+  +++       +++INGPS+L+  L+ SGFP S +LF GFL+H        L   +N   TI++FE+VHR++ TL++I+ +F N++ + + RELTK++E+ Y  ++ A + +  IT KGEFVI+I+N+   T+ + +    YS  L   E+ +L++ G K K AC  ++ +  LKSN LY  + +
  S:     4 LKVIATPIGNIEEVSPRVKAALTKCEVLFCEDTRVTKKLLGLLGIDFSNKQFIINNEFKEKQNLSKVANLIHQYHCGLVSDAGYPSVSDPGHILVE-YVRTQLPQIAIEVINGPSALVCGLVTSGFPESPLLFLGFLDHKPTQVTQTLKHYQNFQGTIVLFEAVHRLQQTLEVIQTVFSNTE-VFVGRELTKLHESHYWFNTSAPLPD--ITLKGEFVIVINNH--HTQPVGQ----YSDQLLKQEITQLVQMGVKVKDACHYLAKRLQLKSNKLYTLFHE 274
>gi|171920744|ref|ZP_02695289.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178786|ref|ZP_02554825.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024303|ref|ZP_02570064.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039530|ref|ZP_02528607.2| hypothetical protein Uures_02515 [Ureaplasma urealyticum serovar 8] >gi|188039654|ref|ZP_02529009.2| hypothetical protein Uures_03462 [Ureaplasma urealyticum serovar 8] >gi|188039681|ref|ZP_02529052.2| hypothetical protein Uures_03622 [Ureaplasma urealyticum serovar 8] >gi|188518521|ref|ZP_03003991.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524070|ref|ZP_02557303.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530828|ref|ZP_02546568.2| hypothetical protein Uurese_01000003_0200001595 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568691|ref|ZP_03005455.1| hypothetical protein Uurealyserovar_00980 [Ureaplasma urealyticum serovar 2] >gi|188592501|ref|ZP_02694047.2| hypothetical protein Uureaserovar_01010 [Ureaplasma urealyticum serovar 10] >gi|195867755|ref|ZP_03079756.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903492|gb|EDT49781.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209406|gb|EDU06449.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018977|gb|EDU57017.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997938|gb|EDU67035.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660155|gb|EDX53535.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660610|gb|EDX53866.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (279 aa)
Score = 434, Expect = 4.3e-41, Identities = 117/275 (42%), Positives = 163/275 (59%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEY--CLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L I+ATPIGN++E SE  I +L    +  CEDTR + KLL+LLNI  + K   S +  NE + +N       +Y   L+SDAGYP +SDPG+ LIN   + N  VQ+INGPSSLMH+L+ SG  S + +F GFL   +  + ++L Q KN   T +I+E+VHR++ TL  + E + +   + I RELTK NE+ Y   ++ +    ITEKGEFVI+IDN   +T     +  D +  LNE+  LI++  K K ACK VS      S  LY     +K
  S:    10 LSIIATPIGNLEEASERVIKSLNEAYVILCEDTRMTSKLLHLLNI-YDYKKLVSFHNFNEVEKLNEAINYIKKYPTALVSDAGYPTISDPGYKLINECHRQNIGVQVINGPSSLMHALVASGMCSQDFMFLGFLGKTQKQRVEKLKQYKNLQTTFVIYEAVHRLQTTLMDVYETWGDVL-VFIGRELTKKNESHYYGYLSQLP--PITEKGEFVIVIDN---KTNFDVIKNNDINECLNEIRTLIKQNFKLKDACKEVSKTSGFDSKELYKLMVNQK 279
>gi|13357753|ref|NP_078027.1| hypothetical protein UU195 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762351|ref|YP_001752276.1| hypothetical protein UPA3_0201 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920203|ref|ZP_02931585.1| conserved hypothetical protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508795|ref|ZP_02958257.1| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186702002|ref|ZP_02971621.1| conserved hypothetical protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|11279537|pir||A82922 conserved hypothetical UU195 [imported] - Ureaplasma urealyticum >gi|6899160|gb|AAF30602.1|AE002119_7 conserved hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827928|gb|ACA33190.1| conserved hypothetical protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902586|gb|EDT48875.1| conserved hypothetical protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675743|gb|EDT87648.1| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700780|gb|EDU19062.1| conserved hypothetical protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (279 aa)
Score = 416, Expect = 5.6e-39, Identities = 116/275 (42%), Positives = 164/275 (59%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEY--CLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L ++ATPIGN++E+SE  I  L    +  CEDTR + KLL+LLNI  + K   S +  NE Q +N       +Y   L+SDAGYP +SDPG+ LIN   + N  +Q+INGPSSLMH+L+ SG  S + +F GFL   +  + ++L   KN   T +I+E+VHRI+ TL  I EI+ +   I I RELTK NE+ Y   ++ +    ITEKGEFVI+IDN + + + IK    +    L ++  L+++  K K ACK VS   +  S  LY     +K
  S:    10 LSVIATPIGNLEEVSERVIKCLNEAYVILCEDTRVTAKLLHLLNI-YDYKKLISYHNFNEIQKLNEAINYIKKYPTALVSDAGYPTISDPGYKLINECHQQNIGIQVINGPSSLMHALVASGMCSQDFMFLGFLGKTQKQRVEKLKLYKNLQTTFVIYEAVHRIEKTLMDIYEIWGDIL-IFIGRELTKKNESHYYGYLSQLP--PITEKGEFVIVIDNKINQ-DVIKNNNINEC--LIKIRDLMKQNFKLKDACKEVSKSSNFDSKELYKLIINQK 279
>gi|114565622|ref|YP_752776.1| methyltransferases [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114336557|gb|ABI67405.1| methyltransferases [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (283 aa)
Score = 402, Expect = 2.5e-37, Identities = 93/276 (33%), Positives = 155/276 (56%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           KL+I  TPIGN+ ++S   + TL    +  CEDTR + KLLN   I     +++  +   ++ ++ +   +     L+SDAG P +SDPG  LI   ++    +++I GPS+L  +L +SG  +S   F GFL H ++ ++ +L QL++E KTII++E+ HR+++ L  I EI    + + IARELTK +E I R +   +  +      +GE  +LI          K  ET++ + + E E+LI  G  +K A K+ +  Y +K N LY ++ ++K
  S:     5 KLYICGTPIGNLDDVSIRLLKTLRKVDLIACEDTRMTIKLLNRFKIKTRMISYHEHSKREKEDYLIAQLLQGQNIALVSDAGMPTISDPGEELIRRALQTGIPLEVIPGPSALTAALALSGMDTSAFTFAGFLPHRRSRRRGELEQLQSEQKTIILYEAPHRLRECLLDIVEIMGAERKLAIARELTKKHEEIRRGTAGELLHHFSASPPRGEICLLI-----APAEDKAAETNWELIIAETEELINLGMDKKEAFKIKAKNYGIKKNELYKYFVEKK 277
>gi|167755128|ref|ZP_02427255.1| hypothetical protein CLORAM_00632 [Clostridium ramosum DSM 1402] >gi|167705178|gb|EDS19757.1| hypothetical protein CLORAM_00632 [Clostridium ramosum DSM 1402] (284 aa)
Score = 397, Expect = 7.7e-37, Identities = 102/274 (37%), Positives = 158/274 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLN-GNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQR 278
           L++VATPIGN++E++  AI TL        EDTRN+ K+LN  NI  +  + +  N G +  + IN      N   L+SDAGYP +SDPG+ L+   I N  +V  I+G ++ + +L+VSG      LFYGFL+H    K+ +L  LKN  +TI+ +ES HRI  TLK++++I  + + I + RE+TK +E I R SI+ I ++    KGE VI++  N    E    E+T     +  +++ + KG   K A K V+   ++K N +Y  + Q+
  S:    14 LYLVATPIGNLEEMTYRAIRTLQEVDYIGAEDTRNTVKILNHYNIRTKLISHHEHNLGQSIPKLINLL-LDGNNIALVSDAGYPAISDPGYELVKAAIDNEINVIPISGANACLDALVVSGIAPQPFLFYGFLDHQDKKKKKELQVLKNYQETIVFYESPHRITKTLKLMEDILGD-RPIALCREITKKHEEILRGSISEITKVAGDLKGEMVIVVSGNNNVIEETVFEQT----IVEHVDEYVSKGMTVKDAIKEVAKLRNIKKNEVYATYHQK 282
>gi|66880274|ref|ZP_00405257.1| COG0313: Predicted methyltransferases [Mycoplasma genitalium G-37] (200 aa)
Score = 395, Expect = 1.5e-36, Identities = 95/195 (48%), Positives = 137/195 (70%)
  Q:     3 KKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQ-------FINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQI--INGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIY 197
           K L +VATPIGNI+EISE A   L +  + FCED+R ++K+L+LLNI  + K F   N   EKQ       FI +F     + CL+SDAGYP LSDPG  +IN  I  N +++I  INGPS+LM  LI SGF ++ +LF GFL+H +N  ++ L+  +N+  TI+ FE+VHR+++TL+ +K +F N+ ++ I RELTK++E+ Y
  S:     2 KTLKVVATPIGNIQEISERAKKALQDCEVLFCEDSRVTRKMLDLLNIDCKQKKFVINNSFKEKQNLTFAEEFITNF-----KCCLVSDAGYPSLSDPGNEMINWIISKNKEIRIEVINGPSALMCGLITSGFKTTPLLFLGFLSHKQNQLKNYLSTYQNQKSTIVFFEAVHRLENTLETVKNVFKNN-DVFIGRELTKLHESHY 199
>gi|169824819|ref|YP_001692430.1| putative methyltransferase [Finegoldia magna ATCC 29328] >gi|167831624|dbj|BAG08540.1| putative methyltransferase [Finegoldia magna ATCC 29328] (275 aa)
Score = 390, Expect = 4.8e-36, Identities = 96/269 (35%), Positives = 161/269 (59%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           K+++V TPIGN+K+++  ++  L N  + +CEDTRN+ KLLN  +I     +++  N  +  ++ I+    +     ++SDAG P +SDPG +L+   I  + D++++ G S+ + +L+ SGF S    F GF+    + K    +Q+KN + T II+ESVHR++ T++ + E   + K IC+ RELTK++E++ + +   + E+   E  KGEFVI+ID  ++E E I  +E        +L +LI  G  +K A K+VS  Y LK N +Y
  S:     7 KIYVVPTPIGNLKDMTLRSLDVLKNVDVIYCEDTRNTSKLLNYYDIKTPLVSYHKHNEQSRSEEIIDKILLEHINCAVVSDAGMPSISDPGQILLEKAIDRDVDIEVLPGASAAITALVRSGFDSLQFAFLGFVPRKNSDKNKFYDQIKNATMTTIIYESVHRVEATVEELSEFLGDRK-ICVLRELTKIHESVIKGTCPEVMEMLKNETVKGEFVIVIDKLIEENEEIDVKE--------KLTELINDGISKKQAVKIVSDMYGLKKNDVY 269
>gi|169351612|ref|ZP_02868550.1| hypothetical protein CLOSPI_02392 [Clostridium spiroforme DSM 1552] >gi|169291834|gb|EDS73967.1| hypothetical protein CLOSPI_02392 [Clostridium spiroforme DSM 1552] (284 aa)
Score = 384, Expect = 2.4e-35, Identities = 107/276 (38%), Positives = 157/276 (56%)
  Q:     2 NKK--LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           NKK  +++VATPIGN++EI+  AI  L        EDTRN+ KLLN  NI  +  + +  N       I +   + N   L+SDAGYP +SDPG+ L+   IK   +V  I+G ++ + +L+VSG      +FYGFL+H+   K+ +L+ LK   +TII +ES HRI  TL+++ EIF N + I + RE+TK +E I R +I  I EI    KGE VI++  N    E    E+T     +  +++ I KG   K A K V+   +LK N +Y  + Q
  S:     9 NKKPCIYLVATPIGNLEEITYRAIRILKEVDYIAAEDTRNTIKLLNYYNIKTKLISHHEHNIKQSIPKIINLLLEGNNIALVSDAGYPAISDPGYELVKEAIKKEINVIPISGANACLDALVVSGISPQPFIFYGFLDHSDKKKKRELDNLKKNQETIIFYESPHRITKTLQLMLEIFGN-REIALCREITKKHEEIIRGNIDEILEISPNLKGEIVIVVSGNNGVIEEPVFEQT----IIEHVDEYIAKGMSVKDAIKEVAKVRNLKKNEVYAKYHQ 281
>gi|118725992|ref|ZP_01574626.1| Protein of unknown function UPF0011 [Clostridium cellulolyticum H10] >gi|118664691|gb|EAV71319.1| Protein of unknown function UPF0011 [Clostridium cellulolyticum H10] (290 aa)
Score = 381, Expect = 5.4e-35, Identities = 100/270 (37%), Positives = 154/270 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNE--LEKLIRKGEKEKVACKMVSYKYSLKSNSLYN 273
           KL++VATPIGN+++I+  AI TL +      EDTR + KLLN   I     ++Y  N   +  ++           L+SDAG P +SDPG  L+ L I+N  +V +I GP + +  L++SG P+   +F GFL  NK  +Q++L QLKNE++TII +E+ H++  TLK I   + + + I +ARELTK  E + R S+    E   TE  KGEFV++I+    E   +++E   YS+   E  + + + +G  +K A K  +    L    +YN
  S:    14 KLYLVATPIGNLQDITFRAINTLKDVDFIAAEDTRQTIKLLNHFEIKKPLVSYYEHNKLVKGNYLIEQLLSGKNIALVSDAGSPGISDPGEDLVRLAIENGIEVTMIPGPVAAVTGLVISGLPAGRFVFEGFLPMNKRSRQERLQQLKNETRTIIFYEAPHKLSYTLKDIYNAWGD-RRIALARELTKRFEEVIRCSLFEAMERFQTEAPKGEFVVIIEGQ-DEALLVEQEREKYSIVSIEDHVNRYVEEGLTKKEAIKKAAEDRGLNKRDIYN 285
>gi|160914733|ref|ZP_02076947.1| hypothetical protein EUBDOL_00740 [Eubacterium dolichum DSM 3991] >gi|158433273|gb|EDP11562.1| hypothetical protein EUBDOL_00740 [Eubacterium dolichum DSM 3991] (284 aa)
Score = 381, Expect = 6.6e-35, Identities = 92/268 (34%), Positives = 150/268 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L+IVATPIGN+ E++  AI  L +  +   EDTRN+ +L    +I       +  N       +     K N   L+SDAGYP++SDPG++ +   I+    V  I+G ++++ +L+ SG  + + LFYGFL   +  +  +L  L +   T++ +E+ HRI+  LK +  +F++ +NIC+ARELTK +E + R  I+ I EI    KGE V++++   KE E+I  + T   VY  E+ + I++G     A K V+ +  L  N +Y
  S:    14 LYIVATPIGNLSEMTPRAIEVLKSVDVIAAEDTRNTMRLCAHFDIHTRLIAHHKYNEETSADGLLDLLDKGNSVALVSDAGYPLVSDPGYVAVQKVIEKGHPVIPISGSNAMLAALVASGLDTQHFLFYGFLKAQEKERVKELQVLADYPFTMVFYEAPHRIEKMLKSMLAVFED-RNICLARELTKKHEELIRGKISEILEIVGECKGEMVVVVE-GAKEKEAI-VDATSPLVY-EEIHRYIQEGLTTNAAIKRVAKEMGLSKNEVY 277
>gi|161506956|ref|YP_001576910.1| putative methyltransferase [Lactobacillus helveticus DPC 4571] >gi|160347945|gb|ABX26619.1| putative methyltransferase [Lactobacillus helveticus DPC 4571] (284 aa)
Score = 376, Expect = 2.5e-34, Identities = 91/274 (33%), Positives = 148/274 (54%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           KL++V TPIGN+++I+  A   LT+      EDTR S  LL  + +     +F+  N       +     + N    +SDAG P++SDPG++L+   IKN+  V  + GPS+   +LI SGF +    +YGFL    + ++    Q+     T I +E+ HR+  TLK +  +    + I  ARELTK++E   R ++  + E   +   +GEFVILI  N   TE+ K  +  +S  ++ +  L++KGE +K A K V+ ++ +  N LY+ + Q
  S:    13 KLYLVPTPIGNLEDITIRAKKVLTDADYIAAEDTRTSGILLEKIGVHNRMISFHKYNSKERAPELIKLMQEGNVIAEISDAGMPVISDPGYILVQECIKNDIPVVPLPGPSAFATALIASGFDAQPFTYYGFLPRKSSEQKPYFEQMNKAKATSIFYEAPHRLAKTLKNLATVLPKDRQIVAARELTKIHEEFIRGTVEEVTEYFAQNAPRGEFVILISPN---TEAPK--QLSWSELIDLVNTLVKKGESKKDAIKQVAKEHHVSKNELYDEYHQ 283
>gi|31544731|ref|NP_853309.1| methyl transferase [Mycoplasma gallisepticum R] >gi|31541577|gb|AAP56877.1| predicted methyl transferas [Mycoplasma gallisepticum R] (273 aa)
Score = 375, Expect = 2.7e-34, Identities = 111/270 (41%), Positives = 163/270 (60%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQ--FINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQI-INGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDN-NVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L++V  PIGN+ EI+  A+  L    I +CE+T N KKLLNLLNI+  +K   S +  NE     +     K N+  L+SDAG+P ++DPG  L++     +++  I ING ++ + +L  SGF SS   + GF  + K    ++LN+      T+I +ESVHRIK+TL++I E F + + +CIARELTK  E++Y   I+ I   KI  KGEFVILI+  N+K+   I +E       + EL  LI+   + K ACK ++ KY+LKS+ LY F
  S:     4 LYLVGLPIGNLSEINHRALEILNQLEIIYCENTDNFKKLLNLLNINFRDKKLISYHKFNETNRFIMIQEQLKSNDVGLVSDAGFPCINDPGQKLVSYLRSIDFNQIICINGSNAALCALATSGFESSQFYYGGFFGYKKQEIINELNEKLKYDTTLIYYESVHRIKNTLEIINENFPDLE-VCIARELTKKFESLYFGKISEIIG-KIEYKGEFVILINKRNIKQENEINEE------IIKELNTLIKYNMRSKDACKYLADKYNLKSSLLYAF 269
>gi|126701170|ref|YP_001090067.1| putative corrin/porphyrin methyltransferase [Clostridium difficile 630] >gi|145952705|ref|ZP_01801714.1| hypothetical protein CdifQ_04004086 [Clostridium difficile QCD-32g58] >gi|168697837|ref|ZP_02730114.1| putative corrin/porphyrin methyltransferase [Clostridium difficile QCD-37x79] >gi|168726471|ref|ZP_02758748.1| putative corrin/porphyrin methyltransferase [Clostridium difficile QCD-76w55] >gi|168730082|ref|ZP_02762359.1| putative corrin/porphyrin methyltransferase [Clostridium difficile QCD-97b34] >gi|196162271|ref|ZP_03122832.1| putative corrin/porphyrin methyltransferase [Clostridium difficile CIP 107932] >gi|115252607|emb|CAJ70450.1| putative corrin/porphyrin methyltransferase [Clostridium difficile 630] (277 aa)
Score = 375, Expect = 3.1e-34, Identities = 102/272 (37%), Positives = 160/272 (58%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           M+ KL+I  TPIGN+++I+   + TL    +   EDTR+S KLLN   IS    +++  N +++  ++ +         L+SDAG P +SDPG  +I   I+NN +++++ G ++ + +L+ SG  +   +F GFL+ +K +++ QL +LK ES+TII +ES HR+KDTLK + +I  N +NI I RELTK  + I R +I     IKI E    +GEFV++++      E  KKE  D       + KLI  G  +K A K+V     LK + +Y
  S:     1 MSGKLYICPTPIGNLEDITYRTLRTLKEVDLIAAEDTRHSIKLLNHFEISKPLTSYHEHNKDSKGDYLINKLIDGENIALISDAGMPGISDPGEEIIKQAIQNNIEIEVLPGATAFVTALVGSGMDTHRFVFEGFLDRDKKVRKAQLEELKEESRTIIFYESPHRLKDTLKDMLKILGN-RNISINRELTKKYQEIIRENIETT--IKIFEEKEVRGEFVLIVEGF--HGEKSKKENYDGLTDREYVLKLIESGMNKKDAIKIVCKDRKLKKDVVY 271
>gi|119713522|gb|ABL97575.1| hypothetical protein MBMO_EB0-35D03.0038 [uncultured marine bacterium EB0_35D03] (276 aa)
Score = 373, Expect = 5.7e-34, Identities = 90/219 (41%), Positives = 130/219 (59%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKIT----EKGEFVILI 219
           MN KLFIVATPIGN+ +I+  AI  L +  I   EDTR+SKKL     I+   + F+  N   +   I +      +  L+SDAG P++SDPGF+L++   K+  DV  I GPS+L+ +L  SG       F+GFL   +  +   L    N  +TII +ES  RI  TL+ + ++F  S+++CIA+ELTK  ETI  + + N+ E  +T    +KGEFVIL+
  S:     1 MNGKLFIVATPIGNLSDITLRAIDILKSVDIVLAEDTRHSKKLFIHYEITTSIRAFHEHNEREKTDSIIAEINDGKDVALISDAGTPLISDPGFILVSTAKKDGIDVVPIPGPSALITALSASGLAIDKFTFFGFLPSRQAARLKMLQAKTNLKETIIFYESPKRILSTLEDLLKVFGASRDVCIAKELTKSFETILTNKLPNLIEYFVTDESHQKGEFVILV 223
>gi|149195113|ref|ZP_01872205.1| hypothetical protein CMTB2_06416 [Caminibacter mediatlanticus TB-2] >gi|149134826|gb|EDM23310.1| hypothetical protein CMTB2_06416 [Caminibacter mediatlanticus TB-2] (260 aa)
Score = 372, Expect = 6.5e-34, Identities = 101/257 (39%), Positives = 153/257 (59%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFD---FKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVS 261
           L ++ TPIGN+++IS+ AI+ L  + I FCEDTR +KKLLNLLNI  +NK F S++ +NE + +   D    K      +SDAG P +SDPG  L+    K+N    +I GP++ + + + SGF     +FYGFL H  + ++ +LN++ N  K  I++ES HRI+  L  +KE   N + I +A+ELTK++ET  +  + +IN I+ T KGE+V++ID         +K  T    Y   L   + K EK K+  K+ S
  S:     2 LTLIPTPIGNLEDISKRAISALKTSEILFCEDTRVTKKLLNLLNIDYKNKEFISMHSHNEDKILQKLDPEILKTKNVGYVSDAGMPGISDPGSKLVKFAQKHNIPYTVIPGPNAAITAFVASGF-EGEFIFYGFLPHKGSEREKKLNEVINSQKISILYESPHRIEKLLNELKEKIPN-RTIFLAKELTKLHETFIKGKVKDIN-IENT-KGEWVVVIDKG-------EKANTLSLTYDEILNLPLPKKEKSKLLAKISS 250
>gi|196163959|ref|ZP_03124490.1| putative corrin/porphyrin methyltransferase [Clostridium difficile QCD-23m63] (277 aa)
Score = 370, Expect = 1.2e-33, Identities = 101/272 (37%), Positives = 160/272 (58%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           M+ KL+I  TPIGN+++I+   +  L    +   EDTR+S KLLN   IS    +++  N +++ +++ +         L+SDAG P +SDPG  +I   I+NN +++++ G ++ + +L+ SG  +   +F GFL+ +K +++ QL +LK ES+TII +ES HR+KDTLK + +I  N +NI I RELTK  + I R +I     IKI E    +GEFV++++      E  KKE  D       + KLI  G  +K A K+V     LK + +Y
  S:     1 MSGKLYICPTPIGNLEDITYRTLRILKEVDLIAAEDTRHSIKLLNHFEISKPLTSYHEHNKDSKGEYLINKLIDGENIALISDAGMPGISDPGEEIIKQAIQNNIEIEVLPGATAFVTALVGSGMDTHKFVFEGFLDRDKKVRKAQLEELKEESRTIIFYESPHRLKDTLKDMFKILGN-RNISINRELTKKYQEIIRENIETT--IKIFEEKEVRGEFVLIVEGF--HGEKSKKENYDELTDREYVLKLIESGMNKKDAIKIVCKDRKLKKDVVY 271
>gi|168714893|ref|ZP_02747170.1| putative corrin/porphyrin methyltransferase [Clostridium difficile QCD-63q42] >gi|196125484|ref|ZP_03117233.1| putative corrin/porphyrin methyltransferase [Clostridium difficile ATCC 43255] (277 aa)
Score = 370, Expect = 1.2e-33, Identities = 101/272 (37%), Positives = 159/272 (58%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           M+ KL+I  TPIGN+++I+   +  L    +   EDTR+S KLLN   IS    +++  N +++  ++ +         L+SDAG P +SDPG  +I   I+NN +++++ G ++ + +L+ SG  +   +F GFL+ +K +++ QL +LK ES+TII +ES HR+KDTLK + +I  N +NI I RELTK  + I R +I     IKI E    +GEFV++++      E  KKE  D       + KLI  G  +K A K+V     LK + +Y
  S:     1 MSGKLYICPTPIGNLEDITYRTLRILKEVDLIAAEDTRHSIKLLNHFEISKPLTSYHEHNKDSKGDYLINKLIDGENIALISDAGMPGISDPGEEIIKQAIQNNIEIEVLPGATAFVTALVGSGMDTHRFVFEGFLDRDKKVRKAQLEELKEESRTIIFYESPHRLKDTLKDMLKILGN-RNISINRELTKKYQEIIRENIETT--IKIFEEKEVRGEFVLIVEGF--HGEKSKKENYDGLTDREYVLKLIESGMNKKDAIKIVCKDRKLKKDVVY 271
>gi|116629047|ref|YP_814219.1| methyltransferase [Lactobacillus gasseri ATCC 33323] >gi|116094629|gb|ABJ59781.1| Predicted methyltransferase [Lactobacillus gasseri ATCC 33323] (285 aa)
Score = 369, Expect = 1.4e-33, Identities = 88/274 (32%), Positives = 147/274 (53%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           +L++V TPIGN+++I+  A   LT       EDTR S  LL  + +  +  +F+  N       +     + N    +SDAG P++SDPG++L+   IKN+  V  + GPS+   +LI SGF +    +YGFL    + +++    +     T I +E+ HR++ TLK + E+    + I +ARELTK++E   R +I+ INE   K   +GEFV+L+  N  E + +  +E      + ++   +  GE +K A K+V+    +  N LY+ + Q
  S:    14 RLYLVPTPIGNLEDITLRAKRILTEADYIAAEDTRTSGILLEKIGVHNKMISFHKYNSKERAPELIKLLKEGNTIAEISDAGMPVISDPGYILVQECIKNDIPVVALPGPSAFATALIASGFDAQPFTYYGFLPRKSSEQKEYFEMMNQARATSIFYEAPHRLQKTLKTLAEVIKPDRKIVLARELTKIHEEYLRGTISEINEYFTKNDPRGEFVVLVSPNDDEEKQLSWDE-----LIKQVADRVEAGESKKDAIKLVAKANKVSKNELYDKYHQ 284
>gi|126645811|ref|ZP_01718328.1| putative tetrapyrrole (corrin/porphyrin) methylase [Algoriphagus sp. PR1] >gi|126577443|gb|EAZ81663.1| putative tetrapyrrole (corrin/porphyrin) methylase [Algoriphagus sp. PR1] (231 aa)
Score = 367, Expect = 2.2e-33, Identities = 80/215 (37%), Positives = 130/215 (60%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE-YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILI 219
           L++V TPIGN+++I+  AI  L    +   EDTR S KLL  L IS   ++++  N +   + +     KD E + L+SDAG P +SDPGFLL+   +    DVQ + GP++ + +L+ SG P+   +F GFL H K  ++ +++ L +E +T++ +ES HRI  TL+ + E F   +  C++RELTK++E   R ++A +     T   KGE V+++
  S:     9 LYLVPTPIGNLQDITLRAIEVLKAADVILAEDTRTSGKLLKHLEISRPLQSYHIFNEHKTVEKLVQ-RMKDGEHFALISDAGTPAISDPGFLLVREVLAAGLDVQTLPGPTAFVPALVNSGLPNDRFIFEGFLPHKKG-RKTRIDGLVDEVRTMVFYESTHRIMKTLEQLAEAFGADRQACVSRELTKIHEENARGTLAELIAYYQTHPVKGEIVLVV 224
>gi|110004199|emb|CAK98537.1| conserved hypothetical upf0011 methyltransferase protein [Spiroplasma citri] (302 aa)
Score = 367, Expect = 2.3e-33, Identities = 99/278 (35%), Positives = 170/278 (61%)
  Q:     2 NKKLFIVATPIGNIKEISELAITTLTNN-SIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSF--DFKDN-EYCLLSDAGYPILSDPGFLLINLFIKN-NWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI----NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKL-IRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           N K++++ATPIGN++E++  AI  + NN    +CEDTRN+ KLLN  N     K   SLN  NE   +     D   N    ++SDAGYP++SDPG+  +N  +++  +DV  I+G ++ +++++ SG    + LF+GFLN  K  K ++L +L +    II +E+ HRI +TLK+IK +F + K I + +E+TK++E  YR  ++ +     + +    GE+V+++D     T+ +  +E    + + E+++L I++  + K A   V+ KY +  N LYN + Q+K
  S:    14 NPKIYLIATPIGNLQEMTPRAIEVIKNNVQKIYCEDTRNTIKLLNYFNCK---KQLISLNKENEMHRLTEMLNDLAQNLSIAIISDAGYPLISDPGYYAVNHILEHYPYDVIPISGANAALNAIVSSGLNPHHFLFFGFLNKAKTKKINELEKLLSLPYPIIFYEAPHRILETLKIIKTVFGDRK-IAVGKEITKIHEQWYRGHLSKVLLFLQQEENVSVGEYVLVVDGVGNVTDPVIADE----ILVAEIDQLIIKQNYRVKQAIDFVANKYKISKNVLYNKYHQQK 293
>gi|126652966|ref|ZP_01725108.1| hypothetical protein BB14905_03941 [Bacillus sp. B14905] >gi|126590296|gb|EAZ84418.1| hypothetical protein BB14905_03941 [Bacillus sp. B14905] (291 aa)
Score = 367, Expect = 2.5e-33, Identities = 99/274 (36%), Positives = 153/274 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEK----LIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQR 278
           L++V TPIGN+++IS  A+  L    I   EDTRN+KKL N   I     +++  N     + + +F  +     L+SDAG P +SDPG  ++   I  N+ V  I GP++ + +LI SG       FYGFLN  K  ++ QL QLK   +TI+++E+ HR+K+TLK ++ I  N ++I +ARELTK  E   R ++A   E   TE  +GEF I+++ N +E E ++  E  Y   L+ +E     L +     K A K V+ +  L    +YN +  +
  S:    15 LYLVGTPIGNLEDISVRALRILKEADIIAAEDTRNTKKLCNYFEIDTPLMSYHEHNLAVGGEKLLTFLQEGKTIALVSDAGLPCISDPGADIVEKAIAQNFPVVPIPGPNAAITALIASGLTPQPFFFYGFLNRGKKDRRQQLEQLKKRQETILLYEAPHRLKETLKDMEAILGN-RHIVLARELTKKFEEFLRGTLAEAIEWSQTEEIRGEFCIVLEGN-QEVE-VEDSEKAYWHTLSIIEHVDYILQQNDVSSKEAIKEVAKERQLAKRDVYNEYHNQ 291
>gi|71278341|ref|YP_271079.1| hypothetical protein CPS_4431 [Colwellia psychrerythraea 34H] >gi|71144081|gb|AAZ24554.1| conserved hypothetical protein TIGR00096 [Colwellia psychrerythraea 34H] (282 aa)
Score = 366, Expect = 3.7e-33, Identities = 99/268 (36%), Positives = 148/268 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQF---INSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--------NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L+IVATPIGN+ +IS+ AI  LT   +  CEDTR++ KLL+    S++NKT  SL+ +NE+Q    + S   +     L+SDAG P++SDPGF L+         V  I G  + + +L V+G P+    F GFL      +Q  L  L +ES+T++ +++  R  DT++ I       + I IARELTK  ETI+  +  N+        N++    KGE V++I       E  K  E + S  +    KL+    K K AC + +  Y +K N+LY
  S:    11 LYIVATPIGNLSDISQRAIDILTQVDVIACEDTRHTGKLLSAF--SIKNKTM-SLHDHNERQRQDQVASMLQEGKTIALVSDAGTPLISDPGFHLVRHCRSLGLQVSPIPGACAAIAALSVAGLPTDRFSFEGFLPSKSGARQATLTALADESRTMVFYDAPRRAIDTVQDIVTTLGGDRYIVIARELTKTFETIHSDTAENLLAWLEQDANQL----KGEMVLII-------EGYKATENEISAEVINTLKLLLAEMKPKKACAIAAEIYGVKKNALY 275
>gi|15923479|ref|NP_371013.1| hypothetical protein SAV0489 [Staphylococcus aureus subsp. aureus Mu50] >gi|15926166|ref|NP_373699.1| hypothetical protein SA0447 [Staphylococcus aureus subsp. aureus N315] >gi|21282173|ref|NP_645261.1| hypothetical protein MW0444 [Staphylococcus aureus subsp. aureus MW2] >gi|49485353|ref|YP_042574.1| tetrapyrrole (corrin/porphyrin) methylase family protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651370|ref|YP_185419.1| tetrapyrrole methylase family protein [Staphylococcus aureus subsp. aureus COL] >gi|87160205|ref|YP_493175.1| hypothetical protein SAUSA300_0466 [Staphylococcus aureus subsp. aureus USA300] >gi|88194246|ref|YP_499038.1| hypothetical protein SAOUHSC_00459 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148266947|ref|YP_001245890.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Staphylococcus aureus subsp. aureus JH9] >gi|150392993|ref|YP_001315668.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Staphylococcus aureus subsp. aureus JH1] >gi|151220664|ref|YP_001331486.1| hypothetical protein NWMN_0452 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156978817|ref|YP_001441076.1| hypothetical protein SAHV_0486 [Staphylococcus aureus subsp. aureus Mu3] >gi|161508735|ref|YP_001574394.1| tetrapyrrole (corrin/porphyrin) methyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728131|ref|ZP_02760408.1| possible tetrapyrrole (corrin/porphyrin) methyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|13700379|dbj|BAB41677.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] >gi|14246257|dbj|BAB56651.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] >gi|21203609|dbj|BAB94309.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] >gi|49243796|emb|CAG42221.1| tetrapyrrole (corrin/porphyrin) methylase family protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|57285556|gb|AAW37650.1| tetrapyrrole methylase family protein [Staphylococcus aureus subsp. aureus COL] >gi|87126179|gb|ABD20693.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201804|gb|ABD29614.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740016|gb|ABQ48314.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Staphylococcus aureus subsp. aureus JH9] >gi|149945445|gb|ABR51381.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Staphylococcus aureus subsp. aureus JH1] >gi|150373464|dbj|BAF66724.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|156720952|dbj|BAF77369.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] >gi|160367544|gb|ABX28515.1| possible tetrapyrrole (corrin/porphyrin) methyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (279 aa)
Score = 365, Expect = 4.6e-33, Identities = 98/273 (35%), Positives = 151/273 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETE-------SIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           L++V TPIGN+ +I+  A+  L    +  CEDTR + KL N  +I    K+++  N + +  FI        +  L+SDAG P++SDPG+ L+    + N  V+ + GP++ + +L+ SG PS    F GFL   +  K   L Q  +E+ T+II+ES HR+ DTLK I +I D ++ + + RELTK  E I    +    A I +  +  KGEFVILI+      E       SI  E  D+ +  +++        K K A K V+ +  LK+N +YN + Q
  S:     4 LYLVGTPIGNLADITYRAVDVLKRVDMIACEDTRVTSKLCNHYDIPTPLKSYHEHNKDKQTAFIIEQLELGLDVALVSDAGLPLISDPGYELVVAAREANIKVETVPGPNAGLTALMASGLPSYVYTFLGFLPRKEKEKSAVLEQRMHENSTLIIYESPHRVTDTLKTIAKI-DATRQVSLGRELTKKFEQIVTDDVTQLQALIQQGDVPLKGEFVILIEGAKANNEISWFDDLSI-NEHVDHYIQTSQM--------KPKQAIKKVAEERQLKTNEVYNIYHQ 277
>gi|169335040|ref|ZP_02862233.1| hypothetical protein ANASTE_01446 [Anaerofustis stercorihominis DSM 17244] >gi|169257778|gb|EDS71744.1| hypothetical protein ANASTE_01446 [Anaerofustis stercorihominis DSM 17244] (274 aa)
Score = 365, Expect = 4.9e-33, Identities = 99/278 (35%), Positives = 166/278 (59%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSS----IANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQR 278
           M  K++IV+TPIGN+++++  AI  L    +  CEDTR+S KLLN   I  +  +++  N      +I S   ++    L+SDAG P++SDPG +L+   I+N+    ++ G ++L+ +LI+SGF S   LF GFL    N K+++LN LK+  KT+I + S + + D +K I  +  + K   I++E+TK++ET YR +    IA +N+++I  KGEFVI+++ N +E + + KEE          +  I+KGE  K   K ++ + +L    LYN+  ++
  S:     1 MEDKVYIVSTPIGNLEDMTFRAIKVLKEVDVILCEDTRHSIKLLNHFEIKNKLISYHKFNEKERIDYILSLINENKTLALISDAGTPLISDPGNILVKELIENDIKFTVVPGANALLPALILSGFNSEEFLFIGFLPKKNNKKEEKLNTLKDFDKTLIFYSSPYELIDMIKAIDNVLGDRKT-AISKEITKLHETTYRGTPKELIAMLNDMEI--KGEFVIVVEGNKEEKKLLTKEEAK-----QIFDMEIQKGEHPKDLIKKLAKENNLNKRELYNYLMKK 274
>gi|169825666|ref|YP_001695824.1| hypothetical protein Bsph_0056 [Lysinibacillus sphaericus C3-41] >gi|168990154|gb|ACA37694.1| UPF0011 protein [Lysinibacillus sphaericus C3-41] (291 aa)
Score = 364, Expect = 6.2e-33, Identities = 95/274 (34%), Positives = 153/274 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGE-KEKVACKMVSYKYSLKSNSLYNFWQQR 278
           L++V TPIGN+++IS  A+  L    I   EDTRN++KL N   I     +++  N     + + +F  +     L+SDAG P +SDPG  ++   I  N+ V  I GP++ + +LI SG       FYGFLN  K  ++ QL  LK   +TI+++E+ HRIK+TLK ++ I  N + I +ARELTK  E   R ++A   E    E  +GEF I+I+ N +  E   +E   +++ + E ++ +I + +   K A K V+ +  L    +YN + ++
  S:    15 LYLVGTPIGNLEDISVRALRILKEVDIIAAEDTRNTRKLCNYFEIETPLMSYHEHNLAVGGEKLLTFLQEGKTIALVSDAGLPCISDPGADIVEKAIAQNFPVVPIPGPNAAITALIASGLTPQPFFFYGFLNRGKKERRQQLELLKKRQETILLYEAPHRIKETLKDMEAILGN-RRIVLARELTKKFEEFLRGTLAEAVEWSQAEEIRGEFCIVIEGNQQVEEEDSEEAYWHTLSIIEHVDYIIEQTDVSSKEAIKEVAKQRQLAKRDVYNEYHKQ 291
>gi|49482716|ref|YP_039940.1| tetrapyrrole (corrin/porphyrin) methylase family protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|49240845|emb|CAG39512.1| tetrapyrrole (corrin/porphyrin) methylase family protein [Staphylococcus aureus subsp. aureus MRSA252] (279 aa)
Score = 363, Expect = 7.6e-33, Identities = 98/273 (35%), Positives = 151/273 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETE-------SIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           L++V TPIGN+ +I+  A+  L    +  CEDTR + KL N  +I    K+++  N + +  FI        +  L+SDAG P++SDPG+ L+    + N  V+ + GP++ + +L+ SG PS    F GFL   +  K   L Q  +E+ T+II+ES HR+ DTLK I +I D ++ + + RELTK  E I    +    A I +  +  KGEFVILI+      E       SI  E  D+ +  +++        K K A K V+ +  LK+N +YN + Q
  S:     4 LYLVGTPIGNLADITYRAVDVLKRVDMIACEDTRVTSKLCNHYDIPTPLKSYHEHNKDKQTAFIIEQLELGLDVALVSDAGLPLISDPGYELVVAAREANIKVETVPGPNAGLTALMASGLPSYVYTFLGFLPRKEKEKSAVLEQRMHENSTLIIYESPHRVTDTLKTIAKI-DATRQVSLGRELTKKFEQIVTDDVTQLQALIQQGDVPLKGEFVILIEGAKANNEISWFDDLSI-NEHVDHYIQTSQM--------KPKQAIKKVAEERQLKTNEVYNIYHQ 277
>gi|87121507|ref|ZP_01077396.1| hypothetical methyltransferase [Marinomonas sp. MED121] >gi|86163350|gb|EAQ64626.1| hypothetical methyltransferase [Marinomonas sp. MED121] (299 aa)
Score = 363, Expect = 7.6e-33, Identities = 93/276 (33%), Positives = 152/276 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK---QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI----NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIR---KGEKEKVACKMVSYKYSLKSNSLYNFWQQRKN 280
           L+IVATPIGN+ ++S+ A  TL   S    EDTR++KKLLN  NI       +SL+ +NEK   Q+I        +  L+SDAG P++SDPG+ +++      + V  + GPS+++ +L  SG P+    F GFL      +++ +   K ++ T + +ES HRIKD++  + ++F++   I +ARELTK  ET  +   + I     E     +GEFV+++D          +EETD      E ++++    +    K A ++ +    LK N LY    Q ++
  S:    26 LYIVATPIGNLDDLSKRAKDTLEKASFIAAEDTRHTKKLLNYFNIEAR---LFSLHDHNEKDRAQYIAKLLDDGEDVALVSDAGTPLISDPGYHVVSYLRDLGYQVSPVPGPSAIITALCASGLPTDKFFFQGFLPAKSKSRKEVMASWKQQAGTTVFYESTHRIKDSISDLMDVFEDDVEIVLARELTKTFETFLKGKPSYILQRFEEDSNQVRGEFVVMLD---------YREETDADDNDQEAKRILEILLQDLSLKQASQLAAKITGLKKNYLYQIALQMQS 299
>gi|89210933|ref|ZP_01189315.1| Protein of unknown function UPF0011 [Halothermothrix orenii H 168] >gi|89159479|gb|EAR79145.1| Protein of unknown function UPF0011 [Halothermothrix orenii H 168] (286 aa)
Score = 363, Expect = 8.2e-33, Identities = 100/272 (36%), Positives = 159/272 (58%)
  Q:     1 MNK--KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKM-NETIYRSSIANINE-IKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           MNK  KL+I  TP+GN+++IS  AI TL    +   EDTR + KLLN  +IS    +++  N   + ++ IN  + +  +  L+SDAG P +SDPG +LI   I   + V  + GP++ + +L+VSGF +   +F GFL      ++++L  +KNE +TIII+ES HR+K TL+ +   +   + I + RELTK+  E +Y +    + E  K   KGE VI+I+  VKE ++  ++    SV ++ ++ L+ KG  +K A K VS    L    +Y
  S:     1 MNKIGKLYICGTPLGNLEDISFRAIKTLKEVDLVAAEDTRRTVKLLNYYDISTPLTSYHEHNEEKKSEELINKLE-EGQKIALVSDAGMPGISDPGLILIQKVIDRGFKVIPVPGPTAAVSALVVSGFDTDRFVFEGFLPRRGKTREERLKDIKNEKRTIIIYESPHRLKKTLRDL-HTYIPERRIALIRELTKVYEEKMYGTPSELLEEATKRKIKGELVIVIEGGVKENQT-GRDFGSLSV-VDHIKMLMDKGYTKKKAIKEVSRVRGLPKKEVY 273
>gi|118594400|ref|ZP_01551747.1| tetrapyrrole (Corrin/Porphyrin) methylase domain protein [Methylophilales bacterium HTCC2181] >gi|118440178|gb|EAV46805.1| tetrapyrrole (Corrin/Porphyrin) methylase domain protein [Methylophilales bacterium HTCC2181] (280 aa)
Score = 362, Expect = 8.7e-33, Identities = 99/249 (39%), Positives = 145/249 (58%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEI---KITEKGEFVILIDNNVKETESIK-------KEETDYSVYLNELEKLIRK 249
           M   L++VATPIGN  +IS  A+ TL N  +  CEDTR+S  LL+   I  +  + +  N  ++  +I S   +      +SDAG P +SDPG LL+        +V  I GPS+L+ +  VSGFP++N LFYGFL +     +  L  +  +  T II+ES HRI  TL++++++F     I I RELTK+ ETIY+  + N I EI   K  +KGEFV+++      +ES +        E+T   V LN+  K+I K
  S:     1 MKAGLYLVATPIGNRDDISIRALDTLKNVDMIACEDTRHSSLLLSFFGIKKKLISLHQHNEEDKATYIASLIQQGYALAYISDAGTPAISDPGALLVRHMHNLQINVVPIPGPSALVTAFSVSGFPTNNFLFYGFLPNANGKCKKALLDIYQKKVTAIIYESPHRIIKTLELVRQVFGEEHEIVITRELTKIFETIYKGYVGNLITEIESKKDNQKGEFVLILSEPNDHSESSQLMPLKEALEDTLNVVSLNQSVKIIAK 260
>gi|167749301|ref|ZP_02421428.1| hypothetical protein EUBSIR_00252 [Eubacterium siraeum DSM 15702] >gi|167657746|gb|EDS01876.1| hypothetical protein EUBSIR_00252 [Eubacterium siraeum DSM 15702] (276 aa)
Score = 362, Expect = 9.4e-33, Identities = 89/272 (32%), Positives = 159/272 (58%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYC-LLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILIDN--NVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           M  KL+IV TPIGN+ ++S  A+ TL        EDTR ++KLL   +IS    +++  +GN   + I +    D E C +++DAG P +SDPG  L+    ++  +++ + GPS+ + +L +SG  +S   F GFL+  K  + + L+++K+ S+T+I +E+ H++K+TL  +  +  N + I + RELTK++E + + +I+ + E   ++T +GE+V++++    VKE E I     D ++   E   L+  G K   AC+ V+ K     + +Y
  S:     1 MAGKLYIVGTPIGNLSDLSPRAVETLGKVDFIAAEDTRVTQKLLTHFSISKPMVSYHKFSGNKRGEDITA-RLLDGETCAIVTDAGMPCISDPGEELVRECHEHGVEIESVPGPSAAITALCMSGLDTSRFSFEGFLSVTKKQRDEHLDEIKDFSRTLIFYEAPHKLKNTLDDLYRVLGN-RQIALCRELTKIHEEVIKGTISEMIERYKELTPRGEYVLVVEGKPKVKENEDITL--ADAALMAKE---LVDGGIKPSDACRQVAGKTPFSKSEIY 270
>gi|146297418|ref|YP_001181189.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410994|gb|ABP67998.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Caldicellulosiruptor saccharolyticus DSM 8903] (286 aa)
Score = 361, Expect = 1.3e-32, Identities = 88/272 (32%), Positives = 155/272 (56%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           M+ KLFIV TPIGN+ ++S+ A+ TL       CEDTR + KLLN   I     +++  +   ++  I        +  L+SDAG P++SDPG+ L+   IK   +V +I GP + + +L++SG  + N +F GFL  NK  K+++L  LK E +T+I +E+ H++ DTL  +  +F   + I I +E+TK++E++  +++    +   K   KGE+V+++    +E    K ++ D       L++ + +G  +K A K+V+ +  +  N +Y
  S:     1 MSGKLFIVGTPIGNLDDMSKRALDTLNIVDFIACEDTRVTIKLLNHFGIKKRLVSYHEFSPEEKEDRIIQELKNGKKIALVSDAGMPLISDPGYELVRRCIKEGIEVTVIPGPCAFVCALVISGQNTQNFVFEGFLPKNKRAKKEKLESLKFEKRTMIFYEAPHKLLDTLSQMTAVFGEDREISIVKEITKVHESVMITTLREAIDFFEKTPPKGEYVLVV-RGFEENAKEKDKKFDVESIKKRLKEKMAQGFTKKEAVKIVAEELKVAKNMVY 273
>gi|117922311|ref|YP_871503.1| hypothetical protein Shewana3_3879 [Shewanella sp. ANA-3] >gi|117614643|gb|ABK50097.1| Protein of unknown function UPF0011 [Shewanella sp. ANA-3] (281 aa)
Score = 360, Expect = 1.4e-32, Identities = 88/270 (32%), Positives = 147/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ ++S  AI  LT  ++  CEDTR+S KLL+   IS +    +  N     Q+I           L+SDAG P++SDPG+ L++   ++ + V  + GP + + +L  SG PS    F GFL   +  + D+L +LK +S+T+I +ES HRI+ +L  + E+    + + +ARE+TK  ET     +    A ++     +KGE V+++  +     + + ++   +V +N L+ L  +   +K A       + LK N+LY F
  S:     7 LYIVPTPIGNLGDMSPRAIEVLTQVALIACEDTRHSGKLLSHFGISTQTIALHDHNERARAQWIVEQLAAGQSIALISDAGTPLISDPGYHLVSHVRQSGFSVIPLPGPCAAITALSASGLPSDRFSFEGFLPSKEKARADKLLELKEDSRTLIFYESPHRIEHSLTTMVEVLGGERQVVMAREVTKTFETFLSGPVAEVLATVSSDPYQQKGEIVLMVHGH----RAAEDDDAIPTVAINTLKLLCEELPLKKAAAIAAQI-HGLKKNALYKF 275
>gi|82750196|ref|YP_415937.1| tetrapyrrole methylase family protein [Staphylococcus aureus RF122] >gi|82655727|emb|CAI80126.1| tetrapyrrole methylase family protein [Staphylococcus aureus RF122] (279 aa)
Score = 360, Expect = 1.7e-32, Identities = 98/273 (35%), Positives = 150/273 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETE-------SIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           L++V TPIGN+ +I+  A+  L    +  CEDTR + KL N  +I    K+++  N + +  FI        +  L+SDAG P++SDPG+ L+    + N  V+ + GP++ + +L+ SG PS    F GFL   +  K   L Q   E+ T+II+ES HR+ DTLK I +I D ++ + + RELTK  E I    +    A I +  +  KGEFVILI+      E       SI  E  D+ +  +++        K K A K V+ +  LK+N +YN + Q
  S:     4 LYLVGTPIGNLADITYRAVDVLKRVDMIACEDTRVTSKLCNHYDIPTPLKSYHEHNKDKQTAFIIEQLELGLDVALVSDAGLPLISDPGYELVVAAREANIKVEPVPGPNAGLTALMASGLPSYVYTFLGFLPRKEKEKSAVLEQRMYENSTLIIYESPHRVTDTLKTIAKI-DATRQVSLGRELTKKFEQIVTDDVTQLQALIQQGDVPLKGEFVILIEGAKANNEISWFDDLSI-NEHVDHYIQTSQM--------KPKQAIKKVAEERQLKTNEVYNIYHQ 277
>gi|58336722|ref|YP_193307.1| tetrapyrrole methylase family protein [Lactobacillus acidophilus NCFM] >gi|58254039|gb|AAV42276.1| tetrapyrrole methylase family protein [Lactobacillus acidophilus NCFM] (284 aa)
Score = 360, Expect = 1.8e-32, Identities = 87/274 (31%), Positives = 141/274 (51%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           KL++V TPIGN+++I+  A   LT+      EDTR S  LL  + +  +  +F+  N       +            +SDAG P++SDPG++L+   IKN+  V  + GPS+   +LI SGF +    +YGFL    + ++    Q+     T I +E+ HR+  TLK +  +    + I  ARELTK++E   R ++  +     +   +GEFVIL+  N  E E +   E      +  ++ L+ KGE +K A K V+ +  +  N LY+ + Q
  S:    13 KLYLVPTPIGNLEDITIRAKKVLTDADYIAAEDTRTSGILLEKIGVHNKMLSFHKYNSKERAPELVKMMKDGAVIAEISDAGMPVISDPGYILVQECIKNDIPVVPLPGPSAFATALIASGFDAQPFTYYGFLPRKSSEQKKYFEQIAKAKATSIFYEAPHRLAKTLKTMASVLPKDRQIVAARELTKIHEEFVRGTVEELMNYFAENAPRGEFVILVSPNEDEPEQLSWPE-----LVKMVDDLVEKGESKKDAIKQVAKQNKVSKNELYDQYHQ 283
>gi|83319469|ref|YP_424385.1| hypothetical protein MCAP_0410 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283355|gb|ABC01287.1| conserved hypothetical protein, TIGR00096 [Mycoplasma capricolum subsp. capricolum ATCC 27343] (296 aa)
Score = 359, Expect = 2.0e-32, Identities = 108/276 (39%), Positives = 168/276 (60%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLF--IKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFL-NHNKNLKQDQLNQLKNE---SKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRKN 280
           ++++ TPIGN+++IS  AI TL    +  CEDTR SK LL+   I+    + +  N N   + I S   ++    ++SDAG PI+SDP   +IN    +K N ++  I   S+ +H+LI SGF   +  FYGFL N NK  KQ++L +L N+      I ++ESVHR+K T+  + EI D +  I IA+ELTK+NE I  ++I  +N+     +   KGEFVI+I+  +K +   KK+ TD  + +N +++ I++G K K AC++V  K  +  N LY  +  +KN
  S:    14 VYLITTPIGNLEDISLRAIKTLKQVDVICCEDTRTSKVLLDKYQITNNLLSLHKFNENLRVEQIISLLNQNKNIAIISDAGVPIISDPASYIINQLKELKINCNITAIGAGSAYLHALISSGFLIDSHYFYGFLKNKNKISKQNELTELINKYANDSIICLYESVHRLKSTINCLNEILDKNHKIVIAKELTKINEEIIYATIDQMNQYINSDEFVLKGEFVIIINKMIKTS---KKQFTDLEL-INLIDEQIKEGYKLKQACEIVYLKTKISKNILYKKYTFKKN 295
>gi|159028497|emb|CAO87304.1| unnamed protein product [Microcystis aeruginosa PCC 7806] (279 aa)
Score = 359, Expect = 2.3e-32, Identities = 87/271 (32%), Positives = 157/271 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNG-NNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI---ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           KL++V TPIGN+ +++  ++ TL   ++   EDTR++ KLL   +IS    +++  N  +   Q +N    +  +  L++DAG P +SDPG+ LI   I+   +V  I G ++++ +L VSG P+    F GFL   + LKQ++L  LK E++T++ +E+ H++  TL+ ++E F  ++ I + RELTK+ E I+R +I    N+     T KGEF I++  N  + ++I+  + +      EL+++I +G     A + ++   +L  + LY  
  S:     6 KLYVVGTPIGNLDDLTFRSLATLKKVALIAAEDTRHTGKLLQHFDISTPQISYHEHNRLSRLDQLLNILS-QGQDIALVTDAGMPGISDPGYELIKACIEAQIEVVPIPGVTAVITALAVSGLPTERFCFEGFLPGKEKLKQERLEGLKTETRTMVFYEAPHKLIKTLEDLRETFGPTRKIVLGRELTKLYEEIWRGTIDEAINLYRENKTPKGEFTIVVMGN-DQGDNIQLSDEELK---RELKQIIERGVSRSQASRQLAQVTNLSRSRLYKL 275
>gi|153095044|gb|EDN75595.1| possible methyltransferase [Mannheimia haemolytica PHL213] (290 aa)
Score = 358, Expect = 2.8e-32, Identities = 94/270 (34%), Positives = 150/270 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQ----FINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IVATPIGN+ +I++ A+ TL++  +   EDTR+S  LL+   I    K F++L+ +NE+Q     +     K     L+SDAG P++SDPGF L+    +    V  I G  + + +L  SG  S    F GFL      + D+L +L+NE +T+I +ES HRI DTL  ++ +F   + + +ARE+TK  ETIY   + N    +NE     KGE V++++   + +E        +S    +L  L+ +    K A  +V+  +  K N+LY +
  S:    17 LYIVATPIGNLGDITQRALDTLSSVDLVAAEDTRHSGLLLSHYGI---KKPFFALHDHNEQQKAVVLVEKLA-KGENIALISDAGTPLISDPGFHLVRHCRQAGVKVVPIPGACAAVTALCASGIASDRFCFEGFLPAKTKSRCDKLTELENEPRTLIFYESTHRILDTLADMQTVFGEDRYVVMAREITKTWETIYGDQLGNLIEWLNEDSNRIKGEIVLVVEGKPQSSEEA------FSSQAIKLLTLLCQELPLKKAAAIVAETFGYKKNALYQY 284
>gi|15893599|ref|NP_346948.1| methyltransferase [Clostridium acetobutylicum ATCC 824] >gi|15023150|gb|AAK78288.1|AE007545_5 Predicted methyltransferase [Clostridium acetobutylicum ATCC 824] (282 aa)
Score = 357, Expect = 3.7e-32, Identities = 92/273 (33%), Positives = 159/273 (58%)
  Q:     2 NKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDN--SKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           N KLF+V TPIGN+K+I+  A+ TL N  +   EDTR S KLLN  +I     +++  N NN    +     +  +  L++DAG P +SDPG +++  FI+NN + ++I GP++L+ +L+ SG  +S  +F GFL      ++  + ++KN   T+I +E+ H++ +TL     +FDN   + I I RELTK++E I  +++ +  E       KGE+V++I+   +E  +I+K      + + E + K + +G  +K A K V+   +L  + +Y +
  S:     3 NGKLFLVGTPIGNLKDITLRALETLQNCDVIAAEDTRQSLKLLNHFDIKKPLISYHKFNENNRSSELMDMVREGKKVALVTDAGMPGISDPGSVIVEKFIENNLEFEVIPGPTALITALVYSGLDTSKFVFRGFLPKETKDRKIVMEEVKNVKDTLIFYEAPHKLLNTLGF---LFDNLGDREIAICRELTKLHEEIKHTTLKSAIEFYESTKPKGEYVLIIEGKSEEEIAIEKMSEWQDINVEEHIIKCMEEGLSKKEAIKKVAKARNLSKSEVYKY 277
>gi|149377272|ref|ZP_01895019.1| predicted methyltransferase [Marinobacter algicola DG893] >gi|149358460|gb|EDM46935.1| predicted methyltransferase [Marinobacter algicola DG893] (287 aa)
Score = 356, Expect = 4.5e-32, Identities = 91/268 (33%), Positives = 144/268 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L+IVATPIGN+ ++S  A   L+  ++   EDTR+S +LL  L IS   K   +L+ +NE+        K     +  L+SDAG P++SDPGF+L+       + V  + G  +L+ +L  +G P+   LF GFL      ++  L++L  ES T++ +ES HRI DT+  I E+    + + +ARELTK  ET Y  + A++ +    +    +GEFV+++     E  S+   E D  + L   E  ++K      A K+ S    +  N LY
  S:    14 LYIVATPIGNLDDLSPRAAAVLSRVAVIAAEDTRHSGRLLQHLGIS---KPMMALHEHNERDKAGQVLGKLAACQDVALISDAGTPLISDPGFVLVREARARGYRVTPVPGACALISALSAAGLPTDRFLFEGFLPSKSGARRAALDRLVRESATLVFYESPHRIVDTVGDIAEVMGAERELVLARELTKTFETFYAGAAAHVRQTLEADPHGSRGEFVVMVRGASAEELSVGSAEADRVLTLLLTELPVKK------AAKLASELTGISKNELY 279
>gi|166367865|ref|YP_001660138.1| tetrapyrrole methylase family protein [Microcystis aeruginosa NIES-843] >gi|166090238|dbj|BAG04946.1| tetrapyrrole methylase family protein [Microcystis aeruginosa NIES-843] (279 aa)
Score = 355, Expect = 5.4e-32, Identities = 86/271 (31%), Positives = 153/271 (56%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIA---NINEIKITEKGEFVILI-DNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           KL++V TPIGN+ +++  ++ TL   ++   EDTR++ KLL   +I     +++  N  +    + +   +  +  L++DAG P +SDPG+ LI   I+   +V  I G ++++ +L VSG P+    F GFL   + L+Q+ L  LK E++T++ +E+ H++  TL+ ++E F  ++ I + RELTK+ E I+R ++A   N+     T KGEF I++  NN  +T  +  EE        EL+++I  G     A + ++   +L  + LY  
  S:     6 KLYVVGTPIGNLDDLTFRSLATLKKVTLIAAEDTRHTGKLLQHFDILTPQISYHEHNRLSRLDELLNILSQGQDIALVTDAGMPGISDPGYELIKACIEAQIEVVPIPGVTAVITALAVSGLPTERFCFEGFLPGKEKLRQEHLESLKTETRTMVFYEAPHKLIKTLEDLRETFGPTRKIVLGRELTKLYEEIWRGTVAEAINLYRENKTPKGEFTIVVMGNNRFDTIQLSDEELK-----RELKQIIEGGVNRSQASRQLAQVTNLSRSRLYKL 275
>gi|42518526|ref|NP_964456.1| hypothetical protein LJ0431 [Lactobacillus johnsonii NCC 533] >gi|41582811|gb|AAS08422.1| hypothetical protein LJ_0431 [Lactobacillus johnsonii NCC 533] (285 aa)
Score = 355, Expect = 6.5e-32, Identities = 90/274 (32%), Positives = 145/274 (52%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE---KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           +L++V TPIGN+++I+  A   LT       EDTR S  LL  + +  +  +F+  N       +     +      +SDAG P++SDPG++L+   IKN+  V  + GPS+   +LI SGF +    +YGFL    + ++     +     T I +E+ HR+K TLK + E     + I +ARELTK++E   R SI+ INE   TE   +GEFV+L+  N +E + +  +E      + ++   +  GE +K A K V+    +  N LY+ + Q
  S:    14 RLYLVPTPIGNLEDITLRAKRILTEADYIAAEDTRTSGILLEKIGVHNKMISFHKYNSKERAPELIKLLKEGKTIAEISDAGMPVISDPGYVLVQECIKNDIPVVSLPGPSAFATALIASGFDAQPFTYYGFLPRKSSEQKKYFEMMNTSRATSIFYEAPHRLKKTLKTLAEAIKPDRKIALARELTKIHEEYIRGSISEINEY-FTENDPRGEFVVLVSPNEEEEKQLSWDE-----LIKQVADQVAAGESKKDAIKSVAKANKVSKNELYDKYHQ 284
>gi|113972010|ref|YP_735803.1| hypothetical protein Shewmr4_3683 [Shewanella sp. MR-4] >gi|113886694|gb|ABI40746.1| Protein of unknown function UPF0011 [Shewanella sp. MR-4] (281 aa)
Score = 354, Expect = 7.3e-32, Identities = 87/270 (32%), Positives = 146/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ ++S  AI  LT  ++  CEDTR+S KLL+   IS +    +  N     Q+I           L+SDAG P++SDPG+ L++   ++ + V  + GP + + +L  SG PS    F GFL   +  + D+L +LK + +T+I +ES HRI+ +L  + ++  + + + +ARE+TK  ET     +    A ++     +KGE V+++  +     +   +E   +V +N L+ L  +   +K A       + LK N+LY F
  S:     7 LYIVPTPIGNLGDMSPRAIEVLTQVALIACEDTRHSGKLLSHFGISTKTIALHDHNERARAQWIVDQLAAGQSIALISDAGTPLISDPGYHLVSHVRQSGFRVVPLPGPCAAITALSASGLPSDRFAFEGFLPSKEKARADKLLELKEDPRTLIFYESPHRIEHSLTTMAQVLGDERQVVMAREVTKTFETFLSGPVAEVLATVSSDPNQQKGEIVLMVHGH----RAADDDEAIPTVAINTLKLLCEELPLKKAAAIAAQI-HGLKKNALYKF 275
>gi|29655027|ref|NP_820719.1| tetrapyrrole methylase domain-containing protein [Coxiella burnetii RSA 493] >gi|153208238|ref|ZP_01946648.1| conserved hypothetical protein TIGR00096 [Coxiella burnetii 'MSU Goat Q177'] >gi|161830627|ref|YP_001597560.1| hypothetical protein COXBURSA331_A1930 [Coxiella burnetii RSA 331] >gi|165923952|ref|ZP_02219784.1| conserved hypothetical protein TIGR00096 [Coxiella burnetii RSA 334] >gi|29542296|gb|AAO91233.1| tetrapyrrole (Corrin/Porphyrin) methylase domain protein [Coxiella burnetii RSA 493] >gi|120576143|gb|EAX32767.1| conserved hypothetical protein TIGR00096 [Coxiella burnetii 'MSU Goat Q177'] >gi|161762494|gb|ABX78136.1| conserved hypothetical protein TIGR00096 [Coxiella burnetii RSA 331] >gi|165916608|gb|EDR35212.1| conserved hypothetical protein TIGR00096 [Coxiella burnetii RSA 334] (285 aa)
Score = 354, Expect = 8.3e-32, Identities = 86/232 (37%), Positives = 135/232 (58%)
  Q:     1 MNK-KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKE 232
           MN+  L+I ATPIGN ++I+  AI TL +  +   EDTR+SKKLL    I     + +  N       +     +     L+SDAG P++SDPG+ L+N   +   +V  I G  + + +L+ SG P+   +F GF+     +++ +L  LKN+ +TII +ESVHRI + + ++ EIF   +   IARELTK  ETI+ +++A     INE  + EKGEFV+++    ++   I +E
  S:     1 MNRGSLYITATPIGNREDITLRAIDTLRSVDLIAAEDTRHSKKLLEHYGIKTPLLSLHEHNEAARATLLCEKLKQGLNVALISDAGTPLISDPGYRLVNAVREAGIEVVPIPGACAAIAALVASGLPTDRFIFEGFIPSKGEVRRKKLEDLKNQRRTIIFYESVHRIVNLIDLLNEIFGTERRATIARELTKKFETIHTATLAELKNWINENPVQEKGEFVVIVAGQTEKLTEINEE 237
>gi|154707304|ref|YP_001423685.1| hypothetical protein CBUD_0263 [Coxiella burnetii Dugway 5J108-111] >gi|154356590|gb|ABS78052.1| conserved hypothetical protein TIGR00096 [Coxiella burnetii Dugway 5J108-111] (285 aa)
Score = 354, Expect = 8.5e-32, Identities = 86/232 (37%), Positives = 136/232 (58%)
  Q:     1 MNK-KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKE 232
           MN+  L+I ATPIGN ++I+  AI TL +  +   EDTR+SKKLL    I     + +  N       +     +     L+SDAG P++SDPG+ L+N   +   +V  I G  + + +L+ SG P+   +F GF+     +++ +L  LKN+ +TII +ESVHRI + + ++ EIF   +   IARELTK  ETI+ +++A     INE  + EKGEFV+++    ++ + I +E
  S:     1 MNRGSLYITATPIGNREDITLRAIDTLRSVDLIAAEDTRHSKKLLEHYGIKTPLLSLHEHNEAARATLLCEKLKQGLNVALISDAGTPLISDPGYRLVNAVREAGIEVVPIPGACAAIAALVASGLPTDRFIFEGFIPSKGEVRRKKLEDLKNQRRTIIFYESVHRIVNLIDLLNEIFGTERRATIARELTKKFETIHTATLAELKNWINENPVQEKGEFVVIVAGQTEKLKEINEE 237
>gi|52425342|ref|YP_088479.1| hypothetical protein MS1287 [Mannheimia succiniciproducens MBEL55E] >gi|52307394|gb|AAU37894.1| unknown [Mannheimia succiniciproducens MBEL55E] (282 aa)
Score = 353, Expect = 1.1e-31, Identities = 93/270 (34%), Positives = 146/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANIN----EIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IVATPIGN+++I++ A+   T   +   EDTR+S  LL+   I    K F++L+ +NE+Q  ++   K        L+SDAG P++SDPGF L+    +    V  + G  + + +L  SG  S    F GFL      ++D+L  +  E +T+I +ES HRI DTL+ I+ I    + I +ARE+TK  ETI   ++AN+     E     KGE V++I+   K  ++      + S    +   L+ K    K A  +V+  Y  K N+LY +
  S:     8 LYIVATPIGNLQDITQRALDIFTQVDLIAAEDTRHSGLLLSHYGI---KKPFFALHDHNEQQKADALVEKLRQGTNIALISDAGTPLISDPGFHLVRKCRQTGLKVVPLPGACAAITALCASGIASDRFCFEGFLPAKSKARKDKLQNIAEEDRTLIFYESTHRILDTLEDIEAILGAERYIVLAREITKTWETITGDTVANLRKWLAEDPNRTKGEMVLVIEGKAKSDDA-----EEISPQAIKALALLAKELPLKKAAAIVAELYGYKKNALYQY 276
>gi|170017860|ref|YP_001728779.1| methyltransferase [Leuconostoc citreum KM20] >gi|169804717|gb|ACA83335.1| Predicted methyltransferase [Leuconostoc citreum KM20] (291 aa)
Score = 353, Expect = 1.1e-31, Identities = 89/268 (33%), Positives = 149/268 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI------NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYL--NELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           LF+V TPIGN+++++  AI TL   ++   EDTR++++LLN  +I  +  +F+  N  ++   + +   +  +   +SDAG P +SDPG  L+   ++NN  V  I G ++ + +LI SG       FYGFL    + +  +L QL     T+I +ES HR+K TL  I+++  N + + +ARELTK  E   R  I  +      N+I    +GEFV++I      ++S  + ETD ++    + +  L+ KG K   A K V+ +  L   ++Y
  S:    15 LFLVPTPIGNLQDMTPRAIDTLNAVALIAAEDTRHTQQLLNHFDIETKQTSFHEHNWQSKIPSLIATLSQGGDVAQVSDAGMPSISDPGKELVAAAVENNIPVVPIPGATAGVTALIASGLVPQPFYFYGFLQRKNSEQLSELKQLSTVKDTVIFYESPHRLKQTLANIQKVMGNDRQVVLARELTKRYEEFLRGHIEELVLWSKNNDI----RGEFVVMIAGFTGASQS--EPETDLTMLSVHDAVSALVAKGLKPNAAIKQVAKERQLDRQAVY 284
>gi|15602510|ref|NP_245582.1| hypothetical protein PM0645 [Pasteurella multocida subsp. multocida str. Pm70] >gi|17368779|sp|Q9CN04|Y645_PASMU UPF0011 protein PM0645 >gi|12720920|gb|AAK02729.1| unknown [Pasteurella multocida subsp. multocida str. Pm70] (281 aa)
Score = 353, Expect = 1.2e-31, Identities = 98/270 (36%), Positives = 146/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVK-ETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IVATPIGN+++I++ A+       +   EDTR+S  LL+   I    K F++L+ +NE+Q  +    K        L+SDAG P++SDPGF L+    +    V  I G  + + +L  SG  S    F GFL      + D+L  L  E +T+I +ES HRI DTL  I++     + + +ARE+TK  ETI   ++AN    + E     KGE V++I+  VK ET+ I  +       L  LE LI +    K A  +V+  Y  K N+LY +
  S:     8 LYIVATPIGNLQDITQRALAIFEQVDLIAAEDTRHSGLLLSHYGI---KKPFFALHDHNEQQKAHLLVEKLQQGQHIALISDAGTPLISDPGFHLVRQCRQAGIKVVPIPGACAAVTALCASGIASDRFCFEGFLPAKSKARCDKLQNLAEEERTLIFYESTHRILDTLADIEKTLGAERYVVLAREITKTWETIVGDNVANLRQWLGEDPNRTKGEMVLIIEGKVKQETDEINPQA------LKALE-LISQSLPLKKAAAIVAEIYGYKKNALYQY 275
>gi|73663576|ref|YP_302357.1| tetrapyrrole methylase family protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72496091|dbj|BAE19412.1| tetrapyrrole methylase family protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (278 aa)
Score = 352, Expect = 1.3e-31, Identities = 93/273 (34%), Positives = 148/273 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILI-------DNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           L++V TPIGN+ +I+  A+  L N  +  CEDTR +KKL     I    K+++  N   +  ++     +  +  L+SDAG P++SDPG+ L+    +    V+ + GP++ + +L+ SG PS    F GFL   +  K   L Q   E  T+II+ES HR+KDTLK I  I D ++ + + RELTK  E I    ++ + E      I  KGEFV+L+       D +  E  SIK+  T +          I +  K K A K+V+    +K++ +Y+ + +
  S:     4 LYLVGTPIGNLADITYRAVDILRNVDLIACEDTRVTKKLCAHYEIQAPLKSYHDHNKEQQTDYLIEQLQEGVDIALVSDAGLPLISDPGYELVVAAREKQIRVETVPGPNAGLTALMASGLPSFTYTFLGFLPRKEKQKHSILEQRMYEDSTLIIYESPHRVKDTLKTILNI-DEARKVSVGRELTKKFEQIVTGYVSEVIEQLEDGNIPLKGEFVVLVEGDEHAEDTSWFEDMSIKEHVTYH----------INQNMKPKAAIKVVAEARHMKTSEVYDIYHE 276
>gi|114045774|ref|YP_736324.1| hypothetical protein Shewmr7_0262 [Shewanella sp. MR-7] >gi|113887216|gb|ABI41267.1| Protein of unknown function UPF0011 [Shewanella sp. MR-7] (281 aa)
Score = 351, Expect = 1.6e-31, Identities = 87/270 (32%), Positives = 145/270 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ ++S  AI  LT  ++  CEDTR+S KLL+   IS +    +  N     Q+I           L+SDAG P++SDPG+ L++   ++ + V  + GP + + +L  SG PS    F GFL   +  + D+L +LK + +T+I +ES HRI+ +L  + ++    + + +ARE+TK  ET     +    A ++     +KGE V+++  +     +   +E   +V +N L+ L  +   +K A       + LK N+LY F
  S:     7 LYIVPTPIGNLGDMSPRAIEVLTQVALIACEDTRHSGKLLSHFGISTKTIALHDHNERARAQWIVDQLAAGQSIALISDAGTPLISDPGYHLVSHVRQSGFRVVPLPGPCAAITALSASGLPSDRFSFEGFLPSKEKARADKLLELKEDPRTLIFYESPHRIEHSLTTMAQVLGGERQVVMAREVTKTFETFLSGPVAEVLATVSSDPNQQKGEIVLMVHGH----RAADDDEAIPTVAINTLKLLCEELPLKKAAAIAAQI-HGLKKNALYKF 275
>gi|167925317|ref|ZP_02512408.1| Tetrapyrrole methylas family protein [Mycoplasma mycoides subsp. mycoides LC str. GM12] (295 aa)
Score = 351, Expect = 1.9e-31, Identities = 105/276 (38%), Positives = 166/276 (60%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLF--IKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFL-NHNKNLKQDQLNQLKNE--SKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRKN 280
           ++++ TPIGN+++IS  AI TL    +  CEDTR SK LL+   I+    + +  N N   + I +   ++    ++SDAG PI+SDP   +IN    ++ N ++  I   S+ +H+LI SGF   N  FYGFL N NK  KQ++LNQL N+     I ++ESVHR+KDT+  + ++ D +  I IA+ELTK+NE I   +I  IN+     K   KGEFVI+I+  + + + I   +   S  ++ +++ I+ G K K AC++++ K  +  N LY  +  +KN
  S:    14 VYLITTPIGNLEDISLRAIQTLKQVDVICCEDTRTSKVLLDKYQITNNLLSLHKFNENLRIEQIINLLNQNKNIAIISDAGVPIISDPASYIINQLKELEINCNITAIGAGSAYLHALISSGFLIDNHYFYGFLKNKNKISKQNELNQLINQYGDSIICLYESVHRLKDTITCLNQLLDKNHKIVIAKELTKINEEIIYGNINQINQYINSEKFVLKGEFVIVINKKIID-QIINYTD---SQLIDLIDQEIKNGYKLKQACEIINLKTKISKNVLYKLYTFKKN 294
>gi|24371899|ref|NP_715941.1| methyltransferase [Shewanella oneidensis MR-1] >gi|24345728|gb|AAN53386.1|AE015478_3 conserved hypothetical protein TIGR00096 [Shewanella oneidensis MR-1] (281 aa)
Score = 351, Expect = 2.0e-31, Identities = 86/270 (31%), Positives = 147/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKIT----EKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ ++S  AI  L+  ++  CEDTR+S KLL+   IS +    +  N     Q+I           L+SDAG P++SDPG+ L++   ++ + V  + GP + + +L  SG PS    F GFL   +  + D+L +LK + +T+I +ES HRI+ +L  + ++  + + + +ARE+TK  ET     +A +     +    +KGE V+++  +     + + +E   +V +N L+ L  +   +K A       + LK N+LY F
  S:     7 LYIVPTPIGNLGDMSPRAIDVLSQVALIACEDTRHSGKLLSHFGISTKTIALHDHNERARAQWIVDQLAAGQSIALISDAGTPLISDPGYHLVSHVRQSGFKVIPLPGPCAAITALSASGLPSDRFSFEGFLPSKEKARADKLLELKEDPRTLIFYESPHRIEHSLTTMAQVLGDDRQVVMAREVTKTFETFLSGPVAEVLATVSSDLNQQKGEIVLMVHGH----RAAEDDEAIPTVAINTLKLLCEELPLKKAAAIAAQI-HGLKKNALYKF 275
>gi|164688850|ref|ZP_02212878.1| hypothetical protein CLOBAR_02498 [Clostridium bartlettii DSM 16795] >gi|164602054|gb|EDQ95519.1| hypothetical protein CLOBAR_02498 [Clostridium bartlettii DSM 16795] (277 aa)
Score = 350, Expect = 2.2e-31, Identities = 95/272 (34%), Positives = 153/272 (56%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           M+ KL+I  TPIGN+++I+   +  L    +   EDTR+S KLLN   IS    +++  N + +  ++ +         L+SDAG P +SDPG  LI   I+NN ++ ++ G ++   +L+ SG  +   +F GFL+ +K L++ +L +++ E +T+I +ES HR+KDTLK + + F N K I + RELTK  + + R  I  +  +KI E    KGEFV+++D    E ++  K   D       +E LI  G  +K A K V     LK + +Y
  S:     1 MSGKLYICPTPIGNLEDITYRTLKVLNEVDLIAAEDTRHSIKLLNHFEISKPLTSYFEHNKDTKGDYLINKLLDGENIALISDAGMPGISDPGEDLIKQAIENNIEIDVLPGATAFTVALVGSGLDTHKFVFEGFLDRDKKLRRKRLEEIQEEDRTMIFYESPHRLKDTLKDMLKFFGNRK-IAVNRELTKKYQEVIREDIETV--LKIYEEKEIKGEFVLIVDGFKGEKQA--KNNYDELSEREYVEVLINTGLSKKDAIKTVCKDRKLKKDVVY 271
>gi|42561097|ref|NP_975548.1| tetrapyrrole methylas family protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492594|emb|CAE77190.1| Tetrapyrrole methylas family protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] (295 aa)
Score = 349, Expect = 2.7e-31, Identities = 105/276 (38%), Positives = 167/276 (60%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLF--IKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFL-NHNKNLKQDQLNQLKNE--SKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYS--VYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRKN 280
           ++++ TPIGN+++I+  AI TL    I  CEDTR SK LL+   I+    + +  N N   + I +   ++    ++SDAG PI+SDP   +IN    ++ N ++  I   S+ +H+LI SGF   +  FYGFL N NK  KQ++LNQL N+     I ++ESVHR+KDT+  + ++ + +  I IA+ELTK+NE I   +I  IN+   ++    KGEFVI+I+      + I  E T YS    ++ +++ I+ G K K AC++++ K  +  N LY  +  +KN
  S:    14 VYLITTPIGNLEDITLRAIQTLKQVDIICCEDTRTSKVLLDKYQITNNLLSLHKFNENLRIEQIINLLNQNKNIAIISDAGVPIISDPASYIINQLKELEINCNITAIGAGSAYIHALISSGFLIDSHYFYGFLKNKNKISKQNELNQLINKYGDSIICLYESVHRLKDTITCLNQLLNKNHKIAIAKELTKINEEIIYGNIDQINQYIYSDEFVLKGEFVIVIN------KKINNETTTYSDIQLIDLIDQEIKNGYKLKQACEIINLKTKISKNVLYKLYTFKKN 294
>gi|146294774|ref|YP_001185198.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Shewanella putrefaciens CN-32] >gi|145566464|gb|ABP77399.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Shewanella putrefaciens CN-32] (280 aa)
Score = 349, Expect = 2.8e-31, Identities = 88/270 (32%), Positives = 146/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKIT----EKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ ++S  AI  L   S+  CEDTR+S KLL+   I+ +    +  N     Q+I           L+SDAG P++SDPG+ L++   ++ ++V  + GP + + +L  SG PS    F GFL   +  + D+L  LK + +T+I +ES HRI+ +L  + E+  + +++ +ARE+TK  ET     +A++     T    +KGE V+++         I  +E   +V +N L+ L  +   +K A       + LK N+LY +
  S:     7 LYIVPTPIGNLGDMSSRAIEVLNQVSLIACEDTRHSGKLLSHFGITTKTIALHDHNERARAQWIVDQLAAGQSIALISDAGTPLISDPGYHLVSHVRQSGFNVIPLPGPCAAITALSASGLPSDRFSFEGFLPSKEKARADKLLALKEDPRTLIFYESPHRIEHSLTTMLEVLGDDRHVVMAREVTKTFETFLSGPVADVLARVSTDPNQQKGEIVLMVHG-----YHIDDDEAIPTVAINTLKLLCEELPLKKAAAIAAQI-HGLKKNALYKY 274
>gi|69246404|ref|ZP_00603926.1| Protein of unknown function UPF0011 [Enterococcus faecium DO] >gi|68195276|gb|EAN09728.1| Protein of unknown function UPF0011 [Enterococcus faecium DO] (290 aa)
Score = 349, Expect = 2.8e-31, Identities = 94/273 (34%), Positives = 146/273 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSS----IANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           L++V TPIGN++++S  ++  L  + +   EDTRN++KLLN   I    K+ +  N       + +   +      +SDAG P +SDPG  L+   IK    V  I GP++ M +LI SG      LFYGFL   K  +++ L +LK ++ T+I +ES +RI  TL    EIF N + + + RELTK++E   R S    +A I E  +  KGE  +L++ N+ E    + +E +      ++E  I  GEK   A K V+ K  LK   +Y  + +
  S:    16 LYLVPTPIGNLEDMSYRSVRMLQESDLIASEDTRNTQKLLNHFEIHTPQKSLHEHNYKERVPQLIALLKEGKTIAQVSDAGMPSISDPGHELVLACIKEGISVISIPGPTAGMTALIASGLVPQPFLFYGFLPRKKKEQKETLKKLKEQTVTLIFYESPYRITATLTNFLEIFGN-RQVVLCRELTKVHEEYLRGSTEELLAYIEEHPV--KGECCLLVEGNLFEMPVTEVDE-ELGTLKEQVEAKIASGEKPNAAIKAVALKNGLKKQEVYRQYHE 288
>gi|104774433|ref|YP_619413.1| putative methyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103423514|emb|CAI98416.1| Putative methyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (287 aa)
Score = 349, Expect = 3.5e-31, Identities = 82/274 (29%), Positives = 145/274 (52%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           KL++V TPIGN+++I+  A   L        EDTR S  +L+ L I+ +   F+  N   +   +     +      +SDAG P++SDPG++L+   IK+N  V  + GPS+   +LI SGF      +YGFL    + ++  L ++     T I +E+ HR+  TL+ + E+    + +  ARELTK++E   R S+  + +   ++  +GEFV+L+  N +E      +  D++  +  +++ + +G  +K A K V+    +  N LY+ + Q
  S:    14 KLYLVPTPIGNLEDITIRAKRILEEADYIAAEDTRTSGIMLDRLGINNKMVAFHKFNSKEKAPELVKLMQEGATIAEISDAGMPVISDPGYILVQECIKSNVPVVPLPGPSAFATALIASGFDGQPFTYYGFLPRKASQQRPFLEEINASRATSIFYEAPHRLLKTLEQMVEVLPGGRQVVCARELTKIHEEFVRGSLEEVIQHFKEVDPRGEFVVLVSPNTEE------KTLDWADLVKLVKEQVAQGVSKKDAIKQVAKSQGVSKNELYDRYHQ 283
>gi|120600618|ref|YP_965192.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Shewanella sp. W3-18-1] >gi|120560711|gb|ABM26638.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Shewanella sp. W3-18-1] (280 aa)
Score = 348, Expect = 4.2e-31, Identities = 88/270 (32%), Positives = 145/270 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKIT----EKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ ++S  AI  L   S+  CEDTR+S KLL+   I+ +    +  N     Q+I           L+SDAG P++SDPG+ L++   ++ ++V  + GP + + +L  SG PS    F GFL   +  + D+L  LK + +T+I +ES HRI+ +L  + E+    +++ +ARE+TK  ET     +A++     T    +KGE V+++         I  +E   +V +N L+ L  +   +K A       + LK N+LY +
  S:     7 LYIVPTPIGNLGDMSSRAIEVLNQVSLIACEDTRHSGKLLSHFGITTKTIALHDHNERARAQWIVDQLAAGQSIALISDAGTPLISDPGYHLVSHVRQSGFNVIPLPGPCAAITALSASGLPSDRFSFEGFLPSKEKARADKLLALKEDPRTLIFYESPHRIEHSLTTMVEVLGGERHVVMAREVTKTFETFLSGPVADVLARVSTDPNQQKGEIVLMVHG-----YHIDDDEAIPTVAINTLKLLCEELPLKKAAAIAAQI-HGLKKNALYKY 274
>gi|152979129|ref|YP_001344758.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Actinobacillus succinogenes 130Z] >gi|150840852|gb|ABR74823.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Actinobacillus succinogenes 130Z] (281 aa)
Score = 348, Expect = 4.2e-31, Identities = 90/270 (33%), Positives = 147/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQ---FINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IVATPIGN+++I++ A+  L+   +   EDTR+S  LLN   I    K  ++L+ +NE+Q    +     K  +  L+SDAG P++SDPGF ++    +    V  + G  + + +L  SG  S    F GFL      +QD+L  L  E +T+I +ES HRI D L+ I+ +   ++ I +ARE+TK  ETI   +++     ++E     KGE V++I+   K+      E  ++     +  +LI +    K A  +V+  Y  K N+LY +
  S:     8 LYIVATPIGNLQDITQRALDILSQVDLIAAEDTRHSGLLLNRYGI---KKPLFALHDHNEQQKATLLVEKLLKGTDIALISDAGTPLISDPGFHVVRQCRQAGIRVVPLPGACAAITALCASGIASDRFCFEGFLPAKTKARQDKLQSLAEEPRTLIFYESTHRILDALEDIEAVLGENRYIVLAREITKTWETISGDTVSALRQWLSEDPNRTKGEMVLIIEGKAKQ------ENDEFDGQAVKALQLISRELPLKKAAAIVAELYGYKKNALYQY 275
>gi|124548488|ref|ZP_01707129.1| Protein of unknown function UPF0011 [Shewanella putrefaciens 200] >gi|124508420|gb|EAY52516.1| Protein of unknown function UPF0011 [Shewanella putrefaciens 200] (280 aa)
Score = 348, Expect = 4.6e-31, Identities = 88/270 (32%), Positives = 145/270 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKIT----EKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ ++S  AI  L   S+  CEDTR+S KLL+   I+ +    +  N     Q+I           L+SDAG P++SDPG+ L++   ++ ++V  + GP + + +L  SG PS    F GFL   +  + D+L  LK + +T+I +ES HRI+ +L  + E+    +++ +ARE+TK  ET     +A++     T    +KGE V+++         I  +E   +V +N L+ L  +   +K A       + LK N+LY +
  S:     7 LYIVPTPIGNLGDMSSRAIEVLNQVSLIACEDTRHSGKLLSHFGITTKTIALHDHNERARAQWIVDQLAAGQSIALISDAGTPLISDPGYHLVSHVRQSGFNVIPLPGPCAAITALSASGLPSDRFSFEGFLPSKEKARADKLLALKEDPRTLIFYESPHRIEHSLTTMLEVLGGDRHVVMAREVTKTFETFLSGPVADVLARVSTDPNQQKGEIVLMVHG-----YHIDDDEAIPTVAINTLKLLCEELPLKKAAAIAAQI-HGLKKNALYKY 274
>gi|149114326|ref|ZP_01841080.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Shewanella baltica OS223] >gi|153002568|ref|YP_001368249.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Shewanella baltica OS185] >gi|146866023|gb|EDK51291.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Shewanella baltica OS223] >gi|151367186|gb|ABS10186.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Shewanella baltica OS185] (280 aa)
Score = 347, Expect = 4.8e-31, Identities = 87/270 (32%), Positives = 147/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDN-NVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ ++S  AI  L   S+  CEDTR+S KLL+   I+ +    +  N     Q+I           L+SDAG P++SDPG+ L++   ++ ++V  + GP + + +L  SG PS    F GFL   +  + D+L  LK + +T+I +ES HRI+ +L  + E+    +++ +ARE+TK  ET     +    A ++     +KGE V+++   ++ + E+I       +V +N L+ L  +   +K A       + LK N+LY +
  S:     7 LYIVPTPIGNLGDMSSRAIEVLNQVSLIACEDTRHSGKLLSHFGITTKTTALHDHNERARAQWIVDQLAAGQSIALISDAGTPLISDPGYHLVSHVRQSGFNVIPLPGPCAAITALSASGLPSDRFTFEGFLPSKEKARADKLLALKEDPRTLIFYESPHRIEHSLTTMVEVLGGDRHVVMAREVTKTFETFLSGPVSEVLAKVSTDPNQQKGEIVLMVHGYHLSDDEAIP------TVAINTLKLLCEELPLKKAAAIAAQI-HGLKKNALYKY 274
>gi|28377574|ref|NP_784466.1| methyltransferase (putative) [Lactobacillus plantarum WCFS1] >gi|28270406|emb|CAD63309.1| methyltransferase (putative) [Lactobacillus plantarum WCFS1] (298 aa)
Score = 347, Expect = 5.0e-31, Identities = 88/273 (32%), Positives = 143/273 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           L++V TPIGN+++++  A+ TL    +   EDTRN++KLLN   I+ +  +F+  N      Q I       N    +SDAG P +SDPG  L+   I  N  V  + G ++ + +LI SG       FYGFL   KN ++  L +L    +T++++ES  R+  TL ++  + + ++ I   RELTK  E   R ++A +         KGEFV+LI  N  + E    +E        ++E LI  G+K  VA K ++ + ++   S+YN + +
  S:    16 LYLVPTPIGNLQDMTYRAVATLKTVDLIAAEDTRNTQKLLNHFEITTKQISFHEHNTQERIPQLIEKLQTGVN-LAQVSDAGMPSISDPGKELVAACIAANIPVVPLPGANAGLTALIASGLVPQPFYFYGFLPRKKNEQKADLAKLARRHETVVLYESPFRVAKTLTLLATVCEGTRPIVACRELTKRYEEFARGTLAEMVTWAQDHQLKGEFVLLIGGNPDKDEPETTDELAQLPVKAQVEALIAAGDKPNVAIKTIAKRRNIPRQSVYNQFHE 290
>gi|116514532|ref|YP_813438.1| methyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116093847|gb|ABJ59000.1| Predicted methyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (287 aa)
Score = 347, Expect = 5.3e-31, Identities = 82/274 (29%), Positives = 144/274 (52%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           KL++V TPIGN+++I+  A   L        EDTR S  +L+ L I  +   F+  N   +   +     +      +SDAG P++SDPG++L+   IK+N  V  + GPS+   +LI SGF      +YGFL    + ++  L ++     T I +E+ HR+  TL+ + E+    + +  ARELTK++E   R S+  + +   ++  +GEFV+L+  N +E      +  D++  +  +++ + +G  +K A K V+    +  N LY+ + Q
  S:    14 KLYLVPTPIGNLEDITIRAKRILEEADYIAAEDTRTSGIMLDRLGIHNKMVAFHKFNSKEKAPELVKLMQEGATIAEISDAGMPVISDPGYILVQECIKSNVPVVPLPGPSAFATALIASGFDGQPFTYYGFLPRKASQQRPFLEEINASRATSIFYEAPHRLLKTLEQMVEVLPGGRQVVCARELTKIHEEFVRGSLEEVIQHFKEVDPRGEFVVLVSPNTEE------KTLDWADLVKLVKEQVAQGVSKKDAIKQVAKSQGVSKNELYDRYHQ 283
>gi|52783893|ref|YP_089722.1| YabC [Bacillus licheniformis ATCC 14580] >gi|52346395|gb|AAU39029.1| YabC [Bacillus licheniformis DSM 13] (278 aa)
Score = 347, Expect = 5.9e-31, Identities = 89/272 (32%), Positives = 148/272 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNE---LEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQ 276
           L++V TPIGN+++++  A++ L    I   EDTR +KKL ++  I  +  +++  N  +    I  +  +     L+SDAG P +SDPG  ++  FI+    V  + G ++ + +LI SG       F+GFL+ +K  ++ QL  LKN  +T+I +ES HR+K+TL  I+E+F N + I + RELTK  E   R SI         E  +GEF ++I+ + +ET     EE  +  +L+E   +E  I +G   K A K  +    +    +Y+ + 
  S:     4 LYLVPTPIGNLEDMTFRAVSVLKEADIIAAEDTRQTKKLCHVYEIETQLVSYHEHNKESSGHKILEWLKEGKNVALVSDAGMPTISDPGAEIVRDFIEMGGYVVPLPGANAALTALIASGIAPQPFFFFGFLDRSKRERKKQLEALKNRQETMIFYESPHRLKETLAAIREVFGN-RQIALTRELTKKFEEFIRGSIEEALTWSEQEQVRGEFCLVIEGSREET----IEEAVWWEHLSEKEHVEHYISEGYPSKEAIKKTAVDRGVPKRKIYDAYH 275
>gi|33151962|ref|NP_873315.1| hypothetical protein HD0804 [Haemophilus ducreyi 35000HP] >gi|33148184|gb|AAP95704.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP] (284 aa)
Score = 346, Expect = 6.0e-31, Identities = 93/273 (34%), Positives = 147/273 (53%)
  Q:     2 NKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQ----FINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           N  L IVATPIGN+ +I++ A+ T     +   EDTR+S  LL+   I    K F++L+ +NE+Q     I       N   L+SDAG P++SDPGF L+    +    V  + GP + + +L V+G  S    F GFL      + D+L+ L NE +T+I +ES HRI  TL  ++ +F   + + +ARE+TK  E+IY   +A+    +N+ K   KGE V++++  +K  E        +S     +  L+      K A  +V+  +  K N+LY +
  S:     6 NGILHIVATPIGNLADITQRALDTFAQVDLIAAEDTRHSGLLLSHYGI---KKPFFALHDHNEQQKAVVLIEKLQQGVN-IALISDAGTPLISDPGFHLVRHCRQMGIKVVPVPGPCAAVTALCVAGIASDRFCFEGFLPAKNKARIDKLSSLVNEERTLIFYESTHRILATLMDMQTVFGQDRYVVMAREMTKTWESIYGDRLADLISWLNQDKHRLKGEIVLVVEGKLKVAEE------SFSAQAISVLNLLCAELPLKKAVAIVAEAFGYKKNALYQY 276
>gi|160877289|ref|YP_001556605.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Shewanella baltica OS195] >gi|160862811|gb|ABX51345.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Shewanella baltica OS195] (280 aa)
Score = 346, Expect = 6.3e-31, Identities = 87/270 (32%), Positives = 147/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKIT----EKGEFVILIDN-NVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ ++S  AI  L   S+  CEDTR+S KLL+   I+ +    +  N     Q+I           L+SDAG P++SDPG+ L++   ++ ++V  + GP + + +L  SG PS    F GFL   +  + D+L  LK + +T+I +ES HRI+ +L  + E+    +++ +ARE+TK  ET     ++ +     T    +KGE V+++   ++ + E+I       +V +N L+ L  +   +K A       + LK N+LY +
  S:     7 LYIVPTPIGNLGDMSSRAIEVLNQVSLIACEDTRHSGKLLSHFGITTKTTALHDHNERARAQWIVDQLAAGQSIALISDAGTPLISDPGYHLVSHVRQSGFNVIPLPGPCAAITALSASGLPSDRFSFEGFLPSKEKARADKLLALKEDPRTLIFYESPHRIEHSLTTMVEVLGGDRHVVMAREVTKTFETFLSGPVSEVLATVSTDPNQQKGEIVLMVHGYHLSDDEAIP------TVAINTLKLLCEELPLKKAAAIAAQI-HGLKKNALYKY 274
>gi|162447000|ref|YP_001620132.1| methyltransferase [Acholeplasma laidlawii PG-8A] >gi|161985107|gb|ABX80756.1| methyltransferase [Acholeplasma laidlawii PG-8A] (282 aa)
Score = 346, Expect = 6.5e-31, Identities = 90/280 (32%), Positives = 155/280 (55%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEY--CLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRKN 280
           +   L+IV+TPIG++K+I+  AI  L +  I  CEDTR + KLL+  +I +  K++   N       +   ++ DN+    L+SDAG P++SDPGF+L++  I  N++V  I G S+L+ +L+ SG  +    F GFL          L    +  +++II+ES +R++ TL  + +I  N + + +ARELTK  ET YR  I +I E  +  +GE+VI+++ +   T  +K E+      +  +   +++G  EK A K  S    +  + +Y  ++  K+
  S:    10 LKPTLYIVSTPIGSLKDITLRAIEVLKSVDIILCEDTRVTSKLLDAYDIHVPLKSYQKFN--ERSMVLQVIEYLDNKMSVALVSDAGTPLISDPGFILVDELIGKNYNVVSIPGASALLSALVTSGILTQPFTFIGFLPRKLGEINKVLKDYVSRKESLIIYESPNRVQKTLSYMLDILGN-RRVSVARELTKKFETYYRGYIKDILETTLDTRGEYVIVVEGST--TSDVKIEDP-----VELVLSYMKQGYDEKEAIKQASKDLGVHKSEVYKIFKIDKS 281
>gi|119485571|ref|ZP_01619846.1| hypothetical protein L8106_24350 [Lyngbya sp. PCC 8106] >gi|119456896|gb|EAW38023.1| hypothetical protein L8106_24350 [Lyngbya sp. PCC 8106] (285 aa)
Score = 346, Expect = 7.3e-31, Identities = 83/270 (30%), Positives = 142/270 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L++V TPIGN+ +++  A+ TL    +   EDTR++ KLL    I     ++Y  N +     +     +     +++DAG P +SDPG+ L+   I+    V  I G S+ + +L VSG  +   +F GFL     L+Q +L  L+++S TII++ES HR++ TL+ + E   + + I   RELTK++E  +R S+     IK  E    KGE+ +++   ++ET  + +          E+E L+R+G     A + ++   SL    +Y  
  S:     8 LYVVGTPIGNLGDLTFRAVQTLKTVDLIAAEDTRHTGKLLQHFQIQTPQISYYEHNQHRRIPEVLEKLHQGKAIAIVTDAGIPGISDPGYELVKACIEAEIAVIPIPGVSACLTALSVSGLETDRFVFEGFLPTKNKLRQQRLQDLRSQSHTIILYESPHRLRQTLQDLAETLGSDRQIVFGRELTKLHEEFWRGSLE--EAIKHYENREPKGEYTLVVAGKIQETPQLSE-----GAIKAEIEALLRQGLTRSQASRQLAQNISLPRREIYQL 274
>gi|116617411|ref|YP_817782.1| methyltransferase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096258|gb|ABJ61409.1| Predicted methyltransferase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (289 aa)
Score = 345, Expect = 8.1e-31, Identities = 94/268 (35%), Positives = 143/268 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI------NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELE---KLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           LF+V TPIGN++++S  AI TL +  I   EDTR++++LLN   I+ +  +F+  N   +   + +          +SDAG P +SDPG  L+   +  N  V  I G ++ + +LI SG       FYGFL    + +  +L QL     T+I +ES HR+K TL  I+++  + + I +ARELTK  E   R +I  +      NEI    +GEFV++ID    E       E D S+ L   E    LI+KG K   A K ++ +  L   ++Y
  S:    15 LFLVPTPIGNLQDMSPRAIDTLRDVDIIAAEDTRHTQQLLNHFAITTKQTSFHEHNWQAKIPGLIADLRNGKNVAQVSDAGMPSISDPGKELVAAAVAENLAVVPIPGATAGVTALIASGLVPQPFYFYGFLQRKNSEQLAELQQLSTMRDTVIFYESPHRLKQTLVNIQKVMGDERRIVLARELTKRYEEFIRGTIDELVSWSQSNEI----RGEFVVMIDGFHGEI-----SEPDNSIALTVQEAVSALIKKGLKPNAAIKQIAKERGLDRQAVY 282
>gi|167625972|ref|YP_001676266.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Shewanella halifaxensis HAW-EB4] >gi|167355994|gb|ABZ78607.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Shewanella halifaxensis HAW-EB4] (280 aa)
Score = 345, Expect = 9.6e-31, Identities = 86/268 (32%), Positives = 139/268 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSS----IANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L+IV TPIGN+ +IS  AI  L   S+  CEDTR+S KLL+   I       +  N  +  Q+I           L+SDAG P++SDPG+ L+    +  ++V  + GP + + +L  SG PS    F GFL   +  + D+L  LK++ +T+I +ES HRI  +L+ + E     + I +ARE+TK  ET         +  + +    ++GE V++   +  +      EE+++S  +    KL+ +    K A  +    Y +K N+LY
  S:     7 LYIVPTPIGNLGDISSRAIEVLNQVSLIACEDTRHSGKLLSHFGIETRKTALHDHNERDRAQWIIQKLGNGEAVALISDAGTPLISDPGYHLVKQVREAGFNVIPLPGPCAAITALSASGLPSDRFTFEGFLPSKEKARFDKLTALKDDPRTLIFYESPHRIVHSLESLVEALGADREIVMAREVTKTFETFLSGPAGEVLQTVKDDPNQQRGEIVLMCHGHRSD------EESEFSPTVINTLKLLCEELPLKKAAAVAGQIYDIKKNALY 272
>gi|147669011|ref|YP_001213829.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Dehalococcoides sp. BAV1] >gi|146269959|gb|ABQ16951.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Dehalococcoides sp. BAV1] (274 aa)
Score = 345, Expect = 9.8e-31, Identities = 84/271 (30%), Positives = 151/271 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFW 275
           L++VATPIGN+++I+  A+  L+   +   EDTR+++KLL+  NI     +++  N  ++  +I     ++ +  L+SDAG P +SDPG+ LI    +N   V  + G S+++ ++ VSG  S +  + GFL   K+ ++  L++++    +I+I E+ HR++  L  IKE+  + + I + RELTK+ E I+R SI+         +GEFV++++ N      I  +       ++EL  L ++G+  K +  +VS K  L    +Y  W
  S:     3 LYVVATPIGNLEDITLRALRLLSEVKLIAAEDTRHTRKLLSAHNIKTPLTSYFEHNRLSKLDYILEV-LREGDVALVSDAGMPGISDPGYELIKAAHENGIKVVPVPGASAVITAVAVSGLDSGSFSYLGFLPRQKSERRKALSEVEMLGASIVILEAPHRLQGCLLDIKEVLGD-RQISVCRELTKIYEEIFRGSISQSISHFSQPRGEFVLVVEGN----RQIPAQPELTGDIISELGLLKKQGKSAKESVALVSQKNGLSKKEIYRAW 267
>gi|15612612|ref|NP_240915.1| hypothetical protein BH0049 [Bacillus halodurans C-125] >gi|17369112|sp|Q9KGL2|Y049_BACHD UPF0011 protein BH0049 >gi|10172661|dbj|BAB03768.1| BH0049 [Bacillus halodurans C-125] (289 aa)
Score = 345, Expect = 1.0e-30, Identities = 92/273 (33%), Positives = 146/273 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILIDNNVKETESIKKEETDYSVY--LNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           L++VATPIGN+++++  AI TL        EDTR +KKLLN  +I+ +  +++  N     K+ I+    +     L+SDAG P +SDPG+ L+   IK    V  I G ++ + +LI SG P+ +  F GFL   K  ++  L + K    T+I +ES HR+KDTL  +  I  N +++ I RELTK  E   R ++        + T KGEF ++++ N    E ++ EE  +     +  +E  I  G + K A K V+    +    +YN + Q
  S:    16 LYLVATPIGNLEDVTFRAIRTLKEADQIAAEDTRQTKKLLNHFDIATKLVSYHEHNKETMGKRLIDDL-IEGRTIALVSDAGMPAISDPGYELVVSAIKEGIAVIPIPGANAAVTALIASGLPTESFQFIGFLPRQKKQRRQALEETKPTKATLIFYESPHRLKDTLDDMLLILGN-RHVSICRELTKTYEEFLRGTLEEAVHWAREATIKGEFCLIVEGN---GEKVEPEEVWWESLSPVQHVEHYIALGFRSKEAIKQVATDRGVPKRDIYNIYHQ 288
>gi|157150399|ref|YP_001450815.1| hypothetical protein SGO_1536 [Streptococcus gordonii str. Challis substr. CH1] >gi|157075193|gb|ABV09876.1| conserved hypothetical protein TIGR00096 [Streptococcus gordonii str. Challis substr. CH1] (284 aa)
Score = 344, Expect = 1.1e-30, Identities = 91/274 (33%), Positives = 146/274 (53%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           KL++VATPIGN+++ S   + TL        EDTRN+ +LL+  +IS +  +F+  N       I +   +  +   +SDAG P +SDPG  L+   I  N  V  + GPS+ + +LI SG      +F+GFL   K  + D     K   +T I +ES HR+K TL+ + +++ + + + + RELTK+ E   R  I+ + E    E  KGE ++++D   +E     +EE      L E++ LI  G ++  A K V+ KY L  + LY+ + Q
  S:    15 KLYLVATPIGNLQDASTRMLETLEKVDYIAAEDTRNTGRLLDYFDISTKLISFHDHNSRARIPEIIALLKEGYDLAQVSDAGLPCISDPGHDLVKAAIAENIIVVSVPGPSAGISALIASGLAPQPHIFFGFLPRKKGQQNDFFESKKAYPETQIFYESPHRVKSTLENMLDVYGD-RQVVLVRELTKIYEEYQRGLISELLEAIGDEPLKGECLLIVDGASEEKADKSEEE-----LLAEIDFLIETGSQKSKAIKEVARKYGLNKSDLYSTYHQ 284
>gi|163751656|ref|ZP_02158876.1| hypothetical methyltransferase [Shewanella benthica KT99] >gi|161328482|gb|EDP99637.1| hypothetical methyltransferase [Shewanella benthica KT99] (281 aa)
Score = 344, Expect = 1.2e-30, Identities = 88/270 (32%), Positives = 140/270 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILID--NNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +IS  AI  L +  +  CEDTR+S KLL+   I     + +  N  +   +I           L+SDAG P++SDPG+ L++      +DV  + GP + + +L  SG PS    F GFL   +  + D+L  LK + +T+I +ES HRI  +L+         + I +ARE+TK  ET    ++A + E+       ++GE V++     + K+   I  E       +N L+ L+ +   +K A  +    Y LK N+LY +
  S:     7 LYIVPTPIGNLGDISSRAIDVLNSVKLIACEDTRHSGKLLSHFGIETRKTSLHDHNERDRADWIIQKLSNGEPVALISDAGTPLISDPGYHLVSAVRAAGYDVIPLPGPCAAVTALSASGLPSDRFTFEGFLPSKEKGRFDKLTALKEDPRTLIFYESPHRIVQSLESFLAALGEDRQIVMAREITKTFETFLSGTVAEVLEMVKNDPNQQRGEIVLMCHGYRSAKDDAEIPTE------VVNTLKLLVEELPLKKAAA-IAGQIYGLKKNALYKY 275
>gi|27469212|ref|NP_765849.1| hypothetical protein SE2294 [Staphylococcus epidermidis ATCC 12228] >gi|27316761|gb|AAO05936.1|AE016751_231 conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] (279 aa)
Score = 344, Expect = 1.2e-30, Identities = 95/272 (34%), Positives = 151/272 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNV-KETES-----IKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQ 276
           L++V TPIGN+ +I+  AI TL    +  CEDTR ++KL N   I    K+++  N   +  ++           L+SDAG P++SDPG+ L+    KNN +++ + GP++ + +L+ SG PS    F GFL   +  K + L     ++ T+I++ES +R+ DTLK I +I D+ + I + RELTK  E +   ++ +    IN  K+  KGEFVILI+  + K  ES       KE  DY +    +        K K A K V+    +K+ ++YN + 
  S:     4 LYLVGTPIGNLGDITFRAIETLKKVDVIACEDTRVTRKLCNHYEIQTPLKSYHEHNKEQQTDYLIKQLQTGLNIALVSDAGLPLISDPGYELVVEARKNNINIETVPGPNAGLTALMSSGLPSFTYTFLGFLPRKEKEKIEVLEDRMFQNSTLILYESPYRVTDTLKAIAKI-DSQRWITVGRELTKKFEQVLTLTVDDMLKLINHDKLPLKGEFVILIEGALPKSGESWFESYTVKEHVDYYIETKHV--------KPKKAIKFVATDRHMKTGNIYNIYH 276
>gi|172056074|ref|YP_001812534.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Exiguobacterium sibiricum 255-15] >gi|171988595|gb|ACB59517.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Exiguobacterium sibiricum 255-15] (284 aa)
Score = 344, Expect = 1.3e-30, Identities = 80/268 (29%), Positives = 147/268 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L+IV TPIGN+++++  A+  L  + +   EDTR + KL N   I  +  +++  N       + +      +  L+SDAG P +SDPG  LI   I  +  V ++ G ++ + +L+ SG  +   L+YGFL   K  +++ L  ++ E  ++I +E+ HR+K+ L  ++++  + + + +ARELTK  E   R S+    E    E +GEFV++++ + +E  + ++++ D    L ++E+ I +GEK   A K V+ +  L    LY
  S:    14 LYIVPTPIGNLEDMTYRAVRILQESDLVAAEDTRQTMKLFNHFKIETKLVSYHEHNKQVSGARLLADLHAGKQIALVSDAGMPGISDPGSDLIREAIAEDIPVIVLPGANAALTALVASGLATERFLYYGFLPRKKKERREALETVRYEKGSLIFYEAPHRLKEMLGALRDVLGD-RQLTLARELTKRYEEYIRGSVTEALEWAEEEVRGEFVVIVEGSTEERPAEEEQKAD---PLQQIERYIEQGEKPNAALKRVAKERGLDRQELY 278
>gi|57866026|ref|YP_187723.1| tetrapyrrole family methyltransferase [Staphylococcus epidermidis RP62A] >gi|57636684|gb|AAW53472.1| methyltransferase, tetrapyrrole family [Staphylococcus epidermidis RP62A] (279 aa)
Score = 344, Expect = 1.3e-30, Identities = 95/272 (34%), Positives = 150/272 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNV-KETES-----IKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQ 276
           L++V TPIGN+ +I+  AI TL    +  CEDTR ++KL N   I    K+++  N   +  ++           L+SDAG P++SDPG+ L+    KNN +++ + GP++ + +L+ SG PS    F GFL   +  K + L     ++ T+I++ES +R+ DTLK I +I D+ + I + RELTK  E +   ++ +    IN  K+  KGEFVILI+  + K  ES       KE  DY +    +        K K A K V+    +K+  +YN + 
  S:     4 LYLVGTPIGNLGDITFRAIETLKKVDVIACEDTRVTRKLCNHYEIQTPLKSYHEHNKEQQTDYLIKQLQTGLNIALVSDAGLPLISDPGYELVVEARKNNINIETVPGPNAGLTALMSSGLPSFTYTFLGFLPRKEKEKIEVLEDRMFQNSTLILYESPYRVTDTLKAIAKI-DSQRWITVGRELTKKFEQVLTLTVDDMLKLINHDKLPLKGEFVILIEGALPKSGESWFESYTVKEHVDYYIETKHV--------KPKKAIKFVATDRHMKTGDIYNIYH 276
>gi|190150681|ref|YP_001969206.1| hypothetical protein APP7_1412 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|189915812|gb|ACE62064.1| hypothetical protein APP7_1412 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (284 aa)
Score = 343, Expect = 1.4e-30, Identities = 93/273 (34%), Positives = 152/273 (55%)
  Q:     2 NKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETD--YSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           N  L+IVATPIGN+ +I++ A+ T     +   EDTR+S  LL+   I    K F++L+ +NE+Q       K  +     L+SDAG P++SDPGF L+    +    V  + G  + + +L  SG  S    F GFL      + D+L ++ +ES+T+I +ES HRI DTL+ ++++    + + +ARE+TK  ETI+  ++AN    +NE     KGE V++++         K E+ D  +S    +L  L+ +    K A  +V+  +  K N+LY +
  S:     6 NGTLYIVATPIGNLGDITQRALDTFAQVDLIAAEDTRHSGLLLSHYGI---KKPFFALHDHNEQQKAAVLVEKLQQGLNIALISDAGTPLISDPGFHLVRHCRQAGVKVVPLPGACAAITALCASGIASDRFCFEGFLPAKTKSRCDKLAEVADESRTLIFYESTHRILDTLEDMQKMLGADRYVVMAREITKTWETIHGDTLANLIAWLNEDSNRIKGEIVLVVEG--------KPEQADEAFSAQAVKLLGLLCQELPLKKAAAIVAETFGYKKNALYQY 276
>gi|196258806|ref|ZP_03157339.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Cyanothece sp. PCC 7822] >gi|196200126|gb|EDX94948.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Cyanothece sp. PCC 7822] (284 aa)
Score = 343, Expect = 1.4e-30, Identities = 80/270 (29%), Positives = 152/270 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILIDN-NVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L++V TPIGN+++++  A+  L        EDTR++ KLL    ++    +++  N  + +Q +       +   L++DAG P +SDPG+ L+   ++    V  I G ++ + +L VSG P+   +F GFL      ++++LN LK+E++T+I +E+ HR+  TL+ + E+   S+ I +ARELTK++E ++R ++A+      + + KGEF ++++   + E ES+ + E        EL++L+ +G     A + ++   SL    +Y  
  S:    11 LYVVGTPIGNLEDMTFRAVRILQQVDAIAAEDTRHTGKLLQHFQVTTPQISYHDHNRFSRQQVLIDRLIAGDTIALVTDAGMPGISDPGYELVKAALEEGILVIPIPGVTAGVTALAVSGLPTDRFVFEGFLPTKGKERRERLNCLKDETRTLIFYEAPHRLPQTLQDLAEVLGESRLIVLARELTKLHEEVWRGTLADAIAFYQQHSPKGEFTLVLEGATLAEKESLSEAELK-----AELQQLLSQGMTRSQASRHLAQLTSLPRRQIYQL 278
>gi|75908208|ref|YP_322504.1| hypothetical protein Ava_1987 [Anabaena variabilis ATCC 29413] >gi|75701933|gb|ABA21609.1| Protein of unknown function UPF0011 [Anabaena variabilis ATCC 29413] (285 aa)
Score = 343, Expect = 1.5e-30, Identities = 83/268 (30%), Positives = 145/268 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L+IV TPIGN+++I+  A+  L N  +   EDTR++ KLL  L +     +++  N ++    +           L+SDAG P +SDPG+ L+   ++    V  I G S+ + +L  +G P+   +F GFL      +++ L  L+ ES+T+I +ES HR+++TL+ + E++ + + I +ARELTK+ E  +R SI   I   +  E +GE+ +L+  N      + +E+        EL++LI +G     A + ++   SL    +Y
  S:    10 LYIVGTPIGNLEDITFRAVRILQNVDLIAAEDTRHTGKLLQHLQVKTPQVSYHEHNRSSRIPELLEHLHSGKAIALVSDAGMPGISDPGYELVKACVEVAIPVVPIPGASAAITALSAAGLPTDKFVFEGFLPAKGQQRREHLEALQTESRTLIFYESPHRLRETLQDLAEVWGSDRQIVLARELTKLYEEFWRGSIEEAIAHYQQKEPQGEYTLLVAGNPPSQTLLTEEQLK-----AELQQLISQGISRSQASRQLAKYTSLNRRQVY 274
>gi|148543571|ref|YP_001270941.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Lactobacillus reuteri F275] >gi|184152978|ref|YP_001841319.1| hypothetical protein LAR_0323 [Lactobacillus reuteri F275] >gi|148530605|gb|ABQ82604.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Lactobacillus reuteri F275] >gi|183224322|dbj|BAG24839.1| conserved hypothetical protein [Lactobacillus reuteri F275] (288 aa)
Score = 343, Expect = 1.6e-30, Identities = 91/273 (33%), Positives = 145/273 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCL--LSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           L++V TPIGN+ +++  AI TL    +   EDTR++++LLN  +IS    +F+    N E++     +     Y +   SDAG P +SDPG  L+   ++    V  + G ++ + +LI SG       F+GFL      +   L QLK   +T+I +E+ HR+K TL  + E+F N + + +ARELTK  E   R ++A +         +GEFVIL+  N   TE   K + +  + L E ++K I  G     A K+V+ K ++K   LY  + Q
  S:    15 LYLVPTPIGNLDDMTFRAIKTLKEVDLIAAEDTRHTQQLLNHFDISTRQISFHE--HNTEQRVPELIEKLKAGYSIAQCSDAGMPSISDPGKELVAAAVREGLPVIPLPGANAGLTALIASGLVPQPFYFFGFLERKHQQQVTALEQLKERKETMIFYEAPHRLKKTLATMAEVFGNERRVVLARELTKRYEEFTRGTLAEVTAWFEDHQPRGEFVILVAGNEHPTE---KTDNEIELPLTEQVDKEILNGLSTNAAIKLVAKKNNIKRQELYKQYHQ 287
>gi|157960082|ref|YP_001500116.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Shewanella pealeana ATCC 700345] >gi|157845082|gb|ABV85581.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Shewanella pealeana ATCC 700345] (280 aa)
Score = 342, Expect = 1.8e-30, Identities = 85/268 (31%), Positives = 138/268 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIA----NINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L+IV TPIGN+ +IS  A+  L   ++  CEDTR+S KLL+   I       +  N  +  Q+I           L+SDAG P++SDPG+ L+    +  ++V  + GP + + +L  SG PS    F GFL   +  + D+L  LK++ +T+I +ES HRI  +L+ I       + I +ARE+TK  ET     +A     + +    ++GE V++   +  +      EE ++S  +    KL+ +    K A  +    Y +K N+LY
  S:     7 LYIVPTPIGNLGDISSRALEVLNQVALIACEDTRHSGKLLSHFGIETRKTALHDHNERDRAQWIIQKLGNGEAVALISDAGTPLISDPGYHLVKQVREAGFNVIPLPGPCAAITALSASGLPSDRFSFEGFLPSKEKARLDKLTALKDDPRTLIFYESPHRIVHSLESIMAALGEEREIVMAREVTKTFETFLSGPVAEVLQTVKDDPNQQRGEIVLMCHGHRSD------EEAEFSPTVINTLKLLCEELPLKKAAAVAGQIYDIKKNALY 272
>gi|163119177|ref|YP_077322.2| methyltransferase [Bacillus licheniformis ATCC 14580] >gi|145902680|gb|AAU21684.2| putative methyltransferase YabC containing domain UPF0011 [Bacillus licheniformis ATCC 14580] (292 aa)
Score = 342, Expect = 1.9e-30, Identities = 89/272 (32%), Positives = 148/272 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNE---LEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQ 276
           L++V TPIGN+++++  A++ L    I   EDTR +KKL ++  I  +  +++  N  +    I  +  +     L+SDAG P +SDPG  ++  FI+    V  + G ++ + +LI SG       F+GFL+ +K  ++ QL  LKN  +T+I +ES HR+K+TL  I+E+F N + I + RELTK  E   R SI         E  +GEF ++I+ + +ET     EE  +  +L+E   +E  I +G   K A K  +    +    +Y+ + 
  S:    18 LYLVPTPIGNLEDMTFRAVSVLKEADIIAAEDTRQTKKLCHVYEIETQLVSYHEHNKESSGHKILEWLKEGKNVALVSDAGMPTISDPGAEIVRDFIEMGGYVVPLPGANAALTALIASGIAPQPFFFFGFLDRSKRERKKQLEALKNRQETMIFYESPHRLKETLAAIREVFGN-RQIALTRELTKKFEEFIRGSIEEALTWSEQEQVRGEFCLVIEGSREET----IEEAVWWEHLSEKEHVEHYISEGYPSKEAIKKTAVDRGVPKRKIYDAYH 289
>gi|153956377|ref|YP_001397142.1| methyltransferase [Clostridium kluyveri DSM 555] >gi|146349235|gb|EDK35771.1| Predicted methyltransferase [Clostridium kluyveri DSM 555] (279 aa)
Score = 342, Expect = 2.0e-30, Identities = 98/271 (36%), Positives = 158/271 (58%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYR----SSIANINEIKITEKGEFVILIDNNVKE---TESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           KLF+VATPIGN+K+I+  A+ TL N  +   EDTR S KLLN  NI     +++  N N++ + +           L+SDAG P +SDPG +++   I+   D +++ G +++  +L+ SG  +S  +F GFL      K+  L  +K+  +T+I++ES HR+ +TL+++K+I  N + I I RELTK+ E I R     SI   +E  I  KGEFV++I+   K     E ++K E D S+  + +   I KG  +K A K V+   ++  + +Y +
  S:     3 KLFLVATPIGNLKDITLRALDTLKNVDLIAAEDTRQSLKLLNHFNIKRPLMSYHKYNENDKSELLIQKLKDGKNIALVSDAGTPGISDPGNIIVRKCIEEGIDFEVLPGATAVTTALVYSGMDTSQFVFMGFLPRENKDKRTFLQSVKDRIETLIMYESPHRLINTLEILKDILGN-RRIAICRELTKVYEQILRFTIEESIKYYSESSI--KGEFVLVIEGRDKRELLKEQMEKWE-DLSIE-DHIRMYIEKGLNKKEAVKKVARDRNICKSQIYKY 275
>gi|73748229|ref|YP_307468.1| tetrapyrrole methylase family protein [Dehalococcoides sp. CBDB1] >gi|73659945|emb|CAI82552.1| tetrapyrrole methylase family protein [Dehalococcoides sp. CBDB1] (274 aa)
Score = 342, Expect = 2.2e-30, Identities = 85/271 (31%), Positives = 150/271 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFW 275
           L++VATPIGN+++I+  A+  L+   +   EDTR+++KLL+  NI     +++  N  ++  +I      + +  L+SDAG P +SDPG+ LI    +N   V  + G S+++ ++ VSG  S +  + GFL   K+ ++  L++++    +I+I E+ HR++  L  IKE+  + + I + RELTK+ E I+R SI+         +GEFV++++ N      I  +       ++EL  L ++G+  K A  +VS K  L    +Y  W
  S:     3 LYVVATPIGNLEDITLRALRLLSEVKLIAAEDTRHTRKLLSAHNIKTPLTSYFEHNRLSKLDYILEV-LMEGDVALVSDAGMPGISDPGYELIKAAHENGIKVVPVPGASAVITAVAVSGLDSGSFSYLGFLPRQKSERRKALSEVEILGASIVILEAPHRLQGCLLDIKEVLGD-RQISVCRELTKIYEEIFRGSISQSISHFSQPRGEFVLVVEGN----RQIPAKPELTGDIISELGLLKKQGKSAKEAVALVSQKNGLSKKEIYRAW 267
>gi|17232172|ref|NP_488720.1| tetrapyrrole methylase family protein [Nostoc sp. PCC 7120] >gi|17133817|dbj|BAB76379.1| tetrapyrrole methylase family protein [Nostoc sp. PCC 7120] (285 aa)
Score = 341, Expect = 2.4e-30, Identities = 84/268 (31%), Positives = 147/268 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L+IV TPIGN+++I+  A+  L N  +   EDTR++ KLL  L +     +++  N  +    +           L+SDAG P +SDPG+ L+   ++    V  I G S+ + +L  +G P+   +F GFL      +++ L  L+ ES+T+I +ES HR+++TL+ + E++ + + I +ARELTK+ E  +R SI   I   +  E +GE+ +L+  N   +E++  EE   +    EL++L+ +G     A + ++   SL    +Y
  S:    10 LYIVGTPIGNLEDITFRAVRILQNVDLIAAEDTRHTGKLLQHLQVKTPQVSYHEHNRTSRIPELLKHLHSGKAIALVSDAGMPGISDPGYELVKACVEVAIPVVPIPGASAAITALSAAGLPTDKFVFEGFLPAKGQQRREHLEALQTESRTLIFYESPHRLRETLQDLAEVWGSDRQIVLARELTKLYEEFWRGSIGEAIAHYQQKEPQGEYTLLVAGN-PPSETLLTEEQLKA----ELQQLMMQGISRSQASRQLTKYTSLNRRQVY 274
>gi|125974591|ref|YP_001038501.1| hypothetical protein Cthe_2101 [Clostridium thermocellum ATCC 27405] >gi|125714816|gb|ABN53308.1| Protein of unknown function UPF0011 [Clostridium thermocellum ATCC 27405] (280 aa)
Score = 341, Expect = 2.5e-30, Identities = 92/273 (33%), Positives = 152/273 (55%)
  Q:     1 MNKK--LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDN-NVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYN 273
           MN K  L++VATPIGN+++I+  AI  L    +   EDTR + KLLN  +I     ++Y  N   +  ++     +     L+SDAG P +SDPG  +I L I+N     ++ GP + +  L++SGF S   +F GFL  NK  ++++++ LK+E +T++ +E+ H++  TLK + E+  N + I +ARELTK  E I R ++    E    E  +GE+V++++  + K+    KK E +    L   +  I +G   K A K V+    +    +YN
  S:     1 MNNKGTLYLVATPIGNLEDITLRAIRVLKEVDLIAAEDTRQTIKLLNHFDIKKPLVSYYEHNKVVKGNYLVERLLEGKNIALVSDAGTPGISDPGEDMIKLCIENEIPFTMVPGPVAAVMGLVLSGFSSGRFVFEGFLPMNKRARRERIDSLKDEIRTMVFYEAPHKLVYTLKDLYEVLGN-RRIALARELTKKFEEILRCTLKEAIEKYENESPRGEYVLVVEGADEKQIIEDKKSEWNSMSILEHYQMYIDEGLSRKEAMKKVAQDRGISKRDVYN 277
>gi|126176283|ref|YP_001052432.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Shewanella baltica OS155] >gi|125999488|gb|ABN63563.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Shewanella baltica OS155] (280 aa)
Score = 341, Expect = 2.8e-30, Identities = 87/270 (32%), Positives = 147/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDN-NVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ ++S  AI  L   S+  CEDTR+S KLL+   I+ +    +  N     Q+I           L+SDAG P++SDPG+ L++   ++ ++V  + GP + + +L  SG PS    F GFL   +  + D+L  LK + +T+I +ES HRI+ +L  + E+    +++ +ARE+TK  ET     +    A ++     +KGE V+++   ++ + E+I       +V +N L+ L  +   +K A       + LK N+LY +
  S:     7 LYIVPTPIGNLGDMSSRAIEVLNQVSLIACEDTRHSGKLLSHFGITTKTTALHDHNERARAQWIVDQLAAGLSIALISDAGTPLISDPGYHLVSHVRQSGFNVIPLPGPCAAITALSASGLPSDRFSFEGFLPSKEKARADKLLALKEDPRTLIFYESPHRIEHSLTTMVEVLGGDRHVVMAREVTKTFETFLSGPVSEVLAKVSTDLNQQKGEIVLMVHGYHLSDDEAIP------TVAINTLKLLCEELPLKKAAAIAAQI-HGLKKNALYKY 274
>gi|148827077|ref|YP_001291830.1| methyltransferase [Haemophilus influenzae PittGG] >gi|148718319|gb|ABQ99446.1| predicted methyltransferase [Haemophilus influenzae PittGG] (283 aa)
Score = 340, Expect = 3.0e-30, Identities = 92/270 (34%), Positives = 149/270 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IVATPIGN+++I++ A+ T     +   EDTR+S  LL+   I    K F++L+ +NE++  +    K    +   L+SDAG P++SDPGF L+    +    V  + G  + + +L  SG  S    F GFL      ++D+L  +  E +T+I +ES HRI DTL+ ++ +    + I +ARE+TK  ETI  ++I N+ E  + +    KGE V++++   K   +   E +  +V   E   LI +    K A  +V+  Y  K N+LY F
  S:     8 LYIVATPIGNLQDITQRALETFAQVDLIAAEDTRHSGLLLSHYGI---KKPFFALHDHNEQEKAHILVEKLKQGSNIALISDAGTPLISDPGFHLVRQCREAGIRVVPLPGACAAITALCASGIASDRFCFEGFLPAKSKARKDKLENIAEEDRTLIFYESTHRILDTLEDMQAVLGEGRYIVLAREMTKTWETITGNTIKNLREWLLEDPNRTKGEMVLIVEGKPKSDNN--DEISPQAVKALE---LIAEELPLKKAAAIVAELYGYKKNALYQF 276
>gi|70727521|ref|YP_254437.1| hypothetical protein SH2522 [Staphylococcus haemolyticus JCSC1435] >gi|68448247|dbj|BAE05831.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (280 aa)
Score = 340, Expect = 3.6e-30, Identities = 90/272 (33%), Positives = 155/272 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIK---ITEKGEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGE-KEKVACKMVSYKYSLKSNSLYNFWQ 276
           L++V TPIGN+ +I+  AI TL +     CEDTR +KKL N  +I    K+++  N + + +++     +     L+SDAG P++SDPG+ L+      +  V+ + GP++ + +L+ SG PS    F GFL   +  K   L +   +  T+II+ES  R+ +TLK I ++ D+++ + + RELTK  E I    + + IN  +   I +KGEFVILI+      + ++ E+   S+ ++E +E  I +   K K A K+V+    +K+  +Y+ + 
  S:     4 LYLVGTPIGNLGDITFRAIETLKDADFIACEDTRVTKKLCNHYDIQTPLKSYHEHNKSQQTEYLIDLLNEGYNIALVSDAGLPLISDPGYELVVAAHSYDIHVETVPGPNAGLTALMASGLPSYTYTFLGFLPRKEKDKVAVLQERMFQDSTLIIYESPFRVVETLKAISKV-DDTRRVAVGRELTKKFEQIVMQEVGHLINAFQNDEIMQKGEFVILIEG----AKPLETEQWFQSLTISEHVEHYISEQNIKPKKAIKLVAEDRHMKTGEVYDIYH 276
>gi|119776485|ref|YP_929225.1| hypothetical protein Sama_3353 [Shewanella amazonensis SB2B] >gi|119768985|gb|ABM01556.1| protein of unknown function UPF0011 [Shewanella amazonensis SB2B] (281 aa)
Score = 339, Expect = 3.9e-30, Identities = 89/268 (33%), Positives = 142/268 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKIT-----EKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEK--EKVACKMVSYKYSLKSNSLY 272
           L+IV TPIGN+ ++S  A+  L + S+  CEDTR+S +L +   IS    + +  N     Q+I     + +   L+SDAG P++SDPG+ L++   +  + V  + GP + + +L  SG PS    F GFL      + D+L  L+ + +T+I +ES HRI  TL+ I  +    + + +ARELTK  ET    + A + E K+      +KGE V++    V        EET+ ++    +E L     +   K A  M +  + LK N+LY
  S:     7 LYIVPTPIGNLGDMSPRAVEILQSVSLIACEDTRHSGRLFSHFGISTRTTSVHDHNERARAQWIIEKLSQGDAVALVSDAGTPLISDPGYHLVSQVREAGFAVIPLPGPCAAITALSASGLPSDRFSFEGFLPAKDKGRNDKLTALREDPRTLIFYESPHRILQTLEAIVAVLGGERPMVMARELTKTFETFLSGTAAEVLE-KVKSDDNQQKGEMVLMCHGFV-------AEETEEAIPAKAMETLALLATELPLKKAAAMAAQIHDLKKNALY 273
>gi|119944933|ref|YP_942613.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Psychromonas ingrahamii 37] >gi|119863537|gb|ABM03014.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Psychromonas ingrahamii 37] (286 aa)
Score = 339, Expect = 4.1e-30, Identities = 97/271 (35%), Positives = 147/271 (54%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIY----RSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           KL+IVATPIGNI +I+  AI  L    +   EDTR+S KLL+  +I    K  + L+ +NE+Q       K        L+SDAG P++SDPG+ L+N       D+  I G  + + +L  +G PS    F GFL      KQD+L  L  ES+T+I +ES  R++DT++ I  IF   + + IARELTK+ E+ Y       +  + E     +GEFV+++    K+ ++I +      V LN L  L+++    K A  + +  +  K N LY +
  S:    14 KLYIVATPIGNISDITYRAIEILQQVDLIAAEDTRHSGKLLSHYHI---KKPMFPLHDHNERQRGQVLIEKIKAGQSIALISDAGTPLISDPGYHLVNECRAAGVDIVPIPGACAAIAALSAAGMPSDRFSFEGFLPAKGKSKQDKLKALIEESRTMIFYESPRRVQDTVEQIISIFGGDRKLVIARELTKIFESFYALTAEEMLVWLKEDTNHCRGEFVLMVAGAQKDDDAIPQ------VALNTL-TLLKEQLPLKKAAALTAQIHDQKKNELYKW 281
>gi|16273541|ref|NP_439796.1| hypothetical protein HI1654 [Haemophilus influenzae Rd KW20] >gi|1176815|sp|P45298|Y1654_HAEIN UPF0011 protein HI1654 >gi|1574503|gb|AAC23298.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20] (283 aa)
Score = 339, Expect = 4.1e-30, Identities = 92/270 (34%), Positives = 149/270 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IVATPIGN+++I++ A+ T     +   EDTR+S  LL+   I    K F++L+ +NE++  +    K    +   L+SDAG P++SDPGF L+    +    V  + G  + + +L  SG  S    F GFL      ++D+L  +  E +T+I +ES HRI DTL+ ++ +    + I +ARE+TK  ETI  ++I N+ E  + +    KGE V++++   K   +   E +  +V   E   LI +    K A  +V+  Y  K N+LY F
  S:     8 LYIVATPIGNLQDITQRALETFAQVDLIAAEDTRHSGLLLSHYGI---KKPFFALHDHNEQEKAHILVEKLKQGSNIALISDAGTPLISDPGFHLVRQCREAGIRVVPLPGACAAITALCASGIASDRFCFEGFLPAKSKARKDKLENIAEEDRTLIFYESTHRILDTLEDMQAVLGEERYIVLAREMTKTWETITGNTIKNLREWLLEDPNRTKGEMVLIVEGKPKSDNN--DEISPQAVKALE---LIAEELPLKKAAAIVAELYGYKKNALYQF 276
>gi|186682692|ref|YP_001865888.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Nostoc punctiforme PCC 73102] >gi|186465144|gb|ACC80945.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Nostoc punctiforme PCC 73102] (286 aa)
Score = 339, Expect = 4.3e-30, Identities = 83/270 (30%), Positives = 140/270 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L++V TPIGN+++I+  A+  L    I   EDTR++ KLL    +     +++  N  +    +      +    L+SDAG P +SDPG+ L+   I+    V  I G S+ + +L  SG P+   +F GFL      +Q+ L  L+ ES+T+I +ES HR++DTL+ + +++ + + I + RELTK+ E  +R +IA  I      E +GE+ +++         + +EE        EL+ LI +G     A + ++   SL    LY  
  S:    10 LYVVGTPIGNLEDITFRAVRILQTVDIIAAEDTRHTGKLLQHFQVKTPQVSYHEHNRTSRIPELLEHLINNKAIALVSDAGMPGISDPGYELVKACIEAGISVVPIPGASAAITALSASGLPTDRFVFEGFLPAKTQQRQEHLESLQTESRTLIFYESPHRLRDTLQDLAQVWGSDRQIVLGRELTKLYEEFWRGTIAEAIAHYSQREPQGEYTLVVAGIPASQPQLTEEELK-----AELKLLISQGISRSQASRQLAKFTSLPRRQLYQL 276
>gi|165976786|ref|YP_001652379.1| hypothetical protein APJL_1379 [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|165876887|gb|ABY69935.1| hypothetical protein APJL_1379 [Actinobacillus pleuropneumoniae serovar 3 str. JL03] (284 aa)
Score = 338, Expect = 5.5e-30, Identities = 92/273 (33%), Positives = 151/273 (55%)
  Q:     2 NKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETD--YSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           N  L+IVATPIGN+ +I++ A+ T     +   EDTR+S  LL+   I    K F++L+ +NE+Q       K  +     L+SDAG P++SDPGF L+    +    V  + G  + + +L  SG  S    F GFL      + D+L ++ +E +T+I +ES HRI DTL+ ++++    + + +ARE+TK  ETI+  ++AN    +NE     KGE V++++         K E+ D  +S    +L  L+ +    K A  +V+  +  K N+LY +
  S:     6 NGTLYIVATPIGNLGDITQRALDTFAQVDLIAAEDTRHSGLLLSHYGI---KKPFFALHDHNEQQKAAVLVEKLQQGLNIALISDAGTPLISDPGFHLVRHCRQAGVKVVPLPGACAAITALCASGIASDRFCFEGFLPAKTKSRCDKLAEVADEPRTLIFYESTHRILDTLEDMQKMLGADRYVVMAREITKTWETIHGDTLANLIAWLNEDSNRIKGEIVLVVEG--------KPEQADEAFSAQAVKLLGLLCQELPLKKAAAIVAETFGYKKNALYQY 276
>gi|112944272|gb|ABI26341.1| predicted methyltransferase [Lactobacillus reuteri] (288 aa)
Score = 338, Expect = 5.5e-30, Identities = 91/273 (33%), Positives = 143/273 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCL--LSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILIDNNVKETESIKKEETDYSVYL---NELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           L++V TPIGN+ +++  AI TL    +   EDTR++++LLN  +I     +F+    N E++     +     Y +   SDAG P +SDPG  L+   ++    V  + G ++ + +LI SG       F+GFL      +   L QLK   +T+I +E+ HR+K TL  + E+F N + + +ARELTK  E   R ++A           +GEFVIL+  N   T     EETD  + L    +++K I  G     A K+V+ K ++K   LY  + Q
  S:    15 LYLVPTPIGNLDDMTFRAIKTLKEVDLIAAEDTRHTQQLLNHFDILTRQISFHE--HNTEQRVPELIEKLKAGYSIAQCSDAGMPSISDPGKELVAAAVREGLSVIPLPGANAGLTALIASGLVPQPFYFFGFLGRKHQQQVATLEQLKEREETMIFYEAPHRLKKTLATMAEVFGNERRVVLARELTKRYEEFTRGTLAEATAWFEDHQPRGEFVILVAGNEHPT-----EETDNDIELPLTEQVDKEILNGLSTNAAIKLVAKKNNIKRQELYKQYHQ 287
>gi|72382651|ref|YP_292006.1| hypothetical protein PMN2A_0812 [Prochlorococcus marinus str. NATL2A] >gi|72002501|gb|AAZ58303.1| Protein of unknown function UPF0011 [Prochlorococcus marinus str. NATL2A] (295 aa)
Score = 338, Expect = 5.7e-30, Identities = 89/274 (32%), Positives = 148/274 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILI-DNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQR 278
           L++V TPIGN+ ++S  A + L N S   CEDTR S +LL ++   +   +++  N  + +  +     +     L+SDAG P ++DPG  L++    N+++V  I GP +   +L++SG PS    F GFL   ++L++ +L  +  E +T +I+ES H++   L+ +       + I IARELTK  E     +I  + +  IT   KGEF I++  NN K+   + + E      LN+L  LI +GEK  +A + V+ +   K   LY+   +R
  S:    21 LYLVGTPIGNLGDLSPRAKSILKNVSRIACEDTRRSGQLLKIIKSEVPLLSYHKHNFKSRQSQLLEILERGGSLALISDAGLPGINDPGEELVHAARSNSYEVICIPGPCAATTALVISGLPSERFCFEGFLPKKQSLRKKRLEDISQEQRTTVIYESPHQLIKLLEDLSISCGKERPIQIARELTKRYEESIGKTIEEVTKYFITNKPKGEFTIVLGGNNNKQQNKVSESEA-----LNKLNTLINQGEKSNIAAQKVAEETGYKKKWLYSKLHKR 292
>gi|90409151|ref|ZP_01217269.1| putative methyltransferase [Psychromonas sp. CNPT3] >gi|90309737|gb|EAS37904.1| putative methyltransferase [Psychromonas sp. CNPT3] (286 aa)
Score = 338, Expect = 5.7e-30, Identities = 97/271 (35%), Positives = 145/271 (53%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDN---EYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYR---SSIANINEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           KL+I+ATPIGNI +I+  AI TL    I   EDTR+S KLL+   I    K  ++L+ +NE+        K        L+SDAG P++SDPG+ L+N       DV  I GPS+++ +L  +G  +    F GFL   +  KQD+L  L  E +T++ +ES  RI DT+K I  IF   + + IARELTK  E+ Y    S +    E      +GEFV+++     + + I ++       LN L +L++     K A  + +  +  K N LY +
  S:    14 KLYIIATPIGNISDITYRAIETLRLVDIIAAEDTRHSGKLLHHYQI---KKPMFALHDHNERDRAKVLIEKIKGGLAIALISDAGTPLISDPGYHLVNECRAAGVDVVPIPGPSAVITALSSAGLATDRFTFEGFLPAKEKGKQDKLKALIEEKRTMVFYESPRRIMDTVKQIILIFGGERKLVIARELTKTFESFYSFPASEMLTWLEQDTNHCRGEFVLMVAGASLQEDRIPEDA------LNTL-RLLKDQLPLKKAAALTAQIHQQKKNDLYKW 281
>gi|94967066|ref|YP_589114.1| hypothetical protein Acid345_0035 [Acidobacteria bacterium Ellin345] >gi|94549116|gb|ABF39040.1| Protein of unknown function UPF0011 [Acidobacteria bacterium Ellin345] (287 aa)
Score = 338, Expect = 6.6e-30, Identities = 83/276 (30%), Positives = 150/276 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNG-NNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYR-SSIANINEIK--ITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRKN 280
           L++V TPIGN+++I+  AI T+    +  CEDTR ++KLLN  +I     +++  N      + +   + +     L++DAG P +SDPGF LI L I++   V  I GPS+ + +L+ SG P+    F GFL   +  +   L  ++N ++T+I +E+ HR+ +T++ I ++    + + +ARE+TK++E   R +S   ++E+K     KGE  +LI     E +  +   +  +V     E +  +   E+ A K V+ +  +  +  Y   Q+ K+
  S:    10 LYLVGTPIGNLEDITFRAIRTMKEVQLIACEDTRQTQKLLNHYDIVTHTTSYHEHNELTRSAELVMQLE-QGKSIALVTDAGMPGISDPGFRLITLAIRHRIPVVPIPGPSAFLSALVASGLPTDAFRFLGFLPSKEGQRAKALEGIRNSTRTVIFYEAPHRLLETVEEIVQVLGPERPVVVAREVTKLHEEFLRGTSTEVLSELKHRAEVKGEITLLI-GRAPEQQHGQSVFSAATVRTRVRELMKHENLDERDALKRVAKEMGVSKSEAYRELQKTKD 287
>gi|53732736|ref|ZP_00154991.2| COG0313: Predicted methyltransferases [Haemophilus influenzae R2846] >gi|148825806|ref|YP_001290559.1| hypothetical protein CGSHiEE_03785 [Haemophilus influenzae PittEE] >gi|148715966|gb|ABQ98176.1| hypothetical protein CGSHiEE_03785 [Haemophilus influenzae PittEE] (283 aa)
Score = 338, Expect = 6.6e-30, Identities = 92/270 (34%), Positives = 149/270 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IVATPIGN+++I++ A+ T     +   EDTR+S  LL+   I    K F++L+ +NE++  +    K    +   L+SDAG P++SDPGF L+    +    V  + G  + + +L  SG  S    F GFL      ++D+L  +  E +T+I +ES HRI DTL+ ++ +    + I +ARE+TK  ETI  ++I N+ E  + +    KGE V++++   K   +   E +  +V   E   LI +    K A  +V+  Y  K N+LY F
  S:     8 LYIVATPIGNLQDITQRALETFAQVDLIAAEDTRHSGLLLSHYGI---KKPFFALHDHNEQEKAHILVEKLKQGSNIALISDAGTPLISDPGFHLVRQCREVGIRVVPLPGACAAITALCASGIASDRFCFEGFLPAKSKARKDKLENIAEEDRTLIFYESTHRILDTLEDMQAVLGEERYIVLAREMTKTWETITGNTIKNLREWLLEDPNRTKGEMVLIVEGKPKSDNN--DEISPQAVKALE---LIAEELPLKKAAAIVAELYGYKKNALYQF 276
>gi|24215693|ref|NP_713174.1| methyltransferase [Leptospira interrogans serovar Lai str. 56601] >gi|24196862|gb|AAN50192.1|AE011462_10 Predicted methyltransferase [Leptospira interrogans serovar Lai str. 56601] (250 aa)
Score = 337, Expect = 6.6e-30, Identities = 84/221 (38%), Positives = 129/221 (58%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETI-YRSSIANINEIKITEKGEFVILIDNNVKE 225
           L++V+TPIGN+++++  A+  L N     CE++ +SKKL    +I  +  T Y     N    I     +   + L+SDAG P +SDPG  LI +  +  + +  I GPS+L   L +SG+ ++  LF GFL+  K  K++QL + K     I+IFESVHRI+DTL  I+E+F + +   I RE+TK++E I + S  A     +   KGEFV+LI+ N K+
  S:    17 LYVVSTPIGNLEDLTFRALRILKNTDRILCENSGHSKKLFRSYSIHTQCSTLYKDQSENPYLSILEELKEGKTFALVSDAGTPGISDPGSHLIRVVREKGFKISPIPGPSALTALLGISGWQANPFLFLGFLSEKKGKKRNQLYEWKEFEGLIMIFESVHRIEDTLNSIQEVFSDCE-FLIGREMTKIHEEILHFSPFATEKSKEFASKGEFVVLINTNRKK 237
>gi|127511162|ref|YP_001092359.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Shewanella loihica PV-4] >gi|126636457|gb|ABO22100.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Shewanella loihica PV-4] (280 aa)
Score = 337, Expect = 6.7e-30, Identities = 88/270 (32%), Positives = 137/270 (50%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSS----IANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELE--KLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +IS  A+  L   S+  CEDTR+S KLL+   I       +  N  +  Q I           L+SDAG P++SDPG+ L++   +  + V  + GP + + +L  SG PS    F GFL   +  + D+L +LK + +T+I +ES HRI  +L  I       + + +ARE+TK  ET         +A ++E    +KGE V++   +        + + D  V    LE  KL+ +    K A  + +  + LK N+LY  
  S:     7 LYIVPTPIGNLGDISSRALEVLNQVSLIACEDTRHSGKLLSHFGIETRKTALHDHNERDRAQGIIQKLANGESVALISDAGTPLISDPGYHLVSQVREAGFKVVPLPGPCAAITALSASGLPSDRFSFEGFLPAKEKGRLDKLTELKEDPRTLIFYESPHRIVHSLTSIVAALGGDRQVVMAREVTKTFETFLSGPAAEVLATVSEDPNQQKGEIVLMCHGH--------RTDEDAGVPAQALETLKLLSQELPLKKASALAAQIHGLKKNALYKL 274
>gi|153872858|ref|ZP_02001628.1| Protein of unknown function UPF0011 [Beggiatoa sp. PS] >gi|152070674|gb|EDN68370.1| Protein of unknown function UPF0011 [Beggiatoa sp. PS] (279 aa)
Score = 337, Expect = 7.2e-30, Identities = 92/277 (33%), Positives = 156/277 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE----KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI----NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRKNC 281
           L++VATPIG+++++S  A + L   ++   EDTR+S+ LLN   I+    +  SL+ +NE    + F+      DN   L+SDAG P++SDPG  LI   +     V  I GPS+L+ +L VSGF +   +F GFL      +Q  L  L ++++T++ +E+ HR+ D L  + +IF  ++   + +ELTK+ ET+YR ++  I    N +   +KGEFV+++        + K +    +V + ++  ++ K    K A K+ S    +  N LY F   +K+C
  S:     6 LYVVATPIGHLQDLSPRAQSILQEVNLIAAEDTRHSRHLLNYFGIT---TSLQSLHEHNEHVKYRLFLQRLHDGDN-IALISDAGTPLISDPGQYLIQTALAEQITVLPIPGPSALISALSVSGFLADRFIFEGFLPAKTVARQLCLENLVHDTRTLVFYEAPHRLLDCLNDMIQIFGENREAVLVKELTKVFETVYRDTLIGIVHWLNAVIQRQKGEFVLVVQG------APKFDNKAINVEVEKIFNILHKELPLKQAAKLTSEITGVNKNILYAF-GLKKSC 279
>gi|30693914|ref|NP_175126.2| tetrapyrrole methylase family protein [Arabidopsis thaliana] >gi|34365739|gb|AAQ65181.1| At1g45110 [Arabidopsis thaliana] >gi|110738768|dbj|BAF01308.1| hypothetical protein [Arabidopsis thaliana] (343 aa)
Score = 337, Expect = 7.3e-30, Identities = 88/270 (32%), Positives = 138/270 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI-NEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L++V TPIGN+++I+  AI  L +  +   EDTR+S KLL   NI  +  +++  N    +Q + +   +     L+SDAG P +SDPG  L  +  K N DV  I G  +++ +L  SG  +    F GFL  +   ++++L    NE++T I +   H++   L+     F  S+   IARE+TK++E  +R SIA    E  I + KGE  +LI+      E  K E    S    EL  LI  G     A K V+ + S++   +Y+ 
  S:    57 LYLVGTPIGNLEDITLRAIRVLRSADVILSEDTRHSGKLLQYYNIKAQLLSYHKFNEAQREQAVLTRLKQGEIVALISDAGTPGISDPGTQLAKMCAKENIDVIPIPGACAVVAALSASGLETDEFTFVGFLPKHSGTRKERLIVSSNETRTQIFYVPPHKLSQFLEETTPYFGESRQCVIAREITKLHEEFWRGSIAEAKQEFLIRQPKGEITLLIEGK----EETKAENPTESQLEEELRGLISDGHSLSTAVKTVAERTSMRKKEVYSL 324
>gi|88858786|ref|ZP_01133427.1| putative methyltransferase [Pseudoalteromonas tunicata D2] >gi|88819012|gb|EAR28826.1| putative methyltransferase [Pseudoalteromonas tunicata D2] (287 aa)
Score = 337, Expect = 7.5e-30, Identities = 88/268 (32%), Positives = 147/268 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE-----KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++VATPIGN+ +IS+ AI TL++  +   EDTR++ KLL+  ++S++ KTF +L+ +NEKQ         NE     L+SDAG P++SDPG+ +++L  +    V  + G  + + ++  SG P+    F GF       +QD          T II+ES HRI  +L  I+ +    + + +A+ELTK  ET +  ++  + E  +TE     +GE V+++    K+ E I  +          +  L+      K AC +V+  + +K N+LY
  S:    13 LYVVATPIGNLDDISQRAIATLSSVDLIAAEDTRHTGKLLS--HLSIKAKTF-ALHDHNEKQKAQQIVNWLNEGLDVALVSDAGTPLISDPGYSVVSLCREQGAKVTPVPGACAAIAAVSCSGLPTDRFQFLGFSPAKSKARQDFFLSAYESGMTSIIYESTHRIMASLDDIEHVLGAQQQVVLAKELTKTFETFFSGTVVELREF-LTEDPTRQRGEIVLMLPGKEKQPEEIPADA-------RRMLSLLEAEMPMKKACGIVADYFGIKKNALY 277
>gi|113460884|ref|YP_718951.1| methyltransferase [Haemophilus somnus 129PT] >gi|112822927|gb|ABI25016.1| conserved hypothetical protein [Haemophilus somnus 129PT] (281 aa)
Score = 337, Expect = 8.1e-30, Identities = 90/270 (33%), Positives = 144/270 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L++VATPIGN+++I++ A+   T   +   EDTR+S  LLN   I    + F++L+ +NE+Q  +    K  +     L+SDAG P++SDPGF ++    + N  V  + G  + + +L  SG  S    F GFL      ++D+L  L NE +T+I +ES HRI D L  I+      + + +ARE+TK  ETI    I      + E     KGE V++++         K+E+  +S    +  +L+ +    K A  +V+  Y  K N+LY F
  S:     8 LYVVATPIGNLQDITQRALDVFTKVDLIAAEDTRHSGLLLNHYGI---KRNFFALHDHNEQQKADVLIEKLQQGLNIALISDAGTPLISDPGFHVVRKCHQANIRVVPLPGACAAITALCASGIASDRFCFEGFLPAKSKARRDKLANLANEDRTLIFYESTHRILDCLTDIELELGADRYVVLAREITKTWETIRGDQIGRLRQWLQEDPNRTKGEMVLIVEGKS------KREDETFSPQAIKTLQLVSQELPLKKAASIVAEIYGYKKNALYQF 275
>gi|45656956|ref|YP_001042.1| tetrapyrrole (corrin/porphyrin) methylase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|45600193|gb|AAS69679.1| tetrapyrrole (corrin/porphyrin) methylase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (250 aa)
Score = 337, Expect = 8.5e-30, Identities = 84/221 (38%), Positives = 128/221 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETI-YRSSIANINEIKITEKGEFVILIDNNVKE 225
           L++V+TPIGN+++++  A+  L N     CE++ +SKKL    +I  +  T Y     N    I     +   + L+SDAG P +SDPG  LI +  +  + +  I GPS+L   L +SG+ ++  LF GFL+  K  K++QL + K     I+IFESVHRI DTL  I+E+F + +   I RE+TK++E I + S  A     +   KGEFV+LI+ N K+
  S:    17 LYVVSTPIGNLEDLTFRALRILKNTDRILCENSGHSKKLFRSYSIHTQCSTLYKDQSENPYLSILEELKEGKTFALVSDAGTPGISDPGSHLIRVVREKGFKISPIPGPSALTALLGISGWQANPFLFLGFLSEKKGKKRNQLYEWKEFEGLIMIFESVHRIGDTLNSIQEVFSDCE-FLIGREMTKIHEEILHFSPFATKKPKEFASKGEFVVLINTNRKK 237
>gi|67924972|ref|ZP_00518359.1| Protein of unknown function UPF0011 [Crocosphaera watsonii WH 8501] >gi|67853185|gb|EAM48557.1| Protein of unknown function UPF0011 [Crocosphaera watsonii WH 8501] (300 aa)
Score = 337, Expect = 8.6e-30, Identities = 91/270 (33%), Positives = 149/270 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGN-NEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI-----NEIKITEKGEFVILIDNNVK-ETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+++I+  AI  L + ++   EDTR++ KLL+   I+    +++  N      Q +N  + +     L++DAG P +SDPG+ LI   I  N  V  I G ++ + +L VSG P+   +F GFL      + D+LNQL  E++TIII+E+ HR+  TL+  KE+F     I +ARELTK  E  +R ++ N      N  +I  KGEF ++I    + +   +  EE       +EL++L+++G     A + ++         +Y+ 
  S:    28 LYIVGTPIGNLEDITFRAIRILKSVNLIAAEDTRHTAKLLHHFEITTPQVSYHHHNRTARHTQLLNYLE-EGQTIALVTDAGMPGISDPGYDLIYTCIIANIPVIPIPGATAAITALSVSGLPTDRFIFEGFLPLKGKDRSDRLNQLMTETRTIIIYEAPHRLLKTLRNFKEVFGQDHQITVARELTKRYEEFWRGTLDNAILYYQNSQQI--KGEFTLIIAGGSQNDGLELTIEELK-----DELQQLLKQGMTRSQASRQLAKVTHFSRRQIYDL 296
>gi|121602718|ref|YP_989318.1| tetrapyrrole methylase family protein [Bartonella bacilliformis KC583] >gi|120614895|gb|ABM45496.1| tetrapyrrole methylase family protein [Bartonella bacilliformis KC583] (301 aa)
Score = 336, Expect = 9.1e-30, Identities = 83/231 (35%), Positives = 131/231 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFD-FKDNE-YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI---KITEKGEFVILIDNNVKETESIKKEETD 235
           L++VATPIGN+ +I+  A+  L    I  CEDTR ++ LL   +  ++ KTF     N +K          DN+   L+SDAG P++SDPGF L+    K  + +  I G S+L+ SL+V+G P+ +  F GFL+  K  +Q +L +LK    T++ +ES HR+ ++L+ +  IF   +   I RELTK  E +   ++ ++ EI   K   +GE V+L+      TE +  +E D
  S:    28 LYLVATPIGNLSDITLRALQVLAGADIVACEDTRVTRVLLE--HYGIQKKTFLYHEYNAQKAGPKLLKALADNQSVALVSDAGTPLISDPGFKLVGEARKAGYKIIPIPGASALLASLVVTGLPTDSFFFAGFLSAKKTQRQKRLEKLKFIPATLVFYESPHRLVESLQDMVTIFTADRPAAICRELTKKFEKVNVDNLGHLLEIYSKKDCIRGEIVVLVGEEEISTEIMSSQEID 261
>gi|68250256|ref|YP_249368.1| methyltransferase [Haemophilus influenzae 86-028NP] >gi|145633329|ref|ZP_01789060.1| predicted methyltransferase [Haemophilus influenzae 3655] >gi|68058455|gb|AAX88708.1| predicted methyltransferase [Haemophilus influenzae 86-028NP] >gi|144986175|gb|EDJ92765.1| predicted methyltransferase [Haemophilus influenzae 3655] (283 aa)
Score = 336, Expect = 9.1e-30, Identities = 92/270 (34%), Positives = 148/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IVATPIGN+++I++ A+ T     +   EDTR+S  LL    I    K F++L+ +NE++  +    K    +   L+SDAG P++SDPGF L+    +    V  + G  + + +L  SG  S    F GFL      ++D+L  +  E +T+I +ES HRI DTL+ ++ +    + I +ARE+TK  ETI  ++I N+ E  + +    KGE V++++   K   +   E +  +V   E   LI +    K A  +V+  Y  K N+LY F
  S:     8 LYIVATPIGNLQDITQRALETFAQVDLIAAEDTRHSGLLLIHYGI---KKPFFALHDHNEQEKAHILVEKLKQGSNIALISDAGTPLISDPGFHLVRQCREAGIRVVPLPGACAAITALCASGIASDRFCFEGFLPAKSKARKDKLENIAEEDRTLIFYESTHRILDTLEDMQAVLGEGRYIVLAREMTKTWETITGNTIKNLREWLLEDPNRTKGEMVLIVEGKPKSDNN--DEISPQAVKALE---LIAEELPLKKAAAIVAELYGYKKNALYQF 276
>gi|84394444|ref|ZP_00993160.1| hypothetical protein V12B01_10023 [Vibrio splendidus 12B01] >gi|84374943|gb|EAP91874.1| hypothetical protein V12B01_10023 [Vibrio splendidus 12B01] (288 aa)
Score = 336, Expect = 9.7e-30, Identities = 86/270 (31%), Positives = 142/270 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ AI  L++  +   EDTR++ KLL   NIS      +  N   + Q +     +     L+SDAG P++SDPG+ L++   +    V  + G  +++ +L  SG PS    F GFL      ++D+  ++    +T I +ES HRI D+L+ + EI    + + +ARELTK  ETI    +      I E    ++GE V+LI  + +E  +   +E   ++ +   E  ++K      A  M +  Y+LK N+LY +
  S:    14 LYIVPTPIGNLGDITQRAIEILSSVDVIAAEDTRHTGKLLAHFNISTRTFALHDHNEQTKAQVLVERLLEGQSIALVSDAGTPLISDPGYHLVSQCRQAGVRVVPLPGACAVITALSASGLPSDRFSFEGFLPPKSKGRKDKFLEIAKAERTCIFYESPHRITDSLQDMLEILGPDREVVLARELTKTFETIQGLPLGELIEWIEEDSNRKRGEMVLLIHGHREEASTDLPDEATRTLGILTKELPLKK------AAAMTAEIYNLKKNALYKW 281
>gi|170717432|ref|YP_001784532.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Haemophilus somnus 2336] >gi|168825561|gb|ACA30932.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Haemophilus somnus 2336] (281 aa)
Score = 336, Expect = 9.8e-30, Identities = 89/270 (32%), Positives = 145/270 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANIN----EIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L++VATPIGN+++I++ A+   T   +   EDTR+S  LLN   I    + F++L+ +NE+Q  +    K  +     L+SDAG P++SDPGF ++    + N  V  + G  + + +L  SG  S    F GFL      ++D+L  L NE +T+I +ES HRI D L  I+      + + +ARE+TK  ETI    +  ++    E     KGE V++++         K+E+  +S    +  +L+ +    K A  +V+  Y  K N+LY F
  S:     8 LYVVATPIGNLQDITQRALDVFTKVDLIAAEDTRHSGLLLNHYGI---KRNFFALHDHNEQQKADVLIEKLQQGLNIALISDAGTPLISDPGFHVVRKCHQANIRVVPLPGACAAITALCASGIASDRFCFEGFLPAKSKARRDKLANLANEDRTLIFYESTHRILDCLTDIELELGADRYVVLAREITKTWETIRGDQVGKLHQWLQEDPNRTKGEMVLIVEGKS------KREDETFSPQAIKTLQLVSQELPLKKAASIVAEIYGYKKNALYQF 275
>gi|28209993|ref|NP_780937.1| corrin/porphyrin methyltransferase [Clostridium tetani E88] >gi|28202428|gb|AAO34874.1| corrin/porphyrin methyltransferase [Clostridium tetani E88] (281 aa)
Score = 336, Expect = 9.9e-30, Identities = 91/263 (34%), Positives = 162/263 (61%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKI-TEKGEFVILIDNNVKETESIKKEETDYSVYLNE-----------LEKLIRKGEKEKVACKMVSYKYSL 266
           KL+IV TPIGN+K+I+  A+ TL    I   EDTR + KLLN  +I  +  +++  N   + Q I     + N   L+SDAG P +SDPG +++   I+ N D +++ G ++L+ +LI SG  ++  LF GFL  +   K++ + ++K+ ++TIII+E+ HR+ +TLK +KE  +N + I I RE++K++E ++R ++   I+  K  + +GE+VI+I+   KE    ++ +    + ++E            ++ I++  K++   K   YKYS+
  S:     5 KLYIVPTPIGNLKDITLRALDTLKVVDIIAAEDTRQTIKLLNHYDIKKKLISYHQHNEQGKSQDIIGLLEEGNNIALVSDAGTPAISDPGSVIVKKCIEQNIDYEVLPGATALIPALIYSGLDTTKFLFRGFLPRDNKFKKEVIEEIKDYTETIIIYEAPHRLLNTLKFLKENLNN-RRISIIREISKLHEQVHRFTLEEAIDYYKCNSTRGEYVIVIEGKSKEELEKEELDQWKELSISEHILFYMKDGVSKKEAIKRTAKDRKISKSEVYKYSI 279
>gi|91791642|ref|YP_561293.1| hypothetical protein Sden_0274 [Shewanella denitrificans OS217] >gi|91713644|gb|ABE53570.1| Protein of unknown function UPF0011 [Shewanella denitrificans OS217] (280 aa)
Score = 336, Expect = 1.0e-29, Identities = 88/270 (32%), Positives = 139/270 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L++V TPIGN  ++S  AI  L   ++  CEDTR+S KLL+   I+      +  N  +  Q+I           L+SDAG P++SDPG+ L+    +  +DV  + GP + + +L  SG PS    F GFL   +  + D+L  L+ + +T+I +ES HRI+ +L  I ++    + + +ARE+TK  ET    +   I +I       +KGE V++    V +      EE   +V LN L  L  +   +K A       + LK N+LY +
  S:     7 LYVVPTPIGNFGDMSSRAIEVLNQVALIACEDTRHSGKLLSHFGIATRKIALHDHNERDRAQWIVEKLQAGESIALISDAGTPLISDPGYHLVKHVREAGFDVIPLPGPCAAITALSASGLPSDRFSFEGFLPAKEKGRCDKLEALREDPRTLIFYESPHRIEQSLASIVQVLGEDRQMVMAREVTKTFETFLSGTAQEILDIVRHDPNQQKGEIVLMCHGFVTQ-----DEEAIPTVALNTLTLLCEELPLKKAAAIAAQI-HGLKKNALYKY 274
>gi|145641101|ref|ZP_01796682.1| hypothetical protein CGSHiR3021_08526 [Haemophilus influenzae R3021] >gi|145274262|gb|EDK14127.1| hypothetical protein CGSHiR3021_08526 [Haemophilus influenzae 22.4-21] (283 aa)
Score = 336, Expect = 1.1e-29, Identities = 91/270 (33%), Positives = 149/270 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IVATPIGN+++I++ A+ T     +   EDTR+S  LL+   I    K F++L+ +NE++  +    K    +   L+SDAG P++SDPGF L+    +    +  + G  + + +L  SG  S    F GFL      ++D+L  +  E +T+I +ES HRI DTL+ ++ +    + I +ARE+TK  ETI  ++I N+ E  + +    KGE V++++   K   +   E +  +V   E   LI +    K A  +V+  Y  K N+LY F
  S:     8 LYIVATPIGNLQDITQRALETFAQVDLIAAEDTRHSGLLLSHYGI---KKPFFALHDHNEQEKAHILVEKLKQGSNIALISDAGTPLISDPGFHLVRQCREAGIRIVPLPGACAAITALCASGIASDRFCFEGFLPAKSKARKDKLENIAEEDRTLIFYESTHRILDTLEDMQAVLGEERYIVLAREMTKTWETITGNTIKNLCEWLLEDPNRTKGEMVLIVEGKPKSDNN--DEISPQAVKALE---LIAEELPLKKAAAIVAELYGYKKNALYQF 276
>gi|189546093|ref|XP_001921864.1| PREDICTED: similar to tetrapyrrole methylase family protein (ISS) [Danio rerio] (296 aa)
Score = 336, Expect = 1.1e-29, Identities = 76/215 (35%), Positives = 123/215 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILI 219
           L++VATPIGN+ +I+  A+ TL    +  CEDTR ++ LL+   I      ++  N +     + +F  +     L+SDAG P++SDPG+ L  L I++ + V  I G S+ + +L+ SG P+   LF GFL      ++D+L +LK+   T+I+FES HRI DTL    ++  + ++  + RELTK  E   R ++A + +       KGE V++I
  S:    27 LYLVATPIGNLGDITLRALETLAGADVLACEDTRVTRVLLDRYGIRNRPFAYHEHNADEAGPRLLAFLEQGKTVALVSDAGTPLVSDPGYRLGQLAIESGYPVIPIPGASAPLAALVGSGLPNDAFLFAGFLPAKDKARRDRLAELKDVPATLILFESPHRIGDTLAAAADVLGSERDASVCRELTKTFEEFRRGTLAELAQAYADAPVKGEIVLVI 243
>gi|148980578|ref|ZP_01816125.1| hypothetical protein VSWAT3_27048 [Vibrionales bacterium SWAT-3] >gi|145961161|gb|EDK26477.1| hypothetical protein VSWAT3_27048 [Vibrionales bacterium SWAT-3] (288 aa)
Score = 336, Expect = 1.1e-29, Identities = 86/270 (31%), Positives = 142/270 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ AI  L++  +   EDTR++ KLL   NIS      +  N   + Q +     +     L+SDAG P++SDPG+ L++   +    V  + G  +++ +L  SG PS    F GFL      ++D+  ++    +T I +ES HRI D+L+ + EI    + + +ARELTK  ETI    +      I E    ++GE V+LI  + +E  +   +E   ++ +   E  ++K      A  M +  Y+LK N+LY +
  S:    14 LYIVPTPIGNLGDITQRAIEILSSVDVIAAEDTRHTGKLLAHFNISTRTFALHDHNEQTKAQVLVEKLLEGQSIALVSDAGTPLISDPGYHLVSQCRQAGVRVVPLPGACAVITALSASGLPSDRFSFEGFLPPKSKGRKDKFLEIAKAERTCIFYESPHRISDSLQDMLEILGPDREVVLARELTKTFETIQGLPLGELIEWIEEDANRKRGEMVLLIHGHREEASTELPDEATRTLGILTKELPLKK------AAAMTAEIYNLKKNALYKW 281
>gi|89095269|ref|ZP_01168190.1| hypothetical protein MED92_15870 [Oceanospirillum sp. MED92] >gi|89080476|gb|EAR59727.1| hypothetical protein MED92_15870 [Oceanospirillum sp. MED92] (277 aa)
Score = 335, Expect = 1.2e-29, Identities = 79/239 (33%), Positives = 141/239 (58%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI----NEIKITEKGEFVILI----DNNVKETESIKKEETDYSVYLNEL 243
           L++VATPIGN+ +++  A+  L    +   EDTR+S +L+    I   +    S++ +NE+Q I++   +        L+SDAG P++SDPG++++    +  + V  + G  + + +L  +G P+   +F GFL H    ++ QL  L +E++T++ +ES HRI  +LK ++E+F   + + IARE+TK  ETI    +A++          ++GEFV+L+     N  KE ++  K+  +  V L+EL
  S:     6 LYVVATPIGNLLDMTPRAVEVLQQVELIAAEDTRHSARLMAHFGI---DTRLVSVHEHNERQRIDTIVHQLASGASVALISDAGTPLISDPGYVVVKGVREQGYRVVPVPGCVAFIAALSAAGLPTDRFVFEGFLPHKSAARKQQLKSLSDETRTLVFYESPHRILASLKDMQEVFGADRQVAIAREITKTYETIRSDGLADLIAWMEADSNQQRGEFVVLVHGVEQNGPKELDANAKQVLE--VLLSEL 250
>gi|86148531|ref|ZP_01066818.1| hypothetical protein MED222_16878 [Vibrio sp. MED222] >gi|85833677|gb|EAQ51848.1| hypothetical protein MED222_16878 [Vibrio sp. MED222] (288 aa)
Score = 335, Expect = 1.2e-29, Identities = 86/270 (31%), Positives = 142/270 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ AI  L++  +   EDTR++ KLL   NIS      +  N   + Q +     +     L+SDAG P++SDPG+ L++   +    V  + G  +++ +L  SG PS    F GFL      ++D+  ++    +T I +ES HRI D+L+ + EI    + + +ARELTK  ETI    +      I E    ++GE V+LI  + +E  +   +E   ++ +   E  ++K      A  M +  Y+LK N+LY +
  S:    14 LYIVPTPIGNLGDITQRAIEILSSVDVIAAEDTRHTGKLLAHFNISTRTFALHDHNEQTKAQVLVERLLEGQSIALVSDAGTPLISDPGYHLVSQCRQAGVRVVPLPGACAVITALSASGLPSDRFSFEGFLPPKSKGRKDKFLEIAKAERTCIFYESPHRITDSLQDMLEILGPDREVVLARELTKTFETIQGLPLGELIEWIEEDANRKRGEMVLLIHGHREEASTELPDEATRTLGILTKELPLKK------AAAMTAEIYNLKKNALYKW 281
>gi|124026373|ref|YP_001015489.1| putative tetrapyrrole methylase family protein [Prochlorococcus marinus str. NATL1A] >gi|123961441|gb|ABM76224.1| putative tetrapyrrole methylase family protein [Prochlorococcus marinus str. NATL1A] (358 aa)
Score = 335, Expect = 1.2e-29, Identities = 88/274 (32%), Positives = 147/274 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILI-DNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQR 278
           L++V TPIGN+ ++S  A + L N S   CEDTR S +LL ++   +   +++  N  + +  +           L+SDAG P ++DPG  L++    N+++V  + GP +   +L++SG PS    F GFL   ++L++ +L  +  E +T +I+ES H++   L+ +       + I IARELTK  E     +I  + +  IT   KGEF I++  NN K+   + + E      LN+L  LI +GEK  +A + V+ +   K   LY+   +R
  S:    84 LYLVGTPIGNLGDLSPRAKSILKNVSRIACEDTRRSGQLLKIIKSEVPLLSYHKHNFKSRQSQLLEILECGGSLALISDAGLPGINDPGEELVHAARSNSYEVICVPGPCAATTALVISGLPSERFCFEGFLPKKQSLRKKRLEDISQEQRTTVIYESPHQLIKLLEDLSISCGKERPIQIARELTKRYEESIGKTIEEVTKYFITNKPKGEFTIVLGGNNNKQQNKVSESEA-----LNKLNTLINQGEKSNIAAQKVAEETGYKKKWLYSKLHKR 355
>gi|39938718|ref|NP_950484.1| hypothetical protein PAM232 [Onion yellows phytoplasma OY-M] >gi|39721827|dbj|BAD04317.1| conserved hypothetical protein [Onion yellows phytoplasma OY-M] (285 aa)
Score = 335, Expect = 1.2e-29, Identities = 92/264 (34%), Positives = 146/264 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSV--YL----NELEKLIRKGEKEKVACKMVSYKYSLKS 268
           L++VATPIGN+++I+  A+ TL    +   EDTR +KKLL+   I     ++Y  N       I     +     L+SDAG P++SDPGF L+    K+ ++V  I G S+ + + + S  PS   +F  FL       +  L Q KN S++++I+ES HRIK TL +I +++ N K I +ARELTK  ETI   ++ +I E  +  KGE+VI++  N    E +     +  V  YL    NE E   +  ++  +  K + ++Y +K+
  S:    15 LYLVATPIGNLQDITLRALATLKEVFLILAEDTRRAKKLLHTYQIQTPLLSYYEHNQTRRLPQILELLSQGKNIALISDAGTPLISDPGFSLVCEVQKHGFNVVAIPGVSAFLTAFMTSAIPSP-FIFLAFLPRLSQALEKYLLQYKNASESLVIYESPHRIKKTLLLIHKLYGNRK-ISLARELTKKFETIINGNLDSILEFDLINKGEYVIVVAGNPNPNEHLLALSINDHVLFYLKLGFNEKEAFSKVAQERNITKKEIYHQYKIKN 282
>gi|145634459|ref|ZP_01790169.1| hypothetical protein CGSHiAA_06699 [Haemophilus influenzae PittAA] >gi|145268439|gb|EDK08433.1| hypothetical protein CGSHiAA_06699 [Haemophilus influenzae PittAA] (283 aa)
Score = 335, Expect = 1.2e-29, Identities = 92/270 (34%), Positives = 148/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IVATPIGN+++I++ A+ T     +   EDTR+S  LL    I    K F++L+ +NE++  +    K    +   L+SDAG P++SDPGF L+    +    V  + G  + + +L  SG  S    F GFL      ++D+L  +  E +T+I +ES HRI DTL+ ++ +    + I +ARE+TK  ETI  ++I N+ E  + +    KGE V++++   K   +   E +  +V   E   LI +    K A  +V+  Y  K N+LY F
  S:     8 LYIVATPIGNLQDITQRALETFAQVDLIAAEDTRHSGLLLIHYGI---KKPFFALHDHNEQEKAHILVEKLKQGSNIALISDAGTPLISDPGFHLVRQCREAGIRVVPLPGACAAITALCASGIASDRFCFEGFLPAKSKARKDKLENIAEEDRTLIFYESTHRILDTLEDMQAVLGEERYIVLAREMTKTWETITGNTIKNLREWLLEDPNRTKGEMVLIVEGKPKSDNN--DEISPQAVKALE---LIAEELPLKKAAAIVAELYGYKKNALYQF 276
>gi|46133585|ref|ZP_00157422.2| COG0313: Predicted methyltransferases [Haemophilus influenzae R2866] >gi|145629260|ref|ZP_01785059.1| hypothetical protein CGSHi22121_10670 [Haemophilus influenzae 22.1-21] >gi|145639191|ref|ZP_01794798.1| hypothetical protein CGSHiII_04114 [Haemophilus influenzae PittII] >gi|144978763|gb|EDJ88486.1| hypothetical protein CGSHi22121_10670 [Haemophilus influenzae 22.1-21] >gi|145271753|gb|EDK11663.1| hypothetical protein CGSHiII_04114 [Haemophilus influenzae PittII] (283 aa)
Score = 335, Expect = 1.3e-29, Identities = 92/270 (34%), Positives = 148/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IVATPIGN+++I++ A+ T     +   EDTR+S  LL+   I    K F++L+ +NE++  +    K    +   L+SDAG P++SDPGF L+    +    V  + G  + + +L  SG  S    F GFL      ++D+L  +  E +T+I +ES HRI DTL+ ++ +    + I +ARE+TK  ETI  ++I N+ E    +    KGE V++++   K   +   E +  +V   E   LI +    K A  +V+  Y  K N+LY F
  S:     8 LYIVATPIGNLQDITQRALETFAQVDLIAAEDTRHSGLLLSHYGI---KKPFFALHDHNEQEKAHILVEKLKQGSNIALISDAGTPLISDPGFHLVRQCREAGIRVVPLPGACAAITALCASGIASDRFCFEGFLPAKSKARKDKLENIAEEDRTLIFYESTHRILDTLEDMQAVLGEERYIVLAREMTKTWETITGNTIKNLREWLSEDPNRTKGEMVLIVEGKPKSDNN--DEISPQAVKALE---LIAEELPLKKAAAIVAELYGYKKNALYQF 276
>gi|163764883|ref|ZP_02171935.1| methyltransferase-like protein [Bacillus selenitireducens MLS10] >gi|160354660|gb|EDP81321.1| methyltransferase-like protein [Bacillus selenitireducens MLS10] (300 aa)
Score = 335, Expect = 1.3e-29, Identities = 84/272 (30%), Positives = 147/272 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNEL------EKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQ 276
           L +V TPIGN+ +I+  A+ TL    +   EDTR+SKKL ++ +I+    +++  N +  +Q +     +     L++DAG P +SDPG  L++ FI+ +  V  + G ++ + +L+ SG P+    F GFL+ NK  + + LN  +    T+I +ES HR+K+ LK   +   + + + I+RE+TK  ETI R S++ +      E  KGE V+LI+    + E+    E     +  +L         ++ G + K A K V+ + +L    +Y  + 
  S:    17 LMLVPTPIGNLDDITYRAVQTLKEADVIAAEDTRHSKKLSHVFDITTPLISYHEHNKHAREQELVDRARRGETIALVTDAGTPGISDPGSELVSRFIEEDLPVHALPGANAAVTALVASGLPTETFSFIGFLDRNKKKRLETLNLWEKAPSTLIFYESPHRLKEMLKAALDALGDRRAV-ISREITKQYETILRGSLSELFHWIEQEGVKGECVVLIEGATGDEEAAVFGEEPEEAWWKDLGIADHVAHYVKAGMRSKEAIKEVAKERALPKRDVYQAYH 295
>gi|56751344|ref|YP_172045.1| tetrapyrrole methylase family protein [Synechococcus elongatus PCC 6301] >gi|81298985|ref|YP_399193.1| hypothetical protein Synpcc7942_0174 [Synechococcus elongatus PCC 7942] >gi|56686303|dbj|BAD79525.1| tetrapyrrole methylase family protein [Synechococcus elongatus PCC 6301] >gi|81167866|gb|ABB56206.1| Protein of unknown function UPF0011 [Synechococcus elongatus PCC 7942] (292 aa)
Score = 335, Expect = 1.4e-29, Identities = 82/270 (30%), Positives = 137/270 (50%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L++V TP+GN+++IS  A+  L        EDTR + +LL  L I     +++  N       + +         L+SDAG P ++DPG  L+   I     V  I GPS+++ +L  SG  S    F GFL   +  ++D L  L  E++T+I +ES HR++DTL+ +  +F   + I +ARELTK++E  +R S+   I E    E +GEF +++   V +T+++ ++         EL  L+  G     A + ++ +       LY  
  S:     9 LYLVGTPLGNLEDISYRAVKILRGVDAIAAEDTRRTGRLLQALGIDRPQVSYHEHNRQQRGPELIARLQAGQSIALVSDAGMPAIADPGQELVQAAIAAGLTVVPIAGPSAVIAALCASGLSSDRFAFEGFLPAKRKARRDVLQSLHQEARTLIFYESPHRLRDTLEDLAAVFGGDRAIVLARELTKLHEEFWRGSVTEAIAEFTRREPQGEFTLVVAGAVVQTQALSED-----TLRQELATLLAAGVSRSEASRTLAAQTGTPKRRLYQL 275
>gi|168187957|ref|ZP_02622592.1| conserved hypothetical protein [Clostridium botulinum C str. Eklund] >gi|169294206|gb|EDS76339.1| conserved hypothetical protein [Clostridium botulinum C str. Eklund] (280 aa)
Score = 334, Expect = 1.6e-29, Identities = 94/272 (34%), Positives = 157/272 (57%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYR----SSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYL---NELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           M+ KL++V TPIGN+K+I+  A+  L N  I   EDTR + KLLN  NI  +  +++  N N +   I +      +  L+SDAG P +SDPG ++I   I+ + + +++ G +++  +L+ SG  ++  LF GFL      ++  ++ LKN  +T+I +ES HR+  TL+ + E   N + I I RELTK++E I R     SIA  +E +   +GE+V++++   K  E + KEE +    L   N ++K I +G  +K A K V+    +  + +Y
  S:     1 MSGKLYVVPTPIGNLKDITLRALEILQNADIIAAEDTRQTLKLLNHFNIKKQMISYHKFNENIKSDDIINMLKDCKQVALVSDAGTPGISDPGSVIIKRCIEESIEFEVLTGATAVTTALVYSGLDTTKFLFRGFLPRENKDRKPIIDDLKNRQETLIFYESPHRLIKTLEFLYENLGN-RRISICRELTKLHEEILRLTLEESIAYYSENET--RGEYVLVVEG--KSIEEVIKEEQEVWADLSIENHIKKYIDEGLTKKEAIKKVAKDRGVPKSDIY 274
>gi|194468118|ref|ZP_03074104.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Lactobacillus reuteri 100-23] >gi|194452971|gb|EDX41869.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Lactobacillus reuteri 100-23] (288 aa)
Score = 334, Expect = 1.7e-29, Identities = 90/273 (32%), Positives = 143/273 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCL--LSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           L++V TPIGN+ +++  AI TL    +   EDTR++++LLN  +IS    +F+    N E++     +     Y +   SDAG P +SDPG  L+   ++    V  + G ++ + +LI SG       F+GFL      +   L QLK   +T+I +E+ HR+K TL  + E+  + + + +ARELTK  E   R ++A +         +GEFVIL+  N   TE   K   D  + L E ++K I  G     A K+V+ K ++K   LY  + Q
  S:    15 LYLVPTPIGNLDDMTFRAIKTLKEVDLIAAEDTRHTQQLLNHFDISTRQISFHE--HNTEQRVPELIEKLKAGYSIAQCSDAGMPSISDPGKELVAAAVREGVPVIPLPGANAGLTALIASGLVPQPFYFFGFLERKHQQQVTALEQLKERKETMIFYEAPHRLKKTLATMAEVLGDERQVVLARELTKRYEEFIRGTLAEVTAWFEDHQPRGEFVILVAGNEHPTE---KNNNDIELPLTEQVDKEILNGLSTNAAIKLVAKKNNIKRQELYKQYHQ 287
>gi|49474527|ref|YP_032569.1| hypothetical protein BQ09730 [Bartonella quintana str. Toulouse] >gi|49240031|emb|CAF26449.1| hypothetical protein [Bartonella quintana str. Toulouse] (295 aa)
Score = 334, Expect = 1.8e-29, Identities = 78/231 (33%), Positives = 128/231 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEK-----GEFVILIDNNVKETESIKKEETD 235
           L++VATPIGN+ +I+  A+  L    I  CEDTR ++ LL    I  +   ++  N     Q + +   ++    L+SDAG P++SDPGF L+    K  + +  I G S+L+ +L+ +G P+ +  F GFL+  K  +Q +L QLK    T++ +ES HR+ +TL+ +  +F       I RELTK  ET+  S++ ++  +K   K     GE V+L+   +   E +  +E D
  S:    22 LYLVATPIGNLADITLRALQVLAGVDILACEDTRVTRILLERYGIQKKTFLYHEHNAQKAGQKLLAALSENKTVALVSDAGTPLISDPGFRLVEAARKAGYKIVPIPGASALLAALVTTGLPTDSFFFAGFLSARKAQRQKRLEQLKAIPATLVFYESPHRLVETLQDMVSLFSADCPAAICRELTKKFETVDVSNLGDL--LKSYRKQLHIYGEIVVLVGQKLSPLEVMSDQEVD 255
>gi|116327700|ref|YP_797420.1| methyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331641|ref|YP_801359.1| methyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116120444|gb|ABJ78487.1| Methyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116125330|gb|ABJ76601.1| Methyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (251 aa)
Score = 334, Expect = 1.9e-29, Identities = 82/221 (37%), Positives = 127/221 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETI-YRSSIANINEIKITEKGEFVILIDNNVKE 225
           L++++TPIGN+++++  A+  L N     CE+  +SKKL    +IS    T Y          I         + L+SDAG P +SDPG  LI +  +  + +  I G S+L   L +SG+ ++  LF GFL+  KN K++QL + K     +++FESVHRI DTL  ++E+F +S+   + RE+TK++E I Y S   + N  K   KGEFV+LI+ N K+
  S:    18 LYVISTPIGNLEDLTFRALRILKNTDRILCENVEHSKKLFRSYSISTPASTLYKDQSEIPYSGILEELKVGKTFALVSDAGTPGISDPGSHLIRVVREAGFKITPIPGASALTALLGISGWQANPFLFLGFLSEKKNKKRNQLTEWKKFEGLVMLFESVHRIGDTLDAVEEVFPDSE-FLVGREITKIHEEILYFSPFLSENPKKFVHKGEFVVLINTNRKK 238
>gi|110639756|ref|YP_679966.1| methyltransferase [Cytophaga hutchinsonii ATCC 33406] >gi|110282437|gb|ABG60623.1| methyltransferase [Cytophaga hutchinsonii ATCC 33406] (250 aa)
Score = 333, Expect = 2.0e-29, Identities = 77/234 (32%), Positives = 132/234 (56%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILIDNNVKETESIKKEETDYS 237
           KL++V TPIGN+++I+  AI  L    +   EDTR S  LL  L +  + + F++ N +   Q       +     L+SDAG P +SDPGFLL+     +N  V+ + GP++ + +++ SG PS   +F GFL H K  ++ ++ +L  E +TII +ES +R+  TL+ +++ F   +   ++RELTKM E     S+  +  +  K T KGE V+++     +++++   +  YS
  S:    10 KLYLVPTPIGNLEDITLRAIRILKEVDLVLAEDTRTSGNLLKHLAVQTKLQAFHAHNEHRALQSTIQLLQQGKNLALVSDAGTPGISDPGFLLVRECYVHNIPVECLPGPTAFVPAIVKSGLPSDKFVFEGFLPHKKG-RKTRIEKLMPEDRTIIFYESPYRLVKTLEQLRDAFGADRQASVSRELTKMFEETRNGSLEELAAHYTKHTPKGEIVLIVAGYNSKSDTLGNVDEAYS 244
>gi|126665256|ref|ZP_01736239.1| predicted methyltransferase [Marinobacter sp. ELB17] >gi|126630626|gb|EBA01241.1| predicted methyltransferase [Marinobacter sp. ELB17] (293 aa)
Score = 333, Expect = 2.0e-29, Identities = 89/268 (33%), Positives = 138/268 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIY----RSSIANINEIKITEKGEFVILIDNNVKETESIKKE-ETD--YSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L+IVATPIGN+ ++S  A+ TL    +   EDTR+S +LL  L +       +  N  ++   I +         L+SDAG P++SDPGF+L+       + V  I G  +L+ +L  SG P+    F GFL    + ++  L  L+ E+ T++++ES HRI DT+  +  I    + + + RELTK  ET Y       +A + +     +GEFV++I     E +S +   +TD   ++ L EL          K A KMV+     K N LY
  S:    17 LYIVATPIGNLDDLSTRAVKTLATVDLIAAEDTRHSGRLLQHLGLHKPMMALHDHNERDQHSRILAELGAGRSVALVSDAGTPLISDPGFILVREARVQGFQVSPIPGACALVAALSASGLPTDRFQFIGFLPAKGSGRRSVLESLQAETSTLVLYESPHRITDTIADVIAIMGAGRELVLGRELTKAFETFYCGTAEQVLAELQQDPHGSRGEFVVMIHGAAPEPDSEQTTLDTDRLLTILLTELPV--------KTAAKMVAEITGRKKNELY 283
>gi|53728968|ref|ZP_00134428.2| COG0313: Predicted methyltransferases [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126208825|ref|YP_001054050.1| hypothetical protein APL_1361 [Actinobacillus pleuropneumoniae L20] >gi|126097617|gb|ABN74445.1| hypothetical protein APL_1361 [Actinobacillus pleuropneumoniae L20] (284 aa)
Score = 333, Expect = 2.1e-29, Identities = 91/273 (33%), Positives = 150/273 (54%)
  Q:     2 NKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETD--YSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           N  L+IVATPIGN+ +I++ A+       +   EDTR+S  LL+   I    K F++L+ +NE+Q       K  +     L+SDAG P++SDPGF L+    +    V  + G  + + +L  SG  S    F GFL      + D+L ++ +E +T+I +ES HRI DTL+ ++++    + + +ARE+TK  ETI+  ++AN    +NE     KGE V++++         K E+ D  +S    +L  L+ +    K A  +V+  +  K N+LY +
  S:     6 NGTLYIVATPIGNLGDITQRALDAFAQVDLIAAEDTRHSGLLLSHYGI---KKPFFALHDHNEQQKAAVLVEKLQQGLNIALISDAGTPLISDPGFHLVRHCRQAGVKVVPLPGACAAITALCASGIASDRFCFEGFLPAKTKSRCDKLAEVADEPRTLIFYESTHRILDTLEDMQKMLGADRYVVMAREITKTWETIHGDTLANLIAWLNEDSNRIKGEIVLVVEG--------KPEQADEAFSAQAVKLLGLLCQELPLKKAAAIVAETFGYKKNALYQY 276
>gi|186902914|ref|ZP_02975854.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Cyanothece sp. PCC 7424] >gi|186690060|gb|EDU14696.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Cyanothece sp. PCC 7424] (284 aa)
Score = 333, Expect = 2.2e-29, Identities = 82/270 (30%), Positives = 145/270 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNV-KETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L++V TPIGN+++++  A+  L        EDTR++ KLL    I+    +++  N  +    + S   +     L++DAG P +SDPG+ L+   ++ N  V  I G ++ + +L VSG P+   +F GFL   +  K+D+L+ L +E++T+I +E+ HR+  TL+ + E    S+ I + RELTK++E ++R ++        T   KGEF I+I+  +  E +++  E+        EL  L+ +G     A + ++   SL    LY  
  S:    11 LYVVGTPIGNLEDMTFRAVKILQKVDAIAAEDTRHTGKLLQHFQITTPQISYHDHNRFSRSLELISRLKRGENIALVTDAGMPGISDPGYDLVKACVQENISVIPIPGVTAAITALAVSGLPTDRFIFEGFLPTKEGEKRDRLSSLSHETRTLIFYEAPHRLLQTLENLGEGLGYSRKIVLGRELTKLHEELWRGTLKEAIAFYQTHSPKGEFTIVIEGAILDEKQTLSPEQLKI-----ELHHLLEEGMTRSQASRHLAQLTSLPRRHLYQL 278
>gi|154496752|ref|ZP_02035448.1| hypothetical protein BACCAP_01045 [Bacteroides capillosus ATCC 29799] >gi|150274004|gb|EDN01104.1| hypothetical protein BACCAP_01045 [Bacteroides capillosus ATCC 29799] (277 aa)
Score = 333, Expect = 2.4e-29, Identities = 88/269 (32%), Positives = 142/269 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI--------ANINEIKITEKGEFVILIDN-NVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYN 273
           L++V TPIGN+ ++S+  I TL        EDTR S KLLN L +     ++Y  N     Q + +         L++DAG P +SDPG  L+ L   N  +V  I GP +L+ +L VSG P+    F GFL  NK  ++  L  L  E +T+I +E+ H++  TL  +++ F   + I + RELTK++E + R+++        AN      + KGEFV++++     E ES+  E+      L  +E+   +G   + A +  + +  L    LY+
  S:     5 LYLVPTPIGNLGDMSQRMIDTLAEADFIAAEDTRVSLKLLNHLGLKKPMVSYYRHNTETGGQNVLNRLLAGESCALVTDAGTPAISDPGEELVKLCADNGVEVISIPGPCALVTALSVSGLPTGRFTFEGFLPMNKKNRKAHLLSLTGEQRTMIFYEAPHKLSATLADLRDTFGGERRISLCRELTKLHEEVRRTTLDEAVAWYEAN------SPKGEFVLVVEGAQPVEEESVSPEDG-----LALVERYRAEGLSLRDAARRAAEETGLSRKELYD 271
>gi|90580218|ref|ZP_01236025.1| putative methyltransferase [Vibrio angustum S14] >gi|90438520|gb|EAS63704.1| putative methyltransferase [Vibrio angustum S14] (286 aa)
Score = 332, Expect = 2.7e-29, Identities = 87/270 (32%), Positives = 149/270 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQ---FINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ A+  L N  +   EDTR++ +LL+  +IS   +TF +L+ +NE+Q   F+           L+SDAG P++SDPG+ L+N   +    V  + GP +++ +L  +G PS    F GFL      ++D    L N+ +T+I +ES HRI D+L  +  +    + + +ARELTK  ETI+ + +  + E    +    +GE V+L+  +  + E +  E       L  L  L+++   +K A  + +  +  K N+LY +
  S:    14 LYIVPTPIGNLADITQRALDVLANVDLIAAEDTRHTSRLLSHFSIS--TRTF-ALHDHNEQQKADFLIEKLQSGTSIALVSDAGTPLISDPGYHLVNRCRQAGVKVVPLPGPCAVITALSGAGLPSDRFSFEGFLPPKSKGRRDCFQALANDERTLIFYESPHRINDSLSDMLAVLGAERQVVLARELTKTYETIHGAPLGELIEWLAEDSNRVRGEMVVLVAGHRAQKEELSAES------LRTLGLLVKELPLKKAAA-LTAEIHGAKKNALYKW 280
>gi|89074180|ref|ZP_01160679.1| putative methyltransferase [Photobacterium sp. SKA34] >gi|89050116|gb|EAR55642.1| putative methyltransferase [Photobacterium sp. SKA34] (286 aa)
Score = 332, Expect = 3.2e-29, Identities = 87/270 (32%), Positives = 149/270 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQ---FINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ A+  L N  +   EDTR++ +LL+  +IS   +TF +L+ +NE+Q   F+           L+SDAG P++SDPG+ L+N   +    V  + GP +++ +L  +G PS    F GFL      ++D    L N+ +T+I +ES HRI D+L  +  +    + + +ARELTK  ETI+ + +      ++E     +GE V+L+  +  + E +  E       L  L  L+++   +K A  + +  +  K N+LY +
  S:    14 LYIVPTPIGNLADITQRALDVLANVDLIAAEDTRHTSRLLSHFSIS--TRTF-ALHDHNEQQKADFLIEKLQSGTSIALVSDAGTPLISDPGYHLVNRCRQAGVKVVPLPGPCAVITALSGAGLPSDRFSFEGFLPPKSKGRRDCFQALANDERTLIFYESPHRINDSLSDMLAVLGAERQVVLARELTKTYETIHGAPLGELIEWLSEDSNRVRGEMVVLVAGHRAQKEELSAES------LRTLGLLVKELPLKKAAA-LTAEIHGAKKNALYKW 280
>gi|148652308|ref|YP_001279401.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Psychrobacter sp. PRwf-1] >gi|148571392|gb|ABQ93451.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Psychrobacter sp. PRwf-1] (309 aa)
Score = 331, Expect = 3.5e-29, Identities = 88/268 (32%), Positives = 140/268 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L+IVATPIGN+ +I+  AI TL    I  CEDTR S KLL    I  +   ++  N   +   I     + +   L+SDAG P++SDPG+ L+         V  I G S+ + +L V+G PS    F GFL    + +  QL Q    ++T+I +E+ HRI  +LK +  +F +++   + RELTK  ET+ +S++  + +        +KGE V+++  NV        +  D S++ +EL   + +    K A  + S    +K N+LY
  S:    35 LYIVATPIGNMGDITARAIDTLKQVDIIACEDTRTSGKLLANFGIDTQTWAYHEHNSEIQTPKIIEMIQRGHSVALISDAGTPLISDPGYQLVQAAHAAGVGVVPIVGASAAIAALSVAGLPSDKFSFVGFLPAKTHGRVKQLEQYIERTETLIFYEAPHRIVVSLKDMASVFGDNRPATLCRELTKTFETVKKSTLGELAQFVEADNNQQKGEIVLVVGGNV------NNDSDDDSIH-DELLLRLLQDLSVKKAAALASELTGVKKNTLY 299
>gi|85858491|ref|YP_460693.1| tetrapyrrole (corrin/porphyrin) methylase family protein [Syntrophus aciditrophicus SB] >gi|85721582|gb|ABC76525.1| tetrapyrrole (corrin/porphyrin) methylase family protein [Syntrophus aciditrophicus SB] (285 aa)
Score = 331, Expect = 3.7e-29, Identities = 86/249 (34%), Positives = 139/249 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEK 252
           KL++VATPIGN+++I+  AI  L   ++   EDTR ++KL +  +IS    + Y  N   + + +     + ++   +SDAG P +SDPGFLLI   ++N   V  + G S+ + +L VSG P  + +F GFL      ++D L  LK+E KT+I FE+ HR++  L+ I  I  N + I IARELTK++E I R  + ++  +      KGE  +++    + T  +  +E   S+Y     +L R G +
  S:     6 KLYVVATPIGNLEDITFRAIRVLKEVALVAAEDTRRTRKLFDAYSISTPLISLYEHNEFRKSRVLIDRLREGSDVAYVSDAGTPGISDPGFLLIRQALENRIPVIPVPGVSAGIAALSVSGIPMESFVFMGFLPAKAGKRRDLLVSLKDEQKTLIFFEAPHRLEAALEDIHSILGN-REIAIARELTKLHEEILRGRLQDLLPVLRDRRIKGEITLIVAGQ-EPTVRVVSDEDVRSLYF----RLARAGNR 250
>gi|171325939|ref|ZP_02914434.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Geobacillus sp. WCH70] >gi|171088052|gb|EDT34408.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Geobacillus sp. WCH70] (290 aa)
Score = 331, Expect = 3.9e-29, Identities = 81/216 (37%), Positives = 123/216 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI------ANINEIKITEKGEFVILID 220
           L+IV TPIGN+++++  A+  L    I   EDTR +KKLLN   I     +++  N       I     +     L+SDAG P +SDPG+ LI   +K    V  + G ++ + SL+ SG P+ +  F+GFL   K  K++QL  LK   +T+I +E+ HR+K+TL M+ E+F + + I I RELTK  E   R ++      A  NEI    +GEF I+++
  S:    16 LYIVPTPIGNLEDMTFRAVRILKEVDIIAAEDTRQTKKLLNHFEIHTPVISYHEHNKYTSGPQIVEQLKEGKSVALVSDAGMPGISDPGYELIVSALKEQCSVVPLPGANAALTSLVASGLPTDHFYFFGFLERTKKEKKEQLESLKTVRETMIFYEAPHRLKETLAMMYEVFGD-RRIAICRELTKRFEEFIRGTLREAVEWAETNEI----RGEFCIIVE 232
>gi|88804663|ref|ZP_01120183.1| hypothetical protein RB2501_07415 [Robiginitalea biformata HTCC2501] >gi|88785542|gb|EAR16711.1| hypothetical protein RB2501_07415 [Robiginitalea biformata HTCC2501] (226 aa)
Score = 331, Expect = 4.2e-29, Identities = 73/216 (33%), Positives = 125/216 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILI 219
           KLFIV TPIGN+ +I+  A+  L    +   EDTR S KLL    +    ++++    +NE + +++   +        L+SDAG P +SDPGFLL+   I+    V  + G ++ + +L+ SGFP+   +F GFL H K  +Q +L +L  E++T++ +ES HR+   L+   + F   + + + RELTK  E I R +++ + +   +   +GEFV+++
  S:     5 KLFIVPTPIGNLGDITLRALEVLREADLILSEDTRTSGKLLKHYEVETPQRSYHM---HNEHRVVDALVAEVAAGRTLALISDAGTPGISDPGFLLVRACIQAGHAVDCLPGATAFVPALVCSGFPTDRFVFEGFLPHKKG-RQTRLAELAGEARTMVFYESPHRLLKALEQFADHFGAEREVAVCRELTKHFEEIVRGTVSEVADHFKQNAPRGEFVLVV 221
>gi|184154767|ref|YP_001843107.1| methyltransferase [Lactobacillus fermentum IFO 3956] >gi|183226111|dbj|BAG26627.1| methyltransferase [Lactobacillus fermentum IFO 3956] (286 aa)
Score = 330, Expect = 4.5e-29, Identities = 81/274 (29%), Positives = 135/274 (49%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           +L++V TPIGN+ +++  AI  L    +   EDTR++++LLN   I+ +  +F+  N       + +   +       SDAG P +SDPG  L+   +K    V  + G ++ + +LI SG       FYGFL      +  +L  L+N  +T+I +E+ HR+  TL  + E+F   +   +ARELTK  E   R S+A  +   K   +GEFV+++  N    E    E+      L +++  +  G+    A K V+ +  L    LY  + Q
  S:    14 RLYLVPTPIGNLDDMTFRAIKVLKEVDLICAEDTRHTRQLLNHFEITTKAISFHEHNTEQRLPELVARLKQGENLAQCSDAGMPSISDPGKELVAACVKEGIPVVPLPGANAALTALIASGLSPQPFYFYGFLERKHQQQVTELTALRNRGETMIFYEAPHRLAKTLTTMAEVFGEERQAVLARELTKRYEEFERGSLAELVAWAKEGVRGEFVVMVAGNDHPQED---EQRPSGTPLEQIQAAVDGGQSPNAAIKQVAKRLGLNRQDLYKQYHQ 285
>gi|119469195|ref|ZP_01612179.1| putative methyltransferase [Alteromonadales bacterium TW-7] >gi|119447447|gb|EAW28715.1| putative methyltransferase [Alteromonadales bacterium TW-7] (285 aa)
Score = 330, Expect = 4.5e-29, Identities = 85/268 (31%), Positives = 144/268 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++VATPIGN  ++S  AI TL+   +   EDTR++ KLL+  +  ++ KTF +L+ +NEKQ       + N+     L+SDAG P++SDPG+ ++NL  +    V  + G  + + ++  SG P+    F GF       +QD      N S T I++ES HRI  +L  ++    + + +  A+ELTK  ET +  S++ + +        ++GE V+++    K  + I  E         ++  L+ K    K AC +V+  + +K N+LY
  S:    13 LYVVATPIGNYDDLSHRAIATLSQVDLIAAEDTRHTGKLLS--HFGIKAKTF-ALHDHNEKQKAQQIIDQLNQGLNIALVSDAGTPLISDPGYAVVNLCREQGASVTPVPGACAAITAVCCSGLPTDRFQFIGFTPAKSKARQDFFIDAINSSITSIMYESTHRIMASLDDLETALGSEQQVVFAKELTKTFETFFNGSVSELKQFLTDDPTKQRGEIVLMLPGKPKVVDDIPPEA-------RKMLALLEKEMPMKKACGVVAEYFGMKKNALY 277
>gi|157736424|ref|YP_001489107.1| putative methyltransferase [Arcobacter butzleri RM4018] >gi|157698278|gb|ABV66438.1| conserved hypothetical protein, putative methyltransferase [Arcobacter butzleri RM4018] (273 aa)
Score = 330, Expect = 4.6e-29, Identities = 83/216 (38%), Positives = 138/216 (63%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLL----NISLENKTFYSLNGNNEKQFINSFD---FKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILID 220
           L +V TPIGN+++IS  ++  L  + + FCEDTR +KKLLNLL    N+   NK + S + +NE Q + + D   F  N    +SDAG P +SDPG  L++  IKN     ++ G ++++ +  +SGF  +   FYGFL+H    +  +L+++ N+ K  I++ES HR+   L+ + E   N + I +A+E+TK+++T Y++S +N+ E    I  KGE+V++I+
  S:     2 LCLVPTPIGNLEDISSRSLKVLEESELIFCEDTRVTKKLLNLLGEKYNLDFSNKEYKSFHSHNENQILKTLDKDTFSKN-VVYVSDAGMPCVSDPGATLVDFCIKNQIPYDVLPGANAILTAYAMSGFIQTTFSFYGFLDHKGASRASKLDEILNDDKLSILYESPHRLLKLLEELNEKEPN-RTIFLAKEITKLHQTTYKNSASNLFEEFKNINIKGEWVVVIE 224
>gi|152973884|ref|YP_001373401.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152022636|gb|ABS20406.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98] (291 aa)
Score = 330, Expect = 4.8e-29, Identities = 89/275 (32%), Positives = 144/275 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  A+  L    I   EDTR +KKL N   I     +++  N     Q I +   +     L+SDAG P +SDPG+ ++   +   + V  + G ++ + +LI SG  + +  FYGFL  NK  ++ +L +L+  S T++ +E+ HR+ DTL  +KE+F N + I + RELTK  E   R SI    E   K   +GEF IL+  + +E  S  +     SVY +  + +  +G   K A K V+   +L    +Y  +   K
  S:    15 LYLVPTPIGNLEDMTFRAVRILKEADIIAAEDTRQTKKLCNYFEIETPVMSYHEHNKGVSGQKILAKLEEGKTIALVSDAGMPCISDPGYDVVVEAVGKQYHVIPLPGANAALTALIASGLETKHFYFYGFLQRNKKERKAELEKLRYVSTTMMFYEAPHRLDDTLLSMKEVFGN-REIVLCRELTKKFEEFIRGSIEEAIEWTRKNEVRGEFCILVSGSKEEAVSEVEWWETISVYDHIEQYINEQGMSSKDAIKQVAKDRNLSKRDVYQIYHIDK 290
>gi|163812510|ref|ZP_02204181.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Dehalococcoides sp. VS] >gi|157403887|gb|EDO69936.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Dehalococcoides sp. VS] (274 aa)
Score = 330, Expect = 4.9e-29, Identities = 88/271 (32%), Positives = 149/271 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFW 275
           L++VATPIGN+++I+  A+  L+   +   EDTR+++KLL+  NI     +++  N  ++  +I      + +  L+SDAG P +SDPG+ LI    +N   V  + G S+++ ++ VSG  S+N  + GFL   K  ++  L++      +I+I E+ HR+   L  IK++  + + I + RELTK+ E I+R SI+         +GEFV++++   K   S + E TD    + EL  L ++G+  K A  +VS K  L    +Y  W
  S:     3 LYVVATPIGNLEDITLRALRVLSEVKLIAAEDTRHTRKLLSAHNIKTPLTSYFEHNRLSKLDYILEV-LGEGDVALVSDAGMPGISDPGYELIKAAHENGIKVVPVPGASAVITAVAVSGLDSANFNYLGFLPRQKTERRKALSEAALLGVSIVILEAPHRLHGCLLDIKDVLGD-RQIAVCRELTKIYEEIFRGSISQAISHFDQPRGEFVLVVE-GCKPPVS-QPELTDD--IIKELGMLKKQGKPAKEAVALVSQKSGLPKKEIYRAW 267
>gi|153830238|ref|ZP_01982905.1| conserved hypothetical protein [Vibrio cholerae 623-39] >gi|125620619|gb|EAZ48983.1| conserved hypothetical protein [Vibrio cholerae V51] >gi|148874298|gb|EDL72433.1| conserved hypothetical protein [Vibrio cholerae 623-39] (288 aa)
Score = 330, Expect = 5.0e-29, Identities = 86/270 (31%), Positives = 142/270 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ A+  L +  +   EDTR++ KLL   NIS +    +  N   + Q +           L+SDAG P++SDPG+ L+    +    V  + GP +++ +L  SG PS +  F GFL      ++D+L ++   S+T I +ES HRI ++L+ + ++    + + +ARELTK  ETI    +A     I E    +KGE V+L+       E    +E   ++ +   E  ++K      A  +V+  Y LK N+LY +
  S:    14 LYIVPTPIGNLGDITQRALDVLASVDMIAAEDTRHTGKLLAHFNISTKTFALHDHNEQQKAQVLVDKLLSGLSIALVSDAGTPLISDPGYHLVTQCRQAGVKVVPLPGPCAVITALSASGLPSDSFSFEGFLPAKSKARKDKLLEIAKVSRTCIFYESPHRICESLQDMLDVLGGEREVVLARELTKTFETIQGMPLAELIEWIAEDDNRKKGEMVLLVHGYRDAGEQQLPDEALRTLTILTKELPLKK------AAALVAEIYQLKKNALYKW 281
>gi|4454322|emb|CAA10788.1| hypothetical protein [Staphylococcus aureus] (217 aa)
Score = 330, Expect = 5.0e-29, Identities = 78/211 (36%), Positives = 120/211 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEF 215
           L++V TPIGN+ +I+  A+  L    +  CEDTR + KL N  +I    K+++  N + +  FI        +  L+SDAG P++SDPG+ L+    + N  V+ + GP++ + +L+ SG PS    F GFL   +  K   L Q  +E+ T+II+ES HR+ DTLK I +I D ++ + + RELTK  E I    +    A I +  +  KGEF
  S:     4 LYLVGTPIGNLADITYRAVDVLKRVDMIACEDTRVTSKLCNHYDIPTPLKSYHEHNKDKQTAFIIEQLELGLDVALVSDAGLPLISDPGYELVVAAREANIKVETVPGPNAGLTALMASGLPSYVYTFLGFLPRKEKEKSAVLEQRMHENSTLIIYESPHRVTDTLKTIAKI-DATRQVSLGRELTKKFEQIVTDDVTQLQALIQQGDVPLKGEF 217
>gi|167854690|ref|ZP_02477470.1| hypothetical protein HPS_01322 [Haemophilus parasuis 29755] >gi|167854227|gb|EDS25461.1| hypothetical protein HPS_01322 [Haemophilus parasuis 29755] (286 aa)
Score = 330, Expect = 5.2e-29, Identities = 90/270 (33%), Positives = 146/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQ----FINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--------NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IVATPIGN+++I++ A+ T     +   EDTR+S  LL+   I    K F++L+ +NE+Q     +       N   L+SDAG P++SDPGF L+    +   ++  I G  + + +L  SG  S    F GFL      + D+ N+L  E +T+I +ES HRI D L  ++ +F   + + +ARELTK  ETI+   +A +        N I    KGE V++++    +      E  ++S    +L  L+ +    K A  +V+  +  K N+LY +
  S:    13 LYIVATPIGNLEDITQRALNTFAAVDLIAAEDTRHSGILLSHYGI---KKPFFALHDHNEQQRATVLVEKLQQGQN-IALISDAGTPLISDPGFHLVRHCRQVGINIVPIPGACAAITALCSSGIASDRFCFEGFLPAKSKARCDKFNELATEPRTLIFYESTHRILDCLTDMQSVFGGERYVVMARELTKTWETIHGDPLAQLIDWLQQDSNRI----KGEIVLIVEGKTAD------ESEEFSPQALKLLSLLSEELPLKKAAAIVADTFGYKKNALYQY 280
>gi|90962196|ref|YP_536112.1| tetrapyrrole (Corrin/Porphyrin) methylase family protein [Lactobacillus salivarius UCC118] >gi|90821390|gb|ABE00029.1| Tetrapyrrole (Corrin/Porphyrin) methylase family protein [Lactobacillus salivarius UCC118] (293 aa)
Score = 330, Expect = 5.2e-29, Identities = 94/276 (34%), Positives = 143/276 (51%)
  Q:     2 NKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           N  L++V TPIGN+ +++  AI  L    +   EDTRN++KLLN  NIS +  +F+  N      + +       N    +SDAG P +SDPG  L+   IK +  V  + G ++ + +LI SG       FYGFL    + ++ +L  LK  + TII +E+ HR+K TLK + E+  N K + + RELTK  E   R ++  + E   T   +GEFVI++D N  E     K  T+ S+     E +  +  K   A K V+ +  LK   +YN +  
  S:    15 NGTLYLVPTPIGNLGDMTPRAIEVLGEVDLIAAEDTRNTQKLLNHFNISTKQISFHEHNTKERIPKLVEKLKTGIN-IAQVSDAGMPSISDPGHELVETCIKEDIPVVPLPGANAGITALIASGLIPQPFYFYGFLPRKNSEQKQELTNLKGHTSTIIFYEAPHRLKKTLKNMLEVLGNRK-VVLCRELTKKFEEFIRGNLEEVMEWANTSEIRGEFVIILDGNHNEQVEENKVTTNLSIEEQVKELIEDRNLKPNQAIKEVAKENGLKKQEVYNLYHH 291
>gi|116493215|ref|YP_804950.1| methyltransferase [Pediococcus pentosaceus ATCC 25745] >gi|116103365|gb|ABJ68508.1| Predicted methyltransferase [Pediococcus pentosaceus ATCC 25745] (292 aa)
Score = 329, Expect = 5.6e-29, Identities = 87/274 (31%), Positives = 148/274 (54%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE-IKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGE-KEKVACKMVSYKYSLKSNSLYNFWQQ 277
           +L++V TPIGN+++++  AI  L +  +   EDTRN++KLLN   I  +  +F+  N       I        +   +SDAG P +SDPG  L+ + +  + +V  + G ++ + +LI SG       FYGFL+     ++++L  LKN   T+I +E+ HR+  T+K I   F  ++ + +ARELTK  E   R SI  + + I   E +GEFV++++ N     +   E    S+ +NE ++K+I   + K  +A K V+    L    +Y+ + Q
  S:    14 RLYLVPTPIGNLEDMTFRAINILKDVDLILAEDTRNTQKLLNHFEIDTKQMSFHEHNTQQRIPTILKMLEDGQQIAQVSDAGMPSISDPGQELVKVAVSQHLNVVPLPGSNAGITALIASGLVPQPFTFYGFLSRKTKEQKEELEVLKNNPNTVIFYEAPHRLAKTVKQIGSSFGTTRKMVLARELTKRYEEFIRGSIEEVQQWIAENEVRGEFVVMVEGNDHPQVTTNNEWE--SMTINEHVQKIIDDEQVKPTIAIKQVAKLRGLSKQEVYDIYHQ 289
>gi|126658165|ref|ZP_01729316.1| hypothetical protein CY0110_11542 [Cyanothece sp. CCY0110] >gi|126620536|gb|EAZ91254.1| hypothetical protein CY0110_11542 [Cyanothece sp. CCY0110] (287 aa)
Score = 329, Expect = 5.7e-29, Identities = 84/270 (31%), Positives = 151/270 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI-----NEIKITEKGEFVILIDNNVKE---TESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+++I+  AI  L + ++   EDTR++ KLL+   I+    +++  N    +  + ++  +     L++DAG P +SDPG+ LIN  I  N  V  I GP++ + +L VSG P+   +F GFL      ++D+   LK E++TII++E+ HR+  TL  ++E++ N   + + RE+TK  E  +R S+ +      N  +I  KGEF ++I    +    T ++ + +       +EL++L+ +G     A + ++   +     +YN 
  S:    15 LYIVGTPIGNLEDITFRAIRILKSVNLIAAEDTRHTAKLLHHFQITTPQISYHHHNRTARQTELLNYLEEGKTIALVTDAGMPGISDPGYDLINASIIANIPVIPIPGPTAAITTLSVSGLPTDRFIFEGFLPLKGKERRDRFQVLKTETRTIILYEAPHRLLKTLTDLREVYSNDHQLTVGREITKRYEEFWRGSLEDAILYYQNSQQI--KGEFTLIIAGCSQSRFLTLTVDQLK-------DELQQLLDQGMTRSQASRQLAEVTTFSRRQIYNL 283
>gi|134297942|ref|YP_001111438.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Desulfotomaculum reducens MI-1] >gi|134050642|gb|ABO48613.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Desulfotomaculum reducens MI-1] (286 aa)
Score = 329, Expect = 5.8e-29, Identities = 88/268 (32%), Positives = 151/268 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGN-NEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLK-MIKEIFDNSKNICIARELTKMNETIYRSSIAN--INEIKITEKGEFVILIDNNVKE--TESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++ ATPIGN+++I+   +  L        EDTR+++KLL+  +I     +++S +    E+Q ++     +N   L+SDAG P +SDPG  L+ L ++   +V  + G S+ + +L+ SG P+   +F GFL+  +  ++ QL  LK E +T+I +ES HR+ DTLK M++E  D      +ARELTK++E   R  ++   I+      +GE  +L+    KE  T  I++E  + SV    +  L+ +G  +K A K+V+    +    +Y
  S:     9 LYLCATPIGNLEDITLRVLRILKEADCIAAEDTRHTRKLLSHFDIHTPLVSYHSHSSEGKEEQLLDRLQQGEN-IALVSDAGMPGISDPGADLVRLALEYGIEVVPLPGASAGIAALVASGLPTHKFIFEGFLSSQRKTRRKQLQALKWEQRTLIFYESPHRLTDTLKDMVQEFGDRPG--VVARELTKLHEEFKRGMLSELLIHYGHNHPRGEICLLVAGISKEEATSGIEEEWCELSVR-EHVASLVEQGHNKKGAIKLVAQLRGMPKREVY 278
>gi|118443390|ref|YP_879218.1| tetrapyrrole (Corrin/Porphyrin) methylase [Clostridium novyi NT] >gi|118133846|gb|ABK60890.1| Tetrapyrrole (Corrin/Porphyrin) Methylase [Clostridium novyi NT] (280 aa)
Score = 329, Expect = 6.0e-29, Identities = 90/272 (33%), Positives = 156/272 (57%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYL---NELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           MN KL++V TPIGN+K+I+  A+  L N  +   EDTR + KLLN  N+  +  +++  N N +   I +      +  L+SDAG P +SDPG ++I   I+ N + +++ G +++  +L+ SG  ++  LF GFL      ++  +  LKN  +T+I +ES HR+  TL+ ++E   N + I I RELTK++E I R ++   I+     E +GE+V++++   K  E + KEE +    L   + ++K I +G  +K + K V+    +  + +Y
  S:     1 MNGKLYVVPTPIGNLKDITLRALEVLENADVIAAEDTRQTLKLLNHFNMKKQMISYHKFNENIKSDDIINMLKNCKQVALVSDAGTPGISDPGSVIIKRCIEENIEFEVLTGATAVTTALVYSGLDTTKFLFRGFLPRENKDRKPIIEDLKNRQETLIFYESPHRLIKTLEFLRENLGN-RRIAICRELTKLHEEILRLTLEEAIDYYSENETRGEYVLVVEG--KSIEEVIKEEQEAWEELSIEDHIKKYIDQGLTKKESIKKVAKDRGVPKSEIY 274
>gi|146329351|ref|YP_001209549.1| tetrapyrrole methylase family protein [Dichelobacter nodosus VCS1703A] >gi|146232821|gb|ABQ13799.1| tetrapyrrole methylase family protein [Dichelobacter nodosus VCS1703A] (280 aa)
Score = 329, Expect = 6.2e-29, Identities = 81/221 (36%), Positives = 128/221 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKE 225
           LFIVATPIGN+K+IS  A+ TL + S   CEDTR S+ LL    I    K   +L+ +NE +  +S   +     +  ++SDAG P++SDPG ++  L  +N   V  + G ++++ +L  SG P+   +F GF+      +   L Q  +   T + +E+ HRIK TL   ++ F   + + IARELTK  E I  +++A+    +N  K  EKGEFV+L+  + ++
  S:    11 LFIVATPIGNLKDISTRALETLQHCSAIACEDTRVSQHLLTAFGI---QKPLIALHQHNEYRAADSILARLHAGEDIAVISDAGTPLISDPGAIITALAHQNQIRVIPVPGANAVITALSASGLPADRFVFSGFIPAKAGERDRFLTQHGHYPLTTVFYETPHRIKATLDACQQQFSAERKLVIARELTKTFEQIVSTTVADAPSWLNADKQHEKGEFVLLLAGDTEQ 235
>gi|149182679|ref|ZP_01861146.1| uroporphyrin-III C-methyltransferase [Bacillus sp. SG-1] >gi|148849589|gb|EDL63772.1| uroporphyrin-III C-methyltransferase [Bacillus sp. SG-1] (293 aa)
Score = 329, Expect = 6.6e-29, Identities = 88/276 (31%), Positives = 148/276 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILIDNNVKETESIKKEE--TDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRKN 280
           L++V TPIGN++++S  AI  L    +   EDTRN+KKL N   I     +++  N     + +     K     L+SDAG P +SDPG+ ++   +     V  + G ++ + +LI SG       FYGFL+ +K  K+ +L  L  ++ T+I +ES HR+K+TLK +KEI  N ++I ++RELTK  E   R +I    E   +   +GEF I+++ +  +    ++E+   D ++  +    +  KG   K A KMVS +  L    +Y  +  +++
  S:    15 LYLVPTPIGNLEDMSFRAIRILKECDVIAAEDTRNTKKLCNYFEIDTFVVSYHEHNKETSGEKLLERIEKGETVALVSDAGMPCISDPGYEIVREAVDRGIAVIPLPGANAALTALIASGLIPQPFYFYGFLSRSKKDKRKELETLSKQNSTLIFYESPHRLKETLKEMKEILGN-RSIVLSRELTKKFEEFIRGTIEEALEWSGEGEVRGEFCIVVEGSTDKEAKEEEEQWWNDLTLSAHVQHYIDEKGVSSKEAIKMVSKERELPKRDVYQAFHVQQD 293
>gi|77163888|ref|YP_342413.1| hypothetical protein Noc_0357 [Nitrosococcus oceani ATCC 19707] >gi|76882202|gb|ABA56883.1| Protein of unknown function UPF0011 [Nitrosococcus oceani ATCC 19707] (281 aa)
Score = 329, Expect = 6.8e-29, Identities = 76/232 (32%), Positives = 128/232 (55%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI----NEIKITEKGEFVILIDNNVKETESIKKE 232
           MN  L++VATPIGN+ + S  A   L    +   EDTR+S  LL    I+    + +  N     + + +   +     L+SDAG P++SDPG+ ++        +V  I GP +L+ +L V+G PS   +F GFL      +Q +L QL  ES+T+I +E+  R+ +TL+ + E F+  +   +ARELTK  ET+   +++ +     +   + +GE V+L+    KE ++I++E
  S:     1 MNGTLYVVATPIGNLGDFSPRAQEILRKADLIAAEDTRHSAALLRHFGITTAMISLHEYNERRRAELLIARCREGLSVALISDAGTPLISDPGYRVVRQARHAGIEVLPIPGPCALVAALSVAGLPSDRFVFEGFLPAKTGARQARLLQLAEESRTLIFYEAPRRLLETLQAMIEAFEPDREAVVARELTKRYETVQGGTLSFLLSWARQTPESSRGELVLLVHGAEKEQDAIQQE 236
>gi|71891844|ref|YP_277573.1| hypothetical protein BPEN_053 [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|71795950|gb|AAZ40701.1| conserved hypothetical protein [Candidatus Blochmannia pennsylvanicus str. BPEN] (297 aa)
Score = 329, Expect = 7.0e-29, Identities = 89/275 (32%), Positives = 145/275 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L+IV TPIGN+++I+  A++ L        EDTR ++ LL+  +I   + + Y L+ +NE + I     K        L+SDAG P+++DPG+ L+    K    V  + GP + + +L  SG PS    F GFL H   L+ D+L  L  ES+T+I ++  HRI DTLK +  +F   + + +ARELTK+ E+IY + +      + +     +GE V+++  N      +KK E    +    + +L+      K A  +  Y Y ++ N LY  +   K
  S:    15 LYIVPTPIGNLQDITYRALSVLRQVDCIAAEDTRRTRILLDFFSI---HTSLYILHQHNEYKRIPMLISKLQRGLSIALVSDAGTPLINDPGYCLVQSCQKLKIRVIPLPGPCAAITALCGSGLPSDRFCFEGFLPHKHKLRIDRLRDLSEESRTLIFYDVKHRIIDTLKDMVSVFGLDRYVVLARELTKIWESIYGAPVGQLLSWVQKDHFRIQGEIVLVVAGNC-----LKKNELSPKIL--RVMRLLASELPVKRAAILAGYIYGVQKNMLYKQYIDEK 286
>gi|88711716|ref|ZP_01105804.1| methyltransferase [Flavobacteriales bacterium HTCC2170] >gi|88710657|gb|EAR02889.1| methyltransferase [Flavobacteriales bacterium HTCC2170] (224 aa)
Score = 329, Expect = 7.3e-29, Identities = 84/216 (38%), Positives = 127/216 (58%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSF--DFKDN--EYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILI 219
           KLFIV TPIGN+++I+  AI  L   S+   EDTR S KLL+   I   N    S + +NE + +++     K N  +  L+SDAG P +SDPGFLL    ++N+ +V  + G ++ + +L+ SG P+   +F GFL   K  +Q +L  L  ES+T+I +ES H++  TL    E F   + I ++RELTK+ E   R +I  +     T+  KGE VI++
  S:     3 KLFIVPTPIGNLEDITLRAIRVLKEVSLILAEDTRTSGKLLHHFEI---NTPMQSHHMHNEHKTVDNLVKRLKSNLEDIALISDAGTPAISDPGFLLTRACLENDIEVDCLPGATAFVPALVNSGLPNDKFVFEGFLPVKKG-RQTRLKLLAEESRTMIFYESPHKLVKTLTHFAEYFGEDRLISVSRELTKLYEETVRGTIIEVLGHFTTKPPKGEIVIVV 220
>gi|160882028|ref|YP_001560996.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Clostridium phytofermentans ISDg] >gi|160430694|gb|ABX44257.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Clostridium phytofermentans ISDg] (281 aa)
Score = 328, Expect = 7.4e-29, Identities = 86/273 (31%), Positives = 151/273 (55%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNE--LEKLIRKGEKEKVACKMVSYKYSLKSNSLYN 273
           M+ KL++ ATPIGN+++++  A+ TL+   +   EDTRNS KLLN  NI     +++  N   + + +     +     L+SDAG P +SDPG  L+ +  +    V  + G  +L+ +L +SG  +   +F  FL  +K  +   L +L NE++TII++E+ HR+  TL  + E+  N + I + RELTK  ET + ++I +          KGE V+LI+   +E E  K+E+  ++ +  E  ++  + +G  +K A K+V+    +    +Y+
  S:     1 MSGKLYLCATPIGNLEDMTFRAVRTLSEVDLIAAEDTRNSIKLLNHFNIKTPMTSYHEFNKIEKGKHLIEEMLQGKNVALISDAGTPGISDPGEELVQMAYEAGIVVTSLPGACALITALTISGRSTRRFVFEAFLPVDKKERHSILEELVNETRTIILYEAPHRLVKTLNALHEVLGN-RRITVCRELTKRYETAFLTTIEDALAFYTDSEPKGECVVLIEGRTRE-ELKKEEQERWAEWTLEAHMDYYLGQGLSKKEAMKLVASDRGVSKREIYS 275
>gi|116333257|ref|YP_794784.1| methyltransferase [Lactobacillus brevis ATCC 367] >gi|116098604|gb|ABJ63753.1| Predicted methyltransferase [Lactobacillus brevis ATCC 367] (293 aa)
Score = 328, Expect = 7.7e-29, Identities = 87/268 (32%), Positives = 142/268 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLN-ELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++V TPIGN+ +++  A+ TLT   +   EDTRN++KLLN   I+ +  +F+  N      Q I     +  +   +SDAG P +SDPG  L+N  I  +  V  + G ++ + +LI SG       FYGFL+     ++ ++  L    +T+I +E+ HR+K TL+ +   F + +   + RELTK  E   R S+A +     T+  +GEFV+L+  N   T +      D S  ++ ++++LI  GEK   A K V+     K   +Y
  S:    15 LYLVPTPIGNLDDMTFRAVKTLTAVDLIAAEDTRNTQKLLNHFEITTKQISFHEHNTQERIPQLIAKLK-QGMQIAQVSDAGMPSISDPGHELVNACIDAHIPVVPLPGANAGLTALIASGLAPQPFYFYGFLDRKPKDRKAEIAGLAQRPETLIFYEAPHRLKKTLQNLAAGFGDERPAVLCRELTKRYEEFLRGSLAELANWAATDTVRGEFVVLVGGNPAPTTA-ATTAVDLSEPIDVQVDRLIAAGEKPNDAIKEVAKLRGAKKQEIY 284
>gi|148265773|ref|YP_001232479.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Geobacter uraniireducens Rf4] >gi|146399273|gb|ABQ27906.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Geobacter uraniireducens Rf4] (282 aa)
Score = 328, Expect = 8.9e-29, Identities = 87/268 (32%), Positives = 149/268 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIA----NINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKE-KVACKMVSYKYSLKSNSLY 272
           L+IVATPIGN+++I+  A+  L    +   EDTR+S+KLL+   IS    +++  N + + ++I     +     L++DAG P +SDPG+ L+   +   + V  + GPS+ + +L  SG P+   +F GFL + +  ++D+L  L++E + +I +ES +R+   L  +++I  + + I +ARELTK+ E   R  I+     +NE KI  KGE V+L+        S  +EE         L   + +GE   K A K+V+ +  L  + +Y
  S:     8 LYIVATPIGNLEDITFRAVRILKEADLIAAEDTRHSRKLLSHFGISKPLTSYFDHNKHLKGKYILDQLGEGRTVALITDAGTPCISDPGYQLVRDAVAAGFTVVPVPGPSAAITALSASGLPTDTFVFEGFLPNRQGKRRDKLALLRDERRVLIFYESPNRLHAALADMRDILGD-REIVVARELTKVYEEFIRGDISAVIDQLNERKI--KGEVVVLV-----APRSGGREEGTSRPLAELLGDYLDRGELSLKDAVKLVAMETGLPRSDVY 272
>gi|15837154|ref|NP_297842.1| hypothetical protein XF0552 [Xylella fastidiosa 9a5c] >gi|17369390|sp|Q9PFV5|Y552_XYLFA UPF0011 protein XF_0552 >gi|9105411|gb|AAF83362.1|AE003902_7 conserved hypothetical protein [Xylella fastidiosa 9a5c] (273 aa)
Score = 328, Expect = 9.1e-29, Identities = 77/215 (35%), Positives = 121/215 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILI 219
           L IVATPIGN+ ++S  A   L   ++   EDTR++++LL    I       ++ N +   + I +         L+SDAG P++SDPGFLL+         V  + GPS+L+ +L VSG PS+   F GFL      ++D+L  L +E +T+I +E+ HRI + L  +  IF + +   +ARELTK+ ET+   ++A +      +    KGEFVI++
  S:     7 LHIVATPIGNLGDLSPRAQHILRTVTMICAEDTRHTRQLLAHFGIERPLLALHAHNEDTLAERIITRLISGASLALVSDAGTPLISDPGFLLVRAARAAGIRVTPVPGPSALIAALSVSGLPSNRFTFEGFLPAKPTARRDRLTHLAHEPRTLIFYEASHRIAECLTDLATIFGSMRAAVVARELTKIFETVLDGTLATLQTQVANDDNQRKGEFVIIV 225
>gi|163786829|ref|ZP_02181277.1| methyltransferase [Flavobacteriales bacterium ALC-1] >gi|159878689|gb|EDP72745.1| methyltransferase [Flavobacteriales bacterium ALC-1] (222 aa)
Score = 327, Expect = 9.8e-29, Identities = 77/216 (35%), Positives = 129/216 (59%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILI 219
           KL++V TPIGN+K+I+  AI  L    +   EDTR S KLL    I+ + ++++    +NE + +N    K        ++SDAG P +SDPGFLL+   +++N +V+ + G ++ + +L+ SG P+   +F GFL   K  +Q +L  L  E++TII +ES H++  TL    E F  ++ + ++RELTK+ E   R ++  + E   ++  KGE VI++
  S:     2 KLYLVPTPIGNLKDITFRAIDVLKEVDLILAEDTRTSGKLLKHFEITTQMQSYHM---HNEHKIVNGLIEKLKSGLSIGVISDAGTPAISDPGFLLVRACVEHNIEVECLPGATAFVPALVNSGLPNDKFVFEGFLPVKKG-RQTRLLLLAEETRTIIFYESPHKLVKTLGHFCEYFGENRPVSVSRELTKLYEETVRGTVKEVLEHYTSKPPKGEIVIIV 218
>gi|34581243|ref|ZP_00142723.1| hypothetical protein [Rickettsia sibirica 246] >gi|28262628|gb|EAA26132.1| unknown [Rickettsia sibirica 246] (281 aa)
Score = 327, Expect = 1.0e-28, Identities = 86/229 (37%), Positives = 131/229 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEE 233
           L+IV+TPIGN ++I+  AI+TL N+ I  CEDTR S+KLL   +I  + + +   +   +++ I S     N   L+SDAG P++SDPG+ L+      N  + ++ G S+ + +L +S  P+   LF+GFL      K+   ++L N   T+I FE+  R+ +TL + KEI  N + IC+ARELTK+ + I    I  I E       KGE V+LI  N++E    K  E
  S:    10 LYIVSTPIGNFEDITLRAISTLKNSDIILCEDTRISQKLLAKHDIHTKLQIYNDHSDEKDRENIISLIKSGNIISLISDAGTPLISDPGYKLVRGIRNLNCHIDVVPGVSAPVTALTLSALPTDQFLFHGFLPKTIESKKKIFSELVNLKATLIFFETAPRLINTLSVAKEILGN-REICVARELTKLYQEIKTGDIDEIIEFYQNNILKGEIVLLISGNIQEQNQYKNLE 239
>gi|71274584|ref|ZP_00650872.1| Protein of unknown function UPF0011 [Xylella fastidiosa Dixon] >gi|71898123|ref|ZP_00680309.1| Protein of unknown function UPF0011 [Xylella fastidiosa Ann-1] >gi|170730846|ref|YP_001776279.1| hypothetical protein Xfasm12_1750 [Xylella fastidiosa M12] >gi|71164316|gb|EAO14030.1| Protein of unknown function UPF0011 [Xylella fastidiosa Dixon] >gi|71732097|gb|EAO34153.1| Protein of unknown function UPF0011 [Xylella fastidiosa Ann-1] >gi|167965639|gb|ACA12649.1| conserved hypothetical protein [Xylella fastidiosa M12] (273 aa)
Score = 327, Expect = 1.0e-28, Identities = 77/215 (35%), Positives = 121/215 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILI 219
           L IVATPIGN+ ++S  A   L   ++   EDTR++++LL    I       ++ N +   + I +         L+SDAG P++SDPGFLL+         V  + GPS+L+ +L VSG PS+   F GFL      ++D+L  L +E +T+I +E+ HRI + L  +  IF + +   +ARELTK+ ET+   ++A +      +    KGEFVI++
  S:     7 LHIVATPIGNLGDLSPRAQHILRTVTMICAEDTRHTRQLLAHFGIERPLLALHAHNEDTLAERIITRLISGESLALVSDAGTPLISDPGFLLVRAARAAGIRVTPVPGPSALIAALSVSGLPSNRFTFEGFLPAKPTARRDRLTHLAHEPRTLIFYEASHRIAECLTDLATIFGSMRIAVVARELTKIFETVLDGTLATLQTQVANDDNQRKGEFVIIV 225
>gi|28199467|ref|NP_779781.1| hypothetical protein PD1588 [Xylella fastidiosa Temecula1] >gi|71900623|ref|ZP_00682749.1| Protein of unknown function UPF0011 [Xylella fastidiosa Ann-1] >gi|182682197|ref|YP_001830357.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Xylella fastidiosa M23] >gi|32130337|sp|Q87B70|Y1588_XYLFT UPF0011 protein PD_1588 >gi|28057582|gb|AAO29430.1| conserved hypothetical protein [Xylella fastidiosa Temecula1] >gi|71729617|gb|EAO31722.1| Protein of unknown function UPF0011 [Xylella fastidiosa Ann-1] >gi|182632307|gb|ACB93083.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Xylella fastidiosa M23] (273 aa)
Score = 327, Expect = 1.0e-28, Identities = 77/215 (35%), Positives = 121/215 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILI 219
           L IVATPIGN+ ++S  A   L   ++   EDTR++++LL    I       ++ N +   + I +         L+SDAG P++SDPGFLL+         V  + GPS+L+ +L VSG PS+   F GFL      ++D+L  L +E +T+I +E+ HRI + L  +  IF + +   +ARELTK+ ET+   ++A +      +    KGEFVI++
  S:     7 LHIVATPIGNLGDLSPRAQHILRTVTMICAEDTRHTRQLLAHFGIERPLLALHAHNEDTLAERIITRLISGESLALVSDAGTPLISDPGFLLVRAARAAGIRVTPVPGPSALIAALSVSGLPSNRFTFEGFLPAKPTARRDRLTHLAHEPRTLIFYEASHRIAECLTDLATIFGSMRIAVVARELTKIFETVLDGTLATLQTQVANDENQRKGEFVIIV 225
>gi|113475293|ref|YP_721354.1| hypothetical protein Tery_1602 [Trichodesmium erythraeum IMS101] >gi|110166341|gb|ABG50881.1| Protein of unknown function UPF0011 [Trichodesmium erythraeum IMS101] (279 aa)
Score = 327, Expect = 1.2e-28, Identities = 84/268 (31%), Positives = 150/268 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI--ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L+IV TPIGN+++ +  AI TL    +   EDTR++ KLL   +I     +++    +NE+  I     K N+     L++DAG P +SDPG+ L+   ++ N  +  I G ++ + +L  SG P++  +F GFL     L+++QL +L N  +TI+++ES +R+  TL+ + +I   ++ I +ARELTK++E  +R ++  A I+      KGEF ++I     E   + ++         EL++L  +G     A + ++ K +L   ++Y
  S:     9 LYIVGTPIGNLEDTTFRAIQTLQKVDLIAAEDTRHTSKLLQHFHIRTPQLSYHQ---HNEQSRIPELIEKLNQGKTIALVTDAGMPGISDPGYELVKACVEENISIVPIPGVTASITALCASGLPTNKFIFIGFLPTKIKLREEQLEKLSNLLETIVLYESPYRLLQTLEDLGKILGENRKIVLARELTKLHEEFWRGTVGEAVIHYQNNQPKGEFTLVITGAEPELPVLSEDTIK-----QELQELFAQGISRSQASRQLAQKINLSRRTIY 273
>gi|51473914|ref|YP_067671.1| hypothetical protein RT0732 [Rickettsia typhi str. Wilmington] >gi|51460226|gb|AAU04189.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington] (280 aa)
Score = 327, Expect = 1.2e-28, Identities = 84/225 (37%), Positives = 133/225 (59%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILIDNNVKE 225
           +   L+IV+TPIGN ++I+  AI+TL N+ I  CEDTR S+KLL   +I  + + +   +   ++++I S     +   L+SDAG P++SDPG+ L+      N+ ++++ G S+ + +L +S  P+   LF GFL      K+   ++L N   T+I F++  R+ +TL + KEIF   + IC+ARELTK+ + I    I  I E   K   KGE V+LI  NV+E
  S:     3 LKSGLYIVSTPIGNFEDITLRAISTLKNSDIILCEDTRISQKLLVKHDIITKLQIYNDHSDYKDREYIISLIKAGHVVSLISDAGTPLISDPGYKLVRDLRNLNYYIEVVPGVSAPITALTLSSLPTDRFLFCGFLPKTIESKKKIFSELVNLKATLIFFDTASRLINTLSLAKEIF-GKREICVARELTKIYQEIKTGDIDAIIEFYKKNILKGEIVLLISGNVQE 228
>gi|27375781|ref|NP_767310.1| hypothetical protein bll0670 [Bradyrhizobium japonicum USDA 110] >gi|27348919|dbj|BAC45935.1| bll0670 [Bradyrhizobium japonicum USDA 110] (316 aa)
Score = 327, Expect = 1.2e-28, Identities = 75/231 (32%), Positives = 126/231 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILIDNNVKETESIKKEETD 235
           L++VATPIGN+ +I+  A+ TL    +  CEDTR +++L    +IS + K ++  N    +  I     +     L+SDAG P++SDPGF L+         V  + GPSS++ +L V+  P+    F GFL      ++ +L +L     T+++FES +R++DTL  + EI   ++   I RELTK++E I R+++  +      +  +GEFV++I     + E +     D
  S:    37 LYLVATPIGNLGDITLRALQTLAGVDVIACEDTRITRRLTERYDISAQLKPYHEHNAEAARPKILERLSQGGSIALVSDAGTPLISDPGFKLVREVCAAGHAVYALPGPSSVLAALSVAALPTDRFFFEGFLPAKSAARRSRLAELARIDATLVMFESGNRVQDTLADLAEIM-GTREAAICRELTKLHEEISRATLTELAREADALETRGEFVLVIAPPAADAEMLTSHALD 268
>gi|160934891|ref|ZP_02082277.1| hypothetical protein CLOLEP_03766 [Clostridium leptum DSM 753] >gi|156866344|gb|EDO59716.1| hypothetical protein CLOLEP_03766 [Clostridium leptum DSM 753] (278 aa)
Score = 326, Expect = 1.3e-28, Identities = 92/272 (33%), Positives = 147/272 (54%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYC-LLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEK----LIR-KGEKEKVACKMVSYKYSLKSNSLY 272
           M+  L +V TP+GN+ ++S  A+  L        EDTR + KLLN   I     +++  N     + I     +  E C L+SDAG P +SDPG  L+ L  +    V ++ GPS+L+ +L VSG P+    F GFL+ NK  ++D L Q+KNE++T+I +E+ H++   L+ +   + + + I +  ELTK++E + R+++    A  +E  I  KGEFV++I       E  K EE      L +  +    L+R +G     A K  S +  LK   +Y
  S:     1 MSGILTVVGTPLGNLGDMSPRAVEALRQADFIAAEDTRVTLKLLNHFEIKKPMISYFEHNRKFHGELICQ-KIEAGENCALVSDAGMPAISDPGEDLVRLCGERGITVSVVPGPSALIAALAVSGLPTGRFTFEGFLSTNKKSRRDHLEQVKNETRTMIFYEAPHKLHACLRDMYAAWGD-RRIAVVHELTKIHEEVIRTTLKAAAARYSEGNI--KGEFVLVI-------EGAKPEELQEGYTLEQAVEIAAGLMREQGMSASEAAKTASQQTGLKKGDIY 271
>gi|150019694|ref|YP_001311948.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Clostridium beijerinckii NCIMB 8052] >gi|149906159|gb|ABR36992.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Clostridium beijerinckii NCIMB 8052] (281 aa)
Score = 326, Expect = 1.3e-28, Identities = 88/273 (32%), Positives = 149/273 (54%)
  Q:     2 NKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEK--GEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           N KL++V TPIGN+K+I+  A+ TL N  I   EDTR + KLLN   I     +++  N   +   I     + N   L+SDAG P +SDPG +++   I+   + +++ G +++  +L+ SG  ++  LF GFL      ++   N L    +TII +E+ HR+ DTL+ + + F + K I + RELTK+ + IYR ++    +  +  K  GEFV++++    E    ++ E    + + E + K I  G  +K A K+V+ +  L  + +Y F
  S:     3 NGKLYLVPTPIGNLKDITLRALETLRNVDIIAAEDTRQTLKLLNHFEIKKPLISYHKFNEQIKSDKIIDLLMEGNNVALVSDAGTPGISDPGSVIVGRCIEKKINFEVLPGATAITTALVYSGLDTTKFLFRGFLPRENKERKIVTNDLLQSQETIIFYEAPHRLIDTLEFLLDTFGDRK-IAVCRELTKIYQEIYRGTLKEAAQYFLENKPRGEFVLVLEGKRLEEIKEEQREEWIHLSIEEHIVKYINGGASKKEAIKLVAKERELPKSEVYKF 277
>gi|15893081|ref|NP_360795.1| hypothetical protein RC1158 [Rickettsia conorii str. Malish 7] >gi|15620285|gb|AAL03696.1| unknown [Rickettsia conorii str. Malish 7] (281 aa)
Score = 326, Expect = 1.4e-28, Identities = 86/229 (37%), Positives = 130/229 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEE 233
           L+IV+TPIGN  +I+  AI+TL N+ I  CEDTR S+KLL   +I  + + +   +   +++ I S     N   L+SDAG P++SDPG+ L+      N  + ++ G S+ + +L +S  P+   LF+GFL      K+   ++L N   T+I FE+  R+ +TL + KEI  N + IC+ARELTK+ + I    I  I E       KGE V+LI  N++E    K  E
  S:    10 LYIVSTPIGNFADITLRAISTLKNSDIILCEDTRISQKLLAKHDIHTKLQIYNDHSDEKDRENIISLIKSGNIISLISDAGTPLISDPGYKLVRGIRNLNCHIDVVPGVSAPVTALTLSALPTDRFLFHGFLPKTIESKKKIFSELVNLKATLIFFETAPRLINTLSVAKEILGN-REICVARELTKLYQEIKTGDIDEIIEFYQNNILKGEIVLLISGNIQEQNQHKNLE 239
>gi|90421845|ref|YP_530215.1| hypothetical protein RPC_0321 [Rhodopseudomonas palustris BisB18] >gi|90103859|gb|ABD85896.1| Protein of unknown function UPF0011 [Rhodopseudomonas palustris BisB18] (317 aa)
Score = 326, Expect = 1.4e-28, Identities = 73/231 (31%), Positives = 131/231 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILIDNNVKETESIKKEETD 235
           L +VATPIGN+ +I+  A+ TL    I  CEDTR +++L    NI    K ++  N    +  I     +     L+SDAG P++SDPGF L+       ++V  + GPSS++ +L V+  P+    F GFL   +  ++ +L +L     T+++FES +R++DTL+ + ++   +++  I RELTK++E + R+ +A +  +   +  +GEFV++I     + + +  ++ D
  S:    38 LHLVATPIGNLGDITLRALETLAGVDIIACEDTRITRRLTERYNIHASLKQYHEHNAAQARPKILEKLAQGCSIALVSDAGTPLISDPGFKLVREVTAAGFNVFALPGPSSVLTALAVAALPTDRFFFEGFLPSKQMARRARLAELSRIDATLVLFESGNRVEDTLQDMAQVM-GTRDAAICRELTKLHEEVRRAPVAELAASAGALETRGEFVLVIGPPAADAQLMAAQDLD 269
>gi|168333804|ref|ZP_02692049.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Epulopiscium sp. 'N.t. morphotype B'] (277 aa)
Score = 326, Expect = 1.6e-28, Identities = 90/268 (33%), Positives = 150/268 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIK-ITEKGEFVILIDNNVKETESIKKEETDYSVYLN---ELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L + ATPIGN+ +IS   +  L  + +  CEDTR S +LLN  NI+   ++++  N N++   I     +     L++DAG P +SDPG  L+         V    GP + + +LI+SG  +   +F GFL  +K  +   +  L +E++TII++ES HRI  TL ++ E   N +NI +ARELTK  ET+  S+I++ I E +  T KGEFV++I+   K+   +K +     + ++    ++  +++G  EK A K V+   ++    +Y
  S:     2 LTLCATPIGNLADISLRTLEILKESDLILCEDTRVSIRLLNHYNITARLESYHEHNKNSKTASIXRQLREGXSIALVTDAGTPGISDPGEDLVRACAAEGISVTATPGPVAFVVALILSGKSTRRFVFEGFLPSDKKERLAVVASLVDETRTIILYESPHRITKTLSLLLEHLGN-RNITLARELTKKFETLIHSTISDAIVEFESTTPKGEFVVIIEG--KDANELKADSAKKWINMSFEAHMDLYLKQGFSEKDAMKKVATDRAISKRDVY 271
>gi|67459586|ref|YP_247210.1| hypothetical protein RF_1194 [Rickettsia felis URRWXCal2] >gi|67005119|gb|AAY62045.1| Conserved hypothetical protein [Rickettsia felis URRWXCal2] (279 aa)
Score = 325, Expect = 1.7e-28, Identities = 88/233 (37%), Positives = 135/233 (57%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEE 233
           +   L+IV+TPIGN ++I+  AI+TL N+ I  CEDTR S+KLL   +I  + + +   +   +++ I S     N   L+SDAG P++SDPG+ L+      N  + ++ G S+ + +L +S  P+   LF+GFL      K+   ++L N   T+I FE+  R+ +TL + KEI  N + IC+ARELTK+ + I    I  I  IK  +    KGE V+LI  N++E    KK E
  S:     3 LKSGLYIVSTPIGNFEDITLRAISTLKNSDIILCEDTRISQKLLAKHDIHTKLQIYNDHSDEKDRENIISLIKSGNIISLISDAGTPLISDPGYKLVRDLRILNCHIDVVPGVSAPVTALTLSALPTDRFLFHGFLPKTIESKKKIFSELVNLKATLIFFETAPRLINTLSVAKEILGN-REICVARELTKLYQEIKTGDIDEI--IKFYQNNILKGEIVLLISGNIQEQNQQKKLE 236
>gi|167472278|ref|ZP_02336982.1| tetrapyrrole (corrin/porphyrin) methylase family protein [Rickettsia africae ESF-5] (281 aa)
Score = 325, Expect = 1.8e-28, Identities = 86/229 (37%), Positives = 131/229 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEE 233
           L+IV+TPIGN ++I+  AI+TL N+ I  CEDTR S+KLL   +I  + + +   +   +++ I S     N   L+SDAG P++SDPG+ L+      N  + ++ G S+ + +L +S  P+   LF+GFL      K+   ++L N   T+I FE+  R+ +TL + KEI  N + IC+ARELTK+ + I    I  I E       KGE V+LI  N++E    K  E
  S:    10 LYIVSTPIGNFEDITLRAISTLKNSDIILCEDTRISQKLLAKHDIHTKLQIYNDHSDEKDRENIISLIKSGNIISLISDAGTPLISDPGYKLVRGIRNLNCHIDVVPGVSAPVTALTLSALPTDRFLFHGFLPKTIESKKKIFSELVNLKATLIFFETAPRLINTLSVAKEILGN-REICVARELTKLYQEIKTGDIDEIIEFYQNNILKGEIVLLISGNIQEQNQHKNLE 239
>gi|86134613|ref|ZP_01053195.1| methyltransferase [Tenacibaculum sp. MED152] >gi|85821476|gb|EAQ42623.1| methyltransferase [Polaribacter dokdonensis MED152] (224 aa)
Score = 325, Expect = 1.8e-28, Identities = 81/221 (36%), Positives = 126/221 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSF--DFKDNEYC-LLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILIDNNVK 224
           KL++V TPIGN+++++  AI  L        EDTR S KLL    IS +    +S + +NE + I       K  E C ++SDAG P +SDPGFLL    ++NN +V+ + G ++ + +L+ SG P+   +F GFL   K  +Q +   L  E++T+I +ES H++  TL    E F   + + ++RELTKM E   R + A +  +  K   KGE VI+++   K
  S:     3 KLYLVPTPIGNLEDMTFRAIRVLKEADFILAEDTRTSGKLLKHFEISTQ---MHSHHMHNEHKSIEGILNRIKSGETCAVISDAGTPAISDPGFLLTRACVENNIEVECLPGATAFVPALVNSGLPNDKFVFEGFLPVKKG-RQTRFLLLAEETRTMIFYESPHKLVKTLGHFIEYFGEERKVSVSRELTKMFEETVRGTAAEVLAHFTKKPPKGEIVIIVEGKNK 224
>gi|157828993|ref|YP_001495235.1| hypothetical protein A1G_06370 [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165933716|ref|YP_001650505.1| tetrapyrrole (corrin/porphyrin) methylase family protein [Rickettsia rickettsii str. Iowa] >gi|157801474|gb|ABV76727.1| hypothetical protein A1G_06370 [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165908803|gb|ABY73099.1| tetrapyrrole (corrin/porphyrin) methylase family protein [Rickettsia rickettsii str. Iowa] (281 aa)
Score = 325, Expect = 1.9e-28, Identities = 85/229 (37%), Positives = 131/229 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEE 233
           L+IV+TPIGN ++I+  AI+TL N+ +  CEDTR S+KLL   +I  + + +   +   +++ I S     N   L+SDAG P++SDPG+ L+      N  + ++ G S+ + +L +S  P+   LF+GFL      K+   ++L N   T+I FE+  R+ +TL + KEI  N + IC+ARELTK+ + I    I  I E       KGE V+LI  N++E    K  E
  S:    10 LYIVSTPIGNFEDITLRAISTLKNSDVILCEDTRISQKLLAKHDIHTKLQIYNDHSDEKDRENIISLIKSGNIISLISDAGTPLISDPGYKLVRGIRNLNCHIDVVPGVSAPVTALTLSALPTDRFLFHGFLPKTIESKKKIFSELVNLKATLIFFETAPRLINTLSVAKEILGN-REICVARELTKLYQEIKTGDIDEIIEFYQNNILKGEIVLLISGNIQEQNQHKNLE 239
>gi|167747820|ref|ZP_02419947.1| hypothetical protein ANACAC_02542 [Anaerostipes caccae DSM 14662] >gi|167653182|gb|EDR97311.1| hypothetical protein ANACAC_02542 [Anaerostipes caccae DSM 14662] (282 aa)
Score = 325, Expect = 2.0e-28, Identities = 88/272 (32%), Positives = 148/272 (54%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIR---KGEKEKVACKMVSYKYSLKSNSLY 272
           M  KL++ ATPIGN+++I+   + TL    +   EDTR+S KLLN  +I  +  +++  N   + +++           L++DAG P +SDPG  L+    +N   V  + G  +L++ LI+SG P+    F  FL  +K  +   L QLK+E++TII++E+ HR+  TL+ +     N K + + RELTK +ET++ S +  +         KGE V++I    +  E +KKE  +    L+ +E + R   KG  +K A K+V+    +    +Y
  S:     1 MAGKLYLCATPIGNLEDITFRTLETLKAVDLIAAEDTRHSIKLLNHFDIKTKMTSYHEYNRVEKARYLVKLLEDGKNIALITDAGTPGISDPGEELVRQCHENGIQVTSLPGACALINGLIISGQPTRRFCFEAFLPPDKKERAMILEQLKDETRTIILYEAPHRLLKTLEELYSTMGNRK-MTVCRELTKKHETVFVSEMEEVISYYTEHPAKGECVLIIQG--RTLEELKKESQEQFQELDLMEHMERYLGKGLSQKEAMKLVAKDRGVGKRDIY 274
>gi|153827397|ref|ZP_01980064.1| conserved hypothetical protein [Vibrio cholerae MZO-2] >gi|149738700|gb|EDM53042.1| conserved hypothetical protein [Vibrio cholerae MZO-2] (288 aa)
Score = 325, Expect = 2.1e-28, Identities = 85/270 (31%), Positives = 142/270 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ A+  L +  +   EDTR++ KLL   NIS +    +  N   + Q +           L+SDAG P++SDPG+ L+    +    V  + GP +++ +L  SG PS +  F GFL      ++D+L ++   S+T I +ES HRI ++L+ + ++    + + +ARELTK  ETI    +A     I E    +KGE V+L+       E    +E   ++ +   E  ++K      A  +V+  + LK N+LY +
  S:    14 LYIVPTPIGNLGDITQRALDVLASVDMIAAEDTRHTGKLLAHFNISTKTFALHDHNEQQKAQVLVDKLLSGLSIALVSDAGTPLISDPGYHLVTQCRQAGVKVVPLPGPCAVITALSASGLPSDSFSFEGFLPAKSKARKDKLLEIAKVSRTCIFYESPHRICESLQDMLDVLGGEREVVLARELTKTFETIQGMPLAELITWIAEDDNRKKGEMVLLVHGYRDAGEQQLPDEALRTLTILTKELPLKK------AAALVAEIHQLKKNALYKW 281
>gi|153803185|ref|ZP_01957771.1| conserved hypothetical protein [Vibrio cholerae MZO-3] >gi|124121288|gb|EAY40031.1| conserved hypothetical protein [Vibrio cholerae MZO-3] (288 aa)
Score = 325, Expect = 2.1e-28, Identities = 85/270 (31%), Positives = 142/270 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ A+  L +  +   EDTR++ KLL   NIS +    +  N   + Q +           L+SDAG P++SDPG+ L+    +    V  + GP +++ +L  SG PS +  F GFL      ++D+L ++   S+T I +ES HRI ++L+ + ++    + + +ARELTK  ETI    +A     I E    +KGE V+L+       E    +E   ++ +   E  ++K      A  +V+  + LK N+LY +
  S:    14 LYIVPTPIGNLGDITQRALDVLASVDMIAAEDTRHTGKLLAHFNISTKTFALHDHNEQQKAQVLVDKLLSGLSIALVSDAGTPLISDPGYHLVTQCRQAGVKVVPLPGPCAVITALSASGLPSDSFSFEGFLPAKSKARKDKLLEIAKVSRTCIFYESPHRICESLQDMLDVLGGEREVVLARELTKTFETIQGMPLAELIEWIAEDDNRKKGEMVLLVHGYRDAGEQQLPDEALRTLTILTKELPLKK------AAALVAEIHQLKKNALYKW 281
>gi|153216764|ref|ZP_01950604.1| conserved hypothetical protein [Vibrio cholerae 1587] >gi|124114152|gb|EAY32972.1| conserved hypothetical protein [Vibrio cholerae 1587] (288 aa)
Score = 325, Expect = 2.1e-28, Identities = 85/270 (31%), Positives = 142/270 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ A+  L +  +   EDTR++ KLL   NIS +    +  N   + Q +           L+SDAG P++SDPG+ L+    +    V  + GP +++ +L  SG PS +  F GFL      ++D+L ++   S+T I +ES HRI ++L+ + ++    + + +ARELTK  ETI    +A     I E    +KGE V+L+       E    +E   ++ +   E  ++K      A  +V+  + LK N+LY +
  S:    14 LYIVPTPIGNLGDITQRALDVLASVDMIAAEDTRHTGKLLAHFNISTKTFALHDHNEQQKAQVLVDKLLSGLSIALVSDAGTPLISDPGYHLVTQCRQAGVKVVPLPGPCAVITALSASGLPSDSFSFEGFLPAKSKARKDKLLEIAKVSRTCIFYESPHRICESLQDMLDVLGGEREVVLARELTKTFETIQGMPLAELIEWIAEDDNRKKGEMVLLVHGYRDAGEQQLPDEALRTLTILTKELPLKK------AAALVAEIHQLKKNALYKW 281
>gi|177666456|ref|ZP_02942251.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Cyanothece sp. PCC 8801] >gi|196245015|ref|ZP_03143740.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Cyanothece sp. PCC 8802] >gi|172074633|gb|EDT60051.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Cyanothece sp. PCC 8801] >gi|196207133|gb|EDY01927.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Cyanothece sp. PCC 8802] (289 aa)
Score = 324, Expect = 2.2e-28, Identities = 82/270 (30%), Positives = 145/270 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN---INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L++V TPIGN+++I+  AI  L +  +   EDTR++ KLL+   I+    +++  +    ++ + S   +     L++DAG P +SDPG+ LI   I+ N  V  I G ++ + +L VSG P+ + +F GFL     L++D+L  L  E++T+I +ES HR+  TL  + E+   ++ I + RELTK  E ++R ++       +     KGEF +++    + ++    E+        EL++L+ +G     A K +S   SL    +Y  
  S:    11 LYVVGTPIGNLEDITLRAIRILQSVDVIAAEDTRHTGKLLHHFQINTPQLSYHQHSELTRQERLISQLQEGQTIALVTDAGMPGISDPGYELIKACIEQNIPVVPIPGVTAAITALSVSGLPTDHFVFEGFLPTKGKLRRDRLTHLSTETRTLIFYESPHRLLQTLTDLVEVLGQNRLITVGRELTKFYEELWRGTLQEAMIYYQDSRQLKGEFTLIVAGCSQMSDLDLTEDQ----LKKELQQLLSQGMTRSQASKQLSQLTSLNRRQIYEL 279
>gi|83648532|ref|YP_436967.1| methyltransferase [Hahella chejuensis KCTC 2396] >gi|83636575|gb|ABC32542.1| predicted methyltransferase [Hahella chejuensis KCTC 2396] (282 aa)
Score = 324, Expect = 2.2e-28, Identities = 83/268 (30%), Positives = 144/268 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI----NEIKITEKGEFVILIDNNVKETESIKKEETDY-SVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L+IVATPIGN+ +++  AI  L +  +   EDTR+S KLL+   +     + +  N   + + + S         L+SDAG P++SDPGF L+    +  + V  + G  +L+ +L  SG PS   +F GFL    + ++ +L +L +E +T++ +ES HRI   ++ ++ +   ++ + IARELTK  ETI    + +I     E    ++GEFV+L+          +KE+ D+  + +++L + + K    K A  + S    +  N LY
  S:     8 LYIVATPIGNLDDMTPRAIAILKSVDLIAAEDTRHSGKLLSHFGVDAPMTSLHQFNEEAKTERLLSELAVGKSIALISDAGTPLISDPGFPLVRATREAGFIVTPVPGACALVAALSASGMPSERFVFEGFLPAKGSGRRGRLQELADEPRTMVFYESPHRILAMMEDLEVVMGAAREVVIARELTKTFETIKAGCVQDIKAWMQEDGNQQRGEFVVLVKGE-------RKEQGDFVEIKVSQLLQALLKELPVKKAAALASSLTGVGKNELY 273
>gi|163868917|ref|YP_001610144.1| hypothetical protein Btr_1881 [Bartonella tribocorum CIP 105476] >gi|161018591|emb|CAK02149.1| unnamed protein product [Bartonella tribocorum CIP 105476] (296 aa)
Score = 324, Expect = 2.3e-28, Identities = 77/215 (35%), Positives = 125/215 (58%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITE-KGEFVILI 219
           L++VATPIGN+ +I+  A+  L    I  CEDTR ++ LL   +I  +   ++  N +     + +   ++    L+SDAG P++SDPGF L+    K    +  I G S+L+ +LI +G P+ +  F GFL+  K  +Q +L QLK    T+I +ES HR+ +TL+ +  +F   +   I RELTK  ET+  S++ ++  N  K T+ +GE V+L+
  S:    22 LYLVATPIGNLADITLRALQVLAGVDILACEDTRVTRVLLERYSIRKKTFLYHEYNAHKAGPKLLAALAENKTVALVSDAGTPLISDPGFRLVEEARKAGHKIIPIPGASALLAALIPTGLPTDSFFFAGFLSARKAQRQKRLEQLKEIPATLIFYESPHRLVETLQDMVTLFSADRPAAICRELTKKFETVDVSNLGSLLENYRKQTQIRGEIVVLV 239
>gi|150422841|gb|EDN14793.1| conserved hypothetical protein [Vibrio cholerae AM-19226] (288 aa)
Score = 324, Expect = 2.3e-28, Identities = 85/270 (31%), Positives = 142/270 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ A+  L +  +   EDTR++ KLL   NIS +    +  N   + Q +           L+SDAG P++SDPG+ L+    +    V  + GP +++ +L  SG PS +  F GFL      ++D+L ++   S+T I +ES HRI ++L+ + ++    + + +ARELTK  ETI    +A     I E    +KGE V+L+       E    +E   ++ +   E  ++K      A  +V+  + LK N+LY +
  S:    14 LYIVPTPIGNLGDITQRALDVLASVDMIAAEDTRHTGKLLAHFNISTKTFALHDHNEQQKAQVLVDKLLSGLSIALVSDAGTPLISDPGYHLVTQCRQAGVKVVPLPGPCAVITALSASGLPSDSFSFEGFLPAKSKARKDKLLEIAKVSRTCIFYESPHRICESLQDMLDVLGGEREVVLARELTKTFETIKGMPLAELIEWIAEDDNRKKGEMVLLVHGYRDAGEQQLPDEALRTLTILTKELPLKK------AAALVAEIHQLKKNALYKW 281
>gi|15640604|ref|NP_230233.1| hypothetical protein VC0582 [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121591038|ref|ZP_01678354.1| conserved hypothetical protein [Vibrio cholerae 2740-80] >gi|121730076|ref|ZP_01682482.1| conserved hypothetical protein [Vibrio cholerae V52] >gi|147673119|ref|YP_001216079.1| hypothetical protein VC0395_A0114 [Vibrio cholerae O395] >gi|153224134|ref|ZP_01954239.1| conserved hypothetical protein [Vibrio cholerae MAK 757] >gi|153820165|ref|ZP_01972832.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457] >gi|153823608|ref|ZP_01976275.1| conserved hypothetical protein [Vibrio cholerae B33] >gi|194531093|ref|YP_002066609.1| conserved hypothetical protein [Vibrio cholerae MO10] >gi|17369150|sp|Q9KUD9|Y582_VIBCH UPF0011 protein VC_0582 >gi|9655013|gb|AAF93750.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121547109|gb|EAX57242.1| conserved hypothetical protein [Vibrio cholerae 2740-80] >gi|121628179|gb|EAX60705.1| conserved hypothetical protein [Vibrio cholerae V52] >gi|124117832|gb|EAY36575.1| conserved hypothetical protein [Vibrio cholerae MAK 757] >gi|125617261|gb|EAZ45837.1| conserved hypothetical protein [Vibrio cholerae MO10] >gi|126509294|gb|EAZ71888.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457] >gi|126518872|gb|EAZ76095.1| conserved hypothetical protein [Vibrio cholerae B33] >gi|146315002|gb|ABQ19541.1| conserved hypothetical protein [Vibrio cholerae O395] (288 aa)
Score = 324, Expect = 2.3e-28, Identities = 85/270 (31%), Positives = 142/270 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ A+  L +  +   EDTR++ KLL   NIS +    +  N   + Q +           L+SDAG P++SDPG+ L+    +    V  + GP +++ +L  SG PS +  F GFL      ++D+L ++   S+T I +ES HRI ++L+ + ++    + + +ARELTK  ETI    +A     I E    +KGE V+L+       E    +E   ++ +   E  ++K      A  +V+  + LK N+LY +
  S:    14 LYIVPTPIGNLGDITQRALDVLASVDMIAVEDTRHTGKLLAHFNISTKTFALHDHNEQQKAQVLVDKLLSGLSIALVSDAGTPLISDPGYHLVTQCRQAGVKVVPLPGPCAVITALSASGLPSDSFSFEGFLPAKSKARKDKLLEIAKVSRTCIFYESPHRICESLQDMLDVLGGEREVVLARELTKTFETIQGMPLAELITWIAEDDNRKKGEMVLLVHGYRDAGEQQLPDEALRTLTILTKELPLKK------AAALVAEIHQLKKNALYKW 281
>gi|157804116|ref|YP_001492665.1| hypothetical protein A1E_04795 [Rickettsia canadensis str. McKiel] >gi|157785379|gb|ABV73880.1| hypothetical protein A1E_04795 [Rickettsia canadensis str. McKiel] (279 aa)
Score = 324, Expect = 2.3e-28, Identities = 88/236 (37%), Positives = 140/236 (59%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI-----KITEKGEFVILIDNNVKETESIKKEETDYSVYL 240
           L+IV+TPIGN ++I+  AI+TL N+ I  CEDTR S+ LL   +I  + + +   +   +++ I S   + N   L+SDAG P++SDPG+ L       N+ + +I G S+ + +L +S  P+   LF+GFL      K+   ++L N   T+I FE+  R+ +TL + KEI  N + IC+ARELTK+ + I    I +I+EI         KGE V+LI  N++E +  +K+E D   ++
  S:     7 LYIVSTPIGNFEDITLRAISTLKNSDIILCEDTRISQTLLAKHDIHTKLQIYNDHSDQKDREHIISLIKEGNIVSLISDAGTPLISDPGYKLSRDLRMLNYHIDVIPGVSAPITALTLSALPTDRFLFHGFLPKTIESKKKIFSELVNLKATLIFFETAPRLINTLSVAKEILGN-REICVARELTKLYQGI---KIGDIDEIIAFYQNNILKGEIVLLISGNLREKK--EKQEVDLEKFI 241
>gi|78043091|ref|YP_358927.1| hypothetical protein CHY_0055 [Carboxydothermus hydrogenoformans Z-2901] >gi|77995206|gb|ABB14105.1| conserved hypothetical protein TIGR00096 [Carboxydothermus hydrogenoformans Z-2901] (269 aa)
Score = 324, Expect = 2.4e-28, Identities = 86/275 (31%), Positives = 146/275 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI-NEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TP+GN+K+I+  A+ TL    I   EDTR++ KLLN   I     +++  N     + I     +  +  L++DAG P +SDPG  ++   +K  + V+ + G S+L+ +L  SG  +S   F GFL      ++  L +L  E +T+I +E+ HR+  TL+ + + F  ++ + +ARELTK++E   R SIA + +  K  E KGEFV+++       E    EE +   ++ E    I +G  +K A  ++  +   K   +Y  + Q K
  S:     4 LYLVPTPLGNLKDITLRALDTLKEVDIIAAEDTRHTLKLLNHYEIKKPLLSYHEHNRREAGKKILELLAQGKQVALVTDAGTPGISDPGEDIVREALKEGYKVEALPGASALIVALAASGLTTSRFCFEGFLPRKAGDREKWLRELSRERRTMIFYEAPHRLLKTLEDLAKHFGENRRMVVARELTKIHEEYIRGSIAEVLSHFKEKEPKGEFVLVV-------EGAPPEEKNVEEFVRE---CIERGLSQKEAV-LLGRELGFKKKEIYKLYLQLK 269
>gi|16330705|ref|NP_441433.1| hypothetical protein sll0818 [Synechocystis sp. PCC 6803] >gi|2829612|sp|P74038|Y818_SYNY3 UPF0011 protein sll0818 >gi|1653197|dbj|BAA18113.1| sll0818 [Synechocystis sp. PCC 6803] (279 aa)
Score = 324, Expect = 2.5e-28, Identities = 86/270 (31%), Positives = 139/270 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYR----SSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L++VATPIGN+ +++  A+ TL    +   EDTR++ KLL    I+    +++  N +   Q + +         L+SDAG P +SDPG  L+    + N +V  I G ++L+ +LI SG  +   +F GFL+     +Q  L  L  E +TII++E+ HR+  TL  ++      +++ +ARELTK +E  +R    ++IA   E   T KGEF ++I     E      EE       +EL  L+ KG     A + ++ +  L    LY  
  S:     4 LYLVATPIGNLGDMTPRAVETLQTVDLIAAEDTRHTGKLLQHFQITTPQISYHDHNRHGRTQELLAKLQAGQNIALVSDAGTPGISDPGQELVAACGEANIEVIPIPGATALIAALISSGLATDRFVFEGFLSTKNRPRQQLLQSLAQEERTIILYEAPHRLLATLTDLQTFLGQERSLTVARELTKYHEQFWRGTLQTAIAYFTE--NTPKGEFCLVIAGATPEDRPSFSEEN----LRDELRSLMAKGLTRSQASRQLAEETKLPRRQLYQL 271
>gi|85057770|ref|YP_456686.1| tetrapyrrole (Corrin/Porphyrin) methylase [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789875|gb|ABC65607.1| tetrapyrrole (Corrin/Porphyrin) methylase [Aster yellows witches'-broom phytoplasma AYWB] (285 aa)
Score = 324, Expect = 2.5e-28, Identities = 93/265 (35%), Positives = 144/265 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETE-----SIKKEETDY-SVYLNELEKLIRKGEKEKVACKMVSYKYSLKSN 269
           L++VATPIGN ++I+  A+ TL    +   EDTR +KKLL+   I     ++Y  N       I     +     L+SDAG P++SDPGF L+    K+ ++V  I G S+ + + + S  PS   +F  FL       +  L Q KN S++++I+ES HRIK TL +I +++ N K I +ARELTK  ETI   ++ +I E+ +  KGE+VI++  N    E     SI      Y  +  NE E   +  ++  +  K +  +Y +K N
  S:    15 LYLVATPIGNSEDITLRALYTLKEVFLILAEDTRRAKKLLHTYQIQKPLLSYYEHNQTRRLPQILELLSQGKNIALISDAGTPLISDPGFSLVCEVQKHGFNVVAIPGVSAFLTAFMTSAIPSP-FIFLAFLPRLSQALKKYLLQYKNTSESLVIYESPHRIKKTLLLINKLYGNRK-ISLARELTKKFETIINGNLDSILELDLINKGEYVIVVAGNPNPNEHLLVLSINDHVLFYLKLGFNEKEAFSKVAQERNITKKEIYRQYKIKKN 283
>gi|77361436|ref|YP_341011.1| methyltransferase [Pseudoalteromonas haloplanktis TAC125] >gi|76876347|emb|CAI87569.1| putative methyltransferase [Pseudoalteromonas haloplanktis TAC125] (285 aa)
Score = 324, Expect = 2.7e-28, Identities = 84/268 (31%), Positives = 142/268 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L+IVATPIGN  ++S+ AI TL+   +   EDTR++ KLL+  +  ++ KTF +L+ +NEKQ       + N+     L+SDAG P++SDPG+ ++NL  +    V  I G  + + ++  SG P+    F GF       +Q+      N   T I++ES HRI  +L  + E   + + +  A+ELTK  ET +  S++ +          ++GE V+++    K  + +  E         ++  L+      K AC +V+  + +K N+LY
  S:    13 LYIVATPIGNYDDLSQRAIATLSQVDLIAAEDTRHTGKLLS--HFGIKAKTF-ALHDHNEKQKAQQIIDQLNQGLDIALVSDAGTPLISDPGYAVVNLCREQGAHVTPIPGACAAITAVCCSGLPTDRFQFVGFTPAKSKARQEFFIDAVNSGITSIMYESTHRIMASLDDLAEALGDDQQVVFAKELTKTFETFFNGSVSELKAFLTNDPTKQRGEIVLMLPGKPKLIDDVPPEA-------RKMLALLESEMPMKKACGIVADYFGMKKNALY 277
>gi|78486034|ref|YP_391959.1| hypothetical protein Tcr_1693 [Thiomicrospira crunogena XCL-2] >gi|78364320|gb|ABB42285.1| Tetrapyrrole (Corrin/Porphyrin) Methylase family protein [Thiomicrospira crunogena XCL-2] (291 aa)
Score = 324, Expect = 2.7e-28, Identities = 82/216 (37%), Positives = 122/216 (56%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFD--FKDNEY-CLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILI 219
           KLFIVATPIGN+K+I+  A+  L N      EDTR+SKKLL    +   NK   SL+ +NE +  N      K  E   L+SDAG P++SDPG+ L+NL  + +  V+ I G S+++ +L  SG P+    F GFL   K  +   L  L  E +T++ +ES HR+ ++L      F N + I +A+E+TK  E  +  ++        E     +GEFV ++
  S:    18 KLFIVATPIGNLKDITLRALEVLENVDWVAAEDTRHSKKLLQHYGL---NKKLISLHEHNELERRNELLALLKTGEQGALISDAGTPLISDPGYHLVNLLRQEHIQVEPIPGASAMIAALSASGLPTDRFSFEGFLPAKKQKRLHVLEGLTQEVRTMVFYESPHRLLESLATFVAAFGNDREIVVAKEITKQFELFFSGTVEEALGFFEENTDKVRGEFVFIL 237
>gi|149277076|ref|ZP_01883218.1| methyltransferase [Pedobacter sp. BAL39] >gi|149231953|gb|EDM37330.1| methyltransferase [Pedobacter sp. BAL39] (235 aa)
Score = 323, Expect = 2.9e-28, Identities = 83/227 (36%), Positives = 127/227 (55%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQF---INSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANIN---EIKITEKGEFVILIDNNVKETE 227
           M  KL++V TPIGN+++++  AI  L    +   EDTR S  +L    I   +K  YS + +NE Q    I  F  +  +  L+SDAG P +SDPGF L+   IK++  V+ + G ++ + +L+ SG PS   +F GFL   K  +Q +  +L  E +TII++ES HR+  TL+   +     +   ++RELTK+ E   R ++  I    E  I  KGEFVI I    +E +
  S:     1 MEGKLYLVPTPIGNLEDMTFRAIRILKEADVILAEDTRTSAPMLKHFGI---DKKAYSHHQHNEHQATSEIIKFLKEGKQVALISDAGTPAISDPGFFLVREAIKHDLAVECLPGATAFVPALVNSGLPSDTFIFEGFLPVKKG-RQTRFKKLAEEDRTIILYESPHRLLKTLEEFAQYCGEDRQASVSRELTKLYEETVRGTLTEIKSHFENNIL-KGEFVICIAGKAEEKK 228
>gi|167626975|ref|YP_001677475.1| SAM-dependent methyltransferase [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167596976|gb|ABZ86974.1| SAM-dependent methyltransferase [Francisella philomiragia subsp. philomiragia ATCC 25017] (288 aa)
Score = 323, Expect = 3.0e-28, Identities = 80/218 (36%), Positives = 130/218 (59%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENK--TFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNN 222
           L++VATPIGN+++I+  A++ L++  +   EDTR + KLL  LNI  + K  + +  N  +  +++      DN   L+SDAG P++SDPG+ ++       + V  + G S+L+ +L  +G PS + LF GFL+  +  +Q Q+  L   S T+II+ESVHRI   L  + EI  ++ NI +A+ELTK  E     S+  + +   +     +GEFV++ID N
  S:     9 LYVVATPIGNLQDITYRAMSILSSADVILAEDTRMTAKLLTNLNIRGDQKLISCHDFNEESRVEYVKELLDNDNSIALVSDAGTPLISDPGYKIVASLRNGGYKVVPVPGVSALITALSAAGLPSDSFLFKGFLSAKQAKRQQQIRDLLLVSATVIIYESVHRITYLLDDLLEIMPHN-NIVVAKELTKQFEKFVAGSVEEVCDFFKSNPDIIRGEFVVVIDCN 231
>gi|116619211|ref|YP_821367.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Solibacter usitatus Ellin6076] >gi|116222373|gb|ABJ81082.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Solibacter usitatus Ellin6076] (273 aa)
Score = 323, Expect = 3.0e-28, Identities = 74/215 (34%), Positives = 120/215 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE---KGEFVILI 219
           L++VATPIGN+++I+  A+  L    +  CEDTR ++KLL+  NI     +++  N     + + +         L+SDAG P++SDPG+ L++  I+    VQ I GPS+ + +L  SG P+ +  F GFL      +   L  L  E  T+I +E+ HRI +TL+ I+      + + +ARE+TK++E   R + A I+    +    KGE  +LI
  S:     5 LYVVATPIGNLEDITYRAVRLLGEADLIACEDTRQTRKLLDHYNIHKPTISYHDHNEAERTEDLTARLLAGETIALVSDAGMPLVSDPGYRLVHAAIEAGVSVQPIPGPSASLTALAASGLPTDSFHFGGFLPPKTGQRAKLLESLAEEHATLIFYEAPHRILETLEAIEAAL-GPRPVVVAREITKIHEEFLRGTAAEIHAQLASRDAVKGEITLLI 221
>gi|157964891|ref|YP_001499715.1| putative methyltransferase [Rickettsia massiliae MTU5] >gi|157844667|gb|ABV85168.1| Putative methyltransferase [Rickettsia massiliae MTU5] (281 aa)
Score = 323, Expect = 3.1e-28, Identities = 85/229 (37%), Positives = 132/229 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEE 233
           L+IV+TPIGN ++I+  AI+TL N+ I  CEDTR S+KLL   +I  + + +   +   +++ I +     N   L+SDAG P++SDPG+ L+      +  + ++ G S+ + +L +S  P+   LF+GFL      K++  + L N   T+I FE+  R+ +TL + KEI  N + IC+ARELTK+ + I    I  I E       KGE V+LI  N++E    KK E
  S:    10 LYIVSTPIGNFEDITLRAISTLKNSDIILCEDTRISQKLLAKHDIHTKLQIYNDHSDEKDRENIINLIKSGNIISLISDAGTPLISDPGYKLVRDIRNLHCHIDVVPGVSAPITALTLSALPTDRFLFHGFLPKTIESKKEIFSALVNLKATLIFFETAPRLINTLSVAKEILGN-REICVARELTKLYQEIKTGDIDEIIEFYQNNILKGEIVLLISGNIQEQNQQKKLE 239
>gi|160902473|ref|YP_001568054.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Petrotoga mobilis SJ95] >gi|160360117|gb|ABX31731.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Petrotoga mobilis SJ95] (226 aa)
Score = 323, Expect = 3.5e-28, Identities = 82/216 (37%), Positives = 127/216 (58%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFIN---SFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIA---NINEIKITEKGEFVILI 219
           KL +V TPIGN+++IS  A+ TL    +   ED R + KL+N  +  L  K  ++ N  N ++ ++   S     N   L+SDAG P+L+DPGF L+    +    + ++ GPS+L  +L VSGFP+S  LF GFL  +K L++  L ++K     I+ FES +RIK TL+ I EIF    ++ +ARE+TK+ +  ++  I+      E K   KGE  ++I
  S:     3 KLILVGTPIGNLEDISLRALKTLKEADLILTEDKRVTLKLIN--HFELGKKELFTFNEANSEKIMDTVLSLIESHNITALVSDAGMPVLADPGFNLVQRCWEKGIPIDVVPGPSALTSALAVSGFPASKFLFLGFLPRDKKLRR-LLREIKEFEYPIVFFESPNRIKKTLQEILEIF-GEMDVLVAREMTKLYQEFFKGKISEGIKFFESKDQVKGELTVVI 220
>gi|158336643|ref|YP_001517817.1| tetrapyrrole methylase family protein [Acaryochloris marina MBIC11017] >gi|158306884|gb|ABW28501.1| tetrapyrrole methylase family protein [Acaryochloris marina MBIC11017] (285 aa)
Score = 322, Expect = 3.7e-28, Identities = 85/273 (31%), Positives = 143/273 (52%)
  Q:     2 NKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI-ANINEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           N  L+IVATPIGN++++S  A+  L   +    EDTR++ KLL+   I     +++  N     Q +        +  L+SDAG P +SDPG  L+   ++   +V  I G ++ + +L+ SG P     F GFL      +Q +L  +  ES+T++++E+ HR++ TLK + E     + I +ARELTK  E  +R S+ A I   +  E KGEF +++   V      K   TD  +   EL+ L+ +G  +  A + ++ K+++    +Y  
  S:    11 NGSLYIVATPIGNLEDMSFRAVRILQTVAAIAAEDTRHTGKLLHHFQIKTPQISYHQHNTQTRTQELIQRLESGQDLALVSDAGMPGISDPGVELVQACVEVGIEVIPIPGANAAIAALVASGLPCDRFCFEGFLPAKGKARQQRLQDIATESRTVVLYEAPHRLRQTLKDLAEQVSAERQIVLARELTKRFEEFWRGSVQAAITHYQSHEPKGEFTVVLAGAVVS----KTLPTDLELR-TELQALLAQGWSKSRASRQLAEKHAMSRRQIYQL 280
>gi|82545614|ref|YP_409561.1| hypothetical protein SBO_3236 [Shigella boydii Sb227] >gi|187732797|ref|YP_001881937.1| tetrapyrrole methylase family protein [Shigella boydii CDC 3083-94] >gi|81247025|gb|ABB67733.1| conserved hypothetical protein [Shigella boydii Sb227] >gi|187429789|gb|ACD09063.1| tetrapyrrole methylase family protein [Shigella boydii CDC 3083-94] (286 aa)
Score = 322, Expect = 3.8e-28, Identities = 84/271 (30%), Positives = 146/271 (53%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           +L+IV TPIGN+ +I++ A+  L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  ++ E +T+I +ES HR+ D+L+ I  +   S+ + +ARELTK  ETI+ + +    A + E +   KGE V++++ +       K +E D          L++     K A  +V+  + +K N+LY +
  S:    13 QLYIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGI---NARLFALHDHNEQQKAETLLAKLQEGQNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIEAEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGH-------KAQEEDLPADALRTLALLQAELPLKKAAALVAEIHGVKKNALYKY 280
>gi|153835653|ref|ZP_01988320.1| conserved hypothetical protein [Vibrio harveyi HY01] >gi|156973212|ref|YP_001444119.1| corrin/porphyrin methyltransferase [Vibrio harveyi ATCC BAA-1116] >gi|148867735|gb|EDL66995.1| conserved hypothetical protein [Vibrio harveyi HY01] >gi|156524806|gb|ABU69892.1| hypothetical protein VIBHAR_00892 [Vibrio harveyi ATCC BAA-1116] (287 aa)
Score = 322, Expect = 4.1e-28, Identities = 91/270 (33%), Positives = 146/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE-IKI---TEKGEFVILIDNNVKETESIKKEETDYS--VYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ AI  L+N  I   EDTR++ KLL+  NI  + KTF +L+ +NE+Q       K        L+SDAG P++SDPG+ L+    +    V  + G  +++ +L  SG PS    F GFL      ++D+  ++ +  +T I +ES HRI D+L+ + ++    + + +ARELTK  ETI    +  + E +K     ++GE V+LI  +   TE    +E   +  +   EL          ++        YSLK N+LY +
  S:    14 LYIVPTPIGNLADITQRAIEVLSNVDIIAAEDTRHTGKLLSHFNI--QTKTF-ALHDHNEQQKAQVLVEKLLSGQSIALVSDAGTPLISDPGYHLVTKCRQAGVRVVPLPGACAVITALSASGLPSDRFSFEGFLPPKSKGRKDKFLEIASVERTCIFYESPHRILDSLQDMLDVLGPEREVVLARELTKTFETIQGMPLGELIEWVKSDDNQQRGEMVLLIHGHRDSTEDTLPDEATRTLGILTKELPLKKAAALAAEI--------YSLKKNALYKW 281
>gi|120437678|ref|YP_863364.1| tetrapyrrole (corrin/porphyrin) methylase family protein [Gramella forsetii KT0803] >gi|117579828|emb|CAL68297.1| tetrapyrrole (corrin/porphyrin) methylase family protein [Gramella forsetii KT0803] (223 aa)
Score = 322, Expect = 4.1e-28, Identities = 75/217 (34%), Positives = 119/217 (54%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILID 220
           KLF+V TPIGN+++I+  AI  L    +   EDTRNS KLL    I  +  + +  N +   + I S         L+SDAG P +SDPGFLL    ++   +V  + G ++ + +L+ SG P+   +F GFL   K  +Q +L  L  E++TI+ +ES H++  TL    E F   + + ++RE+TKM+E   R +   +  +      KGE VI+++
  S:     3 KLFLVPTPIGNLEDITFRAIRVLKEADLILAEDTRNSGKLLKHFEIQTQMHSHHMHNEHKTVEGIVSRIQAGETIALISDAGTPAISDPGFLLTRACVEAGVEVDCLPGATAFVPALVNSGLPNDKFVFEGFLPVKKG-RQTRLKILAEETRTIVFYESPHKLIKTLGHFTEYFGEDRRVSVSREITKMHEETIRGTALEVLQHYTDNPPKGEIVIVVE 220
>gi|194017968|ref|ZP_03056575.1| conserved hypothetical protein [Bacillus pumilus ATCC 7061] >gi|194010305|gb|EDW19880.1| conserved hypothetical protein [Bacillus pumilus ATCC 7061] (292 aa)
Score = 322, Expect = 4.4e-28, Identities = 85/272 (31%), Positives = 148/272 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEKL---IRKGEKEKVACKMVSYKYSLKSNSLYNFWQ 276
           L++V TPIGN+++++  AI TL +      EDTR +KKL ++  I     +++  N ++    +  +  +     L+SDAG P +SDPG  ++  F      V  + G ++ + +LI SG       FYGFL+  K  K+ QL  LK   +TII +E+ HR+K+TL ++KE++ N +NI I RELTK  E   R  + ++    +    +GEF +++  N ++ E + +E   +   L+E E +   I +G   K A K  + +  +   ++Y+ + 
  S:    16 LYLVPTPIGNLEDMTFRAIQTLKDVDYIAAEDTRQTKKLCHVYEIDTPLTSYHEHNKDSSGHKLIEWLKEGKNIALVSDAGLPTISDPGAEVVRDFTNIGGYVVPLPGANAALTALIASGITPQPFFFYGFLDRQKKEKKKQLEALKKRQETIIFYEAPHRLKETLTLMKEVWGN-RNIAITRELTKKFEEFIRGDLESVLTWAVENQIRGEFCLVVQGNDQDEEELNEEA--WWKSLSEKEHVIHYIEEGLTSKEAIKRTAVERGVPKRTIYDAYH 289
>gi|57234816|ref|YP_181131.1| tetrapyrrole methylase family protein [Dehalococcoides ethenogenes 195] >gi|57225264|gb|AAW40321.1| tetrapyrrole methylase family protein [Dehalococcoides ethenogenes 195] (274 aa)
Score = 322, Expect = 4.5e-28, Identities = 83/271 (30%), Positives = 148/271 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFW 275
           L++VATPIGN+++I+  A+  L+   +   EDTR ++KLL+  NI     +++  N  ++  +I      + +  L+SDAG P +SDPG+ LI    ++   V  + G S+++ ++ VSG   ++  + GFL   K  ++  L++  +   +I+I E+ HR++  L  IK++  + + I + RELTK+ E I+R SI+         +GEFV++++    +    + E TD    + EL  L ++G+  K A  +VS K  L    +Y  W
  S:     3 LYVVATPIGNLEDITLRALRVLSEVKLIAAEDTRRTRKLLSAHNIKTPLTSYFEHNRLSKLDYILEV-LGEGDVALVSDAGMPGISDPGYELIKAAHEHGIKVVPVPGASAVITAVAVSGLDCASFSYLGFLPRQKTERRKALSEAASLGASIVILEAPHRLQGCLLDIKDVLGD-REIAVCRELTKIYEEIFRGSISQAISHFDQPRGEFVLVVEGC--KVPVSQPELTDD--IIKELGMLKKQGKPAKEAVALVSQKSGLPKKEIYRAW 267
>gi|148984678|ref|ZP_01817946.1| hypothetical protein CGSSp3BS71_01502 [Streptococcus pneumoniae SP3-BS71] >gi|147923069|gb|EDK74184.1| hypothetical protein CGSSp3BS71_01502 [Streptococcus pneumoniae SP3-BS71] (289 aa)
Score = 322, Expect = 4.6e-28, Identities = 89/276 (32%), Positives = 151/276 (54%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE---KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSL---YNFWQQRK 279
           KL++VATPIGN+ +++  AI TL        EDTRN+  LL   +IS +  +F+  N   +   +  F         +SDAG P +SDPG  L+   I+    V  + G S+ + +LI SG      +FYGFL      ++      K+  +T I +ES HR+ DTL+ + E++ + +++ + RELTK+ E   R +I+ + E  I+E   KGE +++++   K  E  +K+E D  +   E++  I++G K+  A K V+  Y    + L   Y+ W++++
  S:    15 KLYLVATPIGNLDDMTFRAIQTLKEVDWIAAEDTRNTGLLLKHFDISTKQISFHEHNAKEKTPDLIGFLKAGQSIAQVSDAGLPSISDPGHDLVKAAIEEEIAVVTVPGASAGISALIASGLAPQPHIFYGFLPRKSGQQKQFFGSKKDYPETQIFYESPHRVADTLENMLEVYGD-RSVVLVRELTKIYEEYQRGTISELLE-SISETSLKGECLLIVEGASKGVE--EKDEEDLFL---EIQARIQQGMKKNQAIKEVAKIYQWNKSQLYAAYHDWEEKQ 289
>gi|148996971|ref|ZP_01824625.1| hypothetical protein CGSSp11BS70_09425 [Streptococcus pneumoniae SP11-BS70] >gi|149006389|ref|ZP_01830101.1| hypothetical protein CGSSp18BS74_03729 [Streptococcus pneumoniae SP18-BS74] >gi|168575600|ref|ZP_02721536.1| conserved hypothetical protein [Streptococcus pneumoniae MLV-016] >gi|147756671|gb|EDK63711.1| hypothetical protein CGSSp11BS70_09425 [Streptococcus pneumoniae SP11-BS70] >gi|147762166|gb|EDK69128.1| hypothetical protein CGSSp18BS74_03729 [Streptococcus pneumoniae SP18-BS74] >gi|183578495|gb|EDT99023.1| conserved hypothetical protein [Streptococcus pneumoniae MLV-016] (289 aa)
Score = 321, Expect = 5.1e-28, Identities = 86/276 (31%), Positives = 152/276 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSL---YNFWQQRK 279
           KL++VATPIGN+ +++  AI TL        EDTRN+  LL   +IS +  +F+  N   +   +  F         +SDAG P +SDPG  L+   I+    V  + G S+ + +LI SG      +FYGFL      ++   +  K+  +T I +ES HR+ DTL+ + E++ + +++ + RELTK+ E   R +I+ + E   + + KGE +++++   ++ E  +K+E D  +   E++  I++G K+  A K V+  Y    + L   Y+ W++++
  S:    15 KLYLVATPIGNLDDMTFRAIQTLKEVDWIAAEDTRNTGLLLKHFDISTKQISFHEHNAKEKIPDLIGFLKAGQSIAQVSDAGLPSISDPGHDLVKAAIEEEIAVVTVPGASAGISALIASGLAPQPHIFYGFLPRKSGQQKQFFDSKKDYPETQIFYESPHRVADTLENMLEVYGD-RSVVLVRELTKIYEEYQRGTISELLESIAETSLKGECLLIVEGASQDVE--EKDEEDLFL---EIQARIQQGMKKNQAIKEVAKIYQWNKSQLYAAYHDWEEKQ 289
>gi|189346138|ref|YP_001942667.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Chlorobium limicola DSM 245] >gi|189340285|gb|ACD89688.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Chlorobium limicola DSM 245] (250 aa)
Score = 321, Expect = 5.4e-28, Identities = 82/215 (38%), Positives = 124/215 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEK--GEFVILI 219
           L++VATP+GN+ +I+  AI TL N+    CEDTR +  LL  L I+   K   S +  NE   I+       E     L++DAG P++SDPG+L++    +  + V  I GPS+L  +L V   P S+ LF GFL H K  +Q +L  L +   T +++ES +RIK  L  +     +++ I IARE+TK++E     ++ NI E    EK  GEFV+++
  S:    11 LYVVATPLGNLDDITLRAIKTLANSEAIACEDTRRASILLRHLGIT--GKQLVSYHDFNEPAAISRIARLLEEGLDVSLITDAGTPVISDPGYLMVRTLREKGFTVLPIPGPSALTAALSVCPLPVSSFLFAGFLPHKKG-RQSRLEYLSSLGMTFVLYESPYRIKKLLDELTAHLPDAE-IFIAREMTKIHEEYLAGTVENIKEQLPDEKIRGEFVVVV 226
>gi|168483007|ref|ZP_02707959.1| conserved hypothetical protein [Streptococcus pneumoniae CDC1873-00] >gi|172043394|gb|EDT51440.1| conserved hypothetical protein [Streptococcus pneumoniae CDC1873-00] (289 aa)
Score = 321, Expect = 5.7e-28, Identities = 89/276 (32%), Positives = 151/276 (54%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE---KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSL---YNFWQQRK 279
           KL++VATPIGN+ +++  AI TL        EDTRN+  LL   +IS +  +F+  N   +   +  F         +SDAG P +SDPG  L+   I+    V  + G S+ + +LI SG      +FYGFL      ++   +  K+  +T I +ES HR+ DTL+ + E++ + +++ + RELTK+ E   R +I+ + E  I E   KGE +++++   +  E  +K+E D  V   E++  I++G K+  A K V+  Y    + L   Y+ W++++
  S:    15 KLYLVATPIGNLDDMTFRAIQTLKEVDWIAAEDTRNTGLLLKHFDISTKQISFHEHNAKEKIPDLIGFLKAGQSIAQVSDAGLPSISDPGHDLVKAAIEEEIAVVTVPGASAGISALIASGLAPQPHIFYGFLPRKSGQQKQFFDSKKDYPETQIFYESPHRVADTLENMLEVYGD-RSVVLVRELTKIYEEYQRGTISELLE-SIAETPLKGECLLIVEGASQGVE--EKDEEDLFV---EIQTRIQQGMKKNQAIKEVAKIYQWNKSQLYAAYHDWEEKQ 289
>gi|153815174|ref|ZP_01967842.1| hypothetical protein RUMTOR_01406 [Ruminococcus torques ATCC 27756] >gi|145847433|gb|EDK24351.1| hypothetical protein RUMTOR_01406 [Ruminococcus torques ATCC 27756] (286 aa)
Score = 321, Expect = 5.8e-28, Identities = 81/280 (28%), Positives = 156/280 (55%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRKN 280
           M   L++ ATPIGN+++I+   +  L    +   EDTRNS +LLN   I     +++  N  ++ + +     +  +  L++DAG P +SDPG  L+ +  +    V  + G S+ + +L +SG P+    F  FL  +K  ++  L+ L+ E +TI+++E+ HR+  TLKM+ E   + + + + RELTK +ET+YRS++  +  +   E    KGE V++I+   +E    ++++   ++ + E +E  + +G  +K A K  +    ++   +YN+ ++ K+
  S:     1 MAGTLYLCATPIGNLEDITFRVLRVLREADLIAAEDTRNSIRLLNYFEIETPMTSYHEYNKFDKGRVLIEKLLEGKDIALITDAGTPGISDPGEELVRMCYEEGITVTAVPGASACVSALTISGLPTRRFAFEAFLPSDKKEREAVLSCLEKEQRTIVLYEAPHRLIKTLKMLGERLGD-RRVSVCRELTKRHETVYRSTL--LEAVSYYEENLPKGECVLVIEGLSREEIEQEEQKKWSNLSIEEHMEYYLSQGIDKKEAMKKTAKDRGVQKREIYNYLEKLKS 282
>gi|148992930|ref|ZP_01822549.1| hypothetical protein CGSSp9BS68_07642 [Streptococcus pneumoniae SP9-BS68] >gi|168490247|ref|ZP_02714446.1| conserved hypothetical protein [Streptococcus pneumoniae SP195] >gi|147928382|gb|EDK79398.1| hypothetical protein CGSSp9BS68_07642 [Streptococcus pneumoniae SP9-BS68] >gi|183571390|gb|EDT91918.1| conserved hypothetical protein [Streptococcus pneumoniae SP195] (289 aa)
Score = 321, Expect = 5.9e-28, Identities = 89/276 (32%), Positives = 152/276 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE---KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSL---YNFWQQRK 279
           KL++VATPIGN+ +++  AI TL        EDTRN+  LL   +IS +  +F+  N   +   +  F         +SDAG P +SDPG  L+   I+    V  + G S+ + +LI SG      +FYGFL      ++   +  K+  +T I +ES HR+ DTL+ + E++ + +++ + RELTK+ E   R +I+ + E  I+E   KGE +++++   K  E  +K+E D  +   E++  I++G K+  A K V+  Y    + L   Y+ W++++
  S:    15 KLYLVATPIGNLDDMTFRAIQTLKEVDWIAAEDTRNTGLLLKHFDISTKQISFHEHNAKEKIPDLIGFLKAGQSIAQVSDAGLPSISDPGHDLVKAAIEEEIAVVTVPGASAGISALIASGLAPQPHIFYGFLPRKSGQQKQFFDSKKDYPETQIFYESPHRVADTLENMLEVYGD-RSVVLVRELTKIYEEYQRGTISELLE-SISETSLKGECLLIVEGASKGVE--EKDEEDLFL---EIQARIQQGMKKNQAIKEVAKIYQWNKSQLYAAYHDWEEKQ 289
>gi|163730348|ref|ZP_02137823.1| corrin/porphyrin methyltransferase [Vibrio fischeri MJ11] >gi|161396500|gb|EDQ20794.1| corrin/porphyrin methyltransferase [Vibrio fischeri MJ11] (287 aa)
Score = 321, Expect = 6.0e-28, Identities = 84/270 (31%), Positives = 143/270 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ AI  L +  +   EDTR++ KLL+   I+ +    +  N  ++   + S   +     L+SDAG P++SDPG+ L+N   + N +V  + G  +++ +L  +G PS    F GFL      ++D+  ++    +T I +ES HRI D+L  +  +    + + +ARELTK  ETIY + +      I E    ++GE V+LI     E     K+E  +      L  L+++   +K A  M +  + +K N+LY +
  S:    14 LYIVPTPIGNLGDITQRAIEVLKSVDLIAAEDTRHTGKLLSHFGIASQTFALHDHNEQHKADLLISKLQQGLSIALVSDAGTPLISDPGYHLVNRCRQANVNVVPLPGACAVITALSAAGLPSDRFSFEGFLPPKSKGRRDKFEEIAQAERTCIFYESPHRIMDSLDDMLTVLGPERQVVLARELTKTYETIYGAPLGELIEWIKEDDNRKRGEMVLLIHGFRSEA----KDELPFEA-TRSLSILVKELPLKKAAA-MAAEIHGVKKNALYKW 281
>gi|114705082|ref|ZP_01437990.1| probable methyltransferase protein [Fulvimarina pelagi HTCC2506] >gi|114539867|gb|EAU42987.1| probable methyltransferase protein [Fulvimarina pelagi HTCC2506] (298 aa)
Score = 320, Expect = 7.1e-28, Identities = 79/215 (36%), Positives = 118/215 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTL-KMIKEIFDNSKNICIARELTKMNETIYRSSIANINE---IKITEKGEFVILI 219
           L++VATPIG++ ++S  A+  +    I  CEDTR + KLL    I      ++  +G      +           L+SDAG P++SDPG+ L+   I+    V  I G S+++ +L VSG PS    F GFL   +  + D+L QL +   T+I +E+ HRI  +L  M++ + D    +C  RELTKM+ETIYR S+  + E      T KGE V+ I
  S:    26 LYLVATPIGHLDDLSLRALDIIAGADILACEDTRVTGKLLKRYGIERRMAAYHEHSGEKAGAALVETIRGGGSVALVSDAGTPLVSDPGYELVRAAIEAEVSVVAIPGASAVLTALAVSGLPSDAFFFAGFLPAKEKARADRLEQLLHIPSTLIFYEAPHRIAASLAAMLEALGDRPAAVC--RELTKMHETIYRGSLRELAEEFAALETVKGEIVVCI 242
>gi|196250750|ref|ZP_03149437.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Geobacillus sp. G11MC16] >gi|196209700|gb|EDY04472.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Geobacillus sp. G11MC16] (301 aa)
Score = 320, Expect = 7.2e-28, Identities = 75/230 (32%), Positives = 131/230 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEET 234
           L+IV TPIGN+++++  A+ TL    +   EDTR +KKLL+  +I     +++  N     + +  +  +     L+SDAG P +SDPG+ LI   +     V  + G ++ + +L+ SG P+   LF GFL   K  K++QL  LK  ++T++ +E+ HR+K+TL  + ++F   + + + RELTK  E   R  ++  I   + T+ +GEF I+++     +E  ++EET
  S:    17 LYIVPTPIGNLEDMTFRAVRTLREADVIAAEDTRQTKKLLSHFDIHTPLVSYHEHNKYASGRQLVEWLKEGKNVALVSDAGMPGISDPGYELIVAALAERCRVVPLPGANAALTALVASGLPTGRFLFVGFLERAKKEKREQLLSLKTAAETLVFYEAPHRLKETLAAMYDVF-GERRVALCRELTKRFEEFIRGDLSEAIAWAETTDIRGEFCIVVEGAQNGSEPEREEET 247
>gi|138893707|ref|YP_001124160.1| Corrin/porphyrin methyltransferase [Geobacillus thermodenitrificans NG80-2] >gi|134265220|gb|ABO65415.1| Corrin/porphyrin methyltransferase [Geobacillus thermodenitrificans NG80-2] (301 aa)
Score = 320, Expect = 7.2e-28, Identities = 75/230 (32%), Positives = 131/230 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEET 234
           L+IV TPIGN+++++  A+ TL    +   EDTR +KKLL+  +I     +++  N     + +  +  +     L+SDAG P +SDPG+ LI   +     V  + G ++ + +L+ SG P+   LF GFL   K  K++QL  LK  ++T++ +E+ HR+K+TL  + ++F   + + + RELTK  E   R  ++  I   + T+ +GEF I+++     +E  ++EET
  S:    17 LYIVPTPIGNLEDMTFRAVRTLREADVIAAEDTRQTKKLLSHFDIHTPLVSYHEHNKYASGRQLVEWLKEGKNVALVSDAGMPGISDPGYELIVAALAERCRVVPLPGANAALTALVASGLPTGRFLFVGFLERAKKEKREQLLSLKTAAETLVFYEAPHRLKETLAAMYDVF-GERRVALCRELTKRFEEFIRGDLSEAIAWAETTDIRGEFCIVVEGAQNGSEPEREEET 247
>gi|148988374|ref|ZP_01819821.1| hypothetical protein CGSSp6BS73_06090 [Streptococcus pneumoniae SP6-BS73] >gi|147926055|gb|EDK77129.1| hypothetical protein CGSSp6BS73_06090 [Streptococcus pneumoniae SP6-BS73] (298 aa)
Score = 320, Expect = 7.2e-28, Identities = 93/276 (33%), Positives = 154/276 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNE-SKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE---KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSL---YNFWQQRK 279
           KL++VATPIGN+ +++  AI TL        EDTRN+  LL   +IS +  +F+  N   +   +  F         +SDAG P +SDPG  L+   I+    V  + G S+ + +LI SG      +FYGFL   K+ +Q Q   LK +  +T I +ES HR+ DTL+ + E++ + +++ + RELTK+ E   R +I+ + E  I E   KGE +++++   +  E  +K+E D  V   E++  I++G K+  A K V+  Y    + L   Y+ W++++
  S:    24 KLYLVATPIGNLDDMTFRAIQTLKEVDWIAAEDTRNTGLLLKHFDISTKQISFHEHNAKEKIPDLIGFLKAGQSIAQVSDAGLPSISDPGHDLVKAAIEEEIAVVTVPGASAGISALIASGLAPQPHIFYGFLPR-KSGQQKQFFGLKKDYPETQIFYESPHRVADTLENMLEVYGD-RSVVLVRELTKIYEEYQRGTISELLE-SIAETPLKGECLLIVEGASQGVE--EKDEEDLFV---EIQTRIQQGVKKNQAIKEVAKIYQWNKSQLYAAYHDWEEKQ 298
>gi|116495707|ref|YP_807441.1| methyltransferase [Lactobacillus casei ATCC 334] >gi|191639195|ref|YP_001988361.1| Putative uncharacterized protein yeaE [Lactobacillus casei] >gi|116105857|gb|ABJ70999.1| Predicted methyltransferase [Lactobacillus casei ATCC 334] >gi|190713497|emb|CAQ67503.1| Putative uncharacterized protein yeaE [Lactobacillus casei BL23] (285 aa)
Score = 320, Expect = 7.5e-28, Identities = 85/273 (31%), Positives = 139/273 (50%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLN-ELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           L++V TPIGN+ +++  AI  L    +   EDTR+++ LLN   I  +  +F+  N       + +          +SDAG P +SDPG  L+   I     V  + G ++   +LI SG P    LFYGFL      K  +L +L +ES T++ +ES HR+  TL  ++  F + +   +ARELTK  ET  R S++ +      + KGEFVI+++       +  K   D +V L  ++E ++  G K   A K+V+ +  L    +Y+ + +
  S:    15 LYLVPTPIGNLGDMTIRAIEILKTVDLIAAEDTRHTQMLLNHFEIKTKTISFHEHNTQMRIPELLAKLANGETIAQVSDAGMPSISDPGKELVRAAIDAGVPVVPLPGANAATTALIASGLPPQPFLFYGFLPRKAGEKNRELEKLAHESATLLFYESPHRVGKTLAAMQTAFGD-RQAALARELTKKFETFIRGSLSALQTYAAGDLKGEFVIMVEG------AADKPAVDVTVPLKMQVEAIVATGAKPNAAIKLVAKQNGLAKQVVYDAYHE 282
>gi|167753410|ref|ZP_02425537.1| hypothetical protein ALIPUT_01684 [Alistipes putredinis DSM 17216] >gi|167658035|gb|EDS02165.1| hypothetical protein ALIPUT_01684 [Alistipes putredinis DSM 17216] (236 aa)
Score = 320, Expect = 8.0e-28, Identities = 76/232 (32%), Positives = 122/232 (52%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILIDNNVKETESIKKEETD 235
           KL+IV TPIGN+ +I+  A+  L+       EDTR S  LL  L I  +    +  N +     +     +     L+SDAG P +SDPGFLL+   ++   +V+ + G ++ + +L+ SGFP     F GFL   K  +   L  L +E +T+I +ES  R+  TL+   E+F   +   ++RELTK  E   R ++A + +   + T KGEFVI++    K  +++  E  +
  S:     3 KLYIVPTPIGNLDDITIRAVRVLSEVDFILAEDTRTSSVLLKHLGIEKKMYAHHKFNEHATVGLVADNIAQGRSAALISDAGTPGISDPGFLLVRACLEAGIEVETLPGATAFVPALVQSGFPCDRFCFEGFLPQKKG-RNKHLQSLASEPRTMIFYESPFRVVKTLEQFAEVFGPERMAAVSRELTKKFEQTVRGTLAEVADYFREHTPKGEFVIVVAGLPKPGKNMDTESEE 235
>gi|194684983|emb|CAR47200.1| putative tetrapyrrole methylase [Proteus mirabilis HI4320] (292 aa)
Score = 319, Expect = 8.2e-28, Identities = 86/268 (32%), Positives = 147/268 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKE---KVACKMVSYKYSLKSNSLY 272
           L+IV TPIGN+ +I++ A+  L++  +   EDTR++  LL    I   N   ++L+ +NE+Q  +    K  +     L+SDAG P+++DPG+ L+N   KN   V  + G  + + +L  +G PS    + GFL      +QD L  L  E +T+I +ES HR+ D+L  +  ++  ++ + +ARELTK  ETI    +      + E +   KGE V+++       E  +K + D+  +  E+ + +   +KE   K A  + +  Y +K N+LY
  S:    14 LYIVPTPIGNLGDITQRALDVLSHVDLIAAEDTRHTGLLLQHFAI---NARLFALHDHNEQQKADQLISKLQQGLSIALVSDAGTPLINDPGYHLVNQCRKNGIKVVPLPGACAAITALSAAGLPSDRFCYEGFLPAKTKSRQDCLRDLAQEPRTLIFYESTHRLLDSLADMVTVWGEARYVVLARELTKTWETIQGMPVGELLNWVREDENRRKGEMVLIV-------EGYQKPQEDH--FAPEVLRTLAILQKELPLKKAAAVTAEIYGVKKNALY 279
>gi|157826166|ref|YP_001493886.1| hypothetical protein A1C_05715 [Rickettsia akari str. Hartford] >gi|157800124|gb|ABV75378.1| hypothetical protein A1C_05715 [Rickettsia akari str. Hartford] (278 aa)
Score = 319, Expect = 8.3e-28, Identities = 85/225 (37%), Positives = 129/225 (57%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKE 225
           +   L+IV+TPIGN ++I+  AI+TL N+ I  CEDTR S+KLL   +I  + + +   +   +++ I S     N   L+SDAG P++SDPG+ L+      N  V ++ G S+L+ +L +S  P+   LF+GFL      KQ    +L N   T+I FE+  R+ +TL + K+I  N + IC+ARELTK+ + I    I  I E       KGE V+LI   ++E
  S:     3 LKSGLYIVSTPIGNFEDITLRAISTLKNSDIILCEDTRISQKLLAKHDIHTKLQIYNDHSDEKDRENIISLIKSGNIISLISDAGTPLISDPGYKLVKGLRSLNCHVDVVPGVSALITALTLSTLPTDRFLFHGFLPKTTESKQKIFYELVNLKATLIFFETAPRLINTLSVAKKILGN-REICVARELTKLYQEIKTGDIDEIIEFYQNNILKGEIVLLISGILQE 228
>gi|91228504|ref|ZP_01262426.1| hypothetical protein V12G01_00255 [Vibrio alginolyticus 12G01] >gi|91187938|gb|EAS74248.1| hypothetical protein V12G01_00255 [Vibrio alginolyticus 12G01] (287 aa)
Score = 319, Expect = 8.5e-28, Identities = 92/270 (34%), Positives = 151/270 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE-IKI---TEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKL--IRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ AI  L+   I   EDTR++ KLL+  NI  + KTF +L+ +NE+Q       K        L+SDAG P++SDPG+ L+    +    V  + G  +++ +L  SG PS    F GFL      ++D+  ++ +  +T I +ES HRI D+L+ + ++    + + +ARELTK  ETI    +  + E +K     ++GE V+L+  +        +E TD S+  + L  L  + K    K A  +V+  ++LK N+LY +
  S:    14 LYIVPTPIGNLADITQRAIEILSTVDIIAAEDTRHTGKLLSHFNI--QTKTF-ALHDHNEQQKAQVLVEKLLSGQSIALVSDAGTPLISDPGYHLVTKCRQAGVRVVPLPGACAVITALSASGLPSDRFSFEGFLPPKSKGRKDKFLEIASVERTCIFYESPHRILDSLQDMLDVLGPDREVVLARELTKTFETIQGMPLGELIEWVKSDDNQQRGEMVLLVHGH--------RETTDDSLPEDALRTLGILTKELPLKKAAALVAEIHNLKKNALYKW 281
>gi|149002485|ref|ZP_01827419.1| hypothetical protein CGSSp14BS69_12191 [Streptococcus pneumoniae SP14-BS69] >gi|147759422|gb|EDK66414.1| hypothetical protein CGSSp14BS69_12191 [Streptococcus pneumoniae SP14-BS69] (289 aa)
Score = 319, Expect = 8.8e-28, Identities = 88/276 (31%), Positives = 152/276 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE---KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSL---YNFWQQRK 279
           KL++VATPIGN+ +++  AI TL        EDTRN+  LL   +IS +  +F+  N   +   +  F         +SDAG P +SDPG  L+   I+    V  + G S+ + +LI SG      +FYGFL      ++      K+  +T I +ES HR+ DTL+ + E++ + +++ + RELTK+ E   R +I+ + E  I+E   KGE +++++   ++ E  +K+E D  +   E++  I++G K+  A K V+  Y    + L   Y+ W++++
  S:    15 KLYLVATPIGNLDDMTFRAIQTLKEVDWIAAEDTRNTGLLLKHFDISTKQISFHEHNAKEKIPDLIGFLKAGQSIAQVSDAGLPSISDPGHDLVKAAIEEEIAVVTVPGASAGISALIASGLAPQPHIFYGFLPRKSGQQKQFFGSKKDYPETQIFYESPHRVADTLENMLEVYGD-RSVILVRELTKIYEEYQRGTISELLE-SISETSLKGECLLIVEGASQDVE--EKDEEDLFL---EIQARIQQGMKKNQAIKEVAKIYQWNKSQLYAAYHDWEEKQ 289
>gi|29347683|ref|NP_811186.1| methyltransferase [Bacteroides thetaiotaomicron VPI-5482] >gi|29339584|gb|AAO77380.1| methyltransferase [Bacteroides thetaiotaomicron VPI-5482] (224 aa)
Score = 319, Expect = 9.1e-28, Identities = 71/216 (32%), Positives = 119/216 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILI 219
           KL++V TP+GN+++++  AI  L    +   EDTR S  LL    I    ++ +  N +   + + +         L+SDAG P +SDPGFL++   ++N  +VQ + G ++ + +L+ SG P+    F GFL   K  +Q +L  L  E +T++ +ES HR+  TL    E F   +   ++RE++K++E   R S+A  I     TE +GE VI++
  S:     3 KLYVVPTPVGNLEDMTFRAIRVLKEVDLILAEDTRTSGILLKHFEIKNAMQSHHKFNEHKTVESVVNRIKAGETVALISDAGTPGISDPGFLVVRECVRNGIEVQCLPGATAFVPALVASGLPNEKFCFEGFLPQKKG-RQTRLKALAEEHRTMVFYESPHRLLKTLTQFAEYFGTERQATVSREISKLHEETVRGSLAELIEHFTATEPRGEIVIVL 219
>gi|118586630|ref|ZP_01544070.1| methyltransferase [Oenococcus oeni ATCC BAA-1163] >gi|118432945|gb|EAV39671.1| methyltransferase [Oenococcus oeni ATCC BAA-1163] (287 aa)
Score = 319, Expect = 9.9e-28, Identities = 95/277 (34%), Positives = 147/277 (53%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRKN 280
           KL++V TPIGN+ +++  A++TL    +   EDTR+S  LL    I    K   SL+ +N  Q +     K  +      +SDAG P +SDPG  L+   I+N  DV  + GPS+ + +LI SG P+    F GFL+   + ++ QL +L     T+I +ES  R+  TL+ ++ IF     + +ARELTK  E+ YR  I   +N IK    +GEFV+LI    K  E+I   +    + ++ +++ I  G K   A K V+    L    +Y  + + KN
  S:    13 KLYLVPTPIGNLDDMTIRAVSTLKEVDLIAAEDTRHSGILLQHFQI---KKDLISLHEHNYAQRVPELVDKLKKGLNIAQISDAGMPSISDPGHELVLAAIQNGVDVISLPGPSAGITALIASGLPADKFTFIGFLSKKDSEQKKQLEELMPLDSTLIFYESPFRVGKTLENVRAIFGEKTKVVLARELTKKFESYYRGDITQALNFIKSNRPRGEFVLLIK---KIHEAIVPSD---ELIVDLIDERIASGTKPIDAIKAVAKLLGLIRADVYKIYHKEKN 285
>gi|171853631|emb|CAM11502.1| Putative methyltransferase [Candidatus Phytoplasma australiense] (289 aa)
Score = 319, Expect = 1.0e-27, Identities = 90/276 (32%), Positives = 150/276 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKL---IRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRKN 280
           L++VATPIGN+++I+  A+  L    +   EDTRNSKKLL    I  +  ++Y  N  N    I     +  +  L+SDAG P++SDPGFLL+N   K  +++  I G S+ + + + +   +   +F GFL       + +L + +N  +T+II+ES +RIK TL +I +++ N + I +ARELTK  ETI   ++ ++ +  +  KGE+V+LI+   K T  +         +LN  E +   ++ G  +K A   V+ +       +Y  +   KN
  S:    15 LYLVATPIGNLEDITFRAVRVLKEVFLILAEDTRNSKKLLEHYQIKKKIISYYQHNQKNRLPQILELLSQGKDLALISDAGTPLISDPGFLLVNEIEKKGFNIVAIPGASAFLTAFVTANLKTP-FIFLGFLPRLGQALKKELLKYQNNHETLIIYESPYRIKKTLLLIHQLYGN-RRISLARELTKKFETIINGNLEDVLKEDLVYKGEYVLLIEGKQKTTPQL--------TFLNISEHIAFYLKLGFSQKEALMQVAQERQESKKEIYRKYNHIKN 283
>gi|167038524|ref|YP_001666102.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167038734|ref|YP_001661719.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Thermoanaerobacter sp. X514] >gi|166852974|gb|ABY91383.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Thermoanaerobacter sp. X514] >gi|166857358|gb|ABY95766.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Thermoanaerobacter pseudethanolicus ATCC 33223] (273 aa)
Score = 319, Expect = 1.0e-27, Identities = 83/270 (30%), Positives = 147/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI-NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L++  TPIGN+++I+   + TL    I   EDTR + KLLN  +I     +++  N   +   +     K     L++DAG P +SDPG  L+ L I+    V  + GP++ + +L+ SG  +S+ +F GFL      ++++LN++  E +TII++E+ HR+K+TL+ +K  +   + I IARELTK++E   R +I  +  ++    KGE V++I+   K+    K E          ++K + +G  +K A K V+ +  +  + +Y  
  S:     7 LYLCPTPIGNLEDITLRVLKTLKEVDIIAAEDTRQTLKLLNHFDIKKPLTSYHEHNKRTKGAKLIEELKKGKSIALVTDAGTPAISDPGEDLVKLCIEEGIKVVPLPGPTAAITALVASGLDTSSFVFEGFLPTKNKEREERLNRISKEERTIILYEAPHRLKETLRELKS-YVAERKIVIARELTKIHEEFIRGTIDEVLTKLGDEIKGEIVLIIEGAQKQQVEEKPEIL--------IQKYLEEGMDKKEAIKRVAKELGIPKSQVYKL 268
>gi|196235385|ref|ZP_03134188.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Thermus aquaticus Y51MC23] >gi|196220647|gb|EDY15263.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Thermus aquaticus Y51MC23] (262 aa)
Score = 319, Expect = 1.0e-27, Identities = 66/216 (30%), Positives = 120/216 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILI 219
           +L +V TPIGN+++I+  A+ TL    +  CEDTR +  LL    I            +  K+ +  + +        +DAG P +SDPG  L+ L ++  W V+ + GP++L+ +L+ SG P+    F GFL      ++++L  L  E +T +++ES HR++ TL+ + E++  +  + +ARE++K++E ++R S+          KGEFV+++
  S:     2 RLVLVPTPIGNLEDITLRALRTLKEAEVVACEDTRRTGLLLRHYGIPTPTLRLDQHTLDRAKELLAPYAY----VAYATDAGTPGISDPGAELVRLALEWGWRVEALPGPTALIPALVASGLPTHRFTFEGFLPKAGRERKERLQALAREGRTAVLYESPHRLRKTLEDLMEVYGEAHPVAVAREISKVHEEVFRGSLKEAWARFAEPKGEFVLVL 213
>gi|15604581|ref|NP_221099.1| hypothetical protein RP747 [Rickettsia prowazekii str. Madrid E] >gi|6226391|sp|Q9ZCJ3|Y747_RICPR UPF0011 protein RP747 >gi|3861276|emb|CAA15175.1| unknown [Rickettsia prowazekii] (280 aa)
Score = 319, Expect = 1.0e-27, Identities = 84/224 (37%), Positives = 129/224 (57%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVK 224
           +   L+IV+TPIGN ++I+  AI+TL N+ I  CEDTR S+KLL    I  + + +   +   ++++I S     N   L+SDAG P++SDPG+ L+      N+ ++++ G SS + +L +S  P+   LF GFL      K+    +L N   T+I F++  R+ +TL + KEIF N + IC+ARELTK+ +      I  I E       KGE V+LI  NV+
  S:     3 LKSGLYIVSTPIGNFEDITLRAISTLKNSDIILCEDTRISQKLLAKHYIHTKLQIYNDHSDYKDREYIISLIKAGNVVSLISDAGTPLISDPGYKLVRDLRNLNYYIEVVPGVSSPITALTLSSLPTDRFLFSGFLPKTIESKKKIFAELVNLKATLIFFDTASRLINTLLLAKEIFGN-REICVARELTKIYQETKTGDIDEIIEFYKNNILKGEIVLLISGNVQ 227
>gi|28897224|ref|NP_796829.1| hypothetical protein VP0450 [Vibrio parahaemolyticus RIMD 2210633] >gi|153839037|ref|ZP_01991704.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810] >gi|28805433|dbj|BAC58713.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD 2210633] >gi|149747465|gb|EDM58413.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810] (287 aa)
Score = 319, Expect = 1.0e-27, Identities = 88/270 (32%), Positives = 152/270 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE-IKI---TEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ AI  L+N  I   EDTR++ KLL+  NI  + KTF +L+ +NE+Q       K        L+SDAG P++SDPG+ L+    +    V  + G  +++ +L  SG PS    F GFL      ++D+  ++ +  +T I +ES HRI D+L+ + ++    + + +ARELTK  ETI    +  + E +K     ++GE V+L+  + + ++    +E   ++ +   E  ++K      A  +V+  ++LK N+LY +
  S:    14 LYIVPTPIGNLADITQRAIEVLSNVDIIAAEDTRHTGKLLSHFNI--QTKTF-ALHDHNEQQKAQVLVEKLLSGQSIALVSDAGTPLISDPGYHLVTKCRQAGVRVVPLPGACAVITALSASGLPSDRFSFEGFLPPKSKGRKDKFLEIASVERTCIFYESPHRILDSLQDMLDVLGPEREVVLARELTKTFETIQGMPLGELIEWVKSDDNQQRGEMVLLLHGHRETSDEALPDEALRTLGILTKELPLKK------AAALVAEIHNLKKNALYKW 281
>gi|157690818|ref|YP_001485280.1| methyltransferase [Bacillus pumilus SAFR-032] >gi|157679576|gb|ABV60720.1| methyltransferase [Bacillus pumilus SAFR-032] (292 aa)
Score = 319, Expect = 1.0e-27, Identities = 87/272 (31%), Positives = 150/272 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI------NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKL---IRKGEKEKVACKMVSYKYSLKSNSLYNFWQ 276
           L++V TPIGN+++++  AI TL +      EDTR +KKL ++  I     +++  N ++    +  +  +     L+SDAG P +SDPG  ++  F      V  + G ++ + +LI SG       FYGFL+  K  K+ QL  LK   +TII +E+ HR+K+TL ++KE++ N +NI I RELTK  E   R  + ++      N+I    +GEF +++  N ++ E + +E   +   L+E E +   I +G   K A K  + +  +   ++Y+ + 
  S:    16 LYLVPTPIGNLEDMTFRAIQTLKDVDYIAAEDTRQTKKLCHVYEIDTPLTSYHEHNKDSSGHKLIEWLKEGKNIALVSDAGLPTISDPGAEVVRDFTNIGGYVVPLPGANAALTALIASGITPQPFFFYGFLDRQKKEKKKQLEALKKRQETIIFYEAPHRLKETLTLMKEVWGN-RNIAITRELTKKFEEFIRGDLESVLTWATENQI----RGEFCLVVQGNDQDEEELNEEV--WWKSLSEKEHVIHYIEEGLTSKEAIKRTAVERGVPKRTIYDAYH 289
>gi|153808656|ref|ZP_01961324.1| hypothetical protein BACCAC_02955 [Bacteroides caccae ATCC 43185] >gi|149128482|gb|EDM19700.1| hypothetical protein BACCAC_02955 [Bacteroides caccae ATCC 43185] (224 aa)
Score = 318, Expect = 1.1e-27, Identities = 70/216 (32%), Positives = 120/216 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILI 219
           KL++V TP+GN+++++  AI  L    +   EDTR S  LL    I    ++ +  N +   + + +         L+SDAG P +SDPGFL++   ++N  +V+ + G ++ + +L+ SG P+    F GFL   K  +Q +L  L  E +T++ +ES HR+  TL    E F   + + ++RE++K++E   R S+A  I     TE +GE VI++
  S:     3 KLYVVPTPVGNLEDMTFRAIKVLKEVDLILAEDTRTSGILLKHFEIKNAMQSHHKFNEHKTVESVVNRIKAGETVALISDAGTPGISDPGFLVVRECVRNGIEVECLPGATAFVPALVASGLPNEKFCFEGFLPQKKG-RQTRLKALAEEHRTMVFYESPHRLLKTLTQFAEYFGAERQVTVSREISKLHEETVRGSLAELIEHFTATEPRGEIVIVL 219
>gi|194476548|ref|YP_002048727.1| hypothetical protein PCC_0060 [Paulinella chromatophora] >gi|171191555|gb|ACB42517.1| hypothetical protein PCC_0060 [Paulinella chromatophora] (283 aa)
Score = 318, Expect = 1.1e-27, Identities = 82/268 (30%), Positives = 142/268 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNE-TIYRSSIANINEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++V TPIGN+ ++S  +   L N     CEDTR S ++L  L I     +F+  N  +    +           ++SDAG P +SDPG  L+   +K   +V  I GP +L+ +L++SG P+    F GFL   +N ++ +L +L N+ +T+II+ES HR+ D L+ ++ I  N + + +ARELTK +E  I  + +  +   +I + +GE  ++I     E++ +     +  V +  L++LI  G     A +++S    +    LY
  S:    11 LYLVGTPIGNLGDLSPRSRQVLQNVDRIACEDTRRSGQMLAQLGIKARLLSFHQRNETSRIPQLLEIITNGESLAVISDAGLPGISDPGEELVAAALKTGHEVICIPGPCALITALVISGLPTRRFCFEGFLPVKQNQRRKRLQELANDPRTLIIYESPHRLVDLLEELESILGN-RPLQVARELTKHHEQQIGPNVVTALAHFRINKPQGECTVVI-GGASESKYLGLYPWNQVVLIETLKELIETGSSPSEAARILSKNTGMPRRQLY 278
>gi|157377382|ref|YP_001475982.1| uroporphyrin-III C/tetrapyrrole (corrin/porphyrin) methyltransferase [Shewanella sediminis HAW-EB3] >gi|157319756|gb|ABV38854.1| uroporphyrin-III C/tetrapyrrole (corrin/porphyrin) methyltransferase [Shewanella sediminis HAW-EB3] (280 aa)
Score = 318, Expect = 1.2e-27, Identities = 87/270 (32%), Positives = 138/270 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI-NEIKI---TEKGEFVILIDN-NVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +IS  AI  L N  +  CEDTR+S  LL+   I       +  N  +   +I           L+SDAG P++SDPG+ L++      + V  + G  + + +L  SG PS    F GFL   +  + D+L +LK + +T+I +ES HRI  +L+ I       + I +ARE+TK  ET    ++  +  ++K     +KGE V++     + E E I       +V +N L KL+ +    K A  +    + +K N+LY +
  S:     7 LYIVPTPIGNLGDISSRAIDVLNNVKLIACEDTRHSGILLSHFGIETRKTALHDHNERDRADWIIQKLSNGEAVALISDAGTPLISDPGYHLVSAVRNAGYKVIPLPGACAAITALSASGLPSDRFTFEGFLPSKEKGRIDKLTELKEDPRTLIFYESPHRIVHSLESILTALGEDRVIVMAREVTKTFETFLCGTVKEVLEQVKADPNQQKGEIVLMCHGYRLAEDEGIP------TVVINTL-KLLCEELPLKKASALAGQIHGMKKNALYKY 274
>gi|160885075|ref|ZP_02066078.1| hypothetical protein BACOVA_03073 [Bacteroides ovatus ATCC 8483] >gi|156109425|gb|EDO11170.1| hypothetical protein BACOVA_03073 [Bacteroides ovatus ATCC 8483] (224 aa)
Score = 318, Expect = 1.2e-27, Identities = 71/216 (32%), Positives = 119/216 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILI 219
           KL++V TP+GN+++++  AI  L    +   EDTR S  LL    I    ++ +  N +   + + +         L+SDAG P +SDPGFL++   ++N  +VQ + G ++ + +L+ SG P+    F GFL   K  +Q +L  L  E +T++ +ES HR+  TL    E F   +   ++RE++K++E   R S+A  I     TE +GE VI++
  S:     3 KLYVVPTPVGNLEDMTFRAIKVLKEVDLILAEDTRTSGILLKHFEIKNAMQSHHKFNEHKTVESVVNRIKAGETVALISDAGTPGISDPGFLVVRECVRNGIEVQCLPGATAFVPALVASGLPNEKFCFEGFLPQKKG-RQTRLKTLAEEHRTMVFYESPHRLLKTLTQFAEYFGAERQATVSREISKLHEETVRGSLAELIEHFTATEPRGEIVIVL 219
>gi|160893393|ref|ZP_02074179.1| hypothetical protein CLOL250_00943 [Clostridium sp. L2-50] >gi|156864968|gb|EDO58399.1| hypothetical protein CLOL250_00943 [Clostridium sp. L2-50] (279 aa)
Score = 318, Expect = 1.2e-27, Identities = 83/269 (30%), Positives = 147/269 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDN--SKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRK-GEKEKVACKMVSYKYSLKSNSLYN 273
           L++VATPIGN+++++  A+ TL+   +   EDTRNS KLLN   I     +++  N  ++ + +           +++DAG P +SDPG  L+   +     V  + G  + + +LI SG P+    F  FL  +K  K + L +LK+E++T++I+E+ HR++ TL    E+FD    + I + RELTK +ETI +  ++  IN  +  E +GE+V++I+         ++++   S+ + E   +  K G  +K A K  +    +    +YN
  S:     5 LYLVATPIGNLEDMTFRAVRTLSEVDLIAAEDTRNSIKLLNHFEIKTPMTSYHEFNKYDKAKVLVDKLLTGTNIAVITDAGTPGISDPGEELVRQALAAGVTVTAVPGACACITALISSGLPTRRFAFEAFLPQDKKEKAEVLAELKDETRTMVIYEAPHRLQKTL---AELFDTLGDRKITLCRELTKRHETIEQFVLSEAINYYEEHEPRGEYVMVIEGMDVAAAKAERQQEFLSMTIEEHVAMYEKQGMTKKDAIKQAAADRGVPKREVYN 275
>gi|15900818|ref|NP_345422.1| tetrapyrrole methylase family protein [Streptococcus pneumoniae TIGR4] >gi|15902882|ref|NP_358432.1| hypothetical protein spr0838 [Streptococcus pneumoniae R6] >gi|111658123|ref|ZP_01408821.1| hypothetical protein SpneT_02000689 [Streptococcus pneumoniae TIGR4] >gi|116515519|ref|YP_816311.1| hypothetical protein SPD_0828 [Streptococcus pneumoniae D39] >gi|149010420|ref|ZP_01831791.1| hypothetical protein CGSSp19BS75_03677 [Streptococcus pneumoniae SP19-BS75] >gi|168485887|ref|ZP_02710395.1| conserved hypothetical protein [Streptococcus pneumoniae CDC1087-00] >gi|182683882|ref|YP_001835629.1| tetrapyrrole methylase family protein [Streptococcus pneumoniae CGSP14] >gi|14972413|gb|AAK75062.1| tetrapyrrole methylase family protein [Streptococcus pneumoniae TIGR4] >gi|15458440|gb|AAK99642.1| Conserved hypothetical protein [Streptococcus pneumoniae R6] >gi|116076095|gb|ABJ53815.1| conserved hypothetical protein TIGR00096 [Streptococcus pneumoniae D39] >gi|147764901|gb|EDK71830.1| hypothetical protein CGSSp19BS75_03677 [Streptococcus pneumoniae SP19-BS75] >gi|182629216|gb|ACB90164.1| tetrapyrrole methylase family protein [Streptococcus pneumoniae CGSP14] >gi|183571008|gb|EDT91536.1| conserved hypothetical protein [Streptococcus pneumoniae CDC1087-00] (289 aa)
Score = 318, Expect = 1.2e-27, Identities = 93/276 (33%), Positives = 154/276 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNE-SKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE---KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSL---YNFWQQRK 279
           KL++VATPIGN+ +++  AI TL        EDTRN+  LL   +IS +  +F+  N   +   +  F         +SDAG P +SDPG  L+   I+    V  + G S+ + +LI SG      +FYGFL   K+ +Q Q   LK +  +T I +ES HR+ DTL+ + E++ + +++ + RELTK+ E   R +I+ + E  I E   KGE +++++   +  E  +K+E D  V   E++  I++G K+  A K V+  Y    + L   Y+ W++++
  S:    15 KLYLVATPIGNLDDMTFRAIQTLKEVDWIAAEDTRNTGLLLKHFDISTKQISFHEHNAKEKIPDLIGFLKAGQSIAQVSDAGLPSISDPGHDLVKAAIEEEIAVVTVPGASAGISALIASGLAPQPHIFYGFLPR-KSGQQKQFFGLKKDYPETQIFYESPHRVADTLENMLEVYGD-RSVVLVRELTKIYEEYQRGTISELLE-SIAETPLKGECLLIVEGASQGVE--EKDEEDLFV---EIQTRIQQGVKKNQAIKEVAKIYQWNKSQLYAAYHDWEEKQ 289
>gi|151572927|gb|EDN38581.1| tetrapyrrole methyltransferase family protein [Francisella tularensis subsp. novicida GA99-3548] (290 aa)
Score = 318, Expect = 1.3e-27, Identities = 92/268 (34%), Positives = 152/268 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENK--TFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++VATPIGN+++I+  A+  L+N  I   EDTR + KLL  LNI    K  + +  N  +  Q++           L+SDAG P++SDPG+ ++    K N+ V  I G S+++ +L  +G PS + +F GFL+   N +Q Q+ + +  + T+I++ESVHRI   L+ + E+  NS NI +A+ELTK  E     S+  + +     + T +GEFV++ID N   ++S   +  +  + ++EL K +        A K+V+     K N +Y
  S:     9 LYVVATPIGNLEDITYRALNVLSNVDIILAEDTRVTIKLLASLNIRNNQKLVSCHDFNEESRVQYVKELLDAAKSIALVSDAGTPLISDPGYKIVASLRKENYKVVPIPGVSAVITALSAAGLPSDSFIFKGFLSAKHNRRQQQIREFQQINTTVILYESVHRINYLLEDLLELLPNS-NIVVAKELTKQFENFVFGSVQQVYDYFQANQDTLRGEFVVIIDCN---SDSDVSDSNNLKIDVDELLKGLLDEVPLNKAVKLVTKITGAKKNFVY 278
>gi|119356390|ref|YP_911034.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Chlorobium phaeobacteroides DSM 266] >gi|119353739|gb|ABL64610.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Chlorobium phaeobacteroides DSM 266] (244 aa)
Score = 318, Expect = 1.3e-27, Identities = 82/232 (35%), Positives = 134/232 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQF---INSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKI---TEKGEFVILIDNNVKETESIKKEETDY 236
           L++VATP+GN+++I+  A+ TL N     CEDTR +  LL   +I    K   S +  NE +    I     +  + CL +DAG PI+SDPG+ LI+   +  + V  I GPS+L  +L V   P +N  F GFL H K  ++ +L  L + +  ++ +ES HRI   L   KE F +S+ + IARE+TK++E  YR+   +    ++   T +GEFV++++   K+ +  +++  D+
  S:    11 LYVVATPLGNLEDITLRAVKTLQNAGAIACEDTRRASILLKHFDII--GKKLISYHNYNEARAVLQITRLLEEGVDVCLTTDAGTPIISDPGYSLIHALREKGFPVIPIPGPSALTAALSVCPLPVNNFFFAGFLPHKKG-RKSRLAFLSSLNTPVVFYESPHRIIKLLDEFKEAFPDSE-LFIAREMTKIHEE-YRTGTLDALRERLEHETIRGEFVVVVNPACKKNKKTEQDNADH 243
>gi|83855907|ref|ZP_00949436.1| methyltransferase [Croceibacter atlanticus HTCC2559] >gi|83849707|gb|EAP87575.1| methyltransferase [Croceibacter atlanticus HTCC2559] (222 aa)
Score = 318, Expect = 1.3e-27, Identities = 79/216 (36%), Positives = 125/216 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSF--DFKDNEYC-LLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILI 219
           KLF+V TPIGN+++++  AI TL +      EDTR S KLL    +S      +S + +NE + +       +  E C L+SDAG P +SDPGFLL    I+ N DV+ + G ++ + +L+ SG P+   +F GFL   K  +Q +L  L  E++T++ +ES H++  TL    E F   + + ++REL+K+ E   R +   +  +K  E    KGE VI++
  S:     3 KLFLVPTPIGNLEDMTFRAIQTLKDVDFILAEDTRTSGKLLKHFEVS---TPMHSHHMHNEHKSVVGVVKRIQSGETCALISDAGTPAISDPGFLLTRACIEANLDVECLPGATAFVPALVNSGLPNDKFVFEGFLPVKKG-RQTRLKLLAEETRTMVFYESPHKLVKTLGNFAEYFGADRPVSVSRELSKLYEETIRGTATEV--LKHFEEKAPKGEIVIVV 219
>gi|194397823|ref|YP_002037575.1| conserved hypothetical protein [Streptococcus pneumoniae G54] >gi|194357490|gb|ACF55938.1| conserved hypothetical protein [Streptococcus pneumoniae G54] (289 aa)
Score = 318, Expect = 1.3e-27, Identities = 88/276 (31%), Positives = 152/276 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE---KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSL---YNFWQQRK 279
           KL+ VATPIGN+ +++  AI TL        EDTRN+  LL   +IS +  +F+  N   +   +  F         +SDAG P +SDPG  L+   I+    V  + G S+ + +LI SG      +FYGFL      ++   +  K+  +T I +ES HR+ DTL+ + E++ + +++ + RELTK+ E   R +I+ + E  I+E   KGE +++++   ++ E  +K+E D  +   E++  I++G K+  A K V+  Y    + L   Y+ W++++
  S:    15 KLYXVATPIGNLDDMTFRAIQTLKEVDWIAAEDTRNTGLLLKHFDISTKQISFHEHNAKEKIPDLIGFLKAGQSIAQVSDAGLPSISDPGHDLVKAAIEEEIAVVTVPGASAGISALIASGLAPQPHIFYGFLPRKSGQQKQFFDSKKDYPETQIFYESPHRVADTLENMLEVYGD-RSVVLVRELTKIYEEYQRGTISELLE-SISETSLKGECLLIVEGASQDVE--EKDEEDLFL---EIQARIQQGMKKNQAIKEVAKIYQWNKSQLYAAYHDWEEKQ 289
>gi|168494366|ref|ZP_02718509.1| conserved hypothetical protein [Streptococcus pneumoniae CDC3059-06] >gi|183575682|gb|EDT96210.1| conserved hypothetical protein [Streptococcus pneumoniae CDC3059-06] (289 aa)
Score = 318, Expect = 1.3e-27, Identities = 85/276 (30%), Positives = 152/276 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSL---YNFWQQRK 279
           KL++VATPIGN+ +++  AI TL        EDTRN+  LL   +IS +  +F+  N   +   +  F         +SDAG P +SDPG  L+   I+    V  + G S+ + +LI SG      +FYGFL      ++   +  K+  +T I +ES HR+ DTL+ + E++ + +++ + RELTK+ E   R +I+ + E   + + KGE +++++   ++ E    E+ +  ++L E++  I++G K+  A K V+  Y    + L   Y+ W++++
  S:    15 KLYLVATPIGNLDDMTFRAIQTLKEVDWIAAEDTRNTGLLLKHFDISTKQISFHEHNAKEKIPDLIGFLKAGQSIAQVSDAGLPSISDPGHDLVKAAIEEEIAVVTVPGASAGISALIASGLAPQPHIFYGFLPRKSGQQKQFFDSKKDYPETQIFYESPHRVADTLENMLEVYGD-RSVVLVRELTKIYEEYQRGTISELLESIAETSLKGECLLIVEGASQDVE----EKGEEDLFL-EIQARIQQGMKKNQAIKEVAKIYQWNKSQLYAAYHDWEEKQ 289
>gi|115314111|ref|YP_762834.1| tetrapyrrole methyltransferase [Francisella tularensis subsp. holarctica OSU18] >gi|167010130|ref|ZP_02275061.1| tetrapyrrole methyltransferase [Francisella tularensis subsp. holarctica FSC200] >gi|115129010|gb|ABI82197.1| tetrapyrrole methyltransferase [Francisella tularensis subsp. holarctica OSU18] (290 aa)
Score = 318, Expect = 1.3e-27, Identities = 93/268 (34%), Positives = 152/268 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENK--TFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++VATPIGN+++I+  A+  L+N  I   EDTR + KLL  LNI    K  + +  N  +  Q++           L+SDAG P++SDPG+ ++    K N+ V  I G S+++ +L  +G PS + +F GFL+   N +Q Q+ + +  + T+I++ESVHRI   L+ + E+  NS NI +A+ELTK  E     S+  + +     + T +GEFV++ID N   ++S   +  +  + +NEL K +        A K+V+     K N +Y
  S:     9 LYVVATPIGNLEDITYRALNVLSNVDIILAEDTRVTAKLLASLNIRNNQKLVSCHDFNEESRVQYVKELLDAAKSIALVSDAGTPLISDPGYKIVANLRKENYKVVPIPGVSAVITALSAAGLPSDSFIFKGFLSAKHNKRQQQIREFQQINTTVILYESVHRINYLLEDLLELLPNS-NIVVAKELTKQFENFVFGSVQQVYDYFQANQDTLRGEFVVIIDCN---SDSEVNDSNNLKIDVNELLKDLLDEMPLNKAVKLVTKITGAKKNFVY 278
>gi|154482641|ref|ZP_02025089.1| hypothetical protein EUBVEN_00308 [Eubacterium ventriosum ATCC 27560] >gi|149736541|gb|EDM52427.1| hypothetical protein EUBVEN_00308 [Eubacterium ventriosum ATCC 27560] (279 aa)
Score = 318, Expect = 1.3e-27, Identities = 87/273 (31%), Positives = 150/273 (54%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEK---GEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLYN 273
           M  KL++ ATPIGN+++I+   + TL    +   EDTRNS KLLN  +I     +++  N  ++ + +     +     +++DAG P +SDPG  ++    +    V  + GP++ + +L +SG  +    F  FL  +K  K   L +LKNE++TIII+E+ HR+  TLK ++E   N + + + RELTK  E   +++I    E K  EK   GE+V++I+   +E    + ++   S+ + E +E  I +G  +K A K+V+    +    +YN
  S:     1 MAGKLYLCATPIGNLEDITYRVVRTLNEVDLIGAEDTRNSIKLLNHFDIKTPMTSYHEFNKYDKAKQLVEMMKEGKNIAIITDAGTPGISDPGEEVVRQCFEAGIQVTSLPGPAACITALTMSGQKTRRFCFEAFLPKDKKEKVAVLEELKNETRTIIIYEAPHRLARTLKELRETLGN-RQLTLCRELTKKYEEADKTTIDQAIE-KYNEKEPRGEYVLVIEGKSQEEIQEENKQKWESMTIEEHMEYYISQGNDKKSAMKLVAKDRGVSKRDIYN 275
>gi|114561578|ref|YP_749091.1| hypothetical protein Sfri_0390 [Shewanella frigidimarina NCIMB 400] >gi|114332871|gb|ABI70253.1| Protein of unknown function UPF0011 [Shewanella frigidimarina NCIMB 400] (280 aa)
Score = 318, Expect = 1.3e-27, Identities = 87/270 (32%), Positives = 136/270 (50%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN  +IS  AI  L    +  CEDTR+S +LL+   I       +  N  +  Q+I     +     L+SDAG P++SDPG+ L+N   +    V  + G  + + +L  SG PS    F GFL   +  + D+L  LK + +T+I +ES HRI  +L  I ++    + + +ARE+TK  ET    + A +  +       +KGE VI+         ++  EE   +V +  L KL+ +    K A  +    + LK N+LY +
  S:     7 LYIVPTPIGNFGDISARAIEVLQQVDLIACEDTRHSGRLLSHFGIETRKTALHDHNERDRAQWIVEQLNEGKSIALISDAGTPLISDPGYHLVNHVRQAGHRVVPLPGACAAITALSASGLPSDRFSFEGFLPSKEKARIDKLEFLKEDPRTLIFYESPHRILYSLAAIVDVLGADRQVVMAREVTKTFETFLSGTAAEVLALVEADDNQQKGEMVIMCHGF-----TLSDEEGIPAVAVATL-KLLCEELPLKKAAAIAGQIHGLKKNALYKY 274
>gi|188996816|ref|YP_001931067.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931883|gb|ACD66513.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Sulfurihydrogenibium sp. YO3AOP1] (278 aa)
Score = 317, Expect = 1.4e-27, Identities = 98/276 (35%), Positives = 154/276 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSF--DFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSS---IANINEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRKN 280
           L++VATPIGN+K+IS  A+ TL       CEDTR +KKLLN   I  E+K   S + +NE++         +  +  L+SDAG P +SDPG+ ++    +NN  V  I GP +   +L  SG PS   LF GFL   ++ K+  L +      T+I++ES +R+ DT+ +IK++ D   NI +A+ELTK++E     +   I +  E  + + KGEFVIL+  + K+  +I ++E    V      +L  +  K K   K+++ +Y+L  N  Y    +  N
  S:     4 LYVVATPIGNLKDISFRALDTLKKVKYIACEDTRQTKKLLNFYGI--EDKHLISYHEHNEEEASEKILKILEKEDIALVSDAGTPCISDPGYRVVKKARENNIKVVPIPGPFAGAVALSASGLPSDKFLFLGFLPQKRSHKEKVLKKYIELDTTLILYESPNRVIDTVNLIKDL-DEKANIVVAKELTKIHEEFIIGNPFEILDFFEKNLDKIKGEFVILVHPSEKKA-TIDEDEIKRRVI-----ELKNQNLKSKEIAKIIADEYNLPKNQAYKMTLESGN 276
>gi|90413029|ref|ZP_01221027.1| putative methyltransferase [Photobacterium profundum 3TCK] >gi|90326044|gb|EAS42483.1| putative methyltransferase [Photobacterium profundum 3TCK] (279 aa)
Score = 317, Expect = 1.4e-27, Identities = 77/228 (33%), Positives = 130/228 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKE 232
           L+IV TPIGN+ +I+  A+  L N  +   EDTR++ +LL+  +IS   +TF +L+ +NE+Q  +    K        L+SDAG P++SDPG+ L+N   +    V  + GP +++ +L  +G PS    F GFL      ++D    L ++ +T+I +ES HRI D+L  +  +    + + +ARELTK  ETI+ + +      ++E     +GE V+L+  + K  + +  E
  S:     7 LYIVPTPIGNLADITHRALDVLANVDLIAAEDTRHTSRLLSHFSIS--TRTF-ALHDHNEQQKADYLIEKLQAGTSIALVSDAGTPLISDPGYHLVNRCRQAGVKVVPLPGPCAVITALSGAGLPSDRFSFEGFLPPKSKGRRDTFQSLADDERTLIFYESPHRITDSLADMLAVLGPERQVVLARELTKTYETIHGAPLGELIDWLSEDSNRVRGEMVVLVAGHRKAKDDLPSE 238
>gi|54310314|ref|YP_131334.1| putative methyltransferase [Photobacterium profundum SS9] >gi|46914755|emb|CAG21532.1| putative methyltransferase [Photobacterium profundum SS9] (286 aa)
Score = 317, Expect = 1.4e-27, Identities = 77/228 (33%), Positives = 130/228 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKE 232
           L+IV TPIGN+ +I+  A+  L N  +   EDTR++ +LL+  +IS   +TF +L+ +NE+Q  +    K        L+SDAG P++SDPG+ L+N   +    V  + GP +++ +L  +G PS    F GFL      ++D    L ++ +T+I +ES HRI D+L  +  +    + + +ARELTK  ETI+ + +      ++E     +GE V+L+  + K  + +  E
  S:    14 LYIVPTPIGNLADITHRALDVLANVDLIAAEDTRHTSRLLSHFSIS--TRTF-ALHDHNEQQKADYLIEKLQAGTSIALVSDAGTPLISDPGYHLVNRCRQAGVKVVPLPGPCAVITALSGAGLPSDRFSFEGFLPPKSKGRRDTFQSLADDERTLIFYESPHRITDSLADMLAVLGPERQVVLARELTKTYETIHGAPLGELIDWLSEDSNRVRGEMVVLVAGHRKAKDDLPSE 245
>gi|89255605|ref|YP_512966.1| tetrapyrrole methyltransferase family protein [Francisella tularensis subsp. holarctica] >gi|89143436|emb|CAJ78612.1| tetrapyrrole methyltransferase family protein [Francisella tularensis subsp. holarctica LVS] >gi|134252826|gb|EBA51920.1| tetrapyrrole methyltransferase family protein [Francisella tularensis subsp. holarctica 257] (290 aa)
Score = 317, Expect = 1.4e-27, Identities = 93/268 (34%), Positives = 152/268 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENK--TFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++VATPIGN+++I+  A+  L+N  I   EDTR + KLL  LNI    K  + +  N  +  Q++           L+SDAG P++SDPG+ ++    K N+ V  I G S+++ +L  +G PS + +F GFL+   N +Q Q+ + +  + T+I++ESVHRI   L+ + E+  NS NI +A+ELTK  E     S+  + +     + T +GEFV++ID N   ++S   +  +  + +NEL K +        A K+V+     K N +Y
  S:     9 LYVVATPIGNLEDITYRALNVLSNVDIILAEDTRVTAKLLASLNIRNNQKLVSCHDFNEESRVQYVKELLDAAKSIALVSDAGTPLISDPGYKIVANLRKENYKVVPIPGVSAVITALSAAGLPSDSFIFKGFLSAKHNKRQQQIREFQQINTTVILYESVHRINYLLEDLLELLPNS-NIVVAKELTKQFENFVFGSVQQVYDYFQANQDTIRGEFVVIIDCN---SDSEVNDSNNLKIDVNELLKDLLDEMPLNKAVKLVTKITGAKKNFVY 278
>gi|94501907|ref|ZP_01308417.1| predicted methyltransferase [Oceanobacter sp. RED65] >gi|94425960|gb|EAT10958.1| predicted methyltransferase [Oceanobacter sp. RED65] (278 aa)
Score = 317, Expect = 1.4e-27, Identities = 84/276 (30%), Positives = 146/276 (52%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI----NEIKITEKGEFVILIDN-NVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           KL++VATPIGN+ +I++ A+  L +      EDTR++K+LLN L I    K   + + +NE Q       K        L+SDAG P+++DPG+ +    ++  +DV  I G  +++ +L  +  P+   LF GFL    + +Q     +  + +T+++++S HRI  +L  + E+  + K + +ARE+TK  ET  R S ++I     +    +KGEFVI+I     K+ + + +E  D ++ L+    +       K A  + +     K N LY    + K
  S:     5 KLYVVATPIGNLADITQRAVEILNSVDCIAAEDTRHTKRLLNHLTIE---KPLLAAHDHNEDQVAKRIIDKLSAGESMALVSDAGTPLIADPGYHVTQAVVEAGFDVVPIPGSCAIIAALSAAALPTDRFLFDGFLPAKSHGRQAYFQSILEQERTVVVYDSPHRITASLSDLIEVMGDDKQLVVAREITKTFETFLRGSASDILKTMQDDANQQKGEFVIMIRGAQAKKHQEVSQEAIDLTLLLSTELPM-------KKAAALAATHTGYKKNQLYQLALEAK 278
>gi|118496695|ref|YP_897745.1| SAM-dependent methyltransferase [Francisella tularensis subsp. novicida U112] >gi|194324002|ref|ZP_03057777.1| conserved hypothetical protein [Francisella tularensis subsp. novicida FTE] >gi|118422601|gb|ABK88991.1| SAM-dependent methyltransferase [Francisella tularensis subsp. novicida U112] >gi|194321899|gb|EDX19382.1| conserved hypothetical protein [Francisella tularensis subsp. novicida FTE] (290 aa)
Score = 317, Expect = 1.4e-27, Identities = 92/268 (34%), Positives = 152/268 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENK--TFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++VATPIGN+++I+  A+  L+N  I   EDTR + KLL  LNI    K  + +  N  +  Q++           L+SDAG P++SDPG+ ++    K N+ V  I G S+++ +L  +G PS + +F GFL+   N +Q Q+ + +  + T+I++ESVHRI   L+ + E+  NS NI +A+ELTK  E     S+  + +     + T +GEFV++ID N   ++S   +  +  + ++EL K +        A K+V+     K N +Y
  S:     9 LYVVATPIGNLEDITYRALNVLSNVDIILAEDTRVTAKLLASLNIRNNQKLVSCHDFNEESRVQYVKELLDAAKSIALVSDAGTPLISDPGYKIVASLRKENYKVVPIPGVSAVITALSAAGLPSDSFIFKGFLSAKHNKRQQQIREFQQINTTVILYESVHRINYLLEDLLELLPNS-NIVVAKELTKQFENFVFGSVQQVYDYFQANQDTLRGEFVVIIDCN---SDSEVNDSNNLKIDVDELLKDLLDEMPLNKAVKLVTKITGAKKNFVY 278
>gi|172037596|ref|YP_001804097.1| tetrapyrrole methylase family protein [Cyanothece sp. ATCC 51142] >gi|171699050|gb|ACB52031.1| tetrapyrrole methylase family protein [Cyanothece sp. ATCC 51142] (287 aa)
Score = 317, Expect = 1.5e-27, Identities = 82/270 (30%), Positives = 147/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI-----NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+++I+  A+  L + ++   EDTR++ KLL+   I+    +++  N    +  + ++  +     L++DAG P +SDPG+ LI+  I  N  V  I GP++ + +L VSG P+   +F GFL      + D+L  LK E++TII++E+ HR+  TL  +++I+     + + RE+TK  E  +R S+ +      N  +I  KGEF ++I    +     +  E       +EL++L+ +G     A + ++   +     +YN 
  S:    15 LYIVGTPIGNLEDITFRAVRILKSVNLIAAEDTRHTAKLLHHFEITTPQISYHHHNRTARQTELLNYLEEGKSIALVTDAGMPGISDPGYDLISASIIANIPVIPIPGPTAAITTLSVSGLPTDRFIFEGFLPLKGKERCDRLQALKTETRTIILYEAPHRLLKTLTDLQDIYGKDHPLTVGREITKRYEEFWRGSLEDAILYYQNSQQI--KGEFTLIIAGCSQN----RFLELSIDQLKDELKQLLDQGMTRSQASRQLAEVTTFSRRQIYNL 283
>gi|170724723|ref|YP_001758749.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Shewanella woodyi ATCC 51908] >gi|169810070|gb|ACA84654.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Shewanella woodyi ATCC 51908] (280 aa)
Score = 317, Expect = 1.5e-27, Identities = 87/270 (32%), Positives = 139/270 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI-NEIKI---TEKGEFVILIDN-NVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +IS  AI  L N  +  CEDTR+S  LL+   I       +  N  +  ++I           L+SDAG P++SDPG+ L++      + V  + G  + + +L  SG PS    F GFL   +  + D+L +LK + +T+I +ES HRI  +L+ I       + I +ARE+TK  ET    ++  +  ++K     +KGE V++     + E E I       +V +N L KL+ +    K A  +    + +K N+LY +
  S:     7 LYIVPTPIGNLGDISSRAIDVLNNVKLIACEDTRHSGILLSHFGIETRKTALHDHNERDRAEWIIQKLSNGEAIALISDAGTPLISDPGYHLVSQVRAAGYKVIPLPGACAAITALSASGLPSDRFSFEGFLPSKEKGRLDKLTELKEDPRTLIFYESPHRIVHSLESILTALGEDRIIAMAREVTKTFETFLYGTVKEVLEQVKSDPNQQKGEIVLMCHGYRLVEDEGIP------AVVINTL-KLLCEELPLKKASALAGQIHGMKKNALYKY 274
>gi|89889686|ref|ZP_01201197.1| tetrapyrrole methyltransferase [Flavobacteria bacterium BBFL7] >gi|89517959|gb|EAS20615.1| tetrapyrrole methyltransferase [Flavobacteria bacterium BBFL7] (221 aa)
Score = 317, Expect = 1.5e-27, Identities = 76/214 (35%), Positives = 122/214 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI-ANINEIKITE-KGEFVI 217
           KL++V TPIGN+ +I+  A+  L +  +   EDTR S KLL    I     +++  N +     + S      +  L++DAG P +SDPGFL+    ++NN DV+ + G ++ + +++VSG P    +F GFL   K  +Q +L  LK E +TI+ +ES H++  TL   K  +  +  + I+RE+TKM E  +R ++ A I   +  + KGEFVI
  S:     2 KLYLVPTPIGNLADITYRAVEILKDVDLILAEDTRTSGKLLQHYEIKTPMLSYHMHNEHKIVDHVVSRIKNGEKMALITDAGSPGISDPGFLITRKMLENNLDVEALPGATAFVPAIVVSGLPCDKFVFEGFLPVKKG-RQKRLEFLKEERRTIVFYESPHKLLKTLADFKTHYGGNSRVSISREITKMFEEHFRGTVDAAITFFETKKPKGEFVI 216
>gi|110801768|ref|YP_697597.1| tetrapyrrole methylase family protein [Clostridium perfringens SM101] >gi|110682269|gb|ABG85639.1| tetrapyrrole methylase family protein [Clostridium perfringens SM101] (280 aa)
Score = 317, Expect = 1.6e-27, Identities = 87/271 (32%), Positives = 151/271 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI--ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIR----KGEKEKVACKMVSYKYSLKSNSLYNF 274
           K+++V TPIGN+ +I+  A+  L N  +   EDTR + KLLN   I     +++  N   + + I     +     ++SDAG P +SDPG +++   I+   + +++ G ++   +LI SG  ++  +F GF       K+  +  +K+ ++TIII+ES +RI DT+  +KE   N K + I RELTK++E I+R ++  A I+  +   KGEFV +I    K  + I++E T   + ++  E +I     +G K+K A K V+    +  + +Y F
  S:     3 KVYLVPTPIGNLGDITLRALEVLKNVDLIAAEDTRQTLKLLNHFEIKKPLISYHKHNEQGKGEEILRRVKEGTSVAIVSDAGTPGISDPGSVIVEKCIEEGIEFEVLPGATAFTTALIYSGLDTTKFMFKGFFPRENKDKRSFIEDIKDRTETIIIYESPYRILDTIDTLKEGLGNRK-VAICRELTKLHEEIFRGTLEEAKIHFEENAPKGEFVCVISG--KTDKEIEEENTSKWISMSIEEHIIHYIDNEGMKKKDAIKQVAKDRGVAKSEIYKF 276
>gi|124009734|ref|ZP_01694404.1| conserved hypothetical protein [Microscilla marina ATCC 23134] >gi|123984239|gb|EAY24588.1| conserved hypothetical protein [Microscilla marina ATCC 23134] (227 aa)
Score = 317, Expect = 1.7e-27, Identities = 72/215 (33%), Positives = 122/215 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANIN---EIKITEKGEFVILI 219
           L++V TPIGN+ +I+  AI  L +  +   EDTR S  LL  L+I    ++++  N +   Q +     K  +  L+SDAG P +SDPGFLL+   +K+   ++ + G ++ + +L+ SG P+   +F GFL H K  +Q +L QL  E++T++ +ES HR+   L  + E+    +   ++RELTK+ E     ++  +    E K   KGE V+++
  S:     9 LYLVPTPIGNLDDITLRAIKILQSVDVILAEDTRTSGVLLRHLDIGKPLQSYHIHNEHKVLQQLVERMQKGEKMALISDAGTPAISDPGFLLVRECLKHEIQIECLPGATAFVPALVKSGLPNDRFIFEGFLPHKKG-RQTRLQQLAAETRTMVFYESPHRLVKMLHQLAEVLGKDRQASVSRELTKIYEETVNGTLEEVAQHFEAKKV-KGEIVVVV 224
>gi|187932211|ref|YP_001892196.1| SAM-dependent methyltransferase [Francisella tularensis subsp. mediasiatica FSC147] >gi|187713120|gb|ACD31417.1| SAM-dependent methyltransferase [Francisella tularensis subsp. mediasiatica FSC147] (290 aa)
Score = 317, Expect = 1.7e-27, Identities = 93/268 (34%), Positives = 153/268 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENK--TFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++VATPIGN+++I+  A+  L+N  I   EDTR + KLL  LNI    K  + +  N  +  Q++           L+SDAG P++SDPG+ ++    K N+ V  I G S+++ +L V+G PS + +F GFL+   N +Q Q+ + +  + T+I++ESVHRI   L+ + E+  NS NI +A+ELTK  E     S+  + +     + T +GEFV++ID N   ++S   +  +  + ++EL K +        A K+V+     K N +Y
  S:     9 LYVVATPIGNLEDITYRALNVLSNVDIILAEDTRVTAKLLASLNIRNNQKLVSCHDFNEESRVQYVKELLDAAKSIALVSDAGTPLISDPGYKIVANLRKENYKVVPIPGVSAVITALSVAGLPSDSFIFKGFLSAKHNKRQQQIREFQQINTTVILYESVHRINYLLEDLLELLPNS-NIVVAKELTKQFENFVFGSVQQVYDYFQANQDTLRGEFVVIIDCN---SDSEVNDSNNLKIDVDELLKDLLDEIPLNKAVKLVTKITGAKKNFVY 278
>gi|118591503|ref|ZP_01548900.1| probable methyltransferase protein [Stappia aggregata IAM 12614] >gi|118435831|gb|EAV42475.1| probable methyltransferase protein [Stappia aggregata IAM 12614] (304 aa)
Score = 316, Expect = 1.8e-27, Identities = 88/268 (32%), Positives = 132/268 (49%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKE---KVACKMVSYKYSLKSNSLY 272
           L+IV+TPIGN+ +I+  A+ TL   S+  CEDTR +  L    ++      ++  N + ++  I           L+SDAG P++SDPG+ L+   +     V  I G S+ +  L+ +G PS  VLF GFL      K  +L  L     T++ FES HR   TL ++ E+   S+   +ARELTK  ET  R ++  ++     +  KGE VIL    V   E   + E D      +L+ L+ +   E     A K VS    L  N +Y
  S:    31 LYIVSTPIGNLGDITVRALETLAAASVIACEDTRVTATLTQRFSLKTPLLPYHEHNADKQRPKILEALADGRAVALVSDAGTPLVSDPGYRLVRDVVAEGHKVIPIPGASAPLAGLVAAGLPSDTVLFAGFLPQKGGPKSRRLQDLAKVPATLVFFESPHRTAATLALMAELLGASREAVVARELTKRFETFERGTLEELSARFDGQQIKGEIVIL----VGPPEDKPEAEAD------DLDALLSEALTEMPVSAAAKKVSKATGLDRNEVY 293
>gi|50364918|ref|YP_053343.1| putative tetrapyrrole methylase [Mesoplasma florum L1] >gi|50363474|gb|AAT75459.1| putative tetrapyrrole methylase [Mesoplasma florum L1] (290 aa)
Score = 316, Expect = 1.9e-27, Identities = 101/274 (36%), Positives = 161/274 (58%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE----KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIK-NNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFL-NHNKNLKQDQLNQLKNE-SKTIIIF-ESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQR 278
           +++V TPIGN+++IS  A+ TL   S+  CEDTR S+  L    I   NK   SL+  NE    ++ I   D K N+  ++SDAG P +SDPG   I   +   + +V  +N   + +H+++ SG+ +    F+GFL N +   K D+L  + N+ SK+II F ESVHRIKDT+  + EI ++++++ I RELTK+NE   +  I  +N    +E    KGE VI++D   ++ ++I   E    V     E+ I++G K K AC +V  K +   N +Y  + ++
  S:    14 IYLVGTPIGNLEDISFRALETLKKVSVICCEDTRTSQTFLKKYEI---NKKLISLHKYNESERIEEIIKILDDK-NDVAIISDAGCPAISDPGANFIKEILNIYDCNVTSVNVGPAYIHAIVASGYTAKENYFHGFLENKSDKSKVDELKDMLNKNSKSIISFYESVHRIKDTISKMSEILNSNQSVLIGRELTKLNEQYIQGEIEVVNNFVQSEEFILKGEIVIVVDTQKQQVDAINDNEIILLV-----EEEIKQGYKLKQACDIVGAKINKSKNEVYQIFIKK 290
>gi|187777346|ref|ZP_02993819.1| hypothetical protein CLOSPO_00898 [Clostridium sporogenes ATCC 15579] >gi|187774274|gb|EDU38076.1| hypothetical protein CLOSPO_00898 [Clostridium sporogenes ATCC 15579] (284 aa)
Score = 316, Expect = 1.9e-27, Identities = 90/271 (33%), Positives = 156/271 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK-QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           KL++V TPIGN+++I+  A+  L N  I   EDTR + KLLN  NI     +++  N  ++    INS     N   L+SDAG P +SDPG++LI   I+     +++ G ++   +L+ SG  ++  +F GF+      +Q  +  +K+  +T+I +ES HR+K+ LK ++E   N +NI I RELTK++E I R ++  +  IK  E    KGE+V++++    E    +KE    S+ + + ++K I +G  +K + K+V+    +  + +Y +
  S:     8 KLYVVPTPIGNLRDITIRALDVLKNVDIIAAEDTRQTLKLLNHFNIKKTLISYHKFNEEDKSINIINSLKEGKN-IALVSDAGMPGISDPGYVLIKKCIEEQIIFEVLPGATAFTTALVYSGMDTTKFIFKGFIPRENKNRQKLVQDIKDRMETLIFYESPHRLKECLKFLRESLGN-RNISICRELTKVHEEIIRDNLEEV--IKYYESHQPKGEYVLVLEGKSIEEIEKEKEMEWSSISIQDHIKKYINEGYSKKESIKLVAKDRKITKSEVYKY 280
>gi|110799114|ref|YP_694736.1| tetrapyrrole methylase family protein [Clostridium perfringens ATCC 13124] >gi|168211814|ref|ZP_02637439.1| tetrapyrrole methylase family protein [Clostridium perfringens B str. ATCC 3626] >gi|168215154|ref|ZP_02640779.1| tetrapyrrole methylase family protein [Clostridium perfringens CPE str. F4969] >gi|168218270|ref|ZP_02643895.1| tetrapyrrole methylase family protein [Clostridium perfringens NCTC 8239] >gi|169344700|ref|ZP_02865663.1| tetrapyrrole methylase family protein [Clostridium perfringens C str. JGS1495] >gi|182626812|ref|ZP_02954550.1| conserved hypothetical protein [Clostridium perfringens D str. JGS1721] >gi|110673761|gb|ABG82748.1| tetrapyrrole methylase family protein [Clostridium perfringens ATCC 13124] >gi|169297167|gb|EDS79281.1| tetrapyrrole methylase family protein [Clostridium perfringens C str. JGS1495] >gi|170710230|gb|EDT22412.1| tetrapyrrole methylase family protein [Clostridium perfringens B str. ATCC 3626] >gi|170713435|gb|EDT25617.1| tetrapyrrole methylase family protein [Clostridium perfringens CPE str. F4969] >gi|177907858|gb|EDT70456.1| conserved hypothetical protein [Clostridium perfringens D str. JGS1721] >gi|182379725|gb|EDT77204.1| tetrapyrrole methylase family protein [Clostridium perfringens NCTC 8239] (280 aa)
Score = 316, Expect = 1.9e-27, Identities = 87/271 (32%), Positives = 151/271 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI--ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIR----KGEKEKVACKMVSYKYSLKSNSLYNF 274
           K+++V TPIGN+ +I+  A+  L N  +   EDTR + KLLN   I     +++  N   + + I     +     ++SDAG P +SDPG +++   I+   + +++ G ++   +LI SG  ++  +F GF       K+  +  +K+ ++TIII+ES +RI DT+  +KE   N K + I RELTK++E I+R ++  A I+  +   KGEFV +I    K  + I++E T   + ++  E +I     +G K+K A K V+    +  + +Y F
  S:     3 KVYLVPTPIGNLGDITLRALEVLKNVDLIAAEDTRQTLKLLNHFEIKKPLISYHKHNEQGKGEEILRRVKEGTSVAIVSDAGTPGISDPGSVVVEKCIEEGIEFEVLPGATAFTTALIYSGLDTTKFMFKGFFPRENKDKRSFIEDIKDRTETIIIYESPYRILDTIDTLKEGLGNRK-VAICRELTKLHEEIFRGTLEEAKIHFEENAPKGEFVCVISG--KTDKEIEEENTSKWISMSIEEHIIHYIDNEGMKKKDAIKQVAKDRGVAKSEIYKF 276
>gi|149190157|ref|ZP_01868433.1| predicted methyltransferase [Vibrio shilonii AK1] >gi|148836046|gb|EDL53007.1| predicted methyltransferase [Vibrio shilonii AK1] (287 aa)
Score = 316, Expect = 1.9e-27, Identities = 86/270 (31%), Positives = 141/270 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKE--TESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           LFIV TPIGN+ +I++ A+  L +  I   EDTR++ KLL+  NI       +  N   + Q +           L+SDAG P++SDPG+ L++   +    V  + G  +++ +L  SG PS    F GFL      ++D+  ++    +T I +ES HRI ++L  + E+    + + +ARELTK  ETI    +      I E +  ++GE V+LI +  +E  T+++  E T        L  L+++   +K A       Y+LK N+LY +
  S:    14 LFIVPTPIGNLGDITQRALDVLNSVDIIAAEDTRHTGKLLSHFNIQTRTFALHDHNEQQKAQVLVDKLLAGESIALVSDAGTPLISDPGYHLVSQCRQAGVKVVPLPGACAVITALSASGLPSDRFSFEGFLPAKSKGRKDKFMEIAKAERTCIFYESPHRITESLADMLEVLGPEREVVLARELTKTYETIQGLPLGELVEWIEEDENRKRGEMVLLI-HGYREPVTDTLPDEAT------RTLAILVKELPLKKAAAATAEI-YNLKKNALYKW 281
>gi|149910618|ref|ZP_01899256.1| putative methyltransferase [Moritella sp. PE36] >gi|149806346|gb|EDM66321.1| putative methyltransferase [Moritella sp. PE36] (279 aa)
Score = 316, Expect = 2.0e-27, Identities = 75/215 (34%), Positives = 127/215 (59%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQ---FINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILI 219
           LFIV TPIGN+ +I+E A+  L +  +   EDTR++ KLL+  +  ++ KTF +L+ +NE+Q   ++ S         L+SDAG P++SDPG+ L+N    +   V  + GP + + ++  SG PS    F GFL   +  + D++ +LK E++T+I +ES  R++ TL  +  I    + +C+ARE+TK  E+I    +      + +     +GE V+L+
  S:     7 LFIVPTPIGNLSDITERALEILRSVDLIAAEDTRHTGKLLS--HYQIKTKTF-ALHDHNEQQKAEYLVSKLQSGISIALVSDAGTPLISDPGYHLVNTCRAHGVKVVPLPGPCAAVTAMSGSGLPSDRFSFEGFLPSKEKARNDKITELKEETRTMIFYESPRRLQYTLDALTAIMGPERQVCVAREMTKAFESITTMPVGELAVWVAQDSNRSRGEIVLLV 225
>gi|81427958|ref|YP_394957.1| putative methyltransferase [Lactobacillus sakei subsp. sakei 23K] >gi|78609599|emb|CAI54645.1| Putative methyltransferase [Lactobacillus sakei subsp. sakei 23K] (292 aa)
Score = 316, Expect = 2.0e-27, Identities = 89/272 (32%), Positives = 144/272 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI------ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQ 276
           L++V TPIGN+ +++  AI TL +  +   EDTRN++KLLN   I  +  +F+  N     +  I   +  D +   +SDAG P +SDPG  L+   I+ N  V  + G ++ + +LI SG       F+GFL        + + QL  + +T I +E+ HR+K TL+ +   F   + + + RELTK  E   R  +      A  NE+    +GEFVI++  N    +++    TD ++ L+E +E  I++G    VA K V+    LK   +YN + 
  S:    15 LYLVPTPIGNLGDMTYRAIETLKDVQLIAAEDTRNTQKLLNHFEIETKQISFHEHNTQQRIETLIEKLEAGD-DIAQVSDAGMPSISDPGHELVKACIEANIAVVPLPGANAGITALIASGITPQPFTFFGFLPRKGKELTETVAQLALKPETTIFYEAPHRLKKTLQALINGFGGERQVTLGRELTKKFEEFIRGDLQEALTWATDNEM----RGEFVIIVAGN-PTPQNLSVVATDPTLSLSEQVEAQIQQGASPNVAIKTVAKANDLKKQVVYNAYH 288
>gi|163814920|ref|ZP_02206308.1| hypothetical protein COPEUT_01071 [Coprococcus eutactus ATCC 27759] >gi|158449859|gb|EDP26854.1| hypothetical protein COPEUT_01071 [Coprococcus eutactus ATCC 27759] (279 aa)
Score = 316, Expect = 2.0e-27, Identities = 81/273 (29%), Positives = 147/273 (53%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETI----YRSSIANINEIKITEKGEFVILIDN-NVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYN 273
           M  KL++VATPIGN+++++  A+  L    +   EDTRNS KLLN   I     +++  N  ++ + +     +     +++DAG P +SDPG  L+   +    +V  + G  + + +LI SG  +    F  FL ++K  +   L ++K E++T++++E+ H++K TL  + E   + ++I +ARE+TK +ETI       +IA   E     +GEFV++I+  +VK+ E  KK   +       ++  + +G  +K A K  +    +    +YN
  S:     1 MAGKLYLVATPIGNLEDMTYRAVRVLEEVDVIAAEDTRNSIKLLNHFEIKTPMTSYHEYNKYDKAKVLVEKMQQGQNVAVITDAGTPGISDPGEELVRQALDAGLEVTPVPGACACISALISSGLSTRRFAFEAFLPYDKKDRARVLEEMKRETRTMVMYEAPHKLKKTLAELMETLGD-RHITLAREITKKHETIEPMMLSQAIARYEEED--PRGEFVLVIEGLDVKKLEEEKKSSFEAMSVEEHVQMYVDQGMSKKDAIKQAAVDRGVPKRDVYN 275
>gi|23097499|ref|NP_690965.1| hypothetical protein OB0044 [Oceanobacillus iheyensis HTE831] >gi|22775722|dbj|BAC12000.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] (293 aa)
Score = 316, Expect = 2.1e-27, Identities = 83/230 (36%), Positives = 130/230 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSF--DFKDNEY-CLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI------NEIKITEKGEFVILIDN-NVKETESIKKEET 234
           L++V TPIGN+++I+  AI  L   S+   EDTRN+KKLL+   I        S + +N +  +N      K  E   L+SDAG P +SDPG  L+   I     V ++ G ++ + +L+ SG  +    FYGFL   K  K+  L  L+    TI+ +ES +R+KDT++ I+E + N K + + RELTK  E   R +   I      NE+    +GEFV++++  N+ +   I++E T
  S:    14 LYVVPTPIGNLEDITYRAIRMLREASVIAAEDTRNTKKLLHYFEIE---TPLISYHEHNHQSRVNQLMERIKGGEVVALVSDAGMPAISDPGVELVQAAIAEELKVVVLPGANAALSALVGSGLTTQPFTFYGFLPRKKKEKKQILENLQKTEGTIVFYESPYRVKDTVEAIQETYGNRK-MALGRELTKRFEEYIRGTAEEIFSWCKKNEM----RGEFVVMVEGRNMSDESEIRQEST 245
>gi|134302663|ref|YP_001122632.1| tetrapyrrole (corrin/porphyrin) methylase family protein [Francisella tularensis subsp. tularensis WY96-3418] >gi|134050440|gb|ABO47511.1| tetrapyrrole (corrin/porphyrin) methylase family protein [Francisella tularensis subsp. tularensis WY96-3418] >gi|151569794|gb|EDN35448.1| tetrapyrrole methyltransferase family protein [Francisella tularensis subsp. novicida GA99-3549] >gi|157121505|gb|EDO65696.1| SAM-dependent methyltransferase [Francisella tularensis subsp. holarctica FSC022] (290 aa)
Score = 316, Expect = 2.2e-27, Identities = 92/268 (34%), Positives = 152/268 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENK--TFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++VATPIGN+++I+  A+  L+N  I   EDTR + KLL  LNI    K  + +  N  +  Q++           L+SDAG P++SDPG+ ++    K N+ V  I G S+++ +L  +G PS + +F GFL+   N +Q Q+ + +  + T+I++ESVHRI   L+ + E+  NS NI +A+ELTK  E     S+  + +     + T +GEFV++ID N   ++S   +  +  + ++EL K +        A K+V+     K N +Y
  S:     9 LYVVATPIGNLEDITYRALNVLSNVDIILAEDTRVTAKLLASLNIRNNQKLVSCHDFNEESRVQYVKELLDAAKSIALVSDAGTPLISDPGYKIVANLRKENYKVVPIPGVSAVITALSAAGLPSDSFIFKGFLSAKHNKRQQQIREFQQINTTVILYESVHRINYLLEDLLELLPNS-NIVVAKELTKQFENFVFGSVQQVYDYFQANQDTLRGEFVVIIDCN---SDSEVNDSNNLKIDVDELLKDLLDEMPLNKAVKLVTKITGAKKNFVY 278
>gi|163938044|ref|YP_001642928.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Bacillus weihenstephanensis KBAB4] >gi|163860241|gb|ABY41300.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Bacillus weihenstephanensis KBAB4] (291 aa)
Score = 316, Expect = 2.2e-27, Identities = 88/275 (32%), Positives = 147/275 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLN-GNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLI-RKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI  L    I   EDTR +KKL N   I     +++  N G + ++ ++  + +     ++SDAG P +SDPG+ ++   +   + V  + G ++ + +LI SG  + +  FYGFL  NK  ++ +L +L+    T++ +E+ HR+ DTL  ++E+  N + I + RELTK  E   R +I   I   K  E +GEF IL+  + +E    ++     SVY N +E  I  KG   K A K V+    L    +Y  +   K
  S:    15 LYLVPTPIGNLEDMTFRAIRILKEADIIAAEDTRQTKKLCNYFEIETPVMSYHEHNKGVSGRKILDKLE-EGKTVAIVSDAGMPCISDPGYDIVVEAVAEQYHVIPLPGANAALTALIASGLETKHFYFYGFLQRNKKGRKLELEKLRYIPTTMMFYEAPHRLDDTLISMQEVLGN-REIVLCRELTKKFEEFIRGTIEEAIEWTKQNEVRGEFCILVAGSTEEPTPEEQWWEAISVY-NHIEHYINEKGMNSKEAIKTVAKDRDLSKRDVYQIYHVDK 290
>gi|46906403|ref|YP_012792.1| tetrapyrrole methylase family protein [Listeria monocytogenes str. 4b F2365] >gi|153165138|ref|ZP_01926156.1| hypothetical protein LMHG_00973 [Listeria monocytogenes FSL N1-017] >gi|153200609|ref|ZP_01942716.1| tetrapyrrole methylase family protein [Listeria monocytogenes HPB2262] >gi|167013634|ref|ZP_02276167.1| tetrapyrrole methylase family protein [Listeria monocytogenes FSL J1-194] >gi|167452885|ref|ZP_02319108.1| tetrapyrrole methylase family protein [Listeria monocytogenes FSL J2-064] >gi|46879667|gb|AAT02969.1| tetrapyrrole methylase family protein [Listeria monocytogenes str. 4b F2365] >gi|133728457|gb|EBA30155.1| hypothetical protein LMHG_00973 [Listeria monocytogenes FSL N1-017] >gi|133736557|gb|EBA38255.1| tetrapyrrole methylase family protein [Listeria monocytogenes HPB2262] (293 aa)
Score = 316, Expect = 2.3e-27, Identities = 84/275 (30%), Positives = 141/275 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVK---ETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI  L    I   EDTRN+ KLLN   I+    +++     N++  I           L+SDAG P +SDPG+ L+   +  N  V  + G ++ + +LI SG       FYGFL      +   + +L    +T I++ES HR+K+TLK I +I  N + I + RELTK  E   R ++ +     + E  +GEF ++I+ N       E +  +E D   +++ +  + ++    K A K V    +L    +Y+ + + K
  S:    16 LYLVPTPIGNLEDMTFRAIRMLKEADIIAAEDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLDGEVVALVSDAGMPSISDPGYELVQSALNANIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIEKLAAREETWILYESPHRLKETLKAIIKITGNDRKIVLCRELTKRFEEFLRGTVEDALNWAMDEEVRGEFCLIIEGNANPPLAEEQLWWQELDIKTHVSTV--MEQENVSSKDAIKTVMKARNLPKREVYSAYHEIK 293
>gi|88799434|ref|ZP_01115011.1| hypothetical protein MED297_03597 [Reinekea sp. MED297] >gi|88777744|gb|EAR08942.1| hypothetical protein MED297_03597 [Reinekea sp. MED297] (267 aa)
Score = 316, Expect = 2.3e-27, Identities = 69/219 (31%), Positives = 123/219 (56%)
  Q:    15 IKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEE 233
           + +I+E A   L++ S   CEDTR+S +LL+ L I    +  +  N  ++   I  +        L+SDAG P++SDPG++L+N  +     V  + G S+++ +L V+G P+    F GFL    + +Q    Q+   + T+I +ES HRI+D+L  + ++   ++ I +ARELTK  ET+ R ++A++  +   +    +GEFV+L+    K  ++   +E
  S:     1 MADITERARQVLSSVSRVCCEDTRHSVRLLDHLGIQARLEALHEHNERDKSALILQWLEAGESIALISDAGTPLISDPGYVLVNDVVAKGLAVVPVPGASAIIAALSVAGLPTDRFSFEGFLPAKTSARQSAFQQISEYAGTVIFYESSHRIEDSLADLAKVLGAARQIVLARELTKTFETVLRGTVADVQAVLANDANQRRGEFVLLVQGVGKSKQAEISDE 223
>gi|169834140|ref|YP_001694390.1| hypothetical protein SPH_1046 [Streptococcus pneumoniae Hungary19A-6] >gi|168996642|gb|ACA37254.1| conserved hypothetical protein [Streptococcus pneumoniae Hungary19A-6] (292 aa)
Score = 316, Expect = 2.3e-27, Identities = 88/269 (32%), Positives = 146/269 (54%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE---KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           KL++VATPIGN+ +++  AI TL        EDTRN+  LL   +IS +  +F+  N   +   +  F         +SDAG P +SDPG  L+   I+    V  + G S+ + +LI SG      +FYGFL      ++   +  K+  +T I +ES HR+ DTL+ + E++ + +++ + RELTK+ E   R +I+ + E  I+E   KGE +++++   K  E  +K+E D  +   E++  I++G K+  A K V+  Y    + LY
  S:    15 KLYLVATPIGNLDDMTFRAIQTLKEVDWIAAEDTRNTGLLLKHFDISTKQISFHEHNAKEKIPDLIGFLKAGQSIAQVSDAGLPSISDPGHDLVKAAIEEEIAVVTVPGASAGISALIASGLAPQPHIFYGFLPRKSGQQKQFFDSKKDYPETQIFYESPHRVADTLENMLEVYGD-RSVVLVRELTKIYEEYQRGTISELLE-SISETSLKGECLLIVEGASKGVE--EKDEEDLFL---EIQARIQQGMKKNQAIKEVAKIYQWNKSQLY 279
>gi|47092854|ref|ZP_00230637.1| tetrapyrrole methylase family protein [Listeria monocytogenes str. 4b H7858] >gi|47018758|gb|EAL09508.1| tetrapyrrole methylase family protein [Listeria monocytogenes str. 4b H7858] (293 aa)
Score = 315, Expect = 2.4e-27, Identities = 84/275 (30%), Positives = 141/275 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVK---ETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI  L    I   EDTRN+ KLLN   I+    +++     N++  I           L+SDAG P +SDPG+ L+   +  N  V  + G ++ + +LI SG       FYGFL      +   + +L    +T I++ES HR+K+TLK I +I  N + I + RELTK  E   R ++ +     + E  +GEF ++I+ N       E +  +E D   +++ +  + ++    K A K V    +L    +Y+ + + K
  S:    16 LYLVPTPIGNLEDMTFRAIRMLKEADIIAAEDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLDGEVVALVSDAGMPSISDPGYELVQSALNANIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIEKLAAREETWILYESPHRLKETLKAIIKITGNDRKIVLCRELTKRFEEFLRGTVEDALNWAMDEEVRGEFCLIIEGNANPPLAEEQLWWQELDIKTHVSTI--MEQENVSSKDAIKTVMKARNLPKREVYSAYHEIK 293
>gi|109899993|ref|YP_663248.1| hypothetical protein Patl_3692 [Pseudoalteromonas atlantica T6c] >gi|109702274|gb|ABG42194.1| Protein of unknown function UPF0011 [Pseudoalteromonas atlantica T6c] (281 aa)
Score = 315, Expect = 2.4e-27, Identities = 88/269 (32%), Positives = 143/269 (53%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           KLFIV TPIGN+++I+  AI TL    +   EDTR+S+KL+   +IS       SL+ +NE Q       K  +     L+SDAG P++SDPG+ L+N    N  DV  + G  + + +L  +G  +    F GFL   +  K   L  ++ E+ T + +ES  RI DT++ + ++    + + +A+EL+K  ET Y  +       ++     ++GEFV++I  +       K + +D      +L KL+      K A  +V+ +Y LK N+LY
  S:     6 KLFIVPTPIGNLEDITLRAIRTLNEVDLIAAEDTRHSQKLMQHFDISTR---LISLHDHNETQRAAQLIEKLQQGLNIALISDAGTPLISDPGYGLVNQCRANRVDVIPLPGACAAVTALSGAGLATDRFRFEGFLPAKQQAKIQALESIERETATSVFYESPRRIADTVQGVVDVLGAERKVVVAKELSKTFETFYSGTAGEALEWLHADSNHQRGEFVLMIAGH-------KSDVSDIPEEALKLLKLLMAELPPKKAAAIVAQQYGLKKNTLY 271
>gi|59712817|ref|YP_205593.1| methyltransferase [Vibrio fischeri ES114] >gi|59480918|gb|AAW86705.1| predicted methyltransferase [Vibrio fischeri ES114] (309 aa)
Score = 315, Expect = 2.5e-27, Identities = 83/270 (30%), Positives = 143/270 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ AI  L +  +   EDTR++ KLL+   I+ +    +  N  ++   + S   +     L+SDAG P++SDPG+ L+N   + N +V  + G  +++ +L  +G PS    F GFL      ++D+  ++    +T I +ES HRI D+L  +  +    + + +ARELTK  ETI+ + +      I E    ++GE V+LI     E     K+E  +      L  L+++   +K A  M +  + +K N+LY +
  S:    36 LYIVPTPIGNLGDITQRAIEVLKSVDLIAAEDTRHTGKLLSHFGIASQTFALHDHNEQHKADLLISKLQQGLSIALVSDAGTPLISDPGYHLVNRCRQANVNVVPLPGACAVITALSAAGLPSDRFSFEGFLPPKSKGRRDKFEEIAQAERTCIFYESPHRIMDSLDDMLTVLGPERQVVLARELTKTYETIHGAPLGELIEWIKEDDNRKRGEMVLLIHGFRSEA----KDELPFEA-TRSLSILVKELPLKKAAA-MAAEIHGVKKNALYKW 303
>gi|30260226|ref|NP_842603.1| hypothetical protein BA0033 [Bacillus anthracis str. Ames] >gi|47525289|ref|YP_016638.1| hypothetical protein GBAA0033 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183070|ref|YP_026322.1| hypothetical protein BAS0035 [Bacillus anthracis str. Sterne] >gi|49481556|ref|YP_034390.1| uroporphyrin-III C-methyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52145177|ref|YP_081649.1| uroporphyrin-III C-methyltransferase [Bacillus cereus E33L] >gi|65317496|ref|ZP_00390455.1| COG0313: Predicted methyltransferases [Bacillus anthracis str. A2012] >gi|165872590|ref|ZP_02217222.1| tetrapyrrole methylase family protein [Bacillus anthracis str. A0488] >gi|166997039|ref|ZP_02263498.1| uroporphyrin-III C-methyltransferase [Bacillus cereus AH820] >gi|167635039|ref|ZP_02393356.1| tetrapyrrole methylase family protein [Bacillus anthracis str. A0442] >gi|167641524|ref|ZP_02399772.1| tetrapyrrole methylase family protein [Bacillus anthracis str. A0193] >gi|170688880|ref|ZP_02880082.1| tetrapyrrole methylase family protein [Bacillus anthracis str. A0465] >gi|170707514|ref|ZP_02897967.1| tetrapyrrole methylase family protein [Bacillus anthracis str. A0389] >gi|177655348|ref|ZP_02936877.1| tetrapyrrole methylase family protein [Bacillus anthracis str. A0174] >gi|190568995|ref|ZP_03021896.1| tetrapyrrole methylase family protein [Bacillus anthracis Tsiankovskii-I] >gi|196036348|ref|ZP_03103745.1| tetrapyrrole methylase family protein [Bacillus cereus W] >gi|196041795|ref|ZP_03109085.1| tetrapyrrole methylase family protein [Bacillus cereus NVH0597-99] >gi|30253547|gb|AAP24089.1| conserved hypothetical protein TIGR00096 [Bacillus anthracis str. Ames] >gi|47500437|gb|AAT29113.1| conserved hypothetical protein TIGR00096 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49176997|gb|AAT52373.1| conserved hypothetical protein TIGR00096 [Bacillus anthracis str. Sterne] >gi|49333112|gb|AAT63758.1| uroporphyrin-III C-methyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51978646|gb|AAU20196.1| uroporphyrin-III C-methyltransferase [Bacillus cereus E33L] >gi|164711718|gb|EDR17263.1| tetrapyrrole methylase family protein [Bacillus anthracis str. A0488] >gi|167510509|gb|EDR85907.1| tetrapyrrole methylase family protein [Bacillus anthracis str. A0193] >gi|167529513|gb|EDR92263.1| tetrapyrrole methylase family protein [Bacillus anthracis str. A0442] >gi|170127510|gb|EDS96384.1| tetrapyrrole methylase family protein [Bacillus anthracis str. A0389] >gi|170667104|gb|EDT17865.1| tetrapyrrole methylase family protein [Bacillus anthracis str. A0465] >gi|172080189|gb|EDT65282.1| tetrapyrrole methylase family protein [Bacillus anthracis str. A0174] >gi|190559919|gb|EDV13903.1| tetrapyrrole methylase family protein [Bacillus anthracis Tsiankovskii-I] >gi|195990978|gb|EDX54949.1| tetrapyrrole methylase family protein [Bacillus cereus W] >gi|196027415|gb|EDX66032.1| tetrapyrrole methylase family protein [Bacillus cereus NVH0597-99] (291 aa)
Score = 315, Expect = 2.5e-27, Identities = 88/275 (32%), Positives = 144/275 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGN-NEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLI-RKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI  L    +   EDTR +KKL N   I     +++  N   + K+ +   D +     L+SDAG P +SDPG+ ++   +   + V  + G ++ + +LI SG  +    FYGFL  NK  ++ +L +L+    T++ +E+ HR+ DTL  ++E+  N + I + RELTK  E   R ++   I   K  E +GEF IL+  + +E    ++     SVY N +E  I  KG   K A K V+    L    +Y  +   K
  S:    15 LYLVPTPIGNLEDMTFRAIRILKEADLIAAEDTRQTKKLCNYFEIETPVMSYHEHNKEVSGKKILEKLD-EGKTVALVSDAGMPCISDPGYDIVVEAVAEQYHVIPLPGANAALTALIASGLQTKQFYFYGFLQRNKKERKMELEKLRYVQTTMMFYEAPHRLDDTLISMQEVLGN-REIVLCRELTKKFEEFIRGTVEEAIEWTKQNEVRGEFCILVAGSTEEPAPEEQWWESISVY-NHIEHYINEKGMNSKEAIKTVAKDRDLSKRDVYQIYHVDK 290
>gi|145638053|ref|ZP_01793678.1| hypothetical protein CGSHiHH_09817 [Haemophilus influenzae PittHH] >gi|145268750|gb|EDK08728.1| hypothetical protein CGSHiHH_09817 [Haemophilus influenzae PittHH] (220 aa)
Score = 315, Expect = 2.6e-27, Identities = 73/202 (36%), Positives = 117/202 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE 206
           L+IVATPIGN+++I++ A+ T     +   EDTR+S  LL+   I    K F++L+ +NE++  +    K    +   L+SDAG P++SDPGF L+    +    V  + G  + + +L  SG  S    F GFL      ++D+L  +  E +T+I +ES HRI DTL+ ++ +    + I +ARE+TK  ETI  ++I N+ E
  S:     8 LYIVATPIGNLQDITQRALETFAQVDLIAAEDTRHSGLLLSHYGI---KKPFFALHDHNEQEKAHILVEKLKQGSSIALISDAGTPLISDPGFHLVRQCREAGIRVVPLPGACAAITALCASGIASDRFCFEGFLPAKSKARKDKLENIAEEDRTLIFYESTHRILDTLEDMQAVLGEKRYIVLAREMTKTWETITGNTIKNLRE 209
>gi|62258883|gb|AAX77826.1| unknown protein [synthetic construct] (325 aa)
Score = 315, Expect = 2.8e-27, Identities = 91/268 (33%), Positives = 151/268 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENK--TFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++VATPIGN+++I+  A+  L+N  I   EDTR + KLL  LNI    K  + +  N  +  Q++           L+SDAG P++SDPG+ ++    K N+ V  I G S+++ +L  +G PS + +F GFL+   N +Q Q+ + +  + T+I++ESVHRI   L+ + E+  NS NI +A+ELTK  E     S+  + +     + T +GEFV++ D N   ++S   +  +  + ++EL K +        A K+V+     K N +Y
  S:    35 LYVVATPIGNLEDITYRALNVLSNVDIILAEDTRVTAKLLASLNIRNNQKLVSCHDFNEESRVQYVKELLDAAKSIALVSDAGTPLISDPGYKIVANLRKENYKVVPIPGVSAVITALSAAGLPSDSFIFKGFLSAKHNKRQQQIREFQQINTTVILYESVHRINYLLEDLLELLPNS-NIVVAKELTKQFENFVFGSVQQVYDYFQANQDTLRGEFVVIFDCN---SDSEVNDSNNLKIDVDELLKDLLDEMPLNKAVKLVTKITGAKKNFVY 304
>gi|88801550|ref|ZP_01117078.1| methyltransferase [Polaribacter irgensii 23-P] >gi|88782208|gb|EAR13385.1| methyltransferase [Polaribacter irgensii 23-P] (223 aa)
Score = 315, Expect = 2.8e-27, Identities = 79/216 (36%), Positives = 122/216 (56%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSF--DFKDNEYC-LLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILI 219
           KL++V TPIGN+++++  AI  L        EDTR S KLL    IS +    +S + +NE + I+      K  E C L+SDAG P +SDPGFLL    ++NN +V  + G ++ + +L+ SG P+   +F GFL   K  +Q +   L  E++T+I +ES H++  TL    E F   + + ++RELTKM E   R +   +  +      KGE VI++
  S:     3 KLYLVPTPIGNLEDMTFRAIRILKEVDFILAEDTRTSGKLLKHYEISTQ---MHSHHMHNEHKSIHGVLNRIKSGETCALISDAGTPAISDPGFLLTRACVENNIEVDCLPGATAFVPALVNSGLPNEKFIFEGFLPVKKG-RQTRFLSLAEENRTMIFYESPHKLIKTLSHFVEYFGTDRQVSVSRELTKMFEETIRGTATEVLAHYTNKPPKGEIVIIV 219
>gi|168267168|ref|ZP_02689133.1| tetrapyrrole methylase family protein [Listeria monocytogenes FSL J2-071] (293 aa)
Score = 315, Expect = 2.9e-27, Identities = 83/275 (30%), Positives = 142/275 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVK---ETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI  L    I   EDTRN+ KLLN   I+    +++     N++  I           L+SDAG P +SDPG+ L+   ++ N  V  + G ++ + +LI SG       FYGFL      +   + +L    +T I++ES HR+K+TLK + +I  N + I + RELTK  E   R ++ +     + E  +GEF ++I+ N       E +  +E D   +++ +  + ++    K A K V    +L    +Y+ + + K
  S:    16 LYLVPTPIGNLEDMTFRAIRMLKEADIIAAEDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLDGEVVALVSDAGMPSISDPGYELVQSALEANIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIEKLAVREETWILYESPHRLKETLKALAKITGNDRKIVLCRELTKRFEEFLRGTVEDALNWAMDEEVRGEFCLIIEGNANPPLAEEQLWWQELDIKTHVSTV--MEQENISSKDAIKTVMKARNLPKREVYSAYHEIK 293
>gi|149019526|ref|ZP_01834845.1| hypothetical protein CGSSp23BS72_02968 [Streptococcus pneumoniae SP23-BS72] >gi|168491025|ref|ZP_02715168.1| conserved hypothetical protein [Streptococcus pneumoniae CDC0288-04] >gi|147930901|gb|EDK81881.1| hypothetical protein CGSSp23BS72_02968 [Streptococcus pneumoniae SP23-BS72] >gi|183574750|gb|EDT95278.1| conserved hypothetical protein [Streptococcus pneumoniae CDC0288-04] (289 aa)
Score = 315, Expect = 3.0e-27, Identities = 88/276 (31%), Positives = 150/276 (54%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE---KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSL---YNFWQQRK 279
           KL++VATPIGN+ +++  AI  L        EDTRN+  LL   +IS +  +F+  N   +   +  F         +SDAG P +SDPG  L+   I+    V  + G S+ + +LI SG      +FYGFL      ++   +  K+  +T I +ES HR+ DTL+ + E++ + +++ + RELTK+ E   R +I+ + E  I E   KGE +++++   +  E  +K+E D  V   E++  I++G K+  A K V+  Y    + L   Y+ W++++
  S:    15 KLYLVATPIGNLDDMTFRAIQILKEVDWIAAEDTRNTGLLLKHFDISTKQISFHEHNAKEKIPDLIGFLKAGQSIAQVSDAGLPSISDPGHDLVKAAIEEEIAVVTVPGASAGISALIASGLAPQPHIFYGFLPRKSGQQKQFFDSKKDYPETQIFYESPHRVADTLENMLEVYGD-RSVVLVRELTKIYEEYQRGTISELLE-SIAETPLKGECLLIVEGASQGVE--EKDEEDLFV---EIQTRIQQGVKKNQAIKEVAKIYQWNKSQLYAAYHDWEEKQ 289
>gi|189462774|ref|ZP_03011559.1| hypothetical protein BACCOP_03471 [Bacteroides coprocola DSM 17136] >gi|189430390|gb|EDU99374.1| hypothetical protein BACCOP_03471 [Bacteroides coprocola DSM 17136] (224 aa)
Score = 314, Expect = 3.3e-27, Identities = 71/216 (32%), Positives = 121/216 (56%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILI 219
           +L++V TP+GN+++++  AI  L    +   EDTR S  LL    I    ++++  N +   + I +         L+SDAG P +SDPGFL++   +KN+ +VQ + G ++ + +L+ SG P     F GFL   K  +  +LN L  E++T+I +ES +R+  TL    EIF   + + + RE++K++E   R ++   I     TE +GE VI++
  S:     3 RLYVVPTPVGNLEDMTFRAIRILKEADLILAEDTRTSGILLKHFEIKNAMQSYHKFNEHKTVEGIINRLKAGETIALVSDAGTPGISDPGFLVVRECVKNDIEVQCLPGATAFVPALVASGLPDERFCFEGFLPQKKG-RMTRLNGLVEETRTMIFYESPYRLVKTLTQFAEIFGPERQVSVCREISKIHEESVRGTLQEVIAHFTATEPRGEIVIIL 219
>gi|160872461|ref|ZP_02062593.1| conserved hypothetical protein [Rickettsiella grylli] >gi|159121260|gb|EDP46598.1| conserved hypothetical protein [Rickettsiella grylli] (279 aa)
Score = 314, Expect = 3.4e-27, Identities = 73/216 (33%), Positives = 120/216 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILID 220
           L++VATP+GN+++ S  AI  L        EDTR+S+KLL    I+    + +  N       +     K+    L+SDAG P++SDPG+ L++L  ++   V  I GP +L+ +L  SG      +F GFL   ++ +  +L     E++T+I +E+ HRI   +  +  +F   + + +ARELTK  ETI+   + N    +N  K  +KGEFV+L++
  S:     7 LYVVATPLGNLEDFSPRAINVLKKVDTIAVEDTRHSQKLLKTFGITTPLVSLHEHNETISTHLLLDALKKNRSIGLISDAGTPLISDPGYRLVHLARQHGISVIPIPGPCALITALCASGLACDRFIFEGFLPGKRSARLKKLQTFLYETRTLIFYEAPHRILALIDDMLAVFGPERYVVLARELTKAFETIHGDPLKNLKLWLNSDKNQQKGEFVVLVE 226
>gi|156501555|ref|YP_001427620.1| tetrapyrrole (corrin/porphyrin) methylase family protein [Francisella tularensis subsp. holarctica FTNF002-00] >gi|156252158|gb|ABU60664.1| tetrapyrrole (corrin/porphyrin) methylase family protein [Francisella tularensis subsp. holarctica FTNF002-00] (290 aa)
Score = 314, Expect = 3.9e-27, Identities = 92/268 (34%), Positives = 151/268 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENK--TFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++VATPIGN+++I+  A+  L+N  I   EDTR + KLL  LNI    K  + +  N  +  Q++           L+SD G P++SDPG+ ++    K N+ V  I G S+++ +L  +G PS + +F GFL+   N +Q Q+ + +  + T+I++ESVHRI   L+ + E+  NS NI +A+ELTK  E     S+  + +     + T +GEFV++ID N   ++S   +  +  + +NEL K +        A K+V+     K N +Y
  S:     9 LYVVATPIGNLEDITYRALNVLSNVDIILAEDTRVTAKLLASLNIRNNQKLVSCHDFNEESRVQYVKELLDAAKSIALVSDVGTPLISDPGYKIVANLRKENYKVVPIPGVSAVITALSAAGLPSDSFIFKGFLSAKHNKRQQQIREFQQINTTVILYESVHRINYLLEDLLELLPNS-NIVVAKELTKQFENFVFGSVQQVYDYFQANQDTLRGEFVVIIDCN---SDSEVNDSNNLKIDVNELLKDLLDEMPLNKAVKLVTKITGAKKNFVY 278
>gi|157148711|ref|YP_001456030.1| hypothetical protein CKO_04540 [Citrobacter koseri ATCC BAA-895] >gi|157085916|gb|ABV15594.1| hypothetical protein CKO_04540 [Citrobacter koseri ATCC BAA-895] (287 aa)
Score = 314, Expect = 4.0e-27, Identities = 73/226 (32%), Positives = 132/226 (58%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESI 229
           +L+IV TPIGN+ +I++ A+  L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+ +  +    V  + GP + + +L  +G PS    + GFL      ++D L  ++ E +T+I +ES HR+ D+L+ +  ++  S+ + +ARELTK  ETIY + +    A + E +   KGE V++++ +  + +++
  S:    13 QLYIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFAI---NARLFALHDHNEQQKAETLVTKLKEGQNIALVSDAGTPLINDPGYHLVRICREAGIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIEAEPRTLIFYESTHRLLDSLEDMVAVWGESRYVVLARELTKTWETIYGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQDDAL 242
>gi|157162631|ref|YP_001459949.1| tetrapyrrole methylase family protein [Escherichia coli HS] >gi|157068311|gb|ABV07566.1| tetrapyrrole methylase family protein [Escherichia coli HS] (286 aa)
Score = 313, Expect = 4.2e-27, Identities = 74/226 (32%), Positives = 130/226 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESI 229
           +L+IV TPIGN+ +I++ A+  L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    ++   V  + GP + + +L  +G PS    + GFL      ++D L  ++ E +T+I +ES HR+ D+L+ I  +   S+ + +ARELTK  ETI+ + +    A + E +   KGE V++++ +  + E +
  S:    13 QLYIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGI---NARLFALHDHNEQQKAETLLAKLQEGQNIALVSDAGTPLINDPGYHLVRTCRESGIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIEAEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQEEDL 242
>gi|167760310|ref|ZP_02432437.1| hypothetical protein CLOSCI_02683 [Clostridium scindens ATCC 35704] >gi|167662193|gb|EDS06323.1| hypothetical protein CLOSCI_02683 [Clostridium scindens ATCC 35704] (278 aa)
Score = 313, Expect = 4.3e-27, Identities = 81/272 (29%), Positives = 145/272 (53%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKE----TESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           M+  L++ ATPIGN+++++   I  L    +   EDTRNS KLLN   I     +++  N   +   +        +  L++DAG P +SDPG  L+ +  +    V  + G  + + +L +SG  +    F  FL  +K  +Q  L +LK E++T+I++E+ HR+  TLK++ E   N + + + RELTK +ET++ ++I +  +   ++  KGE V++I+   +E     E  + EE D   +   +E  + +G  +K A K V+    +    +Y
  S:     1 MSGTLYLCATPIGNLEDMTLRCIRVLKEVDLIAAEDTRNSIKLLNHFEIKTPMTSYHEYNKIEKGHRLAERLQSGEDIALITDAGTPGISDPGEELVRMCQEAGITVTALPGAVACITALTISGLATRRFAFEAFLPTDKKERQAILEELKGETRTMILYEAPHRLTRTLKVLYEALGN-RRLSVCRELTKKHETVFATTIEDALDYYESQEPKGECVMVIEGKSREEIRAEEKAQWEEMDIEAH---MEYYLERGMGKKEAMKQVAKDRGVSKRDIY 274
>gi|47096985|ref|ZP_00234560.1| tetrapyrrole methylase family protein [Listeria monocytogenes str. 1/2a F6854] >gi|153176324|ref|ZP_01931583.1| hypothetical protein LMIG_00440 [Listeria monocytogenes FSL N3-165] >gi|153177830|ref|ZP_01931595.1| hypothetical protein LMMG_02899 [Listeria monocytogenes F6900] >gi|153186715|ref|ZP_01936908.1| hypothetical protein LMOG_02884 [Listeria monocytogenes J0161] >gi|153189325|ref|ZP_01937014.1| hypothetical protein LMPG_02952 [Listeria monocytogenes J2818] >gi|47014648|gb|EAL05606.1| tetrapyrrole methylase family protein [Listeria monocytogenes str. 1/2a F6854] >gi|126940955|gb|EBA18858.1| hypothetical protein LMOG_02884 [Listeria monocytogenes J0161] >gi|127766841|gb|EBA27163.1| hypothetical protein LMPG_02952 [Listeria monocytogenes J2818] >gi|133729037|gb|EBA30735.1| hypothetical protein LMIG_00440 [Listeria monocytogenes FSL N3-165] >gi|133733960|gb|EBA35658.1| hypothetical protein LMMG_02899 [Listeria monocytogenes F6900] (293 aa)
Score = 313, Expect = 4.5e-27, Identities = 83/275 (30%), Positives = 141/275 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVK---ETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI  L    I   EDTRN+ KLLN   I+    +++     N++  I           L+SDAG P +SDPG+ L+   +  N  V  + G ++ + +LI SG       FYGFL      +   + +L    +T I++ES HR+K+TLK + +I  N + I + RELTK  E   R ++ +     + E  +GEF ++I+ N       E +  +E D   +++ +  + ++    K A K V    +L    +Y+ + + K
  S:    16 LYLVPTPIGNLEDMTFRAIRMLKEADIIAAEDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLGGEVVALVSDAGMPSISDPGYELVQSALDANIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIEKLAAREETWILYESPHRLKETLKALAKITGNDRKIVLCRELTKRFEEFLRGTVEDALNWAMDEEIRGEFCLIIEGNSNPPLAEEQLWWQELDIKTHVSTV--MEQENVSSKDAIKTVMKARNLPKREVYSAYHEIK 293
>gi|119505130|ref|ZP_01627206.1| hypothetical protein MGP2080_15614 [marine gamma proteobacterium HTCC2080] >gi|119459112|gb|EAW40211.1| hypothetical protein MGP2080_15614 [marine gamma proteobacterium HTCC2080] (279 aa)
Score = 313, Expect = 4.6e-27, Identities = 86/279 (30%), Positives = 147/279 (52%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI--------ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEK--EKVACKMVSYKYSLKSNSLYNFWQQRK 279
           M + L+IV TPIGN+ +I++ A+ TLT+ ++   EDTR+S+KLL    I      ++        + + +         L+SDAG P++SDPGF L+      N  +  + GP + + +L  +G P+    F GFL      ++ +L  L+ ++ T+I +E+ HRIK TL    EI  + +   +AREL+K  ET+ R S+        A++N+    ++GE V+LI            E +D ++   + + L R  E+   + A  +VS    +K+  LY+    R+
  S:     1 MERGLYIVPTPIGNLADITQRALDTLTHVALVAAEDTRHSRKLLAHYGIETPLCAYHDHVSEEVTEQLLARMIGGEAIALISDAGTPLVSDPGFRLVRAAQAKNIPIIPLPGPCAAITALSGAGLPTDRFFFEGFLPAKSQQRRKRLESLQRQAGTLIFYEAPHRIKATLADATEIMGSEREAVLARELSKTFETLRRDSLSGLLAWVEADVNQ----QRGEQVLLI--------GPADEPSDNALLEKDRQLLFRIAEELPPRKAASIVSEVTGVKARILYDHLINRE 277
>gi|186457634|ref|ZP_02967945.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [bacterium Ellin514] >gi|184206220|gb|EDU03268.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [bacterium Ellin514] (240 aa)
Score = 313, Expect = 4.6e-27, Identities = 72/220 (32%), Positives = 121/220 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILIDNNVK 224
           L++VATPIGN+++++   + TL    +   EDTR + +LL    IS    +++  N     + I     +  +  L++DAG P +SDPG  ++       + V+ + GP +L+ +L  SG P+    F GFL H    ++ QL  +K+ + T++++ES +RI+  L  + EIF   + + +ARELTK  E     +   + E+  K   KGEFV+LI  NV+
  S:    15 LYLVATPIGNLEDMTLRGLRTLRECDVIAAEDTRRTGQLLKHFGISKPMISYFQFNEAKRSEEILQRLARGEKVALVTDAGTPGISDPGERVVQAARSGGFRVEAVPGPCALVAALTASGLPTDEFHFIGFLPHKSGQRRKQLEAVKDFAGTLVLYESPYRIEKLLNELNEIF-GERQVVLARELTKKFEEFLTGTPVQLLEVLKKRALKGEFVVLIGQNVE 235
>gi|163783098|ref|ZP_02178093.1| hypothetical protein HG1285_00945 [Hydrogenivirga sp. 128-5-R1-1] >gi|159881778|gb|EDP75287.1| hypothetical protein HG1285_00945 [Hydrogenivirga sp. 128-5-R1-1] (228 aa)
Score = 313, Expect = 4.7e-27, Identities = 82/215 (38%), Positives = 128/215 (59%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSL-NGNNEKQFINSFD-FKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKN-ESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE--KGEFVIL 218
           KL++V TPIGN+++I+  A+  L       CEDTR  K LLN  +I   NK   S      EKQ        ++ +  L+SDAG P +SDPGF L+   I+   +V+++ GPS+++ +L+ SG P+   +F GF    K  K+    +L + ES T +I+ES  R+  TL++I E+F +   +C+ARELTK++E   R  ++  I E++  +  KGE V+L
  S:     3 KLYVVPTPIGNLRDITLRALEVLKEVEYIACEDTRRVKILLNHYDI--RNKKLISYYEPREEKQIPRIISVLREKDVALVSDAGTPGISDPGFRLVRTCIREGIEVEVLPGPSAVITALVGSGLPTDRFVFAGF--PPKKGKRGFFEELLSCESATFVIYESPKRLVKTLQLIGEVFGDVW-VCVARELTKIHEEYIRGDLSEVIEELEKRKNIKGEVVVL 218
>gi|18309262|ref|NP_561196.1| tetrapyrrole methylase family protein [Clostridium perfringens str. 13] >gi|168207832|ref|ZP_02633837.1| tetrapyrrole methylase family protein [Clostridium perfringens E str. JGS1987] >gi|18143938|dbj|BAB79986.1| conserved hypothetical protein [Clostridium perfringens str. 13] >gi|170660849|gb|EDT13532.1| tetrapyrrole methylase family protein [Clostridium perfringens E str. JGS1987] (280 aa)
Score = 313, Expect = 4.8e-27, Identities = 86/271 (31%), Positives = 151/271 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI--ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIR----KGEKEKVACKMVSYKYSLKSNSLYNF 274
           K+++V TPIGN+ +I+  A+  L +  +   EDTR + KLLN   I     +++  N   + + I     +     ++SDAG P +SDPG +++   I+   + +++ G ++   +LI SG  ++  +F GF       K+  +  +K+ ++TIII+ES +RI DT+  +KE   N K + I RELTK++E I+R ++  A I+  +   KGEFV +I    K  + I++E T   + ++  E +I     +G K+K A K V+    +  + +Y F
  S:     3 KVYLVPTPIGNLGDITLRALEVLKSVDLIAAEDTRQTLKLLNHFEIKKPLISYHKHNEQGKGEEILRRVKEGTSVAIVSDAGTPGISDPGSVVVEKCIEEGIEFEVLPGATAFTTALIYSGLDTTKFMFKGFFPRENKDKRSFIEDIKDRTETIIIYESPYRILDTIDTLKEGLGNRK-VAICRELTKLHEEIFRGTLEEAKIHFEENAPKGEFVCVISG--KTDKEIEEENTSKWISMSIEEHIIHYIDNEGMKKKDAIKQVAKDRGVAKSEIYKF 276
>gi|153197916|ref|ZP_01942120.1| hypothetical protein LMRG_02412 [Listeria monocytogenes 10403S] >gi|127632457|gb|EBA22137.1| hypothetical protein LMRG_02412 [Listeria monocytogenes 10403S] (293 aa)
Score = 313, Expect = 4.8e-27, Identities = 84/275 (30%), Positives = 141/275 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVK---ETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI  L    I   EDTRN+ KLLN   I+    +++     N++  I           L+SDAG P +SDPG+ L+   +  N  V  + G ++ + +LI SG       FYGFL      +   + +L    +T I++ES HR+K+TLK I +I  N + I + RELTK  E   R ++ +     + E  +GEF ++I+ N       E +  +E D   +++ +  + ++    K A K V    +L    +Y+ + + K
  S:    16 LYLVPTPIGNLEDMTFRAIRMLKEADIIAAEDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLGGEVVALVSDAGMPSISDPGYELVQSALDANIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIEKLAAREETWILYESPHRLKETLKAIIKITGNDRKIVLCRELTKRFEEFLRGTVEDALNWAMDEEIRGEFCLIIEGNSNPPLAEEQLWWQELDIKTHVSTV--MEQENVSSKDAIKTVMKARNLPKREVYSAYHEIK 293
>gi|15643472|ref|NP_228518.1| hypothetical protein TM0709 [Thermotoga maritima MSB8] >gi|148269366|ref|YP_001243826.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Thermotoga petrophila RKU-1] >gi|170288024|ref|YP_001738262.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Thermotoga sp. RQ2] >gi|17369846|sp|Q9WZG8|Y709_THEMA UPF0011 protein TM_0709 >gi|4981233|gb|AAD35791.1|AE001742_6 conserved hypothetical protein [Thermotoga maritima MSB8] >gi|147734910|gb|ABQ46250.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Thermotoga petrophila RKU-1] >gi|170175527|gb|ACB08579.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Thermotoga sp. RQ2] (222 aa)
Score = 313, Expect = 5.0e-27, Identities = 76/199 (38%), Positives = 116/199 (58%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINS---FDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIA 202
           KL IV TPIGN+++I+  A+ TL    +   EDTR +  LLN   I    K   S N  N K+ I        +  +  ++SDAG P++SDPG+ L+    +   +V I+ GPS+L  ++ VSGFP S  +F GFL   KN ++  L  LK E++ I+ FES  R+  TL+ I EI  + + + IARE+TK+++  +R  ++
  S:     3 KLIIVGTPIGNLEDITIRALKTLREVDLILAEDTRRTMVLLNKYRI---KKPLLSFNERNSKKRIKEILPLLKEGKKVAIVSDAGMPVISDPGYNLVEECWREGIEVDIVPGPSALTSAVAVSGFPGSKFIFEGFLPRGKN-RRRLLKSLKKENRVIVFFESPERLLSTLRDILEIIGD-REVFIAREMTKLHQEFFRGKVS 199
>gi|168477364|ref|ZP_02706387.1| putative methyltransferase [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168819666|ref|ZP_02831666.1| putative methyltransferase [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] (287 aa)
Score = 313, Expect = 5.1e-27, Identities = 74/226 (32%), Positives = 129/226 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESI 229
           +LFIV TPIGN+ +I++ A+  L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  ++ E +T+I +ES HR+ D+L+ I  +   S+ + +ARELTK  ETI+ + +    A + E +   KGE V++++ +  + + +
  S:    13 QLFIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGI---NARLFALHDHNEQQKAETLVAKLKEGQNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIETEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQEDDL 242
>gi|167768116|ref|ZP_02440169.1| hypothetical protein CLOSS21_02671 [Clostridium sp. SS2/1] >gi|167709640|gb|EDS20219.1| hypothetical protein CLOSS21_02671 [Clostridium sp. SS2/1] (281 aa)
Score = 313, Expect = 5.1e-27, Identities = 83/272 (30%), Positives = 153/272 (56%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIF-DNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           M+  L++ ATPIGN+++I+   I TL    +   EDTR+S KLLN   I  +  +++  N   + + +     +  +  L++DAG P +SDPG  L+    +    V  + G  +L+++LI+SG P+    F  FL  +K  ++  L+ L+NE+++III+E+ HR+  TL+ + E+  D S  +C  RELTK +E++++S++  I     +   KGE V++I+    +    + +E    + L+E + + + +G  +K A K+V+    +    +Y
  S:     1 MSGTLYLCATPIGNLEDITFRVINTLKEVDLIAAEDTRHSIKLLNHFEIKTKMTSYHEYNRVEKAKVLVKQLQEGKDIALITDAGTPGISDPGEELVRQCHEAGITVTALPGACALINALIISGQPTRRFCFEAFLPSDKKERKQILDSLENETRSIIIYEAPHRLVRTLEELHEVLGDRSMTLC--RELTKKHESVFKSTLGEILAYHRENPPKGECVMIIEGKSFQELKEQSQEEFLKIPLSEHMNRYMDQGYSKKEAMKLVAKDRGVGKREIY 274
>gi|62181774|ref|YP_218191.1| hypothetical protein SC3204 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|167552087|ref|ZP_02345840.1| putative methyltransferase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167558130|ref|ZP_02351140.1| putative methyltransferase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|168221406|ref|ZP_02646638.1| putative methyltransferase [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168231872|ref|ZP_02656930.1| putative methyltransferase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168243099|ref|ZP_02668031.1| putative methyltransferase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168463512|ref|ZP_02697429.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|194448701|ref|YP_002047295.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194469092|ref|ZP_03075076.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|62129407|gb|AAX67110.1| putative methyltransferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|194407005|gb|ACF67224.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194455456|gb|EDX44295.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|195633301|gb|EDX51715.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Newport str. SL317] (287 aa)
Score = 313, Expect = 5.1e-27, Identities = 74/226 (32%), Positives = 129/226 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESI 229
           +LFIV TPIGN+ +I++ A+  L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  ++ E +T+I +ES HR+ D+L+ I  +   S+ + +ARELTK  ETI+ + +    A + E +   KGE V++++ +  + + +
  S:    13 QLFIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGI---NARLFALHDHNEQQKAETLVAKLKEGQNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIETEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQEDDL 242
>gi|170018602|ref|YP_001723556.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Escherichia coli ATCC 8739] >gi|188493090|ref|ZP_03000360.1| tetrapyrrole methylase family protein [Escherichia coli 53638] >gi|169753530|gb|ACA76229.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Escherichia coli ATCC 8739] >gi|188488289|gb|EDU63392.1| tetrapyrrole methylase family protein [Escherichia coli 53638] (286 aa)
Score = 313, Expect = 5.1e-27, Identities = 75/226 (33%), Positives = 129/226 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESI 229
           +L+IV TPIGN+ +I++ A+  L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  ++ E +T+I +ES HR+ D+L+ I  +   S+ + +ARELTK  ETI+ + +    A + E +   KGE V++I+ +  + E +
  S:    13 QLYIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGI---NARLFALHDHNEQQKAETLLAKLQEGQNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIEAEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIIEGHKAQEEDL 242
>gi|125531910|gb|EAY78475.1| hypothetical protein OsI_032434 [Oryza sativa (indica cultivar-group)] (370 aa)
Score = 313, Expect = 5.2e-27, Identities = 90/272 (33%), Positives = 137/272 (50%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYL-NELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           ++  L++VATPIGN+++I+  A+  L    +   EDTR+S KLL   NI     +F+  N    +  I     +     L+SDAG P +SDPG  L  L       V  I GPS+ + +L  SG P+    F GFL  +   ++++L     ++ T I +   H I   L      F +S++  IARE+TK++E  +R +I   NE   T   KGE  +LI+  +     I  +ET    +L +EL +L+ +G     A KMVS   S K   +Y
  S:    57 LDSGLYLVATPIGNLEDITLRALRILKCADVILSEDTRHSGKLLQHYNIKTPLLSFHKFNEREREPNILKRLHEGEAVALISDAGTPGISDPGMELARLCATEGIPVIPIPGPSAAIAALSASGLPTDEFTFVGFLPKHARSRKERLEISACQAATQIFYVPPHGIHQFLSDAASSFGDSRSCVIAREITKLHEEFWRGTIGEANETFATRQPKGEITVLIEGKL-----ISADETPSEDFLEHELRELMTQGHPLSAAVKMVSEATSAKKKDVY 326
>gi|196178996|gb|EDX73993.1| conserved hypothetical protein TIGR00096 [Microcoleus chthonoplastes PCC 7420] (278 aa)
Score = 312, Expect = 5.3e-27, Identities = 84/268 (31%), Positives = 138/268 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI--ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++V TPIGN+++++  AI  L        EDTR++ KLL    I     +++  N      + +N          L++DAG P +SDPG+ L+   I+    V  I G ++ + +L  SG P+   +F GFL  +   +Q +L  L  ES+T+I +ES +R++ TL+    IF  S+ I +ARELTK++E  +R +I  A         KGEF +++     ET  + +     +    EL +LI +G     A + +S+  +L    LY
  S:     4 LYVVGTPIGNLEDMTFRAIRILQTVDTIAAEDTRHTGKLLQHFQIKTPQISYHQHNRQQRLPELLNQLT-TGKTIALVTDAGMPSISDPGYELVQGAIEAGITVIPIPGATAGITALSASGLPTDRFVFEGFLPASGQERQQRLEVLAAESRTLIFYESPYRLQQTLQDFVTIFSPSRPIVLARELTKLHEQFWRGTIEEAIAYYTDHEPKGEFTLILAGAPAETPVLSE-----AALKAELSQLINQGLSRSQAARQLSHLTNLPRRHLY 268
>gi|194538504|ref|YP_002073589.1| conserved hypothetical protein [Vibrio sp. Ex25] >gi|151937059|gb|EDN55937.1| conserved hypothetical protein [Vibrio sp. Ex25] (287 aa)
Score = 312, Expect = 5.3e-27, Identities = 91/270 (33%), Positives = 150/270 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE-IK---ITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKL--IRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ AI  L+   I   EDTR++ KLL+  NI  + KTF +L+ +NE+Q       K        L+SDAG P++SDPG+ L+    +    V  + G  +++ +L  SG PS    F GFL      ++D+  ++ +  +T I +ES HRI D+L+ + ++    + + +ARELTK  ETI    +  + E +K     ++GE V+L+  +        +E  D S+  + L  L  + K    K A  +V+  ++LK N+LY +
  S:    14 LYIVPTPIGNLADITQRAIEILSTVDIIAAEDTRHTGKLLSHFNI--QTKTF-ALHDHNEQQKAQVLVEKLLSGQSIALVSDAGTPLISDPGYHLVTKCRQAGVRVVPLPGACAVITALSASGLPSDRFSFEGFLPPKSKGRKDKFLEIASVERTCIFYESPHRILDSLQDMLDVLGPDREVVLARELTKTFETIQGMPLGELIEWVKGDDNQQRGEMVLLVHGH--------RETADDSLPDDALRTLGILTKELPLKKAAALVAEIHNLKKNALYKW 281
>gi|194442995|ref|YP_002042523.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194401658|gb|ACF61880.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Newport str. SL254] (287 aa)
Score = 312, Expect = 5.5e-27, Identities = 74/226 (32%), Positives = 129/226 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESI 229
           +LFIV TPIGN+ +I++ A+  L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  ++ E +T+I +ES HR+ D+L+ I  +   S+ + +ARELTK  ETI+ + +    A + E +   KGE V++++ +  + + +
  S:    13 QLFIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGI---NARLFALHDHNEQQKAETLVAKLKEGQNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALRAIETEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQEDDL 242
>gi|54112637|gb|AAV28952.1| NT02FT1585 [synthetic construct] (290 aa)
Score = 312, Expect = 5.5e-27, Identities = 91/268 (33%), Positives = 151/268 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENK--TFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++VATPIGN+++I+  A+  L+N  I   EDTR + KLL  LNI    K  + +  N  +  Q++           L+SDAG P++SDPG+ ++    K N+ V  I G S+++ +L  +G PS + +F GFL+   N +Q Q+ + +  + T+I++ESVHRI   L+ + E+  NS NI +A+ELTK  E     S+  + +     + T +GEFV++ D N   ++S   +  +  + ++EL K +        A K+V+     K N +Y
  S:     9 LYVVATPIGNLEDITYRALNVLSNVDIILAEDTRVTAKLLASLNIRNNQKLVSCHDFNEESRVQYVKELLDAAKSIALVSDAGTPLISDPGYKIVANLRKENYKVVPIPGVSAVITALSAAGLPSDSFIFKGFLSAKHNKRQQQIREFQQINTTVILYESVHRINYLLEDLLELLPNS-NIVVAKELTKQFENFVFGSVQQVYDYFQANQDTLRGEFVVIFDCN---SDSEVNDSNNLKIDVDELLKDLLDEMPLNKAVKLVTKITGAKKNFVY 278
>gi|88704090|ref|ZP_01101805.1| Tetrapyrrole methylase family protein [gamma proteobacterium KT 71] >gi|88701917|gb|EAQ99021.1| Tetrapyrrole methylase family protein [Congregibacter litoralis KT71] (279 aa)
Score = 312, Expect = 5.6e-27, Identities = 87/279 (31%), Positives = 141/279 (50%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILI----DNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           M   L+IVATPIGN+ +IS  A+  L+  S    EDTR + +LL+   I      ++  +     + + +         L+SDAG P +SDPG+ L+ +       V  + GP + +  L  SG PS    F GFL +    ++ +L  L +   T+I +E+ HRI  TL+ ++ +   S+   +ARELTK  ETI R+S++ + E    +    +GE V+L+    D  V E +S           L EL + + +    + A K+V+    + S  LY++  Q K
  S:     1 MEPALYIVATPIGNLGDISRRAVEVLSQVSCIAAEDTRRTGQLLSGEGIKTRMLAYHEHSAPQVAEQLAARVAAGESVALVSDAGTPTISDPGYRLVRVMQDEGLKVIPLPGPCAAVVGLSGSGLPSDRFAFEGFLPNRGEARRRRLEALASSDATLIFYEAPHRILATLEDLQAVMGGSREAALARELTKSFETIRRASLSELCEWVRDDANQARGEIVLLLAPAPDQGVAEVDSA----------LGELLRGMAEHMPARQAAKLVAAYAGMPSRQLYDYLLQHK 277
>gi|169796685|ref|YP_001714478.1| putative methyltransferase [Acinetobacter baumannii AYE] >gi|169149612|emb|CAM87502.1| putative methyltransferase [Acinetobacter baumannii] (278 aa)
Score = 312, Expect = 5.7e-27, Identities = 82/235 (34%), Positives = 137/235 (58%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETD 235
           M+ +LF+VATPIG++ +++  AI  L + SI   EDTR S +L    NIS      +  N +N+ +Q +      +N   L+SDAG P++SDPGF L+    +N   V  + G  + + +L   G PS    F GFL    + +  QL +LKNE++T+I +E+ HRI + +K + E+F  ++ +  ARE+TK  ETI + ++ +    I      EKGE V+++    ++T+ +++E+ D
  S:     1 MSAQLFVVATPIGHLDDMTFRAIDILKSVSIVAAEDTRQSAQLFKHYNISTPLTACHDHNESNKIEQLVQKLLAGEN-IALISDAGTPLISDPGFKLVRAAQENGIRVVPVPGACAAIAALSAVGLPSDRFSFEGFLPSKASQRISQLEKLKNETQTLIFYEAPHRILECVKNMAEVFGENRPVGFAREITKTFETIKKMTLKDLVSFIENDHNQEKGEIVLVVGGAPEKTD-LEQEKLD 238
>gi|170078954|ref|YP_001735592.1| hypothetical protein SYNPCC7002_A2359 [Synechococcus sp. PCC 7002] >gi|169886623|gb|ACB00337.1| conserved hypothetical protein [Synechococcus sp. PCC 7002] (281 aa)
Score = 312, Expect = 5.8e-27, Identities = 84/270 (31%), Positives = 141/270 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK-QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI--ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L++V TPIGN+ +++  AI TL N  +   EDTR++ KLL    I+    +++  N +  + Q +       N   L+SDAG P +SDPGF L+   I     V  I G S+ +  LI SG      +F GFL   K  +   L +L  E +T+I +E+ HR+  TL  + E F+  + +  ARELTK++E  +R  +  A  +  +   KGEF +++     +T+   +  TD  + L +L+ L+++G     A + ++ + +L    +Y  
  S:     7 LYLVGTPIGNLDDMTFRAIATLKNVDLIAAEDTRHTGKLLKHFQIATPQISYHDHNRHQRQAQLLEKLRSGLN-IALVSDAGLPGISDPGFELVASAIDTEITVVPIPGVSAGLTGLIASGLSPEKFVFEGFLPPKKKDRHQLLTELSQEPRTLIFYEAPHRLVKTLTDLLEHFEGDRPLVCARELTKLHEEFWRGPLETALTHYQQHNPKGEFTLILAGASPQTD--HEALTDAEI-LAQLQALMQQGMSRSGASRTLAQQLNLSRRHIYQL 275
>gi|56418564|ref|YP_145882.1| hypothetical protein GK0029 [Geobacillus kaustophilus HTA426] >gi|56378406|dbj|BAD74314.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426] (303 aa)
Score = 312, Expect = 5.9e-27, Identities = 75/216 (34%), Positives = 123/216 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYR----SSIANINEIKITEKGEFVILID 220
           L+IV TPIGN+++++  A+ TL    +   EDTR +KKLL    I     +++  N     + +  +  +     L+SDAG P +SDPG+ LI   +     V  + G ++ + +L+ SG P+   LF GFL   K  K++QL  LK  ++T+I +E+ HR+K+TL ++ +IF N + I + RELTK  E   R     ++A   E  I  +GEF ++++
  S:    17 LYIVPTPIGNLEDMTFRAVRTLQEADVIAAEDTRQTKKLLAHFGIHTPLVSYHEHNKYASGRQLVEWLKEGKTVALVSDAGMPGISDPGYELIAAALAERCRVVPLPGANAALTALVASGLPTDRFLFVGFLKRAKKEKKEQLLSLKTAAETLIFYEAPHRLKETLALMYDIFGN-RRIALGRELTKRFEEFIRGDLSDAVAWAEEHDI--RGEFCLIVE 233
>gi|125574786|gb|EAZ16070.1| hypothetical protein OsJ_030279 [Oryza sativa (japonica cultivar-group)] (370 aa)
Score = 312, Expect = 6.2e-27, Identities = 90/272 (33%), Positives = 137/272 (50%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYL-NELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           ++  L++VATPIGN+++I+  A+  L    +   EDTR+S KLL   NI     +F+  N    +  I     +     L+SDAG P +SDPG  L  L       V  I GPS+ + +L  SG P+    F GFL  +   ++++L     ++ T I +   H I   L      F +S++  IARE+TK++E  +R +I   NE   T   KGE  +LI+  +     I  +ET    +L +EL +L+ +G     A KMVS   S K   +Y
  S:    57 LDSGLYLVATPIGNLEDITLRALRILKCADVILSEDTRHSGKLLQHYNIKTPLLSFHKFNEREREPNILKRLHEGEAVALISDAGTPGISDPGMELARLCATEGIPVIPIPGPSAAIAALSASGLPTDEFTFVGFLPKHARSRKERLEISACQAATQIFYVPPHGIHQFLSDAASSFGDSRSCVIAREITKLHEEFWRGTIGEANEAFATRQPKGEITVLIEGKL-----ISADETPSEDFLEHELRELMTQGHPLSAAVKMVSEATSAKKKDVY 326
>gi|42779115|ref|NP_976362.1| hypothetical protein BCE_0034 [Bacillus cereus ATCC 10987] >gi|42735030|gb|AAS38970.1| conserved hypothetical protein TIGR00096 [Bacillus cereus ATCC 10987] (291 aa)
Score = 312, Expect = 6.2e-27, Identities = 85/275 (30%), Positives = 143/275 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGN-NEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI  L    +   EDTR +KKL N   I     +++  N   + K+ ++  D +     L+SDAG P +SDPG+ ++   +   + V  + G ++ + +LI SG  +    FYGFL  NK  ++ +L +L+    T++ +E+ HR+ DTL  ++E+  N + I + RELTK  E   R ++   I   K  E +GEF IL+  + +E    ++     SVY +    +  KG   K A K V+    L    +Y  +   K
  S:    15 LYLVPTPIGNLEDMTFRAIRILKEADLIAAEDTRQTKKLCNYFEIETPVMSYHEHNKEVSGKKILDKLD-EGKTVALVSDAGMPCISDPGYDIVVEAVAEQYHVIPLPGANAALTALIASGLETKQFYFYGFLQRNKKERKMELEKLRYIQTTMMFYEAPHRLDDTLISMQEVLGN-REIVLCRELTKKFEEFIRGTVEEAIEWTKQNEVRGEFCILVAGSTEEPAPEEQWWETISVYDHIEHYINEKGMNSKEAIKTVAKDRDLSKRDVYQIYHVDK 290
>gi|16802215|ref|NP_463700.1| hypothetical protein lmo0167 [Listeria monocytogenes EGD-e] >gi|16409526|emb|CAC98382.1| lmo0167 [Listeria monocytogenes] (293 aa)
Score = 312, Expect = 6.4e-27, Identities = 84/275 (30%), Positives = 141/275 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVK---ETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI  L    I   EDTRN+ KLLN   I+    +++     N++  I           L+SDAG P +SDPG+ L+   +  N  V  + G ++ + +LI SG       FYGFL      +   + +L    +T I++ES HR+K+TLK I +I  N + I + RELTK  E   R ++ +     + E  +GEF ++I+ N       E +  +E D   +++ +  + ++    K A K V    +L    +Y+ + + K
  S:    16 LYLVPTPIGNLEDMTFRAIRMLKEADIIAAEDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLGGEVVALVSDAGMPSISDPGYELVQSALDANIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIEKLAAREETWILYESPHRLKETLKAIIKITGNDRKIVLCRELTKRFEEFLRGTVEDALNWAMDEEIRGEFCLIIEGNSNPQLAEEQLWWQELDIKTHVSTV--MEQENVSSKDAIKTVMKARNLPKREVYSAYHEIK 293
>gi|166985349|ref|ZP_02256633.1| hypothetical protein BcerAH_23379 [Bacillus cereus AH187] >gi|168163592|ref|ZP_02598825.1| hypothetical protein BcerH_26157 [Bacillus cereus H3081.97] (291 aa)
Score = 312, Expect = 6.4e-27, Identities = 85/275 (30%), Positives = 142/275 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGN-NEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI  L    +   EDTR +KKL N   I     +++  N   + K+ +   D +     L+SDAG P +SDPG+ ++   +   + V  + G ++ + +LI SG  +    FYGFL  NK  ++ +L +L+    T++ +E+ HR+ DTL  ++E+  N + I + RELTK  E   R ++   I   K  E +GEF IL+  + +E    ++     SVY +    +  KG   K A K V+    L    +Y  +   K
  S:    15 LYLVPTPIGNLEDMTFRAIRILKEADLIAAEDTRQTKKLCNYFEIETPVMSYHEHNKEVSGKKILEKLD-EGKTVALVSDAGMPCISDPGYDIVVEAVAEQYHVIPLPGANAALTALIASGLETKQFYFYGFLQRNKKERKMELEKLRYIQTTMMFYEAPHRLDDTLISMQEVLGN-REIVLCRELTKKFEEFIRGTVEEAIEWTKQNEVRGEFCILVAGSTEEPAPEEQWWESISVYDHIEHYINEKGMNSKEAIKTVAKDRDLSKRDVYQIYHVDK 290
>gi|32267244|ref|NP_861276.1| hypothetical protein HH1745 [Helicobacter hepaticus ATCC 51449] >gi|32263297|gb|AAP78342.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449] (286 aa)
Score = 312, Expect = 6.4e-27, Identities = 88/230 (38%), Positives = 141/230 (61%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNIS---------------LENKTFYSLNGNNEKQFINSFDFKDNEYCLL--SDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKN----ESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILIDNNVKETESIKKEET 234
           L +V+TPIGN+++I+  A+       I  CEDTR +KKLL LL IS               +E+K F S + +N+++FI+S   +    C+L  SDAG P +SDPG  LI+  I ++ D  ++ G  +L  +   SG  S+  +F GFL H K  +  +L QL +    +S ++I +ES HRI +TL  I  +  + + I + +ELTK+++  Y  S   +  I   +T +GE+VI+ D +   +  IK+E+T
  S:     2 LILVSTPIGNLEDITLRALEAFKQADIILCEDTRVAKKLLELL-ISRSLLQIPTDMDCQSFIESKQFKSFHSHNQEEFIDSLHKEMFASCVLYLSDAGTPCISDPGAKLISYAITHDIDFDVLPGACALNVAFCGSGIESTPFVFAGFLPHKKTHRHSKLIQLSHLDMGDSYSVICYESPHRILETLHDIALLLPHIR-IIVQKELTKLHQQRYYGSAQEVIAILKDVTIRGEWVIIFDFS---SSHIKQEKT 249
>gi|115482004|ref|NP_001064595.1| Os10g0414500 [Oryza sativa (japonica cultivar-group)] >gi|78708633|gb|ABB47608.1| expressed protein [Oryza sativa (japonica cultivar-group)] >gi|110289078|gb|ABG66076.1| expressed protein [Oryza sativa (japonica cultivar-group)] >gi|113639204|dbj|BAF26509.1| Os10g0414500 [Oryza sativa (japonica cultivar-group)] (335 aa)
Score = 312, Expect = 6.5e-27, Identities = 90/272 (33%), Positives = 137/272 (50%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYL-NELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           ++  L++VATPIGN+++I+  A+  L    +   EDTR+S KLL   NI     +F+  N    +  I     +     L+SDAG P +SDPG  L  L       V  I GPS+ + +L  SG P+    F GFL  +   ++++L     ++ T I +   H I   L      F +S++  IARE+TK++E  +R +I   NE   T   KGE  +LI+  +     I  +ET    +L +EL +L+ +G     A KMVS   S K   +Y
  S:    57 LDSGLYLVATPIGNLEDITLRALRILKCADVILSEDTRHSGKLLQHYNIKTPLLSFHKFNEREREPNILKRLHEGEAVALISDAGTPGISDPGMELARLCATEGIPVIPIPGPSAAIAALSASGLPTDEFTFVGFLPKHARSRKERLEISACQAATQIFYVPPHGIHQFLSDAASSFGDSRSCVIAREITKLHEEFWRGTIGEANEAFATRQPKGEITVLIEGKL-----ISADETPSEDFLEHELRELMTQGHPLSAAVKMVSEATSAKKKDVY 326
>gi|29377233|ref|NP_816387.1| tetrapyrrole methylase family protein [Enterococcus faecalis V583] >gi|29344699|gb|AAO82457.1| tetrapyrrole methylase family protein [Enterococcus faecalis V583] (290 aa)
Score = 312, Expect = 6.5e-27, Identities = 84/269 (31%), Positives = 137/269 (50%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLI--RKGEKEKVACKMVSYKYSLKSNSLY 272
           KL++V TPIGN++++S   +  L   ++   EDTRN++KLLN   I+    + +  N       + +          +SDAG P +SDPG  L+   ++    V  + GP++ M +LI SG       FYGFL   K  ++D L+ LK E  T I +ES +RI  T+    E++   +   I RELTK++E   R ++  + E   + T KGE  +L+     E E+I       ++ L E  +++   +G   K A K V+   ++K   +Y
  S:    15 KLYLVPTPIGNLEDMSIRCLNILKEATVIASEDTRNTQKLLNHFEITTPQISLHEHNYKERIPQLITRLLNGETIAQVSDAGMPSISDPGHELVTACLEEELAVIALPGPTAGMTALIASGLLPQPFTFYGFLPRKKKEQKDVLSALKEERPTQIFYESPYRIAKTVATFAEVYGQERPAVICRELTKLHEEYLRGTLGELTEYLAENTLKGECCLLVSGFTGEKETIAAMP---AISLKEHVQVLMEEEGRSSKEAIKEVAKLRNVKKQEVY 284
>gi|110602215|ref|ZP_01390346.1| Protein of unknown function UPF0011 [Geobacter sp. FRC-32] >gi|110547076|gb|EAT60371.1| Protein of unknown function UPF0011 [Geobacter sp. FRC-32] (287 aa)
Score = 312, Expect = 6.5e-27, Identities = 78/227 (34%), Positives = 133/227 (58%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKI---TEKGEFVILI-----DNNVKETESIKK 231
           L+IVATPIGN+++I+  A+  L    +   EDTR+S+KLL+   IS    +++  N   + ++I     +     L++DAG P +SDPG+ L+   +   + V  + GPS+ + +L  SG P+   +F GFL + +  ++++L  +K E + +I +ES +R+  TL  ++E+    + + +ARELTK+ E   R S + + E K+   T KGE VIL+     D     TES+ +
  S:    14 LYIVATPIGNLEDITFRAVRILREADLIAAEDTRHSRKLLSHFGISKPLTSYFDHNKELKGRYILDQLAEGVSVALITDAGTPCISDPGYQLVRDAVAAGFAVVPVPGPSAAVTALSASGLPTDAFVFEGFLPNKQGKRREKLAMVKGEQRVVIFYESPNRLLATLMDLREVL-GERELVVARELTKIYEEFIRGSCSPVIE-KLQDRTIKGEVVILVAPAAADPEHDATESVAE 246
>gi|116871568|ref|YP_848349.1| tetrapyrrole methylase family protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116740446|emb|CAK19566.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (293 aa)
Score = 312, Expect = 6.6e-27, Identities = 74/218 (33%), Positives = 117/218 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNN 222
           L++V TPIGN+++++  AI  L    I   EDTRN+ KLLN   I+    +++     N++  I           L+SDAG P +SDPG+ L+   +  +  V  + G ++ + +LI SG       FYGFL      +  ++ +L    +T I++ES HR+K+TLK I +I  N + I + RELTK  E   R ++ +       E  +GEF I+I+ N
  S:    16 LYLVPTPIGNLEDMTFRAIRMLKEADIIAAEDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLDGEVVALVSDAGMPSISDPGYELVQRALNASIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQEIEKLAAREETWILYESPHRLKETLKAIIKITGNDRKIVLCRELTKRFEEFLRGTVEDALNWATDEEVRGEFCIIIEGN 235
>gi|56707397|ref|YP_169293.1| tetrapyrrole methyltransferase family protein [Francisella tularensis subsp. tularensis SCHU S4] >gi|110669868|ref|YP_666425.1| tetrapyrrole methyltransferase family protein [Francisella tularensis subsp. tularensis FSC198] >gi|56603889|emb|CAG44873.1| tetrapyrrole methyltransferase family protein [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320201|emb|CAL08256.1| tetrapyrrole methyltransferase family protein [Francisella tularensis subsp. tularensis FSC 198] >gi|151569146|gb|EDN34800.1| SAM-dependent methyltransferase [Francisella tularensis subsp. tularensis FSC033] (290 aa)
Score = 312, Expect = 6.8e-27, Identities = 91/268 (33%), Positives = 151/268 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENK--TFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++VATPIGN+++I+  A+  L+N  I   EDTR + KLL  LNI    K  + +  N  +  Q++           L+SDAG P++SDPG+ ++    K N+ V  I G S+++ +L  +G PS + +F GFL+   N +Q Q+ + +  + T+I++ESVHRI   L+ + E+  NS NI +A+ELTK  E     S+  + +     + T +GEFV++ D N   ++S   +  +  + ++EL K +        A K+V+     K N +Y
  S:     9 LYVVATPIGNLEDITYRALNVLSNVDIILAEDTRVTAKLLASLNIRNNQKLVSCHDFNEESRVQYVKELLDAAKSIALVSDAGTPLISDPGYKIVANLRKENYKVVPIPGVSAVITALSAAGLPSDSFIFKGFLSAKHNKRQQQIREFQQINTTVILYESVHRINYLLEDLLELLPNS-NIVVAKELTKQFENFVFGSVQQVYDYFQANQDTLRGEFVVIFDCN---SDSEVNDSNNLKIDVDELLKDLLDEMPLNKAVKLVTKITGAKKNFVY 278
>gi|192813935|ref|ZP_03042589.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Geobacillus sp. Y412MC10] >gi|192797245|gb|EDV73771.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Geobacillus sp. Y412MC10] (262 aa)
Score = 311, Expect = 7.2e-27, Identities = 65/216 (30%), Positives = 119/216 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILI 219
           +L +V TPIGN+++I+  A+ TL    +  CEDTR +  LL    I            +  ++ +  + +        +DAG P +SDPG  L+ L ++  W V+ + GP++L+ +L+ SG P+    F GFL      ++++L  L  E +T +++ES HR++ TL+ + E +  +  + +ARE++K++E ++R S+          KGEFV+++
  S:     2 RLVLVPTPIGNLEDITLRALRTLKEAEVVACEDTRRTGLLLRHYGIPTPTLRLDQHTLDRARELLAPYAY----VAYATDAGTPGISDPGAELVRLALEWGWRVEALPGPTALIPALVASGLPTHRFTFEGFLPKAGRERKERLRALAREGRTAVLYESPHRLRKTLEDLMEAYGEAHPVAVAREISKVHEEVFRGSLKEAWARFAEPKGEFVLVL 213
>gi|167211219|ref|ZP_02281526.1| hypothetical protein LmonL_01412 [Listeria monocytogenes LO28] (293 aa)
Score = 311, Expect = 7.3e-27, Identities = 84/275 (30%), Positives = 141/275 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVK---ETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI  L    I   EDTRN+ KLLN   I+    +++     N++  I           L+SDAG P +SDPG+ L+   +  N  V  + G ++ + +LI SG       FYGFL      +   + +L    +T I++ES HR+K+TLK I +I  N + I + RELTK  E   R ++ +     + E  +GEF ++I+ N       E +  +E D   +++ +  + ++    K A K V    +L    +Y+ + + K
  S:    16 LYLVPTPIGNLEDMTFRAIRMLKEVDIIAAEDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLGGEVVALVSDAGMPSISDPGYELVQSALDANIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIEKLAAREETWILYESPHRLKETLKAIIKITGNDRKIVLCRELTKRFEEFLRGTVEDALNWAMDEEIRGEFCLIIEGNSNPPLAEEQLWWQELDIKTHVSTV--MEQENVSSKDAIKTVMKARNLPKREVYSAYHEIK 293
>gi|196238271|ref|ZP_03137047.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Cyanothece sp. PCC 7425] >gi|196218061|gb|EDY12704.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Cyanothece sp. PCC 7425] (293 aa)
Score = 311, Expect = 7.5e-27, Identities = 80/270 (29%), Positives = 139/270 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IVATPIGN++++S  A+  L +  +   EDTR++ KLL    I     +F+S N       +     +     L++DAG P ++DPG+ L+   +     V  I G ++ + +L  +G P+   +F GFL      ++D+L  L  E++TI+++E+ HR+  TL  +  I    +++  ARELTKM+E  +R ++A  I     TE KGEF ++I     E  +   E    +     L +L+++G     A + ++ +  L    +Y  
  S:    12 LYIVATPIGNLEDMSFRAVRILQSVDLIAAEDTRHTGKLLQHFQIDTPQLSFFSHNIQQRLPELLQRLQQRQAIALVTDAGMPTIADPGYELVCACVAAEIPVVPIPGANAALTALSAAGLPTGRFVFEGFLPSKGQERRDRLEALGRETRTIVLYEAPHRLLQTLTDLLPICTGDRSVVAARELTKMHEQFWRGTLAEAIAHYTQTEPKGEFTLVIAGAEIELPTFSPEALKIA-----LTELLQQGLSRSQASRQLAEQTQLSRREIYQL 278
>gi|91212564|ref|YP_542550.1| hypothetical protein UTI89_C3573 [Escherichia coli UTI89] >gi|110643387|ref|YP_671117.1| putative tetrapyrrole methylase [Escherichia coli 536] >gi|117625442|ref|YP_858765.1| putative methyltransferase [Escherichia coli APEC O1] >gi|170681783|ref|YP_001745419.1| tetrapyrrole methylase family protein [Escherichia coli SMS-3-5] >gi|191172169|ref|ZP_03033712.1| tetrapyrrole methylase family protein [Escherichia coli F11] >gi|91074138|gb|ABE09019.1| hypothetical protein UTI89_C3573 [Escherichia coli UTI89] >gi|110344979|gb|ABG71216.1| putative tetrapyrrole methylase [Escherichia coli 536] >gi|115514566|gb|ABJ02641.1| putative methyltransferase [Escherichia coli APEC O1] >gi|170519501|gb|ACB17679.1| tetrapyrrole methylase family protein [Escherichia coli SMS-3-5] >gi|190907479|gb|EDV67075.1| tetrapyrrole methylase family protein [Escherichia coli F11] (287 aa)
Score = 311, Expect = 7.8e-27, Identities = 74/226 (32%), Positives = 129/226 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESI 229
           +L+IV TPIGN+ +I++ A+  L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  ++ E +T+I +ES HR+ D+L+ I  +   S+ + +ARELTK  ETI+ + +    A + E +   KGE V++++ +  + E +
  S:    13 QLYIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGI---NARLFALHDHNEQQKAETLLAKLQEGQNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIEAEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQEEDL 242
>gi|15803688|ref|NP_289722.1| hypothetical protein Z4505 [Escherichia coli O157:H7 EDL933] >gi|15833281|ref|NP_312054.1| hypothetical protein ECs4027 [Escherichia coli O157:H7 str. Sakai] >gi|16131038|ref|NP_417615.1| predicted methyltransferase [Escherichia coli str. K-12 substr. MG1655] >gi|74313683|ref|YP_312102.1| hypothetical protein SSON_3292 [Shigella sonnei Ss046] >gi|82778461|ref|YP_404810.1| hypothetical protein SDY_3325 [Shigella dysenteriae Sd197] >gi|89109911|ref|AP_003691.1| predicted methyltransferase [Escherichia coli W3110] >gi|168708720|ref|ZP_02740997.1| hypothetical protein EschericoliO157_13814 [Escherichia coli O157:H7 str. EC4045] >gi|168718130|ref|ZP_02750407.1| hypothetical protein EschericcoliO157_10307 [Escherichia coli O157:H7 str. EC4206] >gi|168734680|ref|ZP_02766957.1| hypothetical protein EschecoliO157_06485 [Escherichia coli O157:H7 str. EC4115] >gi|168749260|ref|ZP_02774282.1| tetrapyrrole methylase family protein [Escherichia coli O157:H7 str. EC4113] >gi|168754125|ref|ZP_02779132.1| tetrapyrrole methylase family protein [Escherichia coli O157:H7 str. EC4401] >gi|168762110|ref|ZP_02787117.1| tetrapyrrole methylase family protein [Escherichia coli O157:H7 str. EC4501] >gi|168769562|ref|ZP_02794569.1| tetrapyrrole methylase family protein [Escherichia coli O157:H7 str. EC4486] >gi|168773189|ref|ZP_02798196.1| tetrapyrrole methylase family protein [Escherichia coli O157:H7 str. EC4196] >gi|168781288|ref|ZP_02806295.1| tetrapyrrole methylase family protein [Escherichia coli O157:H7 str. EC4076] >gi|168786029|ref|ZP_02811036.1| tetrapyrrole methylase family protein [Escherichia coli O157:H7 str. EC869] >gi|168791534|ref|ZP_02816541.1| hypothetical protein EschercoliO157_03615 [Escherichia coli O157:H7 str. EC4042] >gi|168797745|ref|ZP_02822752.1| tetrapyrrole methylase family protein [Escherichia coli O157:H7 str. EC508] >gi|170082683|ref|YP_001732003.1| methyltransferase [Escherichia coli str. K12 substr. DH10B] >gi|194433730|ref|ZP_03066005.1| tetrapyrrole methylase family protein [Shigella dysenteriae 1012] >gi|194438769|ref|ZP_03070855.1| tetrapyrrole methylase family protein [Escherichia coli 101-1] >gi|195938366|ref|ZP_03083748.1| hypothetical protein EscherichcoliO157_18356 [Escherichia coli O157:H7 str. EC4024] >gi|54042948|sp|P67087|YRAL_ECOLI UPF0011 protein yraL >gi|54040613|sp|P67088|YRAL_ECO57 UPF0011 protein yraL >gi|12517751|gb|AAG58282.1|AE005543_12 orf, hypothetical protein [Escherichia coli O157:H7 EDL933] >gi|606086|gb|AAA57949.1| ORF_f286 [Escherichia coli] >gi|1789535|gb|AAC76180.1| predicted methyltransferase [Escherichia coli str. K-12 substr. MG1655] >gi|13363500|dbj|BAB37450.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] >gi|73857160|gb|AAZ89867.1| conserved hypothetical protein [Shigella sonnei Ss046] >gi|81242609|gb|ABB63319.1| conserved hypothetical protein [Shigella dysenteriae Sd197] >gi|85675942|dbj|BAE77192.1| predicted methyltransferase [Escherichia coli W3110] >gi|169890518|gb|ACB04225.1| predicted methyltransferase [Escherichia coli str. K12 substr. DH10B] >gi|187770789|gb|EDU34633.1| tetrapyrrole methylase family protein [Escherichia coli O157:H7 str. EC4196] >gi|188016346|gb|EDU54468.1| tetrapyrrole methylase family protein [Escherichia coli O157:H7 str. EC4113] >gi|189001066|gb|EDU70052.1| tetrapyrrole methylase family protein [Escherichia coli O157:H7 str. EC4076] >gi|189358425|gb|EDU76844.1| tetrapyrrole methylase family protein [Escherichia coli O157:H7 str. EC4401] >gi|189361465|gb|EDU79884.1| tetrapyrrole methylase family protein [Escherichia coli O157:H7 str. EC4486] >gi|189367597|gb|EDU86013.1| tetrapyrrole methylase family protein [Escherichia coli O157:H7 str. EC4501] >gi|189374011|gb|EDU92427.1| tetrapyrrole methylase family protein [Escherichia coli O157:H7 str. EC869] >gi|189379751|gb|EDU98167.1| tetrapyrrole methylase family protein [Escherichia coli O157:H7 str. EC508] >gi|194417993|gb|EDX34087.1| tetrapyrrole methylase family protein [Shigella dysenteriae 1012] >gi|194422241|gb|EDX38242.1| tetrapyrrole methylase family protein [Escherichia coli 101-1] (286 aa)
Score = 311, Expect = 7.8e-27, Identities = 74/226 (32%), Positives = 129/226 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESI 229
           +L+IV TPIGN+ +I++ A+  L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  ++ E +T+I +ES HR+ D+L+ I  +   S+ + +ARELTK  ETI+ + +    A + E +   KGE V++++ +  + E +
  S:    13 QLYIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGI---NARLFALHDHNEQQKAETLLAKLQEGQNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIEAEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQEEDL 242
>gi|193076766|gb|ABO11480.2| putative methyltransferase [Acinetobacter baumannii ATCC 17978] (278 aa)
Score = 311, Expect = 8.0e-27, Identities = 81/235 (34%), Positives = 137/235 (58%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETD 235
           M+ +LF+VATPIG++ +++  AI  L + S+   EDTR S +L    NIS      +  N +N+ +Q +      +N   L+SDAG P++SDPGF L+    +N   V  + G  + + +L   G PS    F GFL    + +  QL +LKNE++T+I +E+ HRI + +K + E+F  ++ +  ARE+TK  ETI + ++ +    I      EKGE V+++    ++T+ +++E+ D
  S:     1 MSAQLFVVATPIGHLDDMTFRAIDILKSVSVVAAEDTRQSAQLFKHYNISTPLTACHDHNESNKIEQLVQKLLAGEN-IALISDAGTPLISDPGFKLVRAAQENGIRVVPVPGACAAIAALSAVGLPSDRFSFEGFLPSKASQRISQLEKLKNETQTLIFYEAPHRILECVKNMAEVFGENRPVGFAREITKTFETIKKMTLKDLVSFIENDHNQEKGEIVLVVGGAPEKTD-LEQEKLD 238
>gi|16799287|ref|NP_469555.1| hypothetical protein lin0210 [Listeria innocua Clip11262] >gi|16412629|emb|CAC95443.1| lin0210 [Listeria innocua] (293 aa)
Score = 311, Expect = 8.3e-27, Identities = 85/275 (30%), Positives = 140/275 (50%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVK---ETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI  L    I   EDTRN+ KLLN   I+    +++     N++  I           L+SDAG P +SDPG+ L+   +  N  V  + G ++ + +LI SG       FYGFL      +   + +L    +T I++ES HR+K+TLK I +I  N + + + RELTK  E   R ++ +       E  +GEF I+I+ N     E E +  +E D   +++ +  + ++    K A K V    +L    +Y  + + K
  S:    16 LYLVPTPIGNLEDMTFRAIRMLKEADIIAAEDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLDGEVVALVSDAGMPSISDPGYELVQNALNANIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIEKLAAREETWILYESPHRLKETLKAIIKITGNDRKMVLCRELTKRFEEFLRGTVEDALNWATDEEVRGEFCIIIEGNANPPLEEELLWWQELDIKTHVSTV--MEQENISSKDAIKTVMKARNLPKREVYAAYHEIK 293
>gi|163754457|ref|ZP_02161579.1| methyltransferase [Kordia algicida OT-1] >gi|161325398|gb|EDP96725.1| methyltransferase [Kordia algicida OT-1] (222 aa)
Score = 311, Expect = 8.5e-27, Identities = 73/217 (33%), Positives = 117/217 (53%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILID 220
           KL+IV TPIGN+K+++  A+  L N  +   EDTR S KLL    I    ++ +  N +   + +         + L+SDAG P +SDPGFLL    I N   V+ + G ++ + +L+ SG P+   +F GFL   K  +Q +   L  E++T+I +ES H++  TL    E F   + + ++RELTK+ E   R S   +      +  KGE V++++
  S:     2 KLYIVPTPIGNLKDMTFRAVEVLKNVDMILAEDTRTSGKLLKHFEIGTHMQSHHMHNEHKTTETLIKRMQAGETFALISDAGTPAISDPGFLLTRECIANQIPVECLPGATAFVPALVNSGLPNDKFVFEGFLPVKKG-RQTRFKILAEETRTMIFYESPHKLVKTLGHFCEYFGEDRQVSVSRELTKLYEETIRGSAKEVLAYYQNKPPKGEIVVVVE 219
>gi|47570440|ref|ZP_00241076.1| conserved hypothetical protein protein TIGR00096 [Bacillus cereus G9241] >gi|47552898|gb|EAL11313.1| conserved hypothetical protein protein TIGR00096 [Bacillus cereus G9241] (291 aa)
Score = 311, Expect = 8.7e-27, Identities = 88/275 (32%), Positives = 144/275 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGN-NEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLI-RKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI  L    +   EDTR +KKL N   I     +++  N   + K+ +   D +     L+SDAG P +SDPG+ ++   +   + V  + G ++ + +LI SG  +    FYGFL  NK  ++ +L +L+    T++ +E+ HR+ DTL  ++E+  N + I + RELTK  E   R ++   I   K  E +GEF IL+  + +E    ++     SVY N +E  I  KG   K A K V+    L    +Y  +   K
  S:    15 LYLVPTPIGNLEDMTFRAIRILKEADLIAAEDTRQTKKLCNYFEIETPVMSYHEHNKEVSGKKILEKLD-EGKTVALVSDAGMPCISDPGYDIVVEAVAEQYYVIPLPGANAALTALIASGLETKQFYFYGFLQRNKKERKMELEKLRYIQTTMMFYEAPHRLDDTLISMQEVLGN-REIVLCRELTKKFEEFIRGTVEEAIEWTKQNEVRGEFCILVAGSTEEPAPEEQWWESISVY-NHIEHYINEKGMNSKEAIKTVAKDRDLSKRDVYQIYHVDK 290
>gi|157157560|ref|YP_001464621.1| tetrapyrrole methylase family protein [Escherichia coli E24377A] >gi|191168038|ref|ZP_03029838.1| tetrapyrrole methylase family protein [Escherichia coli B7A] >gi|193062070|ref|ZP_03043166.1| tetrapyrrole methylase family protein [Escherichia coli E22] >gi|193067424|ref|ZP_03048392.1| tetrapyrrole methylase family protein [Escherichia coli E110019] >gi|194427713|ref|ZP_03060260.1| tetrapyrrole methylase family protein [Escherichia coli B171] >gi|157079590|gb|ABV19298.1| tetrapyrrole methylase family protein [Escherichia coli E24377A] >gi|190901907|gb|EDV61656.1| tetrapyrrole methylase family protein [Escherichia coli B7A] >gi|192932290|gb|EDV84888.1| tetrapyrrole methylase family protein [Escherichia coli E22] >gi|192959381|gb|EDV89816.1| tetrapyrrole methylase family protein [Escherichia coli E110019] >gi|194414221|gb|EDX30496.1| tetrapyrrole methylase family protein [Escherichia coli B171] (286 aa)
Score = 311, Expect = 8.8e-27, Identities = 75/226 (33%), Positives = 129/226 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESI 229
           +L+IV TPIGN+ +I++ A+  L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  ++ E +T+I +ES HR+ D+L+ I  +   S+ + +ARELTK  ETI+ + +    A + E +   KGE V++I+ +  + E +
  S:    13 QLYIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGI---NARLFALHDHNEQQKAETLLAKLQEGQNIALVSDAGTPLINDPGYHLVRTCREAGICVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIEAEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIIEGHKAQEEDL 242
>gi|168185097|ref|ZP_02619761.1| tetrapyrrole methylase family protein [Clostridium botulinum Bf] >gi|182671847|gb|EDT83808.1| tetrapyrrole methylase family protein [Clostridium botulinum Bf] (284 aa)
Score = 311, Expect = 8.9e-27, Identities = 86/271 (31%), Positives = 156/271 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           KL++V TPIGN+++I+  A+  L +  I   EDTR + KLLN  NI     +++  N  ++   I +   +  +  L+SDAG P +SDPG++LI   I+     +++ G ++   +L+ SG  ++  +F GF+      +Q  +  +K+  +T+I +ES HR+K+ LK +++   N +NI I RELTK++E I R S+   + IK  E    KGE+V++++    E    +KE    S+ + + ++K I +G  +K + K+V+    +  + +Y +
  S:     8 KLYVVPTPIGNLRDITIRALDVLEDVDIIAAEDTRQTLKLLNHFNIKKTLISYHKFNEEDKSINIINNLKEGKKIALVSDAGMPGISDPGYVLIKKCIEEQIIFEVLPGATAFTTALVYSGMDTTKFIFKGFIPRENKNRQKLIQDIKDRMETLIFYESPHRLKECLKFLRDSLGN-RNISICRELTKLHEEIIRDSLE--DAIKYYEHQQPKGEYVLVLEGKSIEEIEKEKEMEWSSINIQDHIKKYINEGYSKKESIKLVAKDRKITKSEVYKY 280
>gi|153812011|ref|ZP_01964679.1| hypothetical protein RUMOBE_02404 [Ruminococcus obeum ATCC 29174] >gi|149831910|gb|EDM86996.1| hypothetical protein RUMOBE_02404 [Ruminococcus obeum ATCC 29174] (279 aa)
Score = 310, Expect = 9.0e-27, Identities = 87/274 (31%), Positives = 151/274 (55%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDN-EYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEK--GEFVILID----NNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           M+ KL++ ATPIGN+++I+   + TL    +   EDTRNS KLLN   I     +++  N   EK +      ++     L++DAG P +SDPG  L  +  +   +V  + GP++ + +L +SG P+    F  FL  +K  +++ L +L NE++TII++E+ H++  TL+ ++E   N + + + RELTK +ET + S+I ++      EK  GE V++I+      +KE  +   EE     ++   EK   +G   K A K V+    +    +Y++
  S:     1 MSGKLYLCATPIGNLEDITLRVLRTLKEVDLIAAEDTRNSIKLLNHFEIKTPMTSYHEYN-KIEKAYTLIEKMQNGMNIALITDAGTPGISDPGEELAAMCYEAGIEVTSLPGPAACITALTLSGLPTRRFAFEAFLPMDKKERKEVLEELVNETRTIILYEAPHKLVRTLRDLRETLGN-RRMTLCRELTKKHETAFHSTIDDLITHYEKEKPLGECVLVIEGKSRQELKEEAAASWEEISIEEHMEIYEK---QGMSRKDAMKQVAKDRGVSKRDIYSY 276
>gi|118475808|ref|YP_892959.1| uroporphyrin-III C-methyltransferase [Bacillus thuringiensis str. Al Hakam] >gi|196047369|ref|ZP_03114582.1| tetrapyrrole methylase family protein [Bacillus cereus 03BB108] >gi|118415033|gb|ABK83452.1| uroporphyrin-III C-methyltransferase [Bacillus thuringiensis str. Al Hakam] >gi|196021771|gb|EDX60465.1| tetrapyrrole methylase family protein [Bacillus cereus 03BB108] (291 aa)
Score = 310, Expect = 9.0e-27, Identities = 87/275 (31%), Positives = 141/275 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLI-RKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI  L    +   EDTR +KKL N   I     +++  N     + I     +     L+SDAG P +SDPG+ ++   +   + V  + G ++ + +LI SG  +    FYGFL  NK  ++ +L +L+    T++ +E+ HR+ DTL  ++E+  N + I + RELTK  E   R ++   I   K  E +GEF IL+  + +E    ++     SVY N +E  I  KG   K A K V+    L    +Y  +   K
  S:    15 LYLVPTPIGNLEDMTFRAIRILKEADLIAAEDTRQTKKLCNYFEIETPVMSYHEHNKEVSGKKILEKLEEGKTVALVSDAGMPCISDPGYDIVVEAVAEQYHVIPLPGANAALTALIASGLQTKQFYFYGFLQRNKKERKMELEKLRYVQTTMMFYEAPHRLDDTLISMQEVLGN-REIVLCRELTKKFEEFIRGTVEEAIEWTKQNEVRGEFCILVAGSTEEPAPEEQWWESISVY-NHIEHYINEKGMNSKEAIKTVAKDRDLSKRDVYQIYHVDK 290
>gi|187605635|ref|ZP_02991826.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Exiguobacterium sp. AT1b] >gi|187482332|gb|EDU20345.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Exiguobacterium sp. AT1b] (289 aa)
Score = 310, Expect = 9.7e-27, Identities = 78/273 (28%), Positives = 139/273 (50%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           L++V TPIGN+++++  A+ TL    +   EDTR + KL    +I+ +  +++  N       +           ++SDAG P +SDPG  L+ L I+ N  V ++ G ++ + +L+ SG  +   L+YGFL   K  + + L  ++ E  T+I +E+ HR+K+ L  I+++F N + I + RELTK  E   R ++   +   +   +GEFV+L+    +   +    E   S Y   +   I +G+K   A K  +       N +Y+ + Q
  S:    14 LYVVPTPIGNLEDMTYRAVRTLQEVDLIAAEDTRQTMKLCRHFDIATKLISYHEHNKEVSGPRLIDDLLSGKSIAVVSDAGMPGISDPGSDLVRLAIEANIPVVVLPGANAALTALVASGLATERFLYYGFLPRKKKDRVEVLESIQYEPGTVIFYEAPHRLKEMLTAIRQVFGN-RQIVLGRELTKTFEEFLRGTVDEALTWCEGEVRGEFVVLVSGATEAAPTTTWWEA-LSTY-EHVVHYIEEGQKPNAAIKQTAKDRGESRNDVYDAYHQ 284
>gi|49475950|ref|YP_033991.1| hypothetical protein BH12360 [Bartonella henselae str. Houston-1] >gi|49238758|emb|CAF28018.1| hypothetical protein [Bartonella henselae str. Houston-1] (295 aa)
Score = 310, Expect = 9.7e-27, Identities = 80/231 (34%), Positives = 131/231 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK---QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE---KGEFVILIDNNVKETESIKKEETD 235
           L++VATPIGN+ +I+  A+  L    I  CEDTR ++ LL    I  + KTF     N +K   + + + + ++    L+SDAG P++SDPGF L+    K    +  I G S+L+ +L+ +G P+ +  F GFL+  K  +Q +L QLK    T++ +ES HR+ +TL+ +  +F   +   I RELTK  ET+  S++ N++E    +   +GE V+L+   +     +   E D
  S:    22 LYLVATPIGNLADITLRALQVLAGVDILACEDTRVTRVLLERYGI--QKKTFLYHEYNAQKAGPKLLTALE-ENKAIALVSDAGTPLISDPGFRLVEEARKAGHKIVPIPGASALLAALVATGLPTDSFFFAGFLSARKAQRQKRLEQLKTIPATLVFYESPHRLVETLQDMVALFSADRPAAICRELTKKFETVDVSNLGNLSESYGKQAHIRGEIVVLVGQKLSSLNVMSDHEID 255
>gi|168181162|ref|ZP_02615826.1| tetrapyrrole methylase family protein [Clostridium botulinum NCTC 2916] >gi|182667999|gb|EDT79978.1| tetrapyrrole methylase family protein [Clostridium botulinum NCTC 2916] (284 aa)
Score = 310, Expect = 1.0e-26, Identities = 86/271 (31%), Positives = 156/271 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           KL++V TPIGN+++I+  A+  L +  I   EDTR + KLLN  NI     +++  N  ++   I +   +  +  L+SDAG P +SDPG++LI   I+     +++ G ++   +L+ SG  ++  +F GF+      +Q  +  +K+  +T+I +ES HR+K+ LK +++   N +NI I RELTK++E I R S+  +  IK  E    KGE+V++++    E    +KE    S+ + + ++K I +G  +K + K+V+    +  + +Y +
  S:     8 KLYVVPTPIGNLRDITIRALDVLEDVDIIAAEDTRQTLKLLNHFNIKKTLISYHKFNEEDKSINIINNLKEGKKIALVSDAGMPGISDPGYVLIKKCIEEQIIFEVLPGATAFTTALVYSGMDTTKFIFKGFIPRENKNRQKLIQDIKDRMETLIFYESPHRLKECLKFLRDSLGN-RNISICRELTKLHEEIIRDSLEEV--IKYYENKQPKGEYVLVLEGKSIEEIEKEKEMEWSSINIQDHIKKYINEGYSKKESIKLVAKDRKITKSEVYKY 280
>gi|116491387|ref|YP_810931.1| methyltransferase [Oenococcus oeni PSU-1] >gi|116092112|gb|ABJ57266.1| Predicted methyltransferase [Oenococcus oeni PSU-1] (287 aa)
Score = 310, Expect = 1.1e-26, Identities = 94/277 (33%), Positives = 146/277 (52%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRKN 280
           KL++V TPIGN+ +++  A++TL    +   EDTR+S  LL    I    K   SL+ +N  Q +     K  +      +SDAG P +SDPG  L+   I+N  DV  + G S+ + +LI SG P+    F GFL+   + ++ QL +L     T+I +ES  R+  TL+ ++ IF     + +ARELTK  E+ YR  I   +N IK    +GEFV+LI    K  E+I   +    + ++ +++ I  G K   A K V+    L    +Y  + + KN
  S:    13 KLYLVPTPIGNLDDMTIRAVSTLKEVDLIAAEDTRHSGILLQHFQI---KKDLISLHEHNYAQRVPELVDKLKKGLNIAQISDAGMPSISDPGHELVLAAIQNGVDVISLPGASAGITALIASGLPADKFTFIGFLSKKDSEQKKQLEELMPLDSTLIFYESPFRVGKTLENVRAIFGEKTKVVLARELTKKFESYYRGDITQALNFIKSNRPRGEFVLLIK---KIHEAIVPSD---ELIVDLIDERIASGTKPIDAIKAVAKLLGLIRADVYKIYHKEKN 285
>gi|125718518|ref|YP_001035651.1| hypothetical protein SSA_1719 [Streptococcus sanguinis SK36] >gi|125498435|gb|ABN45101.1| Conserved uncharacterized protein [Streptococcus sanguinis SK36] (289 aa)
Score = 309, Expect = 1.3e-26, Identities = 81/274 (29%), Positives = 141/274 (51%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKET-ESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           KL++VATPIGN+ ++S   + TL    +   EDTRN+  LL    I  +  +F+  N   +   +      +N+   +SDAG P +SDPG  L+   +     V  I GPS+ + +LI SG      +FYGFL      +++     K+  +T I +ES HR++ TL+ +  ++ + + + + RELTK++E   R  I+ +         KGE ++++    ++  + I +E+      L E++ L+  G K+  A K V+ KY    + LY  + +
  S:    15 KLYLVATPIGNLDDMSIRMVNTLKEVDMIAAEDTRNTGLLLKHFGIETKQISFHEHNAKEKIPVLLDMLQSENDIAQVSDAGLPSISDPGHDLVQAALDAGITVVPIPGPSAGITALIASGLAPQPHIFYGFLPRKAGQQKEFFTSKKSYPETQIFYESPHRVRSTLENMLAVYGD-RQVILVRELTKIHEEYQRGLISELLAYTAEHPPKGECLLIVAGAAEDALQDISQEQI-----LAEIDLLVEAGSKKNHAIKNVAKKYGRNKSELYAVYHE 285
>gi|118602117|ref|YP_903332.1| hypothetical protein Rmag_0059 [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567056|gb|ABL01861.1| Protein of unknown function UPF0011 [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (276 aa)
Score = 309, Expect = 1.3e-26, Identities = 79/231 (34%), Positives = 131/231 (56%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILID-----NNVKETESIKK 231
           MN  L+IVATPIGN+ +I+  AI TL    I   EDTR+SK LLN  +I+   + F+  N   +   + +         L+SDAG P++SDPG++L++   K + +V  I G ++++ ++  SG  S    F+GFL   ++ +   +  + + ++  I +ES  RI    + ++ I  N + +C A+ELTK+ ETI  +++  + +        +KGEFVILI      N + E E + K
  S:     1 MNGTLYIVATPIGNLDDITFRAIETLKIVDIILAEDTRHSKHLLNHYDITTSMRAFHEHNEKRKTPDVINELLAGKHIALISDAGTPLISDPGYILVSEAKKADINVSPIPGSNAMISAISASGIASDKFSFFGFLPSKQSARLKVIRSIAHINEVAIFYESPKRILSCAQDLQVILGNERIVCFAKELTKLFETINTNTLPKLIDYLQADDAHQKGEFVILISAMDKGNKISEEEILDK 240
>gi|170765523|ref|ZP_02900334.1| tetrapyrrole methylase family protein [Escherichia albertii TW07627] >gi|170124669|gb|EDS93600.1| tetrapyrrole methylase family protein [Escherichia albertii TW07627] (287 aa)
Score = 309, Expect = 1.4e-26, Identities = 74/226 (32%), Positives = 128/226 (56%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESI 229
           +L+IV TPIGN+ +I++ A+  L    +   EDTR++  LL    I   N   ++L+ +NE Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  ++ E +T+I +ES HR+ D+L+ I  +   S+ + +ARELTK  ETI+ + +    A + E +   KGE V++++ +  + E +
  S:    13 QLYIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGI---NARLFALHDHNEHQKAETLLAKLQEGQNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIEAEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQEEDL 242
>gi|184157408|ref|YP_001845747.1| methyltransferase [Acinetobacter baumannii ACICU] >gi|183209002|gb|ACC56400.1| predicted methyltransferase [Acinetobacter baumannii ACICU] (278 aa)
Score = 309, Expect = 1.4e-26, Identities = 80/235 (34%), Positives = 137/235 (58%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETD 235
           M+ +LF+VATPIG++ +++  AI  L + S+   EDTR S +L    NIS      +  N +N+ +Q +      +N   L+SDAG P++SDPGF L+    ++   V  + G  + + +L   G PS    F GFL    + +  QL +LKNE++T+I +E+ HRI + +K + E+F  ++ +  ARE+TK  ETI + ++ +    I      EKGE V+++    ++T+ +++E+ D
  S:     1 MSAQLFVVATPIGHLDDMTFRAIDILKSVSVVAAEDTRQSAQLFKHYNISTPLTACHDHNESNKIEQLVQKLLAGEN-IALISDAGTPLISDPGFKLVRAAQEHGIRVVPVPGACAAIAALSAVGLPSDRFSFEGFLPSKASQRITQLEKLKNETQTLIFYEAPHRILECVKNMAEVFGENRPVGFAREITKTFETIKKMTLKDLVSFIENDHNQEKGEIVLVVGGAAEKTD-LEQEKLD 238
>gi|189424208|ref|YP_001951385.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Geobacter lovleyi SZ] >gi|189420467|gb|ACD94865.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Geobacter lovleyi SZ] (278 aa)
Score = 309, Expect = 1.4e-26, Identities = 84/272 (30%), Positives = 140/272 (51%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILI---DNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           M   L+IVATPIGN+++++  A+  L    +   EDTR+S+KLL+   I+    ++Y  N + + + I +      +  L+SDAG P +SDPG+ L+   +     V  I G  + + +L V+G P+ +  F GF  + +  ++  L  L N   T++++E+ HR+ +TL  I +I  + + + + RELTK+ E   R +   + E   +  E+GE VILI   D N +  E    EE        +L   + KG   K    +V+    L    LY
  S:     1 MTGTLYIVATPIGNLEDMTFRAVRILQEVDLIAAEDTRHSRKLLSHFGITTTLTSYYDHNQSLKGERILATLRDGKQVALISDAGTPCISDPGYQLVRDALVEGIKVAPIPGACAAITALSVAGLPTDSFTFAGFPPNKEGKRRSFLAGLLNAHGTLVLYEAPHRLTETLTDIADILGD-RQVVVTRELTKLYEECLRGTAREVREQAREGRERGEMVILIAPADENTQALEGPSPEE--------QLRAALLKGHTVKETAALVAAATGLPRRELY 268
>gi|85714065|ref|ZP_01045054.1| hypothetical protein NB311A_07913 [Nitrobacter sp. Nb-311A] >gi|85699191|gb|EAQ37059.1| hypothetical protein NB311A_07913 [Nitrobacter sp. Nb-311A] (337 aa)
Score = 309, Expect = 1.4e-26, Identities = 72/215 (33%), Positives = 120/215 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKIT--EKGEFVILI 219
           L++VATPIG++ +I+  A+ TL    I  CEDTR +++L     I+   K ++  N    +  I +   +     L+SDAG P++SDPGF L+         V  + GPSS++ +L V+  P+    F GFL   +  ++ ++ +L     T+++FES  RI+  L+ +     N + + I RELTK++E I R+S+A   E   T   +GEFV+++
  S:    56 LYLVATPIGHLGDITVRALETLAGVDIIACEDTRITRRLTERYAITCALKPYHEHNAATARPKILAQLAQGASIALVSDAGTPLISDPGFKLVREACAAGHRVIALPGPSSVLTALSVAALPTDRFFFEGFLPSKEGARRTRIAELARIDATLVLFESGSRIRSALRDLAAGLGN-RGVAICRELTKLHEDIRRASLAEFAETAATLETRGEFVLVV 271
>gi|56459536|ref|YP_154817.1| tetrapyrrole methylase family protein [Idiomarina loihiensis L2TR] >gi|56178546|gb|AAV81268.1| Tetrapyrrole methylase family protein [Idiomarina loihiensis L2TR] (284 aa)
Score = 309, Expect = 1.5e-26, Identities = 71/215 (33%), Positives = 127/215 (59%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFD---FKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILI 219
           L+IV TPIGN+ +I+E A+ TL   +    EDTR+++KL+   +  ++N  F +L+ +NE Q +++      + +   L+SDAG P+++DPG++L++   +    V  + G  ++  +L  +G P+    F GFL      ++ +L  LK E++T++++ES HRI  TL  +  +  + + I +ARELTK  ET    + A     + +    ++GE V+LI
  S:     7 LYIVPTPIGNLGDITERAVKTLAEVAAIAAEDTRHTRKLMQ--HYGIQNDVF-ALHEHNETQRVDAVIERLLQGDSLALVSDAGTPLINDPGYVLVHRCRERGLKVIALPGACAVTVALSAAGLPTDRFAFEGFLPSKPQQRRAKLEALKTETRTVVVYESPHRILHTLTDMNVVLGSGRQIVLARELTKQFETYLNGTAAELLQALTDDTNQQRGEMVLLI 225
>gi|154493889|ref|ZP_02033209.1| hypothetical protein PARMER_03233 [Parabacteroides merdae ATCC 43184] >gi|154086149|gb|EDN85194.1| hypothetical protein PARMER_03233 [Parabacteroides merdae ATCC 43184] (234 aa)
Score = 308, Expect = 1.6e-26, Identities = 72/223 (32%), Positives = 123/223 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILI----DNNVKET 226
           KL +V TP+GN+++++  AI  L    +   EDTR +  LL    I    ++ +  N +   + + +         L+SDAG P +SDPGF+L+   ++   +V+ + G ++ + +L+ SG P+    F GFL   K  +Q +L +L  E +TII +ES  R+  TL  + E F N + + ++RE++K++E   R ++   I    + E KGE VI++    D   KET
  S:     3 KLTVVPTPVGNLEDMTFRAIRVLKEADLILAEDTRTTGILLKHFEIQNRMQSHHKFNEHKTVEQVAARIKAGENIALVSDAGTPAISDPGFMLVRECVRQGVEVECLPGATAFVPALVASGLPNEKFCFEGFLPQKKG-RQTRLKELSTEYRTIIFYESPFRLVKTLTQLAEFFGNDRPVSVSREISKIHEETVRGTLEEVIAHFTVNEPKGEIVIVLAGLKDKKDKET 230
>gi|119508863|ref|ZP_01628015.1| hypothetical protein N9414_20825 [Nodularia spumigena CCY9414] >gi|119466392|gb|EAW47277.1| hypothetical protein N9414_20825 [Nodularia spumigena CCY9414] (288 aa)
Score = 308, Expect = 1.6e-26, Identities = 77/270 (28%), Positives = 140/270 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+++I+  A+  L   ++   EDTR++ KLL    I     +++  N ++    +  +        L+SDAG P +SDPG+ L+   ++    V  I G S+ + +L  +G P+   +F GFL      +++ L  ++ ES+T+I +ES HR++++L+    ++   + I +ARELTK+ E  +R +IA  I      E +GE+ +++         + +E+        EL ++I +G     A + ++   SL    LY  
  S:    10 LYIVGTPIGNLEDITFRAVRILQTVNLIAAEDTRHTGKLLQHFQIKTPQISYHEHNSHSRIPELLEYMANGQAIALVSDAGMPGISDPGYELVKACVEAGVTVVPIPGASAAITALSAAGLPTDRFVFEGFLPAKAQKRREYLELIQAESRTLIFYESPHRLRESLQDFAIVWGGDRQIVLARELTKLYEEFWRGTIAEAIAHYSQREPQGEYTLVLAGITASQPQLTEEQLK-----AELLEIISQGISRSQASRQLAKMTSLPRRQLYQL 276
>gi|16762030|ref|NP_457647.1| hypothetical protein STY3446 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29143519|ref|NP_806861.1| hypothetical protein t3183 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|25318877|pir||AC0899 conserved hypothetical protein STY3446 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16504333|emb|CAD07785.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139153|gb|AAO70721.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] (287 aa)
Score = 308, Expect = 1.6e-26, Identities = 73/226 (32%), Positives = 130/226 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESI 229
           +LFIV TPIGN+ +I++ A+  L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  ++ E +T+I +ES HR+ D+L+ +  ++  S+ + +ARELTK  ETI+ + +    A + E +   KGE V++++ +  + + +
  S:    13 QLFIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGI---NARLFALHDHNEQQKAETLVAKLKEGQNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIEAEPRTLIFYESTHRLLDSLEDMVAVWGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQEDDL 242
>gi|157363102|ref|YP_001469869.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Thermotoga lettingae TMO] >gi|157313706|gb|ABV32805.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Thermotoga lettingae TMO] (226 aa)
Score = 308, Expect = 1.6e-26, Identities = 75/219 (34%), Positives = 118/219 (53%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSL-NGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILI 219
           M  KL IV TPIGN+ +I+  A+  L    +   EDTR +KKLL   NI  +    Y L N      FI +   +  + CL++D+G P ++DPG  L++   ++  ++ +  GPS+L  +L + GF SS V F GFL   K  ++     +K +    + FES  RI +TL    +IF N  +I I RE+TK+ + ++R  I++  E     KGE  +++
  S:     1 MEGKLTIVGTPIGNMMDITIRALRALRECDVVIAEDTRRTKKLLKFFNIDGKQLISYGLHNQLKSVPFILNLLKEGKKLCLVTDSGMPCVADPGGFLVDACWRSGIELDVTPGPSALTSALALCGFDSSRVFFTGFLPRGKK-RRKLFRDIKGKKMLFVFFESATRISETLSDAMDIFGNC-DIFIGREMTKVFQQLFRGKISDAVESFKQTKGELTVVL 218
>gi|148378069|ref|YP_001252610.1| tetrapyrrole methylase family protein [Clostridium botulinum A str. ATCC 3502] >gi|153933655|ref|YP_001382468.1| tetrapyrrole methylase family protein [Clostridium botulinum A str. ATCC 19397] >gi|153936779|ref|YP_001386020.1| tetrapyrrole methylase family protein [Clostridium botulinum A str. Hall] >gi|148287553|emb|CAL81617.1| putative corrin/porphyrin methyltransferase [Clostridium botulinum A str. ATCC 3502] >gi|152929699|gb|ABS35199.1| tetrapyrrole methylase family protein [Clostridium botulinum A str. ATCC 19397] >gi|152932693|gb|ABS38192.1| tetrapyrrole methylase family protein [Clostridium botulinum A str. Hall] (284 aa)
Score = 308, Expect = 1.7e-26, Identities = 86/271 (31%), Positives = 155/271 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           KL++V TPIGN+++I+  A+  L +  I   EDTR + KLLN  NI     +++  N  ++   I +   +  +  L+SDAG P +SDPG++LI   I+     +++ G ++   +L+ SG  ++  +F GF+      +Q  +  +K+  +T+I +ES HR+K+ LK +++   N +NI I RELTK++E I R S+  +  IK  E    KGE+V+++     E    +KE    S+ + + ++K I +G  +K + K+V+    +  + +Y +
  S:     8 KLYVVPTPIGNLRDITIRALDVLEDVDIIAAEDTRQTLKLLNHFNIKKTLISYHKFNEEDKSINIINNLKEGKKIALVSDAGMPGISDPGYVLIKKCIEEQIIFEVLPGATAFTTALVYSGMDTTKFIFKGFIPRENKNRQKLIQDIKDRMETLIFYESPHRLKECLKFLRDSLGN-RNISICRELTKLHEEIIRDSLEEV--IKYYENKQPKGEYVLVLQGKSIEEIEKEKEMEWSSINIQDHIKKYINEGYSKKESIKLVAKDRKITKSEVYKY 280
>gi|27364049|ref|NP_759577.1| methyltransferase [Vibrio vulnificus CMCP6] >gi|37678789|ref|NP_933398.1| methyltransferase [Vibrio vulnificus YJ016] >gi|27360167|gb|AAO09104.1|AE016799_2 Predicted methyltransferase [Vibrio vulnificus CMCP6] >gi|37197530|dbj|BAC93369.1| predicted methyltransferase [Vibrio vulnificus YJ016] (287 aa)
Score = 308, Expect = 1.8e-26, Identities = 84/270 (31%), Positives = 135/270 (50%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKIT----EKGEFVILIDNNVKETESIKKEET--DYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ AI  L++  +   EDTR++ KLL+  NI  +    +  N   + Q +           L+SDAG P++SDPG+ L+    +    V  + G  +++ +L  SG PS    F GFL      ++D+  ++    +T I +ES HRI D+L  + EI    + + +ARELTK  ETI    ++ + E   +    +KGE V+LI       E    EE     ++   EL          ++        Y+LK N+LY +
  S:    14 LYIVPTPIGNLGDITQRAIEVLSSVDMIAAEDTRHTGKLLSHFNIQTKTFALHDHNEQQKAQVLVDKLLSGQNIALVSDAGTPLISDPGYHLVTQCRQAGVKVVPLPGACAVITALSASGLPSDRFSFEGFLPPKSKGRKDKFLEIAKVERTCIFYESPHRIVDSLHDMLEILGPDREVVLARELTKTFETIQGMRLSELVEWVQSDDNQQKGEMVLLIHGYRDSAEESLPEEALRSLAILTKELPLKKAAALAAEI--------YNLKKNALYKW 281
>gi|150009105|ref|YP_001303848.1| methyltransferase [Parabacteroides distasonis ATCC 8503] >gi|149937529|gb|ABR44226.1| methyltransferase [Parabacteroides distasonis ATCC 8503] (234 aa)
Score = 308, Expect = 1.9e-26, Identities = 69/216 (31%), Positives = 118/216 (54%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILI 219
           KL +V TP+GN+++++  AI  L    +   EDTR +  LL    I  + ++ +  N +   + I +         L+SDAG P +SDPGF+L+   ++   DV+ + G ++ + +L+ SG P+    F GFL   K  +Q +L +L  E +TII +ES  R+  TL    E F   + + ++RE++K++E   R S+   I    + E +GE VI++
  S:     3 KLTVVPTPVGNLEDMTFRAIRVLKEADLILAEDTRTTGILLKHFEIQNKMQSHHKFNEHKTVEQIAARIKGGENIALVSDAGTPAISDPGFMLVRECVRQGVDVECLPGATAFVPALVASGLPNEKFCFEGFLPQKKG-RQTRLKELALEYRTIIFYESPFRLLKTLTQFAEFFGTDRQVSVSREISKLHEETVRGSLEEVIQHFTVNEPRGEIVIVL 219
>gi|169633074|ref|YP_001706810.1| putative methyltransferase [Acinetobacter baumannii SDF] >gi|169151866|emb|CAP00699.1| putative methyltransferase [Acinetobacter baumannii] (278 aa)
Score = 308, Expect = 2.0e-26, Identities = 86/272 (31%), Positives = 149/272 (54%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           M+ +LF+VATPIG++ +++  AI  L + S+   EDTR S +L    NIS      +  N +N+ +Q +      +N   L+SDAG P++SDPGF L+    ++   V  + G  + + +L   G PS    F GFL    + +  QL +LKNE++T+I +E+ HRI + +K + E+F  ++ +  ARE+TK  ETI + ++ +    I      EKGE V+++    ++T+  +++       L+EL K + +    K A ++ +    +K    Y
  S:     1 MSAQLFVVATPIGHLDDMTFRAIDILKSVSVVAAEDTRQSAQLFKHYNISTPLTACHDHNESNKIEQLVQKLLAGEN-IALISDAGTPLISDPGFKLVRAAQEHGIRVVPVPGACAAIAALSAVGLPSDRFSFEGFLPSKASQRITQLEKLKNETQTLIFYEAPHRILECVKNMAEVFGENRPVGFAREITKTFETIKKMTLKDLVSFIENDHNQEKGEIVLVVGGAPEKTDQEQEK-------LDELLKRLLQDLSVKAASQLAADLTGIKKKVAY 269
>gi|167462405|ref|ZP_02327494.1| hypothetical protein Plarl_07570 [Paenibacillus larvae subsp. larvae BRL-230010] (248 aa)
Score = 307, Expect = 2.1e-26, Identities = 70/197 (35%), Positives = 111/197 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI 201
           L++V TPIGN+++I+  A+  L    I   EDTR ++KLL  L IS    +++  N       +     +     L+SDAG P +SDPG  L  + ++    V  I GP++ + +LI SG P+    F GF+  ++   ++ L + K+ S T +++ES HRI  TL+ I+E + N + IC+ARELTK +E   R S+
  S:    16 LYLVGTPIGNLEDITYRAVRILQEAEIIAAEDTRQTRKLLTHLGISGRLVSYHEHNKRASGPELIRLMKEGTTIALVSDAGLPAISDPGTDLAQMAMEEGIPVIPIPGPNAALSALIASGMPTDAFTFLGFMPRDRKRLEEHLKRWKHVSSTFLLYESPHRIIKTLEGIEEHWGN-RQICLARELTKRHEEFVRGSV 211
>gi|53711951|ref|YP_097943.1| methyltransferase [Bacteroides fragilis YCH46] >gi|60680151|ref|YP_210295.1| putative tetrapyrrole (corrin/porphyrin) methylase [Bacteroides fragilis NCTC 9343] >gi|52214816|dbj|BAD47409.1| methyltransferase [Bacteroides fragilis YCH46] >gi|60491585|emb|CAH06337.1| putative tetrapyrrole (corrin/porphyrin) methylase [Bacteroides fragilis NCTC 9343] (224 aa)
Score = 307, Expect = 2.2e-26, Identities = 66/216 (30%), Positives = 119/216 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILI 219
           KL++V TP+GN+++++  AI  L    +   EDTR S  LL    I    ++ +  N +   + + +         L+SDAG P +SDPGFL++   ++N  +VQ + G ++ + +L+ SG P+    F GFL   K  +  +L  L +E +T++ +ES HR+  TL    E F   + + ++RE++K++E   R +++ + E       +GE VI++
  S:     3 KLYVVPTPVGNLEDMTFRAIKVLKEADLILAEDTRTSGILLKHFEIKNVMQSHHKFNEHKTVESVVNRIKAGETIALISDAGTPGISDPGFLVVRECVRNGIEVQCLPGATAFVPALVASGLPNEKFCFEGFLPQKKG-RMTKLKSLVDEHRTMVFYESPHRLLKTLTQFAEYFGPERQVSVSREISKIHEETVRGTLSELIEHFTATDPRGEIVIVL 219
>gi|62424713|ref|ZP_00379855.1| COG0313: Predicted methyltransferases [Brevibacterium linens BL2] (327 aa)
Score = 307, Expect = 2.3e-26, Identities = 75/276 (27%), Positives = 131/276 (47%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDF--KDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           KL +V TPIGN+ + SE     +    +   EDTR    L   L ++   +     + N + +     +         LLSDAG P +SDPG+ ++    +    +    GPS+++ +L VSG PS    F GFL      ++  L +L+ E +T++ FES HRI DT+     +    + + I+RELTK  E   R +++++ ++     +GE  +++             ET    +L+ + +L+  G + K A   ++ +Y L    +Y  W  R+
  S:    56 KLVLVGTPIGNLGDASERMQRAIATADVIAAEDTRRFLSLTQRLELTHTKRVISVFDHNEQSRAPELVELIRSGQTVVLLSDAGMPAVSDPGYRVVKACAEAGLPITSTPGPSAVLMALAVSGLPSDRFSFEGFLPRKSGARKTLLEELRGEKRTMVFFESPHRIADTMDDFLTVMGPDRPMSISRELTKTYEETLRGTVSSLRDLAADGLRGELTLVL-------AGATAVETAPEDHLDAVGELVESGVRAKDAAGQIAKQYGLSKREIYEAWLHRE 327
>gi|157827844|ref|YP_001496908.1| putative methyltransferase [Rickettsia bellii OSU 85-389] >gi|157803148|gb|ABV79871.1| Putative methyltransferase [Rickettsia bellii OSU 85-389] (300 aa)
Score = 307, Expect = 2.4e-26, Identities = 83/223 (37%), Positives = 130/223 (58%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI-----KITEKGEFVILIDNNVKETE 227
           L+IV+TPIGN ++I+  AI+TL N+ I  CEDTR S+KLL   +I  + + +   +   +++ I +    +    L+SDAG P++SDP + L+      N+ + ++ G SS + +L +S  P+   LF GFL      K+    +  N   T+I FE+  R+ +TL + KEI  N + IC+ARELTK+ + I     ANI+E+       T KGE V+LI   ++E E
  S:    27 LYIVSTPIGNFEDITLRAISTLKNSDIILCEDTRISQKLLAKHDIRTKLQVYSDHSDEKDRENIINLIKANKIVSLISDAGTPLISDPRYKLVRDLRSLNFPIDVVPGVSSPITALTLSALPTDRFLFCGFLPKTIESKKKLFTEFANIRATLIFFEAAPRLINTLLIAKEILGN-REICVARELTKLYQEI---KTANIDEVIAFYQNNTLKGEIVLLISGVLQEQE 250
>gi|153939457|ref|YP_001389426.1| tetrapyrrole methylase family protein [Clostridium botulinum F str. Langeland] >gi|152935353|gb|ABS40851.1| tetrapyrrole methylase family protein [Clostridium botulinum F str. Langeland] (284 aa)
Score = 307, Expect = 2.5e-26, Identities = 90/269 (33%), Positives = 156/269 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSF-DFKDNE-YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           KL++V TPIGN+++I+  A+  L +  I   EDTR + KLLN  NI     +++  N   E + IN   D K+ +   L+SDAG P +SDPG++LI   I+     +++ G ++   +L+ SG  ++  +F GF+      +Q  +  +K+  +T+I +ES HR+K+ LK +++   N +NI I RELTK++E I R S+  +  IK  E    KGE+V+++     E    +KE    S+ + + ++K I +G  +K + K+V+    +  + +Y
  S:     8 KLYVVPTPIGNLRDITIRALDVLEDVDIIAAEDTRQTLKLLNHFNIKKTLISYHKFN--EEDKSINIIKDLKEGKNIALVSDAGMPGISDPGYVLIKKCIEEQIIFEVLPGATAFTTALVYSGMDTTKFIFKGFIPRENKNRQKLIQDIKDRMETLIFYESPHRLKECLKFLRDSLGN-RNISICRELTKLHEEIIRDSLEEV--IKYYENKQPKGEYVLVLQGKSIEEIEKEKEMEWSSINIQDHIKKYINEGYSKKESIKLVAKDRKITKSEVY 278
>gi|24114437|ref|NP_708947.1| hypothetical protein SF3187 [Shigella flexneri 2a str. 301] >gi|30064486|ref|NP_838657.1| hypothetical protein S3404 [Shigella flexneri 2a str. 2457T] >gi|110807015|ref|YP_690535.1| hypothetical protein SFV_3176 [Shigella flexneri 5 str. 8401] >gi|24053615|gb|AAN44654.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] >gi|30042745|gb|AAP18468.1| hypothetical protein S3404 [Shigella flexneri 2a str. 2457T] >gi|110616563|gb|ABF05230.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] (286 aa)
Score = 307, Expect = 2.5e-26, Identities = 73/226 (32%), Positives = 128/226 (56%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESI 229
           +L+IV TPIGN+ +I++  +  L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  ++ E +T+I +ES HR+ D+L+ I  +   S+ + +ARELTK  ETI+ + +    A + E +   KGE V++++ +  + E +
  S:    13 QLYIVPTPIGNLADITQRTLEVLQAVDLIAAEDTRHTGLLLQHFGI---NARLFALHDHNEQQKAETLLAKLQEGQNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIEAEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQEEDL 242
>gi|187933851|ref|YP_001887560.1| hypothetical protein CLL_A3374 [Clostridium botulinum B str. Eklund 17B] >gi|187722004|gb|ACD23225.1| conserved hypothetical protein [Clostridium botulinum B str. Eklund 17B] (281 aa)
Score = 307, Expect = 2.5e-26, Identities = 89/271 (32%), Positives = 151/271 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFL---NHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI-ANINE-IKITEKGEFVILIDNNVKETESIKKEETDYSVYL---NELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           KL++V TPIGN+K+I+  A+  L    I   EDTR + KLLN   I     +++  N  ++   I           L+SDAG P +SDPG +++   I+      ++ G +++  +L+ SG  ++  +F GFL   N ++N+ +++L Q     +T+I +E+ HR+ DTL  +   F N + I + RELTK+ E I+R +I  +IN  I+   +GEFV++++   K  E IK+E     + L   + + K I +G  +K A K V+    +  + +Y F
  S:     5 KLYLVPTPIGNLKDITLRALEVLNEADIIAAEDTRQTLKLLNHFEIKKTLISYHKFNEKDKSNEIIDRLLNGQSIALVSDAGTPGISDPGSVIVKRCIEEGISFNVLPGATAITTALVYSGLDTTKFIFRGFLPRENKDRNIIKEELLQ---SQETLIFYEAPHRLLDTLSFLYNSFGN-RQIAVCRELTKLYEQIFRGTIEESINYFIENKPRGEFVLVLEG--KRLEEIKQERESEWIDLSIQDHIMKYIDEGISKKEAIKTVAKDRGIPKSEVYKF 277
>gi|22537713|ref|NP_688564.1| tetrapyrrole methylase family protein [Streptococcus agalactiae 2603V/R] >gi|76787523|ref|YP_330192.1| tetrapyrrole methylase family protein [Streptococcus agalactiae A909] >gi|76799462|ref|ZP_00781606.1| conserved hypothetical protein TIGR00096 [Streptococcus agalactiae 18RS21] >gi|77408324|ref|ZP_00785066.1| conserved hypothetical protein TIGR00096 [Streptococcus agalactiae COH1] >gi|22534602|gb|AAN00437.1|AE014263_16 tetrapyrrole methylase family protein [Streptococcus agalactiae 2603V/R] >gi|76562580|gb|ABA45164.1| tetrapyrrole methylase family protein [Streptococcus agalactiae A909] >gi|76585189|gb|EAO61803.1| conserved hypothetical protein TIGR00096 [Streptococcus agalactiae 18RS21] >gi|77173087|gb|EAO76214.1| conserved hypothetical protein TIGR00096 [Streptococcus agalactiae COH1] (287 aa)
Score = 307, Expect = 2.6e-26, Identities = 85/268 (31%), Positives = 142/268 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++V TPIGN+ +++  AI  L        EDTRN+  LL   +I+ +  +F+  N  ++   +     +      +SDAG P +SDPG  L+   I+ +  V  I G S+ + +LI SG      +FYGFL   K  +       ++  +T I +ES  R+ DTLK +KEI+ + + + + RELTK+ E   R +I+ + E   K+  KGE +I++D   ++TE +K       + L  +++ I  G+K   A K V+ +++L    LY
  S:    16 LYLVPTPIGNLDDMTFRAIRILREVDFICAEDTRNTGLLLKHFDITTKQISFHEHNAYDKISGLIDLLKEGKSLAQVSDAGMPSISDPGHDLVKAAIEGDIPVVSIPGASAGITALIASGLAPQPHIFYGFLPRKKGQQITFFETKQDYPETQIFYESPFRVSDTLKHMKEIYGD-RQVVLVRELTKLYEEYQRGTISQLLEHIEKVPLKGECLIIVDGK-RDTERVKDSSQQDPLVL--VKEYIANGDKTNQAIKKVAKEFNLNRQELY 281
>gi|168144513|ref|ZP_02587742.1| Corrin/porphyrin methyltransferase [Bacillus cereus G9842] (291 aa)
Score = 307, Expect = 2.6e-26, Identities = 85/275 (30%), Positives = 142/275 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGN-NEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI  L    +   EDTR +KKL N   I     +++  N   + K+ +   +   N   L+SDAG P +SDPG+ ++   +   + V  + G ++ + +LI SG  +    FYGFL  NK  ++ +L +L+    T++ +E+ HR+ DTL  ++E+  N + I + RELTK  E   R ++   I   K  E +GEF IL+  + +E    ++     SVY +    +  KG   K A K V+    L    +Y  +   K
  S:    15 LYLVPTPIGNLEDMTFRAIRILKEVDLIAAEDTRQTKKLCNYFEIETPVTSYHEHNKEVSGKKILEKLEDGKN-VALVSDAGMPCISDPGYDIVVEAVAEQYHVIPLPGANAALTALIASGLETKQFYFYGFLQRNKKERKMELEKLRYVQTTMMFYEAPHRLDDTLISMQEVLGN-REIVLCRELTKKFEEFIRGTVEEAIEWTKQNEVRGEFCILVAGSTEEPAPEEQWWESLSVYDHIEHYINEKGMNSKEAIKTVAKDRDLSKRDVYQIYHVDK 290
>gi|153853633|ref|ZP_01995013.1| hypothetical protein DORLON_01004 [Dorea longicatena DSM 13814] >gi|149753788|gb|EDM63719.1| hypothetical protein DORLON_01004 [Dorea longicatena DSM 13814] (297 aa)
Score = 307, Expect = 2.6e-26, Identities = 85/272 (31%), Positives = 148/272 (54%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNG-NNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEET----DYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           M   L++ ATPIGN+++++  A+  L    +   EDTRNS KLLN   I     +++  N      + +      +N   +++DAG P +SDPG  L+ +  +    V  + G  + + +L +SG  +    F  FL  +K  +Q  L +LK+E++T++I+E+ HR+  TLK ++E   N + I I RELTK +ET++ ++I + +    + E KGE V++I+   K  E I+ EE     + S+    +E  + +G  +K A K V+    +    +Y
  S:    20 MAGTLYLCATPIGNLEDMTFRAVRILKEVDLIAAEDTRNSIKLLNHFEIKTPMTSYHEYNKIEKGHKLVERLQGGEN-IAVITDAGMPGISDPGEELVKMCQEAGITVTAVPGACACVTALTISGLGTRRFAFEAFLPTDKKERQAVLEELKDETRTMVIYEAPHRLVRTLKTLQETLGN-RRISICRELTKKHETVFATTIEDALAYYDVQEPKGECVMVIEG--KSREEIRNEEKARWEEMSIE-EHMELYLGQGMDKKSAMKQVAKDRGVGKRDIY 293
>gi|26249726|ref|NP_755766.1| hypothetical protein c3899 [Escherichia coli CFT073] >gi|26110154|gb|AAN82340.1|AE016767_100 Hypothetical protein yraL [Escherichia coli CFT073] (287 aa)
Score = 306, Expect = 2.6e-26, Identities = 73/219 (33%), Positives = 126/219 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNN 222
           +L+IV TPIGN+ +I++ A+  L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  ++ E +T+I +ES HR+ D+L+ I  +   S+ + +ARELTK  ETI+ + +    A + E +   KGE V++++ +
  S:    13 QLYIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGI---NARLFALHDHNEQQKAETLLAKLQEGQNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIEAEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGH 235
>gi|170760429|ref|YP_001785392.1| tetrapyrrole methylase family protein [Clostridium botulinum A3 str. Loch Maree] >gi|169407418|gb|ACA55829.1| tetrapyrrole methylase family protein [Clostridium botulinum A3 str. Loch Maree] (284 aa)
Score = 306, Expect = 2.7e-26, Identities = 86/271 (31%), Positives = 155/271 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           KL++V TPIGN+++I+  A+  L +  I   EDTR + KLLN  NI     +++  N  ++   I +   +  +  L+SDAG P +SDPG++LI   I+     +++ G ++   +L+ SG  ++  +F GF+      +Q  +  +K+  +T+I +ES HR+K+ LK +++   N +NI I RELTK++E I R S+     IK  E    KGE+V++++    E    +KE    S+ + + ++K I +G  +K + K+V+    +  + +Y +
  S:     8 KLYVVPTPIGNLRDITIRALDVLEDVDIIAAEDTRQTLKLLNHFNIKKTLISYHKFNEEDKSINIINNLKEGKKIALVSDAGMPGISDPGYVLIKKCIEEQIIFEVLPGATAFTTALVYSGMDTTKFIFKGFIPRENKNRQKLIQDIKDRMETLIFYESPHRLKECLKFLRDSLGN-RNISICRELTKLHEEIIRDSLE--EAIKYYENKQPKGEYVLVLEGKSIEEIEKEKEMEWSSINIQDHIKKYINEGYSKKESIKLVAKDRKITKSEVYKY 280
>gi|188993038|ref|YP_001905048.1| hypothetical protein xccb100_3643 [Xanthomonas campestris pv. campestris] >gi|167734798|emb|CAP53008.1| Conserved hypothetical protein [Xanthomonas campestris pv. campestris] (273 aa)
Score = 306, Expect = 2.7e-26, Identities = 72/215 (33%), Positives = 130/215 (60%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANIN-EIKITE---KGEFVILI 219
           L +VATPIGN+ ++S  A  TL   +    EDTR++++LL+   I   ++   +L+ +NE+        +  E     ++SDAG P++SDPGF L+    +    V  + G  + + +L V+G PS    F GFL      ++++L++L  E++T++ +ES HRI ++L  ++  F +++   IARELTK+ ET+   S+A++  +++  +   KGEFV+++
  S:     7 LHVVATPIGNLADLSPRAQETLRGVTAICAEDTRHTRQLLSHFGI---DRPLLALHDHNEEAMSERIVTRLREGESLAIVSDAGTPLVSDPGFKLVRAAREAGIRVSPVPGACAAIAALSVAGLPSDRFGFEGFLPAKSAARRERLSRLAGETRTLVFYESSHRIVESLADLRSAFGDARPAVIARELTKLFETVLDGSLADLQAQVEADDNQRKGEFVVMV 225
>gi|46446891|ref|YP_008256.1| hypothetical protein pc1257 [Candidatus Protochlamydia amoebophila UWE25] >gi|46400532|emb|CAF23981.1| conserved hypothetical protein [Candidatus Protochlamydia amoebophila UWE25] (271 aa)
Score = 306, Expect = 3.0e-26, Identities = 90/272 (33%), Positives = 137/272 (50%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI-NEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNE-----LEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQ 276
           L++VATPIG++ +I+  AI TL       CEDTR+S +LL   +I    K+++  N   + Q I          CL+SDAG P +SDPG  L+ L I N   V  I GP + + +L  SG P+ +  F GFL   +   +  L  L   + T I +ES HR+ DTLK+   +    + + +ARELTK  E   R +   I  + K  E +GE V++I       E   + + D++ +  E     ++       KE  A KMV+    +    +YN + 
  S:     2 LYLVATPIGHLSDITFRAIETLKFCDYILCEDTRHSLRLLQHYDIHKPLKSYHKFNETEKSQSILDDLHAGKNICLISDAGTPGISDPGTQLVQLCISNQIPVTAIPGPCAAIQALSCSGLPTDHFQFIGFLPRKEGELKKFLLSLFTYTGTTICYESPHRLIDTLKLFHSL-QPHRQLVVARELTKKFEEFVRGTAEEIFKKWKDKEPRGEIVLMI-------EPFSQTQVDWNQWSPEEHVSWMQATYSLSRKE--AIKMVADLRQVSKRDIYNLFH 270
>gi|91206228|ref|YP_538583.1| putative methyltransferase [Rickettsia bellii RML369-C] >gi|91069772|gb|ABE05494.1| Putative methyltransferase [Rickettsia bellii RML369-C] (300 aa)
Score = 306, Expect = 3.0e-26, Identities = 83/223 (37%), Positives = 130/223 (58%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI-----KITEKGEFVILIDNNVKETE 227
           L+IV+TPIGN ++I+  AI+TL N+ I  CEDTR S+KLL   +I  + + +   +   +++ I +    +    L+SDAG P++SDP + L+      N+ + ++ G SS + +L +S  P+   LF GFL      K+    +  N   T+I FE+  R+ +TL + KEI  N + IC+ARELTK+ + I     ANI+E+       T KGE V+LI   ++E E
  S:    27 LYIVSTPIGNFEDITLRAISTLKNSDIILCEDTRISQKLLAKHDIRTKLQVYNDHSDEKDRENIINLIKANKIVSLISDAGTPLISDPRYKLVRDLRSLNFPIDVVPGVSSPITALTLSALPTDRFLFCGFLPKTIESKKKLFTEFANIRATLIFFEAAPRLINTLLIAKEILGN-REICVARELTKLYQEI---KTANIDEVIAFYQNNTLKGEIVLLISGVLQEQE 250
>gi|55981932|ref|YP_145229.1| tetrapyrrole methylase family protein [Thermus thermophilus HB8] >gi|55773345|dbj|BAD71786.1| tetrapyrrole methylase family protein [Thermus thermophilus HB8] (264 aa)
Score = 306, Expect = 3.2e-26, Identities = 65/216 (30%), Positives = 118/216 (54%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILI 219
           +L +V TPIGN+++I+  A+  L    +  CEDTR +  LL    I               ++ +  + +        +DAG P +SDPG  L+ L ++  W V+ + GP++L+ +L+ SG P+    F GFL      +++++  L  E +T +++ES HR++ TL+ + E++     + +AREL+K++E I+R S+    E     +GEFV+++
  S:     2 RLVLVPTPIGNLEDITLRALRVLKEVEVVACEDTRRTGLLLKHYGIPTPTLRLDQHTVGRARELLAPYRY----VAYATDAGTPGISDPGAELVRLALEWGWRVEALPGPTALIPALVASGLPTHRFTFEGFLPKGGRERRERILALAREGRTAVLYESPHRLRKTLEDLLEVYGPDHPVAVARELSKLHEEIFRGSLREALEHFQEPRGEFVLVL 213
>gi|170787746|gb|EDT28790.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5] (294 aa)
Score = 305, Expect = 3.6e-26, Identities = 72/231 (31%), Positives = 126/231 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN--INEIKITEKGEFVILIDNNVKETESIKKEETD 235
           L + ATPIGN+ +I+  A+ TL  + +  CEDTR + KLL    I++    ++  N    +  I +   + +   L+SDAG P++SDPGF L+       + V  + GPSS++ +L V+  P+    F GFL      +++++ +L     T+++FES  R+  +L+ + EI    ++I I RE+TK++E I R  +A       ++  +GEFV++I     +   + + E D
  S:    15 LHLAATPIGNLGDITLRALETLAGSDVICCEDTRVTHKLLERYGITVPLSPYHEHNAVAARPKILARLAQGDAVTLVSDAGTPLVSDPGFKLVREATAAGFAVHALPGPSSVLAALTVAALPTDRFYFEGFLPAKDGARRNRIAELARIDVTLVLFESGARLAASLRDLAEIL-GRRDIAICREMTKLHEDIRRMPLAEAAARADELETRGEFVLVIGPPSADASRMSETELD 246
>gi|196158151|ref|YP_002127640.1| putative methyltransferase [Alteromonas macleodii 'Deep ecotype'] >gi|88774254|gb|EAR05511.1| putative methyltransferase [Alteromonas macleodii 'Deep ecotype'] >gi|196113930|gb|ACG67646.1| putative methyltransferase [Alteromonas macleodii 'Deep ecotype'] (292 aa)
Score = 305, Expect = 3.9e-26, Identities = 84/268 (31%), Positives = 133/268 (49%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L+IV TPIGN+ ++S  AI  L+  +    EDTR+S +LL   +I  +  + +  N +     +           L+SDAG P++SDPGF+L+    +    V  + GP + + +L  SG P+   +F GFL      ++  L+ L +   T + +E+  RI DT+  I+ +    +NI +A+ELTK  ET    S  ++ +    E    KGEFV++I       ++I  E       L E   L       K A  +V+  Y LK N+LY
  S:    21 LYIVPTPIGNLDDMSARAIRVLSEVNWIAAEDTRHSARLLQHFSIGTKTLSLHEHNEDKRTAMLCERLKGGESVALISDAGTPLISDPGFVLVRKCRELGISVSALPGPCAAITALSASGLPTDKFIFEGFLPVKTQAREGALSALLDRPFTTVFYEAPRRILDTVTDIQRVL-GERNIVVAKELTKTFETYASGSAQDVIDYLTAEPAHQKGEFVVMIAPAQINEQAIPSEAMSLLNTLCEHMPL-------KKAAAVVASHYDLKKNALY 284
>gi|149369295|ref|ZP_01889147.1| methyltransferase [unidentified eubacterium SCB49] >gi|149356722|gb|EDM45277.1| methyltransferase [unidentified eubacterium SCB49] (222 aa)
Score = 305, Expect = 3.9e-26, Identities = 69/216 (31%), Positives = 117/216 (54%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILI 219
           KLF+V TPIGN+K+++  A+  L +  +   EDTR S KLL    I+ +  + +  N +   + I +         L+SDAG P +SDPGFLL    ++   +V  + G ++ + +L+ SG P+   +F GFL   K  +Q +   L  E++T+I +ES H++  TL      F   + + ++RE+TK++E   R +   +  +      KGE VI++
  S:     3 KLFLVPTPIGNLKDMTFRAVEVLNDVDLILAEDTRTSGKLLKHFEITTQMHSHHMHNEHKTTEGIVARILGGETVALISDAGTPAISDPGFLLTRACVEAGIEVDCLPGATAFVPALVNSGLPNDKFVFEGFLPVKKG-RQTRFLALAEETRTMIFYESPHKLVKTLGHFVSYFGEDRKVSVSREITKLHEETIRGTATEVLAHYTNKPPKGEIVIIV 219
>gi|86144174|ref|ZP_01062511.1| methyltransferase [Flavobacterium sp. MED217] >gi|85829436|gb|EAQ47901.1| methyltransferase [Leeuwenhoekiella blandensis MED217] (225 aa)
Score = 305, Expect = 4.0e-26, Identities = 75/221 (33%), Positives = 126/221 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSF--DFKDNE-YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI---NEIKITEKGEFVILIDNNVK 224
           KL++V TPIGN+++++  A+  L    +   EDTR S KLL    I+ +    +S + +NE + +       K+ +   L+SDAG P +SDPGFLL    ++   +V  + G ++ + +L+ SG P+   +F GFL   K  +Q +   L  E +T+I +ES H++  TLK + E F   ++I ++RE++K++E   R + A +    E K   KGE VI++    K
  S:     3 KLYLVPTPIGNLEDMTFRAVKVLQEADLILAEDTRTSGKLLKHFEITTQ---MHSHHMHNEHKTVEGLVDRIKNGQTLALISDAGTPAISDPGFLLTRACVEAGLEVDCLPGATAFVPALVNSGLPNDKFVFEGFLPVKKG-RQTRFLLLAEEERTMIFYESPHKLVKTLKNMVEFFGEDRSISVSREISKLHEETVRGTAAEVLKHFEAK-APKGEIVIIVGGKPK 224
>gi|183597930|ref|ZP_02959423.1| hypothetical protein PROSTU_01275 [Providencia stuartii ATCC 25827] >gi|188022699|gb|EDU60739.1| hypothetical protein PROSTU_01275 [Providencia stuartii ATCC 25827] (291 aa)
Score = 305, Expect = 4.1e-26, Identities = 84/274 (30%), Positives = 145/274 (52%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQ----FINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           M   L+IV TPIGN+ +I++ A+  L +  +   EDTR+S  LL    I   N   ++L+ +NE+Q     I+     D+   L+SDAG P+++DPG+ L+    +    V  + G  + + +L  +G PS    + GFL      ++D L  L+ E++T+I +ES HR+ D+L  + E++   +++ +ARE+TK  E+I    +    A + E +   +GE V+++     E      +E D S  +     L+++    K A  + +  Y LK N LY  
  S:    10 MASTLYIVPTPIGNMGDITQRALDVLKHVDLVAAEDTRHSGMLLQNFAI---NARMFALHDHNEQQKADQLISRLQQGDS-IALVSDAGTPLINDPGYHLVTRCREAGIRVVPLPGACAAITALSAAGLPSDRFCYEGFLPAKSKGRKDALKALERETRTLIFYESTHRLLDSLADMVEVWGPERHVVLAREITKTWESIEGRPVGELLAWVKEDENRHRGEMVLVV-----EGYKANLDEDDISPEVIRTLNLLQQELPPKKAAAITAEIYGLKKNRLYKL 282
>gi|170754439|ref|YP_001779689.1| tetrapyrrole methylase family protein [Clostridium botulinum B1 str. Okra] >gi|169119651|gb|ACA43487.1| tetrapyrrole methylase family protein [Clostridium botulinum B1 str. Okra] (284 aa)
Score = 305, Expect = 4.2e-26, Identities = 88/271 (32%), Positives = 158/271 (58%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSF-DFKDNE-YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           KL++V TPIGN+++I+  A+  L +  I   EDTR + KLLN  NI     +++  N   E + IN   D K+ +   L+SDAG P +SDPG++LI   I+     +++ G ++   +L+ SG  ++  +F GF+      +Q  +  +K+  +T+I +ES HR+K+ LK +++   N +NI I RELTK++E I R ++  +  IK  E    KGE+V++++    E    +KE    ++ + + ++K I +G  +K + K+V+    +  + +Y +
  S:     8 KLYVVPTPIGNLRDITIRALDVLEDVDIIAAEDTRQTLKLLNHFNIKKTLISYHKFN--EEDKSINIIKDLKEGKNIALVSDAGMPGISDPGYVLIKKCIEEQIIFEVLPGATAFTTALVYSGMDTTKFIFKGFIPRENKNRQKLIQDIKDRMETLIFYESPHRLKECLKFLRDSLGN-RNISICRELTKLHEEIIRDNLEEV--IKYYEHQQPKGEYVLVLEGKSIEEIEKEKEMEWSNINIQDHIKKYISEGYSKKESIKLVAKDRKITKSEVYKY 280
>gi|21230187|ref|NP_636104.1| hypothetical protein XCC0712 [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66769823|ref|YP_244585.1| hypothetical protein XC_3522 [Xanthomonas campestris pv. campestris str. 8004] >gi|21111724|gb|AAM40028.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66575155|gb|AAY50565.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris str. 8004] (273 aa)
Score = 305, Expect = 4.4e-26, Identities = 72/215 (33%), Positives = 129/215 (60%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANIN-EIKITE---KGEFVILI 219
           L +VATPIGN+ ++S  A  TL   +    EDTR++++LL+   I   ++   +L+ +NE+        +  E     ++SDAG P++SDPGF L+    +    V  + G  + + +L V+G PS    F GFL      ++++L++L  E++T++ +ES HRI ++L  ++  F + +   IARELTK+ ET+   S+A++  +++  +   KGEFV+++
  S:     7 LHVVATPIGNLADLSPRAQETLRGVAAICAEDTRHTRQLLSHFGI---DRPLLALHDHNEEAMSERIVTRLREGESLAIVSDAGTPLVSDPGFKLVRAAREAGIRVSPVPGACAAIAALSVAGLPSDRFGFEGFLPAKSAARRERLSRLAGETRTLVFYESSHRIVESLADLRSAFGDDRPAVIARELTKLFETVLDGSLADLQAQVEADDNQRKGEFVVMV 225
>gi|46199900|ref|YP_005567.1| corrin/porphyrin methyltransferase [Thermus thermophilus HB27] >gi|46197527|gb|AAS81940.1| corrin/porphyrin methyltransferase [Thermus thermophilus HB27] (264 aa)
Score = 304, Expect = 5.2e-26, Identities = 65/216 (30%), Positives = 117/216 (54%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILI 219
           +L +V TPIGN+++I+  A+  L    +  CEDTR +  LL    I               ++ +  + +        +DAG P +SDPG  L+ L +   W V+ + GP++L+ +L+ SG P+    F GFL      +++++  L  E +T +++ES HR++ TL+ + E++     + +AREL+K++E I+R S+    E     +GEFV+++
  S:     2 RLVLVPTPIGNLEDITLRALRVLKEVEVVACEDTRRTGLLLKRYGIPTPTLRLDQHTVGRARELLAPYRY----VAYATDAGTPGISDPGAELVRLALGWGWRVEALPGPTALIPALVASGLPTHRFTFEGFLPKGGGERRERILALAREGRTAVLYESPHRLRKTLEDLLEVYGPDHPVAVARELSKLHEEIFRGSLREALEHFQEPRGEFVLVL 213
>gi|15606379|ref|NP_213759.1| hypothetical protein aq_1111 [Aquifex aeolicus VF5] >gi|2983597|gb|AAC07168.1| hypothetical protein aq_1111 [Aquifex aeolicus VF5] (221 aa)
Score = 304, Expect = 5.3e-26, Identities = 81/215 (37%), Positives = 126/215 (58%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE-YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKN-ESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE--KGEFVIL 218
           KL+++ TPIGN+K+I+  A+  L   +   CEDTR +  LLN   I  +    Y      EKQ        + E   L++DAG P +SDPG+ LI   I+   +++++ GPS+++ +L+ SG P    LF GF    K   +    +LK+ E  T+I+FE+ +R+  TLK+I E+F N +  C+ARELTK++E   R ++   I E++  E  KGE V+L
  S:     3 KLYVIPTPIGNLKDITLRALEVLKEVNYIACEDTRRTMILLNHYGIKGKKLISY-YEPKEEKQIPKILKVLEKEDVALVTDAGMPAISDPGYRLIRKCIEKGIEIEVLPGPSAVITALVGSGLPPDRFLFVGF--PPKKGTKGFFEELKSCEDTTVILFENPNRLLKTLKIIHEVFGNVQ-ACVARELTKLHEEYIRGNLEEIIQELESREKIKGEVVVL 218
>gi|195953994|ref|YP_002122284.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Hydrogenobaculum sp. Y04AAS1] >gi|195933606|gb|ACG58306.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Hydrogenobaculum sp. Y04AAS1] (230 aa)
Score = 304, Expect = 5.4e-26, Identities = 87/216 (40%), Positives = 128/216 (59%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK---QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE--KGEFVILI 219
           KL++V TPIGN+++I+  AI  L +     CEDTR  + LL   NI  E KT  S     E    + I S   KD +  L+SDAG P +SDPGF LIN  IK +  V+++ GP +L+ +L+ SG P+ + +F GF    K+ +        +++ + I++ES  RI DTL++I  I  N   + IARELTKM+E   R +I + I E+K     KGE V+++
  S:     2 KLYVVPTPIGNLEDITIRAINILKSVKFIACEDTRRIQILLKHYNI--EGKTLLSYYHPKEAIQIRKIISLIRKDEDVALVSDAGTPSISDPGFKLINACIKEDIPVEVLPGPCALITALVGSGLPTHSFMFLGFAPR-KSQESFYKEVFSSDTGSYILYESPQRILDTLELISHIEPNI-TVAIARELTKMHEEYIRGNIKDVIEELKKRNNIKGEIVLVL 219
>gi|152991300|ref|YP_001357022.1| hypothetical protein NIS_1558 [Nitratiruptor sp. SB155-2] >gi|151423161|dbj|BAF70665.1| conserved hypothetical protein [Nitratiruptor sp. SB155-2] (271 aa)
Score = 304, Expect = 5.4e-26, Identities = 86/266 (32%), Positives = 146/266 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTF----YSLNGNNEKQFINSFD--FKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNS 270
           L +V TPIGNI++I+  A+  L   +I  CEDTR +KKLL LL+    ++TF     S + +N+  F+   D  F D     +SDAG P +SDPG  L+    +   D +++ GP++ + + + SGF      F+ FL H    +++++ QL       +++ES HR+   L+ I    D  + + +A+ELTK  ET ++ S   ++E   K T KGE+V++I  + ++  ++  +  D  V    L K  +     K++ K +   YS+ +NS
  S:     2 LTLVPTPIGNIEDITFRALRALKQANIILCEDTRVTKKLLTLLSDRF-SETFQAKLISFHEHNQYLFLQKIDPNFFDQNVAYVSDAGMPGISDPGTALVRYAQEYGIDYEVLPGPTAFVTAYVASGFEEKEFCFFAFLPHKGKAREEKIRQLLASPNNSVLYESPHRLVKLLEQIASA-DPDRELFLAKELTKKYETFFKGSAKELSEKLSKETIKGEWVVVIQGSQQKDSTLSLDIEDIMVL--PLPKKEKAKLLSKISDKSIKEWYSILNNS 271
>gi|150398728|ref|YP_001329195.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Sinorhizobium medicae WSM419] >gi|150030243|gb|ABR62360.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Sinorhizobium medicae WSM419] (320 aa)
Score = 303, Expect = 6.2e-26, Identities = 73/215 (33%), Positives = 115/215 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANIN---EIKITEKGEFVILI 219
           L++VATPIGN+ +I+  A+ T+    +  CEDTR ++ LL+   I      ++  N      + + + D       L+SDAG P++SDPG+ L    ++  + V  + GPS+ + +L+ SG PS   LF GFL      K+D+L +L N   T+I FES HRI  TL    E+    +   + RELTK  E   R ++  +    +     KGE V+++
  S:    45 LYLVATPIGNLGDITLRALETIAAADVLACEDTRVTRVLLDRYGIVNRPIAYHEHNAAEAGPRLLAALD-GGKSVALVSDAGTPLVSDPGYRLAQQAVEAGYRVVPVPGPSAPLAALVGSGLPSDAFLFAGFLPGKDKAKRDRLAELANIPATLIFFESPHRIAATLTAAAEVLGEDRRAAVCRELTKAFEEFRRGTLGELRTAYDEGGNVKGEIVLVV 262
>gi|188584683|ref|YP_001916228.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349370|gb|ACB83640.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Natranaerobius thermophilus JW/NM-WN-LF] (285 aa)
Score = 303, Expect = 6.3e-26, Identities = 86/269 (31%), Positives = 145/269 (53%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           KLF+  TPIGN+++I+   I  L   ++  CEDTR +KKLLN L I++E  +++  N  +  Q I     +  +  L+SDAG P +SDPG  L+   I+   +V  + GPS+ + +L  SG  + + +F G++      ++D L ++   + T+I++E+ +R++ T+  + +     + I IA+ELTK++E   R +   + E   K + KGE  +LI      TE       D   +LNE   LI +G  +K A K+VS    +    +Y
  S:     9 KLFLCPTPIGNLRDITLRVIDCLKEVNLVACEDTRRTKKLLNHLEINVEMLSYHKFNQESRGQQIIEKLLQGMDVALVSDAGTPSISDPGKFLVQEAIQKEIEVIALPGPSAPITALAGSGLDTDSFMFLGYIPEKGIERKDILAEIIGSAHTVILYENYNRLEKTINDLSKQL-GKRQIVIAKELTKVHEQYIRGTAKELLEYLEKNSIKGECTVLIQGANHTTELNYLPGEDAKSHLNE---LIGQGFTKKQAIKLVSQLREIPKREVY 275
>gi|120555373|ref|YP_959724.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Marinobacter aquaeolei VT8] >gi|120325222|gb|ABM19537.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Marinobacter aquaeolei VT8] (287 aa)
Score = 303, Expect = 6.4e-26, Identities = 75/222 (33%), Positives = 129/222 (58%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFIN---SFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNN 222
           ++ +L IVATPIGN+ ++S+ A   L    +   EDTR+S +LL  L +S   K   +L+ +NE+  +    S   +  +  L+SDAG P++SDPG++L+    K  + V  I GP +L+ +L  +G P+   LF GFL   +  ++  L +L+ ++ T++ +ES HRI D ++ + + F + +   + RELTK  ET Y  ++    A +       +GEFV+++  N
  S:     9 VDGRLSIVATPIGNLADLSDRARQVLAAADLVAAEDTRHSSRLLQHLGLS---KPLLALHDHNERDRVGRILSALAEGQQVALISDAGTPLISDPGYILVREARKAGFPVSPIPGPCALVAALSAAGLPTDRFLFAGFLPAKRAGRRSALAELREQTATLVFYESPHRILDLMQDLVDEFGDGRECVLGRELTKTFETFYSGTVKEVLAELEADPHGSRGEFVVMVRGN 234
>gi|148244231|ref|YP_001218925.1| methyltransferase [Candidatus Vesicomyosocius okutanii HA] >gi|146326058|dbj|BAF61201.1| methyltransferase [Candidatus Vesicomyosocius okutanii HA] (276 aa)
Score = 303, Expect = 6.4e-26, Identities = 79/232 (34%), Positives = 130/232 (56%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETESIKKE 232
           MN  L+I+ATPIGN+ +I+  AI TL    I   ED  +SK+LLN  +I+    TF+  N   +   I +   K   + L+SDAG P++SDPG +L+    K   +V  I G ++++ ++ VSG  S+   F+GFL   ++ +   +  + N ++  I +ES +RI    + ++ +  N + +C A+ELTK+ ETI  +++  + +        +KGEFVILI    K  E   +E
  S:     1 MNGTLYIIATPIGNLNDITFRAIETLKTVDIILAEDICHSKRLLNHYDITTSMYTFHEHNERCKTPDIINKLLKGKHFALISDAGTPLISDPGHVLVIEAKKVGINVSPIPGSNAMISAISVSGIASNKFSFFGFLPSKQSARLKVIQSIVNINEMAIFYESPNRILSCAQDLQTVLGNERIVCFAKELTKLFETIKTNTLPQLIDYLQADNTHQKGEFVILISAAKKNNEVSGEE 236
>gi|30018307|ref|NP_829938.1| Corrin/porphyrin methyltransferase [Bacillus cereus ATCC 14579] >gi|29893847|gb|AAP07139.1| Corrin/porphyrin methyltransferase [Bacillus cereus ATCC 14579] (291 aa)
Score = 303, Expect = 6.6e-26, Identities = 87/275 (31%), Positives = 144/275 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGN-NEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLI-RKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI  L    +   EDTR +KKL N   I     +++  N   + K+ +   +   N   L+SDAG P +SDPG+ ++   +   + V  + G ++ + +LI SG  +    FYGFL  NK  ++ +L +L+    T++ +E+ HR+ DTL  ++E+  N + I + RELTK  E   R +I   I   K  E +GEF IL+  + +E    ++    +SVY + +E  I  K    K A K V+    L    +Y  +   K
  S:    15 LYLVPTPIGNLEDMTFRAIRILKEVDLIAAEDTRQTKKLCNYFEIETPVTSYHEHNKEVSGKKLLEKLEDGKN-VALVSDAGMPCISDPGYDIVVEAVAEQYHVIPLPGANAALTALIASGLETKQFYFYGFLQRNKKERKMELEKLRYVQTTMMFYEAPHRLDDTLISMQEVLGN-REIVLCRELTKKFEEFIRGTIEEAIEWTKQNEVRGEFCILVAGSTEEPAPEEQWWESFSVY-DHIEYYINEKSMNSKEAIKTVAKDRDLSKRDVYQIYHVDK 290
>gi|116250103|ref|YP_765941.1| putative tetrapyrrole-methylase protein [Rhizobium leguminosarum bv. viciae 3841] >gi|115254751|emb|CAK05825.1| putative tetrapyrrole-methylase protein [Rhizobium leguminosarum bv. viciae 3841] (305 aa)
Score = 303, Expect = 7.0e-26, Identities = 80/241 (33%), Positives = 130/241 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK---QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI----NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEK 245
           L++VATPIGN+ +I+  A+ TL    +  CEDTR ++ LL+   I  +N+ F     N ++   + + + +       L+SDAG P++SDPG+ L    I   + V  I G S+ + +L+ SG P+   LF GFL      ++D+L +L     T+I FES HRI  TL    ++   ++   + RELTK  E   R ++A +     +++   KGE V++I       E ++ +E D    L +L K
  S:    31 LYLVATPIGNLGDITLRALETLAGADVLACEDTRVTRVLLDRYGI--QNRPFAYHEHNADEAGPRLLQALE-AGRSVALVSDAGTPLVSDPGYRLAQQAIAAGYRVIPIPGASAPLAALVGSGLPNDAFLFAGFLPAKDKARRDRLGELAAAPATLIFFESPHRIGATLLAAADVLGPTRPASVCRELTKTYEEFRRGTLAELAAHYQQVE-NVKGEIVLVIG----PPEPVETDEADVEAMLADLSK 270
>gi|167213572|ref|ZP_02283879.1| tetrapyrrole methylase family protein [Listeria monocytogenes FSL R2-503] (275 aa)
Score = 303, Expect = 7.3e-26, Identities = 82/270 (30%), Positives = 137/270 (50%)
  Q:    10 TPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVK---ETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           TPIGN+++++  AI  L    I   EDTRN+ KLLN   I+    +++     N++  I           L+SDAG P +SDPG+ L+   +  N  V  + G ++ + +LI SG       FYGFL      +   + +L    +T I++ES HR+K+TLK I +I  N + I + RELTK  E   R ++ +     + E  +GEF ++I+ N       E +  +E D   +++ +  + ++    K A K V    +L    +Y+ + + K
  S:     3 TPIGNLEDMTFRAIRMLKEADIIAAEDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLDGEVVALVSDAGMPSISDPGYELVQSALNANIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIEKLAAREETWILYESPHRLKETLKAIIKITGNDRKIVLCRELTKRFEEFLRGTVEDALNWAMDEEVRGEFCLIIEGNANPPLAEEQLWWQELDIKTHVSTV--MEQENVSSKDAIKTVMKARNLPKREVYSAYHEIK 275
>gi|54020348|ref|YP_115632.1| hypothetical protein mhp118 [Mycoplasma hyopneumoniae 232] >gi|53987521|gb|AAV27722.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] >gi|144227539|gb|AAZ44344.2| conserved hypothetical protein [Mycoplasma hyopneumoniae J] >gi|144575352|gb|AAZ53635.2| conserved hypothetical protein [Mycoplasma hyopneumoniae 7448] (244 aa)
Score = 302, Expect = 7.8e-26, Identities = 78/219 (35%), Positives = 132/219 (60%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENK-TFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNET-IYRSSIANINEIKITEKGEFVILI 219
           M+ K+ ++ATPIGN+K+IS   I  L    +  CED+R S+KLLN L I  +   +++  N N+    I+   F   +  L+SDAG P++SDPG  LIN   KN  DV  + GP + + + ++SGF  S ++F GF N  K     Q+   K  + + I + S H++ + L++IKEI+ ++  I + +E+TK+++   + + I+ IN++K + KGEF +++
  S:     1 MSAKITVLATPIGNLKDISLRGIEALREAELILCEDSRVSRKLLNFLEIYDKKLISYHKFNENSVISKISPLIFSGKKVLLISDAGSPLVSDPGQFLINWAHKNEIDVDFLPGPCAFVSAFVLSGF-DSPLIFMGFFNSRKQQIIKQITIFK-PNFSYIFYISPHKLINILEVIKEIYGDNIEIFLVKEMTKLHQKYFFGTPISIINQLKDSLKGEFTMVL 219
>gi|188588287|ref|YP_001922498.1| conserved hypothetical protein [Clostridium botulinum E3 str. Alaska E43] >gi|188498568|gb|ACD51704.1| conserved hypothetical protein [Clostridium botulinum E3 str. Alaska E43] (281 aa)
Score = 302, Expect = 8.1e-26, Identities = 88/271 (32%), Positives = 150/271 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFL---NHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI-ANINEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYL---NELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           KL++V TPIGN+K+I+  A+  L    I   EDTR + KLLN  +I     +++  N  ++   I           L+SDAG P +SDPG +++   I+      ++ G +++  +L+ SG  ++  +F GFL   N ++N  +++L Q     +T+I +E+ HR+ DTL  +   F N + I + RELTK+ E I+R +I  +IN     + +GEFV++++   K  E IK+E     + L   + + K I +G  +K A K V+    +  + +Y F
  S:     5 KLYLVPTPIGNLKDITLRALEVLNEADIIAAEDTRQTLKLLNHFDIKKTLISYHKFNEKDKSNEIIDRLLNGQSIALVSDAGTPGISDPGSVIVKRCIEEGIAFNVLPGATAITTALVYSGLDTTKFIFRGFLPRENKDRNAIKEELLQ---SQETLIFYEAPHRLLDTLSFLYNSFGN-RQIAVCRELTKLYEQIFRGTIEESINYFTENKPRGEFVLVLEG--KRLEEIKQERESEWIDLSIEDHIMKYINEGISKKDAIKAVAKDRGIPKSEVYKF 277
>gi|192809524|ref|ZP_03038199.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Geobacillus sp. Y412MC10] >gi|192802195|gb|EDV78700.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Geobacillus sp. Y412MC10] (297 aa)
Score = 302, Expect = 8.3e-26, Identities = 90/269 (33%), Positives = 145/269 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQF---INSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEK---GEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLYN 273
           L++VATPIGN+++I+  A+  L    I   EDTR S+KLL   +  +  K  +S + +N+      I  +  +     L+SDAG P +SDPG  L++L I+    V  I G ++ + +LIVSG P+    F GFL   +     QL  L++   T++ +ES HR+K TL++++E+  N K + +ARELTK  E   R SI+   +  +TE    GE+ ++++    E E  +K      + L E +    R+G   K A K  +    +    +YN
  S:    20 LYLVATPIGNLEDITYRAVRILQECDIIAAEDTRQSRKLLT--HFEIPAKPLFSYHEHNKAASGPEIIRYIIEGKNVALVSDAGLPAISDPGSDLVSLAIEAGISVIPIPGANAALSALIVSGLPTERFTFIGFLPRERKDIVQQLQALQSAQGTLLFYESPHRVKKTLEILQEVLGNRK-VTLARELTKRYEEFVRGSISECLDW-LTEHPPLGEYCLVVEAGSAEEEQKEKNAWWQELSLEEHVGHYEREGLSRKDAMKKTAGDRGVSKRDIYN 291
>gi|25011663|ref|NP_736058.1| tetrapyrrole methylase family protein [Streptococcus agalactiae NEM316] >gi|77413443|ref|ZP_00789635.1| conserved hypothetical protein TIGR00096 [Streptococcus agalactiae 515] >gi|24413203|emb|CAD47282.1| Unknown [Streptococcus agalactiae NEM316] >gi|77160537|gb|EAO71656.1| conserved hypothetical protein TIGR00096 [Streptococcus agalactiae 515] (287 aa)
Score = 302, Expect = 8.5e-26, Identities = 85/268 (31%), Positives = 140/268 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++V TPIGN+ +++  AI  L        EDTRN+  LL   +I+ +  +F+  N  ++   +     +      +SDAG P +SDPG  L+   I+    V  I G S+ + +LI SG      +FYGFL   K  +       K+  +T I +ES  R+ DTLK +KEI+ + + + + RELTK+ E   R +I+ +  +  K+  KGE +I++D   ++TE +K       + L  +++ I  G+K   A K V+ + +L    LY
  S:    16 LYLVPTPIGNLDDMTFRAIRILREVDFICAEDTRNTGLLLKHFDITTKQISFHEHNAYDKISGLIDLLKEGRSLAQVSDAGMPSISDPGHDLVKAAIEGGIPVVSIPGASAGITALIASGLAPQPHIFYGFLPRKKGQQITFFETKKDYPETQIFYESPFRVSDTLKHMKEIYGD-RQVVLVRELTKLYEEYQRGTISQLLGHIEKVPLKGECLIIVDGK-RDTERVKDSSQQDPLVL--VKEYIANGDKTNQAIKKVAKELNLNRQELY 281
>gi|156935669|ref|YP_001439585.1| hypothetical protein ESA_03535 [Enterobacter sakazakii ATCC BAA-894] >gi|156533923|gb|ABU78749.1| hypothetical protein ESA_03535 [Enterobacter sakazakii ATCC BAA-894] (286 aa)
Score = 302, Expect = 8.5e-26, Identities = 72/226 (31%), Positives = 133/226 (58%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESI 229
           +L+IV TPIGN+ +I++ A+T L +  +   EDTR++  LL    IS      ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  L+ E +T+I +ES HR+ ++L+ +  ++  S+ + +ARELTK  ETIY + ++     + + +   KGE V++++ +  + +++
  S:    13 QLYIVPTPIGNLGDITQRALTVLQSVDLIAAEDTRHTGLLLQHFAISAR---LFALHDHNEQQKAETLIAKLREGQNIALVSDAGTPLINDPGYHLVRACREAGLRVVPLPGPCAAIAALSAAGLPSDRFCYEGFLPAKSKGRRDALKALEQEPRTLIFYESTHRLLESLEDMVAVWGESRYVVLARELTKTWETIYGAPVSELLAWVKDDENRRKGEMVLIVEGHKAQEDAL 242
>gi|166033097|ref|ZP_02235926.1| hypothetical protein DORFOR_02819 [Dorea formicigenerans ATCC 27755] >gi|166027454|gb|EDR46211.1| hypothetical protein DORFOR_02819 [Dorea formicigenerans ATCC 27755] (278 aa)
Score = 302, Expect = 8.6e-26, Identities = 82/272 (30%), Positives = 151/272 (55%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI-ANINEIKITE-KGEFVILIDNNVKETESIKKEETDY-SVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           M+  L++ ATPIGN+++++   +  L    +   EDTRNS KLLN  +I     +++  N   +   +        +  L++DAG P +SDPG  L+ +  +    V  + G ++ + +L +SG  +    F  FL  +K  +Q  LN+L  E++T+II+E+ HR+  TL+++     + + I I RELTK +ET++ ++I A +   K  E KGE V++I+   ++ E I++E   +  + + E ++  + +G ++K A KMV+    +    +Y
  S:     1 MSGTLYLCATPIGNLEDMTFRCVRILKEVDLIAAEDTRNSIKLLNHFDIHTPMTSYHEYNKIAKAHTLIEHLENGEDIALITDAGTPGISDPGEELVAMCQEAGITVTAVPGAAACITALTISGLSTRRFAFEAFLPTDKKERQAVLNELMEETRTMIIYEAPHRLVRTLELLLATLGD-RRIRICRELTKKHETVFATTISAAVEYYKEQEPKGECVLVIEGKSRQ-EQIEEERQKWEEMSIQEHMDYYMDQGIQKKEAMKMVAKDRGVGKRDIY 274
>gi|86609934|ref|YP_478696.1| tetrapyrrole methylase family protein [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86558476|gb|ABD03433.1| tetrapyrrole methylase family protein [Synechococcus sp. JA-2-3B'a(2-13)] (329 aa)
Score = 302, Expect = 8.6e-26, Identities = 73/224 (32%), Positives = 121/224 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETES 228
           L++VATPIGN ++I+  A+  L        EDTR+S +LL    IS    +++  N       +  +        L+SDAG P +SDPG  L+   I+    V  + GP + + +L  SG P+   +F GFL    + +Q +L QL  E +T++++E+ HR++ TL+ + +     + I +ARELTK+ E+ +R S+A   E    +  +GEF +L++  V    S
  S:     8 LYLVATPIGNREDITLRALRVLREVDWVAAEDTRHSGQLLKHFQISARLISYHEHNAAQRIPQLLKYLSAGQSVALISDAGTPAISDPGEELVRACIQAGIPVIPVPGPVAAVAALTASGLPTGRFVFEGFLPLKPSQRQARLRQLAQEERTVVLYEAPHRLRQTLQDLLDHCGPERQIVLARELTKLYESFWRGSLAAALEHCAAQPPRGEFTLLLEGYVGAVPS 233
>gi|196189359|gb|EDX84323.1| conserved hypothetical protein TIGR00096 [Synechococcus sp. PCC 7335] (300 aa)
Score = 302, Expect = 9.0e-26, Identities = 77/268 (28%), Positives = 136/268 (50%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI--ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++V TPIGN+++I+  A+  L    +   EDTR++ KLL+   +S    +++  N      Q +           L++DAG P +SDPG+ L+   ++ +  V  I GPS+++ ++  +G P    +F GFL      ++ +L  LK+E +T + +ES HR+  TL  ++ +    + + +ARELTK  E  +R +I  A  +   +  KGEF +L+          K E T       EL+ L+ +G+    A + ++    L    +Y
  S:    13 LYLVGTPIGNLEDITFRALRVLKQADLIAAEDTRHTGKLLHHFQVSTPQISYHDHNTQQRIPQLVKKLQ-AGAVIALVTDAGTPGISDPGYELVCACVEADITVVPIPGPSAVITAITAAGLPCDRFVFEGFLPVKGKYRKARLKALKSEPRTAVFYESPHRLLKTLTDLEAVVGPDRQVVLARELTKRYEEFWRGTIEEAITHYQSVPSKGEFTLLLAPTSTPFSLSKAEIT------TELKSLLAQGQSRTEASRNLAQHSDLSKREIY 276
>gi|54295833|ref|YP_128248.1| hypothetical protein lpl2924 [Legionella pneumophila str. Lens] >gi|53755665|emb|CAH17168.1| hypothetical protein [Legionella pneumophila str. Lens] (283 aa)
Score = 302, Expect = 9.3e-26, Identities = 74/214 (34%), Positives = 117/214 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVIL 218
           L+IVATPIGN ++IS  A+ TL +  +   EDTR+S +LL  L I     + ++ N  N+   I           L+SDAG P++SDPGF L+    +++  V  + G  +L+ +L  +G P  +  F GFL   ++ ++D L   ++   T + +ES HRI D L  I EI+     + +A+E+TK  E      I  I +  ++E    KGEFV++
  S:    12 LYIVATPIGNREDISFRALNTLKSVDLILAEDTRHSMQLLTSLGIKNNLTSLHAHNEANKSNEIIELLLHGKSIALISDAGTPLISDPGFPLVKQARQHHIPVVPVPGACALIAALSAAGVPCDSFAFLGFLPAKQSARKDALESSRSVPYTTVFYESTHRIIDCLNDIAEIYGQDYELVLAKEITKTFERFVSGKIKEIKDWLLSEPGHIKGEFVLI 229
>gi|83816757|ref|YP_446194.1| tetrapyrrole methylase family protein [Salinibacter ruber DSM 13855] >gi|83758151|gb|ABC46264.1| tetrapyrrole methylase family protein [Salinibacter ruber DSM 13855] (222 aa)
Score = 302, Expect = 9.4e-26, Identities = 70/216 (32%), Positives = 121/216 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI-----KITEKGEFVILID 220
           L++V TPIGN+ +I+  A+  L    +  CEDTR S +LL+  ++     +++  N   +   + +      +  L+SDAG P +SDPGF +     + + +VQ + GP++L+ +L  S  PS    F GFL   K  +Q +L  L +E +T++++ES HR+  TL+ + E F   +   +ARELTK  E + R ++  +        K+  +GE V+++D
  S:     2 LYLVPTPIGNLDDITLRALRVLREADLIACEDTRTSGRLLDHHDVDTPTTSYHEHNEREKTPELLTRMRVGRDVALISDAGSPGISDPGFYIARACWEEDIEVQALPGPTALIPALTASALPSDRFAFEGFLP-KKQGRQTRLTTLADEPRTVVLYESPHRLLRTLEDLIEHFGADRRAAVARELTKKYEEVERGTLKEVRSYFGGYKKV--RGECVVVVD 219
>gi|52843189|ref|YP_096988.1| tetrapyrrole (corrin/porphyrin) methylase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52630300|gb|AAU29041.1| tetrapyrrole (corrin/porphyrin) methylase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (283 aa)
Score = 302, Expect = 9.5e-26, Identities = 74/214 (34%), Positives = 117/214 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVIL 218
           L+IVATPIGN ++IS  A+ TL +  +   EDTR+S +LL  L I     + ++ N  N+   I           L+SDAG P++SDPGF L+    +++  V  + G  +L+ +L  +G P  +  F GFL   ++ ++  L   ++   TI+ +ES HRI D L  I EI+     + +A+E+TK  E      I  I +  ++E    KGEFV++
  S:    12 LYIVATPIGNREDISFRALNTLKSVDLILAEDTRHSMQLLTSLGIKNNLASLHTHNEANKSNEIIELLLHGKSIALISDAGTPLISDPGFPLVKQARQHHIPVVPVPGACALIAALSAAGVPCDSFAFLGFLPAKQSARKHALESSRSVPYTIVFYESTHRIIDCLNDIAEIYGQDYELVLAKEITKTFERFVSGKIKEIKDWLLSEPGHIKGEFVLI 229
>gi|160947352|ref|ZP_02094519.1| hypothetical protein PEPMIC_01286 [Peptostreptococcus micros ATCC 33270] >gi|158446486|gb|EDP23481.1| hypothetical protein PEPMIC_01286 [Peptostreptococcus micros ATCC 33270] (279 aa)
Score = 302, Expect = 9.8e-26, Identities = 86/270 (31%), Positives = 143/270 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           ++ V TPIGN+K+I+  A+  L  + I +CEDTRNS  LL   NI+ +  +++  N +   + I S         ++SDAG PI++DPGF+++   IK +   +I+ G  +L++ +  SGF S++ ++ GF+    + ++      KN   T I +ES HR+  TLK +  +F N  N+C+ RELTK+ E   R  +  I      +  KGE V++I       E I +E+ D  +   E+ KL   G   K   K++   +++  N  Y  
  S:     7 IYFVPTPIGNMKDITLRALEVLEKSDIIYCEDTRNSLNLLKFHNINTKLVSYHKFNESERVEEIISNISDGKIVSVISDAGMPIINDPGFVILQEVIKRDISYEILPGACALINGICGSGFDSTSFVYMGFVPKTDSERKKYFQSFKNMKVTGIFYESPHRLLKTLKFLYSLFGNI-NVCVCRELTKLFEEYKRGCLEEIISYYSEKGVKGEIVLII-------EKISEEKEDVDIK-KEILKLKDDGYSNKDIVKILKNNFNISKNEAYEL 269
>gi|169196399|ref|ZP_02855753.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169091142|gb|EDS69852.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] (305 aa)
Score = 302, Expect = 9.8e-26, Identities = 79/255 (30%), Positives = 130/255 (50%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKM 259
           L++VATPIGN+ +I+  A+ TL    +  CEDTR ++ LL+   I     +++  N +     +           L+SDAG P++SDPG+ L    I   + V  I G S+ + +L+ SG P+   LF GFL      ++D+L +L     T+I FES HRI  TL    ++  +++   + RELTK  E   R ++    A+  +++   KGE V++    V   E ++  E D    L +L K +   +    A ++
  S:    31 LYLVATPIGNLGDITLRALETLAGADVLACEDTRVTRVLLDRYGIQNRPFSYHEYNADEAGPRLLQALEAGRSVALVSDAGTPLVSDPGYRLAQQAITAGYRVIPIPGASAPLAALVGSGLPNDAFLFAGFLPVKDKARRDRLGELAAAPATLIFFESPHRIGATLLAAADVLGSARPASVCRELTKTYEEFRRGTLGELAAHYQQVE-NVKGEIVLV----VGPPEPVETPEADVEAVLADLAKTMPTAKAATEAARL 284
>gi|163698974|ref|ZP_02117835.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060] >gi|162434825|gb|EDQ45408.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060] (317 aa)
Score = 301, Expect = 9.9e-26, Identities = 70/220 (31%), Positives = 122/220 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI-NEIKIT--EKGEFVILIDNNVK 224
           L +VATPIGN+K+++  A+ TL        EDTR ++ LL    I+    +++  +G   ++ + +         L+SDAG P++SDPGF L+   I     V  + GPS+ + +L+ +G P+    F GFL      ++++L  L +   T+++FE+ HR+ + L    E+    ++  +ARELTK+ ET+ R  +A++  E   +   KGE V++I   V+
  S:    38 LHVVATPIGNLKDVTFRALGTLAAADAVLAEDTRVTRTLLAHYGITTPLVSYHEHSGEAVRERMVARMKAGEALALVSDAGTPLVSDPGFKLVQAAIAAGLSVTPVPGPSAAITALMAAGLPTDRFFFEGFLPQKAGARRNRLAALASVPGTLVLFEAPHRLPEMLADAAEMLGGGRSAAVARELTKLFETVRRGDLASLAAEFAASGPPKGEVVVVIGAAVE 260
>gi|167358371|ref|ZP_02293027.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167074735|gb|EDR78555.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] (305 aa)
Score = 301, Expect = 1.0e-25, Identities = 80/241 (33%), Positives = 130/241 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK---QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI----NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEK 245
           L++VATPIGN+ +I+  A+ TL    +  CEDTR ++ LL+   I  +N+ F     N ++   + + + +       L+SDAG P++SDPG+ L    I   + V  I G S+ + +L+ SG P+   LF GFL      ++D+L +L     T+I FES HRI  TL    ++    +   + RELTK  E   R ++A++     +++   KGE V++I       E ++ +E D    L +L K
  S:    31 LYLVATPIGNLGDITLRALETLAGADVLACEDTRVTRVLLDRYGI--QNRPFAYHEHNADEAGPRLLQALE-AGRSVALVSDAGTPLVSDPGYRLAQQAIAAGYRVIPIPGASAPLAALVGSGLPNDAFLFAGFLPAKDKARRDRLGELAAAPATLIFFESPHRIGATLLAAADVLGPMRPASVCRELTKTYEEFRRGTLADLAAHYQQVE-NVKGEIVLVIG----PPEPVETDEADVEAMLADLSK 270
>gi|12723275|gb|AAK04500.1|AE006276_15 HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis Il1403] (302 aa)
Score = 301, Expect = 1.1e-25, Identities = 82/268 (30%), Positives = 139/268 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++V TPIGN+++++  ++ TL    +   EDTRN+ +LLN   I +  ++F+  N   +   +  F  K      +SDAG P +SDPG  L+   I    DV  + G S+ + +LI SG      +FYGFL   K  +Q  L    +  +T I +ES  R+ DTL  ++EI+ + + + + RELTK+ E   R  I+ + E    +  KGE +I++    +  + +++ E      L  ++ L+ +  K  VA K ++ +  L    LY
  S:    31 LYLVPTPIGNMQDMTLRSLETLKTVDLICSEDTRNTLRLLNHFEIKVPQESFHEHNSQEKIPKLIDFLKKGQSIAQVSDAGMPSISDPGHDLVLAAIDEGIDVIALPGASAGITALIASGLVPQPHIFYGFLPRKKGEQQKFLKSKLSYPETQIFYESPFRVGDTLANMQEIYGD-REVVLVRELTKIYEEYRRGKISEVLESLTDQPIKGECLIIVSGADEVAQEVQEPEL---TALEAVKVLVEQSVKPNVAIKQIAKERGLNRQELY 296
>gi|16766561|ref|NP_462176.1| putative methyltransferase [Salmonella typhimurium LT2] >gi|161616269|ref|YP_001590234.1| hypothetical protein SPAB_04074 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167544131|ref|ZP_02339703.1| putative methyltransferase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167990172|ref|ZP_02571272.1| putative methyltransferase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168227777|ref|ZP_02653008.1| putative methyltransferase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168237966|ref|ZP_02663024.1| putative methyltransferase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168262724|ref|ZP_02684697.1| putative methyltransferase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|194735040|ref|YP_002116215.1| hypothetical protein SeSA_A3452 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|16421821|gb|AAL22135.1| putative methyltransferase [Salmonella typhimurium LT2] >gi|161365633|gb|ABX69401.1| hypothetical protein SPAB_04074 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194710542|gb|ACF89763.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (287 aa)
Score = 301, Expect = 1.1e-25, Identities = 74/226 (32%), Positives = 129/226 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESI 229
           +LFIV TPIGN+ +I++ A+  L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  ++ E +T+I +ES HR+ D+L+ I  +   S+ + +ARELTK  ETI+ + +    A + E +   KGE V++++ +  + + +
  S:    13 QLFIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGI---NARLFALHDHNEQQKAETLVAKLKEGQNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAIAALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIETEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQEDDL 242
>gi|146313218|ref|YP_001178292.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Enterobacter sp. 638] >gi|145320094|gb|ABP62241.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Enterobacter sp. 638] (288 aa)
Score = 301, Expect = 1.1e-25, Identities = 74/229 (32%), Positives = 132/229 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESIKKE 232
           +L+IV TPIGN+ +I++ A+T L    +   EDTR++  LL    IS      ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  L+ E +T+I +ES HR+ D+L+ +  ++  ++ + +ARELTK  E I+ + +    A + E +   KGE V++++ +  + E++  E
  S:    13 QLYIVPTPIGNLSDITQRALTVLQAVDLIAAEDTRHTGLLLQHFAISAR---LFALHDHNEQQKAETLVAKLKEGQNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAIAALSAAGLPSDRFCYEGFLPAKSKGRRDTLKDLEAEPRTLIFYESTHRLLDSLEDMVTVWGEARYVVLARELTKTWENIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQEEALPAE 245
>gi|148361336|ref|YP_001252543.1| tetrapyrrole (corrin/porphyrin) methylase [Legionella pneumophila str. Corby] >gi|148283109|gb|ABQ57197.1| tetrapyrrole (corrin/porphyrin) methylase [Legionella pneumophila str. Corby] (283 aa)
Score = 301, Expect = 1.1e-25, Identities = 74/214 (34%), Positives = 117/214 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVIL 218
           L+IVATPIGN ++IS  A+ TL +  +   EDTR+S +LL  L I     + ++ N  N+   I           L+SDAG P++SDPGF L+    +++  V  + G  +L+ +L  +G P  +  F GFL   ++ ++  L   ++   TI+ +ES HRI D L  I EI+     + +A+E+TK  E      I  I +  ++E    KGEFV++
  S:    12 LYIVATPIGNREDISFRALNTLKSVDLILAEDTRHSMQLLTSLGIKNNLTSLHAHNEANKSNEIIELLLHGKSIALISDAGTPLISDPGFPLVKQARQHHIPVVPVPGACALIAALSAAGVPCDSFAFLGFLPAKQSARKHALESSRSLPYTIVFYESTHRIIDCLNDIAEIYGQDYELVLAKEITKTFERFVSGKIKEIKDWLLSEPGHIKGEFVLI 229
>gi|33240758|ref|NP_875700.1| tetrapyrrole methylase family protein [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|33238286|gb|AAQ00353.1| Tetrapyrrole methylase family protein [Prochlorococcus marinus subsp. marinus str. CCMP1375] (305 aa)
Score = 301, Expect = 1.1e-25, Identities = 90/274 (32%), Positives = 144/274 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFD---NSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQR 278
           L+++ TPIGN+ ++S  A   L+N S+  CEDTR+S +LL    I  +  +F+  N      + I   D  ++   L+SDAG P +SDPG  L+    +   DV  I GP + + +L+ SG PS    F GFL + +  +   L  +  E +T II+ES HR+   LK++KE++D    ++ + +ARELTK  E     ++ N  E       KGEF +++       E  KK   +      E+++L+ KG   K A + ++ K     N LY+   Q+
  S:    20 LYVIGTPIGNLGDLSPRAKHLLSNVSVIACEDTRHSGQLLKKFKIKGKLVSFHKHNTKLRIPKLIKELDAGES-LGLISDAGLPGISDPGEELVLATRQAGHDVICIPGPCAAITALVSSGLPSQRFCFEGFLPYKQKDRSLILQSIAKEKRTTIIYESPHRL---LKLLKELYDLCGTNRPLQVARELTKKYEEQIGPTLGNALEHFTNNQPKGEFTLVLGGKPNSEELKKKNNVELQ---EEMKRLLDKGLSLKNASRELAKKTGYSKNFLYSLIPQK 292
>gi|189468265|ref|ZP_03017050.1| hypothetical protein BACINT_04661 [Bacteroides intestinalis DSM 17393] >gi|189436529|gb|EDV05514.1| hypothetical protein BACINT_04661 [Bacteroides intestinalis DSM 17393] (224 aa)
Score = 301, Expect = 1.2e-25, Identities = 68/216 (31%), Positives = 116/216 (53%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILI 219
           KL++V TP+GN+++++  AI  L    +   EDTR S  LL    I    ++ +  N +   + + +         L+SDAG P +SDPGFL++   ++N  +VQ + G ++L+ +L+ SG P+    F GFL   K  +  +L  L  E +T++ +ES HR+   L    E F   +   ++RE++KM+E   R S+  + E       +GE VI++
  S:     3 KLYVVPTPVGNLEDMTFRAIRILKEADLILAEDTRTSGILLKHFEIKNAMQSHHKFNEHKMVESVVNRIKAGETVALISDAGTPGISDPGFLVVRECVRNGIEVQCLPGATALVPALVASGLPNEKFCFEGFLPQKKG-RMTRLKILAEERRTMVFYESPHRLVKALAQFAEHFGAERQASVSREISKMHEETVRGSLTELIEHFTANDPRGEIVIVV 219
>gi|108562955|ref|YP_627271.1| hypothetical protein HPAG1_0530 [Helicobacter pylori HPAG1] >gi|107836728|gb|ABF84597.1| hypothetical protein HPAG1_0530 [Helicobacter pylori HPAG1] (287 aa)
Score = 301, Expect = 1.2e-25, Identities = 77/220 (35%), Positives = 135/220 (61%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLL-----------NISLENKTFYSLNGNNEKQFINSFD--FKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKN-----ESKTIIIF-ESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILIDNNVK 224
           L+ + TPIGN+ +I+   +  L    +F CEDTR SK+LL+LL           NI+ + + F + + +N+++F+N  +  F D E  ++SDAG P LSDPG  L+   +K+N    ++ G ++L  +   SGF      + GFL H    ++ ++ ++ N     E KT ++F ES HR+ +TLK + ++     ++  A+ELTK+++  Y   ++ I E   + T +GE+V+++ N  K
  S:     2 LYFLPTPIGNLADITLRTLEVLERCEVFLCEDTRVSKRLLHLLAKNPIISHSFPNIATKKREFIAFHSHNDQEFLNQIEPSFFDKEIAVMSDAGMPSLSDPGMSLVAHALKHNIQYDVLPGANALTTAFCASGFLEGRFFYAGFLPHKSKERRLKIAKILNALAYLEEKTPVVFYESPHRLLETLKDLNDL-AKGMHLFAAKELTKLHQQYYLGEVSQIIERLQQSTIQGEWVLVLLNEKK 241
>gi|114770141|ref|ZP_01447679.1| hypothetical protein OM2255_10910 [alpha proteobacterium HTCC2255] >gi|114548978|gb|EAU51861.1| hypothetical protein OM2255_10910 [alpha proteobacterium HTCC2255] (289 aa)
Score = 301, Expect = 1.2e-25, Identities = 74/219 (33%), Positives = 126/219 (57%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENK---TFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEI--KITEKGEFVILI 219
           ++  L I+ATPIG   +I+  A+  L +  I   EDTR  +KL+ +  I+L  +   +++  NG  ++  I +   +       SDAG P+++DPGF L  + I+NN  V    G S+++ +L ++G P+ N  F GFL    + +   L ++++   T++ +ES  R   TL+ I +IF N ++I + RE+TK  E + R ++   INEI  + T KGE VI++
  S:     6 LDSGLHILATPIGTANDITIRALNILRDADILVAEDTRVLRKLMEIHGINLNGRKVLSYHDHNGEAQRPKIIALLTEGKAVAYASDAGTPLIADPGFSLAKIAIQNNIRVHAAPGASAVLTALCLAGLPTDNFFFGGFLGSKSSQRLKNLEKIQDLDATLVYYESPKRTLSTLRDISKIFGNGRSISVCREMTKKFEEVIRGNVDEVINEIESRNTFKGEVVIVM 230
>gi|30023988|ref|NP_266558.2| hypothetical protein L6615 [Lactococcus lactis subsp. lactis Il1403] (291 aa)
Score = 300, Expect = 1.3e-25, Identities = 82/268 (30%), Positives = 139/268 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++V TPIGN+++++  ++ TL    +   EDTRN+ +LLN   I +  ++F+  N   +   +  F  K      +SDAG P +SDPG  L+   I    DV  + G S+ + +LI SG      +FYGFL   K  +Q  L    +  +T I +ES  R+ DTL  ++EI+ + + + + RELTK+ E   R  I+ + E    +  KGE +I++    +  + +++ E      L  ++ L+ +  K  VA K ++ +  L    LY
  S:    20 LYLVPTPIGNMQDMTLRSLETLKTVDLICSEDTRNTLRLLNHFEIKVPQESFHEHNSQEKIPKLIDFLKKGQSIAQVSDAGMPSISDPGHDLVLAAIDEGIDVIALPGASAGITALIASGLVPQPHIFYGFLPRKKGEQQKFLKSKLSYPETQIFYESPFRVGDTLANMQEIYGD-REVVLVRELTKIYEEYRRGKISEVLESLTDQPIKGECLIIVSGADEVAQEVQEPEL---TALEAVKVLVEQSVKPNVAIKQIAKERGLNRQELY 285
>gi|77406652|ref|ZP_00783695.1| conserved hypothetical protein TIGR00096 [Streptococcus agalactiae H36B] >gi|77411407|ref|ZP_00787754.1| conserved hypothetical protein TIGR00096 [Streptococcus agalactiae CJB111] >gi|77162580|gb|EAO73544.1| conserved hypothetical protein TIGR00096 [Streptococcus agalactiae CJB111] >gi|77174724|gb|EAO77550.1| conserved hypothetical protein TIGR00096 [Streptococcus agalactiae H36B] (287 aa)
Score = 300, Expect = 1.3e-25, Identities = 84/268 (31%), Positives = 141/268 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++V TPIGN+ +++  AI  L        EDTRN+  LL   +I+ +  +F+  N  ++   +     +      +SDAG P +SDPG  L+   I+ +  V  I G S+ + +LI SG      +FYGFL   +  +       K+  +T I +ES  R+ DTLK +KEI+ + + + + RELTK+ E   R +I+ +  +  K+  KGE +I++D   ++TE +K       + L  +++ I  G+K   A K V+ + +L    LY
  S:    16 LYLVPTPIGNLDDMTFRAIRILREVDFICAEDTRNTGLLLKHFDITTKQISFHEHNAYDKISGLIDLLKEGRSLAQVSDAGMPSISDPGHDLVKAAIEGDIPVVSIPGASAGITALIASGLAPQPHIFYGFLPRKQGQQITFFETKKDYPETQIFYESPFRVSDTLKHMKEIYGD-RQVVLVRELTKLYEEYQRGTISQLLGHIEKVPLKGECLIIVDGK-RDTERVKDSSQQDPLVL--VKEYIANGDKTNQAIKKVAKELNLNRQELY 281
>gi|92115779|ref|YP_575508.1| hypothetical protein Nham_0147 [Nitrobacter hamburgensis X14] >gi|91798673|gb|ABE61048.1| Protein of unknown function UPF0011 [Nitrobacter hamburgensis X14] (314 aa)
Score = 300, Expect = 1.4e-25, Identities = 72/215 (33%), Positives = 125/215 (58%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIK--ITEKGEFVILI 219
           L +VATPIGN+ +I+  A+ TL    I  CEDTR +++L +  +I+   K ++  N +  +  I     +     L+SDAG P++SDPGF L+         V  + GPSS++ +L V+  P+    F GFL   +  ++ +L +L     T+++FES +RI+D+L+ +  I  N ++  I RELTK++E I R+++  + +    +  +GEFV+++
  S:    36 LHLVATPIGNLGDITLRALETLAGVDIIACEDTRITRRLTDRFSITGVLKPYHDHNASTARPKILEQLAQGASIALVSDAGTPLISDPGFKLVREVCAAGHQVIALPGPSSVLAALAVAALPTDRFFFEGFLPSKETARRTRLAELAQIDATLVMFESGNRIRDSLRDLAAILGN-RDAAICRELTKLHEDIRRATLVELAQTAAMLETRGEFVLVV 251
>gi|56415198|ref|YP_152273.1| hypothetical protein SPA3132 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|56129455|gb|AAV78961.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (287 aa)
Score = 300, Expect = 1.4e-25, Identities = 74/226 (32%), Positives = 129/226 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESI 229
           +LFIV TPIGN+ +I++ A+  L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  ++ E +T+I +ES HR+ D+L+ I  +   S+ + +ARELTK  ETI+ + +    A + E +   KGE V++++ +  + + +
  S:    13 QLFIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGI---NARLFALHDHNEQQKAETLVAKLKEGQNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAIAALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIETEPRTLIFYESTHRLFDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQEDDL 242
>gi|146298351|ref|YP_001192942.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Flavobacterium johnsoniae UW101] >gi|146152769|gb|ABQ03623.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Flavobacterium johnsoniae UW101] (238 aa)
Score = 300, Expect = 1.4e-25, Identities = 70/229 (30%), Positives = 123/229 (53%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILIDNNVKETESIKKE 232
           KL+IV TPIGN+++++  AI  L    +   EDTR S KLL    I     + +  N +   + + +         L+SDAG P +SDPGFLL    ++N  +V+ + G ++ + +L+ SG P+   +F GFL   K  +Q +   L  E++T+I++ S H++  TL    + F   + +C++REL+K++E   R +   +  +  K   +GE V+++       E+ K +
  S:     3 KLYIVPTPIGNLEDMTFRAIRVLKEVDLILAEDTRTSGKLLKHFEIGTHMHSHHMHNEHKTTENLIARLKAGETIALISDAGTPAISDPGFLLTRACVENKIEVECLPGATAFVPALVNSGLPNDKFVFEGFLPDKKG-RQTRFLALAEETRTMILYVSPHKLVKTLAEFVQYFGEDRQVCVSRELSKLHEENVRGTAKEVLAHFEKTAPRGEIVVVVAGKTITKEAKKSK 232
>gi|34540091|ref|NP_904570.1| hypothetical protein PG0242 [Porphyromonas gingivalis W83] >gi|188994210|ref|YP_001928462.1| putative methyltransferase [Porphyromonas gingivalis ATCC 33277] >gi|34396402|gb|AAQ65469.1| conserved hypothetical protein TIGR00096 [Porphyromonas gingivalis W83] >gi|188593890|dbj|BAG32865.1| putative methyltransferase [Porphyromonas gingivalis ATCC 33277] (233 aa)
Score = 300, Expect = 1.4e-25, Identities = 70/219 (31%), Positives = 120/219 (54%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILI 219
           M  +L +V TPIGN+++I+  A+  L    +   EDTR S  LL+  +I    ++ +  N +   + +           L+SDAG P +SDPGFLL+    +    V+ + GP++L+ +L+ SG P+   +F GFL   K  +Q ++ +L  E +T+I +ES HR+  TL    E F   +     REL+K++E + R ++A +  +      +GEFV+++
  S:     1 MEGRLTVVPTPIGNLEDITLRALKVLREADLILAEDTRTSSVLLHHYDIHCPLQSHHKFNEHRTAKSLAERISGGERIALISDAGTPGISDPGFLLVRACAELGVVVECLPGPTALIPALVASGLPADRFVFEGFLPVKKG-RQTRMKELAEELRTMIFYESPHRVLRTLTQFVETFGLDRPAAACRELSKLHEEVIRGTLAELLAHFENHPPRGEFVLIV 220
>gi|15645177|ref|NP_207347.1| hypothetical protein HP0552 [Helicobacter pylori 26695] >gi|2829473|sp|P56204|Y552_HELPY UPF0011 protein HP_0552 >gi|2313668|gb|AAD07618.1| conserved hypothetical protein [Helicobacter pylori 26695] (287 aa)
Score = 300, Expect = 1.4e-25, Identities = 78/220 (35%), Positives = 134/220 (60%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLL-----------NISLENKTFYSLNGNNEKQFINSF--DFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKN-----ESKTIIIF-ESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILIDNNVK 224
           L+ + TPIGN+ +I+  A+  L    +F CEDTR SK+LL+LL           NI+ + + F + + +N+++F+N     F D E  ++SDAG P LSDPG  L    +K+N    ++ G ++L  +   SGF      + GFL H    ++ ++ ++ N     E KT ++F ES HR+ +TLK + ++     ++  A+ELTK+++  Y   ++ I E   + T +GE+V+++ N  K
  S:     2 LYFLPTPIGNLADITLRALEVLERCEVFLCEDTRVSKRLLHLLAQNPIISHSFPNIATKKREFIAFHSHNDQEFLNQIKPSFFDKEIAVMSDAGMPSLSDPGMSLAAYALKHNIQYDVLPGANALTTAFCASGFLEGRFFYAGFLPHKSKERRLKIAKILNALAYLEEKTPVVFYESPHRLLETLKDLNDL-AKGMHLFAAKELTKLHQQYYLGEVSQIIERLQQSTIQGEWVLVLLNEKK 241
>gi|89892871|ref|YP_516358.1| hypothetical protein DSY0125 [Desulfitobacterium hafniense Y51] >gi|109647820|ref|ZP_01371723.1| Protein of unknown function UPF0011 [Desulfitobacterium hafniense DCB-2] >gi|89332319|dbj|BAE81914.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109640910|gb|EAT50465.1| Protein of unknown function UPF0011 [Desulfitobacterium hafniense DCB-2] (281 aa)
Score = 300, Expect = 1.5e-25, Identities = 77/276 (27%), Positives = 151/276 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK-QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYN-FWQQRKN 280
           L+I  TPIGN+ +I+  A+  L    +   EDTR+S+KLL+   I+    +++  N   +  + +   + +     L+SDAG P +SDPG  +I L ++    + ++ G ++ + +L++SG P+ + LF+GFL      ++ +L        T I +E+ HR+  TL+ + E+F   +   + RE+TK+++++++ +++  I+E K T  +GE  +L    +    +  ++E     +  E+++L  +G K   A K+V+ KY +    +Y     Q+KN
  S:     9 LYICGTPIGNLGDITLRALEVLKGVDLIAAEDTRHSRKLLDHFGIATPLTSYHEHNEKGKALELVRRLE-QGEAIALISDAGMPGISDPGQEVIQLCLEKGIPLDVLPGANAGLTALLLSGMPNDHFLFHGFLPSQSGARKKELQNYAQLPFTQIFYEAPHRLVATLEDLWEVF-GERETAVVREITKLHQSVHKGTLSTLIHEFKDTAPRGEICVLTSPYIPVPPTGGEKE-----WRQEVQELTEQGMKPNDAMKVVAQKYGVSKREVYQAVLSQKKN 281
>gi|152972070|ref|YP_001337216.1| methyltransferase domain-containing protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150956919|gb|ABR78949.1| putative enzyme with methyltransferase domain [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (287 aa)
Score = 300, Expect = 1.5e-25, Identities = 75/226 (33%), Positives = 130/226 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESI 229
           +L+IV TPIGN+ +I++ A+  L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    + N  V  + GP + + +L  +G PS    + GFL      ++D L  L+ E +T+I +ES HR+ ++L+ I  +   S+ + +ARELTK  E+I+ + I    A + E +   KGE V++++    + E++
  S:    13 QLYIVPTPIGNLSDITQRALEVLQAVDLIAAEDTRHTGLLLQHFAI---NARLFALHDHNEQQKAETLLAKLKEGQNIALVSDAGTPLINDPGYHLVRTCREANIRVVPLPGPCAAIAALSAAGLPSDRFCYEGFLPAKSKGRRDTLKALEEEPRTLIFYESTHRLVESLEDICAVLGESRYVVLARELTKTWESIHGAPIGELVAWVKEDENRRKGEMVLIVEGFKAQEEAL 242
>gi|110597073|ref|ZP_01385362.1| Protein of unknown function UPF0011 [Chlorobium ferrooxidans DSM 13031] >gi|110341264|gb|EAT59729.1| Protein of unknown function UPF0011 [Chlorobium ferrooxidans DSM 13031] (244 aa)
Score = 300, Expect = 1.5e-25, Identities = 76/223 (34%), Positives = 129/223 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFIN---SFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE---KGEFVILI---DNNVKETE 227
           L++VATP+GN+++I+  A+ TL       CEDTR +  LL   N+ +  K   S +  NE + I    +   +  +  L +DAG P++SDPG+ ++    +  + V  I GPS++  +L V   P +N  F GFL H K  ++ +L QL     +I+++ES  RI   L  I+++  +++ I I RE+TK++E     +I  I  + +TE   +GEFV+++   DN   ++E
  S:    11 LYVVATPLGNLEDITLRAVKTLQQCDAIACEDTRRASILLK--NLEISGKKLISYHNYNEPRAIGQIIALLEEGTDVALTTDAGTPVISDPGYAMLQALHQRGFKVIPIPGPSAVTAALSVCPLPVNNFFFAGFLPHKKG-RKTRLEQLAGLHVSIVLYESPFRIMKLLDEIEKVMADAR-IFIGREMTKIHEEYITGTIEEI-RLHLTEAKRRGEFVVIVHPADNKSNKSE 237
>gi|167938136|ref|ZP_02525211.1| Corrin/porphyrin methyltransferase [Bacillus cereus AH1134] >gi|168138191|ref|ZP_02581420.1| Corrin/porphyrin methyltransferase [Bacillus cereus B4264] (291 aa)
Score = 300, Expect = 1.6e-25, Identities = 87/275 (31%), Positives = 143/275 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGN-NEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLI-RKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI  L    +   EDTR +KKL N   I     +++  N   + K+ +   +   N   L+SDAG P +SDPG+ ++   +   + V  + G ++ + +LI SG  +    FYGFL  NK  ++ +L +L+    T++ +E+ HR+ DTL  ++E+  N + I + RELTK  E   R +I   I   K  E +GEF IL+  + +E    ++     SVY + +E  I  K    K A K V+    L    +Y  +   K
  S:    15 LYLVPTPIGNLEDMTFRAIRILKEVDLIAAEDTRQTKKLCNYFEIETPVTSYHEHNKEVSGKKLLEKLEDGKN-VALVSDAGMPCISDPGYDIVVEAVAEQYHVIPLPGANAALTALIASGLETKQFYFYGFLQRNKKERKMELEKLRYVQTTMMFYEAPHRLDDTLISMQEVLGN-REIVLCRELTKKFEEFIRGTIEEAIEWTKQNEVRGEFCILVAGSTEEPAPEEQWWESLSVY-DHIEYYINEKSMNSKEAIKTVAKDRDLSKRDVYQIYHVDK 290
>gi|81176827|ref|ZP_00875808.1| Protein of unknown function UPF0011 [Streptococcus suis 89/1591] >gi|146318318|ref|YP_001198030.1| methyltransferase [Streptococcus suis 05ZYH33] >gi|146320511|ref|YP_001200222.1| methyltransferase [Streptococcus suis 98HAH33] >gi|80976414|gb|EAP40024.1| Protein of unknown function UPF0011 [Streptococcus suis 89/1591] >gi|145689124|gb|ABP89630.1| Predicted methyltransferase [Streptococcus suis 05ZYH33] >gi|145691317|gb|ABP91822.1| Predicted methyltransferase [Streptococcus suis 98HAH33] (287 aa)
Score = 299, Expect = 1.7e-25, Identities = 80/272 (29%), Positives = 139/272 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQ 276
           L++V TPIGN+++++  A+  L    I   EDTRN+  LL    +  +  +F+  N + +   +  +         +SDAG P +SDPG  L+   I  +  V  + G S+ + +LI SG      +FYGFL      +++   + K   +T I +ES +R+ DTL+ +  ++ + + + + RELTK+ E   R SI+ + E   +   KGE +I+++   +E      +E D      E+E+ I  G K   A K V+ +Y LK   +Y+ + 
  S:    16 LYLVPTPIGNLQDMTFRAVQILKEVDIIAAEDTRNTGLLLKHFEVETKQISFHEHNAHEKIPVLIDWLKSGQSIAQVSDAGLPSISDPGHDLVGAAIAEDIPVVALPGASAGITALIASGLAPQPHIFYGFLPRKSGQQKEFFQEKKTYPETQIFYESPYRVADTLENMLTVYGD-RQVTVVRELTKLYEEYQRGSISELLEYLEENPLKGECLIIVEGAGEEVYP-SADEVDLKA---EVEREIASGIKPNQAIKEVAKRYQLKKQEVYDIYH 284
>gi|58040408|ref|YP_192372.1| putative corrin/porphyrin methyltransferase [Gluconobacter oxydans 621H] >gi|58002822|gb|AAW61716.1| Putative corrin/porphyrin methyltransferase [Gluconobacter oxydans 621H] (313 aa)
Score = 299, Expect = 1.8e-25, Identities = 73/215 (33%), Positives = 118/215 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESK-----TIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE-IKITE-KGEFVILI 219
           L +VATPIGN+ +ISE AI  L       CEDTR + KLL   NI+   +T +  N  +   F+     +   Y ++SDAG P++SDPG+ L+   I     V  I GP++++ +L +SG P    +F GF       ++     L+   +     T+I +E+ HR+ +TL+ + ++F  ++   + RELTK  E I R ++  + E  + T  +GE  +LI
  S:    35 LILVATPIGNLADISERAIEVLNTVDAILCEDTRVTAKLLLSRNIATPTRTLHDHNEQDRTPFLIEKLQEGARYAVVSDAGTPLVSDPGYRLVRAAIVAGIHVTAIPGPNAVVTALTLSGLPPLPFMFLGFPAPRSEARKTGFATLRAAEQAGLHSTLIWYEAPHRLIETLEDLIDVFGPNREAAVGRELTKRFEEIVRGTLTEVLEHFRTTAPRGEITLLI 256
>gi|188535037|ref|YP_001908834.1| Putative tetrapyrrole methylase [Erwinia tasmaniensis] >gi|188030079|emb|CAO97965.1| Putative tetrapyrrole methylase [Erwinia tasmaniensis] (287 aa)
Score = 299, Expect = 1.9e-25, Identities = 78/270 (28%), Positives = 147/270 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +I++ A+  L +  +   EDTR++  LL    I   N   ++L+ +NE+Q  +    +  E     L+SDAG P+++DPG+ L+ L  +    V  + G  + + +L  +G PS    + GFL      + D L  L+ E +T+I +ES HR+ D+L+ +  +    + + +ARE+TK  E+I+ + +      + E +   KGE V++++    E +++  E    ++ L + E  ++K      A ++ +  + +K N+LY +
  S:    14 LYIVPTPIGNLGDITQRALAVLASVDLIAAEDTRHTGLLLQHFAI---NARLFALHDHNEQQKADVLLTRLREGQSIALVSDAGTPLINDPGYHLVRLCREAGIRVVPLPGACAAVTALSAAGLPSDRFCYEGFLPAKSKGRCDTLKALEQEPRTLIFYESTHRLLDSLQDMVTVLGPQRYVVLAREITKTWESIFGAPVGELLSWVREDENRRKGEMVLIVEGYHAEEQALPPEALR-TLALLQTELPLKK------AAQLTAEIHGVKKNALYKY 280
>gi|160936944|ref|ZP_02084308.1| hypothetical protein CLOBOL_01833 [Clostridium bolteae ATCC BAA-613] >gi|158440134|gb|EDP17881.1| hypothetical protein CLOBOL_01833 [Clostridium bolteae ATCC BAA-613] (298 aa)
Score = 299, Expect = 2.0e-25, Identities = 77/233 (33%), Positives = 134/233 (57%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQ---LNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEE 233
           M   L++ ATPIGN+++I+   + TL    +   EDTR+S KLLN  +I     +++  N  ++ +++     +  +  L++DAG P +SDPG  L+    +    V  + GP++ + +L +SG  +    F  FL   K  K+++   L +L+ E++TII++E+ H +  TL+ + ++  + +NI I RELTK  ET YR++  +  E    E  KGE VI+I+   K  E ++KE+
  S:    18 MAGTLYLCATPIGNLEDITFRVLRTLKEVDLIAAEDTRHSIKLLNHFDIKTPMTSYHEYNKVDKARYLVGQLEEGVDIALITDAGTPGISDPGEELVRQCYEAGIQVTSLPGPAACITALTMSGLSTRRFCFEAFLPSEKGDKKERARILEELRQETRTIIVYEAPHHLVRTLEDLYKVLGD-RNITICRELTKKYETAYRTTFRDALEHYHEEEPKGECVIVIEG--KPLEELRKEQ 252
>gi|32491199|ref|NP_871453.1| hypothetical protein WGLp450 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|25166406|dbj|BAC24596.1| yraL [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (281 aa)
Score = 299, Expect = 2.0e-25, Identities = 92/271 (33%), Positives = 150/271 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFW 275
           L+IV TPIGN+ +I+  AI+ L   +    E+  ++  LLN   I  +  +F  +N  N+ + +     +     L+S+AG P ++DPG+LL++  I+ N  +  + GP + + +L  SG  S    + GFL   K+ + + L  L NES+TII++ES +R+  +LK I  IF   + I IA+ELTK+ E  YR+++      I    I  KGE+V++I  N K+  SI  E       +N    LI+   K+K A  ++S  + +K N LYN++
  S:    12 LYIVPTPIGNLNDITYRAISVLKKVNTIAAENIFHTNNLLNFYFIKNKLTSFNKINEKNKSEILIKKLIQGYSIALVSNAGTPTINDPGYLLVSKCIEQNIKIIPLPGPCAFITALSASGISSDKFCYEGFLPKKKSKRNNFLISLSNESRTIILYESSNRLLSSLKAISLIFGKKRKIVIAKELTKIWEYFYRNTLEKILLFIKNKDIVLKGEWVLIIQGNEKKFISIPIEA------INLFYILIKITSKKK-ALLIISKTFKIKKNFLYNYF 279
>gi|20806633|ref|NP_621804.1| methyltransferase [Thermoanaerobacter tengcongensis MB4] >gi|20515080|gb|AAM23408.1| predicted methyltransferases [Thermoanaerobacter tengcongensis MB4] (275 aa)
Score = 299, Expect = 2.0e-25, Identities = 84/270 (31%), Positives = 150/270 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE----KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L++  TPIGN+++I+   +  L+   +   EDTR + KLLN   I    K+  S + +N+     + I           L++DAG P +SDPG  L+ L I+    +  + GP++ + +LI SG  +S+ +F GFL      ++++L ++  E +T I++ES HR+K+TLK +KE +   + + +ARELTK++E   R ++  + E K+ E  KGE VI+I+    +   ++K+  +       L+K ++ G  +K A K V+ +  +    +Y  
  S:     7 LYLCPTPIGNLEDITLRVLRVLSEVDLIAAEDTRQTLKLLNHYEI---KKSLVSYHEHNKVTMGPKLIEKLK-SGKSIALVTDAGTPSISDPGEELVRLCIQEGIKIVPLPGPTAAITALIASGLDASSFVFEGFLPKKSKERREKLERISREERTTILYESPHRLKETLKELKE-YIGERKVVVARELTKIHEEFIRGTVEEVLE-KLGEEVKGEIVIVIEG--AKISPLQKDPKEL------LDKYLKLGMDKKEAVKKVAEELKVSKREVYKL 268
>gi|54299000|ref|YP_125369.1| hypothetical protein lpp3067 [Legionella pneumophila str. Paris] >gi|53752785|emb|CAH14220.1| hypothetical protein [Legionella pneumophila str. Paris] (283 aa)
Score = 298, Expect = 2.4e-25, Identities = 74/214 (34%), Positives = 117/214 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVIL 218
           L+IVATPIGN ++IS  A+ TL +  +   EDTR+S +LL  L I     + ++ N  N+   I           L+SDAG P++SDPGF L+    +++  V  + G  +L+ +L  +G P  +  F GFL   ++ ++  L   ++   TI+ +ES HRI D L  I EI+     + +A+E+TK  E      I  I +  ++E    KGEFV++
  S:    12 LYIVATPIGNREDISFRALNTLKSVDLILAEDTRHSMQLLTSLGIKNNLTSLHAHNEANKSNEIIELLLHGKSIALISDAGTPLISDPGFPLVKQARQHHIPVVPVPGACALIAALSAAGVPCDSFAFLGFLPAKQSARKHALESSQSLPYTIVFYESTHRIIDCLNDIAEIYGQDYELVLAKEITKTFERFVSGKIKEIKDWLLSEPGHIKGEFVLI 229
>gi|86131240|ref|ZP_01049839.1| methyltransferase [Cellulophaga sp. MED134] >gi|85818651|gb|EAQ39811.1| methyltransferase [Dokdonia donghaensis MED134] (224 aa)
Score = 298, Expect = 2.8e-25, Identities = 71/221 (32%), Positives = 116/221 (52%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILIDNNVK 224
           KL++V TPIGN+++++  AI  L    +   EDTR S KLL    I  +  + +  N +     I            +SDAG P +SDPGFLL    ++   +V  + G ++ + +L+ SGFP+   +F GFL   K  +Q +   LK E++T+II+ES H++  TL      F   + + ++RE+TK++E   R +   +  +      KGE VI++    K
  S:     3 KLYLVPTPIGNLEDMTFRAIRILKEADLILAEDTRTSGKLLKYYEIDTQMMSHHMHNEHKTVDAIVKRIAAGETIACISDAGTPAISDPGFLLTRACVEAGIEVDCLPGATAFVPALVNSGFPNDKFVFEGFLPVKKG-RQTRFLALKEETRTMIIYESPHKLVKTLGHFVAYFGEDRPVSVSREITKLHEETVRGTATEVLAHYTNKPPKGEIVIIVGGKSK 224
>gi|147676401|ref|YP_001210616.1| methyltransferase [Pelotomaculum thermopropionicum SI] >gi|146272498|dbj|BAF58247.1| predicted methyltransferase [Pelotomaculum thermopropionicum SI] (288 aa)
Score = 298, Expect = 2.9e-25, Identities = 66/215 (30%), Positives = 123/215 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILI 219
           L++ ATPIGN+++I+  A+  L    +   EDTR ++KLL+   I     +++  N   + +++           L++DAG P +SDPG  L+   ++       + GPS+ + +L+VSG PS   +F GFL  +K  +  +L +L+ +  T+I +E+ HR+K+TL  + E+  + +    ARELTK++E + R  ++ + E   ++  +GEF +++
  S:     8 LYLCATPIGNLEDITLRALRVLREVDLIAAEDTRRTRKLLSHYGIHTPLTSYHQHNRRKKGEYLLDMLESGKNVALVTDAGLPGISDPGSELVKAALEKGIRTVPLPGPSAGITALVVSGLPSDLFVFAGFLPSSKKSRVKELQELRRQRGTLIFYEAPHRLKETLADVLEVLGD-RPAAAARELTKVHEEVLRGPLSKLLEYFNEVEPQGEFTLVV 223
>gi|188527603|ref|YP_001910290.1| hypothetical protein HPSH_04125 [Helicobacter pylori Shi470] >gi|188143843|gb|ACD48260.1| hypothetical protein HPSH_04125 [Helicobacter pylori Shi470] (287 aa)
Score = 297, Expect = 3.0e-25, Identities = 77/220 (35%), Positives = 135/220 (61%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLL-----------NISLENKTFYSLNGNNEKQFINSFD--FKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKN-----ESKTIIIF-ESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILIDNNVK 224
           L+ + TPIGN+ +I+  A+  L    +F CEDTR SK+LL+LL           NI+ + + F + + +N+++F+N  +  F D E  ++SDAG P LSDPG  L+   +K++    ++ G ++L  +   SGF      + GFL H    ++ ++ ++ N     E KT ++F ES HR+ +TLK + ++     ++  A+ELTK+++  Y   I+ I E   +   +GE+V+++ N  K
  S:     2 LYFLPTPIGNLADITLRALEVLGRCEVFLCEDTRVSKRLLHLLAQNPVISHSFPNIATQKREFIAFHSHNDQEFLNKVELSFFDKEIAVMSDAGMPSLSDPGMSLVAHALKHDIPYDVLPGANALTTAFCASGFLEGRFFYAGFLPHKSKERRLKIAKILNALAYLEEKTPVVFYESPHRLLETLKDLNDL-AKGMHLFAAKELTKLHQQYYLGEISQIIERLQQSNIQGEWVLVLLNEKK 241
>gi|39995759|ref|NP_951710.1| tetrapyrrole methylase family protein [Geobacter sulfurreducens PCA] >gi|39982523|gb|AAR33983.1| tetrapyrrole methylase family protein [Geobacter sulfurreducens PCA] (286 aa)
Score = 297, Expect = 3.1e-25, Identities = 77/276 (27%), Positives = 144/276 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKE-KVACKMVSYKYSLKSNSLYNFWQQRKN 280
           L+I+ATPIGN+++I+  A+  L    +   EDTR+++KLL+   I+    +++  N + + +++ +         L++DAG P +SDPG+ L+   +     V  + GPS+ + +L  +G P+   +F GFL      + ++L  LK E + +I +E+  R++  L  ++E+  + +++ +ARELTK++E   R  ++ + E    +  KGE VIL+          + E  D       L   +R+ +   K A K VS +  +    +Y    + KN
  S:     5 LYIIATPIGNLEDITYRAVRILGEVDLVAAEDTRHTRKLLSRYGITKPLTSYFDHNKSLKGEYLLTRLHDGQSVALVTDAGTPCISDPGYQLVRDAVSEGILVVPVPGPSAFVAALSAAGLPTDAFVFEGFLPTRGKRRLEKLANLKGEQRVVIFYEAPGRLQAALADMREVLGD-RHVVVARELTKIHEEFVRGRVSFVAEHFAAVDVKGEVVILVAPAPAPATPGEGELKDL------LRHYLRRSDISFKDAVKRVSVELDISRAQVYEMALKLKN 276
>gi|86355976|ref|YP_467868.1| methyltransferase protein [Rhizobium etli CFN 42] >gi|86280078|gb|ABC89141.1| probable methyltransferase protein [Rhizobium etli CFN 42] (360 aa)
Score = 297, Expect = 3.4e-25, Identities = 70/200 (35%), Positives = 110/200 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK---QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI 204
           L++VATPIGN+ +I+  A+ TL    +  CEDTR ++ LL+   I  +N+ F     N ++   + I + +       L+SDAG P++SDPG+ L    I   + V  I G S+ + +L+ SG P+   LF GFL      ++D+L +      T+I FES HRI  TL    ++   ++  C+ RELTK  E   R ++A +
  S:    86 LYLVATPIGNLGDITLRALETLAGADVLACEDTRVTRVLLDRYGI--QNRPFAYHEHNADEAGPRLIQALE-AGRSVALVSDAGTPLVSDPGYRLARQAIAAGYRVIPIPGASAPLAALVGSGLPNDAFLFAGFLPSKDKARRDRLGEFAAAPATLIFFESPHRIGATLLAAADVLGPARPACVCRELTKTYEEFRRGTLAEL 285
>gi|153893686|ref|ZP_02014341.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Opitutaceae bacterium TAV2] >gi|151580243|gb|EDN44141.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Opitutaceae bacterium TAV2] (250 aa)
Score = 296, Expect = 3.9e-25, Identities = 72/215 (33%), Positives = 117/215 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKT-FYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILI 219
           L+++ATPIGN+ +++E A T L +  +  CEDTR +  LL  L +     T ++  N  +    +           L+SDAG P +SDPGF L+    +    V  + GP ++  +L  SG P++  LF GFL      +   L + ++   T+ ++ES HRI+     I E    ++ +CIARE+TK++ETI     A++    ++ + KGEFV+LI
  S:    26 LYVIATPIGNLSDLTERARTLLASVDLIACEDTRTTGSLLARLGLPRRELTPYHDHNEQDAAARLADQLASGRSIALVSDAGTPAISDPGFRLVRECRRRALPVVPVPGPCAVTVALSASGLPTNGFLFAGFLPPKSAARLAFLEKYQDFDYTLALYESCHRIEKFAAEIVEKLGPARVVCIAREVTKLHETILTGPAADVTARLLRGSLKGEFVVLI 243
>gi|34556872|ref|NP_906687.1| putative methylase [Wolinella succinogenes DSM 1740] >gi|34482587|emb|CAE09587.1| PUTATIVE METHYLASE [Wolinella succinogenes] (271 aa)
Score = 296, Expect = 3.9e-25, Identities = 76/225 (33%), Positives = 127/225 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLN----ISLENKTFYSLNGNNEKQFINSF--DFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESI 229
           L ++ TPIGN+++I+  ++  L    I  CEDTR SK+LL+LL+    +  +   + SL+ +NE+  + +   DF   E   +SDAG P +SDPG  L+    +      ++ G ++L+     SG  S    FYGFL H    +Q +L +L      +I++E+ HR+ + L+ I+ +  + + I  A+ELTKM+E  Y+ S + I +    E  KGE+ IL+    K  E++
  S:     2 LTLLPTPIGNLQDITLRSLEVLKVAEIILCEDTRVSKRLLSLLSQKELLPPKEYRYISLHSHNEEATLQNLPPDFFTQEVVYMSDAGMPCISDPGAALVRYAQERGISYTVLPGANALLTLFAASGSGSKEFYFYGFLPHKSKERQGELIKLLGMESDVILYEAPHRLMEFLEEIQALAPH-RRIFAAKELTKMHEKFYQGSASEIIQRVRQESTKGEWAILLYQGEKNPEAL 233
>gi|190889987|ref|YP_001976529.1| putative methyltransferase protein [Rhizobium etli CIAT 652] >gi|190695266|gb|ACE89351.1| putative methyltransferase protein [Rhizobium etli CIAT 652] (305 aa)
Score = 296, Expect = 4.0e-25, Identities = 79/241 (32%), Positives = 128/241 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK---QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI----NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEK 245
           L++VATPIGN+ +I+  A+ TL    +  CEDTR ++ LL+   I  +N+ F     N ++   + + + +       L+SDAG P++SDPG+ L    I   + V  I G S+ + +L+ SG P+   LF GFL      ++D+L +L     T+I FES HRI  TL    ++   ++   + RELTK  E   R ++A +     E+    KGE V++    V   + ++  + D    L +L K
  S:    31 LYLVATPIGNLGDITLRALETLAGADVLACEDTRVTRVLLDRYGI--QNRPFAYHEHNADEAGPRLLQALE-AGRSVALVSDAGTPLVSDPGYRLAQQAIAAGYRVVPIPGASAPLAALVGSGLPNDAFLFAGFLPAKDKARRDRLGELAAAPATLIFFESPHRIAATLLAAADVLGGTRPASVCRELTKTYEEFRRGTLAELAAHYQEVD-NVKGEIVLV----VGPPQPVETPDADVEAVLADLAK 270
>gi|161506168|ref|YP_001573280.1| hypothetical protein SARI_04359 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160867515|gb|ABX24138.1| hypothetical protein SARI_04359 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (287 aa)
Score = 296, Expect = 4.0e-25, Identities = 73/226 (32%), Positives = 130/226 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESI 229
           +LFIV TPIGN+ +I++ A+  L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  ++ E +T+I +ES HR+ D+L+ +  ++  S+ + +ARELTK  ETI+ + +    A + E +   KGE V++++ +  + + +
  S:    13 QLFIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFAI---NARLFALHDHNEQQKAETLVAKLKEGQNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAIAALSAAGLPSDRFCYEGFLPAKSKGRRDALKAVETEPRTLIFYESTHRLLDSLEDMVAVWGGSRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQEDDL 242
>gi|190572790|ref|YP_001970635.1| putative tetrapyrrole (corrin/porphyrin) methylase [Stenotrophomonas maltophilia K279a] >gi|190010712|emb|CAQ44321.1| putative tetrapyrrole (corrin/porphyrin) methylase [Stenotrophomonas maltophilia K279a] (272 aa)
Score = 296, Expect = 4.6e-25, Identities = 77/224 (34%), Positives = 125/224 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK---QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE---KGEFVILIDNNVKETES 228
           L++VATPIGN+ ++S  A   L + +    EDTR S +LL+   I    +   +L+ +NE+   Q + S         L+SDAG P++SDPGF L+         V  I G  + + +L V+G PS    F GFL    + ++D+L  L  E +T++ +ES HRI ++L  +  IF   +   +ARELTK+ ET+    +A  + +++  E   KGEFV+++     + E+
  S:     6 LYVVATPIGNLADLSPRAQEVLRSVAAICAEDTRRSGQLLSHFGI---QQPLVALHEHNEEALSQRLVSRLQAGESLALVSDAGTPLVSDPGFRLVRAARAAGIKVSPIPGACAAIAALSVAGLPSDRFSFEGFLPAKASGRRDRLQALAGEVRTMVFYESSHRIAESLADMAAIFGGERPAVLARELTKLFETVLDGDLAGLLAKVEADENQRKGEFVVMVQGAGDDEEA 233
>gi|170720120|ref|YP_001747808.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Pseudomonas putida W619] >gi|169758123|gb|ACA71439.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Pseudomonas putida W619] (291 aa)
Score = 296, Expect = 4.8e-25, Identities = 72/215 (33%), Positives = 119/215 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK-QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILI 219
           L++VATPIGN+ ++S  A+  L N ++   EDTR+S +LL    I       +  N  +E  +FI        +  L+SDAG P++SDPG+ L+        DV  + G  +L+ +L  +G PS   +F GFL      ++ +L Q+K E +T+I +E+ HRI + L+ ++ +F   +   +ARELTK  ET+    +  + E        ++GE V+L+
  S:    15 LYVVATPIGNLDDMSARALKVLANVALIAAEDTRHSIRLLQHFGIDTPLAACHEHNERDEGGRFITKL-MAGEDVALVSDAGTPLISDPGYHLVRQARAAGVDVVPVPGACALIAALSAAGLPSDRFIFEGFLPAKSAGRRARLEQVKEEPRTLIFYEAPHRILECLEDMELVFGAERPALLARELTKTFETLKGLPLGELREFVAGDSNQQRGECVVLV 233
>gi|70732394|ref|YP_262150.1| hypothetical protein PFL_5071 [Pseudomonas fluorescens Pf-5] >gi|68346693|gb|AAY94299.1| conserved hypothetical protein TIGR00096 [Pseudomonas fluorescens Pf-5] (329 aa)
Score = 296, Expect = 4.9e-25, Identities = 72/215 (33%), Positives = 121/215 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILI 219
           L++VATPIGN+ +IS  A+  L   S+   EDTR+S++L+    IS      +  N  +E  +FI      DN   L+SDAG P++SDPG+ L+        +V  + G  +L+ +L  +G PS   +F GFL      ++ +L  +K E +T+I +E+ HRI + L+ ++ +F   +   +ARELTK  ET+    ++ + +        ++GE V+L+
  S:    53 LYVVATPIGNLDDISARALKLLREVSLIAAEDTRHSQRLMQHFGISTPLAACHEHNERDEGSRFITRLLAGDN-VALISDAGTPLISDPGYHLVRQARAAGINVVPVPGACALIAALSAAGLPSDRFIFEGFLPAKAVGRRARLGAVKEEPRTLIFYEAPHRILECLQDMESVFGGERPALLARELTKTFETLKGLPLSELRQFVESDSNQQRGECVVLV 271
>gi|116511259|ref|YP_808475.1| hypothetical protein LACR_0449 [Lactococcus lactis subsp. cremoris SK11] >gi|116106913|gb|ABJ72053.1| Predicted methyltransferase [Lactococcus lactis subsp. cremoris SK11] (291 aa)
Score = 295, Expect = 5.0e-25, Identities = 83/268 (30%), Positives = 138/268 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++V TPIGN+++++  ++ TL    +   EDTRN+ +LLN   I +  ++F+  N   +   +  F         +SDAG P +SDPG  L+   IK   DV  + G S+ + +LI SG      +FYGFL   K  +Q  L       +T I +ES  R+ DTL  ++EI+ + + + + RELTK+ E   R  I+ +    + +  KGE +I++    +  + I++ E      L  ++ L+ +  K  VA K +S +  L    LY
  S:    20 LYLVPTPIGNMQDMTLRSLETLKTVDLICSEDTRNTLRLLNHFEIKVPQESFHEHNSQEKIPKLIDFLKSGQSIAQVSDAGMPSISDPGHDLVLAAIKEEIDVVALPGASAGITALIASGLVPQPHIFYGFLPRKKGEQQKFLKTKLAYPETQIFYESPFRVADTLSNMQEIYGD-REVVLVRELTKIYEEYRRGKISEVLNSLVEQPIKGECLIIVSGADELVQEIQEPEL---TALEAVKNLVAQNVKPNVAIKEISKERGLNRQDLY 285
>gi|21241537|ref|NP_641119.1| hypothetical protein XAC0766 [Xanthomonas axonopodis pv. citri str. 306] >gi|21106887|gb|AAM35655.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] (273 aa)
Score = 295, Expect = 5.2e-25, Identities = 73/223 (32%), Positives = 125/223 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSF--DFKDNE-YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANIN-EIKITE---KGEFVILIDNNVKETE 227
           L +VATPIGN+ ++S  A   L   +    EDTR++++LL    I   ++   +L+ +NE           +D E   ++SDAG P++SDPGF L+         V  + G  + + +L V+G PS    F GFL      ++++L +L  E++T++ +ES HRI ++L  ++  F + +   IARELTK+ ET+   S+A +  +++  +   KGEFV+++       E
  S:     7 LHVVATPIGNLADLSPRAQEVLRGVAAICAEDTRHTRQLLGHFGI---DRPLLALHDHNEDAMSERIVARLRDGESLAIVSDAGTPLVSDPGFKLVRAARAAGIKVSPVPGACAAIAALSVAGLPSDRFGFEGFLPAKSAARRERLARLAGETRTLVFYESAHRIVESLADLRFAFGDERPAVIARELTKLFETVLDGSLAQLQAQVEADDNQRKGEFVVMVQGAADAAE 233
>gi|167762107|ref|ZP_02434234.1| hypothetical protein BACSTE_00458 [Bacteroides stercoris ATCC 43183] >gi|167700066|gb|EDS16645.1| hypothetical protein BACSTE_00458 [Bacteroides stercoris ATCC 43183] (224 aa)
Score = 295, Expect = 5.4e-25, Identities = 65/216 (30%), Positives = 116/216 (53%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILI 219
           KL++V TP+GN+++++  AI  L    +   EDTR S  LL    I    ++ +  N +   + + +         L+SDAG P +SDPGFL++   ++N  +VQ + G ++ + +L+ SG P+    F GFL   K  +  +L  L  E +T++ +ES HR+   L    E F + +   ++RE++K++E   R ++  + E       +GE VI++
  S:     3 KLYVVPTPVGNLEDMTFRAIRILKEADLVLAEDTRTSGILLKHFEIKNAMQSHHKFNEHKTVESVVNRIKGGETVALISDAGTPGISDPGFLVVRECVRNGIEVQCLPGATAFVPALVASGLPNEKFCFEGFLPQKKG-RMTRLKGLAEECRTMVFYESPHRLVKALTQFAEYFGSERQASVSREISKIHEETVRGTLTELIEHFTANEPRGEIVIVV 219
>gi|88811848|ref|ZP_01127101.1| tetrapyrrole methylase family protein [Nitrococcus mobilis Nb-231] >gi|88790732|gb|EAR21846.1| tetrapyrrole methylase family protein [Nitrococcus mobilis Nb-231] (288 aa)
Score = 295, Expect = 5.7e-25, Identities = 72/215 (33%), Positives = 115/215 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKIT----EKGEFVILI 219
           L+ VATPIGN+ +IS  A+  L   ++   EDTR++ +LL    IS    +F+  N       + +         L+SDAG P++SDPGF L+         V  I G  S++ +L V+G P+   +F GFL    + +Q  L  L++E +T+I  ES HRI   L  +  +F  ++   +ARELTK  ET+   ++  +    +     E+GEFV+++
  S:    13 LYCVATPIGNLADISHRALDVLGRVAVIAAEDTRHTGRLLAHFAISRPLLSFHEHNEAQRSPMLLARLEAGESIALVSDAGTPLISDPGFRLVREARLRGLPVSPIPGACSIIAALSVAGLPTDRFVFEGFLPARPSARQRYLQGLRSEPRTLIFLESSHRIGAALYDLVAVFGATRMATLARELTKRYETVRLDTLTGLASWVVAQAERERGEFVLVV 231
>gi|75765081|ref|ZP_00744374.1| Tetrapyrrole (Corrin/Porphyrin) methylase family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74487429|gb|EAO51352.1| Tetrapyrrole (Corrin/Porphyrin) methylase family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] (272 aa)
Score = 295, Expect = 5.9e-25, Identities = 81/254 (31%), Positives = 135/254 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGN-NEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN-INEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACK 258
           L++V TPIGN+++++  AI  L    +   EDTR +KKL N   I     +++  N   + K+ +   +   N   L+SDAG P +SDPG+ ++   +   + V  + G ++ + +LI SG  +    FYGFL  NK  ++ +L +L+    T++ +E+ HR+ DTL  ++E+  N + I + RELTK  E   R ++   I   K  E +GEF IL+  + +E    ++     SVY +    +  KG   K A K
  S:    15 LYLVPTPIGNLEDMTFRAIRILKEVDLIAAEDTRQTKKLCNYFEIETPVTSYHEHNKEVSGKKILEKLEDGKN-VALVSDAGMPCISDPGYDIVVEAVAEQYHVIPLPGANAALTALIASGLETKQFYFYGFLQRNKKERKMELEKLRYVQTTMMFYEAPHRLDDTLISMQEVLGN-REIVLCRELTKKFEEFIRGTVEEAIEWTKQNEVRGEFCILVAGSTEEPAPEEQWWESLSVYDHIEHYINEKGMNSKEAIK 269
>gi|150387944|ref|YP_001317993.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Alkaliphilus metalliredigens QYMF] >gi|149947806|gb|ABR46334.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Alkaliphilus metalliredigens QYMF] (279 aa)
Score = 295, Expect = 6.0e-25, Identities = 91/272 (33%), Positives = 154/272 (56%)
  Q:     1 MNK-KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSS----IANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNE-LEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           M+K KL+I  TPIGN+++I+   + TL    +   EDTR++ +LLN   I     +++  N  ++  Q +N    +  +  L+SDAG P +SDPG  LI L I+ +  V+++ G ++ + +L+ SG  +    F GFL+ +K  K+++L Q+K+E +T+I +E+ HR+K+TLK + E+  N + + + RELTK  E   R      +A+  E     +GE V+L +  V    S  +EE    + + E L +LI  G  +K A K V+    +    +Y
  S:     1 MDKGKLYICPTPIGNLEDITLRVLNTLKAVDVIAAEDTRHTLRLLNHFEIQKPLTSYHEHNRMSKGPQLVNKL-LQGEKIALVSDAGMPGISDPGEDLIKLCIEEDIPVEVLPGATAGILALVASGLDARRFSFEGFLDRDKKKKKERLEQIKHEDRTLIFYEAPHRLKETLKSLSEVLGNRQAV-VGRELTKKFEEFIRGDFETLLAHFQENP--PRGEIVLLCEGGVP---SDHQEEAFKDLTIQEHLIQLIEAGMDKKQAIKEVAKARKVPKRDVY 272
>gi|90417003|ref|ZP_01224932.1| hypothetical protein GB2207_07068 [marine gamma proteobacterium HTCC2207] >gi|90331350|gb|EAS46594.1| hypothetical protein GB2207_07068 [marine gamma proteobacterium HTCC2207] (281 aa)
Score = 295, Expect = 6.1e-25, Identities = 74/224 (33%), Positives = 120/224 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILIDNNVKETES 228
           L++VATPIGN+ ++   A+  L       CEDTR+SKKLL+   I      ++  +       I +     N+  L+SDAG P++SDPG+ L+    +   +V  + G  + + +L V+G P+    F GFL      ++  L +L    +T++ +E+ HRI DTLK   E+F    +  IAREL+K  ET    ++A +  I       ++GE V+++    +ETES
  S:     9 LYVVATPIGNLGDMVPRAVEILQTVKAIACEDTRHSKKLLDHFRIDTPLMAYHDHSDKKSSHKILTQLSAGNDIALISDAGTPLISDPGYRLVLAARQQGINVIPVPGACAAIAALSVAGLPTDRFRFVGFLPAKSTQRKKVLQELAAVPETVVFYEAPHRILDTLKDSVEVFGAEHSGFIARELSKTFETYLHGTLAELVSIVEADSNQQRGEIVLVLAGR-EETES 235
>gi|50119283|ref|YP_048450.1| putative tetrapyrrole methylase [Pectobacterium atrosepticum SCRI1043] >gi|49609809|emb|CAG73243.1| putative tetrapyrrole methylase [Erwinia carotovora subsp. atroseptica SCRI1043] (295 aa)
Score = 294, Expect = 6.9e-25, Identities = 74/226 (32%), Positives = 130/226 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVIL-----IDNNVKETESIK 230
           L+IV TPIGN+ +I++ A+  L +  +   EDTR++  LL    I   N   ++L+ +NE+Q  +    K        L+SDAG P+++DPG+ L+    +    V  + G  + + +L  SG  S    + GFL      ++D+L +L  E +T+I +ES HR+ D+L+ I E+    + + +ARE+TK  E+I+ + +    A + E +   KGE V++     ID +V  +E+++
  S:    14 LYIVPTPIGNLGDITQRALAVLASVDLIAAEDTRHTGLLLQHFAI---NARLFALHDHNEQQKADVLLAKLQSGQSIALVSDAGTPLINDPGYHLVRRCREAGIRVVPLPGACAAITALSASGLASDRFCYEGFLPAKTKGRKDKLRELGEEPRTLIFYESTHRLLDSLQDISEVLGAERYVVLAREITKTWESIHGAPVGELLAWVKEDQNRRKGEMVLIVEGHKIDESVLSSEALR 248
>gi|167629312|ref|YP_001679811.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Heliobacterium modesticaldum Ice1] >gi|167592052|gb|ABZ83800.1| uroporphyrin-iii c/tetrapyrrole (corrin/porphyrin) methyltransferase, putative [Heliobacterium modesticaldum Ice1] (336 aa)
Score = 294, Expect = 7.1e-25, Identities = 68/228 (29%), Positives = 126/228 (55%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI-NEIKITEKGEFVILIDNNVKETESIKK 231
           KL + ATPIGN+++I+   +  L    +   EDTR+++KLL+  +I +   +++  N   +   I     +     L+SDAG P +SDPG  ++   +     ++++ GP++ + +L++SG P+S  +F GFL   K   +++L +L  E +T+I++ES HRI +T++ + +     +   + RELTK  E + R S+A +   ++   +GE  ++I       ES  K
  S:    26 KLILCATPIGNLEDITLRVLKALREADLIAAEDTRHTRKLLSAFDIHVPLTSYHEHNRRQKGAAILDRVAEGATVALVSDAGLPGISDPGEDIVRECVDRGLPLEVLPGPTASLTALVLSGLPTSRFVFEGFLPRPKKEFRERLRRLAFEDRTMILYESPHRILETVESLCDALGADRPAALVRELTKKFEEVRRGSLAELAAAVRDGVRGECTLVIAGRSPAAESADK 254
>gi|145620441|ref|ZP_01776472.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Geobacter bemidjiensis Bem] >gi|144943266|gb|EDJ78360.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Geobacter bemidjiensis Bem] >gi|197089142|gb|ACH40413.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Geobacter bemidjiensis Bem] (276 aa)
Score = 294, Expect = 7.4e-25, Identities = 85/272 (31%), Positives = 142/272 (52%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI-ANINEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKE-KVACKMVSYKYSLKSNSLY 272
           M+  L+IVATPIGN+++I+  A+  L    +   EDTR+S+KLL    IS    +++  N + +   I     +     L++DAG P +SDPG+ L+   +     V  I G  + + +L  SG P+ +  F GFL + +  ++++L  L  +   +I +ES  R+  TL+ + E   + + + +ARELTKM E   R  + A + E++  E +GE  IL+      T + + E TD       L+K +  GE   K A K V+ +  L  + +Y
  S:     1 MSGTLYIVATPIGNLEDITLRALRILKEVDLVAAEDTRHSRKLLTHFGISKPLTSYFDHNKDLKGDQILDRLREGQSVALITDAGTPCISDPGYQLVRDAVAGGISVVPIPGACAAVTALSASGLPTDHFSFAGFLPNRQGKRRERLQSLAADKAVLIFYESPKRLLATLQDMLETMGD-REVVVARELTKMYEEFLRGRLSALVKEVQGREIRGEVAILV------TPAEEPEATDAPGMEELLQKYLSSGEMTLKDAVKRVTLETGLHKSEVY 268
>gi|167770012|ref|ZP_02442065.1| hypothetical protein ANACOL_01354 [Anaerotruncus colihominis DSM 17241] >gi|167667846|gb|EDS11976.1| hypothetical protein ANACOL_01354 [Anaerotruncus colihominis DSM 17241] (284 aa)
Score = 294, Expect = 8.2e-25, Identities = 70/220 (31%), Positives = 127/220 (57%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILID 220
           M  KL++V TPIGN+ ++S  A  TL        EDTR + KLLN   I     ++Y  N     Q I +      +  +++DAG P +SDPG  L+ L  +N  +  ++ GPS+ + +L VSG  ++   F GFL+  ++ + + L Q + ++ T+I +E+ H++  TL+ +   F + + + +ARELTK++E ++R+++A   +   +   +GEFV++++
  S:     1 MAGKLYVVGTPIGNLGDLSPRAAETLRAVDFIAAEDTRVTLKLLNRFEIKKPMVSYYEHNLRERGQMILTRILDGEDCAIVTDAGMPCISDPGEDLVRLCAENGVETVVVPGPSAAVAALAVSGLSTARFSFEGFLSVKRSSRMEHLEQARTQTATMIFYEAPHKLCATLRDMLSAFGD-RRVTLARELTKLHEQVHRTTLAQAVQYYEENPPRGEFVLIVE 221
>gi|15611566|ref|NP_223217.1| hypothetical protein jhp0499 [Helicobacter pylori J99] >gi|11387380|sp|Q9ZLS8|Y552_HELPJ UPF0011 protein jhp_0499 >gi|4155039|gb|AAD06077.1| putative [Helicobacter pylori J99] (289 aa)
Score = 294, Expect = 8.2e-25, Identities = 76/220 (34%), Positives = 133/220 (60%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLL-----------NISLENKTFYSLNGNNEKQFINSFD--FKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKN-----ESKTIIIF-ESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILIDNNVK 224
           L+ + TPIGN+ +I+   +  L    +F CEDTR SK+LL+LL           NI+ + + F + + +N+++F+N  +  F D E  ++SDAG P LSDPG  L+   +K+N    ++ G ++L  +   SGF      + GFL H    ++ ++ ++ N     E KT ++F ES HR+ +TL+ + ++     ++  A+ELTK+++  Y   I+ I     K   +GE+V+++ N  K
  S:     2 LYFLPTPIGNLADITLRTLEVLERCEVFLCEDTRVSKRLLHLLAKNPIISHSFPNIAAKKREFIAFHSHNDQEFLNQIEPSFFDKEIAVMSDAGMPSLSDPGMSLVAYALKHNLQYDVLPGANALTTAFCASGFLEGRFFYAGFLPHKSKERRLRIIKILNALAYLEEKTPVVFYESPHRLLETLRDLNDL-AQGMHLFAAKELTKLHQQYYLGEISQIMTQLQKSNIQGEWVLVLLNEKK 241
>gi|194364369|ref|YP_002026979.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Stenotrophomonas maltophilia R551-3] >gi|194347173|gb|ACF50296.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Stenotrophomonas maltophilia R551-3] (272 aa)
Score = 294, Expect = 8.3e-25, Identities = 76/224 (33%), Positives = 121/224 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK---QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSS----IANINEIKITEKGEFVILIDNNVKETES 228
           L++VATPIGN+ ++S  A   L + +    EDTR S +LL+   I    +   +L+ +NE+   Q + S         L+SDAG P++SDPGF L+         V  I G  + + +L V+G PS    F GFL    + ++D+L  L  E +T++ +ES HRI ++L  +  IF   +   +ARELTK+ ET+        +A +       KGEFV+++     + E+
  S:     6 LYVVATPIGNLADLSPRAQEVLRSVAAICAEDTRRSGQLLSRFGI---QQPLVALHEHNEEALAQRLVSRLQAGESLALVSDAGTPLVSDPGFRLVRAARAAGIKVSPIPGACAAIAALSVAGLPSDRFSFEGFLPAKASGRRDRLQALAGEVRTMVFYESSHRITESLADMAAIFGGERPAVLARELTKLFETVLDGDLAGLLAKVEADDNQRKGEFVVMVQGAGDDEEA 233
>gi|50084324|ref|YP_045834.1| putative methyltransferase [Acinetobacter sp. ADP1] >gi|49530300|emb|CAG68012.1| putative methyltransferase [Acinetobacter sp. ADP1] (281 aa)
Score = 294, Expect = 8.3e-25, Identities = 76/222 (34%), Positives = 124/222 (55%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSS----IANINEIKITEKGEFVILIDNN 222
           M+ +LF+VATPIG++ +++  AI  L + ++   EDTR S +L    NI+      +  N +N+  Q I      +N   L+SDAG P++SDPGF L+    +N   V  + G  + + +L   G PS    F GFL    + +  QL +LK+E++T+I +E+ HRI D +  +  IF   + +  ARE+TK  ETI + +    ++ I      +KGE V+++  N
  S:     1 MSAQLFVVATPIGHLDDMTFRAIEILKSVALVAAEDTRQSAQLFKYYNIATPLTACHDHNESNKIDQLIQRLKSGEN-IALISDAGTPLISDPGFKLVRAAQENQIRVVPVPGACAAIAALSAVGLPSDRFSFEGFLPSKSSQRLLQLEKLKDETQTLIFYEAPHRILDCVTDMMHIFGEDRPVGFAREITKTFETIKKMTLKELVSFIQNDHHQQKGEIVLIVGGN 226
>gi|163757811|ref|ZP_02164900.1| probable methyltransferase protein [Hoeflea phototrophica DFL-43] >gi|162285313|gb|EDQ35595.1| probable methyltransferase protein [Hoeflea phototrophica DFL-43] (316 aa)
Score = 293, Expect = 8.5e-25, Identities = 71/215 (33%), Positives = 111/215 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILI 219
           L++VATPIGN+ +I+  A+ TL    I  CEDTR S+ LL+   I+     ++  N       + +         L+SDAG P++SDPG+ +    I+    V  I G S+ M +L+ SG PS   LF GFL      ++D+L        T++ FES +R+  +LK   ++    +   + RELTK  E I R ++  +      E  +GE V++I
  S:    40 LYLVATPIGNLGDITLRALETLAGADIIACEDTRVSRVLLDRFGIATRPYAYHEHNAERVGPKLMAALEAGKSVALISDAGTPLVSDPGYRISQTAIEAGLPVIPIPGASAPMAALVASGLPSDTFLFAGFLPSKDKARRDRLASFAATEATLMFFESPNRLAASLKSAADMLGAERPAAVCRELTKAYEEIRRGTLGELAARYENENVRGEIVLVI 256
>gi|163722582|ref|ZP_02130120.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Desulfatibacillum alkenivorans AK-01] >gi|161404336|gb|EDQ28566.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Desulfatibacillum alkenivorans AK-01] (288 aa)
Score = 293, Expect = 8.5e-25, Identities = 81/269 (30%), Positives = 147/269 (54%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQ----FINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI-NEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGE--KEKVACKMVSYKYSLKSNSLY 272
           KL+IV+TPIGN+++I+  A+ TL    I   EDTR + KLLN  NI    K   + + +NE++     I+      N   L+SD G P++SDPGF L+++ ++   +   I G  + +  L  +G P+   +F GFL   K   ++ L  +K+   T+I +ES  R+   ++ + E+  + K + +ARE+TK++E   R +++ I  E+   E  KGE  +++  +  +T        D+    N ++  + KGE    K++ K+   ++ ++   +Y
  S:    14 KLYIVSTPIGNLEDITYRAVRTLGEVDIIAAEDTRQTLKLLNHYNI---KKKLVACHEHNEQEAAKGLIDQMQQGQN-VALVSDGGAPLVSDPGFRLVSMAVEQGLEAVPIPGACAAIAGLCGAGLPTDRFMFCGFLPKKKGKLREALESVKDVQATLIFYESPKRVLKVIEGMTEVLGDRKAV-LAREITKIHEEFLRGALSEIAKELNSREGVKGECTLIVGGSEDQT-------PDFGSLENVIKAEVAKGELSASKLSAKLAK-QFGIEKKKVY 278
>gi|159184248|ref|NP_353332.2| tetrapyrrole methylase family protein [Agrobacterium tumefaciens str. C58] >gi|159139575|gb|AAK86117.2| tetrapyrrole methylase family protein [Agrobacterium tumefaciens str. C58] (313 aa)
Score = 293, Expect = 9.2e-25, Identities = 74/227 (32%), Positives = 120/227 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE---KGEFVILID----NNVKETESIKK 231
           L++VATPIGN+ +I+  A+ TL +  +  CEDTR ++ LL    I      ++  N N     + +         L+SDAG P++SDPG+ L  L ++    V  + G S+ + +L+ SG PS   LF GFL      K+D+   L     T+I FES  RI  +LK+  E+    +   + RELTK  E   R ++  + +    +   KGE V+L++    + + + E ++K
  S:    38 LYLVATPIGNLGDITIRALETLASADVLACEDTRVTRILLERYGIRTRPLAYHEHNANEAGPKLIAALEAGKSVALVSDAGTPLVSDPGYRLGQLALEAGHRVVPVPGASAPLAALVGSGMPSDAFLFAGFLPVKDRGKRDRFAGLAKIPATLIFFESPRRIGASLKVASEVLGRDRRAVVCRELTKTFEEFRRGTLGELADYYDGDRVVKGEIVLLVEPPSYDEIPDIEDVEK 271
>gi|150004390|ref|YP_001299134.1| methyltransferase [Bacteroides vulgatus ATCC 8482] >gi|149932814|gb|ABR39512.1| methyltransferase [Bacteroides vulgatus ATCC 8482] (224 aa)
Score = 293, Expect = 9.3e-25, Identities = 66/216 (30%), Positives = 117/216 (54%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILI 219
           KL++V TP+GN+++++  AI  L    +   EDTR S  LL    I    ++ +  N +   + I +         L+SDAG P +SDPGFL++   +K+  +VQ + G ++ + +L+ SG P     F GFL   K  +  +L  L+ E +T+I +ES +R+  TL    E F   + + + RE++K++E   R ++  +  +  +   +GE VI++
  S:     3 KLYVVPTPVGNLEDMTFRAIRVLKEADLILAEDTRTSGILLKHFEIKNAMQSHHKFNEHKTVEGIVNRIKAGETVALISDAGTPGISDPGFLIVRECVKSGIEVQCLPGATAFVPALVASGLPDERFCFEGFLPQKKG-RVTRLTSLQEEKRTMIFYESPYRLVKTLTQFAEFFGAERPVSVCREISKIHEESVRGTLTEVIAHFTQNEPRGEIVIVL 219
>gi|125623286|ref|YP_001031769.1| hypothetical protein llmg_0419 [Lactococcus lactis subsp. cremoris MG1363] >gi|124492094|emb|CAL97023.1| conserved hypothetical protein [Lactococcus lactis subsp. cremoris MG1363] (291 aa)
Score = 293, Expect = 1.0e-24, Identities = 82/268 (30%), Positives = 138/268 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           L++V TPIGN+++++  ++ TL    +   EDTRN+ +LLN   I +  ++F+  N   +   +  F         +SDAG P +SDPG  L+   IK   DV  + G S+ + +LI SG      +FYGFL   K  +Q  L       +T I +ES  R+ DTL  ++EI+ + + + + RELTK+ E   R  I+ +    + +  KGE +I++    +  + I++ E      L  ++ L+ +  K  VA K ++ +  L    LY
  S:    20 LYLVPTPIGNMQDMTLRSLETLKTVDLICSEDTRNTLRLLNHFEIKVPQESFHEHNSQEKIPKLIDFLKSGQSIAQVSDAGMPSISDPGHDLVLAAIKEEIDVVALPGASAGITALIASGLVPQPHIFYGFLPRKKGEQQKFLKTKLAYPETQIFYESPFRVADTLSNMQEIYGD-REVVLVRELTKIYEEYRRGKISEVLNSLVEQPIKGECLIIVSGADELVQEIQEPEL---TALEAVKNLVAQNVKPNVAIKEIAKERGLNRQDLY 285
>gi|195940949|ref|ZP_03086331.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Escherichia coli O157:H7 str. EC4024] (287 aa)
Score = 293, Expect = 1.1e-24, Identities = 72/226 (31%), Positives = 131/226 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESI 229
           +L+IV TPIGN+ +I++ A+T L    +   EDTR++  LL    I   N   ++L+ +NE+Q   +   K  E     L+SDAG P+++DPG+ L+    +    V  + GP + + +L  +G PS    + GFL      ++D L  L+ E +T+I +ES HR+ ++L+ +  ++   + + +ARELTK  ETI+ + +    A + E +   KGE V++++ +  + +++
  S:    13 QLYIVPTPIGNLSDITQRALTVLQAVDLIAAEDTRHTGLLLQHFAI---NARLFALHDHNEQQKAETLVAKLKEGQNIALVSDAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAIAALSAAGLPSDRFCYEGFLPAKSKGRRDVLKDLEAEPRTLIFYESTHRLLESLEDMVTVWGEGRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQEDAL 242
>gi|124523390|ref|ZP_01697517.1| Protein of unknown function UPF0011 [Bacillus coagulans 36D1] >gi|124495565|gb|EAY43248.1| Protein of unknown function UPF0011 [Bacillus coagulans 36D1] (294 aa)
Score = 292, Expect = 1.1e-24, Identities = 83/273 (30%), Positives = 140/273 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE-IKITE-KGEFVILIDNNVKETESIKKEETDY-----SVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           L++V TPIGN+++++  A+  L    +   EDTRNSKKL +  +I     + +  N     + +     +  +  L+SDAG P +SDPG+ L    I+    V  + G ++ + +LI SG       FYGFL   K  K+  L +L     T I++E+ HR+K TL+M+ E+    + I I+RELTK  E   R +I    E ++  E +GEF ++++ + +  E    E+ D+     SV  +    + +K    K A K+ +    L    +Y  + +
  S:    19 LYLVPTPIGNLEDMTFRAVRILKEADLIAAEDTRNSKKLCSYFDIHTPLVSHHEHNKEASTRDLIMRLTRGEKIALVSDAGMPCISDPGYELATACIREGIPVVPLPGANAALTALIASGIAPQPFTFYGFLPREKQEKRAALERLAKIPSTFILYEAPHRLKHTLQMMAEVL-GERQISISRELTKKFEEFLRGTIQEAVEWVENNEVRGEFCLVVEGSPETGE----EDDDFWWTALSVKEHVEAYMQQKQLPAKEAIKLAAKDRKLPKREVYQIYHE 293
>gi|154506313|ref|ZP_02043051.1| hypothetical protein RUMGNA_03861 [Ruminococcus gnavus ATCC 29149] >gi|153793402|gb|EDN75822.1| hypothetical protein RUMGNA_03861 [Ruminococcus gnavus ATCC 29149] (281 aa)
Score = 292, Expect = 1.1e-24, Identities = 79/279 (28%), Positives = 147/279 (52%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI--ANINEIKITEKGEFVILID-NNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           M   L++ ATPIGN+++++   I TL    +   EDTRNS KLLN   I     +++  N   + + +     +     L++DAG P +SDPG  L+ +  ++   V  + G ++ + +L +SG  +    F  FL  +K  ++  L +++ E++T+I++E+ HR+  TLK+  E   N K I + RELTK +ET    ++  A  +      KGE V++I+  + +E    ++++ +     + +E   ++G  +K A K V+    +    +Y + + RK
  S:     1 MTGTLYLCATPIGNLEDMTFRVIRTLKEVDLIAAEDTRNSIKLLNHFEIQTPMTSYHEYNKYEKGRKLVEKLLEGQNIALITDAGTPGISDPGEELVKMCYESGISVTSLPGAAACITALTISGLSTRRFAFEAFLPSDKKEREQILKEMETETRTMIVYEAPHRLVKTLKLFLERLGNRK-ITVCRELTKRHETALAVTLEEAVAHYEANPPKGECVLVIEGKSREEAREEERKQWEEMTIEDHMEVYTKQGMDKKSAMKAVAKDRGVSKRDIYQYLESRK 281
>gi|91215533|ref|ZP_01252504.1| methyltransferase [Psychroflexus torquis ATCC 700755] >gi|91186485|gb|EAS72857.1| methyltransferase [Psychroflexus torquis ATCC 700755] (226 aa)
Score = 292, Expect = 1.2e-24, Identities = 69/216 (31%), Positives = 124/216 (57%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKM-NETIYRSSIANINEIKITE-KGEFVILI 219
           KL++V TPIGN+ +++  A+  L + ++   EDTR S  LL    I    ++++  N ++  + +     +  E  +++DAG P +SDPGFLL         ++Q + G ++ + +L+ SG P+   +F GFL   K  +Q +L  L +E +T+I +ES ++I  TL+   E F + + + I+RE++K+  ET++ +    I    I + KGEFVI++
  S:     3 KLYLVPTPIGNLGDMTFRAVEVLKSVNVILAEDTRVSGILLKHYEIDTPMQSYHQHNEHSMTESVVKQIKRGRETAIITDAGTPGISDPGFLLSRACAAEGVEIQCLPGATAFVPALVNSGLPNDKFVFEGFLPAKKG-RQKRLKALSSEDRTMIFYESPYKILKTLQQFTEHFGSDREVSISREISKIYEETLHGTLDEMIAHFDIKKPKGEFVIVL 219
>gi|58583460|ref|YP_202476.1| hypothetical protein XOO3837 [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58428054|gb|AAW77091.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae KACC10331] (273 aa)
Score = 292, Expect = 1.2e-24, Identities = 70/215 (32%), Positives = 126/215 (58%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANIN-EIKITE---KGEFVILI 219
           L +VATPIGN+ ++S  A   L   +    EDTR++++LL+  +I   ++   +L+ +NE+        +  E     ++SDAG P++SDPGF L+         V  + G  + + +L V+G PS    F GFL      ++++L +L  E++T++ +ES HRI ++L  ++  F + +   IARELTK+ ET+   ++A +  +++  +   KGEFV+++
  S:     7 LHVVATPIGNLADLSPRAQEVLRGVAAICAEDTRHTRQLLSHFSI---DRPLLALHDHNEEAMSERIVARLREGESLAIVSDAGTPLVSDPGFKLVRAARAAGIKVSPVPGACAAIAALSVAGLPSDRFGFEGFLPAKSAARRERLTRLAGETRTLVFYESSHRIVESLADLRLAFGDERPAVIARELTKLFETVLDGTLAQLQAQVEADDNQRKGEFVVMV 225
>gi|154684555|ref|YP_001419716.1| YabC [Bacillus amyloliquefaciens FZB42] >gi|154350406|gb|ABS72485.1| YabC [Bacillus amyloliquefaciens FZB42] (293 aa)
Score = 292, Expect = 1.2e-24, Identities = 85/272 (31%), Positives = 146/272 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI----NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNE---LEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQ 276
           L++V TPIGN+++++  A+ TL +  +   EDTR +KKL ++ +I     +++  N  +    I  +        L+SDAG P +SDPG  ++  F +    V  + G ++ + +L  SG       FYGFLN  K  K+ +L  LK   +T+I +E+ HR+K+TL  + ++  N + I + RELTK  E   R +IA +    NE +I  +GEF ++++ N  +T    +EE  +   L+E   +E  I +G   K A K  +    +    +Y+ + 
  S:    17 LYLVPTPIGNLEDMTFRAVETLKSADVIAAEDTRQTKKLCHVYDIETSLISYHEHNKESSGHKIIEWLKSGKNVALVSDAGMPTISDPGAEIVRDFTQIGGYVVPLPGANAALTALTASGITPQPFFFYGFLNRQKKEKKKELEILKKRQETMIFYEAPHRLKETLTAMHDVLGN-RTIAVTRELTKKYEEFIRGTIAEVMEWANEDQI--RGEFCLVVEGN--QTAEPDEEEKPWWTELSEKEHVEHYINEGASSKQAIKQTAVDRGVPKREIYDAYH 290
>gi|16077104|ref|NP_387917.1| hypothetical protein BSU00360 [Bacillus subtilis subsp. subtilis str. 168] >gi|586874|sp|P37544|YABC_BACSU UPF0011 protein yabC >gi|467425|dbj|BAA05271.1| unknown [Bacillus subtilis] >gi|2632303|emb|CAB11812.1| yabC [Bacillus subtilis subsp. subtilis str. 168] (292 aa)
Score = 291, Expect = 1.6e-24, Identities = 86/275 (31%), Positives = 144/275 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI----NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYL--NELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQRK 279
           L++V TPIGN+++++  AI TL +      EDTR +KKL ++  I     +++  N  +    I  +        L+SDAG P +SDPG  ++  F      V  + G ++ + +LI SG       FYGFLN  K  K+ +L  LK   +TII +E+ HR+K+TL  + EI  + + I + RELTK  E   R +I+ +    NE +I  +GEF ++++ +    E + +EE  +        +E  I KG   K A K  +   ++    +Y+ +  ++
  S:    17 LYLVPTPIGNLEDMTFRAIDTLKSVDAIAAEDTRQTKKLCHVYEIETPLVSYHEHNKESSGHKIIEWLKSGKNIALVSDAGLPTISDPGAEIVKDFTDIGGYVVPLPGANAALTALIASGIVPQPFFFYGFLNRQKKEKKKELEALKKRQETIIFYEAPHRLKETLSAMAEILGD-REIAVTRELTKKYEEFIRGTISEVIGWANEDQI--RGEFCLVVEGS--NNEEVDEEEQWWETLTAKEHVEHYISKGATSKEAIKKAAVDRNVPKREVYDAYHIKQ 292
>gi|166710640|ref|ZP_02241847.1| hypothetical protein Xoryp_04045 [Xanthomonas oryzae pv. oryzicola BLS256] (273 aa)
Score = 291, Expect = 1.6e-24, Identities = 70/215 (32%), Positives = 125/215 (58%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANIN-EIKITE---KGEFVILI 219
           L +VATPIGN+ ++S  A   L   +    EDTR++++LL+   I   ++   +L+ +NE+        +  E     ++SDAG P++SDPGF L+         V  + G  + + +L V+G PS    F GFL      ++++L +L  E++T++ +ES HRI ++L  ++  F + +   IARELTK+ ET+   ++A +  +++  +   KGEFV+++
  S:     7 LHVVATPIGNLADLSPRAQEVLRGVAAICAEDTRHTRQLLSHFGI---DRPLLALHDHNEEAMSERIVARLREGESLAIVSDAGTPLVSDPGFKLVRAARAAGIKVSPVPGACAAIAALSVAGLPSDRFGFEGFLPAKSAARRERLTRLAGETRTLVFYESSHRIVESLADLRLAFGDERPAVIARELTKLFETVLDGTLAQLQAQVEADDNQRKGEFVVMV 225
>gi|67156155|ref|ZP_00417781.1| Protein of unknown function UPF0011 [Azotobacter vinelandii AvOP] >gi|67086485|gb|EAM05954.1| Protein of unknown function UPF0011 [Azotobacter vinelandii AvOP] (287 aa)
Score = 291, Expect = 1.6e-24, Identities = 66/191 (34%), Positives = 106/191 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNET 195
           L++VATPIGN+ +IS  A++ L + ++   EDTR+S +LL    I       +  N  ++     +      +  L+SDAG P++SDPGF L+         V  + GP +L+ +L  +G PS   +F GFL      +Q +L +LK ES+T+I +E+ HR+ + L  ++ I  + +   +ARELTK  ET
  S:    14 LYVVATPIGNLDDISTRALSVLRDVALIAAEDTRHSARLLQHFGIMTPLAACHEHNERDQGARFLARLLAGEDVALISDAGTPLISDPGFHLVRQARAAGIRVVPVPGPCALITALSAAGLPSDRFVFEGFLPARTAARQARLERLKEESRTLIFYEAPHRLLECLGDLERIMGSDRLAVLARELTKTFET 204
>gi|90022786|ref|YP_528613.1| putative methyltransferase [Saccharophagus degradans 2-40] >gi|89952386|gb|ABD82401.1| Protein of unknown function UPF0011 [Saccharophagus degradans 2-40] (280 aa)
Score = 291, Expect = 1.8e-24, Identities = 81/243 (33%), Positives = 134/243 (55%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKIT----EKGEFVILIDNNVK-ET--ESIKKEETDYSVYLNEL 243
           ++  L+IVATPIGN+ +I++ A+  L    +   EDTR+S +LL   NIS    +++  + ++E+Q ++S   K        L+SDAG P++SDPG+ L+    +    V  + G S+++ ++  +G PS    F GF  H    ++     L  +++T++ +ES HRI D LK +   F   + + +ARELTK  ET     +A + E  +     +KGE V+++    K ET  E   + E    V L EL
  S:     3 IDNALYIVATPIGNLGDITQRALNILQQADLIAAEDTRHSGRLLQHFNISTRMISYH--DHSDERQ-VDSIIAKLQAGTSIALISDAGTPLISDPGYGLVKKAREAGVKVVPVPGVSAVITAMSAAGLPSDRFSFEGFPPHKSGARKQLFASLARDARTLVFYESPHRIVDCLKDLAAEFGEDRPLVMARELTKTFETFLSGGVAQVLEQVLADSNQQKGEIVLMVSGYRKPETGDELSPEAEATMKVLLEEL 252
>gi|191164550|ref|ZP_03026413.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Geobacter sp. M21] >gi|190994322|gb|EDV69787.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Geobacter sp. M21] (276 aa)
Score = 291, Expect = 1.8e-24, Identities = 85/272 (31%), Positives = 141/272 (51%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI-ANINEIKITE-KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKE-KVACKMVSYKYSLKSNSLY 272
           M+  L+IVATPIGN+++I+  A+  L    +   EDTR+S+KLL    IS    +++  N + +   I     +     L++DAG P +SDPG+ L+   +     V  I G  + + +L  SG PS +  F GFL + +  ++++L  L  +   +I +ES  R+  TL+ + E   + + + +ARELTKM E   R  + A + E++  E +GE  IL+      T + + E TD       L+K +  GE   K   K V+ +  L  + +Y
  S:     1 MSGTLYIVATPIGNLEDITLRALRILKEVDLVAAEDTRHSRKLLTHFGISKPLTSYFDHNKDLKGGQILDRLREGQSVALITDAGTPCISDPGYQLVRDAVAGGISVVPIPGACAAITALSASGLPSDHFSFAGFLPNRQGKRRERLQSLAADRAVLIFYESPKRLLATLQDMLETMGD-REVVVARELTKMYEEFLRGRLSALVTEVQGREIRGEVAILV------TPAEEPEATDAPGMEELLQKYLSSGEMTLKDVVKRVTLETGLHKSEVY 268
>gi|84625272|ref|YP_452644.1| hypothetical protein XOO_3615 [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84369212|dbj|BAE70370.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF 311018] (273 aa)
Score = 291, Expect = 1.8e-24, Identities = 69/215 (32%), Positives = 126/215 (58%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANIN-EIKITE---KGEFVILI 219
           L +VATPIGN+ ++S  A   L   +    EDTR++++LL+  +I   ++   +L+ +NE+        +  E     ++SDAG P++SDPGF L+         V  + G  + + +L V+G PS    F GFL      ++++L +L  E++T++ +ES HRI ++L  ++  F + +   +ARELTK+ ET+   ++A +  +++  +   KGEFV+++
  S:     7 LHVVATPIGNLADLSPRAQEVLRGVAAICAEDTRHTRQLLSHFSI---DRPLLALHDHNEEAMSERIVARLREGESLAIVSDAGTPLVSDPGFKLVRAARAAGIKVSPVPGACAAIAALSVAGLPSDRFGFEGFLPAKSAARRERLTRLAGETRTLVFYESSHRIVESLADLRLAFGDERPAVVARELTKLFETVLDGTLAQLQAQVEADDNQRKGEFVVMV 225
>gi|53802652|ref|YP_112723.1| hypothetical protein MCA0186 [Methylococcus capsulatus str. Bath] >gi|53756413|gb|AAU90704.1| conserved hypothetical protein TIGR00096 [Methylococcus capsulatus str. Bath] (291 aa)
Score = 290, Expect = 1.9e-24, Identities = 68/220 (30%), Positives = 126/220 (57%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSF--DFKDNE-YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIAN----INEIKITEKGEFVILID 220
           +N  L++VATPIGN+ +IS  A+  L    +   EDTR+S+ LL+   I    +  ++L+ +NE+Q  +      K+ +   L+SDAG P+++DPGF L++        V  + G  +L+ +L  SG  ++   F GF       ++ +   L  + +T++ +E+ HRI+D +  +  +F   + + +ARELTK++E+   +  A+    +++     KGEFV++I+
  S:     7 INGVLYLVATPIGNLGDISFRAVEILKTVDLIAAEDTRHSRPLLDRYGIE---RPLFALHEHNEQQASDRLMDRLKNGQRVALISDAGTPLINDPGFPLVSRARAAGIIVTPVPGACALVAALSASGLSTARFAFEGFAPRTGAARRRRFESLVADERTLVFYEASHRIRDCIADVATVFPGDRRVVVARELTKLHESFLGAPAADMPALMDQAPENSKGEFVVVIE 230
>gi|183602863|ref|ZP_02964224.1| hypothetical protein BIFLAC_05792 [Bifidobacterium animalis subsp. lactis HN019] >gi|183217916|gb|EDT88566.1| hypothetical protein BIFLAC_05792 [Bifidobacterium animalis subsp. lactis HN019] (315 aa)
Score = 290, Expect = 2.1e-24, Identities = 71/227 (31%), Positives = 119/227 (52%)
  Q:     7 IVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLL--SDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILI----DNNVKETESIKKEE 233
           + ATPIGN  + S   +  L    I   EDTR    L N L++ +  +   + + N   +     D   N   +L  SDAG P ++DPG  ++   I+    V    GPS+++ +L +SG P+    + GFL    + +   L  LK E +TI+ +E++HRI +++  ++E+F   + + + RELTK  E I R +I  INE    +  +GE V++I    ++     +S+  EE
  S:    32 LAATPIGNTADASARLVALLERADIVAAEDTRRLYALANRLSVHVGGRVVANHDHNERGKADALLDHVANGETVLVVSDAGMPTINDPGLAIVRRAIERGLPVTCAPGPSAVLDALALSGLPTDRFCYEGFLPRKHSERMQALRALKGERRTIVFYETLHRIAESMADLEEVFGPDRRMALCRELTKDYEQIRRGTIHEINESVANDPPRGEMVLVIAGASEDEADPAQSLSVEE 266
>gi|15964089|ref|NP_384442.1| hypothetical protein SMc00416 [Sinorhizobium meliloti 1021] >gi|15073265|emb|CAC41773.1| Probable tetrapyrrole methylase [Sinorhizobium meliloti 1021] (309 aa)
Score = 289, Expect = 2.7e-24, Identities = 82/269 (30%), Positives = 130/269 (48%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI---KITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYN 273
           L++VATPIGN+ +I+  A+ TL    +  CEDTR ++ LL+   I      ++  N       + +         L+SDAG P++SDPG+ L    ++  + V  I GPS+ + +L+ SG PS   LF GFL      K+D+L +L     T+I FES HRI  T+    E+    +   + RELTK  E   R ++  +  I       +GE V+++     + +    E  D    L EL + +  G+    A +    +  L    LY+
  S:    34 LYLVATPIGNLGDITLRALETLAGADVLACEDTRVTRVLLDRYGIVNRPTAYHEHNAAEAGPRLLAALGNGKSVALVSDAGTPLVSDPGYRLAQQAVEAGYRVVPIPGPSAPLAALVGSGLPSDAFLFAGFLPVKDKAKRDRLAELAAVPATLIFFESPHRIAATVTAAAEVLGADRRAAVCRELTKTFEEFRRGTLGELAAIYDESANVRGEIVLVVGPPEAKPQP---EAADVDALLKELARDLPMGKAATEAAR----RTGLARKELYD 298
>gi|160889918|ref|ZP_02070921.1| hypothetical protein BACUNI_02351 [Bacteroides uniformis ATCC 8492] >gi|156860306|gb|EDO53737.1| hypothetical protein BACUNI_02351 [Bacteroides uniformis ATCC 8492] (224 aa)
Score = 289, Expect = 3.1e-24, Identities = 65/216 (30%), Positives = 115/216 (53%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILI 219
           KL++V TP+GN+++++  AI  L    +   EDTR S  LL    I    ++ +  N +   + + +         L+SDAG P +SDPGFL++   ++N  +VQ + G ++ + +L+ SG P+    F GFL   K  +  +L  L  E +T++ +ES HR+   L    E F   +   ++RE++K++E   R ++  + E       +GE VI++
  S:     3 KLYVVPTPVGNLEDMTFRAIRILKEVDLILAEDTRTSGILLKHFEIKNVMQSHHKFNEHKTVESVVNRIKGGETVALISDAGTPGISDPGFLVVRECVRNGIEVQCLPGATAFVPALVASGLPNEKFCFEGFLPQKKG-RMTRLKALAGERRTMVFYESPHRLVKALAQFTEHFGAGRQASVSREISKVHEETVRGTLTELIEHFTANEPRGEIVIVV 219
>gi|171780204|ref|ZP_02921108.1| hypothetical protein STRINF_01992 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281552|gb|EDT46987.1| hypothetical protein STRINF_01992 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (288 aa)
Score = 289, Expect = 3.1e-24, Identities = 82/272 (30%), Positives = 138/272 (50%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE---KGEFVILIDNNVKETESIKKEETDYSVYLNEL-EKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQ 276
           L++V TPIGN+++++  A+ TL        EDTRN+  LL   +I+++  +F+  N   +   +            +SDAG P +SDPG  L+   I  +  V  + G S+ + +LI SG      +FYGFL      ++D     K   +T I +ES +R+ DTL+ +  ++ + + + + RELTK+ E   R SI+ + E  I E   KGE ++++     + +++  E     +   EL   L+  GEK   A K V+  Y L    +YN + 
  S:    16 LYLVPTPIGNLQDMTFRAVETLKAVDFICAEDTRNTGLLLKHFDITVKQISFHEHNAYEKIPELLELLKSGKNLAQVSDAGMPSISDPGHDLVKAAIAEDITVVALPGASAGITALIASGLAPQPHIFYGFLPRKSGQQKDFFESKKAYPETQIFYESPYRVSDTLENMLAVYGD-RQVVLVRELTKLYEEYQRGSISELLEY-IAENPLKGECLLIVS---AQDQAVLTEAAAEDLNPAELVSSLVEAGEKPNQAIKKVAKTYGLNRQEVYNAYH 286
>gi|150025140|ref|YP_001295966.1| methyltransferase [Flavobacterium psychrophilum JIP02/86] >gi|149771681|emb|CAL43155.1| Probable methyltransferase [Flavobacterium psychrophilum JIP02/86] (237 aa)
Score = 289, Expect = 3.1e-24, Identities = 76/229 (33%), Positives = 125/229 (54%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI---NEIKITEKGEFVILIDNNVKETESIKKE 232
           KL++V TPIGN+++++  AI  L    +   EDTR S KLL    IS    + +  N +   + I           L+SDAG P +SDPGFLL    ++NN +V  + G ++ + +L+ SGFP+   +F GFL   K  +Q +   L  E++T+I++ S H++  TL    + F   + + ++RE++K++E   R +   +    EIK   KGE V+++   +   E  KKE
  S:     3 KLYLVPTPIGNLEDMTFRAIRVLKEVDLILAEDTRTSGKLLKHFEISTHMHSHHMHNEHKTIENIIKRIQTGENIALISDAGTPAISDPGFLLTRACVENNIEVDCLPGATAFVPALVNSGFPNDKFIFEGFLPEKKG-RQTRYLALAEETRTMILYVSPHKLVKTLAEFVQYFGAERPVSVSREISKLHEETIRGTAEEVLSHFEIK-PPKGEIVVIVGGKIAAKE--KKE 230
>gi|77919809|ref|YP_357624.1| putative tetrapyrrole methylase family protein [Pelobacter carbinolicus DSM 2380] >gi|77545892|gb|ABA89454.1| putative tetrapyrrole methylase family protein [Pelobacter carbinolicus DSM 2380] (285 aa)
Score = 289, Expect = 3.1e-24, Identities = 63/215 (29%), Positives = 121/215 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSS----IANINEIKITEKGEFVILI 219
           L++VATPIGN+++++  A+  L    +   EDTR+S+KL +   I+    ++++ N + + + I     +     L++DAG P +SDPGFLL+      +  V  + G S+++  L V+G P+    F GF+      ++     L  E +T++ +E+ HR+   L  + E   + + I + RELTK++E ++R +    +A+  + ++  +GE V+L+
  S:    11 LYLVATPIGNLEDLTFRALRVLKEVDLVAAEDTRHSRKLFSHYGITTALTSYFAHNESVKGERILEMLRQGKSVALITDAGTPAISDPGFLLVRACRDEDLPVTAVPGASAVIAGLSVAGLPTERFAFEGFIPPKSTARRKLFKTLSAEKRTLVFYEAPHRLVACLADLMEELGDEREIAVVRELTKLHEEVFRGTASEALAHFAQGRV--RGEIVLLV 227
>gi|114321352|ref|YP_743035.1| hypothetical protein Mlg_2203 [Alkalilimnicola ehrlichei MLHE-1] >gi|114227746|gb|ABI57545.1| Protein of unknown function UPF0011 [Alkalilimnicola ehrlichei MLHE-1] (282 aa)
Score = 289, Expect = 3.1e-24, Identities = 77/215 (35%), Positives = 122/215 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI-ANINEIKI---TEKGEFVILI 219
           L++VATPIGN  +ISE A   L   ++   EDTR S +LL+   IS       SL+ +NE + +     +     +  L+SDAG P++SDPG+ L++           + GPS++M +L V+G P+    F GFL      ++  L  L  E +T+++ ES HRI D+L+ + E+F   +   +ARELTK  ET+ R  + A +  ++      +GEFV+L+
  S:     8 LYVVATPIGNRGDISERARRVLAGVAVVAAEDTRRSGQLLSHYGISAR---LVSLHEHNEDRQVPRLLARLQAGEDIALISDAGTPLVSDPGYRLVSACAWAGVRTSPVPGPSAVMAALSVAGLPTDRFCFEGFLPARPGPRRKALAALAAEPRTLVLLESSHRILDSLRTVAEVFGPERPAVVARELTKTWETVLRGPVGALVQRLEADPDQRRGEFVLLL 226
>gi|78046374|ref|YP_362549.1| hypothetical protein XCV0818 [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|78034804|emb|CAJ22449.1| conserved hypothetical protein [Xanthomonas campestris pv. vesicatoria str. 85-10] (273 aa)
Score = 288, Expect = 3.2e-24, Identities = 71/215 (33%), Positives = 123/215 (57%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANIN-EIKITE---KGEFVILI 219
           L +VATPIGN+ ++S  A   L   +    EDTR++++LL    I   ++   +L+ +NE         +  E     ++SDAG P++SDPGF L+         V  + G  + + +L V+G PS    F GFL      ++++L +L  E++T++ +ES HRI ++L  ++  F + +   IARELTK+ ET+   S+A +  +++  +   KGEFV+++
  S:     7 LHVVATPIGNLADLSPRAQEVLRGVAAICAEDTRHTRQLLGHFGI---DRPLLALHDHNEDAMSERIVARLREGESLAIVSDAGTPLVSDPGFKLVRAARAAGIKVSPVPGACAAIAALSVAGLPSDRFGFEGFLPAKSAARRERLARLAGETRTLVFYESSHRIFESLADLRLAFGDDRPAVIARELTKLFETVLDGSLAQLQAQVEADDNQRKGEFVVMV 225
>gi|39933401|ref|NP_945677.1| hypothetical protein RPA0324 [Rhodopseudomonas palustris CGA009] >gi|39647247|emb|CAE25768.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Rhodopseudomonas palustris CGA009] (320 aa)
Score = 288, Expect = 3.3e-24, Identities = 71/252 (28%), Positives = 136/252 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVA 256
           L +VATPIG++ +I+  A+ TL    +  CEDTR + +LL   +IS   K ++  N    +  +     +     L+SDAG P++SDPG+ L+         V  + G S+++ +L ++G P+    F GFL   +  ++ +L +L     T+++FE+  RI++++  + ++   ++   I RELTK+++ + R+++A +      +  +GEFV++I      +  +  ++ D   +L+  E L R   K+ VA
  S:    40 LHLVATPIGHLGDITLRALETLAGADLIACEDTRITHRLLERYSISARLKPYHEHNAAQARPKLLEMLAQGQSVALVSDAGTPLISDPGYKLVREVYAAGHQVIGLPGASAVLVALSLAGLPTDRFFFDGFLPSKQGARRARLGELAAIDATLVLFEAGSRIQNSVHDLADLLGATREAAICRELTKLHQEVRRATLAELAAQADTMETRGEFVVVIAPPDPASRVMSDDDLDR--WLS--EALTRHSVKDAVA 289
>gi|152991817|ref|YP_001357538.1| hypothetical protein SUN_0221 [Sulfurovum sp. NBC37-1] >gi|151423678|dbj|BAF71181.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1] (270 aa)
Score = 288, Expect = 3.3e-24, Identities = 70/215 (32%), Positives = 120/215 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLN----ISLENKTFYSLNGNNEKQFINSFD--FKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINE--IKITEKGEFVILI 219
           L  V TPIGN ++I+  A+       IF CEDTR++K+LL LL     +      F+S N +N ++ +  F    +  E   +SDAG P++SDPG LL+    +N     ++ G S++  +   SGF     LFY FL H    +   L++  N     +++E+ HR++  L  I E+ D  + + +A+E++K  +  YR +  ++ +   +IT +GE+V++I
  S:     2 LTFVPTPIGNPQDITLRAMKIFEKAEIFLCEDTRHTKRLLKLLKERFAMVYPEAEFHSFNEHNGEERLAQFGEVLESKEVVYVSDAGMPVISDPGQLLVAYCQQNAIAYDVLPGASAVTTAYAASGFEEGKFLFYAFLPHKGKERSSALSEAMNNGYNTVLYEAPHRLEKLLDEIVEM-DAERELFLAKEISKKYQHYYRGNAKSLRDDFKEITIRGEWVVVI 223
>gi|33861749|ref|NP_893310.1| putative tetrapyrrole methylase family protein [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|33640117|emb|CAE19652.1| putative tetrapyrrole methylase family protein [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (287 aa)
Score = 288, Expect = 3.5e-24, Identities = 93/270 (34%), Positives = 143/270 (52%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE----KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEK----GEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ ++S  AI  L N S+  CEDTR +KK++N    +       S N +N      + IN  +       L+SDAG P + DPG  L+     N  ++  I GP + + +L+ SG PSS  +F GFL   K+ ++  L ++    KT II+ES HR+K  L  +K      + I ++RELTK  E    + I N+  IK  ++    GE  I+I   +K+  ++   ++D    LNE   LI+ G     A K ++ K+ +K +  YN 
  S:    19 LYIVGTPIGNLSDLSSRAINILKNVSLIACEDTRQTKKIMNKFEFT---NNLISFNKHNSLKKIPRIINDLN-SGKSVALVSDAGMPSICDPGEDLVKNVRSNGSNIICIPGPCAALTALVSSGLPSSKFIFEGFLPKKKSQREKILFEISKNEKTTIIYESPHRLKKLLNELKIYCGGEREIQVSRELTKKFEEHIGNDINNV--IKTFQEKEVIGELTIVI-KGIKKESNLLINKSDLKKELNE---LIKAGLSLSAASKYLAKKHGIKKSETYNL 286
>gi|108760516|ref|YP_631745.1| tetrapyrrole methylase family protein [Myxococcus xanthus DK 1622] >gi|108464396|gb|ABF89581.1| tetrapyrrole methylase family protein [Myxococcus xanthus DK 1622] (276 aa)
Score = 288, Expect = 3.7e-24, Identities = 74/226 (32%), Positives = 123/226 (54%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSF--DFKDNEYC-LLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKET 226
           M   L++VATPIGN+ +++  A+ TL       CEDTR+S+ LL+   I    K   SL    E Q          + E C L++DAG P +SDPG  L+   ++    V  + GP++L+ +L  SG P+    F GFL      ++  L ++   S T++++ES  R+ +TL  + + + + +  C+ARELTK++E   R +++ +      E  +GE V+L++    ET
  S:     1 MAGTLYLVATPIGNLGDVTSRALETLRAVRFIACEDTRHSRVLLDHFGIG--GKDLVSLPAFAEGQRAGRILDRIGEGEDCALVTDAGSPAISDPGEKLVAEALERGLTVVPVPGPTALVAALSASGLPTGRFHFLGFLPRKGAERRAMLEEVAQLSATLVLYESPRRLSETLPDLLDAWGD-RRACVARELTKLHEEFARGTLSELAARYAAEEPRGEVVVLVEGRTGET 228
>gi|146281458|ref|YP_001171611.1| tetrapyrrole methylase family protein [Pseudomonas stutzeri A1501] >gi|145569663|gb|ABP78769.1| tetrapyrrole methylase family protein [Pseudomonas stutzeri A1501] (318 aa)
Score = 288, Expect = 3.7e-24, Identities = 72/216 (33%), Positives = 118/216 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK-QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILID 220
           L++VATPIGN+++IS  A+  L   ++   EDTR+S +LL    I       +  N  NE  +FI      D +  L+SDAG P++SDPG+ L+         V  + G  +L+ +L  +G PS   +F GFL      ++ +L  LK E +T+I +E+ HRI ++L   +++F   +   + RELTK  ET+    +    A +      ++GE V+L++
  S:    45 LYVVATPIGNLEDISARALRVLREVALIAAEDTRHSSRLLAHFGIQTPLAACHEHNERNEGGRFIERLQAGD-DVALISDAGTPLISDPGYHLVRQARAAGVAVVPVPGACALIAALSAAGLPSDRFIFEGFLPAKAAARRSRLEALKEEPRTLIFYEAPHRILESLGDFEDVFGGERMAVLGRELTKTFETLKGLPLGALRAWVEADSNQQRGECVLLVE 264
>gi|126662544|ref|ZP_01733543.1| methyltransferase [Flavobacteria bacterium BAL38] >gi|126625923|gb|EAZ96612.1| methyltransferase [Flavobacteria bacterium BAL38] (225 aa)
Score = 288, Expect = 3.9e-24, Identities = 71/216 (32%), Positives = 121/216 (56%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE----KGEFVILI 219
           KL+IV TPIGN+++++  AI  L    +   EDTR S KLL    I+      +S + +NE + + +   +        L+SDAG P +SDPGFLL    ++N   V+ + G ++ + +L+ SG P+   +F GFL   K  +Q +   L+ E +T+I + S H++  TL    + F   + + ++REL+K++E   R +   +  +K  E    KGE V+++
  S:     3 KLYIVPTPIGNLEDMTFRAIKVLKEVDLILAEDTRTSGKLLKHFEIATH---MHSHHMHNEHKTVENLVKRLQAGETIALISDAGTPAISDPGFLLTRACVENGVAVECLPGATAFVPALVNSGLPNDKFVFEGFLPDKKG-RQTRFLALQEEYRTMIFYVSPHKLNKTLAEFAQYFGGDRPVSVSRELSKLHEETVRGTAEEV--LKHFEAKPAKGEIVVVV 219
>gi|114797084|ref|YP_759491.1| tetrapyrrole methylase family protein [Hyphomonas neptunium ATCC 15444] >gi|114737258|gb|ABI75383.1| tetrapyrrole methylase family protein [Hyphomonas neptunium ATCC 15444] (291 aa)
Score = 287, Expect = 4.3e-24, Identities = 68/214 (31%), Positives = 115/214 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE---KGEFVIL 218
           L++V+TPIGN+++I+  A+  L+       EDTR + KL++   I      ++  NG   +  I S         L+SDAG P++SDPG+ L++  ++    V  + G S+L+  L+ SG PS   +F GFL      ++  L  LK+   T++ +ES  R+ ++L  +  +    +   +ARELTK+ E   R ++ ++ E   T    +GE VIL
  S:    17 LYVVSTPIGNLRDITLRALDILSAADEVLAEDTRVAGKLMSAYGIKARLSPYHDHNGAERRPQILSRLADGGRIALISDAGTPLISDPGWKLVHDALEAGHKVYPVPGASALLAGLVASGLPSDRFMFAGFLPPKSGARKAALETLKHVPGTLVFYESGPRLAESLADLAAVLGGGRTAAVARELTKLFEETRRGTLTSLAEHYQTAGPPRGEIVIL 233
>gi|85712545|ref|ZP_01043593.1| Tetrapyrrole methylase family protein [Idiomarina baltica OS145] >gi|85693679|gb|EAQ31629.1| Tetrapyrrole methylase family protein [Idiomarina baltica OS145] (291 aa)
Score = 287, Expect = 4.8e-24, Identities = 77/270 (28%), Positives = 144/270 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK-QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSS----IANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNF 274
           L+IV TPIGN+ +++E A+T L    +   EDTR+S+ LL   N+S +  + +  N ++   Q I       N   L+SDAG P++SDPG+L++         V  + G  + + +L  SG  +   +F GFL      ++     L +++++++ +ES HRI+  L+ + EI   ++++ +AREL+K  ET    +    +A ++E    ++GE V++I     E E++++++   S        L+ +    K A  + +  Y  + N+LY +
  S:    16 LYIVPTPIGNLADMTERAVTILQQVDLIAAEDTRHSRPLLQQYNVSTQVLSVHEHNESSRAGQLIERLKQGLN-IALISDAGMPLISDPGYLIVRECRAEQIPVVALPGACAFVTALAGSGLATDKFMFEGFLPAKSAARKKAFANLADQTRSVVFYESPHRIESCLEDLAEILP-TRDVVLARELSKQYETYLSGTATELLAQMHEDSNQKRGEMVLMIGG--VEKEAVQEDQP--SAEQQRAVTLLMQHLPLKKAAAVTAELYGGRKNALYQW 284
>gi|94502334|ref|ZP_01308806.1| methyltransferase [Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata)] >gi|161833657|ref|YP_001597853.1| S-adenosyl-L-methionine dependent methyltransferase [Candidatus Sulcia muelleri GWSS] >gi|94451111|gb|EAT14064.1| methyltransferase [Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata)] >gi|152206146|gb|ABS30456.1| S-adenosyl-L-methionine dependent methyltransferase [Candidatus Sulcia muelleri GWSS] (231 aa)
Score = 287, Expect = 4.9e-24, Identities = 94/227 (41%), Positives = 129/227 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINS---FDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDN-SKNICIARELTKMNETIYRSSIANINEI-----KITEKGEFVILIDNNVKETESIKK 231
           L+IV TPIGN+++I+  A+  L        E+  NSKKLLN   I        S N  NE + I +   F  K N   L++DAG PI+SDPGFLL+   IKNN  V  + G ++ + +LI SGF  +   F GFL H K  ++      K ES+TIII+ES +RI +TL +IK    N  K I I RE++K  E   ++ I NIN+I     K   KGEFVI++    K     ++
  S:     2 LYIVPTPIGNLEDITFRAVRILKEVDFILAENILNSKKLLNFFKI---KNNILSYNIYNEHKIIFNIILFLKKCNNIALIADAGTPIISDPGFLLVRHCIKNNIKVSCLPGATAFIPALINSGFSINEFTFIGFLPHKKGKEKKIKTLCK-ESRTIIIYESPYRILNTLYIIKNYIGNIEKQISICREISKKFE---QTIIGNINDILFFFSKKKPKGEFVIILQGKGKTIRGTER 230
>gi|194246767|ref|YP_002004406.1| tetrapyrrole (Corrin/Porphyrin) methylase [Candidatus Phytoplasma mali] >gi|193807124|emb|CAP18562.1| tetrapyrrole (Corrin/Porphyrin) methylase [Candidatus Phytoplasma mali] (280 aa)
Score = 287, Expect = 5.2e-24, Identities = 85/272 (31%), Positives = 151/272 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQ 276
           L++V+TPIGN+ +I+  A+  L +      EDTR SKKLLN  +I     +FY  N       I      ++   L+SDAG P++SDPG LL+       +    I G ++ + + I S F    ++F GFL  ++N K+  L + +    T++I+ES +R+ +TL+++K+I+ N +NI +ARELTK  E I  +S+  I + ++  KGE+VI+I+   K +   +    ++S+ L  ++  +++G  EK +   V+ +  +    +Y  ++
  S:    15 LYLVSTPIGNLSDITLRALQILKSVDFILAEDTRISKKLLNFYDIKKPIISFYQYNQQKRLNKILQLLTSNHNLALISDAGTPLISDPGDLLVQEVQTRGFHTIAIPGVTAFLTAFITSSFKLP-LIFLGFLPRSQNKKKLFLLKYQFCEATLLIYESSYRVLETLQLLKKIYGN-RNISLARELTKKFEQIINTSLEEILKKELFLKGEYVIVIEGFTKSSMLYE----NFSL-LQHIQFYLKQGFSEKESFHKVAKERKISKREIYKKYK 279
>gi|37527856|ref|NP_931201.1| hypothetical protein plu4001 [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36787292|emb|CAE16373.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] (288 aa)
Score = 286, Expect = 5.7e-24, Identities = 71/240 (29%), Positives = 131/240 (54%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFK---DNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSI----ANINEIKITEKGEFVILIDNNVKETESIKKEETDYSVYLNELE 244
           L++V TPIGN+ +I++ A+  L +  +   EDTR++  LL    I   N   ++L+ +NE+Q  +    K        L+SDAG P+++DPG+ ++    +    V  + GP + + +L  +G PS    + GFL   +  + D L  L+ E +T+I +ES HR+ ++L+ + E+    + + +ARELTK  E+I    +    A + E +   +GE V++++   K  + +   E   ++ L + E
  S:    14 LYVVPTPIGNLGDITQRALEVLEHVDLIAAEDTRHTGLLLQHFAI---NARMFALHDHNEQQKADQLITKLQQGQSIALVSDAGTPLINDPGYHVVRRCREAGIHVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKRKSRTDTLRALQQEPRTLIFYESTHRLIESLEDMVEVLGAERYVVLARELTKTWESIQGMPVGELLAWVKEDETRRRGEMVLIVEGYKKLDDDVLPPEALRTLALLQQE 257
>gi|188575287|ref|YP_001912216.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188519739|gb|ACD57684.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae PXO99A] (265 aa)
Score = 286, Expect = 5.9e-24, Identities = 68/213 (31%), Positives = 125/213 (58%)
  Q:     7 IVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNE---YCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANIN-EIKITE---KGEFVILI 219
           +VATPIGN+ ++S  A   L   +    EDTR++++LL+  +I   ++   +L+ +NE+        +  E     ++SDAG P++SDPGF L+         V  + G  + + +L V+G PS    F GFL      ++++L +L  E++T++ +ES HRI ++L  ++  F + +   +ARELTK+ ET+   ++A +  +++  +   KGEFV+++
  S:     1 MVATPIGNLADLSPRAQEVLRGVAAICAEDTRHTRQLLSHFSI---DRPLLALHDHNEEAMSERIVARLREGESLAIVSDAGTPLVSDPGFKLVRAARAAGIKVSPVPGACAAIAALSVAGLPSDRFGFEGFLPAKSAARRERLTRLAGETRTLVFYESSHRIVESLADLRLAFGDERPAVVARELTKLFETVLDGTLAQLQAQVEADDNQRKGEFVVMV 217
>gi|182680397|ref|YP_001834543.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Beijerinckia indica subsp. indica ATCC 9039] >gi|182636280|gb|ACB97054.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Beijerinckia indica subsp. indica ATCC 9039] (306 aa)
Score = 286, Expect = 6.1e-24, Identities = 73/231 (31%), Positives = 123/231 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE---KGEFVILIDNNVKETESIKKEETD 235
           L++VATPIGN+ +IS  A++TL        EDTR +K LL    I+     ++  N    +  + +   +     L+SDAG P++SDPGF L+   ++    V  + G S+++ +L+V+G P+    F GFL      ++ +++ L     T++ FES  R+ +TL  +  +  + +   +ARELTK  ET+ R +++ +      E   KGE V+L+     ETE    E+ D
  S:    33 LYVVATPIGNLADISLRALSTLAAADAVLAEDTRVTKILLAHYGIATPLVAYHEHNAAVMRPHLLARLERGAALALVSDAGTPLISDPGFKLVAEALERQIAVTSVPGASAVLAALVVAGLPTDRFFFEGFLPVKSGPRRQRISALAAVPGTLVFFESPRRVAETLADLAAVLGD-RPCALARELTKYFETVRRGTLSELATTLAEEPPPKGEIVLLVGGPT-ETEEASAEDLD 264
>gi|152996415|ref|YP_001341250.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Marinomonas sp. MWYL1] >gi|150837339|gb|ABR71315.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Marinomonas sp. MWYL1] (293 aa)
Score = 286, Expect = 6.2e-24, Identities = 70/215 (32%), Positives = 126/215 (58%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK---QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--------NEIKITEKGEFVILI 219
           L+IVATPIGN+ + S+ A  TL +      EDTR++++LLN  + ++E K F S++ +NEK    ++ S   +     L+SDAG P++SDPG+ +++   +    V  I G  +L+ +L  SG P+    F GF+      + D     K ++ T++ +ES HR+ D++  +++++     + +ARE+TK  ET    + + I        N++    +GEFV+++
  S:    20 LYIVATPIGNLDDFSKRAEQTLRDVDYIAAEDTRHTRRLLN--HFAIEAKLF-SIHDHNEKDKADYVASLLDEGKNVALVSDAGTPLISDPGYHVVHALREKGHKVLPIPGACALIAALCASGLPTDQFFFAGFVPAKSKGRCDLFESWKKQTGTVVFYESTHRVYDSITDVQKVYGEDAQLVLAREVTKTFETFLSGTASEILAKFDADANQL----RGEFVVML 238
>gi|13473887|ref|NP_105455.1| hypothetical protein mlr4632 [Mesorhizobium loti MAFF303099] >gi|17368581|sp|Q98DM9|Y4632_RHILO UPF0011 protein mlr4632 >gi|14024638|dbj|BAB51241.1| mlr4632 [Mesorhizobium loti MAFF303099] (294 aa)
Score = 286, Expect = 6.3e-24, Identities = 76/215 (35%), Positives = 111/215 (51%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLN-GNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSS---IANINEIKITEKGEFVILI 219
           L++VATPIGN+ +I+  A+ TL    I  CEDTR S+ LL+   I      ++  N G    + I +         L+SDAG P++SDPG+ L+   I +   V  I GPS+ + +L  SG PS   LF GFL      +  +L  LK    T+I FES  R+ ++L  + E     +   I RELTK  E +   +   +A+      T KGE V+ +
  S:    16 LYLVATPIGNLADITLRALETLAAADIVACEDTRVSRVLLDRYGIRRRTTAYHEHNAGEAGPKLIAALQ-GGQSVALISDAGTPLVSDPGYRLVGEAIDHGIRVVPIPGPSAPLAALTASGLPSDAFLFAGFLPVKVGQRLTRLEALKAVPATLIFFESPRRLAESLGAMVEALGGERKAAIGRELTKTFEEMRTGTLRALADHYAAADTPKGEIVVCV 233
>gi|33863646|ref|NP_895206.1| putative tetrapyrrole methylase family protein [Prochlorococcus marinus str. MIT 9313] >gi|33635229|emb|CAE21554.1| putative tetrapyrrole methylase family protein [Prochlorococcus marinus str. MIT 9313] (289 aa)
Score = 286, Expect = 6.5e-24, Identities = 68/198 (34%), Positives = 105/198 (53%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIA 202
           L++V TPIG++ ++S  A + LTN S   CEDTR+S  LLN L    +  +F+  N       +     +     L+SDAG P +SDPG  L+         V  I GP +   +L+ SG PS    F GFL      +Q QL  + +E++T I++E+ HR+   LK + ++  + + + +ARELTK +E     +IA
  S:    12 LYVVGTPIGHLGDLSPRARSVLTNVSAIACEDTRHSGHLLNSLGAQSQRFSFHQHNTKARLPQLLQLLNEGQSLALISDAGLPGISDPGEQLVAAARAAGHQVICIPGPCAATTALVSSGLPSGRFCFEGFLASRGKERQQQLAAVASETRTTILYEAPHRLVQLLKELAQLCGDERPLQVARELTKRHEQQVGPTIA 209
>gi|19704539|ref|NP_604101.1| methyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19714823|gb|AAL95400.1| Methyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (235 aa)
Score = 286, Expect = 6.7e-24, Identities = 89/231 (38%), Positives = 130/231 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK-QFINSFDF--KDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNE-SKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI--KITEKGEFVILIDNNVKETESIKKEETD 235
           L+IVATPIGN+++++  AI TL      F EDTR +KKLL+   I     T Y  + + ++ Q  N  +   ++    L++DAG P +SDPG+ +++   KNN  V  I G S+L  S  ++G       F GFL   K  +Q  L QL  E  +TI+I+ES  RI+ TLK I E F   +++ I RE+TK+ E + R S + + E   K   KGE V+LI+   KE +   K   D
  S:     2 LYIVATPIGNLEDMTFRAIRTLKEVDYIFAEDTRVTKKLLDHYEI---KSTVYRYDEHTKQHQIANIINLLKEEKNIALVTDAGTPCISDPGYEVVDEAHKNNIKVVAIPGTSALTASASIAGISMRRFCFEGFLPKKKG-RQTLLKQLAEEKERTIVIYESPFRIEKTLKDI-ETFMGKRDVVIVREITKIYEEVLRGSTSELIEKLEKNPIKGEIVLLIEPQQKEQKGGNKYVND 233
>gi|33866431|ref|NP_897990.1| putative tetrapyrrole methylase family protein [Synechococcus sp. WH 8102] >gi|33633209|emb|CAE08414.1| putative tetrapyrrole methylase family protein [Synechococcus sp. WH 8102] (286 aa)
Score = 285, Expect = 7.3e-24, Identities = 82/273 (30%), Positives = 134/273 (49%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITEK--GEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLYNFWQQ 277
           L+IV TPIG++ ++S  A   L   ++  CEDTR+S +LL+ L  S    +F+  N      Q + +   +     ++SDAG P +SDPG  L        ++V  I GP +   +L+ SG PS    F GFL      ++ +L Q+  E +T + +E+ HR+   L+ + E     + + +ARELTK +E     +IA   E   T++  GEF +++     +T S    E D S  L  L++ I  G     A + ++ +  +    LY    Q
  S:    12 LYIVGTPIGHLGDLSPRAKAVLAGVTVIACEDTRHSGQLLSSLQASGRKLSFHQHNTRTRVPQLLQALS-EGESVAVISDAGLPGISDPGEELAAEARSAGFEVICIPGPCAATTALVSSGLPSGRFCFEGFLPVKGKERRQRLEQISTEPRTTVFYEAPHRLLPLLQSLAEHCGAERPLQVARELTKRHEQQVGPTIAAALEHFQTQRPQGEFTLVLGGCPAQTPS----EHDDSELLARLQECIANGASASDAARQLALESGISRRRLYALLHQ 282
>gi|55741087|gb|AAV64227.1| hypothetical protein F9002 [Zea mays] (337 aa)
Score = 285, Expect = 7.8e-24, Identities = 87/272 (31%), Positives = 136/272 (50%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLF--------------YGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           +   L++V+TPIGN+++I+  A+  L   ++   EDTR+S KLL   NI     +F+  N    +  I     +     L+SDAG P +SDPG  L  L       V  I GPS+ + +L  SG PS+   F               GFL  +   ++D+L     E+ T I +   H I+  L      F +S++  +ARE+TK++E  +R ++   NE   T   KGE  +LI+  +   + I  E+       +EL +L  KG     A K+V+   S K   +Y
  S:    45 LESGLYLVSTPIGNLEDITLRALRVLKCANVILSEDTRHSGKLLQHYNIKTPLLSFHKFNEREREPTILRRLHEGEAVALISDAGTPGISDPGMELARLCATEKIPVIPIPGPSAAIAALSASGLPSNEFTFVVRNYWGQSIFSILVGFLPKHARSRRDRLEISAREAATQIFYVPPHGIQQFLVDAASSFGDSRHCVVAREITKIHEEFWRGTLGEANEAFATRQPKGEITVLIEGKLISDDEIPSED----FLEHELRELTAKGYTLSAAVKLVTEATSAKKKDVY 328
>gi|55741045|gb|AAV64189.1| hypothetical protein F9002 [Zea mays] (337 aa)
Score = 285, Expect = 8.1e-24, Identities = 87/272 (31%), Positives = 136/272 (50%)
  Q:     1 MNKKLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLF--------------YGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKEETDYSVYLNELEKLIRKGEKEKVACKMVSYKYSLKSNSLY 272
           +   L++V+TPIGN+++I+  A+  L   ++   EDTR+S KLL   NI     +F+  N    +  I     +     L+SDAG P +SDPG  L  L       V  I GPS+ + +L  SG PS+   F               GFL  +   ++D+L     E+ T I +   H I+  L      F +S++  +ARE+TK++E  +R ++   NE   T   KGE  +LI+  +   + I  E+       +EL +L  KG     A K+V+   S K   +Y
  S:    45 LESGLYLVSTPIGNLEDITLRALRVLKCANVILSEDTRHSGKLLQHYNIKTPLLSFHKFNEREREPTILRRLHEGEAVALISDAGTPGISDPGMELARLCATEKIPVIPIPGPSAAIAALSASGLPSNEFTFVVRNYWGQFIFSILVGFLPKHARSRRDRLEISAREAATQIFYVPPHGIQQFLVDAASSFGDSRHCVVAREITKIHEEFWRGTLGEANEAFATRQPKGEITVLIEGKLISDDEIPSED----FLEHELRELTAKGYTLSAAVKLVTEATSAKKKDVY 328
>gi|89101179|ref|ZP_01174011.1| uroporphyrin-III C-methyltransferase [Bacillus sp. NRRL B-14911] >gi|89084114|gb|EAR63283.1| uroporphyrin-III C-methyltransferase [Bacillus sp. NRRL B-14911] (292 aa)
Score = 285, Expect = 8.5e-24, Identities = 76/228 (33%), Positives = 129/228 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEKQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVILIDNNVKETESIKKE 232
           L++V TPIGN++++S  A+  L        EDTRN+KKL N   I     +++  N  +  + I     + +   ++SDAG P +SDPG+ L+   +++   V  + G ++ + +LI SG  S    FYGFLN  K  K+ +L +L     TII++ES HR+K+TL+++       + + + RELTK  E   R S++ + E   ++  +GEF I+++ N  E ES +++
  S:    16 LYLVPTPIGNLEDMSFRAVRMLKEADYIAAEDTRNTKKLCNYFEIETPVISYHEHNKGHSGEKIIQMLEEGSAVAVVSDAGMPTISDPGYDLVVKALEHQLTVVPLPGANAALTALIASGIASQPFYFYGFLNRQKKEKKQELEKLAKMDATIILYESPHRLKETLQLMSGQLGERQAV-LCRELTKRYEEFIRGSLSELAEWAESDEVRGEFCIILEGN-PEGESAEED 243
>gi|152985246|ref|YP_001350330.1| hypothetical protein PSPA7_4994 [Pseudomonas aeruginosa PA7] >gi|150960404|gb|ABR82429.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7] (320 aa)
Score = 285, Expect = 8.7e-24, Identities = 69/215 (32%), Positives = 120/215 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK-QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKIT----EKGEFVILI 219
           LF+VATPIGN+ +I+  A+  L   ++   EDTR+S +L     I       +  N   E  +FI+     D +  L+SDAG P++SDPGF L+         V  + G  +L+ +L  +G PS   +F GFL      ++ +L  ++ E +T+I +E+ HR+ ++L  ++++F   +   +AREL+K  ETI    +A +++   +    ++GE V+L+
  S:    44 LFVVATPIGNLDDITPRALRVLREVALVAAEDTRHSIRLFQHFGIETPLAACHEHNEREEGGRFISRLQSGD-DVALISDAGTPLISDPGFHLVRQAQALGIRVVPVPGSCALIAALSAAGLPSDRFIFEGFLPAKAAGRRSRLQAVQEEPRTLIFYEAPHRLLESLADMRDVFGGERRAVLARELSKTFETIRSLPLAELHDWVASDSNQQRGECVVLV 262
>gi|77460904|ref|YP_350411.1| hypothetical protein PflO1_4683 [Pseudomonas fluorescens PfO-1] >gi|77384907|gb|ABA76420.1| Protein of unknown function UPF0011 [Pseudomonas fluorescens PfO-1] (293 aa)
Score = 285, Expect = 9.2e-24, Identities = 66/192 (34%), Positives = 109/192 (56%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETI 196
           L++VATPIGN+ +IS  A+  L   ++   EDTR+S++L+    IS      +  N  +E  +FI      DN   L+SDAG P++SDPG+ L+        +V  + G  +L+ +L  +G PS   +F GFL      ++ +L  +K E +T+I +E+ HRI + L+ ++ +F   +   +ARE+TK  ET+
  S:    17 LYVVATPIGNLDDISARALKILREVALIAAEDTRHSQRLMQHFGISTPLAACHEHNERDEGSRFITRLLAGDN-VALISDAGTPLISDPGYHLVRQARAAGINVVPVPGACALIAALSAAGLPSDRFIFEGFLPAKAVGRKARLEAIKEEPRTLIFYEAPHRILECLQDMEAVFGADRPALLAREITKTFETL 208
>gi|167035513|ref|YP_001670744.1| uroporphyrin-III C/tetrapyrrole methyltransferase [Pseudomonas putida GB-1] >gi|166862001|gb|ABZ00409.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Pseudomonas putida GB-1] (291 aa)
Score = 284, Expect = 9.4e-24, Identities = 69/215 (32%), Positives = 119/215 (55%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNEK-QFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEI----KITEKGEFVILI 219
           L++VATPIGN+ ++S  A+  L + ++   EDTR+S +LL    I       +  N  +E  +F+           L+SDAG P++SDPG+ L+        +V  + G  +L+ +L  +G PS   +F GFL   +  ++ +L Q+K E +T+I +E+ HRI + L+ ++ +F   +   +ARELTK  ET+    +A +          ++GE V+L+
  S:    15 LYVVATPIGNLDDMSARALKVLADVALIAAEDTRHSIRLLQHFGIDTPLAACHEHNERDEGGRFLTKL-LAGEHVALVSDAGTPLISDPGYHLVRQARAAGVNVVPVPGACALIAALSAAGLPSDRFIFEGFLPAKQAGRRARLEQVKEEPRTLIFYEAPHRILECLEDMEAVFGGDRPALLARELTKTFETLKGLPLAELRAFVAGDSNQQRGECVVLV 233
>gi|109947426|ref|YP_664654.1| putative methylase [Helicobacter acinonychis str. Sheeba] >gi|109714647|emb|CAJ99655.1| putative methylase [Helicobacter acinonychis str. Sheeba] (287 aa)
Score = 284, Expect = 9.8e-24, Identities = 77/220 (35%), Positives = 133/220 (60%)
  Q:     5 LFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLL-----------NISLENKTFYSLNGNNEKQFINSFD--FKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKN-----ESKTIIIF-ESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANI--NEIKITEKGEFVILIDNNVK 224
           L+ + TPIGN+ +I+   +  L    IF CEDTR SK+LL+LL           NI+ + + F + + +N+++F++  +  F D E  ++SDAG P LSDP   L+   +K+N    ++ G S+L  +   SGF      + GFL H    ++ ++ ++ N     E KT ++F ES HR+ +TLK + ++  +  ++  A+ELTK+++  Y   I+ I     K   +GE+V+++ N  K
  S:     2 LYFLPTPIGNLADITLRTLEVLERCEIFLCEDTRVSKRLLHLLAQNPIIGHSFPNIATKKREFIAFHSHNDQEFLSQIELSFFDKEIAVMSDAGMPSLSDPCMSLVAYALKHNIQYDVLPGASALTTAFCASGFLEGCFFYAGFLPHKSKERRLRIAKILNALAYLEEKTPVVFYESPHRLLETLKDLNDL-ASGMHLFAAKELTKLHQHYYLGEISQIMTQLQKNNIQGEWVLVLLNEKK 241
>gi|150385066|ref|ZP_01923722.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Victivallis vadensis ATCC BAA-548] >gi|150258549|gb|EDM95817.1| Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase [Victivallis vadensis ATCC BAA-548] (246 aa)
Score = 284, Expect = 1.0e-23, Identities = 66/214 (30%), Positives = 115/214 (53%)
  Q:     4 KLFIVATPIGNIKEISELAITTLTNNSIFFCEDTRNSKKLLNLLNISLENKTFYSLNGNNE-----KQFINSFDFKDNEYCLLSDAGYPILSDPGFLLINLFIKNNWDVQIINGPSSLMHSLIVSGFPSSNVLFYGFLNHNKNLKQDQLNQLKNESKTIIIFESVHRIKDTLKMIKEIFDNSKNICIARELTKMNETIYRSSIANINEIKITE--KGEFVI 217
           KL++V+TPIGN+++I+  A+  L +  +   EDTR++++LL   +I  + ++F++ N + +     +Q  N           +SDAG P ++DPGF L+   ++     ++I G S+L  +   S  P     F  F       ++    ++++E KT+  FES HRI  TL  I EI      + + RE TK++E + R + A +  +      +GEFVI
  S:    13 KLYLVSTPIGNLEDITLRALNVLKSVDLIAAEDTRHTRQLLTHFDIHTKLESFHAFNEHRKTAGLIEQIRNGLKVAS-----VSDAGTPSIADPGFFLVREAVRAGIRPEVIPGVSALTFAATASALPVDKFAFLAFPPVKSGRRRKFFEEIRHEGKTVFFFESPHRIAKTLPEISEIVGPGAQVAVIREATKLHEEVIRGTAAELAALAGVRDWRGEFVI 228