>gi|26553594|ref|NP_757528.1| hypothetical protein MYPE1410 [Mycoplasma penetrans HF-2] >gi|26453600|dbj|BAC43932.1| hypothetical protein [Mycoplasma penetrans HF-2] (238 aa)
Score = 994, Expect = 3.5e-106, Identities = 238/238 (100%), Positives = 238/238 (100%)
  Q:     1 MKVKVNRNNTNWLSQLGITSIVGGFILFMGIVIFALSLAYTASPDKAASGIGLNLIAFYYSLMVAIIQVFSSVYLWLNFYYWFIAYQKSINNRKKYNMLFLTIIFPLLIIVSLDTAIRLVYSVAGLMEVGRYYDGTLSLAAIDFSKPGAIFGSFSGESSALSFGNFGFNVVFLILGYAGIMGVSLYFFYDQKKKFISEEKENSNKELRANYRSIEMSKIKKKLSKQKTKDLSKRIKAF 238
           MKVKVNRNNTNWLSQLGITSIVGGFILFMGIVIFALSLAYTASPDKAASGIGLNLIAFYYSLMVAIIQVFSSVYLWLNFYYWFIAYQKSINNRKKYNMLFLTIIFPLLIIVSLDTAIRLVYSVAGLMEVGRYYDGTLSLAAIDFSKPGAIFGSFSGESSALSFGNFGFNVVFLILGYAGIMGVSLYFFYDQKKKFISEEKENSNKELRANYRSIEMSKIKKKLSKQKTKDLSKRIKAF
  S:     1 MKVKVNRNNTNWLSQLGITSIVGGFILFMGIVIFALSLAYTASPDKAASGIGLNLIAFYYSLMVAIIQVFSSVYLWLNFYYWFIAYQKSINNRKKYNMLFLTIIFPLLIIVSLDTAIRLVYSVAGLMEVGRYYDGTLSLAAIDFSKPGAIFGSFSGESSALSFGNFGFNVVFLILGYAGIMGVSLYFFYDQKKKFISEEKENSNKELRANYRSIEMSKIKKKLSKQKTKDLSKRIKAF 238