>gi|26553595|ref|NP_757529.1| recombination factor protein RarA [Mycoplasma penetrans HF-2] >gi|26453601|dbj|BAC43933.1| predicted ATPase [Mycoplasma penetrans HF-2] (409 aa)
Score = 1915, Expect = 0.0e+00, Identities = 408/409 (99%), Positives = 409/409 (100%)
  Q:     1 VKKFDEKVLVCNSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           +KKFDEKVLVCNSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ
  S:     1 MKKFDEKVLVCNSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
>gi|15613820|ref|NP_242123.1| recombination factor protein RarA [Bacillus halodurans C-125] >gi|10173873|dbj|BAB04976.1| BH1257 [Bacillus halodurans C-125] (428 aa)
Score = 765, Expect = 2.9e-79, Identities = 163/395 (41%), Positives = 250/395 (63%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV----EAIVEIS---KSDFRQIFFYLKIVLKYYQ---NKSDDIVL---KELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEAL-SPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSN 406
           ++ DE+I +  +  +  II  M++   L S++ +G PGVGK++  Q I    + ++   N+  NNK D+  ++E A    + I+I++E+HRL+K KQD LL +LEK ++I++  TT NPF  +NPAIRSR  ++ +  + +  +K  + + L +K   L  + V    EA+   +     D R     L++ ++  Q       +I L   +E  +  +   D+    HYD+LSAF KSIRGSD NAA++YLA+L+E+GDL+S+ RRL  + YEDIGLAN   GP+  AA+ A+E LG PE RIPL+   +ELCLSPKSNSA +A+D AI  + K  + S P HL+DAHY  A +L    GYKYPHDY   +V+Q+YLP  LK++ +Y+P +  + E+   D + K++ +
  S:    13 SNIDEVIGQQHLVGEGKIIRRMVDAGQLSSMILYGPPGVGKTSIAQAIAGSTDTHYKLLNAVVNNKKDMEIVVEEAKMSGQLILILDEVHRLDKGKQDFLLPHLEKGLLILIGATTANPFHSINPAIRSRCQIFELTPLTTDEIKVALTRALTDKTHGLGEEPVVISDEALAHFAFACGGDVRSALNGLELAVRSTQPNVKGEKEITLSVAEECIQRKSFHHDKDGDAHYDVLSAFQKSIRGSDVNAALHYLARLIEAGDLVSIGRRLLVIAYEDIGLANPQAGPRTLAAIEAAERLGFPEGRIPLANAVVELCLSPKSNSAYVALDAAIADIRKGHVGSVPAHLKDAHYKGAEQLGRGIGYKYPHDYERGWVKQQYLPDSLKSRAYYEPKRTGKFEDALADVYEKLRKS 422
>gi|168308459|ref|ZP_02691134.1| ATPase, AAA family [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902652|gb|EDT48941.1| ATPase, AAA family [Ureaplasma parvum serovar 1 str. ATCC 27813] (408 aa)
Score = 744, Expect = 7.7e-77, Identities = 168/396 (42%), Positives = 256/396 (64%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIV-LKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQ-SVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNN 407
           NS D+++ +  +  +  II  M+ ++ +F+++F+G PGVGKS+  + + + L   F +FN   ++K  L++I+E A + N  IIII+EIHRLNKDKQD+LL  +E + I + ATTTENPFF +NPA+RSR  L  ++ + S+ + E  IK L N +     +    ++  +  D R +   L+I+ L Y ++K D ++LK + + + +L        +DL SAFHKS+RGSD +AA+YYLA+L+  GD  ++YRR+   V+EDIGLAN  L  +V+  +N+   LG PE ++ L+ + +++CLS KSNS  +A  +A + + N +  S PNH+RDAHYASA+KL V GYKYPHD+  +YV Q+YLP+EL NK++Y P    Q E K      K K+NN
  S:    13 NSIDDIVGQKYLLDEIGIIRRMVNHHQVFNLIFYGPPGVGKSSLAKVLAQDLKVPFAFFNPVVDSKKQLMQIIEQALDLNNFIIIIDEIHRLNKDKQDILLPIIEANKIKLFATTTENPFFVINPALRSRCQLLSLKPLTSSQISER-IKTLINVEEVFEPQAFNLLINKTNGDLRAVINTLEIIYLLYKEHKVDYVLLKRIMQESYALGSSDGDEIHDLKSAFHKSMRGSDCDAALYYLARLIIIGDFEAIYRRVSVCVHEDIGLANPNLCLRVDQGINSCRFLGYPENQVILANLVLQICLSNKSNSVYLAYQKAFEDAANGKQYSIPNHVRDAHYASAIKLGVHGYKYPHDFKNNYVNQQYLPRELTNKKYYVPQNNEQ-EFKLNQNQQKFKNNN 408
>gi|154686894|ref|YP_001422055.1| recombination factor protein RarA [Bacillus amyloliquefaciens FZB42] >gi|154352745|gb|ABS74824.1| YrvN [Bacillus amyloliquefaciens FZB42] (422 aa)
Score = 744, Expect = 7.7e-77, Identities = 156/396 (39%), Positives = 246/396 (62%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV------LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           + +++I ++ +  +D II  M+    L S++ +G PG+GK++    I    +  F   N+  +NK D+  +++ A    + I+I++E+HRL+K KQD LL YLE  MII++  TT NP+  +NPAIRSR  ++ +E +   ++K+ + + L ++        V + +  ++   +    D R     L++ +   +  SD  +       +E  +  +   D+    HYD+LSAF KSIRGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+V +A+  +E +G PEARIPL+   IELCLSPKSNSAI A+DEA++ +    +   P HL+DAHY  A +L    GY+YPHD+   +VEQ+YLP+ LKNK++YKP +  + E      + K+    K
  S:    12 NIEDIIGQEHLVKEDKIIGRMVRAKHLSSMILYGPPGIGKTSIATAIAGSTSIAFRKLNAVIHNKKDMEIVVQEAKMSGQVILILDEVHRLDKGKQDFLLPYLENGMIILIGATTANPYHAINPAIRSRTQIFELEPLTPDLIKQALERALTDEHRGLGSYSVSVDDDAMDHFAQGCGGDVRSALNALELAVLSTKESSDGTIRITRETAEECLQKKSYTHDKNGDAHYDVLSAFQKSIRGSDANAALHYLARLIEAGDLESISRRLLVIAYEDIGLASPQAGPRVLSAIQTAERIGFPEARIPLANAVIELCLSPKSNSAISAVDEALKDIRTGKIGDVPKHLKDAHYKGAQELGRGIGYQYPHDFENGWVEQQYLPEPLKNKQYYKPKQTGKFEAAIKQVYEKLMKQKK 422
>gi|16079807|ref|NP_390631.1| recombination factor protein RarA [Bacillus subtilis subsp. subtilis str. 168] >gi|2635199|emb|CAB14695.1| yrvN [Bacillus subtilis subsp. subtilis str. 168] (421 aa)
Score = 742, Expect = 1.4e-76, Identities = 159/389 (40%), Positives = 243/389 (62%)
  Q:    15 DEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           +++I +  +  +D II  M++   L S++ +G PG+GK++    I    +  F   N+  NNK D+  + + A    + I+I++E+HRL+K KQD LL YLE  MII++  TT NP+  +NPAIRSR  ++ +E +   ++K+ + + L ++        V + ++ +E        D R     L++ +   +  +D  +   L      L       D+    HYD+LSAF KSIRGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+V  A+  +E +G PEARIPL+   IELCLSPKSNSAI+AIDEA+  +    +   P HL+DAHY  A +L  +G  YKYPH+Y+  +VEQ+YLP  LKNK++YKP +  + E+     ++K+
  S:    14 EDIIGQQHLVAEDKIIGRMVQAKHLSSMILYGPPGIGKTSIATAIAGSTSIAFRKLNAVINNKKDMEIVAQEAKMSGQVILILDEVHRLDKGKQDFLLPYLENGMIILIGATTANPYHAINPAIRSRTQIFELEPLTPELIKQALERALHDEHRGLGTYSVSIDDQAMEHFAHGCGGDVRSALNALELAVLSTKESADGEIHITLETAEECLQKKSFSHDKDGDAHYDVLSAFQKSIRGSDANAALHYLARLIEAGDLESIARRLLVIAYEDIGLASPQAGPRVLNAIQTAERVGFPEARIPLANAVIELCLSPKSNSAILAIDEALADIRAGKIGDVPKHLKDAHYKGAQELG-RGIDYKYPHNYDNGWVEQQYLPDPLKNKQYYKPKQTGKFESALKQVYDKL 417
>gi|167959497|ref|ZP_02546567.1| ATPase, AAA family protein [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167975025|ref|ZP_02557302.1| ATPase, AAA family [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195659922|gb|EDX53302.1| ATPase, AAA family [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (408 aa)
Score = 742, Expect = 1.5e-76, Identities = 169/396 (42%), Positives = 256/396 (64%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIV-LKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQ-SVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNN 407
           +S D+++ +  +  +  II  M+ ++ +F+++F+G PGVGKS+  + + + L   F +FN   N+K  L++I+E A + N  IIII+EIHRLNKDKQD+LL  +E + I + ATTTENPFF +NPA+RSR  L  ++ + S+ + E  IK L N +     +    ++  +  D R +   L+I+ L Y ++K D ++LK + + + +L        +DL SAFHKS+RGSD +AA+YYLA+L+  GD  ++YRR+   V+EDIGLAN  L  +V+  +N+   LG PE ++ L+ + +++CLS KSNS  +A  +A + + N +  S PNH+RDAHYASAVKL V GYKYPHD+  +YV Q+YLP+EL NK++Y P    Q E K      K K+NN
  S:    13 HSIDDIVGQKDLLDEIGIIRKMVNHHQVFNLIFYGPPGVGKSSLAKVLAQDLKVPFAFFNPVVNSKKQLMQIIEQALDLNNFIIIIDEIHRLNKDKQDILLPIIEANKIKLFATTTENPFFVINPALRSRCQLLSLKPLTSSQISER-IKTLINVEEVFEPQAFNLLITKTNGDLRAVINTLEIIHLLYKEHKVDYVLLKRIMQESYALGVSDGDEIHDLKSAFHKSMRGSDCDAALYYLARLIIIGDFEAIYRRISVCVHEDIGLANPNLCLRVDQGINSCRFLGYPENQVILANLVLQICLSNKSNSVYLAYHKAFEDAANGKQYSIPNHIRDAHYASAVKLGVHGYKYPHDFKNNYVNQQYLPRELANKKYYVPQNNEQ-EFKLNQNQQKFKNNN 408
>gi|13357754|ref|NP_078028.1| recombination factor protein RarA [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167972078|ref|ZP_02554355.1| ATPase, AAA family [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168282304|ref|ZP_02689971.1| ATPase, AAA family [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|170762441|ref|YP_001752277.1| AAA family ATPase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|11280340|pir||B82922 conserved hypothetical ATP/GTP-binding protein UU196 [imported] - Ureaplasma urealyticum >gi|6899161|gb|AAF30603.1|AE002119_8 conserved hypothetical ATP/GTP-binding protein [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168828018|gb|ACA33280.1| ATPase, AAA family [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675769|gb|EDT87674.1| ATPase, AAA family [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700699|gb|EDU18981.1| ATPase, AAA family [Ureaplasma parvum serovar 6 str. ATCC 27818] (408 aa)
Score = 740, Expect = 2.5e-76, Identities = 167/396 (42%), Positives = 256/396 (64%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIV-LKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQ-SVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNN 407
           +S D+++ +  +  +  II  M+ ++ +F+++F+G PGVGKS+  + + + L   F +FN   ++K  L++I+E A + N  IIII+EIHRLNKDKQD+LL  +E + I + ATTTENPFF +NPA+RSR  L  ++ + S+ + E  IK L N +     +    ++  +  D R +   L+I+ L Y ++K D ++LK + + + +L        +DL SAFHKS+RGSD +AA+YYLA+L+  GD  ++YRR+   V+EDIGLAN  L  +V+  +N+   LG PE ++ L+ + +++CLS KSNS  +A  +A + + N +  S PNH+RDAHYASA+KL V GYKYPHD+  +YV Q+YLP+EL NK++Y P    Q E K      K K+NN
  S:    13 HSIDDIVGQKYLLDEIGIIRRMVNHHQVFNLIFYGPPGVGKSSLAKVLAQDLKVPFAFFNPVVDSKKQLMQIIEQALDLNNFIIIIDEIHRLNKDKQDILLPIIEANKIKLFATTTENPFFVINPALRSRCQLLSLKPLTSSQISER-IKTLINVEEVFEPQAFNLLINKTNGDLRAVINTLEIIYLLYKEHKVDYVLLKRIMQESYALGSSDGDEIHDLKSAFHKSMRGSDCDAALYYLARLIIIGDFEAIYRRVSVCVHEDIGLANPNLCLRVDQGINSCRFLGYPENQVILANLVLQICLSNKSNSVYLAYQKAFEDAANGKQYSIPNHVRDAHYASAIKLGVHGYKYPHDFKNNYVNQQYLPRELTNKKYYVPQNNEQ-EFKLNQNQQKFKNNN 408
>gi|167974477|ref|ZP_02556754.1| ATPase, AAA family [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188997939|gb|EDU67036.1| ATPase, AAA family [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (408 aa)
Score = 740, Expect = 2.5e-76, Identities = 168/396 (42%), Positives = 256/396 (64%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIV-LKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQ-SVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNN 407
           +S D+++ +  +  +  II  M+ ++ +F+++F+G PGVGKS+  + + + L   F +FN   N+K  L++I+E A + N  IIII+EIHRLNKDKQD+LL  +E + I + ATTTENPFF +NPA+RSR  L  ++ + S+ + E  IK L N +     +    ++  +  D R +   L+I+ L Y ++K D ++LK + + + +L        +DL SAFHKS+RGSD +AA+YYLA+L+  GD  ++YRR+   V+EDIGLAN  L  +V+  +N+   LG PE ++ L+ + +++CLS KSNS  +A  +A + + N +  S PNH+RDAHYASA+KL V GYKYPHD+  +YV Q+YLP+EL NK++Y P    Q E K      K K+NN
  S:    13 HSIDDIVGQKDLLDEIGIIRKMVNHHQVFNLIFYGPPGVGKSSLAKVLAQDLKVPFAFFNPVVNSKKQLMQIIEQALDLNNFIIIIDEIHRLNKDKQDILLPIIEANKIKLFATTTENPFFVINPALRSRCQLLSLKPLTSSQISER-IKTLINVEEVFEPQAFNLLITKTNGDLRAVINTLEIIHLLYKEHKVDYVLLKRIMQESYALGVSDGDEIHDLKSAFHKSMRGSDCDAALYYLARLIIIGDFEAIYRRISVCVHEDIGLANPNLCLRVDQGINSCRFLGYPENQVILANLVLQICLSNKSNSVYLAYHKAFEDAANGKQYSIPNHVRDAHYASAIKLGVHGYKYPHDFKNNYVNQQYLPRELANKKYYVPQNNEQ-EFKLNQNQQKFKNNN 408
>gi|167941531|ref|ZP_02528606.1| ATPase, AAA family protein [Ureaplasma urealyticum serovar 8] >gi|167941933|ref|ZP_02529008.1| ATPase, AAA family protein [Ureaplasma urealyticum serovar 8] >gi|167941978|ref|ZP_02529053.1| ATPase, AAA family protein [Ureaplasma urealyticum serovar 8] >gi|167972549|ref|ZP_02554826.1| ATPase, AAA family [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167988394|ref|ZP_02570065.1| ATPase, AAA family [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|195867731|ref|ZP_03079732.1| ATPase, AAA family [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|184209307|gb|EDU06350.1| ATPase, AAA family [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018837|gb|EDU56877.1| ATPase, AAA family [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|195660586|gb|EDX53842.1| ATPase, AAA family [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (408 aa)
Score = 739, Expect = 3.6e-76, Identities = 167/396 (42%), Positives = 256/396 (64%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIV-LKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQ-SVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNN 407
           +S D+++ +  +  +  II  M+ ++ +F+++F+G PGVGKS+  + + + L   F +FN   ++K  L++I+E A + N  IIII+EIHRLNKDKQD+LL  +E + I + ATTTENPFF +NPA+RSR  L  ++ + S+ + E  IK L N +     +    ++  +  D R +   L+I+ L Y ++K D ++LK + + + +L        +DL SAFHKS+RGSD +AA+YYLA+L+  GD  ++YRR+   V+EDIGLAN  L  +V+  +N+   LG PE ++ L+ + +++CLS KSNS  +A  +A + + N +  S PNH+RDAHYASA+KL V GYKYPHD+  +YV Q+YLP+EL NK++Y P    Q E K      K K+NN
  S:    13 HSIDDIVGQKDLLDEIGIIRKMVNHHQVFNLIFYGPPGVGKSSLAKVLAQDLKVPFAFFNPVVDSKKQLMQIIEQALDLNNFIIIIDEIHRLNKDKQDILLPIIEANKIKLFATTTENPFFVINPALRSRCQLLSLKPLTSSQISER-IKTLINVEEVFEPQAFNLLITKTNGDLRAVINTLEIIHLLYKEHKVDYVLLKRIMQESYALGASDGDEIHDLKSAFHKSMRGSDCDAALYYLARLIIIGDFEAIYRRISVCVHEDIGLANPNLCLRVDQGINSCRFLGYPENQVILANLVLQICLSNKSNSVYLAYHKAFEDAANGKQYSIPNHIRDAHYASAIKLGVHGYKYPHDFKNNYVNQQYLPRELANKKYYVPQNNEQ-EFKLNQNQQKFKNNN 408
>gi|168337431|ref|ZP_02694046.1| ATPase, AAA family protein [Ureaplasma urealyticum serovar 10] >gi|168807648|ref|ZP_02828707.1| ATPase, AAA family protein [Ureaplasma urealyticum serovar 2] (408 aa)
Score = 738, Expect = 3.8e-76, Identities = 168/396 (42%), Positives = 256/396 (64%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIV-LKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQ-SVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNN 407
           +S D+++ +  +  +  II  M+ ++ +F+++F+G PGVGKS+  + + + L   F +FN   ++K  L++I+E A + N  IIII+EIHRLNKDKQD+LL  +E + I + ATTTENPFF +NPA+RSR  L  ++ + S+ + E  IK L N +     +    ++  +  D R +   L+I+ L Y ++K D ++LK + + + +L        +DL SAFHKS+RGSD +AA+YYLA+L+  GD  ++YRR+   V+EDIGLAN  L  +V+  +N+   LG PE ++ L+ + +++CLS KSNS  +A  +A + + N +  S PNH+RDAHYASAVKL V GYKYPHD+  +YV Q+YLP+EL NK++Y P    Q E K      K K+NN
  S:    13 HSIDDIVGQKDLLDEIGIIRKMVNHHQVFNLIFYGPPGVGKSSLAKVLAQDLKVPFAFFNPVVDSKKQLMQIIEQALDLNNFIIIIDEIHRLNKDKQDILLPIIEANKIKLFATTTENPFFVINPALRSRCQLLSLKPLTSSQISER-IKTLINVEEVFEPQAFNLLITKTNGDLRAVINTLEIIHLLYKEHKVDYVLLKRIMQESYALGVSDGDEIHDLKSAFHKSMRGSDCDAALYYLARLIIIGDFEAIYRRISVCVHEDIGLANPNLCLRVDQGINSCRFLGYPENQVILANLVLQICLSNKSNSVYLAYHKAFEDAANGKQYSIPNHIRDAHYASAVKLGVHGYKYPHDFKNNYVNQQYLPRELANKKYYVPQNNEQ-EFKLNQNQQKFKNNN 408
>gi|169829332|ref|YP_001699490.1| hypothetical protein Bsph_3886 [Lysinibacillus sphaericus C3-41] >gi|168993820|gb|ACA41360.1| conserved hypothetical protein [Lysinibacillus sphaericus C3-41] (420 aa)
Score = 737, Expect = 6.2e-76, Identities = 167/393 (42%), Positives = 247/393 (62%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRL-LLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI-------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVKGYKYPHDYNF----SYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKS 405
           + DE++        ++ +  MI+N  + S+L +G PG+GK++    I       F+  N+T   K D+ +I++ A    K ++ ++EIHR NK +QD LL ++E   I+++  TTENP+  VNPAIRSR   +Y+++ +    L E V K L ++K         L++  +E I E +  D R+    L+ +  YY +   +        I + LI       D++ ++ Y+LLSA  KS+RGSD NAA+YYLA LLE+GDL++V RRL  + YEDIGLAN  +GP + AAV A+E LGLPEARIPL+   IE+CL+ KSNSAI+AIDEAI++++  +    P+HLRDAHYA A  L   GY+YPH+        +V+Q+YLP EL   EFYKP   +  E +    + K+KS
  S:     5 TLDEIVGHQDFIGPNTALYKMIQNEHVPSMLLYGEPGIGKTSIANAIAGSSQLPFFALNATRAGKKDVEDIVQEARISGKVLLFLDEIHRFNKLQQDTLLPHVENGSIVLIGATTENPYHDVNPAIRSRCGEIYQLKRLTKENLMELVEKALADEKRGLGKYHFILTDSQIERIAEAANGDARKALTLLESI--YYASDEVEGPTIAADHIIDHLISRIGVYGDKKGSHFYNLLSALQKSVRGSDTNAALYYLAHLLETGDLVAVSRRLLVMAYEDIGLANPEVGPHMLAAVQAAERLGLPEARIPLASAVIEMCLASKSNSAILAIDEAIKAIHDGKTGGIPHHLRDAHYAGAKDLGHVGYQYPHNTPIGTFGGWVDQQYLPDELVGTEFYKP-VVAGEEKRMASIYEKLKS 414
>gi|171325885|ref|ZP_02914381.1| AAA ATPase central domain protein [Geobacillus sp. WCH70] >gi|171088090|gb|EDT34445.1| AAA ATPase central domain protein [Geobacillus sp. WCH70] (430 aa)
Score = 726, Expect = 1.1e-74, Identities = 166/396 (41%), Positives = 247/396 (62%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRL----LLYRIENINSAVLKEEVI----KYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQN----KSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE--NKFVDYWNKIKSNNK 408
           + DE++ +  I    + +  MI+N  + S+L +G PGVGK++    I   + ++F+  N+TT+ K +L E++E A      I+ I+EIHR NK +QD LL ++E+ +I ++  TTENPF +VNPAIRSR      L R+E  +  +L +  +    + L    + +  +++  I E S  D R     L+ ++   +N    +  +  ++E  +      D++   +Y LLSAF KS+RGSD +AA++YLA+LLE GDL +V RRL  + YEDIGLAN  +G KV AA+ A E LGLPEARIPL+ +TIELCLS KSNSA  A+D AI  V N +    P+HL+DAHY  A  L + KGY+YPHDY   +V Q+YLP EL   ++Y P +  + +   K  +   ++K  NK
  S:    16 NIDEIVGQQHIIGPHTALYKMIKNGYVPSLLLYGEPGVGKTSLAHAIAGTVQRDFFAVNATTSGKKELEEVVETAKLTGNVILFIDEIHRFNKAQQDYLLPHIEQGLITLIGATTENPFHEVNPAIRSRCGQIKQLKRLEPADILILLQRALHDRDRGLGKLSIDMEERLLSMIAESSGGDARLALNLLEAIVYASENDGQIRVAEQTVREFVENRGFTHDKKGDVYYSLLSAFQKSVRGSDVDAALHYLARLLEGGDLAAVCRRLLVIAYEDIGLANPMMGVKVQAAIEAVERLGLPEARIPLAVVTIELCLSAKSNSAYKALDAAIDDVRNGKIGDIPDHLKDAHYKGASVLGHGKGYQYPHDYPNGWVFQQYLPNELAGVKYYSPKENGEEKYYAKVYERLEQLKQRNK 427
>gi|21283306|ref|NP_646394.1| recombination factor protein RarA [Staphylococcus aureus subsp. aureus MW2] >gi|49486460|ref|YP_043681.1| recombination factor protein RarA [Staphylococcus aureus subsp. aureus MSSA476] >gi|21204746|dbj|BAB95442.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] >gi|49244903|emb|CAG43364.1| putative ATPase [Staphylococcus aureus subsp. aureus MSSA476] (424 aa)
Score = 725, Expect = 1.3e-74, Identities = 159/391 (40%), Positives = 238/391 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           + DE+I +  +     II  M++   L S++F+G PG+GK++  + I       F   N+ TN K D+  ++E A    + I++++EIHRL+K KQD LL +LE   I+++  TT NP+  +NPAIRSR  ++ +  +N   +++ + + +E++       + K+    +      S+ D R     L++ +    N  D      L    + L       D+    HYD++SAF KSIRGSD NAA++YLA+L+E+GDL ++ RRL  + YEDIGLA+   G +  AA+ ++E LGLPEARIPLSQ  IELCLSPKSNSA+ AID A+  + N      PNHL+D HY  A  L    GYKYPH Y   YV Q+YLP +LKNK +Y+P   S++E +  + +N +
  S:    14 NIDEIISQQHLVGPRGIIRRMVDTKKLTSMIFYGPPGIGKTSIAKAISGSTQYKFRQLNAVTNTKKDMQLVVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGKIVLIGATTSNPYHAINPAIRSRAQIFELYPLNDEDVRQALTRAIEDEENGLKTYQPKIDEDAMTYFSTQSQGDVRSALNALELAVLSADNDKDGYRHVTLQDAKDCLQKGAFVSDKDGDMHYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDIGLASPNAGQRTLAAIESAERLGLPEARIPLSQAVIELCLSPKSNSAMSAIDSALSDIRNGHVGQIPNHLKDGHYQGAKDLGRSIGYKYPHQYVNGYVSQQYLPDKLKNKIYYEPKTTSKSEQQLKEIYNNL 419
>gi|126653989|ref|ZP_01725824.1| hypothetical protein BB14905_09600 [Bacillus sp. B14905] >gi|126589506|gb|EAZ83649.1| hypothetical protein BB14905_09600 [Bacillus sp. B14905] (420 aa)
Score = 725, Expect = 1.5e-74, Identities = 164/393 (41%), Positives = 244/393 (62%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRL-LLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYY-------QNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNF----SYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKS 405
           + DE++        ++ +  MI+N  + S+L +G PG+GK++    I       F+  N+T   K D+ +I++ A    K ++ ++EIHR NK +QD LL ++E   I+++  TTENP+  VNPAIRSR   +Y+++ +    L E V K L ++K         L+   +E I E +  D R+    L+ +  YY       Q  + D ++  L        D++ ++ Y+LLSA  KS+RGSD NAA+YYLA LLE+GDL++V RRL  + YEDIGLAN  +G  + AA+ A+E LGLPEARIPL+   IE+CL+ KSNSAI+AID+AI++++       P+HLRDAHYA A  L   GY+YPH+        +V+Q+YLP EL   EFYKP   +  E +    + K+KS
  S:     5 TLDEIVGHQDFIGPNTALYKMIQNEHVPSMLLYGEPGIGKTSIANAIAGSSQLPFFALNATRAGKKDVEDIVQEARISGKVLLFLDEIHRFNKLQQDTLLPHVENGSIVLIGATTENPYHDVNPAIRSRCGEIYQLKRLTKENLMELVEKALADEKRGLGKYHFVLTPSQIEHIAEAANGDARKALTLLESI--YYASDEVEGQTIAADHIIDHLISRIGVYGDKKGSHFYNLLSALQKSVRGSDTNAALYYLAHLLETGDLVAVSRRLLVMAYEDIGLANPEVGSHMLAAIQAAERLGLPEARIPLASAVIEMCLASKSNSAILAIDDAIKAIHDGKTGDIPHHLRDAHYAGATDLGHVGYQYPHNTPIGTFGGWVDQQYLPDELVGTEFYKP-VIAGEEKRMASIYEKLKS 414
>gi|49483872|ref|YP_041096.1| recombination factor protein RarA [Staphylococcus aureus subsp. aureus MRSA252] >gi|49242001|emb|CAG40698.1| putative ATPase [Staphylococcus aureus subsp. aureus MRSA252] (424 aa)
Score = 725, Expect = 1.5e-74, Identities = 159/391 (40%), Positives = 238/391 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           + DE+I +  +     II  M++   L S++F+G PG+GK++  + I       F   N+ TN K D+  ++E A    + I++++EIHRL+K KQD LL +LE   I+++  TT NP+  +NPAIRSR  ++ +  +N   +++ + + +E++       + K+    +      S+ D R     L++ +    N  D      L    + L       D+    HYD++SAF KSIRGSD NAA++YLA+L+E+GDL ++ RRL  + YEDIGLA+   G +  AA+ ++E LGLPEARIPLSQ  IELCLSPKSNSA+ AID A+  + N      PNHL+D HY  A  L    GYKYPH Y   YV Q+YLP +LKNK +Y+P   S++E +  + +N +
  S:    14 NIDEIISQQHLVGPRGIIRRMVDTKKLTSMIFYGPPGIGKTSIAKAISGSTQYKFRQLNAVTNTKKDMQLVVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGKIVLIGATTSNPYHAINPAIRSRAQIFELYPLNDEDVRQALTRAIEDEENGLKTYQPKIDEDAMTYFSTQSQGDVRSALNALELAVLSADNDKDGYRHVTLQDAKDCLQKGAFVSDKDGDMHYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDIGLASPNAGQRTLAAIESAERLGLPEARIPLSQAVIELCLSPKSNSAMSAIDSALSDIRNGHVGQIPNHLKDGHYQGAKDLGRSIGYKYPHQYVNGYVSQQYLPDKLKNKIYYEPKTTSKSERQLKEIYNNL 419
>gi|15924617|ref|NP_372151.1| recombination factor protein RarA [Staphylococcus aureus subsp. aureus Mu50] >gi|15927207|ref|NP_374740.1| recombination factor protein RarA [Staphylococcus aureus subsp. aureus N315] >gi|156979945|ref|YP_001442204.1| recombination factor protein RarA [Staphylococcus aureus subsp. aureus Mu3] >gi|13701425|dbj|BAB42719.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] >gi|14247398|dbj|BAB57789.1| similar to ATPase, AAA family [Staphylococcus aureus subsp. aureus Mu50] >gi|156722080|dbj|BAF78497.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] (424 aa)
Score = 724, Expect = 1.9e-74, Identities = 159/391 (40%), Positives = 237/391 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           + DE+I +  +     II  M++   L S++F+G PG+GK++  + I       F   N+ TN K D+  ++E A    + I++++EIHRL+K KQD LL +LE   I+++  TT NP+  +NPAIRSR  ++ +  +N   +++ + + +E+        + K+    +      S+ D R     L++ +    N  D      L    + L       D+    HYD++SAF KSIRGSD NAA++YLA+L+E+GDL ++ RRL  + YEDIGLA+   G +  AA+ ++E LGLPEARIPLSQ  IELCLSPKSNSA+ AID A+  + N      PNHL+D HY  A  L    GYKYPH Y   YV Q+YLP +LKNK +Y+P   S++E +  + +N +
  S:    14 NIDEIISQQHLVGPKGIIRRMVDTKKLTSMIFYGPPGIGKTSIAKAISGSTQYKFRQLNAVTNTKKDMQLVVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGKIVLIGATTSNPYHAINPAIRSRAQIFELYPLNDEDVRQALTRAIEDDENGLKTYQPKIDEDAMTYFSTQSQGDVRSALNALELAVLSADNDKDGYRHVTLQDAKDCLQKGAFVSDKDGDMHYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDIGLASPNAGQRTLAAIESAERLGLPEARIPLSQAVIELCLSPKSNSAMSAIDSALSDIRNGHVGQIPNHLKDGHYQGAKDLGRSIGYKYPHQYVNGYVSQQYLPDKLKNKIYYEPKTTSKSEQQLKEIYNNL 419
>gi|57650509|ref|YP_186522.1| recombination factor protein RarA [Staphylococcus aureus subsp. aureus COL] >gi|151221741|ref|YP_001332563.1| recombination factor protein RarA [Staphylococcus aureus subsp. aureus str. Newman] >gi|161353524|ref|YP_500242.2| recombination factor protein RarA [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|162138568|ref|YP_494279.2| recombination factor protein RarA [Staphylococcus aureus subsp. aureus USA300] >gi|168728810|ref|ZP_02761087.1| recombination factor protein RarA [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|57284695|gb|AAW36789.1| ATPase, AAA family [Staphylococcus aureus subsp. aureus COL] >gi|150374541|dbj|BAF67801.1| ATPase AAA family protein [Staphylococcus aureus subsp. aureus str. Newman] (424 aa)
Score = 724, Expect = 2.0e-74, Identities = 159/391 (40%), Positives = 237/391 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           + DE+I +  +     II  M++   L S++F+G PG+GK++  + I       F   N+ TN K D+  ++E A    + I++++EIHRL+K KQD LL +LE   I+++  TT NP+  +NPAIRSR  ++ +  +N   +++ + + +E+        + K+    +      S+ D R     L++ +    N  D      L    + L       D+    HYD++SAF KSIRGSD NAA++YLA+L+E+GDL ++ RRL  + YEDIGLA+   G +  AA+ ++E LGLPEARIPLSQ  IELCLSPKSNSA+ AID A+  + N      PNHL+D HY  A  L    GYKYPH Y   YV Q+YLP +LKNK +Y+P   S++E +  + +N +
  S:    14 NIDEIISQQHLVGPRGIIRRMVDTKKLTSMIFYGPPGIGKTSIAKAISGSTQYKFRQLNAVTNTKKDMQLVVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGKIVLIGATTSNPYHAINPAIRSRAQIFELYPLNDEDVRQALTRAIEDDENGLKTYQPKIDEDAMTYFSTQSQGDVRSALNALELAVLSADNDKDGYRHVTLQDAKDCLQKGAFVSDKDGDMHYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDIGLASPNAGQRTLAAIESAERLGLPEARIPLSQAVIELCLSPKSNSAMSAIDSALSDIRNGHVGQIPNHLKDGHYQGAKDLGRSIGYKYPHQYVNGYVSQQYLPDKLKNKIYYEPKTTSKSEQQLKEIYNNL 419
>gi|87202996|gb|ABD30806.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] (415 aa)
Score = 723, Expect = 2.5e-74, Identities = 159/391 (40%), Positives = 237/391 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           + DE+I +  +     II  M++   L S++F+G PG+GK++  + I       F   N+ TN K D+  ++E A    + I++++EIHRL+K KQD LL +LE   I+++  TT NP+  +NPAIRSR  ++ +  +N   +++ + + +E+        + K+    +      S+ D R     L++ +    N  D      L    + L       D+    HYD++SAF KSIRGSD NAA++YLA+L+E+GDL ++ RRL  + YEDIGLA+   G +  AA+ ++E LGLPEARIPLSQ  IELCLSPKSNSA+ AID A+  + N      PNHL+D HY  A  L    GYKYPH Y   YV Q+YLP +LKNK +Y+P   S++E +  + +N +
  S:     5 NIDEIISQQHLVGPRGIIRRMVDTKKLTSMIFYGPPGIGKTSIAKAISGSTQYKFRQLNAVTNTKKDMQLVVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGKIVLIGATTSNPYHAINPAIRSRAQIFELYPLNDEDVRQALTRAIEDDENGLKTYQPKIDEDAMTYFSTQSQGDVRSALNALELAVLSADNDKDGYRHVTLQDAKDCLQKGAFVSDKDGDMHYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDIGLASPNAGQRTLAAIESAERLGLPEARIPLSQAVIELCLSPKSNSAMSAIDSALSDIRNGHVGQIPNHLKDGHYQGAKDLGRSIGYKYPHQYVNGYVSQQYLPDKLKNKIYYEPKTTSKSEQQLKEIYNNL 410
>gi|70726294|ref|YP_253208.1| recombination factor protein RarA [Staphylococcus haemolyticus JCSC1435] >gi|68447018|dbj|BAE04602.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (422 aa)
Score = 723, Expect = 2.5e-74, Identities = 161/393 (40%), Positives = 248/393 (63%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSN---KVVEAIVEI----SKSDFRQIF--FYLKIVLKYYQNKSDDIVLKELGKITNS---LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLN-VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKS 405
           + DE+I +  +     II  M+E   L S++F+G PG+GK++  + I    +  F   N+ TN+K D+  ++E A    + I++++EIHRL+K KQD LL +LE   I+++  TT NP+  +NPAIRSR  ++ + +++   ++  + + L + +  L+N   KV E  +E     S+ D R       L ++    +N+   I L++          + D+    HYD++SAF KSIRGSD NAA++YLA+L+E+GDL ++ RRL  + YED+GLA+   G +  AA+ ++E LG PEARIPLSQ  IEL LSPKSNSAI AID A+  + K  +   P+HLRD HYA A  L    GYKYPH+Y   +V Q+YLP +LKNK +Y+P   S++E +F   ++ +++
  S:    14 NIDEIISQQHLVGPRGIIRRMVETKRLSSMIFYGPPGIGKTSIAKAISGSTDYKFRQLNAVTNSKKDMQMVVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGKIVLIGATTSNPYHAINPAIRSRAQIFELYSLDHDDVRLAINRALNDSQRGLANYHPKVDEDALEYFATQSQGDVRSALNALELAVLSASVENEIRHITLQDAKDCLQKGAFVSDKDGDMHYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDVGLASPNAGQRTLAAIQSAERLGFPEARIPLSQAVIELSLSPKSNSAITAIDSALSDIRKGNIGQIPDHLRDGHYAGAKDLGRAIGYKYPHNYENGHVIQQYLPDKLKNKIYYEPKSTSKSEQQFKTIYDNLRN 420
>gi|52081232|ref|YP_080023.1| recombination factor protein RarA [Bacillus licheniformis ATCC 14580] >gi|52786612|ref|YP_092441.1| recombination factor protein RarA [Bacillus licheniformis ATCC 14580] >gi|52004443|gb|AAU24385.1| Replication factor C conserved domain [Bacillus licheniformis ATCC 14580] >gi|52349114|gb|AAU41748.1| YrvN [Bacillus licheniformis DSM 13] (421 aa)
Score = 722, Expect = 2.7e-74, Identities = 157/389 (40%), Positives = 242/389 (62%)
  Q:    15 DEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYYQNKSDDI-----VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           +E++ +D +  +  II  M++   L S++ +G PG+GK++    I    +  F   N+  NNK D+  I   A    + I+I++E+HRL+K KQD LL YLE  MII++  TT NP+  +NPAIRSR  ++ +  ++   +K  + + LE+K        V + ++ ++ +      D R     L++ VL   +N    I     + +E  +  + + D+    HYD++SAF KSIRGSD NAA++Y+A+L+E+GDL S+ RRL  + YED+GLA+   G +   A+  +E +G PEARIPL+   IELCLSPKSNSAI+A+DEA+  V    +   PNHL+DAHY  A +L  +G  YKYPHDY   +V+Q+YLP  LKNK +Y+P +  + E      ++K+
  S:    14 EEVLGQDHLVGEGKIIHRMVQAKHLSSMILYGPPGIGKTSIATAIAGSTSIAFRKLNAVINNKKDMEAIAAEAKMSGQVILILDEVHRLDKGKQDFLLPYLENGMIIMIGATTANPYHAINPAIRSRTQIFELHPLDPEQIKTAIKRALEDKHRGLGSYDVAVDDEALDHLARGCGGDVRSALNALELAVLSTKENSEGAIRITLEIAEECLQKKSFVHDKDGDAHYDVISAFQKSIRGSDVNAALHYMARLIEAGDLESLARRLLVIAYEDVGLASPQAGGRTLQAIQTAERIGFPEARIPLANAVIELCLSPKSNSAILAVDEALSDVRSGKIGDVPNHLKDAHYKGAAELG-RGVEYKYPHDYENGWVKQQYLPDPLKNKVYYQPKQTGKFELALKQVYDKL 417
>gi|148268108|ref|YP_001247051.1| recombination factor protein RarA [Staphylococcus aureus subsp. aureus JH9] >gi|150394176|ref|YP_001316851.1| recombination factor protein RarA [Staphylococcus aureus subsp. aureus JH1] >gi|147741177|gb|ABQ49475.1| Recombination protein MgsA [Staphylococcus aureus subsp. aureus JH9] >gi|149946628|gb|ABR52564.1| AAA ATPase central domain protein [Staphylococcus aureus subsp. aureus JH1] (424 aa)
Score = 721, Expect = 3.6e-74, Identities = 159/391 (40%), Positives = 237/391 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           + DE+I +  +     II  M++   L S++F+G PG+GK++  + I       F   N+ TN K D+  ++E A    + I++++EIHRL+K KQD LL +LE   I+++  TT NP+  +NPAIRSR  ++ +  +N   +++ + + +E+        + K+    +      S+ D R     L++ +    N  D      L    + L       D+    HYD++SAF KSIRGSD NAA++YLA+L+E+GDL ++ RRL  + YEDIGLA+   G +  AA+ ++E LGLPEARIPLSQ  IELCLSPKSNSA+ AID A+  + N      PNHL+D HY  A  L    GYKYPH Y   YV Q+YLP +LKNK +Y+P   S++E +  + +N +
  S:    14 NIDEIISQQHLVGPKGIIRRMVDTKKLTSMIFYGPPGIGKTSIAKAISGSTQYKFRQLNAVTNTKKDMQLVVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGKIVLIGATTSNPYHAINPAIRSRAQIFELYPLNDEDVRQALTRAIEDDENGLKTYQPKIDEDAMTYFSTQSQGDVRNALNALELAVLSADNDKDGYRHVTLQDAKDCLQKGAFVSDKDGDMHYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDIGLASPNAGQRTLAAIESAERLGLPEARIPLSQAVIELCLSPKSNSAMSAIDSALSDIRNGHVGQIPNHLKDGHYQGAKDLGRSIGYKYPHQYVNGYVSQQYLPDKLKNKIYYEPKTTSKSEQQLKEIYNNL 419
>gi|150010979|gb|ABR57146.1| ATPase AAA family protein [Staphylococcus xylosus] (425 aa)
Score = 719, Expect = 6.2e-74, Identities = 160/398 (40%), Positives = 247/398 (62%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLS--NKVVEA-----IVEISKSDFRQIFFYLKI-VLKYYQNKSDDIVL----KELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLN-VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           ++ DE+I ++ +     II  M+E   L S++F+G PG+GK++  + I       F   N+ TN K D+  I+E A    + I++++EIHRL+K KQD LL +LE   I+++  TT NP+  +NPAIRSR  ++ +  ++   +K  + + L +++  L+  N +V+          S+ D R     L++ VL      S   +     K+  +    + D+    HYD++SAF KSIRGSD NAA++YLA+L+E+GDL ++ RRL  + YEDIGLA+ G G +  AA+ ++E LG PEARIPLSQ  IELCLSPKSNS I AID A+  + K  +   P+HL+D HYA A +L    GY+YPH Y+  ++ Q+YLP +LKN+ +Y+P   S++E +F   +  I    ++
  S:    13 SNIDEIISQEHLVGPKGIIRRMVETKRLSSMIFYGPPGIGKTSIAKAISGSTQFKFRQLNAVTNTKKDMQLIVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGKIVLIGATTSNPYHAINPAIRSRAQIFELYPLDENDIKVSLNRALNDEERGLASYNPIVDEDAMSYFTTQSQGDVRSALNALELAVLSSDTTDSQRYITLQDAKDCLQKGAFVSDKDGDMHYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDIGLASPGAGQRTLAAIESAERLGFPEARIPLSQAVIELCLSPKSNSGISAIDAALSDIRKGHIGQIPDHLKDGHYAGAKELGRAIGYQYPHSYDSGFIPQQYLPDKLKNRVYYEPKTTSKSEQQFKSVYENITQAQQK 424
>gi|73662441|ref|YP_301222.1| recombination factor protein RarA [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72494956|dbj|BAE18277.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (427 aa)
Score = 719, Expect = 7.7e-74, Identities = 162/397 (40%), Positives = 250/397 (62%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSN---KVVEAIVEI----SKSDFRQIFFYLKIVLKYYQN--KSDDIVLKELGKITNS---LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKF---VDYWNKIKSNNK 408
           N+ DE+I ++ +     II  M+E   L S++F+G PG+GK++  + I       F   N+ TN K D+  I+E A    + I++++EIHRL+K KQD LL +LE   I+++  TT NP+  +NPAIRSR  ++ +  ++   ++  + + L + +  L++   KV E  +      S+ D R     L++ +   +N  +   I L++          + D+    HYD++SAF KSIRGSD NAA++YLA+L+E+GDL ++ RRL  + +ED+GLA+   G +  AA+ ++E LG PEARIPLSQ  IELCLSPKSNS I AID A+  + K  +   P+HL+D HYA A +L    GYKYPH+Y   +V Q+YLP +LKN+ +Y+P   S++E +F    D+ N+ +  NK
  S:    13 NNIDEIISQEHLVGPKGIIRRMVETKRLSSMIFYGPPGIGKTSIAKAISGSTQFKFRQLNAVTNTKKDMQLIVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGKIVLIGATTSNPYHAINPAIRSRAQIFELYPLDENDVRVSLDRALNDSERGLASYNPKVDEDAMAYFTTQSQGDVRSALNALELAVLSSENIDQQRHITLQDAKDCLQKGAFVSDKDGDMHYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISFEDVGLASPSAGQRTLAAIESAERLGFPEARIPLSQAVIELCLSPKSNSGINAIDAALSDIRKGHVGQIPDHLKDGHYAGAKELGRSIGYKYPHNYENGFVTQQYLPDKLKNRIYYEPKTTSKSEQQFKAVFDHINQSQQKNK 426
>gi|153202438|ref|ZP_01943974.1| hypothetical protein LMSG_00840 [Listeria monocytogenes HPB2262] >gi|133735213|gb|EBA36911.1| hypothetical protein LMSG_00840 [Listeria monocytogenes HPB2262] (437 aa)
Score = 716, Expect = 1.5e-73, Identities = 159/391 (40%), Positives = 238/391 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDF--------RQIFFYLKIVLKYYQNKSDDI------VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLN-VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           + DE++ +  +  KD II  M++   L S++ +G PG+GK++    I       F   N+ TNNK D+  +   A      I++++E+HRL+K KQD LL  LE   II++  TT NP+  +NPAIRSR  ++ ++ +    +   + + L +K+  L N  VE I E++K  F        R     L++ +   +   D +      V +E  +  +   D+    HYD+LSAF KS+RGSD NAA++Y+ +L+E+GDL+S+ RR+  + YEDIGLA+   G    AA+  +E +G PEARIPL+   IELCLSPKSNSAIMAID A+  + + ++   P+HLRD HY+ A KL     YKYPH+Y+ ++VEQ+YLP  LKNK +Y P   S+ E      + KI
  S:    14 ALDEIVGQTHLVGKDKIIYRMVKAKQLSSMILYGPPGIGKTSIASAIAGSTKYAFRTLNAVTNNKKDMEVVAAEAKMSGTVILLLDEVHRLDKAKQDFLLPLLESGAIILIGATTSNPYIAINPAIRSRTQIFELKPLTVEDIMITMDRALSDKERGLGNYDVE-IDEVAKKHFATASNGDVRSALNALELAVISSEPNEDGVIHITLDVAEECLQKKSLAHDKDGDAHYDVLSAFQKSVRGSDVNAALHYMGRLIEAGDLVSISRRMLVMAYEDIGLASPQAGAHTLAAIQTAEKVGFPEARIPLANAVIELCLSPKSNSAIMAIDAALADIRQGKSGEVPDHLRDGHYSGAEKLGRAIDYKYPHNYDNAWVEQQYLPDRLKNKLYYAPKFTSKFEQTIAGVYQKI 419
>gi|153166947|ref|ZP_01927387.1| hypothetical protein LMHG_02593 [Listeria monocytogenes FSL N1-017] >gi|133727235|gb|EBA28933.1| hypothetical protein LMHG_02593 [Listeria monocytogenes FSL N1-017] (427 aa)
Score = 715, Expect = 1.9e-73, Identities = 160/397 (40%), Positives = 240/397 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDF--------RQIFFYLKIVLKYYQNKSDDI------VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLN-VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           + DE++ +  +  KD II  M++   L S++ +G PG+GK++    I       F   N+ TNNK D+  +   A      I++++E+HRL+K KQD LL  LE   II++  TT NP+  +NPAIRSR  ++ ++ +    +   + + L +K+  L N  VE I E++K  F        R     L++ +   +   D +      V +E  +  +   D+    HYD+LSAF KS+RGSD NAA++Y+ +L+E+GDL+S+ RR+  + YEDIGLA+   G    AA+  +E +G PEARIPL+   IELCLSPKSNSAIMAID A+  + + ++   P+HLRD HY+ A KL     YKYPH+Y+ ++VEQ+YLP  LKNK +Y P   S+ E      + KI  N  +
  S:    14 ALDEIVGQTHLVGKDKIIYRMVKAKQLSSMILYGPPGIGKTSIASAIAGSTKYAFRTLNAVTNNKKDMEVVAAEAKMSGTVILLLDEVHRLDKAKQDFLLPLLESGAIILIGATTSNPYIAINPAIRSRTQIFELKPLTVEDIMITMDRALSDKERGLGNYDVE-IDEVAKKHFATASNGDVRSALNALELAVISSEPNEDGVIHITLDVAEECLQKKSLAHDKDGDAHYDVLSAFQKSVRGSDVNAALHYMGRLIEAGDLVSISRRMLVMAYEDIGLASPQAGAHTLAAIQTAEKVGFPEARIPLANAVIELCLSPKSNSAIMAIDAALADIRQGKSGEVPDHLRDGHYSGAEKLGRAIDYKYPHNYDNAWVEQQYLPDRLKNKLYYAPKFTSKFEQTIAGVYQKINENKAK 425
>gi|16800617|ref|NP_470885.1| recombination factor protein RarA [Listeria innocua Clip11262] >gi|16414036|emb|CAC96780.1| lin1549 [Listeria innocua] (427 aa)
Score = 715, Expect = 2.2e-73, Identities = 159/397 (40%), Positives = 238/397 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIE---------NINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI------VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLN-VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           + DE++ +  +  KD II  M++   L S++ +G PG+GK++    I       F   N+ TNNK D+  +   A      I++++E+HRL+K KQD LL  LE   II++  TT NP+  +NPAIRSR  ++ ++          ++ A+L +E  + L N +V++     +     S  D R     L++ +   +   D I      V +E  +  +   D+    HYD+LSAF KS+RGSD NAA++Y+ +L+E+GDL+S+ RR+  + YEDIGLAN   G    AA+  +E +G PEARIPL+   IELCLSPKSNSAIMAID A+  + +  +   P+HLRD HY+ A KL     YKYPH+Y+ ++V+Q+YLP  LKNK +Y P   S+ E      + KI  N  +
  S:    14 ALDEIVGQTHLVGKDKIIYRMVKAKQLSSMILYGPPGIGKTSIASAIAGSTKYAFRTLNAVTNNKKDMEVVAAEAKMSGTVILLLDEVHRLDKAKQDFLLPLLESGAIILIGATTSNPYIAINPAIRSRTQIFELKPLTVEDIMITMDRALLDKE--RGLGNYEVEIDEFAKKHFATASNGDVRSALNALELAVISSEPNEDGIIHITLDVAEECLQKKSLAHDKDGDAHYDVLSAFQKSVRGSDVNAALHYMGRLIEAGDLVSISRRMLVMAYEDIGLANPQAGAHTLAAIQTAEKVGFPEARIPLANAVIELCLSPKSNSAIMAIDAALADIRQGNSGEVPDHLRDGHYSGAKKLGRAMDYKYPHNYDNAWVDQQYLPDRLKNKLYYDPKFTSKFEQTIAGVYQKINENKAK 425
>gi|82751226|ref|YP_416967.1| recombination factor protein RarA [Staphylococcus aureus RF122] >gi|82656757|emb|CAI81186.1| probable ATPase [Staphylococcus aureus RF122] (424 aa)
Score = 714, Expect = 2.6e-73, Identities = 158/391 (40%), Positives = 237/391 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           + DE+I +  +     II  M++   L S++F+G PG+GK++  + I       F   N+ TN K D+  ++E A    + I++++EIHRL+K KQD LL +LE   I+++  TT NP+  +NPAIRSR  ++ +  +N   +++ + + +E++       + K+    +      S+ D R     L++ +    N  D      L    + L       D+    HYD++SAF KSIRGSD NAA++YLA+L+E+GDL ++ RRL  + YEDIGLA+   G +  AA+ ++E L LPEARIPLSQ  IELCLSPKSNSA+ AID A+  + N      PNHL+D HY  A  L    GYKYPH Y   YV Q+YLP +LKNK +Y+P   S++E +  + +N +
  S:    14 NIDEIISQQHLVGPRGIIRRMVDTKKLTSMIFYGPPGIGKTSIAKAISGSTQYKFRQLNAVTNTKKDMQFVVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGKIVLIGATTSNPYHAINPAIRSRAQIFELYPLNDEDVRQALTRAIEDEENGLKTYQPKIDEDAMAYFSTQSQGDVRSALNALELSVLSADNDKDGYRHVTLQDAKDCLQKGAFVSDKDGDMHYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDIGLASPNAGQRTLAAIESAERLSLPEARIPLSQAVIELCLSPKSNSAMSAIDSALSDIRNGHVGQIPNHLKDGHYQGAKDLGRSIGYKYPHQYVNGYVSQQYLPDKLKNKIYYEPKTTSKSEQQLKEIYNNL 419
>gi|110005106|emb|CAK99435.1| putative conserved aaa type atpase protein [Spiroplasma citri] (411 aa)
Score = 714, Expect = 2.8e-73, Identities = 157/381 (41%), Positives = 236/381 (61%)
  Q:    22 VIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKL--SNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI-VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNK 402
           +I  ++ +I  M++ N   S++F+G+PGVGKS+  + +   L   +  FN+  N K DL +I++ A    + III+EE+HR+NKD+QD+LL YLE   +I+ A TTENP+F +NPA+RSR  + ++E I    +   + K +  KK+ L  +N  +  I +++  D R     L++ L  Y  +   + ++  L    N +       H+DL SA  KSIRGSD NAA+YY A+LL SGD  ++ RR+  + YEDIGLAN  +   V  A+++   +GLPE RIPL    +E+CLS KSNSA +A D+A + V K  L P P+HLRD  YASA KL N +GY+YPHD+   YV Q+YLPKE++   +Y+P  +S  E +  + + +
  S:    23 LINEQNGVISRMLKYNYASSLIFYGDPGVGKSSIARALANDLQLEYAIFNAGINKKQDLEKIIKQAANFERFIIIVEEVHRMNKDRQDILLQYLENGHLIMFACTTENPYFVINPALRSRANIIKLERITVDEMLTGLQKIITKKKLPLTITNDALLLICQLASGDLRIAINILELCLNLYPTEEITVTIINNLATSANLINFAEGDEHHDLKSALQKSIRGSDVNAALYYFARLLASGDHEALLRRMLIIAYEDIGLANPAIAVHVKTAIDSFRQIGLPEGRIPLGLAIVEMCLSEKSNSAYLATDQAYEDVLKGNLYPIPHHLRDTSYASAKKLGNGRGYQYPHDFPNDYVAQQYLPKEMQGTVYYQPKLHSVYEKRINELYGR 408
>gi|47097211|ref|ZP_00234775.1| ATPase, AAA family domain protein [Listeria monocytogenes str. 1/2a F6854] >gi|153183866|ref|ZP_01934683.1| hypothetical protein LMOG_00566 [Listeria monocytogenes J0161] >gi|153190953|ref|ZP_01938264.1| hypothetical protein LMPG_01565 [Listeria monocytogenes J2818] >gi|47014425|gb|EAL05394.1| ATPase, AAA family domain protein [Listeria monocytogenes str. 1/2a F6854] >gi|126943518|gb|EBA21239.1| hypothetical protein LMOG_00566 [Listeria monocytogenes J0161] >gi|127765521|gb|EBA25869.1| hypothetical protein LMPG_01565 [Listeria monocytogenes J2818] (427 aa)
Score = 712, Expect = 3.9e-73, Identities = 159/397 (40%), Positives = 241/397 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDF--------RQIFFYLKIVLKYYQNKSDDI------VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLN-VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           + DE++ +  +  KD II  M++   L S++ +G PG+GK++    I       F   N+ TNNK D+  +   A      I++++E+HRL+K KQD LL  LE   II++  TT NP+  +NPAIRSR  ++ ++ +    +   + + L +K+  L N  VE I E++K  F        R     L++ +   +   D +      V +E  +  +   D+    HYD+LSAF KS+RGSD NAA++Y+ +L+E+GDL+S+ RR+  + YEDIGLA+   G    AA+  +E +G PEARIPL+   IELCLSPKSNSAIMAID A+  + + ++   P+HLRD HY+ A KL     YKYPH+Y+ ++V+Q+YLP  LKNK +Y+P   S+ E      + KI  N  +
  S:    14 ALDEIVGQTHLVGKDKIIYRMVKAKQLSSMILYGPPGIGKTSIASAIAGSTKYAFRTLNAVTNNKKDMEVVAAEAKMSGTVILLLDEVHRLDKAKQDFLLPLLESGAIILIGATTSNPYIAINPAIRSRTQIFELKPLTVEDIMITMDRALSDKERGLGNYDVE-IDEVAKKHFATASNGDVRSALNALELAVISSEPNEDGVIHITLDVAEECLQKKSLAHDKDGDAHYDVLSAFQKSVRGSDVNAALHYMGRLIEAGDLVSISRRMLVMAYEDIGLASPQAGAHTLAAIQTAEKVGFPEARIPLANAVIELCLSPKSNSAIMAIDAALADIRQGKSGEVPDHLRDGHYSGAEKLGRAIDYKYPHNYDNAWVDQQYLPDRLKNKLYYEPKFTSKFEQTIAGVYQKINENKAK 425
>gi|46907742|ref|YP_014131.1| recombination factor protein RarA [Listeria monocytogenes str. 4b F2365] >gi|47094362|ref|ZP_00232057.1| ATPase, AAA family domain protein [Listeria monocytogenes str. 4b H7858] >gi|46881011|gb|AAT04308.1| ATPase, AAA family domain protein [Listeria monocytogenes str. 4b F2365] >gi|47017260|gb|EAL08098.1| ATPase, AAA family domain protein [Listeria monocytogenes str. 4b H7858] (427 aa)
Score = 712, Expect = 4.8e-73, Identities = 159/397 (40%), Positives = 240/397 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDF--------RQIFFYLKIVLKYYQNKSDDI------VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLN-VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           + DE++ +  +  KD II  M++   L S++ +G PG+GK++    I       F   N+ TNNK D+  +   A      I++++E+HRL+K KQD LL  LE   II++  TT NP+  +NPAIRSR  ++ ++ +    +   + + L +K+  L N  VE I E++K  F        R     L++ +   +   D +      V +E  +  +   D+    HYD+LSAF KS+RGSD NAA++Y+ +L+E+GDL+S+ RR+  + YEDIGLA+   G    AA+  +E +G PEARIPL+   IELCLSPKSNSAIMAID A+  + + ++   P+HLRD HY+ A KL     YKYPH+Y+ ++V+Q+YLP  LKNK +Y P   S+ E      + KI  N  +
  S:    14 ALDEIVGQTHLVGKDKIIYRMVKAKQLSSMILYGPPGIGKTSIASAIAGSTKYAFRTLNAVTNNKKDMEVVAAEAKMSGTVILLLDEVHRLDKAKQDFLLPLLESGAIILIGATTSNPYIAINPAIRSRTQIFELKPLTVEDIMITMDRALSDKERGLGNYDVE-IDEVAKKHFATASNGDVRSALNALELAVISSEPNEDGVIHITLDVAEECLQKKSLAHDKDGDAHYDVLSAFQKSVRGSDVNAALHYMGRLIEAGDLVSISRRMLVMAYEDIGLASPQAGAHTLAAIQTAEKVGFPEARIPLANAVIELCLSPKSNSAIMAIDAALADIRQGKSGEVPDHLRDGHYSGAEKLGRAIDYKYPHNYDNAWVDQQYLPDRLKNKLYYAPKFTSKFEQTIAGVYQKINENKAK 425
>gi|89100968|ref|ZP_01173813.1| ATPase, AAA family domain protein [Bacillus sp. NRRL B-14911] >gi|89084304|gb|EAR63460.1| ATPase, AAA family domain protein [Bacillus sp. NRRL B-14911] (423 aa)
Score = 711, Expect = 6.0e-73, Identities = 152/394 (38%), Positives = 240/394 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE-------NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSN 406
           S +++I ++ +  +  II  M++   L S++ +G PG+GK++    I       F   N+ TNNK D+  +   A    K I++++E+HRL+K KQD LL YLE  MI+++  TT NP+  +NPAIRSR  ++ ++ ++   +K+ +++ L+       N+KV++    +  +   S  D R     L++ +   +   + ++   LG     L       D+    HYD+LS F KSIRGSD NAA++YL +L+E+GDL+S+ RRL  + YEDIGLA+   G +  AA+  +E +G PEARIPL+   IELCLSPKSNSA  A+D AI  +   ++   P HL+DAHY  A +L  +G  YKYPHD+   +V+Q+YLP ++KNK +Y+P    + E      + K+  +
  S:    14 SIEDIIGQEHLVGEGKIIYRMVKARQLSSMILYGPPGIGKTSIASAIAGSTQFAFRTLNAVTNNKKDMEVVAAEAKMSGKVILLLDEVHRLDKAKQDFLLPYLENGMIVLIGATTSNPYHAINPAIRSRCQIFELKPLSEEDIKKSLLRALQDKENGFGNEKVEIDEDALSHLASSSNGDVRSSLNALELAVLSTEKDENGVISISLGTAEECLQRKSFVHDKDGDAHYDVLSGFQKSIRGSDVNAALHYLGRLIEAGDLVSISRRLLVIAYEDIGLASPQAGARTLAAIETAERIGFPEARIPLANAVIELCLSPKSNSAYSALDAAIADIRAGKSGEVPQHLKDAHYKGAKELG-RGIDYKYPHDFPGGWVKQQYLPDKIKNKIYYEPKTTGKFEQALAAIYEKLNKS 422
>gi|153196851|ref|ZP_01941178.1| hypothetical protein LMRG_01456 [Listeria monocytogenes 10403S] >gi|127633734|gb|EBA23142.1| hypothetical protein LMRG_01456 [Listeria monocytogenes 10403S] (427 aa)
Score = 710, Expect = 8.2e-73, Identities = 159/397 (40%), Positives = 241/397 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDF--------RQIFFYLKIVLKYYQNKSDDI------VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLN-VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           + DE++ +  +  KD II  M++   L S++ +G PG+GK++    I       F   N+ TNNK D+  +   A      I++++E+HRL+K KQD LL  LE   II++  TT NP+  +NPAIRSR  ++ ++ +    +   + + L +K+  L N  VE I E++K  F        R     L++ +   +   D +      V +E  +  +   D+    HYD+LSAF KS+RGSD NAA++Y+ +L+E+GDL+S+ RR+  + YEDIGLA+   G    AA+  +E +G PEARIPL+   IELCLSPKSNSAIMAID A+  + + ++   P+HLRD HY+ A KL     YKYPH+Y+ ++V+Q+YLP  LKNK +Y+P   S+ E      + KI  N  +
  S:    14 ALDEIVGQTHLVGKDKIINRMVKAKQLSSMILYGPPGIGKTSIASAIAGSTKYAFRTLNAVTNNKKDMEVVAAEAKMSGTVILLLDEVHRLDKAKQDFLLPLLESGAIILIGATTSNPYIAINPAIRSRTQVFELKPLTVEDIMITMDRALSDKERGLGNYDVE-IDEVAKKHFATASNGDVRSALNALELAVISSEPNEDGVIHITLDVAEECLQKKSLAHDKDGDAHYDVLSAFQKSVRGSDVNAALHYMGRLIEAGDLVSISRRMLVMAYEDIGLASPQAGAHTLAAIQTAEKVGFPEARIPLANAVIELCLSPKSNSAIMAIDAALADIRQGKSGEVPDHLRDGHYSGAEKLGRAIDYKYPHNYDNAWVDQQYLPDRLKNKLYYEPKFTSKFEQTIAGVYQKINENKAK 425
>gi|153174673|ref|ZP_01930142.1| hypothetical protein LMIG_00974 [Listeria monocytogenes FSL N3-165] >gi|133729904|gb|EBA31602.1| hypothetical protein LMIG_00974 [Listeria monocytogenes FSL N3-165] (427 aa)
Score = 710, Expect = 8.6e-73, Identities = 159/397 (40%), Positives = 241/397 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDF--------RQIFFYLKIVLKYYQNKSDDI------VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLN-VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           + DE++ +  +  KD II  M++   L S++ +G PG+GK++    I       F   N+ TNNK D+  +   A      I++++E+HRL+K KQD LL  LE   II++  TT NP+  +NPAIRSR  ++ ++ +    +   + + L +K+  L N  VE I E++K  F        R     L++ +   +   D +      V +E  +  +   D+    HYD+LSAF KS+RGSD NAA++Y+ +L+E+GDL+S+ RR+  + YEDIGLA+   G    AA+  +E +G PEARIPL+   IELCLSPKSNSAIMAID A+  + + ++   P+HLRD HY+ A KL     YKYPH+Y+ ++V+Q+YLP  LKNK +Y+P   S+ E      + KI  N  +
  S:    14 ALDEIVGQTHLVGKDKIINRMVKAKQLSSMILYGPPGIGKTSIASAIAGSTKYAFRTLNAVTNNKKDMEVVAAEAKMSGTVILLLDEVHRLDKAKQDFLLPLLESGAIILIGATTSNPYIAINPAIRSRTQIFELKPLTIEDIMITMDRALSDKERGLGNYDVE-IDEVAKKHFATASNGDVRSALNALELAVISSEPNEDGVIHITLDVAEECLQKKSLAHDKDGDAHYDVLSAFQKSVRGSDVNAALHYMGRLIEAGDLVSISRRMLVMAYEDIGLASPQAGAHTLAAIQTAEKVGFPEARIPLANAVIELCLSPKSNSAIMAIDAALADIRQGKSGEVPDHLRDGHYSGAEKLGRAIDYKYPHNYDNAWVDQQYLPDRLKNKLYYEPKFTSKFEQTIAGVYQKINENKAK 425
>gi|69247927|ref|ZP_00604543.1| AAA ATPase, central region [Enterococcus faecium DO] >gi|68194629|gb|EAN09116.1| AAA ATPase, central region [Enterococcus faecium DO] (428 aa)
Score = 709, Expect = 9.9e-73, Identities = 155/397 (39%), Positives = 244/397 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVE----AIVEISKS---DFRQIFFYLKI-VLKYYQNKSDDI-----VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           + DE++ +  +  +  II  M++   L S++ +G PG GK++    I    N  F   N+ T++K DL  + E A      I++++E+HRL+K KQD LL +LE   II++  TTENP+  +NPAIRSR  ++ ++ +    ++  V   L +K+  L  + ++    A++ +S++   D R     L++  L    +K   I     +++E  +      D+    HYD++SAF KSIRGSD +AA++YLA+L+E+GDL S+ RRL  + YEDIGL N     +   AV A+E LGLPEARIPL+ + ++LCLSPKSNSA MA+D A+  + + +A   P+HLRD+HY  A  LN   GY+YPH ++ ++V Q+YLP +LKN ++Y+P    + E      + +IK   K 
  S:    13 TIDEVVGQQHLVGEGKIIRRMVDARMLSSMILYGPPGTGKTSIASAIAGSTNYAFRMLNAATDSKKDLQVVAEEAKMSGTVILLLDEVHRLDKTKQDFLLPHLESGRIILIGATTENPYITINPAIRSRTQIFEVKPLTEQDIQLAVEHALRDKERGLGQQAIQLDEDALLHLSRATNGDLRSALNGLELATLSTPSDKEGRIHLTLSIIEECVQRKALTHDKNGDAHYDVISAFQKSIRGSDVDAALHYLARLVEAGDLASICRRLMVIGYEDIGLGNPAAAARTVNAVLAAEKLGLPEARIPLADVVVDLCLSPKSNSAYMALDAALADIREGKAGDVPDHLRDSHYKGAKSLNRGVGYQYPHHFDQAWVNQQYLPDKLKNAQYYQPKDTGKYEQALGQQYYRIKEWKKH 424
>gi|167014748|ref|ZP_02277281.1| recombination factor protein RarA [Listeria monocytogenes FSL J1-194] (438 aa)
Score = 709, Expect = 1.1e-72, Identities = 157/381 (41%), Positives = 235/381 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDF--------RQIFFYLKIVLKYYQNKSDDI------VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLN-VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + DE++ +  +  KD II  M++   L S++ +G PG+GK++    I       F   N+ TNNK D+  +   A      I++++E+HRL+K KQD LL  LE   II++  TT NP+  +NPAIRSR  ++ ++ +    +   + + L +K+  L N  VE I E++K  F        R     L++ +   +   D +      V +E  +  +   D+    HYD+LSAF KS+RGSD NAA++Y+ +L+E+GDL+S+ RR+  + YEDIGLA+   G    AA+  +E +G PEARIPL+   IELCLSPKSNSAIMAID A+  + + ++   P+HLRD HY+ A KL     YKYPH+Y+ ++VEQ+YLP  LKNK +Y P   S+ E
  S:    14 ALDEIVGQTHLVGKDKIIYRMVKAKQLSSMILYGPPGIGKTSIASAIAGSTKYAFRTLNAVTNNKKDMEVVAAEAKMSGTVILLLDEVHRLDKAKQDFLLPLLESGAIILIGATTSNPYIAINPAIRSRTQIFELKPLTVEDIMITMDRALSDKERGLGNYDVE-IDEVAKKHFATASNGDVRSALNALELAVISSEPNEDGVIHITLDVAEECLQKKSLAHDKDGDAHYDVLSAFQKSVRGSDVNAALHYMGRLIEAGDLVSISRRMLVMAYEDIGLASPQAGAHTLAAIQTAEKVGFPEARIPLANAVIELCLSPKSNSAIMAIDAALADIRQGKSGEVPDHLRDGHYSGAEKLGRTIDYKYPHNYDNAWVEQQYLPDRLKNKLYYAPKFTSKFE 409
>gi|16803554|ref|NP_465039.1| recombination factor protein RarA [Listeria monocytogenes EGD-e] >gi|16410943|emb|CAC99592.1| lmo1514 [Listeria monocytogenes] (425 aa)
Score = 708, Expect = 1.3e-72, Identities = 159/397 (40%), Positives = 241/397 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDF--------RQIFFYLKIVLKYYQNKSDDI------VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLN-VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           + DE++ +  +  KD II  M++   L S++ +G PG+GK++    I       F   N+ TNNK D+  +   A      I++++E+HRL+K KQD LL  LE   II++  TT NP+  +NPAIRSR  ++ ++ +    +   + + L +K+  L N  VE I E++K  F        R     L++ +   +   D +      V +E  +  +   D+    HYD+LSAF KS+RGSD NAA++Y+ +L+E+GDL+S+ RR+  + YEDIGLA+   G    AA+  +E +G PEARIPL+   IELCLSPKSNSAIMAID A+  + + ++   P+HLRD HY+ A KL     YKYPH+Y+ ++V+Q+YLP  LKNK +Y+P   S+ E      + KI  N  +
  S:    14 ALDEIVGQTHLVGKDKIINRMVKAKQLSSMILYGPPGIGKTSIASAIAGSTKYAFRTLNAVTNNKKDMEVVAAEAKMSGTVILLLDEVHRLDKAKQDFLLPLLESGAIILIGATTSNPYIAINPAIRSRTQIFELKPLTIEDIMITMDRALSDKERGLGNYDVE-IDEVAKKHFATASNGDVRSALNALELAVISSEPNEDGVIHITLDVAEECLQKKSLAHDKDGDAHYDVLSAFQKSVRGSDVNAALHYMGRLIEAGDLVSISRRMLVMAYEDIGLASPQAGAHTLAAIQTAEKVGFPEARIPLANAVIELCLSPKSNSAIMAIDAALADIRQGKSGEVPDHLRDGHYSVAEKLGRAIDYKYPHNYDNAWVDQQYLPDRLKNKLYYEPKFTSKFEQTIAGVYQKINENKAK 425
>gi|168265988|ref|ZP_02687953.1| recombination factor protein RarA [Listeria monocytogenes FSL J2-071] (437 aa)
Score = 707, Expect = 1.5e-72, Identities = 157/391 (40%), Positives = 237/391 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDF--------RQIFFYLKIVLKYYQNKSDDI------VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLN-VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           + DE++ +  +  KD II  M++   L S++ +G PG+GK++    I       F   N+ TNNK D+  +   A      I++++E+HRL+K KQD LL  LE   II++  TT NP+  +NPAIRSR  ++ ++ +    +   + + L +K+  L N  VE I E++K  F        R     L++ +   +   D +      V +E  +  +   D+    HYD+LSAF KS+RGSD NAA++Y+ +L+E+GDL+S+ RR+  + YEDIGLA+   G    AA+  +E +G PEARIPL+   IELCLSPKSNSAIMAID A+  + +  +   P+HLRD HY+ A KL     YKYPH+Y+ ++V+Q+YLP  L+NK +Y P   S+ E      + KI
  S:    14 ALDEIVGQTHLVGKDKIIYRMVKAKQLSSMILYGPPGIGKTSIASAIAGSTKYAFRTLNAVTNNKKDMEVVAAEAKMSGTVILLLDEVHRLDKAKQDFLLPLLESGAIILIGATTSNPYIAINPAIRSRTQIFELKPLTVEDIMITMDRALSDKERGLGNYDVE-IDEVAKKHFATASNGDVRSALNALELAVISSEPNEDGVIHITLDVAEECLQKKSLAHDKDGDAHYDVLSAFQKSVRGSDVNAALHYMGRLIEAGDLVSISRRMLVMAYEDIGLASPQAGAHTLAAIQTAEKVGFPEARIPLANAVIELCLSPKSNSAIMAIDAALADIRQGNSGEVPDHLRDGHYSGAEKLGRAIDYKYPHNYDNAWVDQQYLPDRLENKLYYAPKFTSKFEQTIAGVYQKI 419
>gi|87126144|gb|ABD20658.1| ATPase, AAA family [Staphylococcus aureus subsp. aureus USA300_FPR3757] (391 aa)
Score = 705, Expect = 3.0e-72, Identities = 154/371 (41%), Positives = 228/371 (61%)
  Q:    33 MIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           M++   L S++F+G PG+GK++  + I       F   N+ TN K D+  ++E A    + I++++EIHRL+K KQD LL +LE   I+++  TT NP+  +NPAIRSR  ++ +  +N   +++ + + +E+        + K+    +      S+ D R     L++ +    N  D      L    + L       D+    HYD++SAF KSIRGSD NAA++YLA+L+E+GDL ++ RRL  + YEDIGLA+   G +  AA+ ++E LGLPEARIPLSQ  IELCLSPKSNSA+ AID A+  + N      PNHL+D HY  A  L    GYKYPH Y   YV Q+YLP +LKNK +Y+P   S++E +  + +N +
  S:     1 MVDTKKLTSMIFYGPPGIGKTSIAKAISGSTQYKFRQLNAVTNTKKDMQLVVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGKIVLIGATTSNPYHAINPAIRSRAQIFELYPLNDEDVRQALTRAIEDDENGLKTYQPKIDEDAMTYFSTQSQGDVRSALNALELAVLSADNDKDGYRHVTLQDAKDCLQKGAFVSDKDGDMHYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDIGLASPNAGQRTLAAIESAERLGLPEARIPLSQAVIELCLSPKSNSAMSAIDSALSDIRNGHVGQIPNHLKDGHYQGAKDLGRSIGYKYPHQYVNGYVSQQYLPDKLKNKIYYEPKTTSKSEQQLKEIYNNL 386
>gi|157693158|ref|YP_001487620.1| recombination factor protein RarA [Bacillus pumilus SAFR-032] >gi|157681916|gb|ABV63060.1| crossover junction endodeoxyribonuclease ATPase [Bacillus pumilus SAFR-032] (421 aa)
Score = 704, Expect = 3.6e-72, Identities = 154/390 (39%), Positives = 240/390 (61%)
  Q:    15 DEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYYQNKSDDIVL-----KELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           +++I ++ +  +  II  M+E   L S++ +G PG+GK++    I    +  F   N+  +NK D+  +   A    + I+I++E+HRL+K KQD LL YLE  MII++  TT NP+  +NPAIRSR  ++ ++ + +  +K  + + L+++       +V + ++ +         D R     L++ VL    +++  IV+     +E  +  +   D+    HYD+LSAF KSIRGSD +AA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+V +AV  +E +G PEARIPL+   IELCLSPKSNSA  AID A+  +    +   P HL+DAHY  A  L  +G  Y YPHDY   +V+Q+YLP  LKNK++Y+P +  + E      +  +K
  S:    14 EDIIGQEHLVGEGQIIRRMVEAKHLSSMILYGPPGIGKTSIATAIAGSTSIAFRTLNAVIHNKKDMEAVAAEAKMSGQVILILDEVHRLDKGKQDFLLPYLENGMIILIGATTANPYHAINPAIRSRTQIFELKPLETEQIKAALTRALQDEHRGLGGYEVTVDDEAMHHFANGCGGDVRSALNALELAVLSTKADEAGHIVITLAAAEECLQKKSFSHDKNGDAHYDVLSAFQKSIRGSDADAALHYLARLIEAGDLESISRRLLVMAYEDIGLASPQAGPRVLSAVQTAERVGFPEARIPLANAVIELCLSPKSNSAYKAIDAALGDIRSGKIGEIPVHLKDAHYKGATALG-RGVDYLYPHDYENGWVKQQYLPDPLKNKQYYEPKQTGKFEGALKQVYENLK 418
>gi|57867117|ref|YP_188766.1| recombination factor protein RarA [Staphylococcus epidermidis RP62A] >gi|57637775|gb|AAW54563.1| ATPase, AAA family [Staphylococcus epidermidis RP62A] (423 aa)
Score = 704, Expect = 4.0e-72, Identities = 156/393 (39%), Positives = 246/393 (62%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSN-------KVVEAIVEISKSDFRQIFFYLKI-VLKYYQNKSDD--IVLKELGKITNS---LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLN-VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKS 405
           + DE+I +  +     II  M++   L S++F+G PG+GK++  + I       F   N+ TN K D+  I+E A    + I++++EIHRL+K KQD LL +LE   I+++  TT NP+  +NPAIRSR  ++ +  ++   ++  + + + +K+  LS          +E     S+ D R     L++ VL  +  + ++  I L +          + D+    HYD++SAF KSIRGSD NAA++YLA+L+E+GDL ++ RRL  + YED+GLA+   G +  AA+ ++E LG PEARIPLSQ  IELCLSPKSNS I AID+A+  + N      P++L+D HY+ A KL    GYKYPH+Y   +V Q+YLP++LKN+ +Y+P   S++E +F   ++ +++
  S:    14 NIDEIISQQHLVGPKGIIRRMVDTKRLSSMIFYGPPGIGKTSIAKAISGSTQFKFRQLNAVTNTKKDMQLIVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGKIVLIGATTSNPYHAINPAIRSRAQIFELYPLDQDDIRLALDRAINDKERGLSTYHPIVDEDAIEYFSTQSQGDVRSALNALELAVLSAHIGEENERHITLDDAKDCLQKGAFVSDKDGDMHYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDVGLASPNAGQRTLAAIQSAERLGFPEARIPLSQAVIELCLSPKSNSGITAIDKALGDIRNGHIGQIPDYLKDGHYSGAKKLGRAIGYKYPHNYENGHVVQQYLPEKLKNRVYYEPKTTSKSEQQFKTIYDNLRN 421
>gi|27468227|ref|NP_764864.1| recombination factor protein RarA [Staphylococcus epidermidis ATCC 12228] >gi|27315773|gb|AAO04908.1|AE016748_142 conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] (426 aa)
Score = 702, Expect = 6.2e-72, Identities = 156/393 (39%), Positives = 246/393 (62%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSN-------KVVEAIVEISKSDFRQIFFYLKI-VLKYYQNKSDD--IVLKELGKITNS---LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLN-VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKS 405
           + DE+I +  +     II  M++   L S++F+G PG+GK++  + I       F   N+ TN K D+  I+E A    + I++++EIHRL+K KQD LL +LE   I+++  TT NP+  +NPAIRSR  ++ +  ++   ++  + + + +K+  LS          +E     S+ D R     L++ VL  +  + ++  I L +          + D+    HYD++SAF KSIRGSD NAA++YLA+L+E+GDL ++ RRL  + YED+GLA+   G +  AA+ ++E LG PEARIPLSQ  IELCLSPKSNS I AID+A+  + N      P++L+D HY+ A KL    GYKYPH+Y   +V Q+YLP++LKN+ +Y+P   S++E +F   ++ +++
  S:    17 NIDEIISQQHLVGPKGIIRRMVDTKRLSSMIFYGPPGIGKTSIAKAISGSTQFKFRQLNAVTNTKKDMQLIVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGKIVLIGATTSNPYHAINPAIRSRAQIFELYPLDQDDIRLALDRAINDKERGLSTYHPIVDEDAIEYFSTQSQGDVRSALNALELAVLSAHIGEENERHITLDDAKDCLQKGAFVSDKDGDMHYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDVGLASPNAGQRTLAAIQSAERLGFPEARIPLSQAVIELCLSPKSNSGITAIDKALGDIRNGHIGQIPDYLKDGHYSGAKKLGRAIGYKYPHNYENGHVVQQYLPEKLKNRVYYEPKTTSKSEQQFKTIYDNLRN 424
>gi|116872943|ref|YP_849724.1| recombination factor protein RarA [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741821|emb|CAK20945.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (427 aa)
Score = 701, Expect = 9.1e-72, Identities = 155/397 (39%), Positives = 238/397 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIE---------NINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI------VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLN-VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           + DE++ +  +  KD II  M++   L S++ +G PG+GK++    I       F   N+ TNNK D+  +   A      I++++E+HRL+K KQD LL  LE   II++  TT NP+  +NPAIRSR  ++ ++          ++ A+L +E  + L N +V++     +     S  D R     L++ +   +   + I      V +E  +  +   D+    HYD+LSAF KS+RGSD NAA++Y+ +L+E+GDL+S+ RR+  + YED+GLAN   G    AA+  +E +G PEARIPL+   IELCLSPKSNSAI AID A+  + +  +   P+HLRD HY+ A KL     YKYPH+Y+ ++V+Q+YLP  L+NK +Y+P   S+ E      + KI  N  +
  S:    14 ALDEIVGQTHLVGKDKIIYRMVKAKQLSSMILYGPPGIGKTSIASAIAGSTKYAFRTLNAVTNNKKDMEVVAAEAKMSGTVILLLDEVHRLDKAKQDFLLPLLESGAIILIGATTSNPYIAINPAIRSRTQIFELKPLTVEDIMITMDRALLDKE--RGLGNYQVEIDEFAKKHFATASNGDVRSALNALELAVISSEANEEGIIHITLDVAEECLQKKSLAHDKDGDAHYDVLSAFQKSVRGSDVNAALHYMGRLIEAGDLVSISRRMLVMAYEDVGLANPQAGAHTLAAIQTAEKVGFPEARIPLANAVIELCLSPKSNSAISAIDAALADIRQGNSGEVPDHLRDGHYSGAQKLGRAIDYKYPHNYDNAWVDQQYLPDRLQNKLYYEPKFTSKFEQTIAGVYQKINENKSK 425
>gi|42783528|ref|NP_980775.1| recombination factor protein RarA [Bacillus cereus ATCC 10987] >gi|42739457|gb|AAS43383.1| ATPase, AAA family [Bacillus cereus ATCC 10987] (428 aa)
Score = 699, Expect = 1.3e-71, Identities = 152/396 (38%), Positives = 244/396 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYY--QNKSDDIVLK---ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           +  E+I +  +  +  I+  M++ N   S++ +G PG GK++    I       F   N+ T+NK D+  +++ A      ++I++E+HRL+K KQD LL +LE  ++ ++  TT NPF  +N AIRSR  ++ +  +    L   + + LE+K+       V ++ + +      S  D R  +  L++ VL  +   +K+ +I L+   E  +  + + D+    HYD+LSAF KS+RGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+  AA+ ++E +G PEARIPL+   IELCLSPKSNSA  A+D A+  + N +    P+HL+D+HY  A  L    GY YPHD+   +V+Q+YLP ++KNK++YKP    + E      + +++S+NK
  S:    13 NIQEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIAGSTGTPFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLLTLIGATTSNPFHAINSAIRSRCQIFELHALTEDDLLIGLKRALEDKEKGLGEYDVTVTPEALHHFANASGGDMRSAYNALELAVLSSFTTDDKAAEITLEIAEECLQKKSFVHDKGGDAHYDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSIGRRLLIMAYEDIGLASPQAGPRTLAAIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNGQTGDIPSHLKDSHYKGAEALGRGIGYLYPHDHPNGWVQQQYLPDKIKNKQYYKPKMTGKFEQALSTVYERLQSSNK 423
>gi|194017275|ref|ZP_03055887.1| crossover junction endodeoxyribonuclease ATPase [Bacillus pumilus ATCC 7061] >gi|194011143|gb|EDW20713.1| crossover junction endodeoxyribonuclease ATPase [Bacillus pumilus ATCC 7061] (421 aa)
Score = 699, Expect = 1.4e-71, Identities = 158/390 (40%), Positives = 237/390 (60%)
  Q:    15 DEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV----EAIVEISKS---DFRQIFFYLKIVLKYYQNKSDDI--VLKELGKITNSLI------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           +++I ++ +  +  II  M+E   L S++ +G PG+GK++    I    +  F   N+  +NK D+  +   A    + I+I++E+HRL+K KQD LL YLE  MII++  TT NP+  +NPAIRSR  ++ ++ + +  +K  + + L+++   L    V    EA+   S     D R     L++ +     K+DD   ++  L      L       D+    HYD+LSAF KSIRGSD +AA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+V +AV  +E +G PEARIPL+   IELCLSPKSNSA  AID A+  +    +   P HL+DAHY  A  L  +G  Y YPHDY   +V+Q+YLP  LKNK++Y+P +  + E      +  +K
  S:    14 EDIIGQEHLVGEGQIIKRMVEAKHLSSMILYGPPGIGKTSIATAIAGSTSIAFRTLNAVIHNKKDMEAVAAEAKMSGQVILILDEVHRLDKGKQDFLLPYLENGMIILIGATTANPYHVINPAIRSRTQIFELKPLETEQIKAALTRALQDEHRGLGGYEVTVDDEAMNHFSNGCGGDVRSALNALELAV--LSTKADDAGHIMITLAAAEECLQKKSFSHDKNGDAHYDVLSAFQKSIRGSDADAALHYLARLIEAGDLESISRRLLVMAYEDIGLASPQAGPRVLSAVQTAERVGFPEARIPLANAVIELCLSPKSNSAYKAIDAALGDIRSGKIGEIPVHLKDAHYKGATALG-RGVDYLYPHDYENGWVKQQYLPDPLKNKQYYEPKQTGKFEGALKQVYENLK 418
>gi|152976813|ref|YP_001376330.1| recombination factor protein RarA [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152025565|gb|ABS23335.1| AAA ATPase central domain protein [Bacillus cereus subsp. cytotoxis NVH 391-98] (428 aa)
Score = 699, Expect = 1.5e-71, Identities = 148/396 (37%), Positives = 243/396 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYY--QNKSDDIVLK---ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           +  E+I +  +  +  I+  M++ N   S++ +G PG GK++    I       F   N+ T+NK D+  +++ A      ++I++E+HRL+K KQD LL +LE  ++ ++  TT NPF  +N AIRSR  ++ +  +    +   + + L +K+       V ++++ +      S  D R  +  L++ VL  +    ++ +I L+   E  +  + + D+    HYD+LSAF KS+RGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+  AA+ ++E +G PEARIPL+   IELCLSPKSNSA  A+D A+  + N +    PNHL+D+HY  A  L    GY YPHDY   ++EQ+YLP ++KNK++Y+P    + E      + ++++++K
  S:    13 NISEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIAGSTGTPFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLLTLIGATTSNPFHAINSAIRSRCQIFELHALTEDDILTGLKRALADKEKGLGEYHVTVTDEAIRHFASASGGDMRSAYNALELAVLSSFATDEQAGEITLEIAEECLQKKSFVHDKDGDAHYDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSICRRLLIMAYEDIGLASPQAGPRTLAAIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNGQTGDIPNHLKDSHYKGAESLGRGIGYLYPHDYPNGWIEQQYLPDKIKNKQYYRPKTTGKFEQALSTVYERLQNSHK 423
>gi|52141108|ref|YP_085721.1| recombination factor protein RarA [Bacillus cereus E33L] >gi|51974577|gb|AAU16127.1| ATPase, AAA family [Bacillus cereus E33L] (428 aa)
Score = 697, Expect = 2.3e-71, Identities = 153/396 (38%), Positives = 243/396 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYY--QNKSDDIVLK---ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           +  E+I +  +  +  I+  M++ N   S++ +G PG GK++    I       F   N+ T+NK D+  +++ A      ++I++E+HRL+K KQD LL +LE  ++ ++  TT NPF  +N AIRSR  ++ +  +    L   + + LE+K+       V ++ + +      S  D R  +  L++ VL  +   +K+ +I L+   E  +  + + D+    HYD+LSAF KS+RGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+  AA+ ++E +G PEARIPL+   IELCLSPKSNSA  A+D A+  + N +    P+HL+D+HY  A  L    GY YPHD    +V+Q+YLP ++KNK++YKP    + E      + K++S+NK
  S:    13 NIQEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIAGSTGTPFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLLTLIGATTSNPFHAINSAIRSRCQIFELHALTEDDLLIGLKRALEDKEKGLGEYDVTVTPEALHHFANASGGDMRSAYNALELAVLSSFTTDDKAAEITLEIAEECLQKKSFVHDKGGDAHYDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSISRRLLIMAYEDIGLASPQAGPRTLAAIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNGQTGDIPSHLKDSHYKGAEALGRGIGYLYPHDQPNGWVQQQYLPDKIKNKQYYKPKTTGKFEQALSTVYEKLQSSNK 423
>gi|30264469|ref|NP_846846.1| recombination factor protein RarA [Bacillus anthracis str. Ames] >gi|47529927|ref|YP_021276.1| recombination factor protein RarA [Bacillus anthracis str. 'Ames Ancestor'] >gi|49187290|ref|YP_030542.1| recombination factor protein RarA [Bacillus anthracis str. Sterne] >gi|65321766|ref|ZP_00394725.1| COG2256: ATPase related to the helicase subunit of the Holliday junction resolvase [Bacillus anthracis str. A2012] >gi|167636495|ref|ZP_02394792.1| ATPase, AAA family [Bacillus anthracis str. A0442] >gi|167638625|ref|ZP_02396901.1| ATPase, AAA family [Bacillus anthracis str. A0193] >gi|170689631|ref|ZP_02880813.1| ATPase, AAA family [Bacillus anthracis str. A0465] >gi|177653256|ref|ZP_02935508.1| ATPase, AAA family [Bacillus anthracis str. A0174] >gi|190566921|ref|ZP_03019837.1| ATPase, AAA family [Bacillus anthracis Tsiankovskii-I] >gi|30259127|gb|AAP28332.1| ATPase, AAA family [Bacillus anthracis str. Ames] >gi|47505075|gb|AAT33751.1| ATPase, AAA family [Bacillus anthracis str. 'Ames Ancestor'] >gi|49181217|gb|AAT56593.1| ATPase, AAA family [Bacillus anthracis str. Sterne] >gi|167513473|gb|EDR88843.1| ATPase, AAA family [Bacillus anthracis str. A0193] >gi|167528088|gb|EDR90885.1| ATPase, AAA family [Bacillus anthracis str. A0442] >gi|170666401|gb|EDT17182.1| ATPase, AAA family [Bacillus anthracis str. A0465] >gi|172081538|gb|EDT66610.1| ATPase, AAA family [Bacillus anthracis str. A0174] >gi|190561912|gb|EDV15881.1| ATPase, AAA family [Bacillus anthracis Tsiankovskii-I] (428 aa)
Score = 697, Expect = 2.3e-71, Identities = 152/396 (38%), Positives = 243/396 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYY--QNKSDDIVLK---ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           +  E+I +  +  +  I+  M++ N   S++ +G PG GK++    I       F   N+ T+NK D+  +++ A      ++I++E+HRL+K KQD LL +LE  ++ ++  TT NPF  +N AIRSR  ++ +  +    L   + + LE+K+       V ++ + +      S  D R  +  L++ VL  +   +K+ +I L+   E  +  + + D+    HYD+LSAF KS+RGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+  AA+ ++E +G PEARIPL+   IELCLSPKSNSA  A+D A+  + N +    P+HL+D+HY  A  L    GY YPHD    +V+Q+YLP ++KNK++YKP    + E      + +++S+NK
  S:    13 NIQEVIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIAGSTGTPFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLLTLIGATTSNPFHAINSAIRSRCQIFELHALTEEDLLIGLKRALEDKEKGLGEYDVTVTPEALHHFANASGGDMRSAYNALELAVLSSFTTDDKAAEITLEIAEECLQKKSFVHDKGGDAHYDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSIGRRLLIMAYEDIGLASPQAGPRTLAAIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNGQTGDIPSHLKDSHYKGAEALGRGIGYLYPHDQPNGWVQQQYLPDKIKNKQYYKPKTTGKFEQALSTVYERLQSSNK 423
>gi|49481747|ref|YP_038449.1| recombination factor protein RarA [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|196034307|ref|ZP_03101716.1| ATPase, AAA family [Bacillus cereus W] >gi|196039170|ref|ZP_03106476.1| ATPase, AAA family [Bacillus cereus NVH0597-99] >gi|49333303|gb|AAT63949.1| ATPase, AAA family [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|195992849|gb|EDX56808.1| ATPase, AAA family [Bacillus cereus W] >gi|196029797|gb|EDX68398.1| ATPase, AAA family [Bacillus cereus NVH0597-99] (428 aa)
Score = 696, Expect = 2.9e-71, Identities = 152/396 (38%), Positives = 243/396 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYY--QNKSDDIVLK---ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           +  E+I +  +  +  I+  M++ N   S++ +G PG GK++    I       F   N+ T+NK D+  +++ A      ++I++E+HRL+K KQD LL +LE  ++ ++  TT NPF  +N AIRSR  ++ +  +    L   + + LE+K+       V ++ + +      S  D R  +  L++ VL  +   +K+ +I L+   E  +  + + D+    HYD+LSAF KS+RGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+  AA+ ++E +G PEARIPL+   IELCLSPKSNSA  A+D A+  + N +    P+HL+D+HY  A  L    GY YPHD    +V+Q+YLP ++KNK++YKP    + E      + +++S+NK
  S:    13 NIQEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIAGSTGTPFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLLTLIGATTSNPFHAINSAIRSRCQIFELHALTEEDLLIGLKRALEDKEKGLGEYDVTVTPEALHHFANASGGDMRSAYNALELAVLSSFTTDDKAAEITLEIAEECLQKKSFVHDKGGDAHYDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSIGRRLLIMAYEDIGLASPQAGPRTLAAIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNGQTGDIPSHLKDSHYKGAEALGRGIGYLYPHDQPNGWVQQQYLPDKIKNKQYYKPKTTGKFEQALSTVYERLQSSNK 423
>gi|168161176|ref|ZP_02596409.1| recombination factor protein RarA [Bacillus cereus H3081.97] (428 aa)
Score = 696, Expect = 3.0e-71, Identities = 152/396 (38%), Positives = 243/396 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYY--QNKSDDIVLK---ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           +  E+I +  +  +  I+  M++ N   S++ +G PG GK++    I       F   N+ T+NK D+  +++ A      ++I++E+HRL+K KQD LL +LE  ++ ++  TT NPF  +N AIRSR  ++ +  +    L   + + LE+K+       V ++ + +      S  D R  +  L++ VL  +   +K+ +I L+   E  +  + + D+    HYD+LSAF KS+RGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+  AA+ ++E +G PEARIPL+   IELCLSPKSNSA  A+D A+  + N +    P+HL+D+HY  A  L    GY YPHD+   +V Q+YLP ++KNK++YKP    + E      + +++S+NK
  S:    13 NIQEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIAGSTGTPFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLLTLIGATTSNPFHAINSAIRSRCQIFELHALTEDDLLIGLKRALEDKEKGLGEYDVTVTPEALHHFANASGGDMRSAYNALELAVLSSFTTDDKAAEITLEIAEECLQKKSFVHDKGGDAHYDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSIGRRLLIMAYEDIGLASPQAGPRTLAAIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNGQTGDIPSHLKDSHYKGAEALGRGIGYLYPHDHPNGWVPQQYLPDKIKNKQYYKPKMTGKFEQALSTVYERLQSSNK 423
>gi|166996043|ref|ZP_02262503.1| recombination factor protein RarA [Bacillus cereus AH820] (428 aa)
Score = 696, Expect = 3.6e-71, Identities = 152/396 (38%), Positives = 243/396 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYY--QNKSDDIVLK---ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           +  E+I +  +  +  I+  M++ N   S++ +G PG GK++    I       F   N+ T+NK D+  +++ A      ++I++E+HRL+K KQD LL +LE  ++ ++  TT NPF  +N AIRSR  ++ +  +    L   + + LE+K+       V ++ + +      S  D R  +  L++ VL  +   +K+ +I L+   E  +  + + D+    HYD+LSAF KS+RGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+  AA+ ++E +G PEARIPL+   IELCLSPKSNSA  A+D A+  + N +    P+HL+D+HY  A  L    GY YPHD    +V+Q+YLP ++KNK++YKP    + E      + +++S+NK
  S:    13 NIQEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIAGSTGTPFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLLTLIGATTSNPFHAINSAIRSRCQIFELHALTEDDLLIGLKRALEDKEKGLGEYDVTVTPEALHHFANASGGDMRSAYNALELAVLSSFTTDDKAAEITLEIAEECLQKKSFVHDKGGDAHYDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSIGRRLLIMAYEDIGLASPQAGPRTLAAIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNGQTGDIPSHLKDSHYKGAEALGRGIGYLYPHDQPNGWVQQQYLPDKIKNKQYYKPKTTGKFEQALSTVYERLQSSNK 423
>gi|162382774|ref|YP_896708.2| recombination factor protein RarA [Bacillus thuringiensis str. Al Hakam] >gi|196044812|ref|ZP_03112046.1| ATPase, AAA family [Bacillus cereus 03BB108] >gi|196024300|gb|EDX62973.1| ATPase, AAA family [Bacillus cereus 03BB108] (426 aa)
Score = 696, Expect = 3.6e-71, Identities = 152/396 (38%), Positives = 243/396 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYY--QNKSDDIVLK---ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           +  E+I +  +  +  I+  M++ N   S++ +G PG GK++    I       F   N+ T+NK D+  +++ A      ++I++E+HRL+K KQD LL +LE  ++ ++  TT NPF  +N AIRSR  ++ +  +    L   + + LE+K+       V ++ + +      S  D R  +  L++ VL  +   +K+ +I L+   E  +  + + D+    HYD+LSAF KS+RGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+  AA+ ++E +G PEARIPL+   IELCLSPKSNSA  A+D A+  + N +    P+HL+D+HY  A  L    GY YPHD    +V+Q+YLP ++KNK++YKP    + E      + +++S+NK
  S:    13 NIQEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIAGSTGTPFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLLTLIGATTSNPFHAINSAIRSRCQIFELHALTEDDLLIGLKRALEDKEKGLGEYDVTVTPEALHHFANASGGDMRSAYNALELAVLSSFTTDDKAAEITLEIAEECLQKKSFVHDKGGDAHYDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSIGRRLLIMAYEDIGLASPQAGPRTLAAIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNGQTGDIPSHLKDSHYKGAEALGRGIGYLYPHDQPNGWVQQQYLPDKIKNKQYYKPKTTGKFEQALSTVYERLQSSNK 423
>gi|166983175|ref|ZP_02254593.1| recombination factor protein RarA [Bacillus cereus AH187] (428 aa)
Score = 695, Expect = 4.0e-71, Identities = 152/396 (38%), Positives = 242/396 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYY--QNKSDDIVLK---ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           +  E+I +  +  +  I+  M++ N   S++ +G PG GK++    I       F   N+ T+NK D+  +++ A      ++I++E+HRL+K KQD LL +LE  ++ ++  TT NPF  +N AIRSR  ++ +  +    L   + + LE+K+       V ++ + +      S  D R  +  L++ VL  +   +K+ +I L+   E  +    + D+    HYD+LSAF KS+RGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+  AA+ ++E +G PEARIPL+   IELCLSPKSNSA  A+D A+  + N +    P+HL+D+HY  A  L    GY YPHD+   +V Q+YLP ++KNK++YKP    + E      + +++S+NK
  S:    13 NIQEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIAGSTGTPFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLLTLIGATTSNPFHAINSAIRSRCQIFELHALTEDDLLIGLKRALEDKEKGLGEYDVTVTPEALHHFANASGGDMRSAYNALELAVLSSFTTDDKAAEITLEIAEECLQKKRFVHDKGGDAHYDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSIGRRLLIMAYEDIGLASPQAGPRTLAAIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNGQTGDIPSHLKDSHYKGAEALGRGIGYLYPHDHPNGWVPQQYLPDKIKNKQYYKPKMTGKFEQALSTVYERLQSSNK 423
>gi|56963348|ref|YP_175079.1| recombination factor protein RarA [Bacillus clausii KSM-K16] >gi|56909591|dbj|BAD64118.1| AAA family ATPase [Bacillus clausii KSM-K16] (420 aa)
Score = 695, Expect = 4.7e-71, Identities = 149/390 (38%), Positives = 237/390 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISK-------SDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNK 402
           S +E+I +  +  +  ++  MI+ N L S++ +G PG GK++  + I      +F   N+T ++K D+   +E A      ++I++E+HRL+K KQD LL +LE  +++++  TT NP+  +NPAIRSR  ++ +E +    +++ + + L +++  L ++ ++   E  +        D R     L++ +     + D      L     S+       D+    HYD+LSAF KSIRGSD NA+++YLA+LLE+GDLIS++RRL  + YEDI LAN   GP+  AA+ ASE LGLPEARIPL+   +EL LSPKSNSA  A+D AI ++ K      P HL+DAHY  A +L     YKYPHDY   +V+Q+YLP ++ +  +Y+P +  + E    + + +
  S:    14 SVEEVIGQHSLLGEGMMLSRMIKANQLSSMVLYGPPGTGKTSIARAIAGSSGMHFRMLNATVHHKKDMETAVEEAKMYGSLLLILDEVHRLDKAKQDFLLPHLESGLLLLIGATTANPYHSINPAIRSRCHIFELEQLEPDDIEKALRRALADEERGLGHEKIDIAPEALRHLALACGGDVRAALNALELAVLSTPKQPDGTRSVTLRSAEQSIQKKSIQHDKDGDAHYDVLSAFQKSIRGSDVNASLHYLARLLEAGDLISIHRRLLVIAYEDISLANPQAGPRTLAAIEASERLGLPEARIPLANAVVELALSPKSNSAYKALDAAIDALRKGGSGEVPRHLKDAHYKGAQQLGRGSDYKYPHDYKDGWVKQQYLPDKIADHRYYEPKQTGKFEQALSEMYKR 418
>gi|168140391|ref|ZP_02583620.1| recombination factor protein RarA [Bacillus cereus G9842] (428 aa)
Score = 694, Expect = 5.5e-71, Identities = 149/396 (37%), Positives = 244/396 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYY--QNKSDDIVLK---ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           +  E+I +  +  +  I+  M++ N   S++ +G PG GK++    I       F   N+ T+NK D+  +++ A      ++I++E+HRL+K KQD LL +LE  ++ ++  TT NPF  +N AIRSR  ++ +  +    +   + + LE+K+       V ++++ +      S  D R  +  L++ VL  +   +++ +I L+   E  +  + + D+    HYD+LSAF KS+RGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+  AA+ ++E +G PEARIPL+   IELCLSPKSNSA  A+D A+  + N +    P+HL+D+HY  A  L    GY YPHD+   +V Q+YLP ++KNK++YKP    + E      + +++++NK
  S:    13 NIQEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIAGSTGTPFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLLTLIGATTSNPFHAINSAIRSRCQIFELHALTEDDILIGLKRALEDKEKGLGEYAVTITDEALHHFTNASGGDMRSAYNALELAVLSSFTTDDQAAEITLEIAEECLQKKSFVHDKGGDAHYDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSIGRRLLIMAYEDIGLASPQAGPRTLAAIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNDQTGDIPSHLKDSHYKGAESLGRGIGYLYPHDHPNGWVRQQYLPDKIKNKQYYKPKTTGKFEQALSTVYERLQTSNK 423
>gi|171778879|ref|ZP_02919941.1| hypothetical protein STRINF_00800 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282525|gb|EDT47949.1| hypothetical protein STRINF_00800 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (422 aa)
Score = 694, Expect = 5.7e-71, Identities = 158/381 (41%), Positives = 239/381 (62%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKE--LGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + D++I +  +  +  II  M+E N L S++ +G PG+GK++    I       F  FN+TT++K  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E +++  +K+ +   L +K+      V +    ++ I   +  D R  F  L + +     K+DD  ++   L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA  AID+AI  ++K    P P HLRD HYA + +L N + YKYPH+Y   +V+Q+YLP +L  K ++ PN+  + E
  S:    13 NIDQVIGQKHLVGEGKIIRRMVEANKLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATTDSKKRLQEIAEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLENGNIIMIGATTENPFFSVTPAIRSRVQIFELEPLSTDDIKQALQTALSDKERGFEFDVDIDADALDFIATATNGDLRSAFNSLDLAV--MSTKADDKGIRHINLDTVENSLQRSYITMDKNGDGHYDVLSALQKSIRGSDVNASLHYAARLIEAGDLPSLARRLTVIAYEDIGLANPDAQIHTVTALDAAQKIGFPEARILIANVVIDLALSPKSNSAYTAIDKAIADLHKNGSLPIPRHLRDGHYAGSKELGNAQDYKYPHNYPEKWVKQQYLPDKLVGKNYFDPNQTGKYE 407
>gi|167938901|ref|ZP_02525976.1| recombination factor protein RarA [Bacillus cereus AH1134] (428 aa)
Score = 693, Expect = 6.3e-71, Identities = 149/396 (37%), Positives = 244/396 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYY--QNKSDDIVLK---ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           +  E+I +  +  +  I+  M++ N   S++ +G PG GK++    I       F   N+ T+NK D+  +++ A      ++I++E+HRL+K KQD LL +LE  ++ ++  TT NPF  +N AIRSR  ++ +  +    +   + + LE+K+       V ++++ +      S  D R  +  L++ VL  +   +++ +I L+   E  +  + + D+    HYD+LSAF KS+RGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+  AA+ ++E +G PEARIPL+   IELCLSPKSNSA  A+D A+  + N +    P+HL+D+HY  A  L    GY YPHD+   +V Q+YLP ++KNK++YKP    + E      + +++++NK
  S:    13 NIQEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIAGSTGTPFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLLTLIGATTSNPFHAINSAIRSRCQIFELHALTEDDILIGLKRALEDKEKGLGEYAVTVTDEALHHFANASGGDMRSAYNALELAVLSSFTTDDQAAEITLEIAEECLQKKSFVHDKGGDAHYDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSIGRRLLIMAYEDIGLASPQAGPRTLAAIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNGQTGDIPSHLKDSHYKGAESLGRGIGYLYPHDHPNGWVRQQYLPDKIKNKQYYKPKTTGKFEQALSTVYERLQTSNK 423
>gi|184154931|ref|YP_001843271.1| ATPase [Lactobacillus fermentum IFO 3956] >gi|183226275|dbj|BAG26791.1| ATPase [Lactobacillus fermentum IFO 3956] (430 aa)
Score = 693, Expect = 7.7e-71, Identities = 155/391 (39%), Positives = 236/391 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           + DE++ +  +     II  M+E   L S++ +G PG GK++    I       F   N+ T++K DL  + E A      I++++EIHRL+K KQD LL +LE   I+++  TTENP+  +NPAIRSR  ++ ++ + +A +   + + L++ +       + L +     ++  +  D R     L++  +     SD  +   L  I  S+       D+    HYD++SAF KSIRGSD +AA++YLAQL+ +GDL+S+ RRL  + YEDIGLAN     +   AV A+E +G PEARIPL+   IELCLSPKSNSAI AID A+  VN+  + + P+HL+DAHY  A KL  +G  Y+YPHDY   +V Q+YLP  +KN ++Y+P +    E  F   + ++
  S:    13 TLDEVVGQQHLIGPGKIIWRMVEARMLSSMILYGPPGTGKTSIASAIAGSTKYAFRTLNAATDSKKDLQVVAEEAKMSGTVILLLDEIHRLDKAKQDFLLPHLESGRIVLIGATTENPYIAINPAIRSRAQIFEVKPLTAAEVGLAIDRALKDPQRGLGKLPLVLDDDARTQLITATNGDLRSALNGLELAARSTAPASDGQIYLTLSVIEESVQKRSLVADKDGDGHYDVISAFQKSIRGSDTDAALHYLAQLIAAGDLVSIARRLVVIAYEDIGLANPPAVERAVTAVQAAERIGFPEARIPLANAVIELCLSPKSNSAIDAIDAALARVNQGNSGAVPDHLKDAHYQGAQKLG-RGVTYRYPHDYPEDWVAQQYLPDRIKNDQYYQPKQNGTFERAFAKQYRQL 418
>gi|29376501|ref|NP_815655.1| recombination factor protein RarA [Enterococcus faecalis V583] >gi|29343965|gb|AAO81725.1| ATPase, AAA family [Enterococcus faecalis V583] (425 aa)
Score = 691, Expect = 1.2e-70, Identities = 156/391 (39%), Positives = 236/391 (60%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNH-------YDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKP---NKYSQ---NENKFVDYWNKIK 404
            DE++ +  +     II  M+E   L S++ +G PG GK++    I    N  F   N+ T+ K DL  + E A      I++++EIHRL+K KQD LL +LE   II++  TTENP+  +NPAIRSR  ++ ++ +    +++ + + L +         V L  K ++ +   +  D R     L++ +K    K++   +K    I    + R+A  H       YD++SAF KSIRGSD +AA++YL +L+E+GDL  + RRL  + YEDIGL N     +   AV A+E LG PEARIPL+ + I+LCLSPKSNSA+ AID A+  + + ++   P+HLRDAHYA A +LN   GY+YPH++   +V Q+YLP +LK   +Y+P    KY Q    + K +  W + K
  S:    14 LDEVVGQQHLVGPGKIIRRMVEAKMLSSMILYGPPGTGKTSIASAIAGSTNYAFRMLNAATDTKKDLQIVAEEAKMSGTVILLLDEIHRLDKTKQDFLLPHLENGRIIMIGATTENPYITINPAIRSRTQIFEVKPLTETDIQQAIQEALTDSTRGLGDYPVHLEEKALQHLTRATNGDLRSALNGLELAVKS-TPKNEQGEIKITLPIIEECVQRKALTHVKDGDAHYDVISAFQKSIRGSDVDAALHYLGRLVEAGDLPIICRRLMVIAYEDIGLGNPAAAARTVTAVQAAEKLGFPEARIPLASVVIDLCLSPKSNSAVTAIDAALADIRQGSVGDVPDHLRDAHYAGAKELNRGIGYQYPHNFENGWVNQQYLPDKLKEARYYEPIDIGKYEQALHQQLKRIQEWKQKK 425
>gi|30022475|ref|NP_834106.1| recombination factor protein RarA [Bacillus cereus ATCC 14579] >gi|168135657|ref|ZP_02578886.1| recombination factor protein RarA [Bacillus cereus B4264] >gi|29898033|gb|AAP11307.1| ATPase, AAA family [Bacillus cereus ATCC 14579] (428 aa)
Score = 691, Expect = 1.3e-70, Identities = 148/396 (37%), Positives = 244/396 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYY--QNKSDDIVLK---ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           +  E+I +  +  +  I+  M++ N   S++ +G PG GK++    I       F   N+ T+NK D+  +++ A      ++I++E+HRL+K KQD LL +LE  ++ ++  TT NPF  +N AIRSR  ++ +  +    +   + + LE+K+       V ++++ +      S  D R  +  L++ VL  +   +++ +I L+   E  +  + + D+    HYD+LSAF KS+RGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+  AA+ ++E +G PEARIPL+   IELCLSPKSNSA  A+D A+  + N +    P+HL+D+HY  A  L    GY YPHD+   +V Q+YLP ++K+K++YKP    + E      + +++++NK
  S:    13 NIQEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIAGSTGTPFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLLTLIGATTSNPFHAINSAIRSRCQIFELHALTEEDILIGLKRALEDKEKGLGEYAVTVTDEALHHFANASGGDMRSAYNALELAVLSSFTTDDQAAEITLEIAEECLQKKSFVHDKGGDAHYDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSIGRRLLIMAYEDIGLASPQAGPRTLAAIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNGQTGDIPSHLKDSHYKGAESLGRGIGYLYPHDHPNGWVRQQYLPDKIKSKQYYKPKTTGKFEQALSTVYERLQTSNK 423
>gi|56421102|ref|YP_148420.1| recombination factor protein RarA [Geobacillus kaustophilus HTA426] >gi|56380944|dbj|BAD76852.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426] (431 aa)
Score = 688, Expect = 2.4e-70, Identities = 157/382 (41%), Positives = 227/382 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS-------AVLKEEVI---KYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNH-------YDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNEN 394
           + DE++ +  I    + +  M++   + S+L +G PG GK++    I +   + +   N+T   K ++ E +E A      ++ I+EIHRLNK +QD+LL +LE  ++ ++  TTENPF +VNPAIRSR    +I+ +          +LK  +    + +    V +   ++  I E +  D R     L+  +     +   + + E   I  S    R   H       Y LLSAF KS+RGSD +AA++YLA+LLE GDL SV RRL  + YEDIGLAN  +G KV AAV A+E LGLPEARIPL+ +TIELCLSPKSNSA  A+D AI  V    L   P+HL+DAHY  A  L   +GY YPHDY   +V Q YLP  L+   +Y+P ++ + ++
  S:    16 TIDEIVGQQHIIGPSTPLYKMVKKGHVPSLLLYGEPGTGKTSLAYAIARTAGREWVAINATAAGKKEIEEAVEAARWSGNVVLFIDEIHRLNKAQQDVLLPHLESGLVTLIGATTENPFHEVNPAIRSR--CGQIQQLKPLKPDDLMIILKRALADPERGVGEPPVVIDESLLWRIAEAAGGDARVALSLLEAAVAAADERHGRLYIDE--DIVASCTANRGFTHDKYGDHYYSLLSAFQKSVRGSDADAALHYLARLLEGGDLASVCRRLLVMAYEDIGLANPMMGVKVQAAVEAAERLGLPEARIPLAVVTIELCLSPKSNSAYKALDAAIADVRSGKLGDIPDHLKDAHYKGAAALGRGQGYLYPHDYPNGWVAQAYLPSALEGVRYYEPKEHGEEKH 412
>gi|47566587|ref|ZP_00237409.1| ATPase, AAA family [Bacillus cereus G9241] >gi|47556617|gb|EAL14949.1| ATPase, AAA family [Bacillus cereus G9241] (431 aa)
Score = 688, Expect = 2.5e-70, Identities = 151/394 (38%), Positives = 242/394 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYY--QNKSDDIVLK---ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSN 406
           +  E+I +  +  +  I+  M++ N   S++ +G PG GK++    I       F   N+ T+NK D+  +++ A      I+I++E+HRL+K KQD LL +LE  ++ ++  TT NPF  +N AIRSR  ++ +  +    L   + + LE+K+       V ++ + +      S  D R  +  L++ VL  +   +K+ +I L+   E  +  + + D+    HYD+LSAF KS+RGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+  AA+ ++E +G PEARIPL+   IELCLSPKSNSA  A+D A+  + N +    P+HL+D+HY  A  L    GY YPHD+   +V+Q+YLP ++KNK++YKP    + E      + +++S+
  S:    13 NIQEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIAGSTGTPFRLLNAVTHNKKDMEVVVQEAKMYRHLILILDEVHRLDKAKQDFLLPHLESGLLTLIGATTSNPFHAINSAIRSRCQIFELHALTEDDLLIGLKRALEDKEKGLGEYDVTVTPEALHHFANASGGDMRSAYNALELAVLSSFTTDDKAAEITLEIAEECLQKKSFVHDKGGDAHYDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSIGRRLLIMAYEDIGLASPQAGPRTLAAIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNGQTGDIPSHLKDSHYKGAESLGRGIGYLYPHDHPNGWVKQQYLPDKIKNKQYYKPKTTGKFEQALSTVYERLQSS 421
>gi|193216561|ref|YP_001999803.1| ATPase, related to the helicase subunit of the Holliday junction resolvase [Mycoplasma arthritidis 158L3-1] >gi|193001884|gb|ACF07099.1| ATPase, related to the helicase subunit of the Holliday junction resolvase [Mycoplasma arthritidis 158L3-1] (402 aa)
Score = 688, Expect = 2.9e-70, Identities = 168/392 (42%), Positives = 244/392 (62%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKV--KLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEAL-SPPNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           + D+ +C D    +  +   +I N+D  S +F+G PG GK+     +   L  +F YFN+    K DL+  L+L    NK I+II+EIHRLNKDKQD+LL Y+E D+I + ATTTENP+FKVNPA+RSR  +  I+N +   L +++ K   N ++   LS+++   I   S  D+R     L ++     +K+  + L E+ KI  ++    D     H+D LSAFHKS+RGSDPNAA+YY   L+ESGD   ++RR+    YED+GLAN  L  +V  A++A E LGLPE  +P++   +E+ LSPKSNSA +A    ++ +    L   PNHL+D+ Y+SA KL  +G  Y YPH+++  YV+Q+YLP ELKNK++Y   K    E K  +YW K+K
  S:    13 ALDDFVCND---SQRFLFEKIIANDDFRSFIFYGKPGTGKTTISYILASSLKVSFDYFNAAIEKKEDLVAKLKL----NK-ILIIDEIHRLNKDKQDILLPYIENDLITIYATTTENPYFKVNPALRSRCAIVEIKNPSIDDLSKQLKKIALNNQLDSNLSDEIYHFIASQSNGDYRSAINSLDLISTL--SKTKKLTLDEIKKILPAIQFTGDSNGDAHFDHLSAFHKSLRGSDPNAALYYGFILVESGDFDGLFRRMICAAYEDVGLANPNLPVQVMNAIDAFERLGLPEGYLPIANAILEIALSPKSNSAYLAYHSVLEDLRSGQLFEVPNHLKDSSYSSAKKLK-RGVEYLYPHNFDRHYVKQDYLPSELKNKQYYCSQK-EGFEEKINEYWRKLK 400
>gi|118418782|gb|ABK87201.1| Recombination protein MgsA [Bacillus thuringiensis str. Al Hakam] (474 aa)
Score = 686, Expect = 4.3e-70, Identities = 152/396 (38%), Positives = 243/396 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYY--QNKSDDIVLK---ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           +  E+I +  +  +  I+  M++ N   S++ +G PG GK++    I       F   N+ T+NK D+  +++ A      ++I++E+HRL+K KQD LL +LE  ++ ++  TT NPF  +N AIRSR  ++ +  +    L   + + LE+K+       V ++ + +      S  D R  +  L++ VL  +   +K+ +I L+   E  +  + + D+    HYD+LSAF KS+RGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+  AA+ ++E +G PEARIPL+   IELCLSPKSNSA  A+D A+  + N +    P+HL+D+HY  A  L    GY YPHD    +V+Q+YLP ++KNK++YKP    + E      + +++S+NK
  S:    61 NIQEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIAGSTGTPFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLLTLIGATTSNPFHAINSAIRSRCQIFELHALTEDDLLIGLKRALEDKEKGLGEYDVTVTPEALHHFANASGGDMRSAYNALELAVLSSFTTDDKAAEITLEIAEECLQKKSFVHDKGGDAHYDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSIGRRLLIMAYEDIGLASPQAGPRTLAAIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNGQTGDIPSHLKDSHYKGAEALGRGIGYLYPHDQPNGWVQQQYLPDKIKNKQYYKPKTTGKFEQALSTVYERLQSSNK 471
>gi|116333872|ref|YP_795399.1| recombination factor protein RarA [Lactobacillus brevis ATCC 367] >gi|116099219|gb|ABJ64368.1| Recombination protein MgsA [Lactobacillus brevis ATCC 367] (425 aa)
Score = 685, Expect = 6.7e-70, Identities = 151/390 (38%), Positives = 231/390 (59%)
  Q:    20 KDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRA-------TNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           +D++ P   II  M+    L S++ +G PG GK++    I       F   N+ T++K DL  + E A      I++++EIHRL+K KQD LL +LE   I+++  TTENP+  +NPAIRSR  ++ +  +    +K  + + L + +       + L+ + +  I   +  D R     L++  +     +DD +   L  +  +   R+A         HYD++SAF KSIRGSD +AA++YLAQL+ +GDL ++ RRL  + YEDIG+AN     +   AV A++ LGLPE RIPL+   IELCLSPKS+S I AID A+  V N    + P+HL+DAHYA A KL +   YKYPH++   +V+Q+YLP  LKN E+Y P    + E +    + ++ + N+ 
  S:    22 QDLVAP-GKIIARMVAAKLLSSMILYGPPGTGKTSIASAIAGSTQYAFRKLNAATDSKKDLQIVAEEAKMSGTVILLLDEIHRLDKTKQDFLLPHLESGRIVLIGATTENPYININPAIRSRTQIFEVHPLTPDDIKIALHRALTDTENGLGKLPIDLNTEALNFIAGATNGDLRSALNGLELAAQSTPAANDDRIHITLA-VAEACFQRKALMGDKDGDAHYDVISAFQKSIRGSDTDAALHYLAQLVAAGDLPAICRRLMVIAYEDIGMANLPAAARTVQAVQAAQQLGLPEGRIPLADAVIELCLSPKSDSGISAIDAALADVLNGHNGAVPDHLKDAHYAGAKKLGHGTDYKYPHNFPNDWVKQQYLPDTLKNAEYYHPKTNGRFETQLAQQYRRLLTANRH 425
>gi|58337096|ref|YP_193681.1| recombination factor protein RarA [Lactobacillus acidophilus NCFM] >gi|58254413|gb|AAV42650.1| chromosomal segregation helicase [Lactobacillus acidophilus NCFM] (439 aa)
Score = 684, Expect = 8.3e-70, Identities = 159/395 (40%), Positives = 236/395 (59%)
  Q:    15 DEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYYQNKSDD--------IVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEAL-SPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           DE++ +  +     II  M+E   L S++ +G PG+GK++    I       F   N+ T+ K  L ++ E        I++++EIHRL+K KQD LL  LE   II++  TTENP+  ++PAIRSR  ++ ++ +++    + + + L++        KV+L+    + ++E    D R     L++ VL   Q   D+        I  +E+     + I   D     HYDL+SAF KSIRGSD +AA++YLA+L+ESGDLIS+ RRL  + YEDIGLAN     +   AV A++ +GLPEARIPL+   IEL LSPKSNSAI AID A+  V  + + S P+HL+DAHY+ A KL     Y YPHDY   +V Q+YLP  L   E++ P   S+ E ++   +  +K   K+
  S:    14 DEVVGQQHLIGPGKIIRRMVEARILSSMILYGPPGIGKTSIASAIAGSTKYAFRKLNAATDGKKQLQQVAEEGKMSGTVILLLDEIHRLDKTKQDFLLPLLESGQIILIGATTENPYISISPAIRSRCQIFELKPLSAEDASKAIDRALKDTENGLGKYKVQLTEDARDLLIEKGNGDLRTTLNSLELAVLSTKQELKDNHKDESTILITQQEMADSIQTKIQNFDASGDGHYDLVSAFQKSIRGSDTDAALHYLARLIESGDLISICRRLTVIAYEDIGLANPPAAERAVTAVQAAQMIGLPEARIPLANAVIELALSPKSNSAISAIDAALTDVKTKKIGSIPDHLKDAHYSGAKKLGHGIDYLYPHDYQNDWVPQQYLPNNLTQAEYFTPKGNSKAEERYKVTYKNLKDMQKK 429
>gi|104773804|ref|YP_618784.1| recombination factor protein RarA [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513810|ref|YP_812716.1| recombination factor protein RarA [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103422885|emb|CAI97547.1| Putative ATPase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093125|gb|ABJ58278.1| Recombination protein MgsA [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (434 aa)
Score = 683, Expect = 1.0e-69, Identities = 154/396 (38%), Positives = 231/396 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYYQN-----KSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           S D+++ +  +     II  M+E   L S++ +G PG+GK++    I       F   N+ T+ + +L ++          +++++EIHRLNK KQD LL  LE   +I++  TTENP+  ++PAIRSR  ++ ++ +    +   V + L +++        KL+ +  E + +    D R     L++ VL   Q      K    +   L  + +SL       D     HYDLLSAF KSIRGSD +A ++YL +LLESGDL+S+ RRL  + YEDIGLAN     +V  AV A++ LGLPEARIPL+   IELCLSPKSNSA+ AID A+  + +  +   P+ L+DAHY  A KL +  GY YPHDY   +V Q YLP  ++ K+++ P   S+ E  F   + ++    K
  S:    12 SIDQVVGQQHLVGPKKIIRRMVEARQLSSMILYGPPGIGKTSIASAIAGSSKYAFRQLNAATDGQKELSQVAAEGKMSGTVVLLLDEIHRLNKVKQDFLLPLLESGQVIMIGATTENPYLAISPAIRSRCQIFELKPLTEEEILTAVDRALTDEERGLGKYHAKLTKEAGEFLAQKGNGDLRATLNSLELAVLSTKQELEAEGKDASSLTVTLDDMADSLQMKIQNFDADGDGHYDLLSAFQKSIRGSDTDAGLHYLGRLLESGDLVSICRRLSVIAYEDIGLANPPACERVILAVQAAQQLGLPEARIPLANAVIELCLSPKSNSAMTAIDAALADIRQSNVGQIPDQLKDAHYKGASKLGHGTGYLYPHDYPGDWVAQAYLPDRMQGKQYFAPKGESKFEAAFKSQYQRLHDLQK 428
>gi|163942149|ref|YP_001647033.1| recombination factor protein RarA [Bacillus weihenstephanensis KBAB4] >gi|163864346|gb|ABY45405.1| AAA ATPase central domain protein [Bacillus weihenstephanensis KBAB4] (428 aa)
Score = 682, Expect = 1.3e-69, Identities = 148/396 (37%), Positives = 244/396 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYY--QNKSDDIVLK---ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           +  E+I +  +  +  I+  M++ N   S++ +G PG GK++    I       F   N+ T+NK D+  +++ A      ++I++E+HRL+K KQD LL +LE  ++ ++  TT NPF  +N AIRSR  ++ +  +    +   + + LE+++       V ++++ +      S  D R  +  L++ VL  +   +K+ +I L+   E  +  + + D+    HYD+LSAF KS+RGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   G +  AA+ ++E +G PEARIPL+   IELCLSPKSNSA  A+D A+  + N +    P+HL+D+HY  A  L    GY YPHD+   +V+Q+YLP ++KNK++YKP    + E      + +++S++K
  S:    13 NIQEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIAGSTGTLFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLLTLIGATTSNPFHAINSAIRSRCQIFELHALTEDDILIGLKRALEDQEKGLGEYDVTVTDEALHHFANASGGDMRSAYNALELAVLSSFTTDDKAAEITLEIAEECLQKKSFVHDKGGDAHYDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSIGRRLLIMAYEDIGLASPQAGQRTLAAIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNGQTGDIPSHLKDSHYKGAESLGRGIGYLYPHDHPNGWVQQQYLPDKIKNKQYYKPKTTGKFEQALSTVYERLQSSHK 423
>gi|83319965|ref|YP_424487.1| recombination factor protein RarA [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283851|gb|ABC01783.1| ATPase, AAA family, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (412 aa)
Score = 682, Expect = 1.4e-69, Identities = 167/393 (42%), Positives = 252/393 (64%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE------NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI-VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEAL-SPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKS 405
           S  ++I +  I   + +I  MI NN   S++FFG  GVGK++    +   L  +   FN++ + K  L+ I++ A +  + I+II+EIHRLNKDKQD+LL Y+EK  I V +TTTENPFF VNPA+RSR LL  ++ +N    K+E+I Y +        K+K+S++ ++ + ++S  D R    YL+++ K Y N+  DI  +K +  ++ +   + + + +DL SA  KSIRGSD +AA+YY ++L+E GD  S+ RR+  + YEDIGLAN  +  +V  A +A   +G PE  IPL    +E+ LS KSNSA +A + A+  V K  + S P HL+D HY SA+KL +  GYKYPHDY   +VEQ+YLP E+KNK+FY  +K +Q E+K    + ++K+
  S:    13 STKDIIGQTEILKSNGLINKMILNNYCTSLIFFGPSGVGKTSFAISLANDLKIDCEIFNASYDKKEKLINIIQNALKKERFILIIDEIHRLNKDKQDILLEYMEKGNIFVFSTTTENPFFVVNPALRSRSLLIELKPVN----KDELISYAKKVINQYQLKIKISDEALDFLAQLSVGDVRTFLNYLELIDKLYSNEFIDIEKIKTIITVSKNPTAQDSDDFHDLKSALQKSIRGSDVDAALYYFSRLIELGDYESLMRRMIIISYEDIGLANPTIPSRVVQACSAFRQIGFPEGIIPLGLAIVEMSLSLKSNSAYLATNSALDFVKKGNIYSVPKHLKDNHYKSAIKLGIGIGYKYPHDYENDWVEQQYLPDEIKNKKFYN-HKNNQYESKVYQLYTRMKT 409
>gi|42560990|ref|NP_975441.1| recombination factor protein RarA [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492487|emb|CAE77083.1| putative ATPase, AAA family [Mycoplasma mycoides subsp. mycoides SC str. PG1] (411 aa)
Score = 681, Expect = 1.9e-69, Identities = 164/390 (42%), Positives = 250/390 (64%)
  Q:    16 EMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE------NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV-LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKS 405
           ++I +  I     +I  MI NN   S++F+G  GVGK++    +   L  ++  FN++ + K  L  I++ A +  + I+II+EIHRLNKDKQD+LL Y+EK  I V +TTTENPFF +NPA+RSR LL  ++ +N    KEE+I Y +        K+ +S++ ++ + +IS  D R    YL+++ + Y N+  DI  +K +  ++ +   + + + +DL SA  KSIRGSD +AA+YY ++L+E+GD  S+ RR+  + YEDIGLAN  +  +V  A +A   +G PE  IPL    +E+ LS KSNSA +A + A+  V N    S P HL+D HY SA+KL +   YKYPHDY   +VEQ+YLP E+KNK+FY  +K +Q E+K  + +N++K+
  S:    16 DIIGQTEILKPKGLINKMILNNYCTSLIFYGPSGVGKTSFAISLANDLKIDYEIFNASYDKKEKLTNIIQTALKQKRFILIIDEIHRLNKDKQDILLEYMEKGNIFVFSTTTENPFFVINPALRSRSLLIELKPVN----KEELISYAKKVINQYQLKINISDEALDFLAQISVGDIRTFLNYLELIDRLYSNEFIDIKEIKTIITVSKNPTAQNSDDFHDLKSALQKSIRGSDVDAALYYFSRLIETGDYESLMRRMIIIGYEDIGLANPAISSRVVQACSAFRQIGFPEGIIPLGLAIVEMSLSLKSNSAYLATNSALDFVRNGNIYSVPKHLKDNHYKSAIKLGIGIDYKYPHDYENDWVEQQYLPDEIKNKKFYN-HKNNQYESKVYELYNRMKN 409
>gi|148543723|ref|YP_001271093.1| recombination factor protein RarA [Lactobacillus reuteri F275] >gi|184153130|ref|YP_001841471.1| hypothetical protein LAR_0475 [Lactobacillus reuteri F275] >gi|148530757|gb|ABQ82756.1| Recombination protein MgsA [Lactobacillus reuteri F275] >gi|183224474|dbj|BAG24991.1| conserved hypothetical protein [Lactobacillus reuteri F275] (434 aa)
Score = 679, Expect = 2.7e-69, Identities = 155/393 (39%), Positives = 224/393 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSN-------KVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKF-VDYWNKIKS 405
           + DE++ +  +     II  M++   L S++ +G PG GK++    I       F   N+ T+ K DL  + E A      I++++EIHRL+K KQD LL +LE   II++  TTENP+  +NPAIRSR  ++ +  +++A +K  +   L +K+  L N          + +V  +  D R     L++  K      D  +   L  I  S+       D+    HYD++SAF KSIRGSD +AA++YLA+L+E+GDL  + RRL    YEDIGLAN     +   AV  +E +G PEARIPL+   IELCLSPKSNS I AIDEA+  V +      P HL+DAHY  A KL     Y YPHD+   +V Q+YLP  +K+ ++Y+P    + E      YW   K+
  S:    13 TLDEVVGQQHLVGPGKIISRMVKAKMLSSMILYGPPGTGKTSIASAIAGSTKYAFRKLNAATDTKKDLQIVAEEAKMSGTVILLLDEIHRLDKVKQDFLLPHLENGRIILIGATTENPYISINPAIRSRTQIFPVHPLSTAEMKTAIQHALVDKERGLGNLPLVLEENAEDQLVAATNGDLRSALNGLELAAKSTDPSEDGKIHLTLPIIEESVQKKALSADKDGDAHYDVISAFQKSIRGSDTDAALHYLARLIEAGDLPIIARRLMVTAYEDIGLANMPAVQRAVTAVQTAERVGFPEARIPLADAVIELCLSPKSNSGINAIDEALAQVRQGGFGDVPAHLKDAHYKGAAKLGHGIDYDYPHDHPQDWVAQQYLPDRIKDAQYYQPKNNGRFEASLGRQYWQLRKA 421
>gi|191638187|ref|YP_001987353.1| Chromosome segregation helicase (Putative) [Lactobacillus casei] >gi|190712489|emb|CAQ66495.1| Chromosome segregation helicase (Putative) [Lactobacillus casei BL23] (431 aa)
Score = 676, Expect = 6.0e-69, Identities = 151/392 (38%), Positives = 222/392 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           + DE++ +  +   D II  M+  + L S++ +G PG GK++    I       F   N+ T+ K DL  + E A      I++++EIHRL+K KQD LL  LE   I+++  TTENP+  + PAIRSR  +++++ +    +   + + L + K       V L    ++ +   +  D R     L++ +       D  +  +L  I  SL       D     HYD++SAF KSIRGSD +AA++YLA+L+  GDL S+ RRL  + YEDIGLAN     +   A+ ++E LGLPE RIPL+   I+LCL+PKSNS I AIDEA+  V N  A   P+ LRDAHY  A +L     YK PH+Y   +V Q+YLP  LKNK +Y+P    + E        ++K
  S:    13 NLDEVVGQQDLVGPDRIIRRMVSAHRLSSMILYGPPGTGKTSIASAIAGSTKYAFRILNAATDTKKDLQIVAEEAKMSGTVILLLDEIHRLDKTKQDFLLPLLESGRIVLIGATTENPYMNIQPAIRSRTQIFQVKPLTPDDIASAINRALADHKRGLGDYQVDLQPDALDYLTHATNGDLRSALNGLELAVLSTPASDDGTITIDLTTIQQSLQKPALAGDTNGDAHYDIISAFQKSIRGSDADAALHYLARLIAIGDLNSITRRLLVIAYEDIGLANPATASRTLTAIQSAERLGLPEGRIPLADAVIDLCLAPKSNSGIKAIDEALADVENGNAGQIPDDLRDAHYRGAKQLGHGIDYKLPHNYPNGWVAQQYLPDNLKNKHYYQPKATGRYEAALAQRLQQLK 419
>gi|194468283|ref|ZP_03074269.1| AAA ATPase central domain protein [Lactobacillus reuteri 100-23] >gi|194453136|gb|EDX42034.1| AAA ATPase central domain protein [Lactobacillus reuteri 100-23] (434 aa)
Score = 675, Expect = 8.0e-69, Identities = 155/393 (39%), Positives = 224/393 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSN-------KVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKF-VDYWNKIKS 405
           + DE++ +  +     II  M++   L S++ +G PG GK++    I       F   N+ T+ K DL  + E A      I++++EIHRL+K KQD LL +LE   II++  TTENP+  +NPAIRSR  ++ +  +++  +K  +   L +K+  L N          + +V  +  D R     L++  K      D  +   L  I  S+       D+    HYD++SAF KSIRGSD +AA++YLA+L+E+GDL  + RRL    YEDIGLAN     +   AV  +E +G PEARIPL+   IELCLSPKSNS I AIDEA+  V +      P HL+DAHY  A KL +   Y YPHDY   +V Q+YLP  +K+ ++Y+P    + E      YW   K+
  S:    13 TLDEVVGQQHLVGPGKIISRMVKAKMLSSMILYGPPGTGKTSIASAIAGSTKYAFRKLNAATDTKKDLQIVAEEAKMSGTVILLLDEIHRLDKGKQDFLLPHLENGRIILIGATTENPYISINPAIRSRTQIFPVHPLSTDEMKIAIQHALVDKERGLGNLPLVLEENAEDQLVAATNGDLRSALNGLELAAKSTDPSEDGKIHLTLPIIEESVQKKALSADKDGDAHYDVISAFQKSIRGSDTDAALHYLARLIEAGDLPIIARRLMVTAYEDIGLANMPAVQRAVTAVQTAERVGFPEARIPLADAVIELCLSPKSNSGINAIDEALAQVRQGGFGDVPVHLKDAHYKGAAKLGHGLDYDYPHDYPQDWVAQQYLPDRIKDAQYYQPKNNGRFEASLGRQYWQLRKA 421
>gi|55821924|ref|YP_140366.1| recombination factor protein RarA [Streptococcus thermophilus LMG 18311] >gi|55823843|ref|YP_142284.1| recombination factor protein RarA [Streptococcus thermophilus CNRZ1066] >gi|116628622|ref|YP_821241.1| recombination factor protein RarA [Streptococcus thermophilus LMD-9] >gi|55737909|gb|AAV61551.1| chromosome segregation helicase [Streptococcus thermophilus LMG 18311] >gi|55739828|gb|AAV63469.1| chromosome segregation helicase [Streptococcus thermophilus CNRZ1066] >gi|116101899|gb|ABJ67045.1| Recombination protein MgsA [Streptococcus thermophilus LMD-9] (422 aa)
Score = 675, Expect = 8.1e-69, Identities = 153/381 (40%), Positives = 230/381 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           S  E+I +  +  +  II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E +++  +KE ++  L +K+      V L +  ++ I   +  D R  +  L + +       +      L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A+ A++ +G PEARI ++ + I+L LSPKSNSA  A+D A+  + K    P P HLRD HYA +  L N + YKYPH Y   +V+Q+YLP +L+   +++PN+  + E
  S:    13 SISEVIGQKHLVGEGKIIRRMVEANMLSSMILYGPPGIGKTSIASAIAGTTKFAFRTFNATVDSKKRLQEIAEEAKFSGGLVLLLDEIHRLDKAKQDFLLPLLENGNIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEDIKEAILNVLGDKERGFAFEVHLDDDALDFIATATNGDLRSAYNSLDLAVMSTPASGNGQHHITLDIVENSLQRSYITMDKDGDGHYDVLSALQKSIRGSDVNASLHYAARLVEAGDLPSLARRLTVIAYEDIGLANPDAQVHTVTALEAAQKIGFPEARILIANVVIDLALSPKSNSAYKAMDAALADLRKSGNLPIPRHLRDGHYAGSKALGNAQDYKYPHAYPEKWVKQQYLPDKLRGVNYFQPNETGKYE 407
>gi|24380393|ref|NP_722348.1| recombination factor protein RarA [Streptococcus mutans UA159] >gi|24378415|gb|AAN59654.1|AE015027_12 putative ATPase [Streptococcus mutans UA159] (427 aa)
Score = 675, Expect = 8.6e-69, Identities = 152/378 (40%), Positives = 230/378 (60%)
  Q:    16 EMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           E+I +  +  +  II  M+  N L S++ +G PG+GK++    I       F  FN+TT+ K  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E +++  +K+ +   L + +      VKL +  ++ I + +  D R  +  L + +   Q   +      L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A+ A++ +G PEARI ++ + I+L LSPKSNSA +A+D+AI  ++K    P P HLRD HYA + +L N + Y YPH Y   +V+Q+YLP +LK   ++  N+  + E
  S:    22 EVIGQKHLVGQGKIISRMVTANRLSSMILYGPPGIGKTSIASAIAGTTKFAFRTFNATTDTKKRLQEIAEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLENGQIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEDIKKAMQAALTDTERGFDFEVKLDDDALDFIAQATNGDLRSAYNSLDLAIMSTQPDDNGSRHITLDTVENSLQRSYITMDKDGDGHYDVLSALQKSIRGSDVNASLHYAARLIEAGDLPSLARRLTIIAYEDIGLANPDAQIHTVTALEAAQKIGFPEARILIANVVIDLALSPKSNSAYVAMDKAIADLHKSGTIPIPRHLRDGHYAGSKELGNAQDYLYPHAYPEKWVKQQYLPDKLKGANYFTANETGKYE 413
>gi|163790370|ref|ZP_02184802.1| ATPase, AAA family protein [Carnobacterium sp. AT7] >gi|159874441|gb|EDP68513.1| ATPase, AAA family protein [Carnobacterium sp. AT7] (428 aa)
Score = 674, Expect = 1.1e-68, Identities = 152/389 (39%), Positives = 235/389 (60%)
  Q:    15 DEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV----EAIVEISKS---DFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNH-------YDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           D ++ +  +  K  II  M+E   L S++ +G PG+GK++    I       F   N+ ++ K DL  ++E A      I++++E+HRL+K KQD LL +LE   II++  TTENP+  +NPAIRSR  ++ ++ +++  ++  +   + + +    N+ V    EA++  S++   D R     L++ +K        I+   L  I    I R+A  H       YD++SA  KSIRGSD +AA++YLA+L+E+GDL  + RRL  + YEDIGLAN     +   AV A+E LG PEARIPL+ + ++LCLSPKSNS+ +AID A+Q V   ++   P+HLRD+HY+ A KL  +G  Y YPH Y  ++V Q+YLP +LK   +Y PN   + E+     +  I
  S:    15 DNIVGQQHLVGKGKIIRRMVEAKMLSSMILYGPPGIGKTSIASAIAGTTKFAFRVLNAASDTKKDLQIVVEEAKMSGTVILLLDEVHRLDKPKQDFLLPHLENGRIILIGATTENPYITINPAIRSRTQIFELKPLSNEDIQHALWNAVNDSEKGFGNEQVTITDEALLHFSRATNGDLRSSLNGLELAIKSTAPDEKGIITITL-DIAEECIQRKALTHDKDGDAHYDVISALQKSIRGSDVDAAMHYLARLIEAGDLPIISRRLMVIAYEDIGLANPSAASRTVTAVQAAEKLGFPEARIPLANVVVDLCLSPKSNSSYVAIDAALQDVRAGKSGDVPDHLRDSHYSGAKKLG-RGVDYLYPHSYPGAWVNQQYLPDKLKKASYYSPNHTGKYEDTLAKQYESI 418
>gi|125717113|ref|YP_001034246.1| recombination factor protein RarA [Streptococcus sanguinis SK36] >gi|125497030|gb|ABN43696.1| Chromosome segregation helicase, putative [Streptococcus sanguinis SK36] (422 aa)
Score = 672, Expect = 1.8e-68, Identities = 150/379 (39%), Positives = 235/379 (62%)
  Q:    15 DEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           D++I +  +     II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L E+ E A      +++++EIHRL+K KQD LL  LE  ++I++  TTENPFF V PAIRSR+ ++ +E +++  ++  +   L +K+      V+L ++ ++ I   +  D R  +  L + +      S  I    L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A+ A++ +G PEARI ++ I I+L LSPKSNSA +A+D+A+  + K    P P HLRD HYA + +L N + Y YPH Y+ ++V+Q+YLP ++K+  ++ PN+  + E
  S:    15 DQIIGQQHLVGPGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTKFAFRTFNATVDSKKRLQEVAEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLESGLVIMIGATTENPFFSVTPAIRSRVQIFELEPLSNDDIRTAIQLALTDKERGFDFPVELDDEALDFIAISTNGDLRSAYNSLDLAVLSTPEDSKGIRHITLDVMENSLQKSYITMDKDGDGHYDVLSALQKSIRGSDVNASLHYAARLVEAGDLPSLARRLTVIAYEDIGLANPDAQVHTVTALEAAQRIGFPEARILIANIVIDLALSPKSNSAYLAMDKALADLRKNGNLPIPRHLRDGHYAGSKELGNAQDYLYPHSYSGNWVKQDYLPDKIKDANYFTPNENGKYE 407
>gi|116629863|ref|YP_815035.1| recombination factor protein RarA [Lactobacillus gasseri ATCC 33323] >gi|116095445|gb|ABJ60597.1| Recombination protein MgsA [Lactobacillus gasseri ATCC 33323] (432 aa)
Score = 672, Expect = 1.8e-68, Identities = 161/392 (41%), Positives = 235/392 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYYQNKSD----DIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           + DE++ ++ +     II  M+E   L S++ +G PG+GK++    I       F   N+ T+ K DL  + E        I++++EIHRL+K KQD LL  LE   II++  TTENP+  ++PAIRSR  ++ +  + S  + + + + L + +       V+L+      +++    D R     L++ VL   Q K      D ++ +  ++ +S+       D     HYDLLSAF KSIRGSD +AA+YYL  L ESGDL+++ RRL  + YEDIGLAN     +V  AV A++ +GLPEARI LS   IELCLSPKSNSAI+AID AI  + NK+  S P+ L+DAHY  A  LN    Y YPHDY   +V Q+YLP  LKN  ++KP   S+ E+     + ++K
  S:    12 NLDEVVGQEHLVGNKKIIRRMVEAKLLSSMILYGPPGIGKTSIASAIAGSTKYAFRKLNAATDTKKDLQIVAEEGKMSGTVILLLDEIHRLDKTKQDFLLPLLESGNIILIGATTENPYISISPAIRSRCQIFELHRLKSTDISKAIDRALTDSENGLGKYNVELTKDARNLLIDKGNGDLRCTLNALELAVLSTDQEKKSKSHKDKLIIDKAEMQDSIQFKSQNYDSSGDGHYDLLSAFQKSIRGSDTDAALYYLGNLCESGDLVAICRRLLVIAYEDIGLANPPACSRVVNAVQAAQMVGLPEARIILSNAVIELCLSPKSNSAIVAIDSAISDIQNKQNYSIPDSLKDAHYKGAQNLNHGVSYIYPHDYQGDWVAQQYLPNNLKNVSYFKPKGNSKIEDALKKQYLRLK 423
>gi|116510915|ref|YP_808131.1| recombination factor protein RarA [Lactococcus lactis subsp. cremoris SK11] >gi|116106569|gb|ABJ71709.1| Recombination protein MgsA [Lactococcus lactis subsp. cremoris SK11] (419 aa)
Score = 671, Expect = 2.3e-68, Identities = 156/381 (40%), Positives = 236/381 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + DE++ +  +  K  II  M+E   L S++ +G PG+GK++    I   +N  F  FN+TT+ K  L EI   A    + +++++EIHRL+K KQD LL  LE   II++  TTENP+F V PAIRSR+ ++ ++ +    L+  V   L++K+      V + +  +  +V  +  D R  F  L++ VL   +++        L  + NSL       D+    HYDLLSA  KSIRGSD NA+++Y A+L+E GDL S+ RRL  + YEDIGLAN         A++A+E LG PEARIPL+ I I+L LSPKSNSA +A+DEA+  + K   L+ P+HL+D HYA A +L     Y+Y H++   +V Q+YLP ++KN ++++P+   + E
  S:    13 NIDEIVGQRHLVGKGKIIRRMVETQLLSSMILYGPPGIGKTSIASAIAGTMNIAFRTFNATTDTKKRLQEIASEAEFSGQLVLLLDEIHRLDKPKQDFLLPLLENGQIILIGATTENPYFSVVPAIRSRVQIFELKALEPEDLESAVNLSLQDKERGFDFDVTIDDDALYFLVHSTNGDLRSTFNALELAVLSSNEHRV------TLDDMENSLQRKAATFDKDGDAHYDLLSALQKSIRGSDVNASLHYAARLIEGGDLQSLARRLTVMAYEDIGLANPDAAVHTVTALSAAEKLGFPEARIPLANIIIDLALSPKSNSAYLAMDEALSDLGKYGNLAVPSHLQDGHYAGAKELGRSVEYQYAHNFPDHWVNQQYLPDKIKNADYFRPDDMGRYE 402
>gi|195978892|ref|YP_002124136.1| ATPase AAA family recombination factor RarA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975597|gb|ACG63123.1| ATPase AAA family recombination factor RarA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (423 aa)
Score = 670, Expect = 3.4e-68, Identities = 151/381 (39%), Positives = 228/381 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           +  E+I +  +  +  II  M++ N L S++ +G PG+GK++    I       F  FN+T +NK  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E ++   +K+ +   + +K+      V L     + I   +  D R  +  L + +   Q  ++ I    L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A+ A++ +G PEARI ++ + I+L LSPKSNSA MA+D A+  + +    P P HLRD HY  + +L N + Y YPH Y   +V+Q+YLP +L  K ++ PN+  + E
  S:    13 TITEVIGQQHLVGEGKIIDRMVKANRLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATIDNKKRLQEIAEEAKFSGGLVLLLDEIHRLDKSKQDFLLPLLEHGHIIMIGATTENPFFSVTPAIRSRVQIFELEPLSPEEIKQALKLAITDKERGFAFDVTLDEAAFDFIATATNGDLRAAYQSLDLAVMSTQPDNEGIRHISLDIVENSLQRSYITMDKDGDGHYDILSALQKSIRGSDVNASLHYAARLVEAGDLPSLARRLTIIAYEDIGLANPEAQIHTVTALEAAQKIGFPEARILIANVVIDLALSPKSNSAYMAMDAALADLRQHGHLPIPRHLRDGHYTGSKELGNAQHYLYPHAYPEKWVKQQYLPDQLVKKNYFDPNETGKYE 407
>gi|15675782|ref|NP_269956.1| recombination factor protein RarA [Streptococcus pyogenes M1 GAS] >gi|13623007|gb|AAK34677.1| conserved hypothetical protein [Streptococcus pyogenes M1 GAS] (422 aa)
Score = 670, Expect = 3.6e-68, Identities = 150/381 (39%), Positives = 229/381 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           +  E+I +  +  +  II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E +++  +K  +   + +K+      V + ++ ++ IV  +  D R  +  L + +       D      L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARIP++ + I+L LSPKSNSA +A+D A+  +      P P HLRD HYA +  L N K Y YPH Y   +V+Q+YLP +L    +++ N+  + E
  S:    13 TISEVIGQKHLVGEGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTRYAFRTFNATIDSKKRLQEIAEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLENGTIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEDIKTAIQLAISDKERGFPFLVTIDDEALDFIVTATNGDLRSAYNSLDLAVMSTSPNEDGSRHISLETMENSLQRSYITMDKNGDGHYDVLSALQKSIRGSDVNASLHYAARLVEAGDLPSLARRLTIIAYEDIGLANPDAQVHTVTALDAAQRIGFPEARIPIANVVIDLALSPKSNSAYLAMDAALADLRTSGNLPIPRHLRDGHYAGSKDLGNAKDYLYPHAYPEKWVKQQYLPDKLVGHHYFEANETGKYE 407
>gi|182684741|ref|YP_001836488.1| AAA family ATPase [Streptococcus pneumoniae CGSP14] >gi|182630075|gb|ACB91023.1| ATPase, AAA family [Streptococcus pneumoniae CGSP14] (423 aa)
Score = 667, Expect = 7.7e-68, Identities = 147/381 (38%), Positives = 234/381 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + D++I +D +     II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE  ++I++  TTENPFF V PAIRSR+ ++ +E +++  +KE +   L N +      ++L    ++ I   +  D R  F  L + +       + I    L  + NSL      +D+    HYD+LSA  KSIRGSD +A+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D+A+  +      P P HLRD HY+ + +L N + Y YPH+Y  ++V+Q+YLP++++N  +++     + E
  S:    13 TIDQVIGQDHLVGPGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEISEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLESGLVIMIGATTENPFFSVTPAIRSRVQIFELEPLSNQDVKEALQIALSNPERGFDFPIELDEDALDFIATSTNGDLRSAFNSLDLAVLSTPENDEGIRHITLDIMENSLQRSYITMDKDGDGHYDVLSALQKSIRGSDVDASLHYAARLIEAGDLPSLARRLTVIAYEDIGLANPEAQIHTVTALDAAQRIGFPEARILIANVVIDLALSPKSNSAYVAMDKALADLKASGHLPIPRHLRDGHYSGSKELGNAQDYLYPHNYPGNWVKQDYLPEKIRNHHYFQAEDTGKYE 407
>gi|23099472|ref|NP_692938.1| recombination factor protein RarA [Oceanobacillus iheyensis HTE831] >gi|22777701|dbj|BAC13973.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] (425 aa)
Score = 667, Expect = 7.9e-68, Identities = 147/396 (37%), Positives = 239/396 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYR-----IENINSAVLKEEVIKYLENKK--VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV------LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           + DE+I ++ +  +  II  M++ N L S++ FG PG GK++    +   +       N+ T+ K D+  ++E A    + ++I++E+HRL+K KQD LL +LE +++ ++  TT NP+  +NPAIRSR  L+      I+N+ +A L   +++Y E  +  + +    +E +   +  D R     L++ +         ++       +E  +  +   D+    HYD+LSAF KSIRGSD +AA++YL++L+E+GDL S+ RR+  + YEDIGLAN   GP+  +AV A+E LG PEARIPL+ + +EL LSPKSN+A  A+D A+  +    +   P HL+D+HY  A KL   K Y YPH+Y  ++V+Q+YLP  +KN+ +Y P    + E      + KI+ + K
  S:    15 NIDEIIGQEHLVGQGKIIDRMVKANMLSSMILFGPPGTGKTSMAYALANSVGLPLKILNAVTDKKKDMEIVVEEAKMRGQMVLILDEVHRLDKAKQDFLLPHLESNLLTLIGCTTSNPYHSINPAIRSRCHLFELHGLTIDNVKTA-LHRAIVQYNETSQNDINIGEDALEHLALAANGDLRSSLNGLELAVSSTPPTETGVIELTIDIAEECMQKKSFSHDKDGDAHYDVLSAFQKSIRGSDVDAALHYLSRLIEAGDLDSIARRMIVIAYEDIGLANPQAGPRAVSAVQAAERLGFPEARIPLANVVVELALSPKSNTAYKALDAALSDLRSGRSGDVPAHLKDSHYKGAEKLGRGKEYLYPHNYPGAWVDQQYLPDSIKNRIYYSPKDTGKFEKALKQVYEKIQRDRK 424
>gi|170016573|ref|YP_001727492.1| ATPase [Leuconostoc citreum KM20] >gi|169803430|gb|ACA82048.1| ATPase [Leuconostoc citreum KM20] (430 aa)
Score = 666, Expect = 1.0e-67, Identities = 144/397 (36%), Positives = 233/397 (58%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI------VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           N  ++++ +  +     II  M+    L S++ +G PG GK++    I       F   N+ T+++ DL  + E A      +++++EIHRLNK KQD LL +LE   II++  TTENP+  V PAIRSR  ++++  +    +K  V + L++        KV L++  +  + + +  D R     L++ +       D        V++E  +      D+    HYD++SA  KSIRGSD +AA++Y A+++ESGDL  + RRL  + YEDIGLAN         A+ ++++LGLPEARIPL+   IEL LSPKSN+A +AID+A+  +   +    P+HLRD+HY  A +L + KGY YPHD++  +V Q+YLP+++   +++ P   S+ E  F D +  +K + +
  S:    14 NKIEDIVGQQHLVGSGKIIWRMVAAKRLSSMILYGPPGTGKTSIASAIAGSSKYAFRVLNAATDSQKDLQIVAEEAKMSGTVVLLLDEIHRLNKVKQDFLLPHLESGAIILIGATTENPYINVTPAIRSRTQIFQVTPLTEDDIKSAVHRALKDDTHGLGKYKVTLTDDAMNHLAQATNGDLRSALNGLELAVLSTPTAKDKTIHITLPVIEETVQRKAMFADKDGDAHYDVISALQKSIRGSDTDAALHYAARIIESGDLPILTRRLTVIAYEDIGLANPTAVQHAVTAIQSAQSLGLPEARIPLANAIIELALSPKSNAAYLAIDKALSDIQSGKTGDVPDHLRDSHYKGAAELGHGKGYIYPHDFDNDWVPQQYLPEKISQTQYFSPKGNSKIEKAFSDVYQTLKKSQR 425
>gi|125622982|ref|YP_001031465.1| recombination factor protein RarA [Lactococcus lactis subsp. cremoris MG1363] >gi|124491790|emb|CAL96710.1| chromosome segregation helicase [Lactococcus lactis subsp. cremoris MG1363] (419 aa)
Score = 666, Expect = 1.0e-67, Identities = 156/381 (40%), Positives = 235/381 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + DE++ +  +  K  II  M+E   L S++ +G PG+GK++    I   +N  F  FN+TT+ K  L EI   A    + +++++EIHRL+K KQD LL  LE   II++  TTENP+F V PAIRSR+ ++ ++ +    L+  V   L++K+      V + +  +  +V  +  D R  F  L++ VL   +++        L  + NSL       D+    HYDLLSA  KSIRGSD NA+++Y A+L+E GDL S+ RRL  + YEDIGLAN         A++A+E LG PEARIPL+ I I+L LSPKSNSA +A+DEA+  + K   L+ P HL+D HYA A +L     Y+Y H++   +V Q+YLP ++KN ++++P+   + E
  S:    13 NIDEIVGQRHLVGKGKIIRRMVETQLLSSMILYGPPGIGKTSIASAIAGTMNIAFRTFNATTDTKKRLQEIASEAEFSGQLVLLLDEIHRLDKPKQDFLLPLLENGQIILIGATTENPYFSVVPAIRSRVQIFELKALEPEDLEFAVNLSLQDKERGFDFDVTIEDDALYFLVHSTNGDLRSTFNALELAVLSSNEHRV------TLDDMENSLQRKAATFDKDGDAHYDLLSALQKSIRGSDVNASLHYAARLIEGGDLQSLARRLTVMAYEDIGLANPDAAVHTVTALSAAEKLGFPEARIPLANIIIDLALSPKSNSAYLAMDEALSDLGKYGNLAVPPHLQDGHYAGAKELGRSVEYQYAHNFPDHWVNQQYLPDKIKNADYFRPDDMGRYE 402
>gi|15672079|ref|NP_266253.1| recombination factor protein RarA [Lactococcus lactis subsp. lactis Il1403] >gi|12722942|gb|AAK04195.1|AE006248_3 chromosome segregation helicase [Lactococcus lactis subsp. lactis Il1403] (419 aa)
Score = 665, Expect = 1.1e-67, Identities = 153/381 (40%), Positives = 235/381 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + DE++ +  +  K  II  M+E   L S++ +G PG+GK++    I   +N  F  FN+TT+ K  L EI   A    + +++++EIHRL+K KQD LL  LE   II++  TTENP+F V PAIRSR+ ++ ++ +    L+  V   L++K+      V + +  +  ++  +  D R  F  L++ +    ++   + L ++    NSL       D+    HYDLLSA  KSIRGSD NA+++Y A+L+E GDL S+ RRL  + YEDIGLAN        +A++A+E LG PEARIPL+ I I+L LSPKSN+A +A+DEAI  + K   L+ P HL+D HYA A  L     Y+Y H++   +V Q+YLP ++KN ++++P+   + E
  S:    13 NIDEIVGQKHLVGKGKIIRRMVETQLLSSMILYGPPGIGKTSIASAIAGTMNVAFRTFNATTDTKKRLQEIASEAEFSGQLVLLLDEIHRLDKPKQDFLLPLLENGQIILIGATTENPYFSVVPAIRSRVQIFELKPLEPEDLEFAVNLSLQDKERGFDFDVTIDDDALYFLIHSTNGDLRSTFNALELAV--LSSEEHHVTLDDM---ENSLQRKAATFDKDGDAHYDLLSALQKSIRGSDVNASLHYAARLIEGGDLQSLARRLTVMAYEDIGLANPDAALHTVSALSAAEKLGFPEARIPLANIIIDLALSPKSNAAYLAMDEAIADLGKYGNLAVPPHLQDGHYAGAKDLGRSVEYQYAHNFPNHWVNQQYLPDKIKNADYFRPDDMGRYE 402
>gi|161621803|ref|YP_016214.2| recombination factor protein RarA [Mycoplasma mobile 163K] (406 aa)
Score = 665, Expect = 1.3e-67, Identities = 157/372 (42%), Positives = 237/372 (63%)
  Q:    33 MIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK--VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI-VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEAL-SPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           +IE  ++ S +F+G  G+GK+ +   I K+  +++  FN T ++K +LLE L +       I+II+E+HRLNKDKQ++LL YLE D II+ ATTTENP+FK+ P++RSRL + R   ++   + + +   +E  K  +K+++ ++ +IV+ S  DFR     L ++   Y N + D   +K++    N   D+ A  HYD LSAFHKS+RGSDP+AA+YY   L ++GD+ ++ RRL  V YEDI LAN     KV+AA+NA E +G PEA   L++I IE+ LSPKSNS  +++++ +  +N   +   P+HL+D HY ++ K N   Y YPHD+  +YV Q YLP EL+   F++    +QNE K   YW KIK
  S:    29 IIEKQEMSSFIFYGESGIGKTTAATVIAKEKQESYDVFNPTIHSKKELLEKLAI-----NKILIIDELHRLNKDKQEILLSYLEDDKIILYATTTENPYFKIIPSLRSRLKILRFNKLSETEIFQGLKNIIEKYKLKIKINDDLLLSIVKFSAGDFRNAINNLDLIETIYPNTNVDFESIKKIFPSMNFYTDKDADKHYDTLSAFHKSLRGSDPDAALYYGMLLAKAGDIDALLRRLIMVAYEDIALANPNASIKVDAAINAIERVGFPEANTILAKIIIEIALSPKSNSTYVSMNKILDKINNGNIYDIPDHLKDTHYKNSAKFNRPKYLYPHDFENNYVNQNYLPIELEKNHFFEFAN-NQNEQKIKSYWEKIK 398
>gi|50915051|ref|YP_061023.1| recombination factor protein RarA [Streptococcus pyogenes MGAS10394] >gi|50904125|gb|AAT87840.1| ATPase, AAA family [Streptococcus pyogenes MGAS10394] (422 aa)
Score = 664, Expect = 1.6e-67, Identities = 150/381 (39%), Positives = 230/381 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           +  E+I +  +  +  II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E +++  +K  +   + +K+      V + ++ ++ IV  +  D R  +  L + +   +  SD      L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D A+  +      P P HLRD HYA +  L N K Y YPH Y   +V+Q+YLP +L    +++ N+  + E
  S:    13 TISEVIGQKHLVGEGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTRYAFRTFNATIDSKKRLQEITEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLENGTIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEDIKTAIQLAISDKERGFPFLVTIDDEALDFIVTATNGDLRSAYNSLDLAVMSTKPDSDGKRHITLDTVENSLQRSYITMDKDGDGHYDVLSALQKSIRGSDVNASLHYAARLVEAGDLPSLARRLTIIAYEDIGLANPDAQVHTVTALDAAQRIGFPEARILIANVVIDLALSPKSNSAYLAMDAALADLRTSGNLPIPRHLRDGHYAGSKDLGNAKDYLYPHAYPEKWVKQQYLPDKLVGHHYFEANETGKYE 407
>gi|138896137|ref|YP_001126590.1| recombination factor protein RarA [Geobacillus thermodenitrificans NG80-2] >gi|196250090|ref|ZP_03148784.1| AAA ATPase central domain protein [Geobacillus sp. G11MC16] >gi|134267650|gb|ABO67845.1| ATPase, AAA family [Geobacillus thermodenitrificans NG80-2] >gi|196210274|gb|EDY05039.1| AAA ATPase central domain protein [Geobacillus sp. G11MC16] (431 aa)
Score = 664, Expect = 1.9e-67, Identities = 154/381 (40%), Positives = 230/381 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRL----LLYRIENINSAVLKEEVIKYLE----NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNH-------YDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + D+++ ++ I   ++ +  MI+   + S+L +G PG GK++    I +   +     N+T+  K ++ E  E A      ++ I+EIHRLNK +QD+LL +LE  ++ ++  TTENPF +VNPAIRSR      L R++  +  V+ +  +   E       V ++ +++  I E +  D R     L+  +     +   + + E   I  S    R   H       Y LLSAF KS+RGSD +AA++YLA+LLE GDL +V RRL  + YEDIGLAN  +G KV AAV A+E +GLPEARIPL+ +TIELCLSPKSNSA  A+D A+  V    L   P+HL+DAHY  A  L + +GY YPHDY   +V Q YLP  ++   +Y+P ++ + +
  S:    16 TIDDIVGQEHIIGPETPLYKMIKKGYVPSLLLYGEPGTGKTSLAYAIARTAERELIAINATSAGKKEIEEAAEAARWSGNVLLFIDEIHRLNKAQQDVLLPHLESGLVTLIGATTENPFHEVNPAIRSRCGQIQQLKRLKPADILVILKRALADSERGVGETPVIIAEELLWRIAEAAGGDARAALSLLEAAVAAADERDGCLYIDE--NIIASCTANRGFTHDKYGDTYYSLLSAFQKSVRGSDADAALHYLARLLEGGDLAAVCRRLLVIAYEDIGLANPMMGVKVQAAVEAAERIGLPEARIPLAVVTIELCLSPKSNSAYKALDAALADVRAGKLGEIPDHLKDAHYKGASILGHGQGYLYPHDYPNGWVAQAYLPVSIEGTRYYEPKEHGEEK 411
>gi|42518874|ref|NP_964804.1| recombination factor protein RarA [Lactobacillus johnsonii NCC 533] >gi|41583160|gb|AAS08770.1| hypothetical protein LJ_0949 [Lactobacillus johnsonii NCC 533] (431 aa)
Score = 663, Expect = 1.9e-67, Identities = 155/396 (39%), Positives = 233/396 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVL----KYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           + DE++ ++ +     II  M+E   L S++ +G PG+GK++    I       F   N+ T+ K DL  + E        I++++EIHRL+K KQD LL  LE   II++  TTENP+  ++PAIRSR  ++ +  +    +   + + L++ +       V+L+      ++E    D R I   L++ +    +  Q  +D+ ++ +  ++ +S+       D     HYDLLSAF KSIRGSD +AA+YYL  L ESGDL+++ RRL  + YEDIGLAN     +   AV A++ +GLPEARI LS   IELCLSPKSNSAI AID AI  + NK+    P+ L+DAHY  A  LN    Y YPHD+   ++ Q+YLP  LKN  ++ P   S+ E+     + ++K   K
  S:    12 NLDEVVGQEHLVGNKKIIRRMVEAKLLSSMILYGPPGIGKTSIASAIAGSTKYAFRKLNAATDTKKDLQIVAEEGKMSGTVILLLDEIHRLDKTKQDFLLPLLESGNIILIGATTENPYISISPAIRSRCQIFELHRLKEMDISHAIDRALKDSETGLGKYNVELTKDARNLLIEKGNGDLRAILNALELAVLSTKEEKQENADNKLVIDKAEMQDSIQFKSQNYDANGDGHYDLLSAFQKSIRGSDTDAALYYLGNLCESGDLVAICRRLLVIAYEDIGLANPPACSRAVNAVQAAQMVGLPEARIILSNAVIELCLSPKSNSAITAIDAAIGDIRNKQNDPIPDSLKDAHYKGAATLNHGVSYLYPHDFQGDWIAQQYLPNNLKNVSYFNPKGNSKVEDALKRQYLRLKKMQK 426
>gi|157151477|ref|YP_001451097.1| recombination factor protein RarA [Streptococcus gordonii str. Challis substr. CH1] >gi|157076271|gb|ABV10954.1| ATPase, AAA family [Streptococcus gordonii str. Challis substr. CH1] (422 aa)
Score = 663, Expect = 2.0e-67, Identities = 149/379 (39%), Positives = 232/379 (61%)
  Q:    15 DEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           D++I +  +     II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE  ++I++  TTENPFF V PAIRSR+ ++ +E +++  ++  +   L +K+      V+L  + ++ I   +  D R  +  L + +         I    L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A+ A++ +G PEARI ++ I I+L LSPKSNSA +A+D+A+  + K    P P HLRD HYA + +L N + Y YPH Y  ++++Q+YLP ++K+  ++ PN+  + E
  S:    15 DQIIGQQHLVGPGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEIAEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLESGLVIMIGATTENPFFSVTPAIRSRVQIFELEPLSNDDIRTAIQLALTDKERGFDFPVELDKEALDFIAISTNGDLRSAYNSLDLAVLSTPEDDKGIRHITLDVMENSLQKSYITMDKDGDGHYDVLSALQKSIRGSDVNASLHYAARLVEAGDLPSLARRLTVIAYEDIGLANPDAQVHTVTALEAAQRIGFPEARILIANIVIDLALSPKSNSAYVAMDKALADLRKNGNLPIPRHLRDGHYAGSKELGNAQDYLYPHSYPGNWIKQDYLPDKIKDANYFMPNENGKYE 407
>gi|194397127|ref|YP_002038384.1| ATPase, AAA family [Streptococcus pneumoniae G54] >gi|194356794|gb|ACF55242.1| ATPase, AAA family [Streptococcus pneumoniae G54] (423 aa)
Score = 663, Expect = 2.3e-67, Identities = 146/381 (38%), Positives = 234/381 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + D++I ++ +     II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE  ++I++  TTENPFF V PAIRSR+ ++ +E +++  +KE +   L N +      ++L    ++ I   +  D R  F  L + +       + I    L  + NSL      +D+    HYD+LSA  KSIRGSD +A+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D+A+  +      P P HLRD HY+ + +L N + Y YPH+Y  ++V+Q+YLP++++N  +++     + E
  S:    13 TIDQVIGQEHLVGPGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEISEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLESGLVIMIGATTENPFFSVTPAIRSRVQIFELEPLSNQDVKEALQIALSNPERGFDFPIELDEDALDFIATSTNGDLRSAFNSLDLAVLSTPENDEGIRHITLDIMENSLQRSYITMDKDGDGHYDVLSALQKSIRGSDVDASLHYTARLIEAGDLPSLARRLTVIAYEDIGLANPEAQIHTVTALDAAQRIGFPEARILIANVVIDLALSPKSNSAYVAMDKALADLKTSGHLPIPRHLRDGHYSGSKELGNAQDYLYPHNYPGNWVKQDYLPEKIRNHHYFQAEDTGKYE 407
>gi|148989581|ref|ZP_01820913.1| ATPase, AAA family protein [Streptococcus pneumoniae SP6-BS73] >gi|149020859|ref|ZP_01835388.1| ATPase, AAA family protein [Streptococcus pneumoniae SP23-BS72] >gi|168483316|ref|ZP_02708268.1| ATPase, AAA family [Streptococcus pneumoniae CDC1873-00] >gi|168488503|ref|ZP_02712702.1| ATPase, AAA family [Streptococcus pneumoniae SP195] >gi|147924898|gb|EDK75980.1| ATPase, AAA family protein [Streptococcus pneumoniae SP6-BS73] >gi|147930500|gb|EDK81483.1| ATPase, AAA family protein [Streptococcus pneumoniae SP23-BS72] >gi|172043264|gb|EDT51310.1| ATPase, AAA family [Streptococcus pneumoniae CDC1873-00] >gi|183572715|gb|EDT93243.1| ATPase, AAA family [Streptococcus pneumoniae SP195] (423 aa)
Score = 662, Expect = 2.6e-67, Identities = 146/381 (38%), Positives = 234/381 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + D++I ++ +     II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE  ++I++  TTENPFF V PAIRSR+ ++ +E +++  +KE +   L N +      ++L    ++ I   +  D R  F  L + +       + I    L  + NSL      +D+    HYD+LSA  KSIRGSD +A+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D+A+  +      P P HLRD HY+ + +L N + Y YPH+Y  ++V+Q+YLP++++N  +++     + E
  S:    13 TIDQVIGQEHLVGPGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEISEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLESGLVIMIGATTENPFFSVTPAIRSRVQIFELEPLSNQDVKEALQIALSNPERGFDFPIELDEDALDFIATSTNGDLRSAFNSLDLAVLSTPENDEGIRHITLDIMENSLQRSYITMDKDGDGHYDVLSALQKSIRGSDVDASLHYTARLIEAGDLPSLARRLTVIAYEDIGLANPEAQIHTVTALDAAQRIGFPEARILIANVVIDLALSPKSNSAYVAMDKALADLKTSGHLPIPRHLRDGHYSGSKELGNAQDYLYPHNYPGNWVKQDYLPEKIRNHHYFQAEDTGKYE 407
>gi|146319767|ref|YP_001199479.1| recombination factor protein RarA [Streptococcus suis 05ZYH33] >gi|146321966|ref|YP_001201677.1| recombination factor protein RarA [Streptococcus suis 98HAH33] >gi|145690573|gb|ABP91079.1| ATPase related to the helicase subunit of the Holliday junction resolvase [Streptococcus suis 05ZYH33] >gi|145692772|gb|ABP93277.1| ATPase related to the helicase subunit of the Holliday junction resolvase [Streptococcus suis 98HAH33] (428 aa)
Score = 662, Expect = 2.7e-67, Identities = 151/396 (38%), Positives = 238/396 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           S DE+I ++ +     II  MI+ N L S++ +G PG+GK++    I       F  FN+TT+N+  L EI E A      +++++EIHRLNK KQD LL  LE   II++  TTENPFF + PAIRSR+ ++ ++ + ++ +++ +   L + +      + +  + ++ +   +  D R  +  L++ +   +   D     +L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+ DL S+ RRL  + YEDIGLAN         A+ A++ +G PEARI ++ + ++L LSPKSNSA +A+D A+  + K    P PNHLRD HYA + +L N  GY+YPH Y   +V+Q+YLP +L + +++  N   + E        KIK+  K
  S:    13 SIDEVIGQEHLVGPGKIIRRMIDANMLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATTDNQKRLQEIAEEAKFSGGLVLLLDEIHRLNKTKQDFLLPLLENGNIIMIGATTENPFFSILPAIRSRVQIFELQPLQTSHIRQALELALTDSERGFDFPITIEPEALDFLANATNGDLRAAYNSLELAVLSTKECDDGSRYIDLDAVENSLQKSYISMDKNGDAHYDILSALQKSIRGSDVNASLHYAARLIEAEDLPSLARRLTVIAYEDIGLANPEAQIHTVTALEAAQKIGFPEARILIANVVVDLALSPKSNSAYLAMDAALADLRKNGHLPIPNHLRDGHYAGSKELGNAIGYQYPHAYPEKWVDQQYLPDKLLHADYFTANDTGKYERALGMTQEKIKNLKK 422
>gi|148984220|ref|ZP_01817515.1| ATPase, AAA family protein [Streptococcus pneumoniae SP3-BS71] >gi|149006551|ref|ZP_01830250.1| ATPase, AAA family protein [Streptococcus pneumoniae SP18-BS74] >gi|147761849|gb|EDK68812.1| ATPase, AAA family protein [Streptococcus pneumoniae SP18-BS74] >gi|147923509|gb|EDK74622.1| ATPase, AAA family protein [Streptococcus pneumoniae SP3-BS71] (423 aa)
Score = 662, Expect = 2.7e-67, Identities = 146/381 (38%), Positives = 234/381 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + D++I ++ +     II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE  ++I++  TTENPFF V PAIRSR+ ++ +E +++  +KE +   L N +      ++L    ++ I   +  D R  F  L + +       + I    L  + NSL      +D+    HYD+LSA  KSIRGSD +A+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D+A+  +      P P HLRD HY+ + +L N + Y YPH+Y  ++V+Q+YLP++++N  +++     + E
  S:    13 TIDQVIGQEHLVGPGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEISEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLESGLVIMIGATTENPFFSVTPAIRSRVQIFELEPLSNQDVKEALQIALSNPERGFDFPIELDEDALDFIATSTNGDLRSAFNSLDLAVLSTPENDEGIRHITLDIMENSLQRSYITMDKDGDGHYDVLSALQKSIRGSDVDASLHYTARLIEAGDLPSLARRLTVIAYEDIGLANPEAQIHTVTALDAAQKIGFPEARILIANVVIDLALSPKSNSAYVAMDKALADLKTSGHLPIPRHLRDGHYSGSKELGNAQDYLYPHNYPGNWVKQDYLPEKIRNHHYFQAEDTGKYE 407
>gi|15901619|ref|NP_346223.1| recombination factor protein RarA [Streptococcus pneumoniae TIGR4] >gi|111656850|ref|ZP_01407692.1| hypothetical protein SpneT_02001892 [Streptococcus pneumoniae TIGR4] >gi|149011349|ref|ZP_01832596.1| ATPase, AAA family protein [Streptococcus pneumoniae SP19-BS75] >gi|14973288|gb|AAK75863.1| ATPase, AAA family [Streptococcus pneumoniae TIGR4] >gi|147764339|gb|EDK71270.1| ATPase, AAA family protein [Streptococcus pneumoniae SP19-BS75] (423 aa)
Score = 662, Expect = 2.7e-67, Identities = 146/381 (38%), Positives = 234/381 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + D++I ++ +     II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE  ++I++  TTENPFF V PAIRSR+ ++ +E +++  +KE +   L N +      ++L    ++ I   +  D R  F  L + +       + I    L  + NSL      +D+    HYD+LSA  KSIRGSD +A+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D+A+  +      P P HLRD HY+ + +L N + Y YPH+Y  ++V+Q+YLP++++N  +++     + E
  S:    13 TIDQVIGQEHLVGPGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEISEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLESGLVIMIGATTENPFFSVTPAIRSRVQIFELEPLSNQDVKEALQIALSNPERGFDFPIELDEDALDFIATSTNGDLRSAFNSLDLAVLSTPENDEGIRHITLDIMENSLQRSYITMDKDGDGHYDVLSALQKSIRGSDVDASLHYTARLIEAGDLPSLARRLTVIAYEDIGLANPEAQIHTVTALDAAQKIGFPEARILIANVVIDLALSPKSNSAYVAMDKALADLKTSGHLPIPRHLRDGHYSGSKELGNAQDYLYPHNYPGNWVKQDYLPEKIRNHHYFQAEDTGKYE 407
>gi|15903658|ref|NP_359208.1| recombination factor protein RarA [Streptococcus pneumoniae R6] >gi|116516731|ref|YP_817033.1| recombination factor protein RarA [Streptococcus pneumoniae D39] >gi|149002087|ref|ZP_01827041.1| ATPase, AAA family protein [Streptococcus pneumoniae SP14-BS69] >gi|15459285|gb|AAL00419.1| Chromosome segregation helicase [Streptococcus pneumoniae R6] >gi|116077307|gb|ABJ55027.1| ATPase, AAA family protein [Streptococcus pneumoniae D39] >gi|147759896|gb|EDK66886.1| ATPase, AAA family protein [Streptococcus pneumoniae SP14-BS69] (423 aa)
Score = 662, Expect = 2.9e-67, Identities = 146/381 (38%), Positives = 234/381 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + D++I ++ +     II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE  ++I++  TTENPFF V PAIRSR+ ++ +E +++  +KE +   L N +      ++L    ++ I   +  D R  F  L + +       + I    L  + NSL      +D+    HYD+LSA  KSIRGSD +A+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D+A+  +      P P HLRD HY+ + +L N + Y YPH+Y  ++V+Q+YLP++++N  +++     + E
  S:    13 TIDQVIGQEHLVGPGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEISEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLESGLVIMIGATTENPFFSVTPAIRSRVQIFELEPLSNQDVKEALQIALSNPERGFDFPIELDEDALDFIATSTNGDLRSAFNSLDLAVLSTPENDEGIRHITLDIMENSLQRSYITMDKDGDGHYDVLSALQKSIRGSDVDASLHYAARLIEAGDLPSLARRLTVIAYEDIGLANPEAQIHTVTALDAAQKIGFPEARILIANVVIDLALSPKSNSAYVAMDKALADLKTSGHLPIPRHLRDGHYSGSKELGNAQDYLYPHNYPGNWVKQDYLPEKIRNHHYFQAEDTGKYE 407
>gi|168486363|ref|ZP_02710871.1| ATPase, AAA family [Streptococcus pneumoniae CDC1087-00] >gi|183570586|gb|EDT91114.1| ATPase, AAA family [Streptococcus pneumoniae CDC1087-00] (423 aa)
Score = 662, Expect = 3.1e-67, Identities = 146/381 (38%), Positives = 234/381 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + D++I ++ +     II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE  ++I++  TTENPFF V PAIRSR+ ++ +E +++  +KE +   L N +      ++L    ++ I   +  D R  F  L + +       + I    L  + NSL      +D+    HYD+LSA  KSIRGSD +A+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D+A+  +      P P HLRD HY+ + +L N + Y YPH+Y  ++V+Q+YLP++++N  +++     + E
  S:    13 TIDQVIGQEHLVGPGKIIRRMVEANCLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEISEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLESGLVIMIGATTENPFFSVTPAIRSRVQIFELEPLSNQDVKEALQIALSNPERGFDFPIELDEDALDFIATSTNGDLRSAFNSLDLAVLSTPENDEGIRHITLDIMENSLQRSYITMDKDGDGHYDVLSALQKSIRGSDVDASLHYTARLIEAGDLPSLARRLTVIAYEDIGLANPEAQIHTVTALDAAQRIGFPEARILIANVVIDLALSPKSNSAYVAMDKALADLKTSGHLPIPRHLRDGHYSGSKELGNAQDYLYPHNYPGNWVKQDYLPEKIRNHHYFQAEDTGKYE 407
>gi|81176786|ref|ZP_00875776.1| AAA ATPase, central region [Streptococcus suis 89/1591] >gi|80976447|gb|EAP40054.1| AAA ATPase, central region [Streptococcus suis 89/1591] (428 aa)
Score = 661, Expect = 3.6e-67, Identities = 153/396 (38%), Positives = 237/396 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           S DE+I ++ +     II  MI+ N L S++ +G PG+GK++    I       F  FN+TT+N+  L EI E A      +++++EIHRLNK KQD LL  LE   II++  TTENPFF + PAIRSR+ ++ ++ + ++ +++ +   L + +      V +  + ++ +   +  D R  +  L++ +   +   D     +L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+ DL S+ RRL  + YEDIGLAN         A+ A++ +G PEARI ++ + I+L LSPKSNSA +A+D A+  + K    P PNHLRD HYA + +L N  GY+YPH Y   +V+Q+YLP +L   +++  N   + E        KIK+  K
  S:    13 SIDEVIGQEHLVGPGKIIRRMIDANMLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATTDNQKRLQEIAEEAKFSGGLVLMLDEIHRLNKTKQDFLLPLLENGNIIMIGATTENPFFSILPAIRSRVQIFELQPLKTSHIRQALELALTDSERGFDFPVTIEPEALDFLANATNGDLRAAYNSLELAVLSTKESDDGSRHIDLDAVENSLQKSYISMDKNGDAHYDILSALQKSIRGSDVNASLHYAARLIEAEDLPSLARRLTVIAYEDIGLANPEAQIHTVTALEAAQKIGFPEARILIANVVIDLALSPKSNSAYLAMDAALADLRKNGHLPIPNHLRDGHYAGSKELGNAIGYQYPHAYPEKWVDQQYLPDKLLAADYFTANDTGKYERALGMTQEKIKNLKK 422
>gi|148995370|ref|ZP_01824100.1| ATPase, AAA family protein [Streptococcus pneumoniae SP9-BS68] >gi|148997835|ref|ZP_01825399.1| ATPase, AAA family protein [Streptococcus pneumoniae SP11-BS70] >gi|168491890|ref|ZP_02716033.1| ATPase, AAA family [Streptococcus pneumoniae CDC0288-04] >gi|168575029|ref|ZP_02720992.1| ATPase, AAA family [Streptococcus pneumoniae MLV-016] >gi|147756334|gb|EDK63376.1| ATPase, AAA family protein [Streptococcus pneumoniae SP11-BS70] >gi|147926761|gb|EDK77823.1| ATPase, AAA family protein [Streptococcus pneumoniae SP9-BS68] >gi|183573935|gb|EDT94463.1| ATPase, AAA family [Streptococcus pneumoniae CDC0288-04] >gi|183578824|gb|EDT99352.1| ATPase, AAA family [Streptococcus pneumoniae MLV-016] (423 aa)
Score = 661, Expect = 3.9e-67, Identities = 145/381 (38%), Positives = 234/381 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + D++I ++ +     II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE  ++I++  TTENPFF V PAIRSR+ ++ +E +++  +KE +   L N +      ++L    ++ I   +  D R  F  L + +       + I    L  + NSL      +D+    HYD+LSA  KSIRGSD +A+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D+A+  +      P P HLRD HY+ + +L N + Y YPH+Y  ++++Q+YLP++++N  +++     + E
  S:    13 TIDQVIGQEHLVGPGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEISEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLESGLVIMIGATTENPFFSVTPAIRSRVQIFELEPLSNQDVKEALQIALSNPERGFDFPIELDEDALDFIATSTNGDLRSAFNSLDLAVLSTPENDEGIRHITLDIMENSLQRSYITMDKDGDGHYDVLSALQKSIRGSDVDASLHYTARLIEAGDLPSLARRLTVIAYEDIGLANPEAQIHTVTALDAAQKIGFPEARILIANVVIDLALSPKSNSAYVAMDKALADLKTSGHLPIPRHLRDGHYSGSKELGNAQDYLYPHNYPGNWIKQDYLPEKIRNHHYFQAEDTGKYE 407
>gi|169833738|ref|YP_001695164.1| chromosome segregation helicase [Streptococcus pneumoniae Hungary19A-6] >gi|168996240|gb|ACA36852.1| chromosome segregation helicase [Streptococcus pneumoniae Hungary19A-6] (423 aa)
Score = 660, Expect = 4.4e-67, Identities = 146/381 (38%), Positives = 234/381 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + D++I ++ +     II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE  ++I++  TTENPFF V PAIRSR+ ++ +E +++  +KE +   L N +      ++L    ++ I   +  D R  F  L + +       + I    L  + NSL      +D+    HYD+LSA  KSIRGSD +A+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D+A+  +      P P HLRD HY+ + +L N + Y YPH+Y  ++V+Q+YLP++++N  +++     + E
  S:    13 TIDQVIGQEHLVGPGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEISEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLESGLVIMIGATTENPFFSVTPAIRSRVQIFELEPLSNQDVKEALQIALSNPERGFNFPIELDEDALDFIATSTNGDLRSAFNSLDLAVLSTPENDEGIRHITLDIMENSLQRSYITMDKDGDGHYDVLSALQKSIRGSDVDASLHYAARLIEAGDLPSLARRLTVIAYEDIGLANPEAQIHTVTALDAAQKIGFPEARILIANVVIDLALSPKSNSAYVAMDKALADLKTSGHLPIPRHLRDGHYSGSKELGNAQDYLYPHNYPGNWVKQDYLPEKIRNHHYFQAEDTGKYE 407
>gi|94989334|ref|YP_597435.1| recombination factor protein RarA [Streptococcus pyogenes MGAS9429] >gi|94993223|ref|YP_601322.1| recombination factor protein RarA [Streptococcus pyogenes MGAS2096] >gi|94542842|gb|ABF32891.1| ATPase, AAA family [Streptococcus pyogenes MGAS9429] >gi|94546731|gb|ABF36778.1| ATPase, AAA family [Streptococcus pyogenes MGAS2096] (422 aa)
Score = 660, Expect = 4.9e-67, Identities = 149/381 (39%), Positives = 229/381 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           +  E+I +  +  +  II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E +++  +K  +   + +K+      V + ++ ++ IV  +  D R  +  L + +       D      L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D A+  +      P P HLRD HYA + +L N K Y YPH Y   +V+Q+YLP +L    +++ N+  + E
  S:    13 TISEVIGQKHLVGEGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTRYAFRTFNATIDSKKRLQEIAEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLENGTIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEDIKTAIQLAISDKERGFPFLVTIDDEALDFIVTATNGDLRSAYNSLDLAVMSTSPNEDGSRHISLETMENSLQRSYITMDKNGDGHYDVLSALQKSIRGSDVNASLHYAARLVEAGDLPSLARRLTIIAYEDIGLANPDAQVHTVTALDAAQRIGFPEARILIANVVIDLALSPKSNSAYLAMDAALADLRTSGNLPIPRHLRDGHYAGSKELGNAKDYLYPHAYPEKWVKQQYLPDKLVGHHYFEANETGKYE 407
>gi|168494301|ref|ZP_02718444.1| chromosome segregation helicase [Streptococcus pneumoniae CDC3059-06] >gi|183575836|gb|EDT96364.1| chromosome segregation helicase [Streptococcus pneumoniae CDC3059-06] (423 aa)
Score = 660, Expect = 5.0e-67, Identities = 146/381 (38%), Positives = 234/381 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + D++I ++ +     II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE  ++I++  TTENPFF V PAIRSR+ ++ +E +++  +KE +   L N +      ++L    ++ I   +  D R  F  L + +       + I    L  + NSL      +D+    HYD+LSA  KSIRGSD +A+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D+A+  +      P P HLRD HY+ + +L N + Y YPH+Y  ++V+Q+YLP++++N  +++     + E
  S:    13 TIDQVIGQEHLVGPGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEISEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLESGLVIMIGATTENPFFSVTPAIRSRVQIFELEPLSNQDVKEALQIALSNPERGFDFPIELDEDALDFIATSTNGDLRSAFNSLDLAVLSTPENDEGIRHITLDIMENSLQRSYITMDKDGDGHYDVLSALQKSIRGSDVDASLHYAARLIEAGDLPSLARRLTVIAYEDIGLANPEAQIHTVTALDAAQRIGFPEARILIANVVIDLALSPKSNSAYVAMDKALADLKASGHLPIPRHLRDEHYSGSKELGNAQDYLYPHNYPGNWVKQDYLPEKIRNHHYFQAEDTGKYE 407
>gi|81428450|ref|YP_395450.1| recombination factor protein RarA [Lactobacillus sakei subsp. sakei 23K] >gi|78610092|emb|CAI55141.1| Putative DNA-replication helicase [Lactobacillus sakei subsp. sakei 23K] (426 aa)
Score = 659, Expect = 5.5e-67, Identities = 147/379 (38%), Positives = 225/379 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS-------DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN---KYSQ 391
           + DE++ +  +     II  M++   L S++ +G PG GK++    I       F   N+ T++K DL  + E A      I++++EIHRL+K KQD LL +LE   I+++  TTENP+  +NPAIRSR  ++ +  +N A +   + + L + +       V L     + + +++  D R     L++ ++             D  V++E  +      D+    HYD++SAF KS+RGSD +AA++Y+ +L+E+GDL S+ RRL  + YED+GLAN     +   AV A++ LG PEARIPL+   I+LCLSPKSNSAI AID A+  +   +A   P HL+DAHYA A KL +   YKYPH+Y   +V Q+YLP +L    +Y+     KY Q
  S:    13 NIDEIVGQTHLVGPQKIIRRMVDAKLLSSMILYGPPGTGKTSIASAIAGSTQYAFRMLNAATDSKKDLQIVAEEAKMSGTVILLLDEIHRLDKTKQDFLLPHLESGRIVLIGATTENPYITINPAIRSRTQIFEVHPLNEADIHVAIQRALTDPQKGLGDEPVNLDETAEKYLAQVTNGDLRSALNALELAVRSTPKNPETGLIDIDIAVIEECVQRKAITHDKDGDAHYDVISAFQKSVRGSDVDAALHYMGRLIEAGDLPSISRRLMTMAYEDVGLANPQACARTVEAVTAAKQLGFPEARIPLAVAVIDLCLSPKSNSAITAIDNALGDIRAGKAGEVPAHLKDAHYAGAAKLGHGVDYKYPHNYPNDWVAQDYLPTKLLGSHYYEAKATGKYEQ 410
>gi|28378917|ref|NP_785809.1| recombination factor protein RarA [Lactobacillus plantarum WCFS1] >gi|28271754|emb|CAD64660.1| chromosome segregation helicase (putative) [Lactobacillus plantarum WCFS1] (426 aa)
Score = 659, Expect = 6.2e-67, Identities = 147/381 (38%), Positives = 218/381 (57%)
  Q:    29 IIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           II  M++   L S++ +G PG GK++    I       F   N+ T++K  L  + E A      I++++EIHRL+K KQD LL +LE   II++  TTENP+  +NPAIRSR  ++++  +    ++  V + L ++K       V L+   +  +   +  D R     L++ +       D  +      I   L       D+    HYD++SAF KSIRGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLAN        AAV A++ LG PEARIPL+   IEL LSPKSNS I AID A+ +V        P  ++DAHY  A KL +  GY +PHD+   +V Q+YLP  +K+ ++Y+P    + E      + K+   N++
  S:    29 IIARMVKAKRLSSMILYGPPGTGKTSIASAIAGSTKYAFRMLNAATDSKKQLQIVAEEAKMSGTVILLLDEIHRLDKTKQDFLLPHLESGRIILIGATTENPYISINPAIRSRTQIFQVFPLTDDDIQHAVERALADEKNGLGSYHVDLAPAAMHHLCTATNGDLRSALNGLELAVLSSSPADDGTIAISQQTIEECLQKKALSADKDGDAHYDVISAFQKSIRGSDVNAALHYLARLVEAGDLKSIMRRLMVIAYEDIGLANPAACAHTVAAVQAADQLGFPEARIPLADAVIELALSPKSNSGISAIDAALTTVRDGHFGDIPADIKDAHYQGAAKLGHGVGYDFPHDHPGDWVAQQYLPDAIKSAKYYEPKTNGRYETALAQQYEKLLKANER 424
>gi|71911512|ref|YP_283062.1| recombination factor protein RarA [Streptococcus pyogenes MGAS5005] >gi|71854294|gb|AAZ52317.1| ATPase, AAA family [Streptococcus pyogenes MGAS5005] (422 aa)
Score = 659, Expect = 7.1e-67, Identities = 149/381 (39%), Positives = 228/381 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           +  E+I +  +  +  II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E +++  +K  +   + +K+      V + ++ ++ IV  +  D R  +  L + +       D      L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D A+  +      P P HLRD HYA +  L N K Y YPH Y   +V+Q+YLP +L    +++ N+  + E
  S:    13 TISEVIGQKHLVGEGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTRYAFRTFNATIDSKKRLQEIAEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLENGTIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEDIKTAIQLAISDKERGFPFLVTIDDEALDFIVTATNGDLRSAYNSLDLAVMSTSPNEDGSRHISLETMENSLQRSYITMDKNGDGHYDVLSALQKSIRGSDVNASLHYAARLVEAGDLPSLARRLTIIAYEDIGLANPDAQVHTVTALDAAQRIGFPEARILIANVVIDLALSPKSNSAYLAMDAALADLRTSGNLPIPRHLRDGHYAGSKDLGNAKDYLYPHAYPEKWVKQQYLPDKLVGHHYFEANETGKYE 407
>gi|71904346|ref|YP_281149.1| recombination factor protein RarA [Streptococcus pyogenes MGAS6180] >gi|139474470|ref|YP_001129186.1| recombination factor protein RarA [Streptococcus pyogenes str. Manfredo] >gi|71803441|gb|AAX72794.1| ATPase, AAA family [Streptococcus pyogenes MGAS6180] >gi|134272717|emb|CAM30989.1| putative ATPase [Streptococcus pyogenes str. Manfredo] (422 aa)
Score = 658, Expect = 7.8e-67, Identities = 149/381 (39%), Positives = 228/381 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           +  E+I +  +  +  II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E +++  +K  +   + +K+      V + ++ ++ IV  +  D R  +  L + +       D      L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D A+  +      P P HLRD HYA +  L N K Y YPH Y   +V+Q+YLP +L    +++ N+  + E
  S:    13 TISEVIGQKHLVGEGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTRYAFRTFNATIDSKKRLQEIAEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLENGTIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEDIKTAIQLAISDKERGFPFLVTIDDEALDFIVTATNGDLRSAYNSLDLAVMSTSPNEDSSRHISLETMENSLQRSYITMDKNGDGHYDVLSALQKSIRGSDVNASLHYAARLVEAGDLPSLARRLTIIAYEDIGLANPDAQVHTVTALDAAQRIGFPEARILIANVVIDLALSPKSNSAYLAMDAALADLRTSGNLPIPRHLRDGHYAGSKDLGNAKDYLYPHAYPEKWVKQQYLPDKLVGHHYFEANETGKYE 407
>gi|19746896|ref|NP_608032.1| recombination factor protein RarA [Streptococcus pyogenes MGAS8232] >gi|94995187|ref|YP_603285.1| recombination factor protein RarA [Streptococcus pyogenes MGAS10750] >gi|19749141|gb|AAL98531.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232] >gi|94548695|gb|ABF38741.1| ATPase, AAA family [Streptococcus pyogenes MGAS10750] (422 aa)
Score = 658, Expect = 7.8e-67, Identities = 149/381 (39%), Positives = 228/381 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           +  E+I +  +  +  II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E +++  +K  +   + +K+      V + ++ ++ IV  +  D R  +  L + +       D      L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D A+  +      P P HLRD HYA +  L N K Y YPH Y   +V+Q+YLP +L    +++ N+  + E
  S:    13 TISEVIGQKHLVGEGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTRYAFRTFNATIDSKKRLQEIAEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLENGTIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEDIKTAIQLAISDKERGFPFLVTIDDEALDFIVTATNGDLRSAYNSLDLAVMSTSPNEDSSRHISLETMENSLQRSYITMDKNGDGHYDVLSALQKSIRGSDVNASLHYAARLVEAGDLPSLARRLTIIAYEDIGLANPDAQVHTVTALDAAQRIGFPEARILIANVVIDLALSPKSNSAYLAMDAALADLRTSGNLPIPRHLRDGHYAGSKDLGNAKDYLYPHAYPEKWVKQQYLPDKLVGHHYFEANETGKYE 407
>gi|161507285|ref|YP_001577239.1| recombination factor protein RarA [Lactobacillus helveticus DPC 4571] >gi|160348274|gb|ABX26948.1| Chromosomal segregation helicase [Lactobacillus helveticus DPC 4571] (437 aa)
Score = 658, Expect = 7.9e-67, Identities = 158/392 (40%), Positives = 233/392 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEA-------IVEISKSDFRQIFFYLKIV-------LKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           + D+++ +  +     II  M+E   L S++ +G PG+GK++    I       F   N+ T+ K  L ++          I++++EIHRL+K KQD LL  LE   II++  TTENP+  ++PAIRSR  ++ ++ +++      + + L +K+  L N  VE        ++E    D R     L++        LK     +D IV+ +  ++ +S+       D     HYDL+SAF KSIRGSD +AA++YLA+L+ESGDLIS+ RRL  + YEDIGLAN         A+ A++ LG PEARIPL+   IEL LSPKSNSAI AID AI  V NK   S P +L+DAHY+ A KL +   Y YPHD+   +V Q+YLP  L N  ++ P   S+ E ++   + K+K
  S:    12 NLDQVVGQQHLIGPGKIIRRMVEARLLSSMILYGPPGIGKTSIASAIAGSTKYAFRKLNAATDGKKQLQQVAAEGKMSGTVILLLDEIHRLDKTKQDFLLPLLESGQIILIGATTENPYISISPAIRSRCQIFELKPLSAQDASSAIDRALTDKENGLGNYPVELTDDARSLLIEKGNGDLRSTLNSLELAVLSTKQELKDNHQDTDSIVITQ-QEMADSIQMKVQNFDSSGDGHYDLVSAFQKSIRGSDTDAALHYLAKLIESGDLISICRRLSVIAYEDIGLANPSAAEHAILAIQAAQTLGFPEARIPLANAVIELALSPKSNSAITAIDRAIYDVKNKNIGSIPVNLKDAHYSGAKKLGHGVNYIYPHDFENDWVAQQYLPDNLLNASYFTPKGNSKVEERYKLIYQKLK 424
>gi|21911250|ref|NP_665518.1| recombination factor protein RarA [Streptococcus pyogenes MGAS315] >gi|28896626|ref|NP_802976.1| recombination factor protein RarA [Streptococcus pyogenes SSI-1] >gi|21905463|gb|AAM80321.1| putative chromosome segregation helicase [Streptococcus pyogenes MGAS315] >gi|28811880|dbj|BAC64809.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1] (422 aa)
Score = 656, Expect = 1.4e-66, Identities = 148/381 (38%), Positives = 228/381 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           +  E+I +  +  +  II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E +++  +K  +   + +K+      V + ++ ++ IV  +  D R  +  L + +       D      L  + NSL      +D+    HYD+LSA  K+IRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D A+  +      P P HLRD HYA +  L N K Y YPH Y   +V+Q+YLP +L    +++ N+  + E
  S:    13 TISEVIGQKHLVGQGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATIDSKKRLQEIAEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLENGTIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEDIKTAIQLAISDKERGFPFLVTIDDEALDFIVTATNGDLRSAYNSLDLAVMSTSPNEDSSRHISLETMENSLQRSYITMDKNGDGHYDVLSALQKAIRGSDVNASLHYAARLVEAGDLPSLARRLTIIAYEDIGLANPDAQVHTVTALDAAQRIGFPEARILIANVVIDLALSPKSNSAYLAMDAALADLRTSGNLPIPRHLRDGHYAGSKDLGNAKDYLYPHAYPEKWVKQQYLPDKLVGHHYFEANETGKYE 407
>gi|94991276|ref|YP_599376.1| recombination factor protein RarA [Streptococcus pyogenes MGAS10270] >gi|94544784|gb|ABF34832.1| ATPase, AAA family [Streptococcus pyogenes MGAS10270] (422 aa)
Score = 655, Expect = 1.9e-66, Identities = 148/381 (38%), Positives = 229/381 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           +  E+I +  +  +  II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E +++  +K  +   + +K+      V + ++ ++ IV  +  D R  +  L + +       D      L  + NSL      +D+    HYD+LSA  K+IRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D A+  +      P P HLRD HYA + +L N K Y YPH Y   +V+Q+YLP +L    +++ N+  + E
  S:    13 TISEVIGQKHLVGEGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTRYAFRTFNATIDSKKRLQEIAEEAKFSGGLVLLLDEIHRLDKIKQDFLLPLLENGTIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEDIKTAIQLAISDKERGFPFLVTIDDEALDFIVTATNGDLRSAYNSLDLAVMSTSPNEDSSRHISLETMENSLQRSYITMDKDGDGHYDVLSALQKAIRGSDVNASLHYAARLVEAGDLPSLARRLIVIAYEDIGLANPDAQVHTVTALDAAQKIGFPEARILIANVVIDLALSPKSNSAYLAMDAALSDLRTSGNLPIPRHLRDGHYAGSKELGNAKDYLYPHAYPKKWVKQQYLPDKLVGHHYFEANETGKYE 407
>gi|47458682|gb|AAT28003.1| ATPase [Mycoplasma mobile 163K] (372 aa)
Score = 654, Expect = 2.1e-66, Identities = 155/364 (42%), Positives = 232/364 (63%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK--VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI-VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEAL-SPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           S +F+G  G+GK+ +   I K+  +++  FN T ++K +LLE L +       I+II+E+HRLNKDKQ++LL YLE D II+ ATTTENP+FK+ P++RSRL + R   ++   + + +   +E  K  +K+++ ++ +IV+ S  DFR     L ++   Y N + D   +K++    N   D+ A  HYD LSAFHKS+RGSDP+AA+YY   L ++GD+ ++ RRL  V YEDI LAN     KV+AA+NA E +G PEA   L++I IE+ LSPKSNS  +++++ +  +N   +   P+HL+D HY ++ K N   Y YPHD+  +YV Q YLP EL+   F++    +QNE K   YW KIK
  S:     3 SFIFYGESGIGKTTAATVIAKEKQESYDVFNPTIHSKKELLEKLAI-----NKILIIDELHRLNKDKQEILLSYLEDDKIILYATTTENPYFKIIPSLRSRLKILRFNKLSETEIFQGLKNIIEKYKLKIKINDDLLLSIVKFSAGDFRNAINNLDLIETIYPNTNVDFESIKKIFPSMNFYTDKDADKHYDTLSAFHKSLRGSDPDAALYYGMLLAKAGDIDALLRRLIMVAYEDIALANPNASIKVDAAINAIERVGFPEANTILAKIIIEIALSPKSNSTYVSMNKILDKINNGNIYDIPDHLKDTHYKNSAKFNRPKYLYPHDFENNYVNQNYLPIELEKNHFFEFAN-NQNEQKIKSYWEKIK 364
>gi|188159346|ref|ZP_02512546.2| recombination factor protein RarA [Mycoplasma mycoides subsp. mycoides LC str. GM12] (411 aa)
Score = 654, Expect = 2.6e-66, Identities = 160/390 (41%), Positives = 249/390 (63%)
  Q:    16 EMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE------NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNK-SDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKS 405
           ++I +  I   + +I  MI N+   S++F+G  GVGK++    +   L  ++  FN++ + K  L  I++ A   ++ I+II+EIHRLNKDKQD+LL Y+EK  I V +TTTENPFF +NPA+RSR LL  ++ +N    K E+I Y +        K+ +S++ ++ + ++S  D R    YL+++ + Y ++  D   +K +  ++ +   + + + +DL SA  KSIRGSD +AA+YY ++L+E+GD  S+ RR+  + YEDIGLAN  +  +V  A NA   +G PE  IPL    +E+ LS KSNSA +A + A+  V N    + P HL+D HY SAVKL +   YKYPHDY   +VEQ+YLP E+KNK+FY  +K +Q E+K  + +N++K+
  S:    16 DIIGQTEILKPNGLINKMILNDYCTSLIFYGPSGVGKTSFAISLANDLKIDYEIFNASYDKKEKLTSIIQKALLQDRFILIIDEIHRLNKDKQDILLEYMEKGNIFVFSTTTENPFFVINPALRSRSLLIELKTVN----KNELISYAKKIIDQYQLKINISDEALDFLAQLSVGDVRTFLNYLELIDRLYSDEFIDIKKIKTIITVSKNPTAQDSDDFHDLKSALQKSIRGSDVDAALYYFSRLIETGDYESLMRRMIIISYEDIGLANPAIPSRVVQACNAFRQIGFPEGIIPLGLAIVEMSLSLKSNSAYLATNSALDFVKNGNIYNVPKHLKDNHYKSAVKLGIGIDYKYPHDYENDWVEQQYLPDEIKNKKFYN-HKNNQYESKVYELYNRMKN 409
>gi|116493046|ref|YP_804781.1| recombination factor protein RarA [Pediococcus pentosaceus ATCC 25745] >gi|116103196|gb|ABJ68339.1| Recombination protein MgsA [Pediococcus pentosaceus ATCC 25745] (425 aa)
Score = 650, Expect = 7.3e-66, Identities = 148/396 (37%), Positives = 231/396 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATN------HYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           + +E++ +  +     II  M++   L S++ +G PG GK++    I       F   N+ T++K DL  + E A      I++++EIHRL+K KQD LL +LE   II++  TTENP+  +NPAIRSR  ++ ++ +    +K+ V+  +++         + +    ++ + E +  D R     +++  +      +  +   L  +   L  R  T       HYD++SAF KSIRGSD +AA++Y+A+LLESGDL SV RRL  + YEDIGLAN     +  +AV A+E +GLPEARIPL+   IELC+SPKSNS I AID A+  V    +   P+HLRD+HY  A  L  +G  YKYPH+Y   ++ Q+YLP +L +  ++     S  E K  + +  +K + +
  S:    12 TIEEIVGQQHLVGPGKIIDRMVKAKLLSSMILYGPPGTGKTSIASAISGSTKYAFRILNAATDSKKDLQIVAEEAKMSGTVILLLDEIHRLDKTKQDFLLPHLENGNIILIGATTENPYININPAIRSRTQIFEVKPLQPDEIKKAVLAAIKDSSRGLGELPIVIDEDALKFVSESTNGDLRSALNAVELAARSTGPDENQKIHLTLAILEECLQKRALTQDKDGDAHYDVISAFQKSIRGSDTDAALHYMARLLESGDLQSVIRRLLIIAYEDIGLANPPACQRTVSAVTAAEHVGLPEARIPLADAVIELCVSPKSNSGISAIDNALTDVRTGKIGEVPDHLRDSHYKGAAALG-RGVDYKYPHNYPNDWIAQQYLPDKLVDAAYFDAKGNSTYEEKIKNRYESLKKSQR 422
>gi|22538114|ref|NP_688965.1| recombination factor protein RarA [Streptococcus agalactiae 2603V/R] >gi|76799348|ref|ZP_00781508.1| ATPase, AAA family [Streptococcus agalactiae 18RS21] >gi|22535021|gb|AAN00838.1|AE014281_7 ATPase, AAA family [Streptococcus agalactiae 2603V/R] >gi|76585295|gb|EAO61893.1| ATPase, AAA family [Streptococcus agalactiae 18RS21] (422 aa)
Score = 648, Expect = 1.2e-65, Identities = 147/381 (38%), Positives = 229/381 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + +E+I +  +     II  M+  N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E +++  +K+ +   + +K+      V + ++ ++ IV  +  D R  +  L + +       D      L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A+ A++ +G PEARI ++ I ++L LSPKSNSA +A+D A+  + +    P P HLRD HY+ +  L N + YKYPH Y   +V+Q+YLP +L    +++ N+  + E
  S:    13 NINEVIGQQHLVGNGKIIDRMVAANMLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEIAEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLENGNIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEDIKKAIQLAISDKERGFPFLVTIDDEALDFIVTATNGDLRSAYNSLDLAVMSTSPNEDGSRHISLETMENSLQCSYITMDKNGDGHYDILSALQKSIRGSDVNASLHYAARLVEAGDLPSLARRLTIIAYEDIGLANPEAQIHTVTALEAAQRIGFPEARILIANIVVDLALSPKSNSAYLAMDAALADLRRSGNLPIPRHLRDGHYSGSKTLGNARDYKYPHAYPEKWVKQQYLPDKLVGHNYFEANETGKYE 407
>gi|90962054|ref|YP_535970.1| recombination factor protein RarA [Lactobacillus salivarius UCC118] >gi|90821248|gb|ABD99887.1| ATPase, AAA family [Lactobacillus salivarius UCC118] (423 aa)
Score = 648, Expect = 1.3e-65, Identities = 146/393 (37%), Positives = 236/393 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYY-QNKSDDIVL-----KELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKS 405
           + D+++ +  +     II  M+E   L S++ +G PG GK++    I       F   N+ T++K  L +++E A      I++++EIHRL K KQD LL +LE   II++  TTENP+  +NPAIRSR  ++ +  +N   + + + + + +K        +++++  +  +   +  D R     L++  K   +N   +IVL     +E  +    + D+    HY+++SA  KSIRGSD +AA++YLA+L+E+ DL S+ RRL  + YEDIGLAN     +   A+ A+E +G PEARIPL+   IELCLSPKSNS I AID A+  +        P++L+DAHY+ A +L     YKYPHDY   +V+Q+YLP +LK+K++Y P +  + E      ++++K+
  S:    12 NIDDVVGQQHLVGPGKIIRRMVEAKLLSSMILYGPPGTGKTSIASAIAGSTKYAFRKMNAATDSKKKLEQVVEEAKFSGTVILLLDEIHRLTKPKQDFLLPHLEDGHIILIGATTENPYISINPAIRSRTQIFEVHPLNEDDIIQAINRAITDKDDGLGELPLQINDDAMHQLAIATHGDLRSTLNALELAAKSTPKNSEGNIVLTLEIIEECMQRKALVQDKDGDAHYNVISALQKSIRGSDVDAALHYLARLIEAEDLPSISRRLITIAYEDIGLANLPAATRTVLAIQAAEKIGFPEARIPLADTVIELCLSPKSNSGISAIDAALSDIRAGNYGDIPDYLKDAHYSGAKELGHGIDYKYPHDYPHDWVKQQYLPNKLKSKQYYHPKQNGRYEESLGKQYHRLKN 419
>gi|25012002|ref|NP_736397.1| recombination factor protein RarA [Streptococcus agalactiae NEM316] >gi|77412913|ref|ZP_00789117.1| ATPase, AAA family [Streptococcus agalactiae 515] >gi|24413545|emb|CAD47623.1| Unknown [Streptococcus agalactiae NEM316] >gi|77161053|gb|EAO72160.1| ATPase, AAA family [Streptococcus agalactiae 515] (422 aa)
Score = 647, Expect = 1.6e-65, Identities = 147/381 (38%), Positives = 229/381 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + +E+I +  +     II  M+  N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E +++  +K+ +   + +K+      V + ++ ++ IV  +  D R  +  L + +       D      L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A+ A++ +G PEARI ++ I ++L LSPKSNSA +A+D A+  + +    P P HLRD HY+ +  L N + YKYPH Y   +V+Q+YLP +L    +++ N+  + E
  S:    13 NINEVIGQQHLVGNGKIIDRMVAANMLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEIAEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLENGNIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEDIKKAIQLAISDKERGFPFLVTIDDEALDFIVTATNGDLRSAYNSLDLAVMSTSPNEDGSRHISLETMENSLQRSYITMDKNGDGHYDILSALQKSIRGSDVNASLHYAARLVEAGDLPSLARRLTIIAYEDIGLANPEAQIHTVTALEAAQRIGFPEARILIANIVVDLALSPKSNSAYLAMDAALADLRRSGNLPIPRHLRDGHYSGSKTLGNARDYKYPHAYPEKWVKQQYLPDKLVGHNYFEANETGKYE 407
>gi|76787547|ref|YP_330532.1| recombination factor protein RarA [Streptococcus agalactiae A909] >gi|77405039|ref|ZP_00782139.1| ATPase, AAA family [Streptococcus agalactiae H36B] >gi|76562604|gb|ABA45188.1| ATPase, AAA family [Streptococcus agalactiae A909] >gi|77176333|gb|EAO79102.1| ATPase, AAA family [Streptococcus agalactiae H36B] (422 aa)
Score = 645, Expect = 2.6e-65, Identities = 147/381 (38%), Positives = 229/381 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + +E+I +  +     II  M+  N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E +++  +K+ +   + +K+      V + ++ ++ I+  +  D R  +  L + +       D      L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A+ A++ +G PEARI ++ I ++L LSPKSNSA +A+D A+  + +    P P HLRD HY+ +  L N K YKYPH Y   +V+Q+YLP +L    +++ N+  + E
  S:    13 NINEIIGQQHLVGNGKIIDRMVAANMLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEIAEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLENGNIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEDIKKAIQLAISDKERGFPFLVTIDDEALDFIITATNGDLRSAYNSLDLAVMSTSPNEDGSRHISLETMENSLQRSYITMDKNGDGHYDVLSALQKSIRGSDVNASLHYAARLVEAGDLPSLARRLTIIAYEDIGLANPEAQIHTVTALEAAQRIGFPEARILIANIVVDLALSPKSNSAYLAMDAALADLRRSGNLPIPRHLRDGHYSGSKTLGNAKDYKYPHAYPEKWVKQQYLPDKLVGHNYFEANETGKYE 407
>gi|77409126|ref|ZP_00785840.1| ATPase, AAA family [Streptococcus agalactiae COH1] >gi|77172254|gb|EAO75409.1| ATPase, AAA family [Streptococcus agalactiae COH1] (422 aa)
Score = 645, Expect = 2.8e-65, Identities = 147/381 (38%), Positives = 228/381 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + +E+I +  +     II  M+  N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E +++  +K+ +   + +K+      V + +  ++ IV  +  D R  +  L + +       D      L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A+ A++ +G PEARI ++ I ++L LSPKSNSA +A+D A+  + +    P P HLRD HY+ +  L N + YKYPH Y   +V+Q+YLP +L    +++ N+  + E
  S:    13 NINEVIGQQHLVGNGKIIDRMVAANMLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEIAEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLENGNIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEDIKKAIQLAISDKERGFPFLVTIDDGALDFIVTATNGDLRSAYNSLDLAVMSTSPNEDGSRHISLETMENSLQRSYITMDKNGDGHYDVLSALQKSIRGSDVNASLHYAARLVEAGDLPSLARRLTIIAYEDIGLANPEAQIHTVTALEAAQRIGFPEARILIANIVVDLALSPKSNSAYLAMDAALADLRRSGNLPIPRHLRDGHYSGSKTLGNARDYKYPHAYPEKWVKQQYLPDKLVGHNYFEANETGKYE 407
>gi|77411974|ref|ZP_00788304.1| ATPase, AAA family [Streptococcus agalactiae CJB111] >gi|77162000|gb|EAO72981.1| ATPase, AAA family [Streptococcus agalactiae CJB111] (422 aa)
Score = 641, Expect = 8.2e-65, Identities = 146/381 (38%), Positives = 229/381 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + +E+I +  +     II  M+  N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E +++  +K+ +   + +K+      V + ++ ++ IV  +  D R  +  L + +       D      L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A+ A++ +G PEARI ++ I ++L LSPKSNSA +A++ A+  + +    P P HLRD HY+ +  L N + YKYPH Y   +V+Q+YLP +L    +++ N+  + E
  S:    13 NINEVIGQQHLVGNGKIIDRMVAANMLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEIAEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLENGNIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEDIKKAIQLAISDKERGFPFLVTIDDEALDFIVTATNGDLRSAYNSLDLAVMSTSPNEDGSRHISLETMENSLQRSYITMDKNGDGHYDVLSALQKSIRGSDVNASLHYAARLVEAGDLPSLARRLTIIAYEDIGLANPEAQIHTVTALEAAQRIGFPEARILIANIVVDLALSPKSNSAYLAMNAALADLRRSGNLPIPRHLRDGHYSGSKTLGNARDYKYPHAYPEKWVKQQYLPDKLVGHNYFEANETGKYE 407
>gi|116618925|ref|YP_819296.1| recombination factor protein RarA [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097772|gb|ABJ62923.1| Recombination protein MgsA [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (428 aa)
Score = 640, Expect = 1.1e-64, Identities = 146/390 (37%), Positives = 236/390 (60%)
  Q:    15 DEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLS--NKVVE--AIVEISKS---DFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           +E++ +  +  +  II  M+  + L S++ +G PG GK++    I       F   N+ T+++ DL  ++E A      +++++EIHRLNK KQD LL +LE   II++  TTENP+  V PAIRSR  ++ + +++   +   V + + +K+  L   N V++  A++++S++   D R     L++ +   +     +V   L  I  ++       D+    HYD++SA  KSIRGSD +AA++Y A+++ESGDL  + RRL  + YEDIGLAN     +   A+ A++ LG PEARIP++   IEL LSPKSNSA  AID AI  V + ++   P+HL+DAHY  + +LN    Y YPHDY+  +V Q+YLP ++ N +++ P   S+ E +  D +  +K
  S:    16 EEIVGQQHLVGEGKIIWRMVAAHRLSSMILYGPPGTGKTSIASAIAGSSKYAFRMLNAATDSQKDLQIVVEEAKMSGTVVLLLDEIHRLNKIKQDFLLPHLESGAIILIGATTENPYINVTPAIRSRTQIFEVNSLSETDITSAVKRAIADKEKGLGQYNIVLDDNAMLQLSRATNGDLRSALNGLELAVLSTKADKKGVVHISLPIIEETVQRKALSADKDGDAHYDVISALQKSIRGSDTDAALHYAARIIESGDLPILARRLTVIAYEDIGLANPPAAQRAVTAIQAAQTLGFPEARIPIANAIIELSLSPKSNSAYKAIDLAISDVRHGKSYDIPDHLKDAHYKGSSELNHGVDYTYPHDYDNDWVAQQYLPDKMTNTQYFHPKGNSKIEQQLFDVYQTLK 420
>gi|85057568|ref|YP_456484.1| recombination factor protein RarA [Aster yellows witches'-broom phytoplasma AYWB] >gi|42632634|gb|AAS22248.1| AAA type ATPase [Aster yellows witches'-broom phytoplasma] >gi|84789673|gb|ABC65405.1| ATPase, AAA family [Aster yellows witches'-broom phytoplasma AYWB] (414 aa)
Score = 639, Expect = 1.3e-64, Identities = 155/385 (40%), Positives = 235/385 (61%)
  Q:    22 VIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLS--NKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATN-HYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSN 406
           +I  ++ II  M++NN   S++F+G PG+GKS+  Q +   L   +  FN+  + K+ L +I++ A    K I+IIEEIHR+NKD+QD+LL YLE   +I+ A TTENP+F +NP+IRSR+ + ++E I +  +   + K + NKK+ L+     +  I ++S  D R     L++ L  Y  +     + +    + +LI+ +  + H++L SA  KSIRGSD +AA++Y A+LL SGD  ++ RR+    YEDIGLAN  +   V  A++A   +GLPE RIPL    IE+CLS KSNSA +A ++A + V      + P HL+D  Y SA KL +   YKYPH++  +YV Q+YLP+E+K   +Y P  +S+ E K      K K N
  S:    24 LINDQNGIISRMLKNNYASSLIFYGVPGIGKSSLAQVLANDLQIKYDIFNAAIDKKSKLEKIIQQALNFKKFILIIEEIHRMNKDRQDILLQYLENGHLIMFACTTENPYFVINPSIRSRVNIIKLERITTEEMLTGLNKLIVNKKLPLNILQDALLLICQLSSGDLRIAINMLELCLHLYPGEEITKKIIKKISSSANLINFKDNDEHHNLKSALQKSIRGSDVDAALHYFARLLASGDHEALIRRMLITAYEDIGLANPMIIIHVKTAIDAFRQIGLPEGRIPLGLAIIEMCLSEKSNSAYLASNKAYEDVLQGNVFNIPKHLQDTSYNSASKLGIGFDYKYPHNFPNNYVNQQYLPQEIKELIYYIPKLHSEYEKKINKIHEKFKQN 413
>gi|163762914|ref|ZP_02169978.1| histidyl-tRNA synthetase [Bacillus selenitireducens MLS10] >gi|160356847|gb|EDP83496.1| histidyl-tRNA synthetase [Bacillus selenitireducens MLS10] (443 aa)
Score = 633, Expect = 6.1e-64, Identities = 149/396 (37%), Positives = 235/396 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELAT-----EDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKEL----GKITNSLI--DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKSNNK 408
           + DE+  +  I  + +++   IE + L  ++F G PG GK+   + I       F   N+ T    D+ E++  A      +  + ++ I+EIHR NK +QD LL ++E   +I++  TTENP F+VNPA+ SR  L+R+E ++   +++ +   L + K       V  S +    I++++  D R     L++ +       ++++  +L      I   +I  D++  NHYD +SAF KSIRGSDP+A +Y+LA+++ +G+    + RR+Y    ED+GLA+        AA +A E LG+PEARIPL++  + L  +PKSN+ I  ID A+++V KE     P HLRDAHY  A KL + +GY YPH YN  YV Q+YLP  LK+K FY+P  N Y +   K +DY+ + K   K
  S:    25 TLDEIFGQTHIIGEGTLLRRAIEADRLSPMIFHGPPGTGKTTLAKVIANTTAAAFEQLNAVTAGIKDVREMVSQAKSRLDYDHKRTVLFIDEIHRFNKGQQDALLPHVEDGTVILIGATTENPMFEVNPALISRSRLFRLELLSDGDMRKVLEHALNDAKRGFGDYQVSFSEEAFNHIIDVAGGDARTALNALELAVLTTDADENEVIRIDLETAEASIQRRMIRYDKKGDNHYDTVSAFIKSIRGSDPDATLYWLAKMIYAGEEPRFIARRIYVHAAEDVGLADPNALLVAQAAFDAVEFLGMPEARIPLAEAALYLATAPKSNAVIKGIDAALETVQKERPGEVPVHLRDAHYKGASKLGHGEGYLYPHHYNHHYVVQQYLPDSLKDKRFYEPSVNGYEKTVLKRLDYFEERKKTGK 443
>gi|148377334|ref|YP_001256210.1| recombination factor protein RarA [Mycoplasma agalactiae PG2] >gi|148291380|emb|CAL58764.1| ATPase, AAA family [Mycoplasma agalactiae PG2] (404 aa)
Score = 633, Expect = 7.1e-64, Identities = 154/364 (42%), Positives = 230/364 (63%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN--KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEAL-SPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           S +FFG  G GK+++   +   L   + YFN++ N+K +L+++L     DN  ++II+EIHRLNKDKQD+LL YLE D II+ ATTTENP+F+VNPA+RSR+ + +   ++   + E +   L+      ++    ++  V++S  D+R     L+I+    +NK   I L ++ K   ++    D  ++ HY+ LSAFHKS+RGSD +AA+YY A +++SGDL  ++RRL A  YED+GLA+  L  +V  A++ +E LGLPEAR+P+    I + L+ KSNS   AI      +N+  +   P  LRD HYASAVKL +  GYKYPHD+    V+QEYLPKE K  +F+ P +   +  K  +Y+  IK
  S:    37 SFIFFGESGTGKTSAAVALANDLGLKYDYFNASVNSKAELIKMLA----DND-VLIIDEIHRLNKDKQDILLSYLEFDKIIIYATTTENPYFRVNPALRSRMQILQFTKLSEQEMFEGIKHNLKKYFPDYQMDESTIKVFVKLSNGDYRSCLNNLQILTLMSKNKQ--ISLDDIKKFVPNISFYSDENSSAHYNNLSAFHKSLRGSDVDAALYYGAIIVKSGDLQGLFRRLIACSYEDVGLADPNLQIRVKNAIDCAELLGLPEARLPIFYAIISVALASKSNSVYEAISNVEGYINQGNIYDVPKFLRDGHYASAVKLGDSIGYKYPHDFPNHIVKQEYLPKEAKGNQFFFPKE--TDSKKITEYYKFIK 398
>gi|78042989|ref|YP_361014.1| recombination factor protein RarA [Carboxydothermus hydrogenoformans Z-2901] >gi|77995104|gb|ABB14003.1| ATPase, AAA family [Carboxydothermus hydrogenoformans Z-2901] (444 aa)
Score = 630, Expect = 1.3e-63, Identities = 151/396 (38%), Positives = 238/396 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK-----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN---KYSQNENKFVDYWNKIKSNNK 408
           S DE I ++ I  +  ++   I ++ L S++F+G PG GK+   + I       F   N+ T+   ++ E+++ A E  K      ++ I+EIHR NK +QD LL  +E   I+++  TTENP+F+VN  + SR  ++  + +    ++E V + L +K       KV++S + ++ +V ++  D R     +++ +       D +    +  I  S+       D+   NHYD +SAF KS+RGSDP+AAVYYLA++LE+G D   + RRL     ED+GLA+        AA +A E +G+PEAR+PL++  I +  +PKSN+ I AID A+  V K    P P HLRDAHYA A +L   KGYKYPHDY   +V +EYLP+ LK + FY+P+   + +Q + +  + W K+K+  K
  S:    25 SLDEFIGQEHILGEGKLLRRAILSDRLGSLIFYGPPGTGKTTLARIIASTTKSGFESINAVTSGVGEIREVIKKAKEREKYYGERTVLFIDEIHRFNKAQQDALLPEVEAGTIVLIGATTENPYFEVNAPLLSRSRIFEFKPLEPEHIREIVRRALVDKERGLGEYKVEISEEALDHLVTMAAGDARAALNGIELAVLTTPPDEDGVRKITVEIIEQSMQKKAIVYDKEGDNHYDTISAFIKSLRGSDPDAAVYYLARMLEAGEDPRFIARRLIVHAAEDVGLADPMALNVAVAAFHALEFVGMPEARLPLAEAAIYIACAPKSNAVIKAIDRALAVVRKGENGPIPQHLRDAHYAGAKELGRGKGYKYPHDYPGHFVLEEYLPENLKGQRFYEPSDSGQEAQIKQRLKELWGKVKNFTK 444
>gi|160914951|ref|ZP_02077165.1| hypothetical protein EUBDOL_00959 [Eubacterium dolichum DSM 3991] >gi|158433491|gb|EDP11780.1| hypothetical protein EUBDOL_00959 [Eubacterium dolichum DSM 3991] (429 aa)
Score = 627, Expect = 3.1e-63, Identities = 147/395 (37%), Positives = 225/395 (56%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKEL----GKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVKGYK-YPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
            DE+I +  +  +  ++   +ENN LFS++F+G PG GK+     +   LNK +  FN+ + NK DL  I E A      ++I++E+HRLNKDKQDLLL ++E   II++  TT NP   +NPAIRSR  L+ ++ +    +K+ +   +++ K     V +    ++ I      D R    Y   +L+      D I+ K+L      I N  +DR    +YD+LSAF KSIRGSD +AA+YYL  ++E+ D+ S+ RRL    YEDIGL N     +   A++A+  +G PE RIPL+   I+LCLSPKS S   AID A+ ++ K + S P +LR         +N+K    Y +D +  + + +YLP +L+N +FY PN  S  E        +IK++ +
  S:    17 LDEIIGQQHLIGEGKVLRKCVENNMLFSMIFYGPPGTGKTTLAMVLANTLNKPYRLFNAVSGNKKDLDRIFEEAKYFPGLVVIVDEVHRLNKDKQDLLLPHIEDGSIIMIGATTSNPLHAINPAIRSRCHLFEVKALTQEDIKQALRNAIQSPKGLQNEVSIEEDALDIIARHCNGDIR----YALNILEICAIACDGIISKDLVMQYSSIPNMSMDRDGDGYYDVLSAFQKSIRGSDVDAALYYLGIMIEANDMDSIERRLLVTAYEDIGLGNPAAVARCVQAIDAARRVGFPEGRIPLAVAIIDLCLSPKSKSGEAAIDAALSTIRKSSYSVPEYLR------LTPVNMKEEDLYDYDRSDLWDKIQYLPNKLRNAQFYIPNTNSSYEKVLAQNLMRIKAHTR 411
>gi|167768575|ref|ZP_02440628.1| hypothetical protein CLOSS21_03134 [Clostridium sp. SS2/1] >gi|167710099|gb|EDS20678.1| hypothetical protein CLOSS21_03134 [Clostridium sp. SS2/1] (438 aa)
Score = 626, Expect = 3.9e-63, Identities = 144/386 (37%), Positives = 242/386 (62%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT-------NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVD 398
           + DE++ ++ I  KD ++   I+ + + SI+F+G PG GK+   + I      NF   N+TT+ K D+ E +  A E       K I+ I+EIHR NK +QD LL ++E   II++  TTENP+F+VN A+ SR  ++ + +++   +K+ +++ + + +         +++  ++ + ++++ D R     +++ +   +   D  +  ++  +    I RR T       NHYD++SAF KS+RGSDP+AA+YYLA+++++G+ ++ + RR+     ED+G A+        AA  A E +G+PEARI L+Q    +  +PKSN+A MA+D+A++SV N +  + PNHLRDAHY  A KL    GYKY HDY   YV+Q+YLP EL    FY+P  N Y +N  ++++
  S:    26 TLDEVVGQEHIIGKDKLLYRAIKADKISSIIFYGPPGTGKTTLAKVIANTTKANFVQMNATTSGKKDMQEAVADAKESLGMYQKKTILFIDEIHRFNKAQQDYLLPFVEDGTIILIGATTENPYFEVNQALISRSNVFELHSLDKEDIKKLIVRAITDDEKGMGIYGATITDDALDFLSDMAEGDARSALNAIELGILTTEPAEDGKIHIDI-DVAQECIQRRVTKYDKDGDNHYDVISAFIKSMRGSDPDAAIYYLARMIDAGESVTFIARRIMICASEDVGNADPQALQVAVAASQAVERIGMPEARIILAQAVTYVASAPKSNAAYMAVDQALESVRNHKIGAVPNHLRDAHYKGAAKLGHGIGYKYAHDYPDHYVKQQYLPDELLGTTFYEPTENGYEKNIKEYLE 434
>gi|50365221|ref|YP_053646.1| recombination factor protein RarA [Mesoplasma florum L1] >gi|50363777|gb|AAT75762.1| putative helicase subunit of Holliday junction resolvase [Mesoplasma florum L1] (410 aa)
Score = 625, Expect = 5.4e-63, Identities = 150/389 (38%), Positives = 238/389 (61%)
  Q:    16 EMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNK--VVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT---NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           E+I ++ +  +D +I  MI NN   S++F+G  GVGK++    +   LN  +  FN++ + K +L +I++ A    + I+II+EIHRLN+DKQD+LL ++E   + + ATTTENPFF +NPAIRSR  +  ++ ++       V K +++KKV ++ K   ++ + E++  D R +   +++    Y  K ++I +  +  I +   +       + +DL SA  KS+RGSD +A+++Y ++LL  GD  ++ RR+  + YEDIGLAN  L P+V  A +A   +G+PE  IPL  + IE+ LS KSNSA+MA  +A + V N  A   P+HL+D HY SAVKLN    Y YPH     +V Q+YLP E+KN +++KP   S  E K    + ++K
  S:    16 EIIGQENLLKEDGLIKKMISNNFCRSLIFYGPSGVGKTSFAIALANDLNIEYDLFNASYDKKENLTKIIDKAINKERFILIIDEIHRLNRDKQDILLNFMESGNVYLFATTTENPFFTINPAIRSRATILELKRVSHDESFAFVNKLIKDKKVDINIKPESLKYLCELNSGDIRSLLNNIELFHNLY--KGEEITIDLISSIISQGKNPSGATGDDFHDLKSALQKSVRGSDVDASLHYFSRLLSIGDYETLMRRMVIMAYEDIGLANPSLPPRVMQACDAFRQIGMPEGIIPLGLVIIEMALSQKSNSALMASGKAFEDVKNGMAYEVPSHLKDNHYKSAVKLNRGVNYLYPHVEEKGWVAQQYLPNEIKNIKYFKPKTNSAYERKLWSLYEEMK 409
>gi|118586592|ref|ZP_01544033.1| ATPase, AAA family [Oenococcus oeni ATCC BAA-1163] >gi|118432971|gb|EAV39696.1| ATPase, AAA family [Oenococcus oeni ATCC BAA-1163] (429 aa)
Score = 615, Expect = 7.3e-62, Identities = 142/394 (36%), Positives = 224/394 (56%)
  Q:    15 DEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQ--NKSDDI-----VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           ++++ +  +  K  II  M++ + L S++ +G PG GK++    I      +F   N+ T+ K +L E+ E        I++++EIHRL+K KQD LL +LE   I+++  TTENP+  V PAIRSR  ++ +E ++   +K  + + L +K+       +KL ++    +   +  D R     L++ +   +   K  +I     +++E  +  +   D+    HYD++SAF KSIRGSD +A +YYL ++LE+GDL    RRL  + YED+GLAN         AV A+  LGLPEARIPL+   IEL LSPKSNSA  AI+ AI  + K      P HL++       K     Y YPHD+   +V Q+YLP ++KNK ++     S+ E    + + K+K N +
  S:    16 EDVVGQQHLIGKGKIIWRMVQAHRLSSMILYGEPGTGKTSIASAIAGSTELSFRILNAATDGKKELQEVAEEGKMSGSVILLLDEIHRLDKTKQDFLLPHLESGRIVLIGATTENPYLSVTPAIRSRTQIFHVEALSEKDIKTAINRALSDKENGLGNYNIKLDDQAKNHLSTATNGDLRSALNGLELAVLSTKAVGKEKEIHITLPIIEETIQRKSMSGDKNGDAHYDVISAFQKSIRGSDADAGIYYLGRILEAGDLTIAARRLLVIAYEDVGLANPNAAAHAVQAVTAALQLGLPEARIPLANAVIELALSPKSNSAYGAINSAIGDIEKGNTGDVPIHLKNTRNWGKTKNQQIDYLYPHDFPNDWVAQQYLPDKIKNKRYFAAKGNSKFEQILSETYTKLKENQQ 424
>gi|110803416|ref|YP_699072.1| recombination factor protein RarA [Clostridium perfringens SM101] >gi|110683917|gb|ABG87287.1| ATPase, AAA family [Clostridium perfringens SM101] (415 aa)
Score = 614, Expect = 1.1e-61, Identities = 147/392 (37%), Positives = 251/392 (64%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSA---VLKEEVIKYLENKK--VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVL-----KELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKS 405
            ++++ +  I  + + + N+I+N ++ + +F+G PGVGK+     I    +K FY  N+TT++  ++  I   ++        I+ I+E+   NK +Q  LL ++E   +I++A+TTENP+F ++ AI SR  +++ + +++    +  E  +  LE +   + L   V++ I EIS+ D R+ +  L++ +K    + D+I+L     ++LG+ +N   D    ++Y+LLSA  KSIRGSDP+A+++YLA+L++ G++ SV RR+  +  EDIGLA+      VN+ ++ +  +G+PEARI LS++ I L   PKSNSA MAID+A++ + +  +   P HL+DAHY+ A  L V GY YPH+Y  SY+ QEY+P+ ++ KE+YKP  NKY   E+    YWN +K+
  S:    13 LEDIVGQKHIVGEGTPLSNLIKNKNMINCIFYGPPGVGKTTLANIISNYTDKKFYKINATTSSIKEIQSITSDIDNLLNFKGIILYIDELQHFNKKQQQALLEFIEDGRVILIASTTENPYFAIHKAILSRSTIFQFKPVSTEDIIIALERAVSKLEKEGYVISLEEGVLKYIGEISQGDVRKAYTILELAIK--SQEKDNILLNKEYVEKLGQ-SNLKSDSSGDDYYNLLSALQKSIRGSDPDASIHYLARLIKGGNMDSVIRRIGVIAAEDIGLAHPNALQVVNSGIDLALKIGMPEARIILSELVIYLATLPKSNSAYMAIDDALRDLERNNSGDVPKHLKDAHYSGASNLGVGGYLYPHNYPNSYINQEYMPENMRGKEYYKPKDNKY---ESSIKAYWNNVKN 414
>gi|28210750|ref|NP_781694.1| recombination factor protein RarA [Clostridium tetani E88] >gi|28203188|gb|AAO35631.1| ATPase associated with chromosome architecture/replication [Clostridium tetani E88] (427 aa)
Score = 613, Expect = 1.3e-61, Identities = 158/394 (40%), Positives = 240/394 (60%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYL------------ENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELG--------KITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKSNN 407
            DE+  +  I  +  I+  +I +  L +++F+G PG GK+     I  + NK  Y  N+T  +  D+  I   L+        ++ ++EI   NK +Q  LL ++EK  I ++A+TTENP+  +  AI SR  ++  +++    LKE++++ L            +N  +  S   +E I ++S  D R+    L++ +   +   ++ ++ +L         K+ N   D+   +HYD+LSAF KSIRGSD +A+++YLA+L+E+GDLIS+ RRL  +  EDIGLA       V   V+++  LGLPE RIPL+Q TI L  SPKSNS I AID+A+  + K+ +   PNH++D+HY  A  LN   GYKYPHD   +YVEQEYLPK+LK K++Y P  NKY   E     YW+ IK NN
  S:    15 LDEVFGQKHILGQGKILRRIINSEKLTNMIFYGPPGTGKTTVANIIANRTNKTLYKLNATNASLADIKNIIADLDSFMGVEGVVLYLDEIQNFNKKQQQSLLEFMEKGQITLIASTTENPYHYIYKAILSRATIFEFKSL----LKEDILEALNRALDILKKEDFKNTYIYFSKDALEHIAKVSNGDLRRALNGLELCVYSTKPTLENKIVVDLEVAIECTQRKVLN--YDKFGDSHYDILSAFQKSIRGSDADASIHYLARLIEAGDLISICRRLLVIASEDIGLAYPSAISIVKNCVDSAMQLGLPEGRIPLAQATILLATSPKSNSCIEAIDKALMDIRKKDVGDIPNHIKDSHYNGAEILNRGTGYKYPHDCKNNYVEQEYLPKKLKGKKYYIPQENKY---EYSIKRYWSSIKKNN 426
>gi|167745397|ref|ZP_02417524.1| hypothetical protein ANACAC_00088 [Anaerostipes caccae DSM 14662] >gi|167655118|gb|EDR99247.1| hypothetical protein ANACAC_00088 [Anaerostipes caccae DSM 14662] (439 aa)
Score = 612, Expect = 1.6e-61, Identities = 143/386 (37%), Positives = 245/386 (63%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYYQNKSDDIVL-----KELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALS-PPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVD 398
           + DE++ ++ I  KD ++   I+ + L SI+F+G PG GK+   + I +    NF   N+TT+ K ++ E ++ A E       K I+ I+EIHR NK +QD LL ++E   II++  TTENP+F+VN A+ SR  ++ ++++    +K+ +++ + +        + K++++ ++ + ++++ D R     +++ +L     ++ +IV+     +E  +      D+   NHYD++SAF KS+RGSDP+AAVYYLA+++++G+ ++ + RR+     ED+G A+        AA  A E +GLPEARI L+Q    +  +PKSN+A MA+++A+++V K      PNHLRDA Y  A KL    GY+Y H++   YV+Q+YLP EL    FY+P  N Y +N  K++D
  S:    26 TLDEVVGQEHIIGKDKLLYRAIQADKLSSIIFYGPPGTGKTTLARVIAQTTQANFVQMNATTSGKKEMQEAVKEAKEALGMFQKKTILFIDEIHRFNKAQQDFLLPFVEDGTIILIGATTENPYFEVNQALISRSNVFELKSLEPEDIKKLLVRAVTDDEKGMGIYRAKITDEALDFLADMAEGDARSALNAVELGILTTEPGENGEIVIDINVAQECIQKRVMRYDKGGDNHYDIISAFIKSMRGSDPDAAVYYLARMIDAGESVTFISRRIMICASEDVGNADPQALQVAVAASQAVERIGLPEARIILAQAVTYVAGAPKSNAAYMAVNQALEAVRKRKNGMVPNHLRDASYKGASKLGRGIGYQYAHNFPGHYVKQQYLPDELLGTVFYEPTENGYEKNIKKYLD 434
>gi|89895174|ref|YP_518661.1| recombination factor protein RarA [Desulfitobacterium hafniense Y51] >gi|89334622|dbj|BAE84217.1| hypothetical protein [Desulfitobacterium hafniense Y51] (440 aa)
Score = 611, Expect = 2.6e-61, Identities = 143/382 (37%), Positives = 223/382 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV-------EAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT-------NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNEN 394
           + D+ I +  I  K  ++   IE + + S++ +G PG GK++  Q I    +  F   N+      ++ EI++ ATE       K ++  +E+HR NK +QD LL  +E   I  +  TTENPFF++N A+ SR  L+R++ + +  ++  + + L +K+  L N  V       E  +  +  D R+    L++ +       +  V +    +    I +RA        NHYD++SAF KS+RGSDP+AA+Y+LA LLESG D   + RR+     ED+GLA+  +  + +AA NA E +GLPEARIP++Q  + +  +PKSNS IMAID A   V        P HLRDA+Y  A K+ + K Y YPHDY   +VEQ YLP+E++ + F+ P+   Q+ +
  S:    27 TLDDYIGQSEIIGKGKLLRRAIEADRVTSLILYGPPGTGKTSLAQVIANTTSSGFVRINAVAAGVKEIREIIQTATEQLHLYGKKTLVFCDEVHRFNKGQQDALLPAVENGTITFIGATTENPFFELNSALLSRSTLFRLQPLTAEDIRSGLAQALADKERGLGNYSVSIDPEAWEHWLNFANGDLRRALNALELAV--LTTPPEQGVRRITLSVAEESIQQRAMRFDKNGDNHYDIVSAFIKSMRGSDPDAALYWLAVLLESGEDPRFIVRRIIVHASEDVGLADPMVMIQAHAAANALEWVGLPEARIPIAQAVLAIATAPKSNSTIMAIDRATGYVRSHPTGQVPAHLRDANYPGAKKMGHGKNYLYPHDYPGHWVEQGYLPQEVQGENFFTPSGTGQDRD 428
>gi|109645520|ref|ZP_01369440.1| AAA ATPase, central region [Desulfitobacterium hafniense DCB-2] >gi|109643469|gb|EAT53022.1| AAA ATPase, central region [Desulfitobacterium hafniense DCB-2] (437 aa)
Score = 610, Expect = 2.7e-61, Identities = 143/382 (37%), Positives = 223/382 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV-------EAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT-------NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNEN 394
           + D+ I +  I  K  ++   IE + + S++ +G PG GK++  Q I    +  F   N+      ++ EI++ ATE       K ++  +E+HR NK +QD LL  +E   I  +  TTENPFF++N A+ SR  L+R++ + +  ++  + + L +K+  L N  V       E  +  +  D R+    L++ +       +  V +    +    I +RA        NHYD++SAF KS+RGSDP+AA+Y+LA LLESG D   + RR+     ED+GLA+  +  + +AA NA E +GLPEARIP++Q  + +  +PKSNS IMAID A   V        P HLRDA+Y  A K+ + K Y YPHDY   +VEQ YLP+E++ + F+ P+   Q+ +
  S:    24 TLDDYIGQSEIIGKGKLLRRAIEADRVTSLILYGPPGTGKTSLAQVIANTTSSGFVRINAVAAGVKEIREIIQTATEQLHLYGKKTLVFCDEVHRFNKGQQDALLPAVENGTITFIGATTENPFFELNSALLSRSTLFRLQPLTAEDIRSGLAQALADKERGLGNYSVSIDPEAWEHWLNFANGDLRRALNALELAV--LTTPPEQGVRRITLSVAEESIQQRAMRFDKNGDNHYDIVSAFIKSMRGSDPDAALYWLAVLLESGEDPRFIVRRIIVHASEDVGLADPMVMLQAHAAANALEWVGLPEARIPIAQAVLAIATAPKSNSTIMAIDRATGYVRSHPTGQVPAHLRDANYPGAKKMGHGKNYLYPHDYPGHWVEQGYLPQEVQGENFFTPSGTGQDRD 425
>gi|162447688|ref|YP_001620820.1| Holliday junction DNA helicase-like ATPase [Acholeplasma laidlawii PG-8A] >gi|161985795|gb|ABX81444.1| Holliday junction DNA helicase-like ATPase [Acholeplasma laidlawii PG-8A] (412 aa)
Score = 609, Expect = 4.0e-61, Identities = 156/393 (39%), Positives = 234/393 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIE-----NINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLK---IVLKYYQNKSDDIVLKELGKITNSLIDRRATNHY-DLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKS 405
           +FDE+  +D +  K  ++  MIE     S + +G PG GK+   +    K   + Y+FN++T+NK  L +IL++ T  +  +II++EIHR+  D QD LL +LE    I++  TT NP+  +N AIRSR  LY I+     +I +A+L    I+YL++  + L++  + AI+  S S+ R     L+   +V+   Q  + +I+ K  GK   SL D    NHY ++LSA  KSIRGSD +A+++YLA+LL  GDL  ++RRL  + YEDIGLAN  +G KV AA+ A++  GLPEARIPLS I +++ LSPKSN+A  A+D+A++        P P H+ + +    +K +   YKYPH+   S   Q +LP  L +K +Y P   S  E    D    I S
  S:    12 NFDEVYGQDHLLSKHGVLTKMIEKKKYLSFILYGPPGTGKTTIAKLFSDKSMLDTYFFNASTDNKAKLKDILDM-TAYHDVLIIVDEIHRMKTDIQDYLLPFLESGKAIMIGLTTLNPYQSINMAIRSRCHLYEIKALSDKDIEAAILN--AIQYLDHD-IHLTDDALAAIIRASNSEIRSALNLLESASLVVDDGQKITSNIIRKLAGKPQLSLDDHE--NHYFEMLSALQKSIRGSDVDASIHYLARLLTLGDLEIIFRRLIVIAYEDIGLANPTMGQKVLAAIQAAKMTGLPEARIPLSVIVVDMALSPKSNTAYSALDKAMEDFQNGLAGPIPKHIDNKY----IKQHPDSYKYPHNDPGSLNSQTHLPDNLLDKTYYVPKDESAYEKALKDRLKLIDS 404
>gi|182418940|ref|ZP_02950197.1| ATPase, AAA family [Clostridium butyricum 5521] >gi|182377223|gb|EDT74791.1| ATPase, AAA family [Clostridium butyricum 5521] (414 aa)
Score = 608, Expect = 5.1e-61, Identities = 142/375 (37%), Positives = 235/375 (62%)
  Q:    30 IINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-----KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI--DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIK 404
           + N+I++ ++ + + +G PG GK+     +   +++ FY  N+TT +  D+ EI   L+     N  ++ I+E+   +K +Q  LL ++EK  I ++A+TTENP+F ++ AI SR  ++  + + +  +K  V+K +E       ++K ++  +  I EIS+ D+R+ +  L++ +     ++ +I ++ +  +  S I  D      Y+ LSA  KSIRGSD +AA++YLA+L++SG+L ++ RRL  +V EDIGLA+      VN+ +     +GLPEA++ LS++ I L   PKSNSA +AI  A+Q + NK     P HL+DAHY+ A KL V GYKYPHDY+ +YV+Q+Y+P+EL++  +Y P  NKY   E    +YW  IK
  S:    29 LYNIIKSKNIVNCILYGPPGTGKTTLANIMANYVDRKFYKLNATTASVKDIQEIASSLDTLLGYNGVVVYIDELQHFSKKQQQSLLEFIEKGQITLIASTTENPYFVLHKAILSRCNIFTFKPLTTDDIKFGVVKAIERAIENGMEIKYTDDAISYIAEISQGDYRKAYNILELGIISSLKRTLEITVEYIAGLEQSHIRFDASGDEFYNSLSALQKSIRGSDADAAIHYLARLIKSGNLTAIVRRLGVIVAEDIGLAHPNALTVVNSGLELVLKVGLPEAQLILSELVIYLATLPKSNSAYLAIKSAMQDLENKNVGDVPMHLKDAHYSGAQKLGVGGYKYPHDYSNNYVKQQYMPQELRDTIYYIPQENKY---EGSINNYWKNIK 413
>gi|187778844|ref|ZP_02995317.1| hypothetical protein CLOSPO_02439 [Clostridium sporogenes ATCC 15579] >gi|187772469|gb|EDU36271.1| hypothetical protein CLOSPO_02439 [Clostridium sporogenes ATCC 15579] (415 aa)
Score = 608, Expect = 5.4e-61, Identities = 152/394 (38%), Positives = 243/394 (61%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK---------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT--NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKS 405
           N  ++ + +  I  ++  + N+++N  + + +F+G PG GK+     +   ++K FY  N+TT +  D+ EI   +      +  ++ I+E+    K +Q  LL ++E   ++++A+TTENP+F ++ AI SR  +++ + +N    KEE+I  L+            +K +++ +E I EI + D+R+ +  L++ +  +   + +I L  +  +  S I   AT   +Y++LSAF KSIRGSD +AAV+YLA+L++SGD+ S+ RRL  +  EDIGLA       VN+ +  +  +G PEA+I LS+ITI L   PKSNSA +AI  A++ + N      P+HL+D+HY  A  L V GYKYPH++N  YV QEYLPKELK+K +YK   NKY +N  K   YW  IKS
  S:    11 NKLEDFVGQKHILSENKPLYNLMKNKSICNSIFYGPPGTGKTTLANIMANYVDKKFYRLNATTASIKDIQEITSSINSLLNYSGVVLYIDELQHFTKKQQQALLEFIEDGRVVLIASTTENPYFVIHKAILSRCNIFQFKPLN----KEEIILGLKKAINKLIDKGINIKYTDEALEYIGEICQGDYRKAYNILELAVNSHCGFNIEITLDYIESLEQSNIRADATGDEYYNILSAFQKSIRGSDADAAVHYLARLIKSGDMTSITRRLSVMAAEDIGLAYPNALTIVNSGIELALKVGFPEAQIILSEITIYLATLPKSNSAYIAIKNAMKDLENINFGDVPDHLKDSHYYGAKNLGVGGYKYPHNFNNHYVSQEYLPKELKDKIYYKAQHNKYEENLKK---YWENIKS 414
>gi|169343695|ref|ZP_02864694.1| ATPase, AAA family [Clostridium perfringens C str. JGS1495] >gi|169298255|gb|EDS80345.1| ATPase, AAA family [Clostridium perfringens C str. JGS1495] (418 aa)
Score = 607, Expect = 6.3e-61, Identities = 147/373 (39%), Positives = 241/373 (64%)
  Q:    33 MIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSA---VLKEEVIKYLENKK--VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKE----LGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKS 405
           +I+N ++ + +F+G PGVGK+     I    +K FY  N+TT++  ++  I   ++        I+ I+E+   NK +Q  LL ++E   +I++A+TTENP+F ++ AI SR  +++ + +++    +  E  +  LE +   + L   V++ I EIS+ D R+ +  L++ +K  Q K++ ++ KE    LG+ +N   D    ++Y+LLSA  KSIRGSDP+A+++YLA+L++ G++ SV RR+  +  EDIGLA+      VN+ ++ +  +G+PEARI LS++ I L   PKSNSA MAID+A++ + +  A   P HL+DAHY+ A  L V GY YPH+Y  SY+ QEY+P+ ++ KE+YKP  NKY   E+    YWN +K+
  S:    35 LIKNKNIMNCIFYGPPGVGKTTLANIISNYTDKKFYKINATTSSIKEIQSITSDIDNLLNFKGIILYIDELQHFNKKQQQALLEFIEDGRVILIASTTENPYFAIHKAILSRSTIFQFKPVSTEDIIIALERAVSKLEKEGYVISLEEGVLKYIGEISQGDVRKAYTVLELAIKS-QEKNNILLNKEYVENLGQ-SNLKSDSSGDDYYNLLSALQKSIRGSDPDASIHYLARLIKGGNMDSVIRRIGVIAAEDIGLAHPNALQVVNSGIDLALKIGMPEARIILSELVIYLATLPKSNSAYMAIDDALRDLERNNAGDVPKHLKDAHYSGASNLGVGGYLYPHNYPNSYINQEYMPENMRGKEYYKPKDNKY---ESSIKAYWNNVKN 417
>gi|170763967|ref|ZP_02636474.2| ATPase, AAA family [Clostridium perfringens B str. ATCC 3626] >gi|170711102|gb|EDT23284.1| ATPase, AAA family [Clostridium perfringens B str. ATCC 3626] (418 aa)
Score = 606, Expect = 8.5e-61, Identities = 145/373 (38%), Positives = 240/373 (64%)
  Q:    33 MIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSA---VLKEEVIKYLENKK--VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVL-----KELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKS 405
           +I+N ++ + +F+G PGVGK+     I    +K FY  N+TT++  ++  I   ++        I+ I+E+   NK +Q  LL ++E   +I++A+TTENP+F ++ AI SR  +++ + +++    +  E  +  LE +   + L   V++ I EIS+ D R+ +  L++ +K    + D+I+L     ++LG+ +N   D    ++Y+LLSA  KSIRGSDP+A+++YLA+L++ G++ SV RR+  +  EDIGLA+      VN+ ++ +  +G+PEARI LS++ I L   PKSNSA MAID+A++ + +  A   P HL+DAHY+ A  L V GY YPH+Y   Y+ QEY+P+ ++ KE+YKP  NKY   E+    YWN +K+
  S:    35 LIKNKNIMNCIFYGPPGVGKTTLANIISNYTDKKFYKINATTSSIKEIQSITSDIDNLLNFKGIILYIDELQHFNKKQQQALLEFIEDGRVILIASTTENPYFAIHKAILSRSTIFQFKPVSTEDIIIALERAVSKLEKEGYVISLEEGVLKYIGEISQGDVRKAYTVLELAIK--SQEKDNILLNKEYVEKLGQ-SNLKSDSSGDDYYNLLSALQKSIRGSDPDASIHYLARLIKGGNMDSVIRRIGVIAAEDIGLAHPNALQVVNSGIDLALKIGMPEARIILSELVIYLATLPKSNSAYMAIDDALRDLERNNAGDVPKHLKDAHYSGASNLGVGGYLYPHNYPNGYINQEYMPENMRGKEYYKPKDNKY---ESSIKAYWNNVKN 417
>gi|18310769|ref|NP_562703.1| recombination factor protein RarA [Clostridium perfringens str. 13] >gi|18145450|dbj|BAB81493.1| conserved hypothetical protein [Clostridium perfringens str. 13] (408 aa)
Score = 606, Expect = 9.8e-61, Identities = 145/373 (38%), Positives = 240/373 (64%)
  Q:    33 MIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSA---VLKEEVIKYLENKK--VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVL-----KELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKS 405
           +I+N ++ + +F+G PGVGK+     I    +K FY  N+TT++  ++  I   ++        I+ I+E+   NK +Q  LL ++E   +I++A+TTENP+F ++ AI SR  +++ + +++    +  E  +  LE +   + L   V++ I +IS+ D R+ +  L++ +K    + D+I+L     ++LG+ +N   D    ++Y+LLSA  KSIRGSDP+A+++YLA+L++ G++ SV RR+  +  EDIGLA+      VN+ ++ +  +G+PEARI LS++ I L   PKSNSA MAIDEA++ + +  A   P HL+DAHY+ A  L V GY YPH+Y   Y+ QEY+P+ ++ KE+YKP  NKY   E+    YWN +K+
  S:    25 LIKNKNIINCIFYGPPGVGKTTLANIISNYTDKKFYKINATTSSIKEIQSITSDIDNLLNFKGIILYIDELQHFNKKQQQALLEFIEDGRVILIASTTENPYFAIHKAILSRSTIFQFKPVSTEDIIIALERAVSKLEKEGYVISLEEGVLKYIGDISQGDVRKAYTVLELAIK--SQEKDNILLNKEYVEKLGQ-SNLKSDSSGDDYYNLLSALQKSIRGSDPDASIHYLARLIKGGNMDSVIRRIGVIAAEDIGLAHPNALQVVNSGIDLALKIGMPEARIILSELVIYLATLPKSNSAYMAIDEALRDLERNNAGDVPKHLKDAHYSGASNLGVGGYLYPHNYPNGYINQEYMPENMRGKEYYKPKDNKY---ESSIKAYWNNVKN 407
>gi|153941104|ref|YP_001391867.1| recombination factor protein RarA [Clostridium botulinum F str. Langeland] >gi|152937000|gb|ABS42498.1| ATPase, AAA family [Clostridium botulinum F str. Langeland] (416 aa)
Score = 604, Expect = 1.7e-60, Identities = 151/391 (38%), Positives = 240/391 (61%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK---------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT--NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIK 404
            ++ + +  I  ++  + N+++N  + + +F+G PG GK+     +   ++K FY  N+TT +  D+ EI   +      +  ++ I+E+    K +Q  LL ++E   +I++A+TTENP+F ++ AI SR  +++ + +N    +E++I  LE            +K S + +E I EI + D+R+ +  L++ +  +   + +I L  +  +  S I   AT   +Y++LSAF KSIRGSD +AAV+YLA+L++SGD+ S+ RRL  +  EDIGLA       VN+ +  +  +G PEA+I LS+ITI L   PKSNSA +AI  A++ +        P+HL+D+HY  A  L V+GYKYPHD+N  YV QEYLPKELK+K +YK   NKY +N  K   YW  IK
  S:    13 LEDFVGQKHILSENKPLYNLMKNKSICNSIFYGPPGTGKTTLANIMANYVDKKFYRLNATTASIKDIQEITSSINSLLNYSGVVLYIDELQHFTKKQQQALLEFIEDGRVILIASTTENPYFVIHKAILSRCNIFQFKPLN----REDIILGLEKAINKLIDKGINIKYSFESLEYIGEICQGDYRKAYNILELAVNSHCGFNIEITLDYIESLAQSNIRADATGDEYYNILSAFQKSIRGSDADAAVHYLARLIKSGDITSITRRLSVMAAEDIGLAYPNALTIVNSGIELALKVGFPEAQIILSEITIYLATLPKSNSAYIAIKNAMKDLESVNFGDVPDHLKDSHYHGAKNLGVEGYKYPHDFNNHYVSQEYLPKELKDKVYYKAQYNKYEENLKK---YWENIK 413
>gi|170764155|ref|ZP_02633248.2| ATPase, AAA family [Clostridium perfringens E str. JGS1987] >gi|170661394|gb|EDT14077.1| ATPase, AAA family [Clostridium perfringens E str. JGS1987] (418 aa)
Score = 603, Expect = 1.9e-60, Identities = 145/373 (38%), Positives = 241/373 (64%)
  Q:    33 MIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSA---VLKEEVIKYLENKK--VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVL-----KELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKS 405
           +I+N ++ + +F+G PGVGK+     I    +K FY  N+TT++  ++  I   ++        I+ I+E+   NK +Q  LL ++E   +I++A+TTENP+F ++ AI SR  +++ + +++    +  E  +  LE +   + L   V++ I +IS+ D R+ +  L++ +K    + D+I+L     ++LG+ +N   D    ++Y+LLSA  KSIRGSDP+A+++YLA+L++ G++ SV RR+  +  EDIGLA+      VN+ ++ +  +G+PEARI LS++ I L   PKSNSA MAID+A++ + +  A   P HL+DAHY+ A  L V GY YPH+Y  SY+ QEY+P+ ++ KE+YKP  NKY   E+    YWN +K+
  S:    35 LIKNKNIINCIFYGPPGVGKTTLANIISNYTDKKFYKINATTSSIKEIQSITSDIDNLLNFKGIILYIDELQHFNKKQQQALLEFIEDGRVILIASTTENPYFAIHKAILSRSTIFQFKPVSTEDIIIALERAVSKLEKEGYVISLEEGVLKYIGDISQGDVRKAYTVLELAIK--SQEKDNILLNKEYVEKLGQ-SNLKSDSSGDDYYNLLSALQKSIRGSDPDASIHYLARLIKGGNMDSVIRRIGVIAAEDIGLAHPNALQVVNSGLDLALKIGMPEARIILSELVIYLATLPKSNSAYMAIDDALRDLERNNAGDVPKHLKDAHYSGASNLGVGGYLYPHNYPNSYINQEYMPENMRGKEYYKPKDNKY---ESSIKAYWNNVKN 417
>gi|114566015|ref|YP_753169.1| recombination factor protein RarA [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114336950|gb|ABI67798.1| Recombination protein MgsA [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (440 aa)
Score = 603, Expect = 2.1e-60, Identities = 157/403 (38%), Positives = 239/403 (59%)
  Q:     2 KKFDEKVLVC-----NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK-----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNK--SDDIVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           KKFD    +       S DE++ ++ I   DS +   IEN+ L S + +G PG GK+     I +  + ++    + ++   ++ +I   A +  K      II ++EIHR NK +QD+LL Y+E   +I++  TTENP +++N A+ SR+ LY +E +N+  L+  V + L + +       + +  + +  IV+ ++ D R     L  +   Y +K  S  I  + L K+T  LI   DR    HYD +SAF KSIRGSDP+AA+++LA +LE G D   + RRL     EDIGLA+        +   A E +G+PEARIPL++ TI L  +PKSNS+ MAID+AI +V N   +  P H+ D+ ++ +  L   KGYKYPHDY   YV+QEYLP+E++    Y+P K    +N   D+  KIK
  S:    10 KKFDAHAPLAWRMRPRSLDEVVGQEHIIGPDSPLHQAIENDRLQSFVLYGPPGSGKTTIAHIIARTTSSHYAAIKAVSSGVGEIRKIAADAADHLKYYQQSSIIFVDEIHRFNKSQQDVLLPYVEDGTLILIGATTENPLYEINNALLSRMKLYIMEALNANSLRRIVEQALADPERGLGKHNISIDEQSMVMIVQAAQGDARTALNILDTLHNSYSSKDGSLRITPELLEKVTGRLILKYDRSGDYHYDTISAFIKSIRGSDPDAALFWLAVMLEGGEDPKFIARRLIVHAAEDIGLADPYALTLAASTARALEFVGMPEARIPLAEATIYLATAPKSNSSKMAIDKAINTVQNTPRIIVPPHIADSSHSQSASLGKGKGYKYPHDYG-GYVKQEYLPQEIEGITLYEPGKNGYEQN-IRDFLQKIK 435
>gi|83590492|ref|YP_430501.1| recombination factor protein RarA [Moorella thermoacetica ATCC 39073] >gi|83573406|gb|ABC19958.1| Recombination protein MgsA [Moorella thermoacetica ATCC 39073] (441 aa)
Score = 602, Expect = 2.5e-60, Identities = 146/390 (37%), Positives = 228/390 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYYQNKSDDI-----VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNK 402
           + DE + ++ I    +++   IE++ L SI+ +G PG GK+   + I      +F   N+  +  ND+  ++  A E       K +I ++EIHR  K+ QD LL  +E+ ++I++  T ENP F VN AIRSR  ++R+E ++ A +   + + L + +       V+   + +E +  ++  D R     L+  VL    + S        V +E  +    L DR    HYD +SA+ KS+RGSDP+AA+Y+LA+++ +G D   + RRL     ED+GLA+       ++A  A E +GLPE RI L++ T+ + L+PKSNS I AID A+ +V KE   P P HLRDA+Y  A  L + +GYKYPHDY   +VEQ+YLP  L+ K FY P+ Y + E +    W +
  S:    26 TLDEFVGQEKIIGPGTLLRRAIESDSLTSIILWGPPGSGKTTLARIIATMTRAHFEALNAVLDGINDIRRVIAAAREREKYYQQKTVIFVDEIHRWAKNIQDALLPCVEEGLLILIGATIENPMFTVNAAIRSRSRIFRLEALSDAAILTLLRRALADAERGLGKFNVQADPEALEHLARVANGDARVALNALEFAVLTTAPDTSGRRHLTLEVAEEAIQQRAVLYDRDGDQHYDCVSAWIKSMRGSDPDAALYWLARMIYAGEDPAFLARRLMIHAAEDVGLADPQALVVASSAAQAVERVGLPEGRIILAEATLYIALAPKSNSVIKAIDAALAAVEKETAGPVPVHLRDANYRGAATLGHGRGYKYPHDYPGGWVEQQYLPDNLRGKVFYHPSDYGR-EGQMKAAWQQ 435
>gi|188588213|ref|YP_001920502.1| ATPase, AAA family [Clostridium botulinum E3 str. Alaska E43] >gi|188498494|gb|ACD51630.1| ATPase, AAA family [Clostridium botulinum E3 str. Alaska E43] (414 aa)
Score = 602, Expect = 2.8e-60, Identities = 143/391 (36%), Positives = 241/391 (61%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-----KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI--DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIK 404
            ++ + +  I  +   + N+I++ ++ + + +G PG GK+     +   +++ FY  N+TT +  D+ EI   L+     N  ++ I+E+   +K +Q  LL ++EK  I ++A+TTENP+F ++ AI SR  ++  + + +  +K  V+K +E       ++K ++  +  I EIS+ D+R+ +  L++ +     ++ +I  + + ++  S I  D      Y+ LSA  KSIRGSD +AA++YLA+L++SG+L ++ RRL  +V EDIGLA+      VN+ +     +GLPEA++ LS++ I L   PKSNSA +AI  A+Q + NK     P HL+DAHY+ A KL V GYKYPHDY+ +YV+Q+Y+P+EL++  +Y P  NKY   E    +YW  IK
  S:    13 LEDFVGQKQIIGEGKPLYNIIKSKNIVNCILYGPPGTGKTTLANIMANYVDRKFYKLNATTASVKDIQEIASSLDTLLGYNGVVVYIDELQHFSKKQQQSLLEFIEKGQITLIASTTENPYFVLHKAILSRCNIFTFKPLTTDDIKFGVVKAIERAIENGMEIKYTDDAISYIAEISQGDYRKAYNILELGIISSLKRTLEITAEYIEELEQSHIRFDASGDEFYNSLSALQKSIRGSDVDAAIHYLARLIKSGNLTAIVRRLGVIVAEDIGLAHPNALTVVNSGLELVLKVGLPEAQLILSELVIYLATLPKSNSAYLAIKSAMQDLENKNVGDVPMHLKDAHYSGAQKLGVGGYKYPHDYSNNYVKQQYMPQELRDTIYYIPQENKY---EGSIKNYWKNIK 413
>gi|182625717|ref|ZP_02953486.1| ATPase, AAA family [Clostridium perfringens D str. JGS1721] >gi|177909119|gb|EDT71594.1| ATPase, AAA family [Clostridium perfringens D str. JGS1721] (418 aa)
Score = 601, Expect = 3.1e-60, Identities = 144/373 (38%), Positives = 239/373 (64%)
  Q:    33 MIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSA---VLKEEVIKYLENKK--VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVL-----KELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKS 405
           +I+N ++ + +F+G PGVGK+     I    +K FY  N+TT++  ++  I   ++        I+ I+E+   NK +Q  LL ++E   +I++A+TTENP+F ++ AI SR  +++ + +++    +  E  +  LE +   + L   V++ I EIS+ D R+ +  L++ +K    + D+I+L     ++LG+ +N   D    ++Y+LLSA  KSIRGSDP+A+++YLA+L++ G++ SV RR+  +  EDIGLA+      VN+ ++ +  +G+PEARI LS++ I L   PKSNSA  AID+A++ + +  A   P HL+DAHY+ A  L V GY YPH+Y   Y+ QEY+P+ ++ KE+YKP  NKY   E+    YWN +K+
  S:    35 LIKNKNIMNCIFYGPPGVGKTTLANIISNYTDKKFYKINATTSSIKEIQSITSDIDNLLNFKGIILYIDELQHFNKKQQQALLEFIEDGRVILIASTTENPYFAIHKAILSRSTIFQFKTVSTEDIIIALERAVSKLEKEGYVISLEEGVLKYIGEISQGDVRKAYTVLELAIK--SQEKDNILLNKEYVEKLGQ-SNLKSDSSGDDYYNLLSALQKSIRGSDPDASIHYLARLIKGGNMDSVIRRIGVIAAEDIGLAHPNALQVVNSGIDLALKIGMPEARIILSELVIYLATLPKSNSAYRAIDDALRDLERNNAGDVPKHLKDAHYSGASNLGVGGYLYPHNYPNGYINQEYMPENMRGKEYYKPKDNKY---ESSIKAYWNNVKN 417
>gi|160893315|ref|ZP_02074102.1| hypothetical protein CLOL250_00864 [Clostridium sp. L2-50] >gi|156865007|gb|EDO58438.1| hypothetical protein CLOL250_00864 [Clostridium sp. L2-50] (438 aa)
Score = 599, Expect = 5.6e-60, Identities = 148/392 (37%), Positives = 236/392 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN-----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRA-------TNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIK 404
           + DE+I ++ I  K+ ++   I+ + L S++F+G PG GK+     I      +F   N+TT+ K D+ +I+E A         + I+ I+EIHR NK +QD LL ++E   II++  TTENP+F+VN A+ SR  ++ ++ ++   +K+ ++K + ++K      V + +  VE + ++S+ D R     +++ +   +  +D  +   L  +    I RRA        NHYD++SAF KS+RGSDP+AAV+YLA++L  G+ I+ + RR+     ED+G A+        A   A E +G+PEA+I L+   I +  +PKSN+ + AI  A   V  E     P +LRDAHY  A KL   GYKY HDY   YV+Q+YLP E+ +++FY+P  N Y QN  +   Y+ KIK
  S:    26 NLDEVIGQEHIIGKNKLLYRAIKADKLGSLIFYGPPGTGKTTLAMVIAHTTKADFKQINATTSGKKDMEQIIEEAKNTKAMYGRRTILFIDEIHRFNKSQQDYLLPFVEDGTIILIGATTENPYFEVNGALISRSNIFELKPLSKENIKDIILKAVYDQKGMGAFNVCIDDDAVEFLSDMSEGDARSALNAVELGVLSSEPAADGRIHITLA-VAEECIQRRALRYDKDGDNHYDIISAFIKSMRGSDPDAAVFYLAKMLYGGESITFIARRIMICACEDVGNADPNAICVATACAQAVERVGMPEAQIILAHAAIYVACAPKSNAIVNAIFSAKDVVEHEQSGQVPVYLRDAHYGGAKKLGHTGYKYAHDYPNHYVKQQYLPDEIADRQFYEPSDNGYEQNIKQ---YFKKIK 435
>gi|170761682|ref|YP_001787888.1| AAA family ATPase [Clostridium botulinum A3 str. Loch Maree] >gi|169408671|gb|ACA57082.1| ATPase, AAA family [Clostridium botulinum A3 str. Loch Maree] (416 aa)
Score = 597, Expect = 8.9e-60, Identities = 150/391 (38%), Positives = 241/391 (61%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK---------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT--NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFY--KPNKYSQNENKFVDYWNKIK 404
            ++ + +  I  ++  + N+++N  + + +F+G PG GK+     +   ++K FY  N+TT +  D+ EI   +      +  ++ I+E+    K +Q  LL ++E   +I++A+TTENP+F ++ AI SR  +++ + +N    +E++I  LE            +K S + +E I EI + D+R+ +  L++ +  +   + +I L  +  +  S I   AT   +Y++LSAF KSIRGSD +AAV+YLA+L++SGD+ S+ RRL  +V EDIGLA       VN+ +  +  +G PEA+I LS+ITI L   PKSNSA +AI  A++ +        P++L+D+HY  A  L V+GYKYPHD+N  YV QEYLPKELK+K +Y  + NKY +N  K   YW  IK
  S:    13 LEDFVGQKHILSENKPLYNLMKNKSICNSIFYGPPGTGKTTLANIMANYVDKKFYRLNATTASIKDIQEITSSINSLLNYSGVVLYIDELQHFTKKQQQALLEFIEDGRVILIASTTENPYFVIHKAILSRCNIFQFKPLN----REDIILGLEKAINKLIDKGINIKYSFESLEYIGEICQGDYRKAYNILELAVNSHCGFNIEITLDYIESLAQSNIRADATGDEYYNILSAFQKSIRGSDADAAVHYLARLIKSGDITSITRRLSVMVAEDIGLAYPNALTIVNSGIELALKVGFPEAQIILSEITIYLATLPKSNSAYIAIKNAMRDLESVNFGDVPDYLKDSHYHGAKNLGVEGYKYPHDFNNHYVSQEYLPKELKDKVYYIAQHNKYEENLKK---YWENIK 413
>gi|170756647|ref|YP_001782185.1| AAA family ATPase [Clostridium botulinum B1 str. Okra] >gi|169121859|gb|ACA45695.1| ATPase, AAA family [Clostridium botulinum B1 str. Okra] (416 aa)
Score = 597, Expect = 1.0e-59, Identities = 149/391 (38%), Positives = 240/391 (61%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK---------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT--NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFY--KPNKYSQNENKFVDYWNKIK 404
            ++ + +  I  ++  + N+++N  + + +F+G PG GK+     +   ++K FY  N+TT +  D+ EI   +      +  ++ I+E+    K +Q  LL ++E   +I++A+TTENP+F ++ AI SR  +++ + +N    +E++I  LE            +K S + +E I EI + D+R+ +  L++ +  +   + +I L  +  +  S I   AT   +Y++LSAF KSIRGSD +AAV+YLA+L++SGD+ S+ RRL  +  EDIGL+       VN+ +  +  +G PEA+I LS+ITI L   PKSNSA +AI  A++ +        P+HL+D+HY  A  L V+GYKYPHD+N  YV QEYLPKELK+K +Y  + NKY +N  K   YW  IK
  S:    13 LEDFVGQKHILSENKPLYNLMKNKSICNSIFYGPPGTGKTTLANIMANYVDKKFYRLNATTASIKDIQEITSSINSLLNYSGVVLYIDELQHFTKKQQQALLEFIEDGRVILIASTTENPYFVIHKAILSRCNIFQFKPLN----REDIILGLEKAINKLIDKGINIKYSFESLEYIGEICQGDYRKAYNILELAVNSHCGFNIEITLDYIESLAQSNIRADATGDEYYNILSAFQKSIRGSDADAAVHYLARLIKSGDITSITRRLSVMAAEDIGLSYPNALTIVNSGIELALKVGFPEAQIILSEITIYLATLPKSNSAYIAIKNAMKDLESVNFGDVPDHLKDSHYHGAKNLGVEGYKYPHDFNNHYVSQEYLPKELKDKVYYIAQHNKYEENLKK---YWENIK 413
>gi|148380525|ref|YP_001255066.1| ATPase, AAA family [Clostridium botulinum A str. ATCC 3502] >gi|153933551|ref|YP_001384812.1| recombination factor protein RarA [Clostridium botulinum A str. ATCC 19397] >gi|153936060|ref|YP_001388283.1| recombination factor protein RarA [Clostridium botulinum A str. Hall] >gi|148290009|emb|CAL84128.1| putative ATPase [Clostridium botulinum A str. ATCC 3502] >gi|152929595|gb|ABS35095.1| ATPase, AAA family [Clostridium botulinum A str. ATCC 19397] >gi|152931974|gb|ABS37473.1| ATPase, AAA family [Clostridium botulinum A str. Hall] (416 aa)
Score = 595, Expect = 1.6e-59, Identities = 152/391 (38%), Positives = 240/391 (61%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV---------EAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT--NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFY--KPNKYSQNENKFVDYWNKIK 404
            ++ + +  I  ++  + N+++N  + + +F+G PG GK+     +   ++K FY  N+TT +  D+ EI   +      +  ++ I+E+    K +Q  LL ++E   +I++A+TTENP+F ++ AI SR  +++ + +N    +E++I  LE    KL +K +         E I EI + D+R+ +  L++ +  +   + +I L  +  +  S I   AT   +Y++LSAF KSIRGSD +AAV+YLA+L++SGD+IS+ RRL  +  EDIGLA       VN+ +  +  +G PEA+I LS+ITI L   PKSNSA +AI  A + + N      P+HL+D+HY  A  L + GYKYPHD+N  YV QEYLPKELK+K +Y  + NKY +N  K   YW  IK
  S:    13 LEDFVGQKHILSENKPLYNLMKNKSICNSIFYGPPGTGKTTLANIMANYVDKKFYRLNATTASIKDIQEITSSINSLLNYSGVVLYIDELQHFTKKQQQALLEFIEDGRVILIASTTENPYFVIHKAILSRCNIFQFKPLN----REDIILGLEKAINKLIDKGINIKYTFESLEYISEICQGDYRKAYNILELAVNSHCGFNIEINLDYIESLAQSNIRADATGDEYYNILSAFQKSIRGSDADAAVHYLARLIKSGDMISITRRLSVMAAEDIGLAYPNALTIVNSGIELALKVGFPEAQIILSEITIYLATLPKSNSAYIAIKNATKDLENINFGDVPDHLKDSHYYGAKNLGIGGYKYPHDFNNHYVSQEYLPKELKDKVYYIAQHNKYEENLKK---YWENIK 413
>gi|168180541|ref|ZP_02615205.1| ATPase, AAA family [Clostridium botulinum NCTC 2916] >gi|182668511|gb|EDT80490.1| ATPase, AAA family [Clostridium botulinum NCTC 2916] (416 aa)
Score = 595, Expect = 1.6e-59, Identities = 152/391 (38%), Positives = 241/391 (61%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV---------EAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT--NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFY--KPNKYSQNENKFVDYWNKIK 404
            ++ + +  I  ++  + N+++N  + + +F+G PG GK+     +   ++K FY  N+TT +  D+ EI   +      +  ++ I+E+    K +Q  LL ++E   +I++A+TTENP+F ++ AI SR  +++ + +N    +E++I  LE    KL +K +         E I EI + D+R+ +  L++ +  +   + +I L  +  +  S I   AT   +Y++LSAF KSIRGSD +AAV+YLA+L++SGD+ S+ RRL  +  EDIGLA       VN+ +  +  +G PEA+I LS+ITI L   PKSNSA +AI  A++ + N      P+HL+D+HY  A  L V+GYKYPHD+N  YV QEYLPKELK+K +Y  + NKY +N  K   YW  IK
  S:    13 LEDFVGQKHILSENKPLYNLMKNKSICNSIFYGPPGTGKTTLANIMANYVDKKFYRLNATTASIKDIQEITSSINSLLNYSGVVLYIDELQHFTKKQQQALLEFIEDGRVILIASTTENPYFVIHKAILSRCNIFQFKPLN----REDIILGLEKAINKLIDKGINIKYTFESLEYISEICQGDYRKAYNILELAVNSHCGFNIEINLDYIESLAQSNIRADATGDEYYNILSAFQKSIRGSDADAAVHYLARLIKSGDITSITRRLSVMAAEDIGLAYPNALTIVNSGIELALKVGFPEAQIILSEITIYLATLPKSNSAYIAIKNAMKDLENINFGDVPDHLKDSHYHGAKNLGVEGYKYPHDFNNHYVSQEYLPKELKDKVYYIAQHNKYEENLKK---YWENIK 413
>gi|169832181|ref|YP_001718163.1| ATPase central domain-containing protein [Candidatus Desulforudis audaxviator MP104C] >gi|169639025|gb|ACA60531.1| AAA ATPase, central domain protein [Candidatus Desulforudis audaxviator MP104C] (435 aa)
Score = 595, Expect = 1.7e-59, Identities = 137/382 (35%), Positives = 222/382 (58%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEA-------IVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENK 395
            DE   ++ I     ++   IE++ L SI+ +G PG GK+     I +    NF   ++ ++   +L +++E A +       K I+ ++E H  NK +QD+LL  +EK ++  +  TTENP+F++  A+ SR  ++R+E +++  L+  + + L +++  L     E        +V ++  D R     L++ +       D I    L    +S+       D+    HYD++SAF KSIRGSDP+AA+++ A++  +G D   + RRL  +  EDIGLA+       +AA NA E +G+PEARIP++Q  I L L+PKSNSA  AI+ A+  V +++  P P HLRD HY  A KL   GY YPHD+   YV+Q+YLP +LK +++Y+P+       K
  S:    33 LDEFTGQEHIVGPGKLLRRAIESDLLGSIILYGPPGSGKTTLAHIISRTTKSNFRTVSAVSSGVKELRQVIEAAADSLKFHGRKTILFVDECHAFNKSQQDVLLPGIEKGIVTFIGGTTENPYFEMRGALLSRSRIFRLEELSTEDLESILRRALADRERGLGEYPAEVEPEALAHLVGVAGGDARSALNALELAVMSTPPGPDGIRRINLATAQDSIQKRAVRYDQAGDQHYDVISAFIKSIRGSDPDAALHWYARMTYAGEDQRFIMRRLIILASEDIGLADPRAMLIAHAAWNALETVGMPEARIPVAQCIIYLALAPKSNSAYRAIEAALDDVREKSPGPVPPHLRDTHYPGAAKLGHTGYLYPHDHPGHYVDQQYLPDKLKGRKYYRPSGQGMERKK 434
>gi|31544730|ref|NP_853308.1| recombination factor protein RarA [Mycoplasma gallisepticum R] >gi|31541576|gb|AAP56876.1| predicted ATP/GTPase [Mycoplasma gallisepticum R] (413 aa)
Score = 593, Expect = 2.7e-59, Identities = 154/406 (37%), Positives = 239/406 (58%)
  Q:     1 VKKFDEKVLVCNSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQN-KSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSN 406
           V K  E      S +++I +  +  +  I+  MI+    +S+L  G PG+GK+     ++ ++N   + FNS +++  +L + +  A E N+ +III+EIHRL++DKQDLL+  L+    I+   TTENP+F +NPAIRSR+    + N  S  L E   K ++ K  V +S+ ++  I  +   D R+    ++++  YY+N +  + +LK +     +L     T H DL SA  KSIRGSDP+AAVYYLAQL+ + DLI++ RRL A  YEDIGLAN  L  +V  A  A++  G PEA   LS I IE+ LS KS+SA  AI +A+  V N    + P H++      +  L N++ YK PH+Y+  +V Q+YLP+E+++K++Y    ++ NE    DYW K + +
  S:     4 VSKNKEPFYQPESVEDIIGQKHLLHEYGILRRMIDLRKPYSLLVTGEPGIGKTTLCNILISEMNLPSFSFNSASDSLQELKQFISKAKELNQCVIIIDEIHRLHRDKQDLLIKGLDAKSFILFGITTENPYFTINPAIRSRVHTIELVNPTSIELFEGYKKIVQQKNIVTISDDILYKIANMVNGDLRKGINIIELLDIYYKNVEITEEILKNVIDNNVTLASYGDTFH-DLKSALQKSIRGSDPDAAVYYLAQLIATKDLITISRRLIACAYEDIGLANPDLCSRVYLATQAAKEAGFPEANQILSSIVIEMALSEKSSSAYEAISDALVEVANGNIQNVPWHIKKNPINLSSTLNNMQKYKNPHNYDNHWVSQDYLPREIRDKKYYIKQAHNYNEKLINDYWLKWRKD 412
>gi|168182648|ref|ZP_02617312.1| ATPase, AAA family [Clostridium botulinum Bf] >gi|182674164|gb|EDT86125.1| ATPase, AAA family [Clostridium botulinum Bf] (416 aa)
Score = 593, Expect = 2.8e-59, Identities = 152/391 (38%), Positives = 239/391 (61%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV---------EAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT--NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFY--KPNKYSQNENKFVDYWNKIK 404
            ++ + +  I  ++  + N+++N  + + +F+G PG GK+     +   ++K FY  N+TT +  D+ EI   +      +  ++ I+E+    K +Q  LL ++E   +I++A+TTENP+F ++ AI SR  +++ + +N    +E++I  LE    KL +K +         E I EI + D+R+ +  L++ +      + +I L  +  +  S I   AT   +Y++LSAF KSIRGSD +AAV+YLA+L++SGD+ S+ RRL  +  EDIGLA       VN+ +  +  +G PEA+I LS+ITI L   PKSNSA +AI  A++ + N      P+HL+D+HY  A  L V GYKYPHD+N  YV QEYLPKELK+K +Y  + NKY +N  K   YW  IK
  S:    13 LEDFVGQKHILSENKPLYNLMKNKSICNSIFYGPPGTGKTTLANIMANYVDKKFYRLNATTASIKDIQEITSSINSLLNYSGVVLYIDELQHFTKKQQQALLEFIEDGRVILIASTTENPYFVIHKAILSRCNIFQFKPLN----REDIILGLEKAINKLIDKGINIKYTFESLEYIGEICQGDYRKAYNILELAVNSRCGFNIEITLDYIESLAQSNIRADATGDEYYNILSAFQKSIRGSDADAAVHYLARLIKSGDITSITRRLSVMAAEDIGLAYPNALTIVNSGIELALKVGFPEAQIILSEITIYLATLPKSNSAYIAIKNAMKDLENINFGDVPDHLKDSHYYGAKNLGVGGYKYPHDFNNHYVSQEYLPKELKDKVYYIAQHNKYEENLKK---YWENIK 413
>gi|89211610|ref|ZP_01189966.1| AAA ATPase, central region [Halothermothrix orenii H 168] >gi|89158794|gb|EAR78486.1| AAA ATPase, central region [Halothermothrix orenii H 168] (450 aa)
Score = 592, Expect = 4.0e-59, Identities = 149/388 (38%), Positives = 233/388 (60%)
  Q:    20 KDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN-----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-----------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE--NKFVDYWNKIKSNN 407
           +DVI P   +    IE + + S++ +G PG GK++  Q I +K    F   N+ T+  + + E+++ A+++      K I+ I+EIHR NK +QD LL  +E   I ++  TTENP+F+VN  + SR  + R++ +     KE++IK L+N             + +S   ++ +  I+  D R     L+I +       + I+      I+ SL       D++  NHYD++SAF KS+RGSDP+AA+++LA++LESG D   + RR+     ED+G+A+        +A NA E +GLPEARIPL++  I +  +PKSNS I  ID A+  V N +    P HLRDAHY  A  L    GYKYPHDY + YV+Q+Y+P E+   EFYKP +  + +   + +D+   + SN+
  S:    36 EDVIGPGKPLR-RAIEADRVQSLILYGPPGCGKTSLAQVIARKTEGKFIRINAVTSGVSKIREVIDKASKNRSLHGIKTILFIDEIHRFNKSQQDALLPAVESGTITLIGATTENPYFEVNSPLLSRSRIVRLKPLK----KEDIIKILKNALNNEERGLGNYNIDISQDALQYLASIAGGDARTALNGLEIAVLTTPPDKEGIIHINKNIISESLQKKLLKYDKQGDNHYDVVSAFIKSMRGSDPDAALFWLARMLESGEDPRFIARRIIVHAAEDVGMADPMALVVATSAANAVEYVGLPEARIPLAEAVIYIATAPKSNSVITGIDAALNYVKNNDTGEVPLHLRDAHYKGARNLKHGLGYKYPHDYPYHYVKQQYVPDEVTGTEFYKPGQQGREKKIKQRLDFLKNLNSND 445
>gi|153814369|ref|ZP_01967037.1| hypothetical protein RUMTOR_00579 [Ruminococcus torques ATCC 27756] >gi|145848765|gb|EDK25683.1| hypothetical protein RUMTOR_00579 [Ruminococcus torques ATCC 27756] (438 aa)
Score = 591, Expect = 5.2e-59, Identities = 141/392 (35%), Positives = 231/392 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           + DE++ +  I  KD ++   I+ + L S++F+G PG GK+   + I    +  F   N+T   K D+ E+++ A +       + I+ I+EIHR NK +QD LL ++E   +I++  TTENP+F+VN A+ SR  ++ ++ +    +K  + + +E+++        K+  + +E + ++S  D R     +++ +   +   D I+   L   +  +       D++  NHYD++SAF KS+RGSDP+AAV+YLA++L +G D+  + RR+     ED+G A+        +A  A E +G+PE++I LSQ    +  +PKSNSA+ AI  A ++V     S P HLRDAHY  A KL +   YKY HDY   YV+Q+YLP E+KN  FY+P      E    +Y  KI+
  S:    26 TLDEVVGQQHIIGKDKLLYRAIKADKLSSVIFYGPPGTGKTTLAKVIANTTSAEFKQINATVAGKKDMEEVVKEAKDMQGMYGKRTILFIDEIHRFNKGQQDYLLPFVEDGTVILIGATTENPYFEVNGALLSRSAVFELKPLEKEDIKILLRRAVEDEEKGLGSFGAKIEEEALEFLADMSGGDARSALNAIELGVLTTERSEDGIIHITLETASECIQKRVVNYDKKGDNHYDIISAFIKSMRGSDPDAAVFYLAKMLYAGEDVKFIARRIMICAAEDVGNADPMALTVAVSAAQAVERIGMPESQIILSQAVTYVACAPKSNSAVNAIFAANEAVRNYQTSVPAHLRDAHYKGAKKLGHGTDYKYAHDYPDHYVKQQYLPDEIKNARFYEPGILGY-EKTITEYLQKIR 436
>gi|150015980|ref|YP_001308234.1| recombination factor protein RarA [Clostridium beijerinckii NCIMB 8052] >gi|149902445|gb|ABR33278.1| AAA ATPase, central domain protein [Clostridium beijerinckii NCIMB 8052] (414 aa)
Score = 590, Expect = 6.1e-59, Identities = 146/393 (37%), Positives = 233/393 (59%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAV----LKEEVIKYL-ENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI--DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFY--KPNKYSQNENKFVDYWNKIK 404
           N  ++ + +  I  +   + N+I   ++ + +F+G PG GK+     +   ++K FY  N+T  +  D+ +I   ++     N  ++ I+E+   NK +Q  LL ++E   I ++A+TTENP+F ++ AI SR  ++  + + +      LK  + K + E  +++ S++ +E I EIS+ D+R+ +  L++ +     +   I  + +  +  S +  D      Y+LLSA  KSIRGSDPNAAV+YLA+L++ G+L ++ RR+  +  EDIGLA       VN+ +  S  +GLPEARI LS+I + L   PKSNSA +AID A+  + N      P HL+DAHY+ A  L V GYKYPHDY   YV+Q YLP+EL  K +Y  + NKY ++  K   YW +IK
  S:    11 NKLEDFVGQQHILGQGKPLYNLIAGKNICNCIFYGPPGTGKTTLANIMANYVDKKFYKLNATVASVKDIQDITNNIDSLLNYNGVVLYIDELQHFNKKQQQALLEFIEDGRITLIASTTENPYFVIHKAIISRCNIFSFKPLTTGDIIVGLKRSIQKLIDEGIEIEYSDEALEYIGEISQGDYRKAYNILELAVNSQVKQVRVISSEYIESLGQSSMRADSSGDEFYNLLSALQKSIRGSDPNAAVHYLARLIKGGNLTAIIRRISVIAAEDIGLAFPNALSVVNSGIELSLKVGLPEARIILSEIVVYLATLPKSNSAYLAIDSAMSDLENMNFGDVPMHLKDAHYSGAANLGVGGYKYPHDYPNHYVKQSYLPQELLGKIYYNEQNNKYEESLRK---YWAEIK 413
>gi|15894948|ref|NP_348297.1| recombination factor protein RarA [Clostridium acetobutylicum ATCC 824] >gi|15024632|gb|AAK79637.1|AE007676_7 Predicted ATPase related to the helicase subunit of the Holliday junction resolvase [Clostridium acetobutylicum ATCC 824] (421 aa)
Score = 588, Expect = 1.1e-58, Identities = 153/392 (39%), Positives = 241/392 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE---DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKE------EVIK-YLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDD-----IVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEAL-SPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           +F+E+  +  I  +  I+  +++++ + +++F+G PG GK+     I KK NK FY  N+TT +  D+ EI +        N  ++ ++EI   NK +Q  LL ++E   I ++A+TTENP+F V  AI SR  ++  + + S  L +      E+IK  L+  ++ ++    +  V +S  D R+    ++I +  Y  K ++     I L+ + + T   +   D+   NHYD+LSAF KSIRGSD +AAV YLA L++ GDL S+ RRL  +  EDIGLA       V A  +++  LG PEARIPL++  I L  SPKSNSAI A+D A++ ++   + S P++LRD HY  A KL  ++ YKYPH Y  +YV+Q+YLP  L+N+ +Y+  K ++ E K  +YW +IK
  S:    12 NFNEVFGQKHIIGEGKILDRILKSSLVPNMIFYGPPGTGKTTVANIIAKKTNKAFYKLNATTASVKDVREITDSTNTLMGRNGVLLYLDEIQNFNKKQQQSLLEFMENGSITLIASTTENPYFYVYNAILSRSTIFEFKPLESDELMKAVNRAVELIKDELKTTEIIITEDAKKYAVGVSSGDVRKTLNSIEIAV--YSTKPNEEGNIFIDLETMKECTQKNVLNFDKDGDNHYDILSAFQKSIRGSDADAAVLYLAMLIKGGDLKSICRRLLVIAAEDIGLAYPQAISIVKACTDSALELGFPEARIPLAEAVILLATSPKSNSAITAVDSALRDLDTINVGSIPDYLRDGHYEGAKKLGRMQDYKYPHSYENNYVKQKYLPSNLENRRYYEYGK-NKIEEKCREYWERIK 420
>gi|153854634|ref|ZP_01995884.1| hypothetical protein DORLON_01879 [Dorea longicatena DSM 13814] >gi|149752738|gb|EDM62669.1| hypothetical protein DORLON_01879 [Dorea longicatena DSM 13814] (439 aa)
Score = 587, Expect = 1.4e-58, Identities = 138/376 (36%), Positives = 225/376 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRI-----ENINSAVLKE--EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           + +E++ +  I  KD ++   I+ + L S++F+G PG GK+   + I    +  F   N+TT  K D+ E++  A E       K I+ ++EIHR NK +QD LL ++E   II++  TTENP+F+VN A+ SR  ++ +     E+I + + +   + +K + + +  +    +E + +IS  D R     +++ +   +  +D  +   L   +  +       D+   NHYD +SAF KS+RGSDP+AAVYYLA++L +G D+  + RR+     ED+G A+        +A  A E +G+PEA+I LSQ    +  +PKSN+A  AI +A+ SV +   + P+HL+DAHY  A KL    GYKY H+Y   YVEQ+YLP E+  ++FY P++
  S:    26 TLEEVVGQQHIIGKDKLLYRAIKADKLSSVIFYGPPGTGKTTLAKVIANTTSAEFTQINATTAGKKDMEEVINKAKEMQGMYRKKTILFVDEIHRFNKGQQDYLLPFVEDGTIILIGATTENPYFEVNGALLSRSSIFELQPLAKEDIKTLITRAVYDTVKGMGSYQAVIDEDALEFLADISGGDARSALNAVELGILTTERSADGKIRITLDVASECIQKRVVKYDKTGDNHYDTISAFIKSMRGSDPDAAVYYLAKMLYAGEDIKFIARRIMICASEDVGNADPMALTVAVSASQAVERIGMPEAQIILSQAVTYVATAPKSNAACNAIFDAMASVKRTKTTVPSHLQDAHYKGAQKLGHGIGYKYAHNYPHHYVEQQYLPDEIVGEKFYVPSE 421
>gi|168714797|ref|ZP_02747074.1| recombination factor protein RarA [Clostridium difficile QCD-63q42] (421 aa)
Score = 586, Expect = 1.6e-58, Identities = 145/389 (37%), Positives = 244/389 (62%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-ELATEDN--KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKE------EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWN 401
           + +++I +  I     I+  ++++N L +++FFG PGVGK+   + I ++ NK+FY  N+T ++  D+ +++ EL + +N    ++ I+EI   NK +Q  +L ++E   I ++A+TTENP+  V  A+ SR  ++  + +    +++      EV+       ++ +N  +E I  +S  D R+    L++V+   +   D+I   +   I  S        D+   +HYD+LSAF KSIRGSDP A+++YLA+L++ GDLIS+ RRL  +  EDIGLA       V A V+++  LG PEA+IPL++ TI L  SPKSNSA +AI +A+  ++KE +   PN ++DAHY+ + ++    GYKYPH++   YV+Q+YLP  +K+  +Y P  NK  +N  K+++Y N
  S:    11 TMNDVIGQSHIIGNGKILSKILQSNFLPNMIFFGPPGVGKTTVAEIIAERSNKSFYKINATNSSLEDIKKVISELGSINNVNGVLLYIDEIQSFNKKQQQSILEFMENGSITLIASTTENPYHYVYKALLSRSTVFEFKPLEKLDIEKGLKRAVEVLNEDSYMDIECNNNAIEDIAILSDGDMRRALNILEVVVYSTKPNKDNITYIDSDVIRASTFNKIINYDKNGDSHYDILSAFQKSIRGSDPQASIHYLARLIKGGDLISICRRLLVIASEDIGLAYPNAIVIVKACVDSAMQLGFPEAKIPLAEATILLATSPKSNSACIAIMKAMDELDKEFVKDIPNSIKDAHYSGSKEIGRGCGYKYPHNFKNHYVKQQYLPDSIKDSIYYIPQENKTEKNIKKYLEYLN 418
>gi|187932817|ref|YP_001885365.1| ATPase, AAA family [Clostridium botulinum B str. Eklund 17B] >gi|187720970|gb|ACD22191.1| ATPase, AAA family [Clostridium botulinum B str. Eklund 17B] (428 aa)
Score = 586, Expect = 1.8e-58, Identities = 147/387 (37%), Positives = 237/387 (61%)
  Q:    23 IFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-ELATEDNKP--IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENI---NSAVLKEEVIKYLENK--KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKI--TNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFY--KPNKYSQNENKFVDYWNKIKSNNKQ 409
           I  +++ + N+I++  + + +F+G PG GK+     + K ++K FY  N+TT +  D+  I  EL    N    ++ I+E+   NK +Q  LL ++E   I ++A+TTENP+F ++ AI SR  ++  E +   +  V  E+ +  L N+  +V  SN+ ++ I EIS+ D+R+ +  L++ +        +I +  + K+  +N   D      Y+LLSA  KSIRGSD +AA++YLA+L++ G++ ++ RR+  +V EDIGLA+      VN+ ++ +  +G PEARI L+++ I L   PKSNSA +AI+ A+  +        P HL+D HYA A  L V GYKYPHDY   Y++QEYLP ELK K +Y  + NKY +N  K   YW+ IK+N+ +
  S:    22 ILGENTPLYNLIKSKKICNCIFYGPPGTGKTTLANIMAKYVDKKFYKLNATTASVKDIQNITNELDNLLNYAGVVLYIDELQHFNKKQQQSLLEFIEDGRITLIASTTENPYFVIHKAIISRCNIFAFEPLIISDIIVGLEKSLDKLINEGIEVTYSNEALKYIAEISQGDYRKAYNILELSINSQMTLHKEISVDYIEKLGQSNMRADNSGDEFYNLLSALQKSIRGSDSDAAIHYLARLIKGGNIAAIIRRISVIVAEDIGLAHPNALTVVNSGLDLAMKVGFPEARIVLAELVIYLATLPKSNSAYLAINSAMNDLESINFGDVPKHLKDGHYAGAESLGVGGYKYPHDYPNHYIKQEYLPTELKKKRYYIEQNNKYEENIRK---YWSSIKNNSNE 418
>gi|145955003|ref|ZP_01804007.1| hypothetical protein CdifQ_04001411 [Clostridium difficile QCD-32g58] >gi|168696395|ref|ZP_02728672.1| recombination factor protein RarA [Clostridium difficile QCD-37x79] >gi|168723239|ref|ZP_02755516.1| recombination factor protein RarA [Clostridium difficile QCD-76w55] >gi|168730872|ref|ZP_02763149.1| recombination factor protein RarA [Clostridium difficile QCD-97b34] >gi|196127276|ref|ZP_03119025.1| recombination factor protein RarA [Clostridium difficile ATCC 43255] >gi|196159984|ref|ZP_03120545.1| recombination factor protein RarA [Clostridium difficile CIP 107932] (421 aa)
Score = 585, Expect = 2.1e-58, Identities = 145/389 (37%), Positives = 244/389 (62%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-ELATEDN--KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKE------EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWN 401
           + +++I +  I     I+  ++++N L +++FFG PGVGK+   + I ++ NK+FY  N+T ++  D+ +++ EL + +N    ++ I+EI   NK +Q  +L ++E   I ++A+TTENP+  V  A+ SR  ++  + +    +++      EV+       ++ +N  +E I  +S  D R+    L++V+   +   D+I   +   I  S        D+   +HYD+LSAF KSIRGSDP A+++YLA+L++ GDLIS+ RRL  +  EDIGLA       V A V+++  LG PEA+IPL++ TI L  SPKSNSA +AI +A+  ++KE +   PN ++DAHY+ + ++    GYKYPH++   YV+Q+YLP  +K+  +Y P  NK  +N  K+++Y N
  S:    11 TMNDVIGQSHIIGNGKILSKILQSNFLPNMIFFGPPGVGKTTVAEIIAERSNKSFYKINATNSSLEDIKKVISELGSINNVNGVLLYIDEIQSFNKKQQQSILEFMENGSITLIASTTENPYHYVYKALLSRSTVFEFKPLEKLDIEKGLKRAVEVLNEDSYMDIECNNNAIEDIAILSDGDMRRALNILEVVVYSTKPNKDNITYIDSDVIRASTFNKIINYDKNGDSHYDILSAFQKSIRGSDPQASIHYLARLIKGGDLISICRRLLVIASEDIGLAYPNAIVIVKACVDSAMQLGFPEAKIPLAEATILLATSPKSNSACIAIMKAMDELDKEFVKDIPNSIKDAHYSGSKEIGRGCGYKYPHNFKNHYVKQQYLPDSIKDSIYYIPQENKTEKNIKKYLEYLN 418
>gi|167758834|ref|ZP_02430961.1| hypothetical protein CLOSCI_01177 [Clostridium scindens ATCC 35704] >gi|167663574|gb|EDS07704.1| hypothetical protein CLOSCI_01177 [Clostridium scindens ATCC 35704] (438 aa)
Score = 585, Expect = 2.4e-58, Identities = 144/391 (36%), Positives = 232/391 (59%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRI-----ENINSAVLKE--EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT-------NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE--NKFVDYWNK 402
           ++ +E++ +  I  KD ++   I+ + L SI+F+G PG GK+   + I    +  F   N+T   K D+ E++  A E       K I+ ++EIHR NK +QD LL ++E   II++  TTENP+F+VN A+ SR  ++ +     E+I + + +   +V K + +    +    +E + +IS  D R     +++ +     +SDD  +     + +  I +R         NHYD +SAF KS+RGSDP+AAVYYLA++L +G D+  + RR+     ED+G A+        +A  A E +G+PEA+I LSQ  + +  +PKSNSA  AI  A+++V  +  S P HL+DAHY  +  L    GYKY HDY   YV+Q+YLP+E+K+  FY+P    Q +   ++++Y  K
  S:    25 STLEEVVGQQHIIGKDKLLYRAIKADKLSSIIFYGPPGTGKTTLAKVIANTTSAVFTQINATVAGKKDMEEVVGRAKETLGMYQKKTILFVDEIHRFNKSQQDYLLPFVEDGTIILIGATTENPYFEVNGALISRSSIFELHPLDKEDIKTVIRRAVYDVEKGMGSYDAVIEEDALEFLADISGGDARNALNAVELGI-LTTERSDDGKIHITLPVASECIQKRVVRYDKTGDNHYDTISAFIKSMRGSDPDAAVYYLAKMLYAGEDIKFIARRIMICASEDVGNADPMALTVAVSAAQAVERIGMPEAQIILSQAVLYVATAPKSNSATNAIFGAMENVKSQKTSVPAHLQDAHYKGSKNLGHGIGYKYAHDYPHHYVKQQYLPEEIKDARFYEPGDMGQEKEIKRWMEYLKK 437
>gi|126698873|ref|YP_001087770.1| recombination factor protein RarA [Clostridium difficile 630] >gi|115250310|emb|CAJ68132.1| putative ATPase [Clostridium difficile 630] (431 aa)
Score = 584, Expect = 2.9e-58, Identities = 145/389 (37%), Positives = 244/389 (62%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-ELATEDN--KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKE------EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWN 401
           + +++I +  I     I+  ++++N L +++FFG PGVGK+   + I ++ NK+FY  N+T ++  D+ +++ EL + +N    ++ I+EI   NK +Q  +L ++E   I ++A+TTENP+  V  A+ SR  ++  + +    +++      EV+       ++ +N  +E I  +S  D R+    L++V+   +   D+I   +   I  S        D+   +HYD+LSAF KSIRGSDP A+++YLA+L++ GDLIS+ RRL  +  EDIGLA       V A V+++  LG PEA+IPL++ TI L  SPKSNSA +AI +A+  ++KE +   PN ++DAHY+ + ++    GYKYPH++   YV+Q+YLP  +K+  +Y P  NK  +N  K+++Y N
  S:    21 TMNDVIGQSHIIGNGKILSKILQSNFLPNMIFFGPPGVGKTTVAEIIAERSNKSFYKINATNSSLEDIKKVISELGSINNVNGVLLYIDEIQSFNKKQQQSILEFMENGSITLIASTTENPYHYVYKALLSRSTVFEFKPLEKLDVEKGLKRAVEVLNEDSYMDIECNNDAIEDIAILSDGDMRRALNILEVVVYSTKPNKDNITYIDSDVIRASTFNKIINYDKNGDSHYDILSAFQKSIRGSDPQASIHYLARLIKGGDLISICRRLLVIASEDIGLAYPNAIVIVKACVDSAMQLGFPEAKIPLAEATILLATSPKSNSACIAIMKAMDELDKEFVKDIPNSIKDAHYSGSKEIGRGCGYKYPHNFKNHYVKQQYLPDSIKDSIYYIPQENKTEKNIKKYLEYLN 428
>gi|153809776|ref|ZP_01962444.1| hypothetical protein RUMOBE_00157 [Ruminococcus obeum ATCC 29174] >gi|149833954|gb|EDM89034.1| hypothetical protein RUMOBE_00157 [Ruminococcus obeum ATCC 29174] (427 aa)
Score = 584, Expect = 3.0e-58, Identities = 141/374 (37%), Positives = 226/374 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRI-----ENINSAVLK--EEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI-------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + DE++ ++ I  KD ++   I+ + L S++F+G PG GK+   + I    + +F   N+T   K D+ E+++ A +       K I+ I+EIHR NK +QD LL ++E   II++  TTENP+F+VN A+ SR +++ +     ENI + +L+   +  K + N    + +  +E + +++  D R     +++ +     KS+D  +     + +  I       D++  NHYD++SAF KS+RGSDP+AAVYYLA++L +G D+  + RR+  +  EDIG A+        AA  A E +G+PE++I LSQ    +  +PKSN+A+ AI  A+ SV     + P HL+DAHY    KL    GYKY HDY   YV Q+YLP E++   FY+P
  S:    26 TLDEVVGQEHIVGKDKLLYRAIKADKLTSVIFYGPPGTGKTTLAKVIANTTSASFTQINATVAGKKDMEEVVKEAQDRLGMYGKKTILFIDEIHRFNKGQQDYLLPFVEDGTIILIGATTENPYFEVNGALLSRSIIFELKPLSNENIRTLILRAVNDCDKGMGNYGAVIDDDALEFLADMAGGDARSALNAVELGI-LTTPKSEDGSIHLTLDVASECIQKRVIKYDKKGDNHYDIISAFIKSMRGSDPDAAVYYLAKMLYAGEDVKFIARRIMILASEDIGNADPQALQVAVAAAQAVERVGMPESQIILSQAVTYMACAPKSNAAVNAIFAAMDSVKHTQTTVPVHLQDAHYGGHEKLGKGIGYKYAHDYPDHYVNQQYLPSEIEGSHFYEP 419
>gi|167217597|ref|ZP_02287233.1| recombination factor protein RarA [Listeria monocytogenes FSL J1-175] (332 aa)
Score = 583, Expect = 4.5e-58, Identities = 131/292 (44%), Positives = 188/292 (64%)
  Q:   102 RLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDF--------RQIFFYLKIVLKYYQNKSDDI------VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLN-VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           RL+K KQD LL  LE   II++  TT NP+  +NPAIRSR  ++ ++ +    +   + + L +K+  L N  VE I E++K  F        R     L++ +   +   D +      V +E  +  +   D+    HYD+LSAF KS+RGSD NAA++Y+ +L+E+GDL+S+ RR+  + YEDIGLA+   G    AA+  +E +G PEARIPL+   IELCLSPKSNSAIMAID A+  + + ++   P+HLRD HY+ A KL     YKYPH+Y+ ++VEQ+YLP  LKNK +Y P   S+ E
  S:     1 RLDKAKQDFLLPLLESGAIILIGATTSNPYIAINPAIRSRTQIFELKPLTVEDIMITMDRALSDKERGLGNYDVE-IDEVAKKHFATASNGDVRSALNALELAVISSEPNEDGVIHITLDVAEECLQKKSLAHDKDGDAHYDVLSAFQKSVRGSDVNAALHYMGRLIEAGDLVSISRRMLVMAYEDIGLASPQAGAHTLAAIQTAEKVGFPEARIPLANAVIELCLSPKSNSAIMAIDAALADIRQGKSGEVPDHLRDGHYSGAEKLGRAIDYKYPHNYDNAWVEQQYLPDRLKNKLYYAPKFTSKFE 307
>gi|167754507|ref|ZP_02426634.1| hypothetical protein CLORAM_00008 [Clostridium ramosum DSM 1402] >gi|167705339|gb|EDS19918.1| hypothetical protein CLORAM_00008 [Clostridium ramosum DSM 1402] (413 aa)
Score = 582, Expect = 4.9e-58, Identities = 139/377 (36%), Positives = 212/377 (56%)
  Q:    27 DSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE-----NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS-DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQ----EYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           ++I+   ++ +  FSI+ +G+PG GK+     +   L+  +  FN++T NK ++  I+E A       +II+E+HRLNK +QD LL ++E  ++IV   TT NPF  +NPAIRSR  +  +  +    +   + K +      N K  +  + + +I ++   D R  +  L+I     +N       LK     TN + D+   N+YD LS   KSIRGSDPN A+YY A+L+ES D+ S+ RRL    YEDIGLAN     +   A+ A++ +G PEARIP++   I+LCLSPKS S+  AID A+ S+N+ +L  P++LR         L   G +    Y++S  E     +YLPKEL N +FY P   S  E    + + +I
  S:    19 NAILTKFVQKSHPFSIILYGSPGCGKTTIAMALANDLDIPYRIFNASTGNKKEMDAIIEEAKLSGSLFVIIDEVHRLNKARQDDLLSHMESGLLIVAGCTTANPFHSINPAIRSRCHILEVRPLTVDEIVAGLNKAMTSPNGLNNKYTIEKEALHSIAKLCSGDIRYGYNCLEICTIVCENNHITQADLKTAAIKTNVVYDKDEDNYYDTLSGLQKSIRGSDPNGAMYYFAKLIESKDIESLERRLITTAYEDIGLANPNACMRTVIAMQAAKTIGFPEARIPIASAIIDLCLSPKSKSSENAIDAALTSLNERSLKTPSYLR---------LTPVGLEDDEKYDYSRPELWEYIQYLPKELGNTQFYVPWMTSNYEKALAENYRRI 396
>gi|196165579|ref|ZP_03126110.1| recombination factor protein RarA [Clostridium difficile QCD-23m63] (421 aa)
Score = 581, Expect = 6.2e-58, Identities = 145/387 (37%), Positives = 244/387 (63%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-ELATEDNKP--IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE--NKK----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDY 399
           + +++I +  I     I+  ++++N L +++FFG PGVGK+   + I ++ NKNFY  N+T ++  D+  ++ EL + +N    ++ I+EI   NK +Q  +L ++E   I ++A+TTENP+  V  A+ SR  ++  + +    +++ + + +E  NK     ++ +   +E I  +S  D R+    L++V+   +   D+I   +   I  S        D+   +HYD+LSAF KSIRGSDP A+++YLA+L++ GDLIS+ RRL  +  EDIGLA       V A V+++  LG PEA+IPL++ TI L  SPKSNSA +AI +A+  ++KE +   PN ++DAHY+ + ++    GYKYPH++   YV+Q+YLP  +K+  +Y P  NK  +N  K+++Y
  S:    11 TMNDVIGQSHIIGNGKILSKILQSNFLPNMIFFGPPGVGKTTVAEIIAERSNKNFYKINATNSSLEDIKNVISELGSINNISGVLLYIDEIQSFNKKQQQSILEFMENGSITLIASTTENPYHYVYKALLSRSTVFEFKPLEKIDIEKGLKRAVEVLNKDSYMDIECNKDAIEYIAILSDGDMRRALNILEVVVYSTKPNKDNITYIDSDIIKASTFNKIINYDKNGDSHYDILSAFQKSIRGSDPQASIHYLARLIKGGDLISICRRLLVIASEDIGLAYPNAIVIVKACVDSAMQLGFPEAKIPLAEATILLATSPKSNSACIAIMKAMDELDKEFVKDIPNSIKDAHYSGSKEIGRGCGYKYPHNFKNHYVKQQYLPDSIKDSVYYIPQENKTEKNIKKYLEY 416
>gi|187605748|ref|ZP_02991936.1| AAA ATPase central domain protein [Exiguobacterium sp. AT1b] >gi|187482225|gb|EDU20241.1| AAA ATPase central domain protein [Exiguobacterium sp. AT1b] (438 aa)
Score = 580, Expect = 8.4e-58, Identities = 143/390 (36%), Positives = 225/390 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELAT-----EDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI-----VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKE--FYKPNK--YSQNENKFVDYWNK 402
           + D++I +  I  +  ++   IE + L +I+ +G PG GK+   + I       F   N+ T   ++L  ++  A      ED + I+ ++EIHR NK +QD LL  LE   ++++  TTENP F+VN A+ SR  ++R+E   +  L+  + + L + +      VK+     +  ++++  D+R +   L++ +         I     V +E  +  +   D+    HYD++SAF KSIRGSDP+AA+Y+LA ++E+G+    + RRLY    EDIG+++      V+AA  ASE +G PEARIP+++  + L  +PKSN+ I AID+A+  V      P P HLRDAH   A +L N  GYKYPHD    +V Q Y P+ L  K   +YKP    + Q   K +DYW K
  S:    21 TLDDVIGQRHIIGEGKLLRRAIEADRLGTIILYGPPGTGKTTLARVISNYTKATFVQLNAVTAKLDELRNVIREAESRYDYEDERTILFLDEIHRFNKLQQDALLPALESGKLVLIGATTENPSFEVNAALLSRATVFRLEPPRAEELRTVLERALHDSRGLGNYPVKMDEAAADHYIKMADGDYRVLLNALELAVLTTPEVEGQIHITLEVAEESIQQKSIKYDKTGDRHYDVISAFIKSIRGSDPDAALYWLAVMIEAGESPRFIMRRLYVHAAEDIGMSDPNALLIVDAAARASEYIGFPEARIPIAEAVLYLATAPKSNAVITAIDKALHHVRTVEGGPVPVHLRDAHSPGAHELGNGVGYKYPHDEKDGFVPQNYWPENLARKRPNYYKPTPRGFEQQIQKRLDYWEK 433
>gi|169350636|ref|ZP_02867574.1| hypothetical protein CLOSPI_01408 [Clostridium spiroforme DSM 1552] >gi|169292690|gb|EDS74823.1| hypothetical protein CLOSPI_01408 [Clostridium spiroforme DSM 1552] (420 aa)
Score = 579, Expect = 1.3e-57, Identities = 150/388 (38%), Positives = 220/388 (56%)
  Q:    16 EMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE---------NKKVKLSNKVVEAIVEISKSDFRQIFFYLKI---VLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQ----EYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           ++I +  +  ++SI+  ++E    FSI+ +GNPG GK+     +   LN    +FN++T NK ++  I+E A   N   III+EIHRLNK +QD LL Y+E  ++IV   TT NPF  +NPAIRSR  +  ++++       E+I  L+         N +  + ++V   I +    D R  +  L+I   V K      DD  LK     TN   D+   N+YD LS   KSIRGSDPN A+YY A+L+++ D+ S+ RRL    YEDIGLAN     +   A+ A++ +G PEARIP++ + I+LCLSPKS S+  AID AI S+N  +   P +LR         L   G K    Y+++  E     +YLPKEL+ ++FY P   S  E      + +I
  S:    16 DVIGQQHLVGENSILTKIVEKKHPFSIILYGNPGCGKTTIANALANDLNIPCRFFNASTGNKKEMDIIIEEAKLCNGLFIIIDEIHRLNKARQDDLLSYMENGLLIVAGCTTSNPFHSINPAIRSRCHILEVKSLTV----NEIIVGLKRAASSLNGLNNQYIVDDEVFAKIAKSCNGDIRYGYNCLEICSIVCKDNHITLDD--LKRSSITTNITYDKNEDNYYDTLSGLQKSIRGSDPNGAMYYFAKLIKANDIESLERRLITTAYEDIGLANPNACMRTVTALQAAKIIGFPEARIPIASVIIDLCLSPKSKSSEAAIDAAISSLNTNSSKIPEYLR---------LTPVGLKDDEKYDYNRPELWEYIQYLPKELEREQFYIPWMTSNYEKALAQNYQRI 404
>gi|160878660|ref|YP_001557628.1| recombination factor protein RarA [Clostridium phytofermentans ISDg] >gi|160427326|gb|ABX40889.1| AAA ATPase central domain protein [Clostridium phytofermentans ISDg] (444 aa)
Score = 578, Expect = 1.5e-57, Identities = 142/391 (36%), Positives = 228/391 (58%)
  Q:    16 EMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKL-------SNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSN 406
           E++ +  I  +D ++   I  + L S++F+G PG GK+   + I    + NF   N+T+  K D+  ++E A +       K I+ ++EIHR NK +QD LL ++E   I+++  TTENP+F+VN A+ SR +++ ++ +    +KE +I+ + +K+  L        +  ++ +   +  D R     +++ +   +   D  +   L   +  +       D+   NHYD +SAF KS+RGSDP+AA+YYLA++L +G D+  + RR+     ED+  A+        AA  A E LG+PE RI L+Q    +  +PKSNSAI+AIDEA + V K+   P P HL+DAHY  A KLN   GY Y H+Y   YV+Q+YLP     + FY+P+  +  E    +Y+ KIK N
  S:    29 EVVGQSHIIGEDKLLYRAIMADKLGSVIFYGPPGTGKTTLAKVIANTTSSNFQQINATSAGKKDMEAVIEQAKQTLGMYGKKTILFVDEIHRFNKGQQDYLLPFVEDGTIVLVGATTENPYFEVNSALISRSIVFELKPLEQNDIKELLIRAITDKEKGLGAYHAVMEDDALDFLANAANGDARSALNAIELGVLTTKRSEDGFIHITLEVASECIQKRVLKYDKSGDNHYDTISAFIKSMRGSDPDAAIYYLAKMLYAGEDVAFIARRIMICAAEDVSNADPNALVVATAAAQAVERLGMPEGRIVLAQAVTYVACAPKSNSAIVAIDEASELVAKDKTPPIPPHLQDAHYKGAAKLNHGVGYLYAHNYENHYVKQQYLPDPYVGRTFYRPSD-NGYEKAIKEYFRKIKGN 439
>gi|154502582|ref|ZP_02039642.1| hypothetical protein RUMGNA_00395 [Ruminococcus gnavus ATCC 29149] >gi|153796774|gb|EDN79194.1| hypothetical protein RUMGNA_00395 [Ruminococcus gnavus ATCC 29149] (438 aa)
Score = 573, Expect = 6.5e-57, Identities = 141/374 (37%), Positives = 222/374 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS----AVLKEEVIKYLENKKV-----KLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + +E++ +  I  KD ++   I+ + L SI+F+G PG GK+   + I    +  F   N+T   K D+ +++  A E       K I+ I+EIHR NK +QD LL ++E   I ++  TTENP+F+VN A+ SR  ++ ++++       +LK  V  Y ENK +     ++    +E + ++S  D R     +++ +   +   D  +   L   +  +       D+   NHYD +SAF KS+RGSDP+AAVYYLA++L +G D+  + RR+     ED+G A+        +A  A E +G+PEA+I LSQ  + +  +PKSNSA+ AI  A ++V +   + P+HL+DAHY  +  L    GYKY HDY   YVEQ+YLP E+KN  FY+P
  S:    26 TLEEVVGQQHIIGKDKLLYRAIKADKLGSIIFYGPPGTGKTTLAKVIAHTTSAEFKQINATVAGKKDMEQVVNEAKELLGMYRKKTILFIDEIHRFNKGQQDYLLPFVEDGTITLIGATTENPYFEVNGALISRSSVFELKSLEKEDIRTLLKRAV--YDENKGMGSFHAEIDEDALEFLADVSGGDARSALNAIELGVLTTERSEDGKIHITLDVASECIQKRVVRYDKGGDNHYDTISAFIKSMRGSDPDAAVYYLAKMLYAGEDIKFIARRIMICAAEDVGNADPVALTVAVSAAQAVERIGMPEAQIILSQAVLYVATAPKSNSAVNAIFAANENVRQYKTTVPSHLQDAHYKGSKNLGHGIGYKYAHDYPNHYVEQQYLPDEIKNARFYEP 419
>gi|167630476|ref|YP_001680975.1| recombination factor protein RarA [Heliobacterium modesticaldum Ice1] >gi|167593216|gb|ABZ84964.1| ATPase, putative [Heliobacterium modesticaldum Ice1] (441 aa)
Score = 572, Expect = 7.5e-57, Identities = 137/376 (36%), Positives = 222/376 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKV-------KLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL---IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKL--NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           S DE+  +  +  K S+   MI+ + L S + +G PG GK+   + I +     F   ++ T N +D+ ++ + A E       + I+ I+EIHR NK +QDLLL  +E   +I++  TTENP +++N A+ SRL +Y ++ +    L   + + L + +         L+ + +  IV+ +K D R     L +V   + +    I   E+ ++T  +    D++   HYD +SAF KSIRGSDP+AA+Y+LA +LE+G D + + RR+     EDIG+A+        AA  A + +GLPE RIPL++ TI L  +PKSN A  +ID+A+++V + + +  P HL D+ ++ +  L  +  GYKYPHDY   YV Q YLP E++   FY P++
  S:    26 SLDEVSGQSHLLKKGSLFRRMIDEDKLQSFILYGPPGTGKTTIARLIAQTTESPFVTLSAVTANTSDIKKVAKEAEERLSFNQKRTILFIDEIHRFNKAQQDLLLPIVEDGTLILIGATTENPLYELNAALLSRLRVYLLQPLKEEELLSLLKRALTDSERGLGLSGNALTEEALALIVQAAKGDARAALTILDMVAGVHGDTDQPIGASEVAEVTGRVAVYYDKKGDRHYDTISAFIKSIRGSDPDAALYWLAVMLEAGEDPLFIARRIVIHAAEDIGMADPMALVVAQAAAEAVKFVGLPEGRIPLAEATIYLACAPKSNGAKESIDKALRAVREAKCIEVPRHLADSSHSKSGALLGSGVGYKYPHDYG-GYVRQSYLPPEMEKARFYTPSE 419
>gi|153953934|ref|YP_001394699.1| recombination factor protein RarA [Clostridium kluyveri DSM 555] >gi|146346815|gb|EDK33351.1| Predicted helicase subunit of Holliday junction resolvase [Clostridium kluyveri DSM 555] (437 aa)
Score = 572, Expect = 8.4e-57, Identities = 143/390 (36%), Positives = 232/390 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVL-----KELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK---YSQNENKFVDYWNK 402
           + +E I ++ I  KD ++   I  +++ S++F+G PGVGK+   + I      NFY  ++  +   D+ +I++ A  +      K I+ I+EIHR NK +QD +L  +EK +II++  TTENP+F+VN A+ SR +++R+E+++   +K+ +   +E+       K+++  KV +     S  D R+    L + ++    K D I +     KE  +   +L D+  T+HYD +SAF KS+RGS P+AAVYYL ++L++G D + + RR+     ED+G A+         A+NA   +G+PE R  LSQ  I +  +PKSN++ +AID A++ V     S  P +LRDAHY  A K     GY YPH Y   +V+Q+YLP   KN  +YKP      S+ +++    W K
  S:    26 TLEEFIGQEHILGKDKMLYRAIVTDNISSVIFYGPPGVGKTTLARIIANTTKANFYELSAVNSGTADVKKIIKEAENNLKFYSKKTILFIDEIHRFNKAQQDSVLNAVEKGIIILIGVTTENPYFEVNNALLSRSMIFRLEHLSENNVKKALKNAIESPKGFSYLKIEVDPKVFDYFALHSGGDIRKALNALDMAVRTSSKKEDKIFITTKDAKECIQRKITLYDKGGTSHYDTISAFIKSLRGSSPDAAVYYLGKMLDAGEDPMFIARRIVIQASEDVGNADPMALIVATNAMNAVHMIGMPECRYALSQAAIYVASAPKSNASCIAIDSALKDVRSRRDSGIPPYLRDAHYKGAEKSGYGTGYLYPHSYG-GFVKQQYLPDSHKNTVYYKPTSNGFESKIKDRLTKLWGK 436
>gi|160934386|ref|ZP_02081773.1| hypothetical protein CLOLEP_03258 [Clostridium leptum DSM 753] >gi|156867059|gb|EDO60431.1| hypothetical protein CLOLEP_03258 [Clostridium leptum DSM 753] (491 aa)
Score = 571, Expect = 1.1e-56, Identities = 145/392 (36%), Positives = 227/392 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLK---EEVIKYLENKK---VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI------VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           + D+M+ +  +      +  +IE+ ++ +++F+G  GVGK+     I ++ N+     N TT    DL EI   A    T  N  ++ ++EI   NK +Q  LL ++E   I ++A+TTENP+F V  AI SR  ++  + +  A +    E     LE ++    ++ + VV  I      D R+    +++ +      +D +        KEL + +    D+    HYDLLSAF KS+RGSDP+AAV+YLA+LLE+GDL SV RRL     ED+GLA   + P V A V+A+  +GLPEAR+ L+   I + ++PKSNSA  AI+EA++ V +    P P  L++ H+       VKG  Y+Y HD+   +V+Q+YLP  LKN E+Y   + ++NE  +  YW K+K
  S:    80 TIDDMVGQRHLLGPGKALRRIIESGEIPNLIFYGPSGVGKTTLASIIARQTNRALRKLNGTTAGTADLREIFTEAENTFTAPNGILLYLDEIQYFNKKQQQTLLEFIENGKITLIASTTENPYFYVYNAILSRSTVFEFKTVEKAEVAKAVERAFSLLEEERGEGFQIEDGVVGHIALACGGDVRKAMNSVELCV-LSSPAADGVRKITLETAKELTQKSALRYDKDGDEHYDLLSAFQKSMRGSDPDAAVHYLARLLEAGDLPSVCRRLMVTACEDVGLAYPQIIPIVKACVDAAFQVGLPEARLCLADGVILVSIAPKSNSAHNAINEAMEDVRRGKYGPIPRQLQNKHFDGEDN-PVKGQFYQYAHDFENHWVDQQYLPDVLKNVEYYHFGE-NKNEQAYRQYWEKVK 487
>gi|189485323|ref|YP_001956264.1| conserved hypothetical protein [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287282|dbj|BAG13803.1| conserved hypothetical protein [uncultured Termite group 1 bacterium phylotype Rs-D17] (439 aa)
Score = 568, Expect = 2.0e-56, Identities = 142/377 (37%), Positives = 230/377 (61%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL---ELATE--DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVL---KEEVIKYLENK----KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           +SF+E   +D I     ++   IE ++L S++FFG PG GKSA  + I  K    F   N+ T +  D+ +I+   E  TE    K I++++EIH  N+ +QD LL+ +EK +I ++  TTENPFF +N AI SR  ++  ++++   L    E  +K  EN     KVK+S +  E ++  +  D R++   L+I +   +   + I + ++     S      L DR    HYD +SAF KS+RG+DP+AAVY++A++L +G D   + RR+     ED+G+A+ G      +A+NA + +G+PEARI L+Q+ I +  +PKSN++ MA+++A+  V + +A + P+HL+DA+  S    + +GYKYPHD+   Y +QEY    +   EFY P K
  S:    25 SSFEEFTGQDNIVGDGKLLRRSIEADNLGSVIFFGPPGTGKSALARIIALKTKAYFEEVNAVTTSTADIRKIIAAAEARTEMSGRKTILMLDEIHHFNRSQQDALLLDVEKGIITLIGITTENPFFYINAAIISRSTVFEFQSLSKKALLYVMESALKDKENGLGSYKVKMSEEAREHLLVNACGDARKLLNALEIGVLSAEVDGEGIRIFDIRAAQESMQKRAVLYDRSGDAHYDHISAFIKSMRGTDPDAAVYWMAKMLAAGEDPRFIARRIIICASEDVGMADPGALTLAVSALNAVQFVGMPEARIILAQVAIYVACAPKSNASYMAVEQALSEVKDGKARNVPSHLKDANLDSEKLGHGRGYKYPHDFEGHYTQQEYWTDPV---EFYVPTK 418
>gi|77918707|ref|YP_356522.1| fused recombination factor protein RarA/unknown domain-containing protein [Pelobacter carbinolicus DSM 2380] >gi|77544790|gb|ABA88352.1| ATPase, AAA family [Pelobacter carbinolicus DSM 2380] (726 aa)
Score = 565, Expect = 5.2e-56, Identities = 131/374 (35%), Positives = 220/374 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYY-------QNKSDDIVL---KELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + +E + +D I  +  ++   I  + L S++F+G PG GK+   Q I       F   N+  +   DL E +E A +     D + I+ ++E+HR NK +QD LL ++EK  II++  TTENP+F+VN A+ SR  ++++  +    L++ V + L++K       +V+     ++ +V ++  D R +   L++ ++          N    I L   +E  +    L D+    H+D +SAF KS+RGSDP+AA+Y++A+++ +G D   ++RR+     ED+G+A+      V AA +A + +GLPE +  L+Q T+ L   PKSNS++   D A+++V KE    PNHLRD+        + KGYKYPH +   +V Q+YLP  LK + FY+P
  S:    23 TLEEYVGQDHILGEGRLLRRAIRADQLSSLIFYGPPGTGKTTLAQVIANSTASRFVSMNAVLSGVKDLREAIEDARQSQEYYDKRTILFVDEVHRWNKSQQDALLPWVEKGTIILIGATTENPYFEVNKALVSRSRVFQLLGLTEENLRQIVTQTLQDKQRGYGKWQVEFEPDALDHLVRVASGDARSLLNALQLAVETTPESFPPPANSRIHITLSAAEESIQQKAVLYDKEGDYHFDTISAFIKSLRGSDPDAALYWMARMVRAGEDPRYIFRRMLISASEDVGMADPYALGVVEAAASAFDRVGLPEGQFHLTQATLYLATCPKSNSSLAFFD-ALEAVAKEEAEVPNHLRDSSRDEHSFGHGKGYKYPHAFRDHWVAQQYLPGTLKGRIFYQP 418
>gi|166031126|ref|ZP_02233955.1| hypothetical protein DORFOR_00811 [Dorea formicigenerans ATCC 27755] >gi|166028973|gb|EDR47730.1| hypothetical protein DORFOR_00811 [Dorea formicigenerans ATCC 27755] (439 aa)
Score = 565, Expect = 5.6e-56, Identities = 141/395 (35%), Positives = 236/395 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRI-----ENINS----AVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNN 407
           + +E++ +  I  KD ++   I+ + L SI+F+G PG GK+   + I    +  F   N+T   K D+ E+++ A E       K I+ ++EIHR NK +QD LL ++E   II++  TTENP+F+VN A+ SR  ++ +     E+I +    AV  +E  K + +   ++  + +E + +I+  D R     +++ +   +  +D  +   L   +  +       D+   NHYD +SAF KS+RGSDP+AAVYYLA++L +G D+  + RR+     ED+G A+        AA  A E +G+PE++I LSQ    +  +PKSN+A+ AI  A+++V     + P HL+DAHY  + KL +  GYKY HDY   YVEQ+Y+P E++  +FY+P+  + +E +  ++   +K N+
  S:    26 TLEEVVGQQHIIGKDKLLYRAIKADKLSSIIFYGPPGTGKTTLAKVIAHTTSAEFTQINATVAGKKDMEEVVQKAKETLGMYQKKTILFVDEIHRFNKGQQDYLLPFVEDGTIILIGATTENPYFEVNGALISRSSIFELHPLEKEDIKTLLKRAVYDQE--KGMGSYHAEIDEEALEFLADIAGGDARNALNAIELGILTTERSADGKIHITLDVASECIQKRVVRYDKTGDNHYDTISAFIKSMRGSDPDAAVYYLAKMLYAGEDVKFIARRIMICASEDVGNADPMALQVAVAAAQAVERIGMPESQIILSQAVTYVATAPKSNAAVKAISAAMENVRNYKTTVPAHLQDAHYKGSQKLGHGVGYKYAHDYPNHYVEQQYMPSEIQKAKFYEPSD-NGHEKEIKEWMEFLKKNS 439
>gi|167769902|ref|ZP_02441955.1| hypothetical protein ANACOL_01243 [Anaerotruncus colihominis DSM 17241] >gi|167667893|gb|EDS12023.1| hypothetical protein ANACOL_01243 [Anaerotruncus colihominis DSM 17241] (421 aa)
Score = 561, Expect = 1.4e-55, Identities = 134/372 (36%), Positives = 215/372 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-ELATEDN--KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS---LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASA-VKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFY 384
           + D+++ ++ +  +D ++  M+E+ ++ +++F+G  GVGK+     I K+  K     N TT + +D+ +++ E  T D     I+ ++EI  LNK +Q  LL ++E   I ++A+TTENP+F V  A+ SR  ++  + +    ++  V +  E       +++++ + V E I      D R+    +++ L      +  + L+E  ++        DR    HYD+LSA  KSIRGSD NAA++YLA+LLE+GDL+S  RRL  +  EDIGLA       V A V+++  LGLPEARIPL+Q  + L  +PKSNSA   ID A+  V      P P  L++ HY  A V    + YKYPHD+   +V Q+YLP  L  + +Y
  S:    13 TLDDVVGQEHLLGRDKVLRRMVESGNIPNLIFYGPSGVGKTTVASIIAKRAGKKLCKLNGTTASTSDIRDVVGETNTIDGIGGVILYLDEIQYLNKKQQQTLLEFIENGSITLIASTTENPYFYVYNAVLSRSTVFEFKPVQPQAVQRAVQRAFEAAGEAAGRRLEVEDGVYEYIASACGGDVRKAVNAVEL-LALAAGANQTVTLEEARQVAQKSAMRYDRDGDEHYDILSALQKSIRGSDENAALHYLARLLEAGDLLSPCRRLLVIASEDIGLAYPMAAVIVKACVDSALQLGLPEARIPLAQAAVLLATAPKSNSAYSGIDAALADVRAGLAGPIPRCLQNKHYDGADVTRPGQFYKYPHDFPGHFVRQQYLPDTLLGRTYY 397
>gi|163815250|ref|ZP_02206627.1| hypothetical protein COPEUT_01410 [Coprococcus eutactus ATCC 27759] >gi|158449445|gb|EDP26440.1| hypothetical protein COPEUT_01410 [Coprococcus eutactus ATCC 27759] (443 aa)
Score = 559, Expect = 2.3e-55, Identities = 141/386 (36%), Positives = 227/386 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIK--YLENKKVKLSNKVVEA----IVEISKSDFRQIFFYLKI-VLKYYQNKSDDIVLKELGKITNSLIDRRAT-------NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVD 398
           S D+++ ++ I  KD ++   I+ + + S++F+G PG GK+     I       F   N+TT  K D+ +++  A +       + I+ I+EIHR NK +QD LL ++E   +I++  TTENP+F+VN A+ SR  ++++  ++   +K+ + K  Y EN        + E     + +++  D R     +++ VL     +SDD  +     +    I +RA        NHYD++SAF KS+RGSDP+AAV+YLA++L  G D+  + RR+     ED+  A+        A   A E +G+PEA+I L+Q    +  +PKSNSA+ AI  A+ +V N++    P +LRDAHY  A KL   GYKY HDY   YV+Q+YLP ++  + FY+P  N Y +N  ++ D
  S:    26 SLDDVVGQEHIIGKDKLLYRAIKADKISSLIFYGPPGTGKTTLAMVIANTTKAEFRQLNATTAGKKDMEQVVNEARDIKAMYGKRTILFIDEIHRFNKSQQDYLLPFVEDGTVILIGATTENPYFEVNGALISRSHIFQLHPLSKEDIKKLIHKAVYSENGMGAFDADIDEDAEDFLSDMASGDARNALNAIELGVLS--TERSDDGRIHITLPVAEECIQKRAIRYDKDGDNHYDIISAFIKSMRGSDPDAAVFYLAKMLYGGEDIKFIARRIMICASEDVSNADPNAIVVATACAQAVERIGMPEAQIILAQAATYVACAPKSNSAVNAIFAAMDAVKNEDTGQVPVYLRDAHYGGAAKLGHTGYKYAHDYPNHYVDQQYLPDKIAGRVFYEPSDNGYERNIRQYFD 432
>gi|154498121|ref|ZP_02036499.1| hypothetical protein BACCAP_02102 [Bacteroides capillosus ATCC 29799] >gi|150273111|gb|EDN00268.1| hypothetical protein BACCAP_02102 [Bacteroides capillosus ATCC 29799] (421 aa)
Score = 559, Expect = 2.3e-55, Identities = 130/394 (32%), Positives = 228/394 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-ELAT--EDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV------EAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVL-----KELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYK--PNKYSQNENKFVDYWNKIKSN 406
           S D+++ +  I  +  ++  +IE+  + +++F+G  G GK+     I K+  +     N+TT + +D+ +++ ++ T    N  ++ ++EI   NK +Q  LL  +EK  + ++A+TTENP+F V  A+ SR  ++  + + +  +   V + +   + +L  + V      E I      D R+    ++++L   + K   + +     K + + +    DR   +HYD++SA  KS+RGSDP+AA++YLA+LLE+GDL+S  RR+  +  ED+GLA   + P V + ++A+  LGLPEARIPL+   + +  SPKSNSA M ++ A+  +        P HL++ H  S+     +GY YPHDY   YV+Q+YLP +L    +Y+   NK  Q   +   YW++IK +
  S:    14 SLDDVVGQRHILGEGGLLRRIIESGKIPNLVFYGPSGTGKTTVANIIAKRSGRALRRINATTGSLSDIKDVIADVGTMLAPNGILLYLDEIQYFNKKQQQSLLEVIEKGDVTLVASTTENPYFYVYNAVLSRSTVFEFKPVTAEDVLPAVNRGITIMEQRLGEQAVCEDGVREHIASACGGDVRKAMNAVELLLNSARRKDGVLTVTLEDAKAVAQRSAMRYDREGDDHYDIVSALQKSVRGSDPDAALHYLARLLEAGDLVSACRRMMVMACEDVGLAYPQIIPIVKSCIDAANMLGLPEARIPLADAVVLMATSPKSNSAYMGMNRAMADIRAGKTGDIPRHLQNVHADSSGMEREQGYLYPHDYPHHYVKQQYLPDKLAGTIYYEYGENKTEQAARR---YWDEIKGD 421
>gi|126646827|ref|ZP_01719337.1| putative AAA family ATPase protein [Algoriphagus sp. PR1] >gi|126576875|gb|EAZ81123.1| putative AAA family ATPase protein [Algoriphagus sp. PR1] (420 aa)
Score = 558, Expect = 2.9e-55, Identities = 141/386 (36%), Positives = 228/386 (59%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN----KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITN---SLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDY 399
            +++I ++ +   +S +   I++ ++ S++ +G PGVGK+     I  ++   FY  ++ ++   D+ E++E A      ++ I+EIHR NK +QD LL  +EK +I ++  TTENP F+VN A+ SR  ++ + ++    L+  V + LE     KK+ +  K  +A++ IS  D R++   L+IV+         I  +++ +I     +L D+    HYD++SAF KSIRGSDPNAAVY+LA+++E G D+  + RRL  +  EDIG AN           +A + +G PE+RI LSQ    L  SPKSN++ MAI++A   V ++  LS P HLR+A       LN  K YKY HD+  ++V QE+LP E+K  + Y P + ++ EN+   Y
  S:    15 LEDLIGQEHLSSPNSFLFKAIKSGNVPSLILWGPPGVGKTTIANIIANEIKAPFYTLSAISSGVKDIREVIEKAKFQMGVVLFIDEIHRFNKSQQDALLGAVEKGIIRLIGATTENPSFEVNAALLSRCQVFTLNSLGKPELEAMVHQALEKDVDLKKLNVELKETDALLRISGGDGRKLLNLLEIVIDGINEDPCIITDEKVMQIAQQKVALYDKSGEQHYDIISAFIKSIRGSDPNAAVYWLARMIEGGEDVKFIARRLVILASEDIGNANPNALLLATNCFDAVKLIGYPESRIILSQCVTYLASSPKSNASYMAINQAQALVREKGDLSVPLHLRNAPTKLMKDLNYGKAYKYSHDFPGNFVAQEFLPDEIKGMKLYDPGENAR-ENELRRY 409
>gi|154484609|ref|ZP_02027057.1| hypothetical protein EUBVEN_02325 [Eubacterium ventriosum ATCC 27560] >gi|149734457|gb|EDM50374.1| hypothetical protein EUBVEN_02325 [Eubacterium ventriosum ATCC 27560] (439 aa)
Score = 555, Expect = 8.0e-55, Identities = 141/394 (35%), Positives = 233/394 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK--VKLSNKVVEA-----IVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRA-------TNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSN 406
           + D+++ ++ I  KD ++   I+ + + SI+F+G PG GK+   + I    + +F   N+T   K D+ +++      +A    K I+ ++EIHR NK +QD LL ++E   +I++  TTENP+F+VN A+ SR +++ +  ++   +K  +++ + +K   + + N V++      + EIS  D R     +++ +       D  +   L ++    + +RA        NHYD +SAF KS+RGSDP+AAVYYL+++L +G+ +  + RR+     ED+G+AN       NAA  A   +G+PEA+I LS+  I +  SPKSNSA  AI  A + V     +  P HL+DAHY  + KL    GYKY HDY   YV+Q+YLP  L++  FY+P      E +  +Y+ KIK +
  S:    26 TLDQVVGQEHIIGKDKLLYRAIKADKISSIIFYGPPGTGKTTLAKVIANTTSADFMQLNATVAGKKDMEDVVAKAKQNMAMSGRKTILFVDEIHRFNKGQQDYLLPFVEDGTVILIGATTENPYFEVNSALISRSIVFELHPLSVENIKTLILRAVNDKTDGMGIYNGVIDDDAVMFLAEISNGDARTALNAVELGILTTDPAQDGKIHITL-EVAQQCVQKRALKYDKSGDNHYDTISAFIKSMRGSDPDAAVYYLSRMLYAGESVDFISRRILICAAEDVGMANPQALVVANAAAQAVHQVGMPEAQIILSEAVIYVASSPKSNSACNAIFAANEVVRSTVTAKVPAHLQDAHYKGSAKLGHGIGYKYAHDYPNHYVKQQYLPDGLEDSRFYEPGDLGY-EVEVKNYFKKIKED 439
>gi|189466213|ref|ZP_03014998.1| hypothetical protein BACINT_02583 [Bacteroides intestinalis DSM 17393] >gi|189434477|gb|EDV03462.1| hypothetical protein BACINT_02583 [Bacteroides intestinalis DSM 17393] (424 aa)
Score = 554, Expect = 8.7e-55, Identities = 143/373 (38%), Positives = 221/373 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN--------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNK----SDDIVLKELGKITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYK 385
           + DE I +  +    +I+  MI+   + S + +G PGVGK+   Q I  KL   FY  ++ T+   D+ E++E A  +       PI+ I+EIHR +K +QD LL  +E+  + ++  TTENP F+V   + SR  LY ++++     KE++++ L+         K+ K+  K   A++  S  D R++   L +V+    N     +D+IV + L +  N L  D+    HYD++SAF KSIRGSDP+ AVY+LA+++E+G D   + RRL     EDIGLAN       NA  +A   +G PE RIPL++ TI L  SPKSNSA +AI+ A++ V +    P P HLR+A      +L     YKY HDY   +V+Q+++P ELK +  ++
  S:    12 TLDEYIGQKHLVGPGAILRKMIDAGRISSFILWGPPGVGKTTLAQIIANKLETPFYTLSAVTSGVKDVREVIERAKSNRFFSQGSPILFIDEIHRFSKSQQDSLLGAVEQGTVTLIGATTENPSFEVIRPLLSRCQLYVLKSLE----KEDLMELLQRAVTTDHILKERKIELKETTAMLRYSGGDARKLLNILDLVVSSEANDPVVITDEIVTERLQQ--NPLAYDKDGEMHYDIISAFIKSIRGSDPDGAVYWLARMVEAGEDPAFIARRLVISASEDIGLANPNAMLIANACFDAVMKVGWPEGRIPLAEATIYLATSPKSNSAYIAINNALELVRETGNLPVPLHLRNAPTKLMKQLGYGDNYKYSHDYPGHFVKQQFMPDELKKRRLWE 399
>gi|160889857|ref|ZP_02070860.1| hypothetical protein BACUNI_02288 [Bacteroides uniformis ATCC 8492] >gi|156860849|gb|EDO54280.1| hypothetical protein BACUNI_02288 [Bacteroides uniformis ATCC 8492] (423 aa)
Score = 553, Expect = 1.2e-54, Identities = 141/374 (37%), Positives = 222/374 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN-----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENI---------NSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNK----SDDIVLKELGKITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + DE I +  +    +++  MI+   + S + +G PGVGK+   Q I  KL   FY  ++ T+   D+ +++E A  +       PI+ I+EIHR +K +QD LL  +E+  + ++  TTENP F+V   + SR  LY ++++           A+  + V+K    +K++L  K   A++  S  D R++   L++V+          +DD+V + L +  N L  D+    HYD++SAF KSIRGSDP+ A+Y+LA+++E G D   + RRL     EDIGLAN       NA  +    +G PE RIPL++ TI L  SPKSNSA MAI+ A++ V +    P P HLR+A      +L   + YKY HDY  ++V+Q++LP ELK++  ++P
  S:    12 TLDEYIGQKHLVGPGAVLRKMIDAGRISSFILWGPPGVGKTTLAQIIANKLETPFYTLSAVTSGVKDVRDVIERAKSNRFFSQASPILFIDEIHRFSKSQQDSLLGAVEQGTVTLIGATTENPSFEVIRPLLSRCQLYTLKSLEKDDLLELLQRAITTDTVLK---ERKIEL--KETTAMLRFSGGDARKLLNILELVIDSEATDPVLITDDMVTERLQQ--NPLAYDKDGEMHYDIISAFIKSIRGSDPDGAIYWLARMVEGGEDPAFIARRLVISASEDIGLANPNALLLANACFDTLMKVGWPEGRIPLAEATIYLATSPKSNSAYMAINNALELVRETGNLPVPLHLRNAPTKLMKQLGYGEKYKYAHDYPGNFVKQQFLPDELKDRRIWEP 400
>gi|160937850|ref|ZP_02085209.1| hypothetical protein CLOBOL_02742 [Clostridium bolteae ATCC BAA-613] >gi|158439289|gb|EDP17042.1| hypothetical protein CLOBOL_02742 [Clostridium bolteae ATCC BAA-613] (445 aa)
Score = 552, Expect = 1.8e-54, Identities = 136/387 (35%), Positives = 228/387 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLS-------NKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT-------NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDY 399
           + DE++ +  I  KD ++   I+ + L SI+F+G PG GK+   + I    + +F   N+T   K D+ E+++ A ++      K I+ ++EIHR NK +QD LL ++E   +I++  TTENP+F+VN A+ SR  ++ ++ +    +KE + + + +K+  +            + + + +  D R     +++ +      +D  +  ++  +    I +RA        NHYD +SAF KS+RGSDP+AAVYYLA++L +G D+  + RR+     ED+G A+         A  A+E +G+PEA I LSQ    +  +PKSN+A MA+ +A+++V  E   P P HL+D HY  A KL +  GY Y HDY   YV+Q+YLP+ ++   FY+P  N Y +  N  + +
  S:    33 TLDEVVGQQHIVGKDKLLYRAIQADKLGSIIFYGPPGTGKTTLAKVIANTTSADFRQINATVAGKKDMEEVVKEAKDNIGMYGRKTILFVDEIHRFNKGQQDYLLPFVEDGTLILIGATTENPYFEVNGALLSRSRIFELKPLEKEDVKELIRRAVYDKERGMGIYDADIDEDAADFLADTANGDARAALNAVELGVLTTAKGADGRIHIDMA-VAQECIQKRAVRYDKNGDNHYDTISAFIKSMRGSDPDAAVYYLARMLYAGEDIKFIARRIMICAAEDVGNADPQALVVAVNAAQAAERIGIPEANIILSQAVTYVATAPKSNAACMAVQKAMEAVRNERTMPVPVHLQDKHYKGAEKLGHGAGYLYAHDYPKHYVQQQYLPEGMEGTVFYEPSDNGYEKQINAHMKW 442
>gi|167749904|ref|ZP_02422031.1| hypothetical protein EUBSIR_00872 [Eubacterium siraeum DSM 15702] >gi|167657216|gb|EDS01346.1| hypothetical protein EUBSIR_00872 [Eubacterium siraeum DSM 15702] (416 aa)
Score = 551, Expect = 2.2e-54, Identities = 142/393 (36%), Positives = 226/393 (57%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-ELAT--EDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE----------NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKI----TNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHY---ASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYK--PNKYSQNENKFVDYWNKIK 404
           ++ DE++ +  I  +   + N+I    + +++F+G  GVGK+     I +K + + Y  N T  + +D+ +++  L T       ++ ++EI  LNK +Q  LL Y+E   I ++A+TTENP+F V  A+ SR  ++  + + +    E+++  +E          + +  L   VV  I      D R+    +++      +  DD V  E  K+    ++   DR   +HYD+LS   KSIRGSD NAA++Y A+LL +GD+ S+ RRL  +  EDIGLA     P V A V+++  LGLPEARIPL +  + L  SPKSNSA + I+ A+Q V + +    P  L++ HY    +AVK   + Y YPHDY   YV+Q+YLP  +K++ +Y    NK+ Q       YW+KIK
  S:    10 STLDEVVGQRHILAQGKPLYNIISRGKIPNMIFYGPSGVGKTTVANIIAQKTSMSLYRLNGTQASTSDIKDVVANLGTFGAAGGILLFLDEIQYLNKKQQQTLLEYIESGEITLIASTTENPYFYVYSAVLSRCTVFEFKQVTA----EDILPAVERAFRLMGEEMHTQFTLEEGVVSHIAYGCGGDVRKAANTVELCC---LSSEDDTVTMETAKLLTQKSSMNYDRDGDHHYDILSGLQKSIRGSDENAALHYAARLLAAGDITSLCRRLLVIASEDIGLAYPMAVPIVKACVDSALQLGLPEARIPLGEAVVLLATSPKSNSAYLGINAAMQDVEDGKTGDIPRQLQNKHYDGEGNAVK--GQHYLYPHDYPDHYVKQQYLPDAIKDRVYYTFGDNKFEQQSKV---YWDKIK 413
>gi|160885966|ref|ZP_02066969.1| hypothetical protein BACOVA_03971 [Bacteroides ovatus ATCC 8483] >gi|156108779|gb|EDO10524.1| hypothetical protein BACOVA_03971 [Bacteroides ovatus ATCC 8483] (423 aa)
Score = 550, Expect = 2.8e-54, Identities = 138/374 (36%), Positives = 220/374 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN----KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + DE I +  +    +I+  MI+   + S + +G PGVGK+   Q I  KL   FY  ++ T+   D+ E+++ A  +     + PI+ I+EIHR +K +QD LL  +E   + ++  TTENP F+V   + SR  LY ++++    L+E + + +      K+ K+  K   A++  S  D R++   L++V+   Q+++++ V+     +T  L       D+    HYD++SAF KSIRGSDP+ A+Y+LA+++E G D   + RRL     EDIGLAN       NA  +    +G PE RIPL++ TI L  SPKSNSA  AI++A++ V      P P HLR+A      +L   + YKY H Y  ++V+Q++LP ELK+K  ++P
  S:    12 TLDEYIGQKHLVGPGAILRKMIDAGRISSFILWGPPGVGKTTLAQIIANKLETPFYTLSAVTSGVKDVREVIDRAKSNRFFSQSSPILFIDEIHRFSKSQQDSLLGAVENGTVTLIGATTENPSFEVIRPLLSRCQLYVLKSLEKEDLQELLQRAITTDAILKERKIELKETTAMLRFSGGDARKLLNILELVV---QSETEETVVITDEMVTERLQQNPLAYDKDGEMHYDIISAFIKSIRGSDPDGAIYWLARMVEGGEDPAFIARRLVISASEDIGLANPNALLIANACFDTLMKIGWPEGRIPLAEATIYLATSPKSNSAYSAINDALELVRSTGNLPVPLHLRNAPTKLMKQLGYGQEYKYAHSYEGNFVKQQFLPDELKDKRIWQP 400
>gi|146297065|ref|YP_001180836.1| recombination factor protein RarA [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410641|gb|ABP67645.1| Recombination protein MgsA [Caldicellulosiruptor saccharolyticus DSM 8903] (444 aa)
Score = 549, Expect = 3.1e-54, Identities = 146/394 (37%), Positives = 230/394 (58%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI-----LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYR---------IENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVL---KELGKITN---SLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNN 407
            +E++ ++ I  +   + N+I+N+ L SI+ +G PG GK+     I +  N  F   N+T    ND+ +I     LE +    + I+ I+EIHR NK +QD LL  +E+ +I+++  TTENPF++VN A+ SR L++          I+ IN A+  +E    L    +K+       I  +S  D R     L+  +   +   D  ++     +G ++N   SL D     HYD +SAF KS+RGSDP+AA++YLA++L+SG D+  + RRL  +  EDIGLA+        +A  A E +G+PEARI LS+ TI L  +PKSNSA +AI++A++   N    S P HLR A +      +  GY YPHD+   +V+Q+YLP EL  + +Y P++  + E +  +Y   +K  +
  S:    27 LEEIVGQEHILGEGKPLYNLIKNDKLTSIILYGPPGTGKTTIAHVIAQVTNNIFKSINATIAGINDIKKIIEEAKLEFSQGGRRTILFIDEIHRFNKLQQDALLPSVEEGIIVLIGATTENPFYEVNKALVSRSLVFELFPLKEEDIIKIINRAISDKE--NGLGEMNIKVEENAKRLIARLSNGDARVALNILEACVYSTKPLEDGTIMITQDTVGNLSNRKISLYDATGDMHYDTISAFIKSVRGSDPDAALFYLAKMLDSGEDIKFIARRLIILAAEDIGLADPMALNVATSAAWACEFVGMPEARIILSEATIYLACAPKSNSAYLAIEKALEDAKNTPIKSIPMHLRMASHGEEKLGHGIGYLYPHDFKNHWVKQQYLPDELVGRRYYYPSEMGK-EREIKEYIENLKKED 439
>gi|118444607|ref|YP_878358.1| recombination factor protein RarA [Clostridium novyi NT] >gi|118135063|gb|ABK62107.1| ATPase, AAA family [Clostridium novyi NT] (419 aa)
Score = 549, Expect = 3.8e-54, Identities = 137/373 (36%), Positives = 217/373 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKD-KQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-----------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV------LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYK 385
           + +E   +  I  K  ++  +IE ++L SI+ +G PGVGK+     I  +    F   N+T+    ++ E ++ A E       + I  I+EIH L K  +QD LL  +EK  +I++  TTENP+F++N A+ SR  ++++E +     +EE+I  L N            KVK+    +  I ++S  D R     L++ +      +D  +      +KE  +      D    NHYD+ SAF KSIRGS+P+AA+Y+  +++  G D   + RRL     EDIG+ +       +AA NA E +G+PEARIP++Q  I L  +PKSN+ ++A+D+AI+         P+HLRD HY  A  L   GYKYP++Y  +YV+Q+Y PKE++ K++YK
  S:    25 NLNEFFGQKHIIGKGKLLRRLIETDNLTSIILYGPPGVGKTTLAYIISLETKSEFVKLNATSAGVKEIREYIKKAEEVLKFYGKRTIFFIDEIHSLKKGAQQDALLDAIEKGTVILIGATTENPYFEINRALLSRSKIFQLETLK----EEEIIDLLYNALKDETRGYGKLKVKIHKDAINIIAKLSGGDGRASLNTLELAILSTSRNNDGFIYITKDIIKECVQKPMVNYDATGDNHYDITSAFIKSIRGSNPDAALYWFGRMILGGEDPRFIVRRLIVHASEDIGMKDPNAMNIAHAAWNALETVGMPEARIPIAQAIIYLSTAPKSNAVLVAVDKAIEDARVNQYRVPSHLRDTHYKGAEDLGSIGYKYPYNYEGNYVKQDYFPKEMEEKKYYK 417
>gi|88710960|ref|ZP_01105048.1| putative AAA family ATPase protein [Flavobacteriales bacterium HTCC2170] >gi|88709901|gb|EAR02133.1| putative AAA family ATPase protein [Flavobacteriales bacterium HTCC2170] (425 aa)
Score = 549, Expect = 4.0e-54, Identities = 145/390 (37%), Positives = 229/390 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED------NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLY--------RIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNK----SDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNK 402
           S  E I ++ +  +   + + I+   + SI+ +G PG GK+     I  +  + FY  ++  +   D+ E+++ A +         PI+ I+EIHR +K +QD LL  +EK  + ++  TTENP F+V PA+ SR  +Y         +E++ S  LK++   YL++KK+KL  K  EA++ +S  D R++    ++V+   ++     ++++V+  + + T  L D+    HYD++SAF KSIRGSDPN AVY+LA+++E G D+  + RR+     EDIG+AN       N    A   +G PEARI LSQ  I L  S KSN++ MAI+ A Q+V +   LS P  LR+A       L   K YKY H+Y  ++ ++E+LPK +    FYKP K +Q EN   D+  K
  S:    13 SLKEYISQNHLVGEAGSLTHQIKKGIIPSIILWGPPGTGKTTLANIIANESQRPFYILSAINSGVKDIREVIDKAKQTGGLFTAKNPILFIDEIHRFSKSQQDSLLGAVEKGWVTLIGATTENPSFEVIPALLSRCQVYVLNPFGKEDLESLLSRALKQDT--YLKSKKIKL--KETEALLRLSGGDGRKLLNIFELVINSEESDAITVTNELVMARVQQNT-VLYDKAGEQHYDIISAFIKSIRGSDPNGAVYWLARMIEGGEDVKFIARRMLISASEDIGMANPTALVIANNTFQAVTTIGYPEARIILSQCAIYLATSAKSNASYMAINNAQQTVKQTGDLSVPLPLRNAPTKLMKDLGYGKDYKYAHEYKDNFADEEFLPKSITGTSFYKPGK-NQRENAIHDFLKK 417
>gi|187250562|ref|YP_001875044.1| ATPase central domain-containing protein [Elusimicrobium minutum Pei191] >gi|186970722|gb|ACC97707.1| AAA ATPase central domain protein [Elusimicrobium minutum Pei191] (416 aa)
Score = 548, Expect = 4.8e-54, Identities = 136/375 (36%), Positives = 221/375 (58%)
  Q:    20 KDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-------DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI------VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP--PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNEN 394
           K VI P   ++  MIE++ + S +FFG PGVGK+A  +FI  K        N+      D+ +++E A E       + + +++++EIH  NK +QD+LL  +E+  II++  TTENP+F +N A+ SR  ++  + +++  L++ + + L+ K+ K+     +  +  +  D R++   + + +      SD I      V KE  +  +   D++   HYD++SAF KS+RGSDP+AAVY+LA++LESG D   + RR+     ED+G A         AA   +E LG+PE RIPL+Q  I +  +PKSN++ +A+DEA++ V +E +    P HLR            +GYKY HDY   YV+QEY+PK    K+FY+P +  + +N
  S:    26 KHVIGP-GRMLRRMIESDTIKSAVFFGPPGVGKTALARFIASKTEAVTVELNAAAAGVGDIKKVIEEAKERRNDTFLEKRTLVVLDEIHHFNKTQQDVLLPSVERGDIILIGLTTENPYFYINNALLSRFSVFEFKPLDAKDLEQILKRVLKIKEAKIQKDAKDFFITQANGDARRLLNAVDLAILTTAKDSDGIVNITMDVAKECMQKRHLNYDKKGDEHYDVISAFIKSMRGSDPDAAVYWLARMLESGEDPRFIARRILICASEDVGNAEPAAIMLAEAAFKCAEVLGMPEVRIPLAQAAIYVACAPKSNASYIAVDEALKEV-REGIQRRVPAHLRSG-------FKNEGYKYAHDYPNHYVKQEYMPKP---KKFYEPTEIGKEKN 404
>gi|172058090|ref|YP_001814550.1| ATPase central domain-containing protein [Exiguobacterium sibiricum 255-15] >gi|171990611|gb|ACB61533.1| AAA ATPase central domain protein [Exiguobacterium sibiricum 255-15] (437 aa)
Score = 548, Expect = 5.0e-54, Identities = 138/390 (35%), Positives = 226/390 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELAT-----EDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRD-AHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKE--FYKPNK--YSQNENKFVDYWNK 402
           S DE++ +  +  + +++   I  + L +++F+G PG GK+   + I       F   N+ T   + L E+L+ A      +  K I+ ++EIHR NK +QD LL  LE   I ++  TTENP F+VN A+ SR  ++R E   +  L+  + + L + +       + ++ + V+  V++S  D+R +   L++ +        +I + +L     S+       D+    HYD++SAF KSIRGSDP+AA+Y+LA ++E+G+    + RRLY    EDIGL++      V+A   A E +G PEARIPL++  + L  +PKSN+ I AID+A++ V +    P P HLRD  H  +A   N   Y+YPH +  +YV+Q Y P+ L   +  FYKP+   + +     +D+W K
  S:    22 SLDEIVGQRHLIGESTLLRRAILADRLGTVIFYGPPGTGKTTLARVISSYTKSAFEQLNAVTAKLDQLREVLKAAESRLQFDQQKTILFLDEIHRFNKMQQDALLPALEAGTITLIGATTENPSFEVNAALLSRATVFRFETPTTEDLRVVLHRTLHDTERGLGKYPITVTEEAVDHYVKLSDGDYRALLNALELAVLTTPEIDGEITI-DLSVAEESIQQKALKYDKDGDRHYDVISAFIKSIRGSDPDAALYWLAVMIEAGESPRFIVRRLYVHAAEDIGLSDPQALLIVDACARACEYIGFPEARIPLAETVLYLATAPKSNTVITAIDQALELVRRSDGGPVPPHLRDAHHAGAAALGNGVEYQYPHQFPHAYVKQNYWPENLARTKPVFYKPSPRGFEKQLQARLDFWKK 435
>gi|56807432|ref|ZP_00365394.1| COG2256: ATPase related to the helicase subunit of the Holliday junction resolvase [Streptococcus pyogenes M49 591] (353 aa)
Score = 547, Expect = 5.4e-54, Identities = 124/316 (39%), Positives = 192/316 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAI 328
           +  E+I +  +  +  II  M+E N L S++ +G PG+GK++    I       F  FN+T ++K  L EI E A      +++++EIHRL+K KQD LL  LE   II++  TTENPFF V PAIRSR+ ++ +E +++  +K  +   + +K+      V + ++ ++ IV  +  D R  +  L + +       D      L  + NSL      +D+    HYD+LSA  KSIRGSD NA+++Y A+L+E+GDL S+ RRL  + YEDIGLAN         A++A++ +G PEARI ++ + I+L LSPKSNSA +A+D A+
  S:    13 TISEVIGQKHLVGEGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTRYAFRTFNATIDSKKRLQEIAEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLENGTIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEDIKTAIQLAISDKERGFPFLVTIDDEALDFIVTTTNGDLRSAYNSLDLAVMSTSPNEDSSRHISLETMENSLQRSYITMDKNGDGHYDVLSALQKSIRGSDVNASLHYAARLVEAGDLPSLARRLTIIAYEDIGLANPDAQVHTVTALDAAQRIGFPEARILIANVVIDLALSPKSNSAYLAMDAAL 340
>gi|167752814|ref|ZP_02424941.1| hypothetical protein ALIPUT_01075 [Alistipes putredinis DSM 17216] >gi|167659883|gb|EDS04013.1| hypothetical protein ALIPUT_01075 [Alistipes putredinis DSM 17216] (423 aa)
Score = 547, Expect = 6.3e-54, Identities = 142/388 (36%), Positives = 223/388 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKP-IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYL----ENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNK---SDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPN--HLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFV----DYW 400
           + DE I +  +  ++ +    +E  ++ S + +G PGVGK+   + +   L + FY  ++ T+   ++ E+LE A +    D+KP I+ I+EIHR NK +QD LL  +E+ ++ ++  TTENP F+V   + SR  +Y ++ +    L+  + + L    E K  ++  +  EA+   S  D R++   L I+      K   ++  V   L +   +L D+    HYD++SAF KS+RGSDPNAA+YYLA++L  G+    + RRL  +  EDI LAN       NA  +    +G+PEARI L++ TI L  SPKS SA MAI++A+  V  +  + P   HLR+A      +    KGYKY HDY   + E E++P+ LK K+FY+PN  +  E K      D W
  S:    13 TLDEYIGQAHLVGQNGVFRKFLETGNVPSFILWGPPGVGKTTLAKIVATTLKRPFYTLSAVTSGVKEVREVLESARKQKFFDSKPPILFIDEIHRFNKSQQDSLLGAVEQGVVTLIGATTENPSFEVISPLLSRCQVYILQPMTDGELQTLLDRALATDPELKTREIEVQETEALFRFSGGDARKLLNILDIITGAANGKVTITNQYVTDCLQQ-NIALYDKNGEQHYDVISAFIKSVRGSDPNAAIYYLARMLAGGEEPRFIARRLVILASEDISLANPNALLLANACFDTVHKIGMPEARITLAETTIYLATSPKSKSAYMAINQALSFVEHDTTNRPVPLHLRNAPTKLMDQAGYGKGYKYAHDYG-GFAELEFMPETLKGKKFYEPNTRNAAEAKIAACIRDLW 418
>gi|110638794|ref|YP_679003.1| recombination factor protein RarA [Cytophaga hutchinsonii ATCC 33406] >gi|110281475|gb|ABG59661.1| ATPase, AAA family [Cytophaga hutchinsonii ATCC 33406] (420 aa)
Score = 546, Expect = 8.8e-54, Identities = 136/360 (37%), Positives = 217/360 (60%)
  Q:    34 IENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKE---EVIK---YLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKE--LGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           +E   + S++ +G PGVGK+   Q + K +   FY  ++ ++   ++ E++  A  D K ++ I+EIHR +K +QD LL  +EK  I ++  TTENP F+V PA+ SR  +Y ++ ++   L E     +K   YL+ + V++  K  ++++ +S  D R++   L++V+    +  D IV+ +  + KI    +   D+    HYD++SAF KS+RGSDPNAAVY+LA+++E G D+  + RRL  +  ED+G AN         A +A   +G PE+RI LSQ+T  L  SPKSN++ MAI+EA Q V      P P HLR+A       L+  K YKY H Y  ++VEQEY+P +L  K+ + P   ++ +
  S:    35 VEEGKIPSMILWGPPGVGKTTLAQLLAKTVGLPFYTLSAISSGVKEVREVIANAQTDGKAVLFIDEIHRFSKSQQDALLGAVEKGTIQLIGATTENPSFEVIPALLSRCQVYVLQPLSEEELVELMRSALKKDAYLKTRSVEI--KEHDSLLRLSGGDARKLLNLLELVID--ASGKDPIVITDAYVQKIAQKKVASYDKNGEMHYDIISAFIKSVRGSDPNAAVYWLARMIEGGEDVEFIARRLLILASEDVGNANPTALVMATTAFDAVRFIGWPESRIILSQVTTYLASSPKSNASYMAINEAQQLVRSHGDLPVPIHLRNAPTKLMKDLDYGKEYKYAHSYEANFVEQEYMPDKLAGKKIFDPGNNAREQ 404
>gi|134299288|ref|YP_001112784.1| recombination factor protein RarA [Desulfotomaculum reducens MI-1] >gi|134051988|gb|ABO49959.1| Recombination protein MgsA [Desulfotomaculum reducens MI-1] (438 aa)
Score = 545, Expect = 1.1e-53, Identities = 136/374 (36%), Positives = 216/374 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKD-KQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSD---DIVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S D+ I ++ I  K  ++   IE + L SI+ +G PG GK+     I +    NF   N+ +    ++   ++ A ++      + I  I+EIH L +  +QD LL  +EK  + ++  TTENP+F++N A+ SR  ++++       L   V + L+++       +VKL+   ++  +E+S  D R +   L++ +       D    I L+     T       D+   NHYD++SAF KSIRGSDP+AA++Y A++  +G D   + RRL     EDIG+A+       +AA NA E +G+PEARIP++Q  + L  +PKSNS I AID A+  V  +++   P HLRDAHY  + +L   GYKYPH++    VEQ+YLP  L+   +Y+P
  S:    24 SIDDFIGQEHIVGKGKLLRRAIEADKLGSIILYGPPGSGKTTLATIISEMTEANFVKINAVSAGVAEIRTEIKKARDNLNFYGKRTIFFIDEIHSLKRGAQQDCLLEAVEKGEVTLIGATTENPYFELNGALLSRSRIFQLAEHTEDDLYRLVQRALKDEEQGLGMYRVKLAEDAMKHFIEMSGGDGRNVLNALELAVLSTAPTEDGYRHITLEVAEDSTQQRYIRYDKSGDNHYDVISAFIKSIRGSDPDAALHYYARMTAAGEDPRFIVRRLIVHASEDIGMADPQAMLMAHAAWNALETVGMPEARIPIAQCIVYLATAPKSNSVISAIDAAMADVKTKSVGKVPPHLRDAHYKGSKELGHTGYKYPHNFPDHMVEQQYLPDALQGVTYYRP 418
>gi|153806769|ref|ZP_01959437.1| hypothetical protein BACCAC_01041 [Bacteroides caccae ATCC 43185] >gi|149131446|gb|EDM22652.1| hypothetical protein BACCAC_01041 [Bacteroides caccae ATCC 43185] (423 aa)
Score = 544, Expect = 1.4e-53, Identities = 139/374 (37%), Positives = 217/374 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN----KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + DE I +  +    +I+  MI+   + S + +G PGVGK+   Q I  KL   FY  ++ T+   D+ E+++ A  +     + PI+ I+EIHR +K +QD LL  +E   + ++  TTENP F+V   + SR  LY ++++    L E + + +      K+ K+  K   A++  S  D R++   L++V+   ++ +DD V+     +T  L       D+    HYD++SAF KSIRGSDP+ A+Y+LA+++E G D   + RRL     EDIGLAN       NA       +G PE RIPL++ TI L  SPKSNSA  AI++A++ V      P P HLR+A      +L   + YKY H Y  ++V+Q++LP ELK+K  ++P
  S:    12 TLDEYIGQKHLVGPGAILRKMIDAGRISSFILWGPPGVGKTTLAQIIANKLETPFYTLSAVTSGVKDVREVIDRAKSNRFFSQSSPILFIDEIHRFSKSQQDSLLGAVENGTVTLIGATTENPSFEVIRPLLSRCQLYVLKSLEKEDLLELLERAISTDTVLKERKIELKETTAMLRFSGGDARKLLNILELVV---ESDTDDTVVITDDMVTERLQQNPLAYDKDGEMHYDIISAFIKSIRGSDPDGAIYWLARMVEGGEDPAFIARRLVISAAEDIGLANPNALLLANACFETLMKIGWPEGRIPLAETTIYLATSPKSNSAYSAINDALELVRSTGNLPVPLHLRNAPTKLMKQLGYGQEYKYAHSYEGNFVKQQFLPDELKDKRIWQP 400
>gi|68536116|ref|YP_250821.1| recombination factor protein RarA [Corynebacterium jeikeium K411] >gi|68263715|emb|CAI37203.1| conserved hypothetical protein [Corynebacterium jeikeium K411] (464 aa)
Score = 544, Expect = 1.4e-53, Identities = 131/381 (34%), Positives = 218/381 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDD----IVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVN--KEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           S DE++ +D +    S +  +I+ +   S++ +G PG GK+     I +   + F   ++  +   ++  I+E A +        ++ I+E+HR +K +QD LL  +E   ++++A TTENP F V   + SR LL ++  ++ A ++  + + L++ +     ++++   +E +V ++  D R+   YL+   +  +   +D    +V  ++ +  N  +   DR    HYD+ SAF KSIRGSDP+AA++YLA++LE G D   + RRL     ED+G+A+        AA +A   +G+PEAR+ L+Q TI L  +PKSN  I AI+ AI  V   +    PP HLRD HY  A  L N  GY YPHD     V Q+YLP +LK+  +Y+P  +   +
  S:    45 SLDEVVGQDKVLGPGSPLRRLIDGHGDTSVILYGPPGTGKTTIASLISQVSGRRFEALSALNSGVKEVRAIIEQARKRLVLGEHTVLFIDEVHRFSKTQQDALLSAVENRTVLLVAATTENPSFSVVSPLLSRSLLVQLSTLSDADIRTVLQRALDDDRGYAGRLRVTPDAMEQLVAMAAGDARRSLTYLEAAAEGLEPDGEDGVAELVASQVKRSLNKAVVRYDRDGDQHYDITSAFIKSIRGSDPDAALHYLARMLEGGEDPRFIARRLVIHASEDVGMADPQALQVAVAAYHAVSFIGMPEARLNLAQATIHLATAPKSNGVIAAINSAIGDVQAGRGGAVPP-HLRDGHYQGAKALGNAVGYVYPHDDPKGVVPQQYLPDDLKDAVYYRPTTHGHEK 444
>gi|77919922|ref|YP_357737.1| recombination factor protein RarA [Pelobacter carbinolicus DSM 2380] >gi|77546005|gb|ABA89567.1| Recombination protein MgsA [Pelobacter carbinolicus DSM 2380] (432 aa)
Score = 543, Expect = 1.5e-53, Identities = 131/376 (34%), Positives = 222/376 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN-----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEI-------SKSDFRQIFFYLKIV--LKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLAN-SGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           + +EM+ +  +   D ++  +IE++ L S++F+G PG GK+   Q I       F +F++      ++ EI++ A E+      K ++ ++EIHR NK +QD  L Y+EK  I ++  TTENP F++N A+ SR  ++ ++ +++A + + + + L + +  L NK  E   E        ++ D R     L++   L   Q       +K+  +      D+ A  HY+++SAF KS+RGSDP+AA+Y+LA+++E+G D + + RR+     ED+G A+  GL   V A+  A   +G+PE RIPL+Q    L  +PKSN++ + ID A+ +V K    P P HL +A       +    GY+YPHDY  ++V QEYLP++L+ K FY+ ++
  S:    24 TLEEMVGQQHLIGTDKVLRRLIESDRLSSVIFWGPPGTGKTTMAQVIAGSTRSRFVFFSAVLQGIKEVREIVKKAREERAYHNRKTLLFVDEIHRFNKAQQDAFLPYVEKGDITLIGATTENPSFEINSALLSRSRVFVLQPLDAADIAQLLQRALTDSR-GLDNKFPETDSETLAFLAGQAQGDARVALNALEVAADLSKEQRAITLQAVKDALQQRGIRYDKGAEEHYNVISAFIKSLRGSDPDAALYWLARMIEAGEDPLFIARRMVIFAAEDVGNADPRGLQLAV-ASQQAVHFIGMPEGRIPLAQAATYLACAPKSNASYLGIDRALDTVRKSGSLPVPAHLCNAPTRLMKDMGYGDGYRYPHDYPGAWVAQEYLPEDLRGKRFYESSE 415
>gi|150006392|ref|YP_001301136.1| recombination factor protein RarA [Bacteroides vulgatus ATCC 8482] >gi|149934816|gb|ABR41514.1| putative ATPase, AAA family [Bacteroides vulgatus ATCC 8482] (425 aa)
Score = 543, Expect = 1.6e-53, Identities = 138/379 (36%), Positives = 225/379 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN-----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENI---------NSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQ 391
           + D+ I +  +    +++  MI+   + S + +G PGVGK+   Q I  KL   FY  ++ T+   D+ +++E A  +       PI+ I+EIHR +K +QD LL  +E  ++ ++  TTENP F+V   + SR  LY ++++         ++A+ K+ ++K    KK++L  K  +A++  S  D R++   L++V++   +    ++  E  K+T  L       D+    HYD++SAF KSIRGSDP+ A+Y+LA+++E+G D   + RRL     EDIGLAN       NAA +A   +G PE RIPL++ T+ L  SPKSNSA   I+ A++ V +    P P HLR+A      +L   K YKY H Y  ++V+Q++LP E+K+   + P   +Q
  S:    13 TLDDYIGQKHLVGPGAVLRKMIDAGRISSFILWGPPGVGKTTLAQIIANKLETPFYTLSAVTSGVKDVRDVIEKARSNRFFSQASPILFIDEIHRFSKSQQDSLLGAVETGVVTLIGATTENPSFEVIRPLLSRCQLYVLKSLEKEDLLELLHNAIAKDVILK---EKKIEL--KETDAMLRFSGGDARKLLNILELVVEADADAGPVVITDE--KVTERLQQNPLAYDKDGEMHYDIISAFIKSIRGSDPDGALYWLARMVEAGEDPAFIARRLVISAAEDIGLANPNALLLANAAFDAVMKIGWPEGRIPLAEATVYLATSPKSNSAYEGINSALELVRQTGNLPVPLHLRNAPTKLMKQLGYGKDYKYAHAYQGNFVQQQFLPDEVKDSRIWHPQNNAQ 407
>gi|167762677|ref|ZP_02434804.1| hypothetical protein BACSTE_01035 [Bacteroides stercoris ATCC 43183] >gi|167699017|gb|EDS15596.1| hypothetical protein BACSTE_01035 [Bacteroides stercoris ATCC 43183] (422 aa)
Score = 543, Expect = 1.9e-53, Identities = 136/374 (36%), Positives = 218/374 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN-----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVL----KEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + DE I +  +    +++  MI+   + S + +G PGVGK+   Q I  KL   FY  ++ T+   D+ ++++ A  +       PI+ I+EIHR +K +QD LL  +E+  + ++  TTENP F+V   + SR  LY ++++    L    +  +   ++ K+ ++  K   A++  S  D R++   L +V+   Q+++ D V+     +T  L       D+    HYD++SAF KSIRGSDP+ A+Y+LA+++E G D   + RRL     EDIGLAN       NA  +    +G PE RIPL++ TI L  SPKSNSA MAI++A++ V +    P P HLR+A      +L     YKY HDY  ++V Q++LP ELK++  ++P
  S:    12 TLDEYIGQKHLVGPGAVLRKMIDAGRISSFILWGPPGVGKTTLAQIIANKLETPFYTLSAVTSGVKDVRDVIDRAKSNRFFSQASPILFIDEIHRFSKSQQDSLLGAVEQGTVTLIGATTENPSFEVIRPLLSRCQLYVLKSLEKDDLLELLQRAITTDVQLKERQIELKETTAMLRYSGGDARKLLNILDLVV---QSETADPVVITDEMVTERLQQNPLAYDKDGEMHYDIISAFIKSIRGSDPDGAIYWLARMVEGGEDPAFIARRLVISASEDIGLANPNALLLANACFDTIMKVGWPEGRIPLAETTIYLATSPKSNSAYMAINDALELVRQTGNLPVPLHLRNAPTKLMKQLGYGDNYKYAHDYPGNFVRQQFLPDELKDRRIWEP 400
>gi|110599872|ref|ZP_01388104.1| AAA ATPase, central region [Geobacter sp. FRC-32] >gi|110549406|gb|EAT62600.1| AAA ATPase, central region [Geobacter sp. FRC-32] (438 aa)
Score = 542, Expect = 2.2e-53, Identities = 130/374 (34%), Positives = 219/374 (58%)
  Q:    16 EMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK-----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSN-------KVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV-LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKY 389
           E + ++ +  +  ++  +IE++ L S++F+G PG GK+   + I    + +F +F++  +   ++ EI++ A E  K      I+ ++EIHR NK +QD  L Y+EK +  ++  TTENP F+V   + SR  +  +  ++   L++ +   L +++  L N         +  + E +  D R     L+   +  +N +  I  ++E  +    L D+    HY+++SAF KS+RGSDP+AAVY+LA+L+E+G D + + RR+  +  EDIG A+      V +A+ A + +G+PE RI LSQ    L  +PKSN++ +AIDEA+  V K    P P H+R+A       L    GY+Y HD+   YVEQ+YLP+ LK +E+Y+P  Y
  S:    29 EYVGQEQLLGEGKLLRRLIESDQLTSLIFWGPPGSGKTTLARVIAGATSSHFIFFSAILSGIKEIREIVKEAEEVRKFQGRRTILFVDEIHRFNKSQQDAFLPYVEKGVFTIIGATTENPSFEVIAPLLSRCKVLVLNTLSEEELQKIIRNALTDRERGLGNLDLAITDDALSYMAEQAGGDGRVALNTLETAARLAENGTITIENVREAVQKKPLLYDKGGEEHYNVISAFIKSMRGSDPDAAVYWLARLIEAGEDPLFILRRMVILASEDIGNADPRALQVVVSALQAFQMVGMPEGRIILSQAVTYLATAPKSNASYLAIDEALAEVRKSGAQPVPMHIRNAPTKLMKDLGYHAGYRYAHDFAGGYVEQDYLPERLKGREYYRPAGY 418
>gi|154495040|ref|ZP_02034045.1| hypothetical protein PARMER_04086 [Parabacteroides merdae ATCC 43184] >gi|154085590|gb|EDN84635.1| hypothetical protein PARMER_04086 [Parabacteroides merdae ATCC 43184] (426 aa)
Score = 542, Expect = 2.4e-53, Identities = 141/397 (35%), Positives = 235/397 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN-----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSA----VLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNK-----SDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           + D+ I +  +    +++  MI+   + S + +G PGVGK+   Q I  KL   FY  ++ ++   D+ E++E A  +       PI+ I+EIHR +K +QD LL  +E  ++ ++  TTENP F+V   + SR  +Y ++++  A    +L + V + +  K + +     +A++  S  D R++   L++V+   +       +D+ V++ L +   +  D+    HYD++SAF KSIRGSDP+AAVY+LA+++  G D   + RRL     EDIGLAN       NA  +A + +G PE RI L++ T+ L  SPKSNSA MAI++A++ VN+    P P HLR+A      +LN  K YKY HDY   +V+QE+LPKE+ N+  +K  + + +E+K ++   ++  +  Q
  S:    14 TLDDYIGQKHLVGPGAVLRKMIDAGRVPSFILWGPPGVGKTTLAQIISNKLEAPFYTLSAISSGVKDVREVIEKAKGNRFFNTVSPILFIDEIHRFSKSQQDSLLNAVETGVVTLIGATTENPSFEVIRPLLSRCQVYVLKSLEKADLLTLLNKAVTEDIILKDMNIVLAETDAMLRYSGGDARKLLNILELVVAAEEGNEKIEITDEKVVERLQE-NPAAYDKGGEMHYDIISAFIKSIRGSDPDAAVYWLARMVAGGEDPEFIARRLVISASEDIGLANPNALLLANACFDALKKIGWPEGRIILAETTVYLACSPKSNSAYMAINDALELVNRTGNLPVPLHLRNAPTKLMAELNYGKDYKYAHDYENHFVKQEFLPKEILNERLWK-GQENPSEHKLIEQMRRLWGDRYQ 425
>gi|163752933|ref|ZP_02160057.1| ATPase, AAA family protein [Kordia algicida OT-1] >gi|161326665|gb|EDP97990.1| ATPase, AAA family protein [Kordia algicida OT-1] (431 aa)
Score = 542, Expect = 2.6e-53, Identities = 139/387 (35%), Positives = 224/387 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN------KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS----AVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNK----SDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA--LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDY 399
           + ++ I ++ +  +  ++   I    + S+L +G PG GK+     I    ++ FY  ++ ++   ++ E+++ A +DN       PI+ I+EIHR +K +QD LL  +EK  + ++  TTENP F+V PA+ SR  +Y +          +L+  + +  E  K ++  K  EA++++S  D R++    ++++     +    ++D+VL  + K T  L D+    HYD++SAF KSIRGSDPN AVY+LA+++E G D+  + RR+     EDIG+AN            A   +G PEARI LSQ  + L  SPKSN++ MAI +A Q++ +E   LS P HLR+A       L   + YKY HDYN ++V QEYLP E+ N + Y+P   S  E    D+
  S:    19 TLEDYISQEHLVGETGVLTRQIRQGIIPSLLLWGPPGTGKTTLANIIATTSDRPFYTLSAISSGVKEVREVIQRAKQDNGLFTTKNPILFIDEIHRFSKSQQDSLLGAVEKGWVTLIGATTENPSFEVIPALLSRCQVYVLNPFGKDDLVKLLQRAIKEDTELAKKQIILKETEALLKLSGGDARKLLNIFELLINSEGTEKVEITNDLVLSRVQKNT-VLYDKTGEQHYDIISAFIKSIRGSDPNGAVYWLARMIEGGEDVKFIARRMLISASEDIGIANPTALVIATNTFQAVSIIGYPEARIILSQCAVYLATSPKSNASYMAIKKA-QAIVRETGDLSVPLHLRNAPTKLMKDLGYGEDYKYSHDYNHNFVAQEYLPNEISNTKIYEPGS-SAREKSMRDF 420
>gi|53713173|ref|YP_099165.1| recombination factor protein RarA [Bacteroides fragilis YCH46] >gi|52216038|dbj|BAD48631.1| putative AAA family ATPase [Bacteroides fragilis YCH46] (423 aa)
Score = 541, Expect = 3.4e-53, Identities = 142/396 (35%), Positives = 231/396 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN----KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS----DDIVLKELGKITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           + D+ I +  +    +I+  MI+   + S + +G PGVGK+   Q I  KL   FY  ++ T+   D+ E+++ A  +     + PI+ I+EIHR +K +QD LL  +E   + ++  TTENP F+V   + SR  LY ++++    L E + + +      K+ K+  K   A++  S  D R++   L++V++    ++    DD+V + L +  N L  D+    HYD++SAF KSIRGSDP+ A+Y+LA+++E G D   + RRL     EDIGLAN       NA  +    +G PE RIPL++ TI L  SPKSNSA  AI++A+  V +    P P HLR+A      +L   + YKY H+Y  ++V+Q++LP E+K K+ ++P +++  E K  +   ++  N K
  S:    12 TLDDYIGQKHLVGPGAILRKMIDAGRISSFILWGPPGVGKTTLAQIIANKLETPFYTLSAVTSGVKDVREVIDRAKSNKFFTQSSPILFIDEIHRFSKSQQDSLLGAVEHGTVTLIGATTENPSFEVIRPLLSRCQLYTLKSLEKEDLLELLQRAITTDVVLKERKMELKETGAMLRFSGGDARKLLNILELVVESETEETVIITDDLVTERLQQ--NPLAYDKDGEMHYDIISAFIKSIRGSDPDGAIYWLARMVEGGEDPAFIARRLVISAAEDIGLANPNALLLANACFDTLMKIGWPEGRIPLAETTIYLATSPKSNSAYNAINDALALVRETGNLPVPLHLRNAPTKLMKQLGYGQEYKYAHNYEGNFVKQQFLPDEIKAKQLWQP-QHNPAEQKHAERMKQLWGNEK 421
>gi|78222159|ref|YP_383906.1| recombination factor protein RarA [Geobacter metallireducens GS-15] >gi|78193414|gb|ABB31181.1| Recombination protein MgsA [Geobacter metallireducens GS-15] (441 aa)
Score = 540, Expect = 3.5e-53, Identities = 128/397 (32%), Positives = 230/397 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK-----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENIN----SAVLKEEVI---KYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI-VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKSNNKQ 409
           + D+ + ++ +  +  ++  +IE++ L S++F+G PG GK+   + I      +F +F++  +   ++ EI++ A  + K      I+ ++EIHR NK +QD  L Y+EK +  ++  TTENP F+V   + SR  +  + ++     + +L+  ++   + L N+ + +S++ +  + E ++ D R     L+   +  +N   D+   +E  +    L D+    HY+++SAF KS+RGSDP+ A+Y+LA+++E+G D + + RR+  +  EDIG A+        AA+ A + +G+PE RI ++Q    L  +PKSN++   ID A+  V K  AL  P H+R+A       L    GYKY HDY   +V QEYLP++L+ K FY P  + Y +   + ++Y   ++  NKQ
  S:    27 TLDDYVGQEHLLGEGKLLRRLIESDTLSSLIFWGPPGSGKTTLARIIANATKSHFIFFSAILSGVKEIREIVKEAENERKYRGSNTILFVDEIHRFNKSQQDAFLPYVEKGVFTIIGATTENPSFEVIAPLLSRCKVLVLNSLTDEEVTTILRRALVDPERGLGNRSLAVSDEALAFMAEQAQGDARIALNTLETAARLAKNGEIDLDSAREAAQKKALLYDKGGEEHYNVISAFIKSMRGSDPDGALYWLARMIEAGEDPLFILRRMVILASEDIGNADPRALQVAVAALQAFQLVGMPEGRIIMAQAVTYLATAPKSNASYAGIDAALAEVRKSGALPVPLHIRNAPTRLMKDLGYHAGYKYAHDYEGGHVSQEYLPEQLRGKTFYAPRGHGYEKTIKERMEYLRTLQERNKQ 441
>gi|188586400|ref|YP_001917945.1| Recombination protein MgsA [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179351087|gb|ACB85357.1| Recombination protein MgsA [Natranaerobius thermophilus JW/NM-WN-LF] (447 aa)
Score = 540, Expect = 3.8e-53, Identities = 144/401 (35%), Positives = 234/401 (58%)
  Q:     2 KKFDEKVLV----CNSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK-----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLK-------EEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYYQNKSDD-IVLKELGK--ITNSLI--DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN---KYSQNENKFVDYWNK 402
           KKF++  L       S D+ + ++ I  K  ++   IE + L SI+ +G PG GK+   + I +   K FY  N+ T+   DL E++E + E+        I+ I+EIHR NK +QD LL Y+E   I ++  TTENP+F VN  + SR  ++++E +    ++       ++  K L N  V+++   ++ + + S  D R     L++ VL    N++   I+ KE+ +  I    +  DR    HYD++SAF KS+RGSDP+A +Y+LA++L +G D + + RR+     EDIG A+        +   + E LGLPE R+ L+Q    L  +PKSNS+   I +AI  V +      P HL+D+HY  A +L + KGY+YPH Y  ++V Q YLP+E +++ +Y P    K  + + +   +W+K
  S:    13 KKFNDTPLADRMRPRSLDDFVGQEQILGKGKLLRRAIEADRLTSIVLYGPPGSGKTTIAKIIAENTEKYFYQLNAVTSGVKDLREVVEKSKENRSYYSKGTIMFIDEIHRFNKSQQDALLPYVEDGTITLIGATTENPYFTVNNPLLSRSRIFKLEQLGIQEIETLLRRSLQDEEKGLGNYNVEINQDALQHLTDCSNGDIRIALNALELAVLTTVPNENGTRIITKEVAEESIQKKAVYYDRDGDYHYDVISAFIKSLRGSDPDAGLYWLARMLSAGEDPLFIARRMLIFASEDIGNADPMALQLALSVYQSVERLGLPEGRLTLAQGVTYLASAPKSNSSYKGILKAISEVEQGGHDQVPQHLKDSHYQGAKELGHGKGYQYPHKYPENFVHQSYLPEEFQDRIYYHPTENGKEKEIKQRLNRFWDK 441
>gi|147677387|ref|YP_001211602.1| recombination factor protein RarA [Pelotomaculum thermopropionicum SI] >gi|146273484|dbj|BAF59233.1| ATPase [Pelotomaculum thermopropionicum SI] (440 aa)
Score = 540, Expect = 4.0e-53, Identities = 134/361 (37%), Positives = 208/361 (57%)
  Q:    28 SIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS---------AVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDR-----RATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           +++  +IE +++ S +FFG PG GK+     I      +F   N+      D+  ++E     LA  + K I+ I+EIHR N+ +QD LL ++E   II++ +TTENP F V+  + SR  LYR E ++          A+L EE  + L   + +++ + ++ +  ++  D R     L++ +       D I    L     ++  R     R   HYD++SAF KS+RGSDP+A +Y+LA+++ +G D   + RR+     ED+GLA+        AA  A E +GLPEARI L++  + +  +PKSNS +  ID A+++V KE   P P HLR   Y  A  L +  GYKYPHDY   YV QEYLP  +  K FY+P++
  S:    41 TLLRRLIEEDNISSAIFFGPPGTGKTTLASIIAGMTRAHFETINAVMAGVGDIKRVVEESRERLALYNQKTILFIDEIHRFNRTQQDALLPFVENGQIIMIGSTTENPMFAVSRPLLSRSQLYRFEPLSDEAVRRILTRALLDEE--RGLAGYRAEVAGEALDHLAAVANGDARAALNALELAVLATPPGEDGIRRISLAAAEEAVQKRVLKYDRTDEHYDVISAFIKSMRGSDPHATLYWLARMIYAGEDPEFICRRIMIHAAEDVGLADPNALVVAAAAAQAVERVGLPEARIILAEAALYIAAAPKSNSVMKGIDAALKAVEKERAEPVPPHLRGTGYKGAATLGHGMGYKYPHDYPGHYVSQEYLPPNMAGKRFYQPSE 421
>gi|29346615|ref|NP_810118.1| recombination factor protein RarA [Bacteroides thetaiotaomicron VPI-5482] >gi|29338511|gb|AAO76312.1| putative ATPase, AAA family [Bacteroides thetaiotaomicron VPI-5482] (422 aa)
Score = 539, Expect = 4.8e-53, Identities = 140/374 (37%), Positives = 220/374 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENI---------NSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS----DDIVLKELGKITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + D+ I +  +    +I+  MI+   + S + +G PGVGK+   Q I  KL   FY  ++ T+   D+ E++E A  +     + PI+ I+EIHR +K +QD LL  +E   + ++  TTENP F+V   + SR  LY ++++           A+  + ++K    +K++L  K   A++  S  D R++   L++V++    ++    DD+V + L +  N L  D+    HYD++SAF KSIRGSDP+ A+Y+LA+++E G D   + RRL     EDIGLAN       NA       +G PE RIPL++ TI L  SPKSNSA  AI++A++ V      P P HLR+A      +L   + YKY H Y  ++V+Q++LP ELK K  ++P
  S:    12 TLDDYIGQKHLVGPGAILRKMIDAGRISSFILWGPPGVGKTTLAQIIANKLETPFYTLSAVTSGVKDVREVIERAKSNRFFSQSSPILFIDEIHRFSKSQQDSLLGAVENGTVTLIGATTENPSFEVIRPLLSRCQLYVLKSLEKEDLLELLQRAITTDTILK---ERKIEL--KETTAMLRFSGGDARKLLNILELVVESDTEETVVITDDMVTERLQQ--NPLAYDKDGEMHYDIISAFIKSIRGSDPDGAIYWLARMVEGGEDPAFIARRLVISAAEDIGLANPNALLLANACFETLMKIGWPEGRIPLAETTIYLATSPKSNSAYSAINDALELVRSTGNLPVPLHLRNAPTKLMKQLGYGQEYKYAHSYEGNFVKQQFLPDELKEKRIWQP 400
>gi|60681434|ref|YP_211578.1| recombination factor protein RarA [Bacteroides fragilis NCTC 9343] >gi|60492868|emb|CAH07643.1| putative AAA family ATPase protein [Bacteroides fragilis NCTC 9343] (423 aa)
Score = 538, Expect = 6.0e-53, Identities = 141/396 (35%), Positives = 231/396 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN----KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS----DDIVLKELGKITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           + D+ I +  +    +I+  MI+   + S + +G PGVGK+   Q I  KL   FY  ++ T+   D+ E+++ A  +     + PI+ I+EIHR +K +QD LL  +E   + ++  TTENP F+V   + SR  LY ++++    L E + + +      K+ K+  K   A++  S  D R++   L++V++    ++    DD+V + L +  N L  D+    HYD++SAF KSIRGSDP+ A+Y+LA+++E G D   + RRL     EDIGLAN       NA  +    +G PE RIPL++ TI L  SPKSNSA  A+++A+  V +    P P HLR+A      +L   + YKY H+Y  ++V+Q++LP E+K K+ ++P +++  E K  +   ++  N K
  S:    12 TLDDYIGQKHLVGPGAILRKMIDAGRISSFILWGPPGVGKTTLAQIIANKLETPFYTLSAVTSGVKDVREVIDRAKSNKFFTQSSPILFIDEIHRFSKSQQDSLLGAVEHGTVTLIGATTENPSFEVIRPLLSRCQLYTLKSLEKEDLLELLQRAITTDVVLKERKIELKETGAMLRFSGGDARKLLNILELVVESETEETVIITDDLVTERLQQ--NPLAYDKDGEMHYDIISAFIKSIRGSDPDGAIYWLARMVEGGEDPAFIARRLVISAAEDIGLANPNALLLANACFDTLMKIGWPEGRIPLAETTIYLATSPKSNSAYNAVNDALALVRETGNLPVPLHLRNAPTKLMKQLGYGQEYKYAHNYEGNFVKQQFLPDEIKAKQLWQP-QHNPAEQKHAERMKQLWGNEK 421
>gi|51893539|ref|YP_076230.1| recombination factor protein RarA [Symbiobacterium thermophilum IAM 14863] >gi|51857228|dbj|BAD41386.1| ATP/GTP-binding domain protein [Symbiobacterium thermophilum IAM 14863] (438 aa)
Score = 537, Expect = 7.8e-53, Identities = 131/379 (34%), Positives = 212/379 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS---AVLKEEVIKY----LENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT------NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQ 391
           + DE + ++ +      +   +E   L S + FG PG GK+   + +   +N +F   N+ T+   D+  I++     LA    K ++ I+EIHR  KD+QD LL ++E  +I ++  TT+NP   VN  + SR  ++ ++ ++    A L +  ++     L N    ++ + +E +V ++  D R     L++ +   Q          L     +L+ R          HY + SA  KSIRGSDP+AA+Y+LA++L +G D   + RRL     EDIGLA+        AA +A   +G+PE RIPL++  + L  +PKSNSA +AID A+  V +E   P PNHL+D  Y S  +L   KGY+YPHD+  ++VEQ YLP+ + +  F++P  Y +
  S:    26 TLDEFVGQEHLVGPGRFLRRALEAGHLPSCILFGPPGTGKTTLARLMASNVNAHFEQLNAVTSGVQDIRRIVDEARARLAERGQKTVVFIDEIHRWRKDQQDALLPHVEDGLITLVGATTQNPLVSVNAPLVSRTRIFELKPLSDEHIAHLLDRALRTPGRGLGNYNATVTPEAMEHLVRMAGGDARAALNALELAVLLTQPDEQGRRTVTLETAEEALLKRAVVYDHDGDEHYHVASALIKSIRGSDPDAALYWLARMLYAGEDPRFIARRLVISAAEDIGLADPQALVIAQAAADAVSFIGMPEGRIPLAEAVVYLACAPKSNSAYLAIDRALAVVEREKTPPVPNHLKDTGYGSDQRLGYGKGYQYPHDFPGAWVEQRYLPEGV-DGPFWEPKGYGR 424
>gi|150007159|ref|YP_001301902.1| recombination factor protein RarA [Parabacteroides distasonis ATCC 8503] >gi|149935583|gb|ABR42280.1| putative AAA family ATPase protein [Parabacteroides distasonis ATCC 8503] (422 aa)
Score = 537, Expect = 7.8e-53, Identities = 140/373 (37%), Positives = 226/373 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN-----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS--------AVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI-VLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYK 385
           + D+ I +  +  + +++  MI+   + S + +G PGVGK+   Q I  KL+  FY  ++ ++   D+ E++E A  +       PI+ I+EIHR +K +QD LL  +E  ++ ++  TTENP F+V   + SR  +Y +++++           + E+V+  L++K ++L+    +A++  S  D R++   L++V+     +SDDI +L E  K+   L       D+    HYD++SAF KSIRGSDP+ A+Y+LA+++  G D   + RRL     EDIGLAN       NA  +A + +G PE RI L++ T+ L  SPKSNSA MAI++A+  VN+    P P HLR+A      +L   K YKY HDY   +V+QEYLPK++  +  +K
  S:    13 TLDDYIGQKHLVGQGAVLRKMIDAGRVPSFILWGPPGVGKTTLAQIIANKLDAPFYTLSAISSGVKDVREVIEKAKSNRFFNTVSPILFIDEIHRFSKSQQDSLLNAVETGVVTLIGATTENPSFEVIRPLLSRCQVYVLKSLDKNDLLTLLYKAIAEDVV--LKDKNIRLTE--TDAMLRYSGGDARKLLNILELVVS--AEESDDIEILDE--KVVERLQENPAAYDKGGEMHYDIISAFIKSIRGSDPDGAIYWLARMVAGGEDPEFIARRLVISASEDIGLANPNALLLANACFDALKKIGWPEGRIILAETTVYLACSPKSNSAYMAINDALALVNRTGNLPVPLHLRNAPTKLMAELEYGKEYKYAHDYENHFVKQEYLPKDILGERLWK 400
>gi|148241495|ref|YP_001226652.1| fused recombination factor protein RarA/unknown domain-containing protein [Synechococcus sp. RCC307] >gi|147849805|emb|CAK27299.1| ATPase related to the helicase subunit of the Holliday junction resolvase [Synechococcus sp. RCC307] (719 aa)
Score = 537, Expect = 9.6e-53, Identities = 129/374 (34%), Positives = 208/374 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S DE I +D I     ++   I  + L S++  G PG GK+   + I      +F   N+      DL   +E A E       + ++ I+E+HR N  +QD LL ++E   + ++  TTENPFF+VN A+ SR  L+R+++++ A L + + + L ++        ++L  +    +VE++  D R +   L++ ++     +   +   L     S      L D++   H+D +SAF KSIRGSDP+AA+++LA+++E+G D   ++RRL     EDIGLA+      V A   A + +GLPE   PL Q T+ L  + KSNSA+   D   Q   ++A   P HLRDA+   +   +  GY+YPH Y   +V Q+YLP  L+ + FY+P
  S:    29 SLDEFIGQDAILGPGRLLRRAIAADRLGSLILHGPPGTGKTTLARIIANTTRCHFSSLNAVLAGIKDLRAEVEQAQERLGRHGLRTLLFIDEVHRFNTSQQDALLPWVENGTVTLIGATTENPFFEVNKALVSRSRLFRLQSLDQAALHQVLDRALSDRTHGYGERSIQLDAEARAHLVEVAGGDARSLLNALELAVETTDANASGAIQITLAVAEESIQQQAVLYDKQGDAHFDTISAFIKSIRGSDPDAALFWLARMVEAGEDPRFIFRRLLISAGEDIGLADPQGIVVVEACATAFDRIGLPEGLYPLVQATLYLAGASKSNSALGFFDAVKQLRQEKAQQIPKHLRDANRDGSAFGDGVGYRYPHAYADHWVAQQYLPNALQGQVFYQP 421
>gi|164688546|ref|ZP_02212574.1| hypothetical protein CLOBAR_02191 [Clostridium bartlettii DSM 16795] >gi|164602959|gb|EDQ96424.1| hypothetical protein CLOBAR_02191 [Clostridium bartlettii DSM 16795] (423 aa)
Score = 537, Expect = 9.8e-53, Identities = 143/393 (36%), Positives = 226/393 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN-----------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKS 405
           + ++M+ +  I  K  II  +IEN  + +++ +G PG GK+     I     K +   N+      ++ + ++ +  D    N  I++++EI  LNK +Q  LL  +E+  + ++A+T +NP+F V  AI SR  ++  + I     KE++   L+            + +   +  +  I E    D R     L++      +   + V   L  + NS        D +  + Y +LSAFHKS+RGSD NAA++YLA+L++S D+ S+ RRL  V  ED+GLA        NA V+++  LG PEAR+PL+Q T+ L   PKSNS   AID A+  + N E    P+HL+DAHYA A KL  +G  YKYPH+Y  +YV+Q+YLP  +KNK++YK    ++NE  +  YWN +K+
  S:    12 AIEDMVGQSHIIGKGKIINRLIENKTIPNMILYGPPGTGKTTLANIIANVTGKKYIKLNAVNCGVKEIKDAIDNSKRDLFSYNGIILMLDEIQALNKKQQQSLLEVIEEGSVTLIASTADNPYFVVYKAILSRSTIFEFKPIQ----KEDIYIGLKRAINRLKPLYTYESITAEDSALRYISETCNGDMRSALNKLELAFNLGIDIGSNSVNITLDDVVNSSSMKILNYDNKGDDSYSVLSAFHKSLRGSDENAALHYLARLIKSQDMQSIIRRLLCVASEDVGLAVPQAITITNACVDSALKLGFPEARLPLAQATVYLARCPKSNSVAEAIDIALYDLDNIETGEIPDHLKDAHYAGAKKLG-RGVEYKYPHNYQNNYVKQQYLPDAIKNKKYYKAGN-NKNEMAYEHYWNSLKN 422
>gi|50086546|ref|YP_048056.1| recombination factor protein RarA [Acinetobacter sp. ADP1] >gi|49532520|emb|CAG70234.1| putative ATPase [Acinetobacter sp. ADP1] (423 aa)
Score = 536, Expect = 1.1e-52, Identities = 132/382 (34%), Positives = 221/382 (57%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN----KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELG-KITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENK 395
             E+I +D +  + + +  MI+   L SI+F+G PGVGK+     + + +++ F   ++      +L EI+  + +   P++ I+EIHR NK +QD LL  +EK  I ++  TTENP F+VN A+ SR  +Y +  ++SA ++  + + +++    K+  +  +  EA+++ +  D R+    + ++   ++   ++IV   +  K+    I   D+    HYD++SAF KSIRGSDP+AA+Y++A++++ G D + + RR+     EDIG +N            + +A+G+PEARI L Q  + L  SPKSNS  +AID A+    K A  P P HLR+A     +K    G  Y YPH Y   +V QEYLP ELK  + Y   ++S+N+ +
  S:    17 LSEIIGQDHLLGEHAPLRQMIDQGHLPSIIFWGPPGVGKTTIALLLAQAVDRPFVSLSALNTGVKELREIIAESGDLLTPVVFIDEIHRFNKSQQDALLNAVEKGKITLIGATTENPSFEVNSALLSRCQVYTLNVLDSAAIQNLIDRAIDSDSFLKQRHIHIEEYEALIQFAAGDARKALNLIDLIASTFEPDQENIVTNAVTVKVAQQNIARYDKSGEQHYDIISAFIKSIRGSDPDAALYWMARMIKGGEDPVFIARRMLIAASEDIGNSNPNALLLAGECFRSVQAVGMPEARIILGQCAVYLATSPKSNSTYLAIDRALALAEKTANLPVPLHLRNAP-TKLMKQQGYGADYLYPHHYPEHFVLQEYLPPELKGTKLY---EFSRNKRE 406
>gi|42525535|ref|NP_970633.1| recombination factor protein RarA [Treponema denticola ATCC 35405] >gi|41815546|gb|AAS10514.1| ATPase, AAA family [Treponema denticola ATCC 35405] (441 aa)
Score = 536, Expect = 1.1e-52, Identities = 136/375 (36%), Positives = 214/375 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK-----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS-------------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           S DE I ++ I  K  ++   I+ + L S++FFG PG GK+   + I      NF   N+       + E +  A E+ K      I+ ++E+HR NK +QD LL ++E   II++  TTENP+F+VN A+ SR  ++ ++ +    LK+     L NK       K++     +E +++ +  D R +   L++ +   +  ++    +E  KIT S             L DR    HYD++SAF KSIRGSDP+AAVY+LA+++ +G D   ++RR+     EDIGLA+ G    V  A  A + +G+PE R  L+   + L   PKSNSA  A  +A+  V KE    PNHL+D++       + +GY YPH +   +V+Q+YLP  L+   FY+P+
  S:    27 SLDEYIGQEHIIGKGCLLRRAIQADRLSSLIFFGPPGTGKTTLARVIANTTKSNFLSLNAVLAGVQQIREAVTNAEENKKLYNRKTILFVDEVHRWNKSQQDALLPWVENGTIILIGATTENPYFEVNKALVSRSRVFELKPLTDNDLKKVAQFALTNKERGYGNWKIEFEAGALEHLIDTASGDARSLLNALELAV---ETSAEHWPPEENFKITISLKAAEESIQKKVVLYDRDGDYHYDVISAFIKSIRGSDPDAAVYWLARMIAAGEDPRFIFRRMLISACEDIGLASPGAVSVVAGAAEAFDRVGMPEGRYHLAHAALYLATCPKSNSA-EAFFKALDCVQKENKEVPNHLKDSNRDGEALGHGEGYLYPHAFEGHWVKQQYLPDGLEGTHFYEPS 423
>gi|19703642|ref|NP_603204.1| recombination factor protein RarA [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713756|gb|AAL94503.1| ATPase associated with chromosome architecture/replication [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (407 aa)
Score = 534, Expect = 2.0e-52, Identities = 137/374 (36%), Positives = 224/374 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALS--PPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S D+ + ++ +  KD +I  +I N+ L + +F+G PG GKS+  + I   L+ NF   N+TT + +D+  ++E A  +      + I+ ++EIHR NK++QD LL Y E   + ++  TTENP++ +N A+ SR++++  + + +  + + + K L    + + +K+ E IV+IS+ D R    Y+++    +   S+D +     +   S   ++  + YD++SAF KSIRGSDP+AAVY+LA+LL+ G D   + RRL+    EDIG+AN       NAA+NA E +G+PE RI L+  TI L +S KSNS   AID A+  + K  L   P N   D         NV GYKYPH+Y  ++++Q+Y+ K+   +++YKP
  S:    22 SLDDFVGQEKLLGKDGVITRLILNSTLSNSIFYGPPGCGKSSLGEIISNTLDCNFEKLNATTASVSDIRNVVETARRNIELYNKRTILFLDEIHRFNKNQQDALLSYTEDGTLTLIGATTENPYYNINNALLSRVMVFEFKALTNEDILKLIDKGLNFLNICMGDKIKEIIVDISQGDSRIALNYVEMYNNIHSQMSEDEIFSIFKERQVSFDKKQ--DKYDMISAFIKSIRGSDPDAAVYWLARLLDGGEDPKYMARRLFIEASEDIGMANPEALLVANAAMNACEKIGMPEVRIILAHTTIYLAISSKSNSVYEAIDGALADIKKGELQEVPMNICHD---------NV-GYKYPHNYTDNFIKQKYMNKK---RKYYKP 388
>gi|38233937|ref|NP_939704.1| recombination factor protein RarA [Corynebacterium diphtheriae NCTC 13129] >gi|38200198|emb|CAE49879.1| Conserved hypothetical protein (putative ATP/GTP binding protein) [Corynebacterium diphtheriae] (456 aa)
Score = 533, Expect = 2.5e-52, Identities = 131/392 (33%), Positives = 224/392 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIV---LKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           S DE++ +  +      +  +I  +   S++ +G PG GK+     I       F   ++  +   ++ E+++ A  +     + ++ I+E+HR +K +QD LL  +E   ++++A TTENP F V   + SR L+ +++ +    +K  ++  L++K+     + +S++ +E +V +S  D R+   YL+     L   +  + +I+   + K      DR    HYD++SAF KS+RGSD +AA++YLA+++++G D   + RRL     ED+G+A+        AA  A   +G+PEARI L+Q TI L  +PKSN+ I AID A+  V +    P P HLRD HYA A +L N  GYKYPHD     VEQ+Y+P  L++  +Y+P+++   E +   Y  K++
  S:    44 SLDEVVGQRHLLDSGKPLQRLIAGSGDASVILYGPPGTGKTTIASLISAGTGHEFVGLSALNSGVKEIREVIDQARRNLIHGKRTVLFIDEVHRFSKTQQDALLAAVENRTVLLVAATTENPSFSVVAPLLSRSLILQLKPLTHDDIKTVLLHALQDKRGLDNRITISDEALEQLVLLSGGDARRSLTYLEAASESLADGEELTPEIIRHNVDKAIVRY-DRDGDQHYDVVSAFIKSMRGSDVDAALHYLARMIDAGEDPRFIARRLVIHASEDVGMADPQALSVAVAASQAVALIGMPEARINLAQATIHLATAPKSNAVITAIDAALADVKQGKTGPVPAHLRDGHYAGAKQLGNAVGYKYPHDDPRGIVEQQYIPNGLEDVVYYRPSEHGA-EQRIESYLGKLR 448
>gi|78776412|ref|YP_392727.1| recombination factor protein RarA [Sulfurimonas denitrificans DSM 1251] >gi|78496952|gb|ABB43492.1| Recombination protein MgsA [Sulfurimonas denitrificans DSM 1251] (393 aa)
Score = 532, Expect = 3.1e-52, Identities = 144/393 (36%), Positives = 216/393 (54%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEAL--SPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           ++FDE+I +D +    + +  + +   L    FFG  G GK++  + I K +   FY FN+T+     L  I E       KP+I I+E+HRL K++Q++LL  +E +  +++  +TENPFF +  AIRSR +L+ + +I++  L   + + L++  +  S++ +E +++ S  D R +   L+       + + DI LK L     S+    A  HYDL SA  KSIRGSD +AA+YYLA+L++ G+    + RRL  +  ED+G AN        +A+ +   +G PEARI LSQ  I LC SPKSNSA +AI  A+ +VN   +   P N          +  N KGY YPHD+   YV+Q YL K LK     KP  Y   E K VD+   IK
  S:    11 SNFDELIGQDHLSKDKAPLRVLCQKGVLGHSFFFGPSGTGKTSIARIIAKTMELPFYEFNATSIKIEQLRAIFEQYKNTLQKPLIFIDEVHRLAKNQQEVLLPVMENNSALIIGASTENPFFSLTSAIRSRSMLFELHHISNEALSRLLRRALDSSDITCSDEALEYLIKSSGGDARSMLKLLEFASNIGTHITLDI-LKSLRPNALSVGSSEAGVHYDLSSAMIKSIRGSDMDAAIYYLARLIDGGESAEFIARRLVILASEDVGNANPQALTLATSAMTSVSKIGYPEARIILSQAVIYLCASPKSNSAYLAIKSALSAVNDGVMLDIPKN----------ITQNSKGYLYPHDFG-GYVKQNYLSKPLKFVTL-KPIGY---EKKMVDWIESIK 391
>gi|158337198|ref|YP_001518373.1| recombination factor protein RarA/unknown domain fusion protein [Acaryochloris marina MBIC11017] >gi|158307439|gb|ABW29056.1| ATPase, AAA family protein [Acaryochloris marina MBIC11017] (742 aa)
Score = 532, Expect = 3.3e-52, Identities = 124/375 (33%), Positives = 214/375 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT-------NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           + DE + +D I     ++   I+ + L S++F+G PG GK+   Q I      +F   N+      D+   ++ A +       + I+ ++E+HR NK +QD LL ++E   +I++  TTENP+F+VN A+ SR  ++++ ++    L++ + + L++K        ++L     E ++ ++  D R +   L++ ++  +     ++   L  +  + I RRA         H+D +SAF KS+RGSDP+AA+Y+LA+++ +G D   ++RR+  +  ED+GLA+      V A   A + +GLPE + PL+Q  + L  +PKSNSA+   D A+ SV KE     PN LRD         +   YKYPH Y   +V Q+YLP  L+ + FY+P+
  S:    26 TLDEFVGQDEIVGPGRLLRRAIQADQLSSLIFYGPPGTGKTTLAQIIANTTQAHFLALNAVLAGIKDIRSSVDEAQDRRGQYGQRTILFVDEVHRFNKAQQDALLPWVENGTVILIGATTENPYFEVNKALVSRSRIFQLRSLMPDDLRQVLERALQDKYFGYGDTAIELEGAATEHLINVANGDARALLNALELAIETTEPDDQGVIPITLA-VAEASIQRRAVLYDKEGDAHFDTISAFIKSMRGSDPDAALYWLARMVYAGEDPRFIFRRMIILASEDVGLADPQAVGVVMACAQAFDRIGLPEGQYPLAQAALYLSTAPKSNSALAYFD-ALASVEKEREGDVPNPLRDKSRDKHAFGHGANYKYPHAYRDHWVAQQYLPDSLQGQVFYQPS 419
>gi|172040631|ref|YP_001800345.1| hypothetical protein cu0951 [Corynebacterium urealyticum DSM 7109] >gi|171851935|emb|CAQ04911.1| conserved hypothetical protein [Corynebacterium urealyticum DSM 7109] (461 aa)
Score = 531, Expect = 4.1e-52, Identities = 128/379 (33%), Positives = 220/379 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLK--YYQNKSDD----IVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV--NKEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQ 391
           S  E++ +D +    + +  +I+     S++ FG PG GK+     I     ++F   ++  +   ++  ++E A        + ++ I+E+HR +K +QD LL  +E   ++++A TTENP F V   + SR LL ++++++   +K  + + + +++     V++++  ++ +  +S  D R+   YL+ V +    Q ++ D    I + ++ + TN  +   DR    HYD+ SAF KS+RGSDP+AA++YLA++LE G D   + RRL  V  EDIG A+        AA  A   +G+PEARI L+  T+ +  +PKSN+A + I+EAI  +   K A+ P  HLRD HY+ A  L N  GY+YPHD     + Q+YLP +L    +Y+P  +  
  S:    40 SLAEVVGQDHVLGPGTPLQRLIDGRGDSSVILFGPPGTGKTTIASLISAASGRHFVALSALNSGVKEVRAVIEDARRRLLHGARTVLFIDEVHRFSKTQQDALLAAVENRTVLLVAATTENPSFSVVSPLLSRSLLVQLKSLDEDGIKSVLRRAIADERGLAGQVQIADDALDQLAAVSGGDARRSLTYLEAVAEDVLQQKEAGDEAPTITVADVTRSTNKAVARYDRDGDQHYDVTSAFIKSMRGSDPDAALHYLARMLEGGEDPRFISRRLVIVASEDIGTADPTALQVAVAAHQAVSFIGMPEARITLAHATVHMATAPKSNAAYVGINEAIADIRAGKGAIVPA-HLRDGHYSGAKALGNATGYQYPHDDPRGVLRQQYLPDDLVEAVYYRPTTHGH 439
>gi|196241291|ref|ZP_03140055.1| AAA ATPase central domain protein [Cyanothece sp. PCC 7425] >gi|196214683|gb|EDY09338.1| AAA ATPase central domain protein [Cyanothece sp. PCC 7425] (731 aa)
Score = 530, Expect = 5.1e-52, Identities = 123/375 (32%), Positives = 214/375 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           S DE I +D I  +  ++   I+ + L S++F+G PG GK+   + I       F   N+      ++   +E A        + I+ ++E+HR NK +QD LL ++E   +I++  TTENP+F+VN A+ SR  +++++ ++   L +   + L ++       KV++ +  +  +V ++  D R +   L++ ++     + D +   L     S      L D+    H+D +SAF KS+RGSDP+AA+Y+LA+++ +G D   ++RR+  +  ED+GLA+      VNA   A + +GLPE   PL+Q  + L  + KSNS  M   +A+++V +E     PNHL+D++       +  GYKYPH Y   +V Q+YLP  L+ + FY+P+
  S:    19 SLDEFIGQDHIIGEGRLLRRAIQADQLSSLIFYGPPGTGKTTLARMIANTTQAYFIAINAVLAGVKEIRAAVETAQTHQQLRQRTILFVDEVHRFNKAQQDALLPWVENGTLILIGATTENPYFEVNKALVSRSRIFQLKPLSEQDLYQVAFQALHDRERGYGNLKVRVEDDALAHLVNVANGDARALLNALELAVETTPGDAQDQIHITLAIAEESIQRRAVLYDKEGDVHFDTISAFIKSLRGSDPDAALYWLARMIYAGEDPRFLFRRMLILASEDVGLADPQAVMVVNACAAAFDRIGLPEGHYPLAQAALYLATAAKSNST-MGFFDALKAVEQEREGDVPNHLKDSNRDKHSFGHGAGYKYPHAYREHWVAQQYLPDNLQGQMFYQPS 411
>gi|118726564|ref|ZP_01575187.1| AAA ATPase, central region [Clostridium cellulolyticum H10] >gi|118664013|gb|EAV70652.1| AAA ATPase, central region [Clostridium cellulolyticum H10] (432 aa)
Score = 530, Expect = 5.1e-52, Identities = 136/388 (35%), Positives = 220/388 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKE-------EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSD---DIVLKELGKITNS---LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVN-KEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYW 400
           + DE + +  I  KD ++  MI+ + + SI+ +G PG GK++  + I       F   N+ T+   D+  I       L   + + ++ I+EIHR NK +QD LL ++E   I+++  TTENPFF+VN A+ SR  ++ ++ + S  ++E       +  + L N K+ ++++ +  + EI   D R     L++ +   +   D   DI +  + +         D+    HYD +SAF KS+RGS P+AAV+YLA+ L +G D+  + RR+     ED+G+AN        AA  A + +G+PEARI L+   + +  SPKSNSA MAI+ A+  V  K   S P HLR+A      +L    GYKY HDY  + V+QE+ P+E+K   +Y P  N Y     ++++ W
  S:    16 TIDEFVGQKHIIEKDKMLYRMIKADRITSIILYGPPGTGKTSLARIIANTTQSTFEKLNAVTSGVADIKRIAADTQNTLLNPNGRTVLFIDEIHRFNKSQQDALLPFVEDGSIVLIGATTENPFFEVNKALISRSTVFMLKPLESTDIRELLENALVDKERGLGNYKINITDEALGYLCEICSGDARTALNSLELAVLTSELGVDGQIDIGIDTIEQCVQKKAIRFDKSGEEHYDNISAFIKSMRGSSPDAAVFYLARALYAGEDVEFLARRIIICASEDVGMANPTALQVAVAAAQAVKMIGMPEARILLAHAAVTVACSPKSNSAYMAINRALSDVEAKNTGSVPMHLRNAAAKGMEQLGYGIGYKYAHDYKNNIVKQEFFPEEMKGTIYYNPTQNGYEARIKEWLERW 426
>gi|88805140|ref|ZP_01120660.1| putative ATPase, AAA family protein [Robiginitalea biformata HTCC2501] >gi|88786019|gb|EAR17188.1| putative ATPase, AAA family protein [Robiginitalea biformata HTCC2501] (427 aa)
Score = 530, Expect = 5.3e-52, Identities = 133/366 (36%), Positives = 213/366 (58%)
  Q:    34 IENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE------DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE----------NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQN---KSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDY 399
           I N  + S++F+G PG GK+     I ++  + F+  ++  +   D+ E++E A +         PI+ I+EIHR +K +QD LL  +EK  + ++  TTENP F+V PA+ SR  +Y +E+      KE+++K LE          ++++KL     +A++ +S  D R++    ++V+        +  D ++ +L +   +  D+    HYD++SAF KSIRGSDPNAAVY+LA+++  G D+  + RR+     EDIGLAN       N    A +A+G PEARI LSQ  + L  SPKSNS   AI++A+ +V K    P P  LR+A      +L     Y+Y HD   ++ + E+LP+ L    FY P K ++ E   V++
  S:    34 IANGTVPSMIFWGPPGTGKTTLAHIIAEESGRPFFTLSAINSGVKDVREVIEKARQGGGLFTTRNPILFIDEIHRFSKSQQDSLLAAVEKGWVTLIGATTENPSFEVIPALLSRCQVYTLESFG----KEDLLKLLERAMASDSQLQSREIKLEE--TDALLRLSGGDGRKLLNIFELVVSASPEDPVRITDKMVTDLVQNQPARYDKTGEQHYDIISAFIKSIRGSDPNAAVYWLARMVAGGEDVKFIARRMVIAASEDIGLANPTALVMANTTFQAVQAIGYPEARIILSQCAVYLATSPKSNSTYAAINKAMGAVEKSGDLPVPLPLRNAPTKLMKELGYGTNYQYAHDQPGNFADMEFLPEALSGTGFYTPGKNAR-EAALVEF 414
>gi|126662272|ref|ZP_01733271.1| ATPase, AAA family protein [Flavobacteria bacterium BAL38] >gi|126625651|gb|EAZ96340.1| ATPase, AAA family protein [Flavobacteria bacterium BAL38] (428 aa)
Score = 530, Expect = 5.4e-52, Identities = 132/353 (37%), Positives = 206/353 (58%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN------KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS---AVLKEEVIK---YLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLK-------ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           S++ +G PG GK+   Q + ++  + FY  ++  +   D+ E++E A + +       PI+ I+EIHR +K +QD LL  +EK  I ++  TTENP F+V PA+ SR  +Y +          L    IK   +L+NK ++L  K  EA++ +S  D R++    ++V+      +    ++       +L +    L D+    HYD++SAF KSIRGSDPN AVY+LA+++E G D+  + RRL  +  EDIG AN       N A  A   +G PE+RI LSQ  I L  S KSN++ MAI +A Q V +    P P HLR+A      +L    YKY HD+  ++ EQE+LP E+   +F++P + ++ +
  S:    41 SLILWGPPGTGKTTLAQIMAQESKRPFYQLSAIHSGVKDIREVIEKAKQSSGLFTAKNPILFIDEIHRFSKSQQDSLLAAVEKGWITLIGATTENPSFEVIPALLSRCQVYVLNAFTKDDLEALLHRAIKTDIHLQNKDIQL--KETEALLRLSGGDGRKLLNIFELVINATDTSTSSASIEVTNEKVMQLVQKNTVLYDKTGEQHYDIVSAFIKSIRGSDPNGAVYWLARMIEGGEDVKFIARRLLILASEDIGNANPTAFIMANNAFQAVTTIGYPESRIILSQCAIYLATSAKSNASYMAIGKAQQMVKQTGDLPVPIHLRNAPTKLMKELGYGDYKYSHDFPNNFAEQEFLPTEISETKFFEPGENAREK 412
>gi|3136020|emb|CAA19102.1| hypothetical protein MLCB1259.27 [Mycobacterium leprae] (447 aa)
Score = 529, Expect = 6.6e-52, Identities = 123/374 (32%), Positives = 214/374 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI--DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S DE++ +  +    S +  ++E + + S +  G PG GK+     I +     F   ++ +    D+  +L++A        + ++ I+E+HR +K +QD LL  +E  +++++A TTENP F V   + SR L+ ++  +N+  ++  V + +++ +     + ++ + V+ +V ++  D R++   L++  +  Q   +  V      + N+ +  DR    HYD++SAF KS+RGSD +AA++YLA++L +G D   + RRL  +  EDIGLA+S   P   AA    + +G+PEA++ L+  TI L  +PKSN+ + A+  AI  +   +A   P HLRD HY+ A  L N KGYKY HD     V Q+Y P EL   ++Y+P
  S:    35 SLDELVGQGHLLAPGSPLRRLVEGSGVVSAILHGPPGCGKTTLAALISQATGHRFEALSALSAGVKDVRAVLKIARSALLSGKRTVLFIDEVHRFSKTQQDALLSAVENRVVLLVAATTENPSFSVVAPLLSRSLILQLRPLNADDIRAVVQRAVDDPRGLGGQIAVAPEAVDLLVRLAAGDARRVLTALEVAAEAVQTGDELTVATIEQSLDNAAVRYDRDGDQHYDIVSAFIKSVRGSDVDAALHYLARMLIAGEDPRFIARRLLILASEDIGLADSTALPLAVAAAQTVQLIGMPEAQLALAHATIHLATAPKSNAVMTALGSAIDDIKAGKAGLVPAHLRDGHYSGAAALGNAKGYKYSHDDPDGVVAQQYPPYELVEVDYYRP 422
>gi|15827173|ref|NP_301436.1| recombination factor protein RarA [Mycobacterium leprae TN] >gi|13092721|emb|CAC30018.1| conserved hypothetical protein [Mycobacterium leprae] (473 aa)
Score = 529, Expect = 6.6e-52, Identities = 123/374 (32%), Positives = 214/374 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI--DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S DE++ +  +    S +  ++E + + S +  G PG GK+     I +     F   ++ +    D+  +L++A        + ++ I+E+HR +K +QD LL  +E  +++++A TTENP F V   + SR L+ ++  +N+  ++  V + +++ +     + ++ + V+ +V ++  D R++   L++  +  Q   +  V      + N+ +  DR    HYD++SAF KS+RGSD +AA++YLA++L +G D   + RRL  +  EDIGLA+S   P   AA    + +G+PEA++ L+  TI L  +PKSN+ + A+  AI  +   +A   P HLRD HY+ A  L N KGYKY HD     V Q+Y P EL   ++Y+P
  S:    61 SLDELVGQGHLLAPGSPLRRLVEGSGVVSAILHGPPGCGKTTLAALISQATGHRFEALSALSAGVKDVRAVLKIARSALLSGKRTVLFIDEVHRFSKTQQDALLSAVENRVVLLVAATTENPSFSVVAPLLSRSLILQLRPLNADDIRAVVQRAVDDPRGLGGQIAVAPEAVDLLVRLAAGDARRVLTALEVAAEAVQTGDELTVATIEQSLDNAAVRYDRDGDQHYDIVSAFIKSVRGSDVDAALHYLARMLIAGEDPRFIARRLLILASEDIGLADSTALPLAVAAAQTVQLIGMPEAQLALAHATIHLATAPKSNAVMTALGSAIDDIKAGKAGLVPAHLRDGHYSGAAALGNAKGYKYSHDDPDGVVAQQYPPYELVEVDYYRP 448
>gi|149371615|ref|ZP_01891031.1| putative ATPase, AAA family protein [unidentified eubacterium SCB49] >gi|149355242|gb|EDM43802.1| putative ATPase, AAA family protein [unidentified eubacterium SCB49] (425 aa)
Score = 529, Expect = 7.0e-52, Identities = 142/388 (36%), Positives = 228/388 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN------KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV-----EAIVEISKSDFRQIFFYLKIV-LKYYQNK---SDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN---KYSQNENKFVDYW 400
           + D  + +  +  K   + + I+     S++F+G PG GK+     I +  ++ FY  ++  +    + E++  A + +       PI+ I+EIHR +K +QD LL  +EK  + ++  TTENP F+V PA+ SR  +Y +++ +   L + + + L N  + LS K +     EA++ +S  D R++   L++V L    +K   ++D+VL ++ K T  L D+    HYD++SAF KSIRGSDPNAAVY+LA+++E G D+  + RRL  +  EDIGLAN       N    +   +G PE+RI LSQ TI L  SPKSN++ MAI++A Q V +   LS P  +R+A      +L   K Y Y H+Y  ++   E+LP+E++   FY+P    K SQ +    + W
  S:    13 TLDTYLSQQHLVGKGGSLTSQIKTGVFSSMIFWGPPGTGKTTLASIIAETSDRPFYTLSAIDSGVAAVREVIAKAKQGDGLFTTKNPILFIDEIHRFSKSQQDSLLGAVEKGWVTLIGATTENPSFEVIPALLSRCQVYILKSFSKDDLNQLLERALINDTI-LSKKDIILKETEALLRLSGGDARKLLNMLELVILSEGTDKVTVTNDLVLAKVQKNT-VLYDKTGEQHYDIISAFIKSIRGSDPNAAVYWLARMIEGGEDVKFIARRLLILASEDIGLANPNALLMANTTFQSVNVIGHPESRIILSQCTIYLATSPKSNASYMAINKAQQLVKQTGDLSVPLSIRNAPTKLMQELGYGKAYAYAHNYEGNFTPHEFLPEEIEGTSFYEPGNNAKESQLKAHLKNLW 419
>gi|95930182|ref|ZP_01312921.1| AAA ATPase, central region [Desulfuromonas acetoxidans DSM 684] >gi|95133876|gb|EAT15536.1| AAA ATPase, central region [Desulfuromonas acetoxidans DSM 684] (439 aa)
Score = 528, Expect = 8.7e-52, Identities = 129/373 (34%), Positives = 223/373 (59%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSR---LLLYRIENINSAVLKEEVI---KYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS-DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPK-VNAAVNASEA---LGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
            DE++ +  +      +  +IE + L S++F+G PG GK+   Q I +     F +F++  N   D+  I+  A ED      + I+ ++EIHR NK +QD  L  LEK  +I++  TTENP F+VN A+ SR    +L  +++ +  +L +  +   + L ++K  +S + ++ + ++++ D R     L++V++  + K  D+  + +  +      D+ A  HY+++SAF KS+RGS+P+ A+Y+LA+++E+G D + + RRL  +  EDIG A+    P+ +  A++A +A   +G+PE RI L+Q T  L  +PKSN++ + ID A+  V +   L  P HLR+A      +L+  K Y+Y HD    +V Q+YLP +L   EFY P
  S:    24 LDEVVGQQHLLADGCPLRQIIEADQLSSLIFWGPPGTGKTTLAQVIAQSTRSRFVFFSAIMNGVKDIRHIVSRAKEDRSMYGTRTILFVDEIHRFNKSQQDAFLPALEKGDLILIGATTENPSFEVNAALLSRARVFVLKPLQHDDIVLLLQRALSDPRGLADQKPDVSQEALDHLAQLAQGDARVALGNLQLVVETAKGKPIDEAAISQTLQQKALRYDKGAEEHYNVISAFIKSVRGSNPDGALYWLARMIEAGEDPLFIARRLVILAAEDIGNAD----PRGLQLAISAQQAVHFVGMPEGRIILAQATTYLASAPKSNASYLGIDTALAEVRRSGPLEVPLHLRNAPTKLMKELDYGKDYQYAHDNPTGFVAQDYLPDQLHGSEFYHP 411
>gi|87308504|ref|ZP_01090644.1| hypothetical protein DSM3645_14130 [Blastopirellula marina DSM 3645] >gi|87288596|gb|EAQ80490.1| hypothetical protein DSM3645_14130 [Blastopirellula marina DSM 3645] (461 aa)
Score = 528, Expect = 9.5e-52, Identities = 130/354 (36%), Positives = 209/354 (59%)
  Q:    33 MIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSN-------KVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELG--KITNSLI--DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           +I+ + L S+LF+G PG GK+   Q + ++    F   N+ T+   +L E+L     E+A    + ++ I+EIHR NK +QD LL  +E  ++I++  TT NPFF VN A+ SR  +++ + ++   +K+ + + L +K V L +         +  + E+S  D R+    L+I +   + +  +   +EL    +    +  DR   +HYD  SA  KSIRGSDP+AA+Y+LA++LE G D+  + RRL  +  ED+G A+        +A+ A E +GLPE ++ LSQ    L  +PKSN+A +AI EA+Q V +  L P P HLRDAHY  A  L +   Y+Y H+ +     Q+YL  +   +E+Y+P
  S:    58 LIQADRLNSVLFYGPPGTGKTTLAQLLARECRSRFEQLNAVTSGVKELREVLQKAKDEIAVGGRRTLLFIDEIHRFNKSQQDALLPDVENGVVILVGATTSNPFFAVNSALVSRSQVFQFQPLSPDDIKQLIHRALADKSVGLGDIPVNIHEDALHFLAEVSDGDARRALNALEIGVLSSKERPVEFT-QELAAESVQRKAVQYDRDGDSHYDAASALIKSIRGSDPDAALYWLARMLEGGEDVRFLTRRLVILASEDVGNADPNALTLAVSAMQACEFIGLPECQLTLSQTVAYLACAPKSNAATIAIGEAVQDVREGRLIPVPVHLRDAHYQGAKTLGHGADYQYAHNADDGVAAQDYLGVD---REYYRP 426
>gi|189425566|ref|YP_001952743.1| AAA ATPase central domain protein [Geobacter lovleyi SZ] >gi|189421825|gb|ACD96223.1| AAA ATPase central domain protein [Geobacter lovleyi SZ] (435 aa)
Score = 527, Expect = 1.2e-51, Identities = 121/362 (33%), Positives = 211/362 (58%)
  Q:    33 MIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI-VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNEN 394
           MIE + L S++F+G PG GK+     I  + +  F +F++      ++ EI +     A    + I+ ++EIHR NK +QD  L  +EK ++ ++  TTENP F+V   + SR  + R++ + +  L   + K L++        ++ + ++ +  + E ++ D R+    L++     Q+    + + +E  +    L D+    HY+++SAF KS+RGSDP+AA+Y+LA++LE+G D + + RR+  +  EDIG A+        +A+ A + +G+PE RI L Q    L  +PKSN++ + ID A+  V K  AL  P H+R+A      +L   +GY+Y HD++  YV+QEYLP+ L+ ++FY P  +   +N
  S:    44 MIEADQLPSMIFWGPPGCGKTTLAHIIAHETSSRFVFFSAIMAGVKEIREIFKDAEAYAAGGTRTILFVDEIHRFNKAQQDAFLPAVEKGLVTIIGATTENPSFEVIAPLLSRCRVLRLKQLEADELATLLQKTLQDTEKGLGGLQLAIEDEALTFLSEAAQGDGRKALNTLEVAAGLAQDGLISLEIAQEAMQQKALLYDKGGEEHYNVISAFIKSMRGSDPDAALYWLARMLEAGEDPLFILRRMIILASEDIGNADPRALQMAVSALQAFQMVGMPEGRIILGQAVTYLATAPKSNASYLGIDAALSEVRKSGALEVPLHIRNAPTKLMKELGYHQGYQYAHDFSSGYVQQEYLPERLQGRKFYDPKGHGYEKN 420
>gi|125973135|ref|YP_001037045.1| recombination factor protein RarA [Clostridium thermocellum ATCC 27405] >gi|196253133|ref|ZP_03151773.1| AAA ATPase central domain protein [Clostridium thermocellum DSM 4150] >gi|125713360|gb|ABN51852.1| Recombination protein MgsA [Clostridium thermocellum ATCC 27405] >gi|196197431|gb|EDX92288.1| AAA ATPase central domain protein [Clostridium thermocellum DSM 4150] (432 aa)
Score = 527, Expect = 1.2e-51, Identities = 140/375 (37%), Positives = 217/375 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEA-------IVEISKSDFRQIFFYLKIVLKYYQNKSD-----DI-VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           + +E   ++ I  +  ++  MI+ + + SI+ +G PG GK++  + I      NF   N+ T    D+  I+      +     + ++ I+EIHR NK +QD LL Y+E   II++  TTENPFF+VN A+ SR  ++ ++ + S  +K+ +   L +K+  L N  +E        + +I   D R     L++ +      SD     DI +++E  +   +  D+    HYD +SAF KS+RGSDP+AAV+YLA+ L +G D + + RR+     ED+G+AN        AA  A   +G+PEARI LSQ  I +  SPKSNS  +AID A+  V NK     P HLR+A  +   +L   KGYKY HDY  + V+Q+YLP+E+K   +Y P+
  S:    16 TLEEFYGQEEIVGEGKLLNRMIKADRISSIILYGPPGTGKTSLARIIANSTKANFEKLNAVTAGVADIKRIVSDTQNPILNPKGRTVLFIDEIHRFNKSQQDALLPYVEDGTIILVGATTENPFFEVNKALISRSSVFMLKPLGSDAIKKIIRNALTDKERGLGNMDIEIEEDALNFLADICDGDARIALNALELAVLTSPVGSDGKFHIDIQLIEECIQKKAARYDKSGEEHYDNISAFIKSMRGSDPDAAVFYLARALYAGEDPMFLARRIMICAAEDVGMANPAALQVAVAAAQAVHMVGMPEARIILSQAAIMVATSPKSNSCYVAIDRALDDVKNKRTGEVPMHLRNAVTSGMKELGYGKGYKYAHDYPGNIVDQDYLPQEIKGTVYYNPS 411
>gi|168334208|ref|ZP_02692411.1| AAA ATPase central domain protein [Epulopiscium sp. 'N.t. morphotype B'] (420 aa)
Score = 526, Expect = 1.7e-51, Identities = 135/373 (36%), Positives = 218/373 (58%)
  Q:    16 EMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS----AVLKEEVI---KYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI-------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           +++ ++ I  K  ++   I  + L S++F+G PG GK+   + I K    +F   N+TT+ K D+L +++     LAT     II I+EIHR NK +QD LL Y E   II++  TTENP+F+VN A+ SR L++ + ++ +     +L+  +    K L      L+++  E I   +  D R     L++       +S D  +    ++ +  +       D++  NHYD++SAF KS+RGSD NA ++YLA++LESG D+  + RR+     ED+G A+         A+ A+E +G+PE++I L+Q    +  S KSN++   I+ AI  V    +   PNHL+D HY  +  L+ +G  YKYPH Y  +YVEQ+YLP  +  K++Y   K
  S:    27 QIVGQEHILAKGKLLHRAITADKLQSMIFYGPPGSGKTTIAKVIAKTTTSHFETLNATTSGKADILRLVQNAKDSLATSSKHTIIFIDEIHRFNKAQQDALLPYAEDGTIILIGATTENPYFEVNRALLSRSLIFELHSLTNENIITILQRAITDTDKGLGVYNAILTDQAAEFIATHAAGDARAALNALELA-TLTTERSADGKINITAQVASECMQKKFLNYDKKGDNHYDVISAFIKSMRGSDANATLHYLARMLESGEDIKFIARRIMICASEDVGNADPMALILATNAMLAAERVGMPESKIILAQAATYIATSKKSNASYAGINAAIADVQTIDIGQVPNHLKDTHYKGSEALS-RGIDYKYPHSYEGNYVEQQYLPDAIATKKYYNDPK 420
>gi|192811867|ref|ZP_03040536.1| AAA ATPase central domain protein [Geobacillus sp. Y412MC10] >gi|192799014|gb|EDV75525.1| AAA ATPase central domain protein [Geobacillus sp. Y412MC10] (435 aa)
Score = 526, Expect = 1.9e-51, Identities = 140/384 (36%), Positives = 211/384 (54%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS----AVLKEEVI---KYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT------NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENK 395
           +S DE I ++ I     ++   IE + + SIL +G PG GK+     I ++   +F   N+      D+ E++E A  +      K I+ ++E+HR N  +QD LL  +E   II +  TTENPF  VN A+ SR  L++++ +        ++  +I   K L    +K   + +E I  ++  D R+    L++        S   V   L     S+  RR T        YD+LSAFHKSIRGS   A  ++L  + + G D +   RRL A   EDIGLAN     +  +A++A    G PEA++ ++Q  +    SPKS+  + AI  A+ ++++ ++   P HLRDAHY+ AVKL   GYKYPHDY   YV+QEYLPKEL  + FY+  +   NE K
  S:    24 SSLDEYIGQEHIIGPGKLLRRAIEADQVSSILLYGPPGCGKTTLAHIISQQTKGHFVRLNAVEATVKDVREVIEQAQSNRSLYGTKTILFLDEVHRFNSSRQDALLPAVENGTIIFIGATTENPFHYVNGALMSRSTLFQLQPLTKDHSMIAMRRALIDQDKGLGFMDLKADEEALEHIAAMANGDIRRALNALELAAMTTPPDSTGTVHITLEVAEESI--RRPTVRADESTQYDVLSAFHKSIRGSSDAALFWFLYAVEKLGMDPMVFIRRLIAASSEDIGLANPQAMVQAVSALDAYRNNGWPEAKLNIAQAILFAVESPKSDGVVSAISRAMSAMDEVKSAEVPLHLRDAHYSGAVKLGHVGYKYPHDYPGHYVKQEYLPKELSRRVFYQATEQG-NEAK 424
>gi|162286716|ref|YP_001086418.2| recombination factor protein RarA [Acinetobacter baumannii ATCC 17978] >gi|193078744|gb|ABO13816.2| putative ATPase [Acinetobacter baumannii ATCC 17978] (421 aa)
Score = 525, Expect = 2.1e-51, Identities = 129/372 (34%), Positives = 217/372 (58%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV-----EAIVEISKSDFRQIFFYLKIVLKYY----QNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYK 385
             E+I +D +  + + +  MI+   L SI+F+G PGVGK+     + + +++ F   ++      +L E++  + +   P++ I+EIHR NK +QD LL  +EK  I ++  TTENP F+VN A+ SR  +Y + +++S  ++  +   L+N K  L  + +     +A+++ +  D R+    L ++   +    +N  ++ V+ ++ +   +  D+    HYDL+SAF KSIRGSDP+AA+Y++A++L+ G D + + RR+     EDIG +N            + +A+G+PEARI L Q  + L  S KSNS  +AI++A++   K A  P P HLR+A     +K    G  Y YPHDY   +V Q+YLP ELK  + Y+
  S:    17 LSEIIGQDHLLGEHAPLRQMIDQGHLPSIIFWGPPGVGKTTIALLLAQAIDRPFVSLSALNTGVKELREVIAESGDLLTPVVFIDEIHRFNKSQQDALLGAVEKGKITLIGATTENPSFEVNSALLSRCQVYTLNSLDSEAIQTLLNNALQNDKF-LKERYIHIEEYDALLQFAAGDARKALNLLDLIASTFEPEVENTINNAVVVKVAQQNIARYDKSGEQHYDLVSAFIKSIRGSDPDAALYWMARMLKGGEDPVFIARRMLIAASEDIGNSNPNALLLAGECFRSVQAVGMPEARIILGQTAVYLATSAKSNSTYLAINKALELAEKTANLPVPLHLRNAP-TKLMKQQGYGINYLYPHDYPEHFVLQDYLPPELKGTKLYE 399
>gi|150390210|ref|YP_001320259.1| recombination factor protein RarA [Alkaliphilus metalliredigens QYMF] >gi|149950072|gb|ABR48600.1| AAA ATPase, central domain protein [Alkaliphilus metalliredigens QYMF] (422 aa)
Score = 524, Expect = 2.6e-51, Identities = 134/391 (34%), Positives = 233/391 (59%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI---LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKE---EVIKYLENKK---VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
            ++++ ++ I  K+ I+   ++   + +++F+G PGVGK+     I    NK  Y  N+T  +  D+  I   L+     N  ++ ++EI   NK +Q  LL Y+E   I ++A+TTENP+  +  AI SR  ++  + +  + + E   +VIK + ++    V+   + ++ I   S  D R+    L++ +   ++++ + V   +     S        D+    HYD+LSAF KSIRG+DP+AA++YLA+L+++GDL S+ RRL  +  EDIGLA       V + V+A+  +G PEARI L+Q T+ L  +PKSNS I A+D A+  ++++ +   P  L+DAHY  A  L  +G  YKYPH Y  +Y++Q+YLP+ +KN+++Y  ++ ++ E +   Y  ++K
  S:    14 LEDVVGQEHILSKNQILNKTLQAGHITNMIFYGPPGVGKTTVANIISNMTNKKLYKLNATNASIKDIQRIVAELDSFMTMNGVLLYLDEIQNFNKKQQQSLLEYIENGKITLIASTTENPYHYIYNAILSRSTVFEFKLLTKSNVIEGLKQVIKRINDEGKTLVEYEEEALDYIATASNGDLRRAMNALELAMYAAESENKEQVFLTIHIAQESTQKKVISYDKFGDQHYDILSAFQKSIRGTDPDAAIHYLARLVKAGDLNSICRRLLVIASEDIGLAYPTAITIVKSCVDAAMQVGFPEARINLAQATLVLATAPKSNSVIEAMDRALADLDQKDIGEIPTSLKDAHYKGASDLG-RGVTYKYPHHYENNYIQQQYLPENIKNEKYYG-SQNNKMEQRIFSYLEQLK 420
>gi|183220685|ref|YP_001838681.1| putative ATPase involved in DNA replication [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189910786|ref|YP_001962341.1| helicase-like ATPase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167775462|gb|ABZ93763.1| helicase-like ATPase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167779107|gb|ABZ97405.1| Putative ATPase involved in DNA replication [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (419 aa)
Score = 524, Expect = 2.6e-51, Identities = 125/354 (35%), Positives = 200/354 (56%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE--NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK--EALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKEL--KNKEFYKPNKYSQNEN 394
           SILF+G PG GK+     + +       Y +  T+   ++ E+LE        ++ ++EIHR +  +QD LL  +E+  II++A TTENP F+VN A+ SR+L+YR+  +      +  +  LE  N    +S  V + +   S  D R++  YL+ +L +   + + I  + L +I    +   D+ + +HYD++SAF KS+RGSDP+AA++YLA +LE G D + + RRL     ED+G A+    P   A   A E +G+PE RIPL Q T  L  +PKSN++ +AI++A+  V +   +   PNHLR+A   +        GYKYPHD+   ++++ Y P+        FY+P      +N
  S:    43 SILFYGPPGTGKTTLAHLLAESWKLEKRYLSCVTSGVKEVREVLEEGKRLGTIVLFLDEIHRFSSSQQDALLSAVEEGEIILIAATTENPSFRVNKALLSRMLVYRLTTLTEEEEDQIFLSCLEKQNTNRTISETVKQELFRRSAGDARKLLGYLERIL-FATKEGEAITDERLSEILGDTLVTYDKNSESHYDIISAFIKSLRGSDPDAALFYLALMLEGGEDPLFIARRLVIFASEDVGNASVHALPLAIATWQAVERVGMPEGRIPLGQCTTFLASAPKSNASYVAINQALSYVKQRNRSFQIPNHLRNAPTVTHKNEGAGVGYKYPHDFPGHFLKERYFPESFYPNPPSFYEPTNQGMEKN 406
>gi|169794256|ref|YP_001712049.1| putative ATPase [Acinetobacter baumannii AYE] >gi|169147183|emb|CAM85042.1| putative ATPase [Acinetobacter baumannii] (421 aa)
Score = 524, Expect = 2.9e-51, Identities = 129/372 (34%), Positives = 217/372 (58%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV-----EAIVEISKSDFRQIFFYLKIVLKYY----QNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYK 385
             E+I +D +  + + +  MI+   L SI+F+G PGVGK+     + + +++ F   ++      +L E++  + +   P++ I+EIHR NK +QD LL  +EK  I ++  TTENP F+VN A+ SR  +Y + +++S  ++  +   L+N K  L  + +     +A+++ +  D R+    L ++   +    +N  ++ V+ ++ +   +  D+    HYDL+SAF KSIRGSDP+AA+Y++A++L+ G D + + RR+     EDIG +N            + +A+G+PEARI L Q  + L  S KSNS  +AI++A++   K A  P P HLR+A     +K    G  Y YPHDY   +V Q+YLP ELK  + Y+
  S:    17 LSEIIGQDHLLGEHAPLRQMIDQGHLPSIIFWGPPGVGKTTIALLLAQAIDRPFVSLSALNTGVKELREVIAESGDLLTPVVFIDEIHRFNKSQQDALLGAVEKGKITLIGATTENPSFEVNSALLSRCQVYTLNSLDSEAIQMLLNNALQNDKF-LKERYIHIEEYDALLQFAAGDARKALNLLDLIASTFEPEVENTINNAVVVKVAQQNIARYDKSGEQHYDLVSAFIKSIRGSDPDAALYWMARMLKGGEDPVFIARRMLIAASEDIGNSNPNALLLAGECFRSVQAVGMPEARIILGQTAVYLATSAKSNSTYLAINKALELAEKTANLPVPLHLRNAP-TKLMKQQGYGINYLYPHDYPEHFVLQDYLPPELKGTKLYE 399
>gi|169634881|ref|YP_001708617.1| putative ATPase [Acinetobacter baumannii SDF] >gi|169153673|emb|CAP02871.1| putative ATPase [Acinetobacter baumannii] (421 aa)
Score = 524, Expect = 3.1e-51, Identities = 129/372 (34%), Positives = 216/372 (58%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV-----EAIVEISKSDFRQIFFYLKIVLKYY----QNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYK 385
             E+I +D +  + + +  MI+   L SI+F+G PGVGK+     + + +++ F   ++      +L E++  + +   P++ I+EIHR NK +QD LL  +EK  I ++  TTENP F+VN A+ SR  +Y + +++S  ++  +   L+N K  L  + +     +A+++ +  D R+    L ++   +    +N   + V+ ++ +   +  D+    HYDL+SAF KSIRGSDP+AA+Y++A++L+ G D + + RR+     EDIG +N            + +A+G+PEARI L Q  + L  S KSNS  +AI++A++   K A  P P HLR+A     +K    G  Y YPHDY   +V Q+YLP ELK  + Y+
  S:    17 LSEIIGQDHLLGEHAPLRQMIDQGHLPSIIFWGPPGVGKTTIALLLAQAIDRPFVSLSALNTGVKELREVIAESGDLLTPVVFIDEIHRFNKSQQDALLGAVEKGKITLIGATTENPSFEVNSALLSRCQVYTLNSLDSEAIQTLLNNALQNDKF-LKERYIHIEEYDALLQFAAGDARKALNLLDLIASTFEPEVENTITNAVVVKVAQQNIARYDKSGEQHYDLVSAFIKSIRGSDPDAALYWMARMLKGGEDPVFIARRMLIAASEDIGNSNPNALLLAGECFRSVQAVGMPEARIILGQTAVYLATSAKSNSTYLAINKALELAEKTANLPVPLHLRNAP-TKLMKQQGYGINYLYPHDYPEHFVLQDYLPPELKGTKLYE 399
>gi|86135511|ref|ZP_01054092.1| putative ATPase, AAA family protein [Tenacibaculum sp. MED152] >gi|85819684|gb|EAQ40841.1| putative ATPase, AAA family protein [Polaribacter dokdonensis MED152] (423 aa)
Score = 524, Expect = 3.1e-51, Identities = 142/390 (36%), Positives = 233/390 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED------NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS----AVLKEEVIK--YLENKKVKLSNKVVEAIVEISKSDFRQIF--FYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA--LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNK 402
           + ++ I +  +     ++ N+I+   + S++ +G PG+GK+     I  + N+ FY  ++ ++   D+ E++E A +         PI+ I+EIHR +K +QD LL  +EK  + ++  TTENP F+V PA+ SR  +Y + + +     A+L+  + K   L  K +KL+    +A++ +S  D R++   F L +  + +   ++D VL ++ + T    D+    HYD++SAF KSIRGSDPNAAVYYLA+++E G D+  + RRL  +  EDIG AN       N    A   +G PE+RI LSQ  + L  S KSN++ +AI++A QS+ K+   LS P HLR+A       L+  K YKY HD+  ++ EQE+LP+E+   + Y+P   ++ EN+F +   K
  S:    13 TLEDYISQQHLVGPKGVLTNLIKQGIIPSLILWGPPGIGKTTLANIIATESNRPFYTLSAISSGVKDVREVIEKAKKSGGLFTAKNPILFIDEIHRFSKSQQDSLLGAVEKGWVTLIGATTENPSFEVIPALLSRCQVYILNSFDKNDLIALLERAIQKDDILAGKTIKLTE--TDALLRVSGGDARKLLNIFELLVSTEDHVEITNDYVLDKIQQNTTRY-DKTGEQHYDIISAFIKSIRGSDPNAAVYYLARMIEGGEDVKFIARRLLILASEDIGNANPTALILANNTFQAVAVIGNPESRIILSQCVVYLANSAKSNASYLAINKA-QSLVKQTGDLSVPLHLRNAPTKLMRDLDYGKTYKYAHDFPNNFAEQEFLPEEIAGTKLYEPGNNAR-ENQFNEILKK 415
>gi|42522441|ref|NP_967821.1| recombination factor protein RarA [Bdellovibrio bacteriovorus HD100] >gi|39574973|emb|CAE78814.1| ATPase, AAA family [Bdellovibrio bacteriovorus HD100] (449 aa)
Score = 523, Expect = 3.7e-51, Identities = 139/402 (34%), Positives = 230/402 (57%)
  Q:     7 KVLVCNSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV-----EAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVL-----KELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDY--WNKIKSNNK 408
           ++L   + D++  +       S +  M+    L S++ +G PG GK+     + +  N ++ + N+  +    L E+ E   +       K I+ ++EIHR NK +QD+LL ++EK  ++++  TTENP +++N A+ SR  +   E ++   L + ++K  E    K  +K++     + ++E S  D R++   L+I+  + +++ +  +L     +EL +      D+ +  HYD +SAF KSIRGSDP+AA+YYLA++L+ G D + + RRL  +  EDIG A+        A + A EA+GLPE  I LSQ+T  L   PKSN++ MA+ +A + V K    P P HLR A  A A  L   + YKYPH+Y   +VEQ YLP+E++    Y+P      +N   DY  W K+K + +
  S:    30 EILRPKTLDDIFGQQKTLGPQSKLGQMLRKGYLPSLIIWGPPGTGKTTFALALSQHFNAHYVHLNAVDSGAKALREVGEAGKDRRLQYQQKTILFVDEIHRFNKAQQDVLLPFVEKGDLVLVGATTENPSYELNRALLSRCRVVIFERLSEDDLNK-IVKRAETHYAKPLDKILTEDAHKNLLEYSDGDARRLINSLEILYTFTKDEVEGPLLDVNDMRELLQQNPLGYDKNSEMHYDTISAFIKSIRGSDPDAAMYYLARMLDGGEDPVFIARRLIILASEDIGNADPRAISVAIAGLQAVEAIGLPEGAITLSQVTTYLASCPKSNASYMALHKARELVEKTRTLPVPLHLRSAKTALAKDLGYGRDYKYPHNYPTGWVEQSYLPEEVEKTAIYEPTTRGFEKN-IRDYLSWMKLKKDKE 449
>gi|161760546|ref|NP_907435.2| recombination factor protein RarA [Wolinella succinogenes DSM 1740] (396 aa)
Score = 523, Expect = 4.0e-51, Identities = 133/378 (35%), Positives = 213/378 (56%)
  Q:     1 VKKFDEKVLVCNSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKEL 378
           +K+F  ++L   SF+++I ++ +F  ++ +  +IE+  L    F+G PG GK+++ + I K+L++ F  FN+TT    +L   L E      KP++ I+E+HRL+K++Q++LL  +E    I++  +TENP+F +  AIRSR +L+  + +    L+  + +  EN  + L N   + ++  S+ D R +   L       ++      LK    ++          HY+L SA  KSIRGSD NAA+YYLA+L+E G+    + RRL  +  EDIG AN        + + +   +G PEARI L+Q  I L  SPKSNSA  AI+EA++ V +KE L  P H++  H         +GY+YPHD+   +VEQ YL + L
  S:     1 MKQF-AQLLRPTSFEDLIGQEHLFGANAPLRRLIEHGSLPHAFFYGPPGTGKTSAAKIIAKRLDRPFALFNATTFKIEELRSYLKEYKNALLKPLLFIDEVHRLSKNQQEVLLPLMENHEAIIIGASTENPYFAMTGAIRSRSMLFEFKPLGKKELEILLERVCENHSILLDNSARDYLLRSSEGDARAMLNLLDCAYSLGESPLSLETLKSFRPVSLHEGSSEGDTHYNLASAMIKSIRGSDENAAIYYLARLIEGGENPEFIARRLVILASEDIGNANPQALNLATSTLLSVAKIGYPEARIILAQCIIYLSASPKSNSAYKAINEALEFVRSKERLEIPPHIKSFH---------EGYRYPHDFG-GWVEQRYLERPL 370
>gi|184159941|ref|YP_001848280.1| ATPase related to the helicase subunit of the Holliday junction resolvase [Acinetobacter baumannii ACICU] >gi|183211535|gb|ACC58933.1| ATPase related to the helicase subunit of the Holliday junction resolvase [Acinetobacter baumannii ACICU] (421 aa)
Score = 523, Expect = 4.2e-51, Identities = 128/372 (34%), Positives = 216/372 (58%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN----KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYY----QNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYK 385
             E+I +D +  + + +  MI+   L SI+F+G PGVGK+     + + +++ F   ++      +L E++  + +   P++ I+EIHR NK +QD LL  +EK  I ++  TTENP F+VN A+ SR  +Y + +++S  ++  +   L+N    K+  +  +  +A+++ +  D R+    L ++   +    +N   + V+ ++ +   +  D+    HYDL+SAF KSIRGSDP+AA+Y++A++L+ G D + + RR+     EDIG +N            + +A+G+PEARI L Q  + L  S KSNS  +AI++A++   K A  P P HLR+A     +K    G  Y YPHDY   +V Q+YLP ELK  + Y+
  S:    17 LSEIIGQDHLLGEHAPLRQMIDQGHLPSIIFWGPPGVGKTTIALLLAQAIDRPFVSLSALNTGVKELREVIAESGDLLTPVVFIDEIHRFNKSQQDALLGAVEKGKITLIGATTENPSFEVNSALLSRCQVYTLNSLDSEAIQTLLNNALQNDRFLKERYIHIEEYDALLQFAAGDARKALNLLDLIASTFEPEVENTITNAVVVKVAQQNIARYDKSGEQHYDLVSAFIKSIRGSDPDAALYWMARMLKGGEDPVFIARRMLIAASEDIGNSNPNALLLAGECFRSVQAVGMPEARIILGQTAVYLATSAKSNSTYLAINKALELAEKTANLPVPLHLRNAP-TKLMKQQGYGINYLYPHDYPEHFVLQDYLPPELKGTKLYE 399
>gi|169334179|ref|ZP_02861372.1| hypothetical protein ANASTE_00575 [Anaerofustis stercorihominis DSM 17244] >gi|169258896|gb|EDS72862.1| hypothetical protein ANASTE_00575 [Anaerofustis stercorihominis DSM 17244] (482 aa)
Score = 523, Expect = 4.2e-51, Identities = 142/382 (37%), Positives = 219/382 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSN-------KVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGK--ITNSLIDRRAT------NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNEN 394
           + DE   ++ I  +  ++  MIE + + SI+ FG  G GK+   + I  K +  FY  N+ T    D+ EI+E     L  E  K I+ I+EIHR NK +QD LL  +E   II++  TTENPFF++N  + SR  L++++ I    +++ +   L+NK+  L N       + ++ +  +S  D R     L+  L Y     D+  + +L K  I   +  ++ T       HYD +SAF KS+RGSDP+AAVYYLA++L +G D   + RR+     EDIG AN        +   A E +G+PE RI L+     L  SPKSN++ MAI++A+  + N+     P H+R+A+Y       +  GYKYPHD+   YV+Q+YLP E+K + +Y+P +     N
  S:    70 NLDEFFGQEHIVGEGKLLNRMIEADRISSIILFGPAGCGKTTLARIIANKTSSYFYSLNAVTCGVKDVREIIENAKANLGMERKKSILFIDEIHRFNKSQQDALLPSVEDGTIILIGATTENPFFEINSPLISRSTLFKLKKIEKEDVRKIIENTLKNKERGLGNYDIQIDEEAIDYLSLMSSGDARVSLNALE--LAYLTTPKDENGVIKLNKDIIAECMQKKKVTYDKGDNEHYDTISAFIKSMRGSDPDAAVYYLAKMLYAGEDPKFIARRMIIFASEDIGNANIKALDLAVSTFKAVEVIGMPEVRINLAHCVTYLASSPKSNASYMAINKAMSDIENEPNYEVPLHIRNANYKGEKDFGIGVGYKYPHDFENDYVKQDYLPDEIKGRVYYEPKENGAEGN 472
>gi|121535958|ref|ZP_01667752.1| AAA ATPase, central domain protein [Thermosinus carboxydivorans Nor1] >gi|121305450|gb|EAX46398.1| AAA ATPase, central domain protein [Thermosinus carboxydivorans Nor1] (446 aa)
Score = 523, Expect = 4.2e-51, Identities = 128/376 (34%), Positives = 212/376 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI-----------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           S DE + +  +      +  M++   L S+L FG PG GK+     I      +F   N+      D+ + +E A E       + I+ I+EIHR NK +QD LL ++E   II++  TTENP+F+VN  + SR+ + +++ ++   + + +++ L +++     ++      +     R      +I L   +  +  +     G+IT +++           D+   +HYD++SAF KS+RGSDP+AA++YLA++LE+G+ ++ + RRL     ED+G A+       NAA  A   +GLPEARI L+Q    +  +PKSN+A +AI++A+  V  K     P HLRDAHY  A  L + +GY YPHDY   +V Q++LP  L    +Y+P +
  S:    26 SLDEFVGQQHLVGPGRFLRRMLKAGTLPSLLLFGPPGTGKTTLAYLIANAAGCHFEKLNAVAAGVADVRKQVEAAQERLKLYGQRTILFIDEIHRFNKGQQDALLPFVEDGTIILIGATTENPYFEVNSPLLSRMRITKLQPLSEEEIVQILVRALTDERGLGDRRLAWDEGALGHYCPRLPAAMPRIALNILEQAAWQLEETGEGRITAAVLETVMGEKIHRYDKSGDSHYDVISAFIKSLRGSDPDAALHYLARMLEAGEDVNFIARRLVISAAEDVGNADPQALIIANAAAQAVHFIGLPEARIILAQAVTYIACAPKSNAAYLAIEQALADVRGKNYGEVPLHLRDAHYRGAKALGHGQGYLYPHDYPGGWVRQQHLPAPLAGTVYYRPGQ 420
>gi|196191424|gb|EDX86388.1| ATPase, AAA family protein [Synechococcus sp. PCC 7335] (742 aa)
Score = 521, Expect = 6.8e-51, Identities = 125/375 (33%), Positives = 210/375 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN-----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           S  E I +D I     ++   IE + L S++F+G PG GK+   + I       F   N+      D+   +E A         + I+ ++E+HR NK +QD LL ++E   +I++  TTENPFF+VN A+ SR  +++++ +N+  L+  V + L + +       + +    +  +V ++  D R +   L++ ++   +  D  +   L    +S      L D+    H+D +SAF KS+RGSDP+AA+Y+LA+++ +G D   ++RRL  +  ED+G+A+      V     A + +G+PE R PL+Q T+ L  +PKSNS +MA  +A+ +V  E     PN +RDA        +  GY YPH Y   +V Q+YLP  L+ + FY+P+
  S:    26 SLIEFIGQDAIVGPGRLLRRAIEADQLSSLIFYGPPGTGKTTLAKVIANTTMAQFVAINAVLGGVKDIRFAIEQAQTHRGQFGRRTILFVDEVHRFNKAQQDALLPWVENGTVILIGATTENPFFEVNKALVSRSRVFQLKPLNADDLEAIVQQALSDSERGYGKQDILIDTDALNHLVNVANGDARTVLNALELAVETTSSDRDGKLRITLAVAEDSVQQRAVLYDKEGDAHFDTISAFIKSVRGSDPDAALYWLARMVYAGEDPRYIFRRLVILAGEDVGMADPNAVVVVTGCAAAFDRVGMPEGRYPLAQATLYLATAPKSNS-VMAFFDALAAVKDEREGDVPNAMRDATRDKKGFGHGAGYLYPHAYRDHWVAQQYLPGSLQGQVFYQPS 419
>gi|146298174|ref|YP_001192765.1| recombination factor protein RarA [Flavobacterium johnsoniae UW101] >gi|146152592|gb|ABQ03446.1| AAA ATPase, central domain protein [Flavobacterium johnsoniae UW101] (425 aa)
Score = 520, Expect = 7.3e-51, Identities = 138/355 (38%), Positives = 206/355 (58%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED------NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKE------EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKE-----LGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYS-QNENK 395
           S++F+G PG GK+   Q I ++  + FY  ++  +   D+ +++E A +         PI+ I+EIHR +K +QD LL  +EK  I ++  TTENP F+V PA+ SR  +Y +       L+       ++ K L +K + L  K  EA++ +S  D R++    ++V+    + SD+IV+       L +    L D+    HYD++SAF KSIRGSDPN AVY+LA+++E G D+  + RR+  +  EDIG AN       N    A   +G PE+RI LSQ  I L  SPKSN++ MAI  A Q V +    P P HLR+A      +L   + YKY HDY  ++ EQE+LP  +K    Y P   S +N N+
  S:    41 SLIFWGPPGTGKTTLAQIIAQESKRPFYELSAINSGVKDIRDVIEKAKQSGGLFTAKNPILFIDEIHRFSKSQQDSLLAAVEKGWITLIGATTENPSFEVIPALLSRSQVYILNAFTKDDLEALLHRAIKIDKELSSKNITL--KETEALLRLSGGDGRKLLNIFELVVN--ASASDEIVITNDRVLALVQQNTVLYDKTGEQHYDIVSAFIKSIRGSDPNGAVYWLARMIEGGEDVKFIARRMLILSSEDIGNANPTAFIMANNTFQAVSTIGYPESRIILSQCAIYLATSPKSNASYMAIGNAQQLVKQTGDLPVPIHLRNAPTKLMKELGYGEDYKYSHDYANNFAEQEFLPDAIKETVLYNPGSNSRENSNR 412
>gi|83856549|ref|ZP_00950078.1| putative ATPase, AAA family protein [Croceibacter atlanticus HTCC2559] >gi|83850349|gb|EAP88217.1| putative ATPase, AAA family protein [Croceibacter atlanticus HTCC2559] (425 aa)
Score = 520, Expect = 8.8e-51, Identities = 143/374 (38%), Positives = 223/374 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN------KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLY---------RIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNK----SDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA--LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S D  I +  +  +D  +   I+   L S++F+G PGVGK+     I  + ++ FY  ++  +   D+ E++E A + +       P++ I+EIHR +K +QD LL  +EK  + ++  TTENP F+V PA+ SR  +Y          ++ IN A++++    Y+  K ++L  K  EA++ +S  D R++    ++++    ++    ++D VLK + + T  L D+    HYD++SAF KSIRGSDPNAAVY+LA+++E G D+  + RRL  +  EDIG AN       N    A   +G PEARI LSQ  I L  S KSN++ MAI +A QS+ K+   L  P  LR+A      +L   K YKY HDY  ++V+  +LP+ELK    +KP
  S:    13 SLDSYISQKHLVGQDGSLSKQIKAGVLPSLIFWGPPGVGKTTLANIIANESDRPFYSLSAINSGVKDVREVIEKAKKSDGLFSSKNPLLFIDEIHRFSKSQQDSLLGAVEKGWVTLIGATTENPSFEVIPALLSRCQVYVLKPFSKEDLLQLINKAIIED---PYISKKNIEL--KETEALLRLSGGDARKLLNIFELLVNTSASEKVVITNDFVLKNVQQNT-VLYDKTGEQHYDIISAFIKSIRGSDPNAAVYWLARMVEGGEDVKFIARRLIILASEDIGNANPTALVIANNTFQAVTTIGYPEARIILSQCVIYLATSAKSNASYMAIKKA-QSLIKQTGNLPVPLELRNAPTQLMKELGYSKSYKYAHDYEGNFVQANFLPEELKGTVLFKP 402
>gi|120403620|ref|YP_953449.1| recombination factor protein RarA [Mycobacterium vanbaalenii PYR-1] >gi|119956438|gb|ABM13443.1| Recombination protein MgsA [Mycobacterium vanbaalenii PYR-1] (429 aa)
Score = 519, Expect = 1.1e-50, Identities = 118/377 (31%), Positives = 217/377 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-----KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKY 389
           S DE++ +  +   +S +  +IE +   S++ +G PG GK+     I +   + F   ++      ++  ++++A + +    + ++ I+E+HR +K +QD LL  +E  +++++A TTENP F V   + SR L+ +++ +    +   + + +E+      KV ++++ V+ +V++S  D R+    L++  +  +  + +++ + L K      DR    HYD++SAF KS+RGSD +AA++YLA++L +G D   V RRL  +  EDIG+A+    P   AA    + +G+PEA++ L+  T+ L  +PKSN+   A+  A+  +   +A   P HLRD HY+ A K+ N  GYKY HD     V Q+Y P +L   ++Y+P  +
  S:    21 SLDEVVGQGHLLKPNSPLRRLIEGSGAASVILYGPPGTGKTTLASMISQATGRRFEALSALAAGVKEVRAVIDVARQASMRGEQTVLFIDEVHRFSKTQQDALLAAVENRVVLLVAATTENPSFSVVAPLLSRSLILQLQPLTPEDVTTVIRRAIEDPRGLGGKVAVTDEAVDQLVQLSAGDARRALTALEVASESGEEVTVEVIEQSLDKAAVRY-DRDGDQHYDVVSAFIKSVRGSDVDAALHYLARMLVAGEDPRFVARRLMILASEDIGMADPTALPTAVAAAQTVQLIGMPEAQLTLAHATVHLATAPKSNAVTTALGAAMADIRAGKAGLVPAHLRDGHYSGAQKMGNAVGYKYAHDSPDGVVPQQYPPDDLVGVDYYRPTNH 408
>gi|171677199|ref|XP_001903551.1| unnamed protein product [Podospora anserina] >gi|170936667|emb|CAP61326.1| unnamed protein product [Podospora anserina] (570 aa)
Score = 518, Expect = 1.2e-50, Identities = 129/372 (34%), Positives = 218/372 (58%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-ELATEDN----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIV------------------LKYYQNKSDDIVLKELGK--ITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK---EALSPPNHLRDAHYASAVKLNVKG-YKYPHDYNFSYVEQEYLPKELKNKEF 383
           +S D++  +D++ P + ++ ++IE + + S++ +G  G GK+   + I +++   F   N+T+    ++ +   E A E N    K II  +EIHR +K +QD+ L  +E   I ++  TTENP FKV  A+ SR   + + ++    L+  +++ ++ +       +VE  +E+S     ++  YL                         Q   +  + K+  K  +T +L+ DR    HYD +SAFHK++RGSD +AA+YYLA++L+SG D + + RR+  +  ED+GLA++ L P   A   A++ +G+PEARIPL+  T+ LCL+PKS  A  A++ A  ++ +    +L  P HLR+A       L     YKYP +Y    V QEYLP+EL+ + F
  S:   158 DSLDDVFGQDLVGP-NGVLRSLIETDRVPSMILWGGSGTGKTTIARCIARRVGSRFIELNATSTGVAEVKKFFAEAANELNLTGRKTIIFCDEIHRFSKSQQDVFLKPVEAGTITLIGATTENPSFKVQAALLSRCRTFTLASLTREDLQRILVRAIQAE-------IVEEGIELSPLIDEELLTYLSAFADGDARTALNLLELALSLTTRPQGGGEAPLTKDDIKAALTKTLVYDRAGDQHYDTISAFHKAVRGSDSDAALYYLARMLQSGEDPLFIARRMVVIASEDVGLADNSLLPLATATYTATQQIGMPEARIPLAHCTVALCLAPKSTRAYRALNNAFSALREPGVASLPVPLHLRNAPTRLMKDLGYGAEYKYPPNYKDGKVRQEYLPEELRGRRF 552
>gi|145224348|ref|YP_001135026.1| recombination factor protein RarA [Mycobacterium gilvum PYR-GCK] >gi|145216834|gb|ABP46238.1| Recombination protein MgsA [Mycobacterium gilvum PYR-GCK] (446 aa)
Score = 518, Expect = 1.5e-50, Identities = 117/377 (31%), Positives = 215/377 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-----KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL---IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKY 389
           + DE++ +D +   +S +  +IE +   S++ +G PG GK+     I +   + F   ++      ++  ++++A +      + ++ I+E+HR +K +QD LL  +E  +++++A TTENP F V   + SR L+ +++ +  A +   + + + ++     +V +S+  +E +V +S  D R+    L++  +      + + ++ + +  +      DR    HYD++SAF KS+RGSD +AA++YLA++L +G D   V RRL  +  EDIG+A+        AA    + +G+PEA++ L+Q T+ L  +PKSN+   A+  A+  +   +A   P HLRD HY+ A KL N  GYKY HD+      Q+Y P EL   ++Y+P  +
  S:    34 NLDEVVGQDHLLKPNSPLRRLIEGSGAASVILYGPPGTGKTTLASMISQATGRRFEALSALAAGVKEVRAVIDVARQAAVRGEQTVLFIDEVHRFSKTQQDALLAAVENRVVLLVAATTENPSFSVVAPLLSRSLILQLQPLTPADVTTVIRRAITDERGLGGRVTVSDDAIEQLVLLSAGDARRALTALEVATETVSESGETVTVEVIEQSLDKAALRYDRDGDQHYDVVSAFIKSVRGSDVDAALHYLARMLVAGEDPRFVARRLMILASEDIGMADPTALQIAVAAAQTVQLIGMPEAQLTLAQATVHLATAPKSNAVTTALGAAMADIRAGKAGQVPAHLRDGHYSGAQKLGNAVGYKYAHDHPGGVASQQYPPDELVGTDYYRPTNH 425
>gi|139436949|ref|ZP_01771109.1| Hypothetical protein COLAER_00082 [Collinsella aerofaciens ATCC 25986] >gi|133776596|gb|EBA40416.1| Hypothetical protein COLAER_00082 [Collinsella aerofaciens ATCC 25986] (454 aa)
Score = 517, Expect = 1.9e-50, Identities = 128/375 (34%), Positives = 209/375 (55%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE-----NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDD-------------IVLKELGKITNS----LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           NS DE + +     K S +   IE++ L S++ +G  G GK+     I       F   ++ T    DL  +++     L T D + I+ I+EIHR +K +QD LL  +E   +I++  TTENP+F+VN A+ SR  +  +E++    +   + + LE     N K        + I  ++  D R     L++  +    + D              I + ++ KI N       D+    HYD++SAF KS+RGSDP+A VY+LA+++++G D   + RR+     ED+G A+       +AA  ++E +G PE RI L+Q  + +CL+PKSN+   +ID A+  ++   L   P++LRD H   + +  V  YKYPHDY   +V+Q YLP+ L+   F++P
  S:    31 NSLDEYVGQQKAVGKGSWLRAAIEHDVLSSVILYGPAGTGKTTLAHIIANHTKSEFVEVSAVTGTVKDLRRVIDEAKTRLNTYDRRTILFIDEIHRFSKSQQDALLHAVENRTVIMIGATTENPYFEVNSALLSRGRVVELEHLKDEDIATLIERALEAPQGLNGKFSADEDTAKTICTLAAGDARSALTTLELASEIAVTRPDTEGTPAPAAGERYPITVDDV-KIANPRRGFTYDKNGDMHYDIISAFIKSMRGSDPDATVYWLARMIDAGEDPKFIARRIMIHASEDVGNADPQALLVAHAAFKSAEVIGYPECRINLAQAALYVCLAPKSNACEASIDAALADIHSSGLREVPSYLRDRHRPGSDEYGV--YKYPHDYPEGWVDQRYLPEGLERGAFWQP 431
>gi|160945075|ref|ZP_02092301.1| hypothetical protein FAEPRAM212_02594 [Faecalibacterium prausnitzii M21/2] >gi|158442806|gb|EDP19811.1| hypothetical protein FAEPRAM212_02594 [Faecalibacterium prausnitzii M21/2] (424 aa)
Score = 517, Expect = 2.1e-50, Identities = 135/373 (36%), Positives = 208/373 (55%)
  Q:    34 IENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYL------ENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKY--YQNKSDDIVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYK--PNKYSQNENKFVDYWNKIKSN 406
           IE+  + +++F+G  G GK+   + I +      +  N T+    D+  +L+    LA      ++ ++EI  LNK +Q  LL  +E   + ++A+TTENP+F +  A+ SR  ++  + + +A ++  V   +      E   V +       + E +  D R+    L   +     +N    I L  + ++T       DR   +HYD++SA+ KS+RGSDP+AA++YLA+LLE+GDL S  RRL     ED+GLA   + P V AAV+A+  +GLPEAR+PL+   I +  SPKSNSA  AI+ AI  V      P P  L++ H+     L VKG  YKY H Y   +V+Q+YLP  LK+ ++Y    NK  Q       YW KIK +
  S:    34 IESGRIPNMIFYGPSGTGKTTVARIIAENSGMTLHKLNGTSCGTGDIKAVLKDIGTLAAAGGI-LLYLDEIQYLNKKQQQSLLECIEDGSVTLIASTTENPYFYIYNALLSRCTVFEFKPLAAADVERGVRNAVQRLSEGEQVPVCMDEDACAYLAESAGGDLRKALGCLDFAVTAAPVENGEKRITLDMIRQVTRRTAMRYDREGDDHYDIVSAYQKSMRGSDPDAALHYLARLLEAGDLPSACRRLMVCACEDVGLAYPQIIPIVKAAVDAANMVGLPEARLPLADAVILVATSPKSNSAHDAINAAIADVQAGRTGPIPRQLQNKHFDGEDAL-VKGQNYKYAHSYANHWVQQQYLPDVLKDTKYYTFGDNKTEQAARA---YWAKIKGD 421
>gi|58337368|ref|YP_193953.1| recombination factor protein RarA [Lactobacillus acidophilus NCFM] >gi|58254685|gb|AAV42922.1| chromosome segregation helicase [Lactobacillus acidophilus NCFM] (429 aa)
Score = 517, Expect = 2.1e-50, Identities = 134/387 (34%), Positives = 204/387 (52%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG-----YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDY 399
           +  EM+ ++ +  K   +  +I+ + L S+L +G PG GK+     + + L   F  FN++  NK+ L ++++    D   +++++EIHRL K  QD LL YLE   ++++ TTTENP   + PAIRSR  ++    I +  ++  +IK  E      L  K   AI      D R     L  +   +        ++E  +  +   D+ AT HYD LSAF  SI GSD +AA+YYLA +L+SGDL SV RRL  +   D+GLA+S    +V    N +  +GLP A   L+  TI L ++P+S+SA+ A  +A +     A  P P +L+D HY  A KL   G     +  PH+       QEYLPK+L  K +Y P +    E  +  Y
  S:    15 TLGEMVGQNHLLAKGKPLYQIIKEHILLSLLLWGPPGCGKTTLAYVMSQTLRLPFEKFNASIQNKSQLQKLIQ-KHPDESFVLLLDEIHRLTKPIQDYLLPYLENGHVLLVGTTTENPIMSIQPAIRSRCQIFEFYPIKAEDIELVLIKAAEEHLNFDLPKKQAHAIANSGNGDVRVSLNILDTLNAMHPQNISMANIEEFARNQHFAFDKDATKHYDYLSAFQDSIEGSDADAALYYLAVILKSGDLESVVRRLKDLAALDVGLADSARVAQVITLANTALEIGLPRASTHLAMATILLAVAPRSDSAMQAYYQAAKDAEHPADHPMPKYLQDYHYKGAGKLRGAGEMQNMFDLPHN----IARQEYLPKDLVGKHYYVPAQNKAEEKLYSQY 403
>gi|189460834|ref|ZP_03009619.1| hypothetical protein BACCOP_01481 [Bacteroides coprocola DSM 17136] >gi|189432408|gb|EDV01393.1| hypothetical protein BACCOP_01481 [Bacteroides coprocola DSM 17136] (424 aa)
Score = 516, Expect = 2.1e-50, Identities = 137/388 (35%), Positives = 230/388 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSA--------VLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNK----SDDIVLKELGKITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK---YSQNENKFVDYW 400
           + D+ I +  +  + +++  MI++  + S + +G PGVGK+   Q I  +L   FY  ++ T+   D+ ++++ A  +       PI+ I+EIHR +K +QD LL  +E  ++ ++  TTENP F+V   + SR  LY ++++            +  +VI  L+ K+V+L  +  +A++  S  D R++   L++V++   N     +DD V++ L +  N L  D+    HYD++SAF KSIRGSDP+ A+Y+LA+++E G D   + RRL     EDIGLAN       NAA +A   +G PE RIPL++ T+ L  SPKSNSA   I+ A++ V +    P P HLR+A      +L   K YKY H Y  ++V+Q++LP E+ +   +   +    ++ +++ V  W
  S:    13 TLDDYIGQKHLVGEGAVLRRMIDSGRISSFILWGPPGVGKTTLAQIIANRLETPFYTLSAVTSGVKDVRDVIDKARSNRFFSQQSPILFIDEIHRFSKSQQDSLLGAVETGVVTLIGATTENPSFEVIRPLLSRCQLYVLKSLEKDDLLELLHHAITTDVI--LKEKQVEL--RETDAMLRYSGGDARKLLNILELVVEADDNVPVVITDDKVVERLQQ--NPLAYDKDGEMHYDIISAFIKSIRGSDPDGALYWLARMVEGGEDPAFIARRLVISASEDIGLANPNALLLANAAFDAVMKIGWPEGRIPLAEATVYLATSPKSNSAYEGINSALELVRQTGNLPVPLHLRNAPTKLMKQLGYGKEYKYAHAYKGNFVKQQFLPDEVCHNRLWHAQENPSEAKLKDRMVQLW 418
>gi|91200409|emb|CAJ73456.1| similar to ATPase related to the helicase subunit of the Holliday junction resolvase [Candidatus Kuenenia stuttgartiensis] (478 aa)
Score = 515, Expect = 2.9e-50, Identities = 128/376 (34%), Positives = 214/376 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI------VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           +  E + ++ +  +  I+ + IEN +L S++F+G PGVGK+     I   +N +F  F++  +   ++  ++E A E       + ++ ++EIHR NK +QD  L ++E   I ++  TTENP F+VN  + SR  +  +E +  + +   ++  L ++       K+++   V++ I E S  + R     L+  +   +    DI      +  E  +    L D+    HY+++SAF KS+RGSDP+AA+Y+LA++LE+G D + + RR+     EDIG A+        +  +A   +G+PE  IPL+Q    L  +PKSN++ MA   AI+ V +  AL  P H+R+A       +   K YKYPH +   YVEQ YLPKEL +KE+Y P +
  S:    59 NLSEFVGQEHLVGEGKILRSFIENKELVSLIFWGPPGVGKTTLALIIANAMNAHFITFSAVLSGVKEIRAVIEEAKEQLKFNGKRTVLFVDEIHRFNKAQQDSFLHHVEDGTITLIGATTENPSFEVNSPLLSRCKVLVLEPLRKSHITAILLNALSDRESGLGGQKIEIPQDVIDFIAEFSHGEARAALNTLETAIMLVRPNEKDIRPVTMEIAMEAMQRKALLYDKGGEEHYNVISAFIKSMRGSDPDAALYWLARMLEAGEDPLFIVRRMVIFAAEDIGNADPAALQLAVSVKDAFHFVGMPEGWIPLAQGVTYLACAPKSNASYMAYLAAIKDVRERGALPAPMHVRNAPTTLMKGMGYGKDYKYPHSFG-GYVEQSYLPKELDSKEYYHPTQ 454
>gi|150020062|ref|YP_001305416.1| recombination factor protein RarA [Thermosipho melanesiensis BI429] >gi|149792583|gb|ABR30031.1| AAA ATPase, central domain protein [Thermosipho melanesiensis BI429] (410 aa)
Score = 515, Expect = 2.9e-50, Identities = 137/387 (35%), Positives = 223/387 (57%)
  Q:     7 KVLVCNSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN---KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATN--HYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNVK--GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           ++L    F+E I ++ +F +  +I   IE+ +LFS +F+G PG GK+++++ I KK +   Y+FN+   +  D+ ++L+ A +     K +I ++EIHR NK +QD+ L  +E+   I +  TTENPF  +NPA+ SR+ +   + +    +K+ + + +  K + +   V++ I  IS  D R       ++    +    +IV  E+  +    +    T+  HY+L SAF KSIRGSDP+AA+YY+A++LE G D   + RRL  +  ED+GLA+        A   A E +GLPE  + LS+  I L L+PKSNS+ +AI +AI+S  +   LS P +L          LNVK  GYK PH Y   ++++ YLPK + +K FY P +  + +
  S:     6 EILRPKGFEEFIGQEHLFGEKGLIRLAIESGNLFSAVFYGPPGCGKTSTLEIIRKKTDFEIYHFNAAVTSTIDVKKVLDYAQKVKGLKKMLIFVDEIHRFNKKQQDIFLPGIERGDYIFIGATTENPFKMINPALLSRIKVIAFKKLKVFEIKKLLERAISVKNIDVMESVMDFITRISDGDARFAINIYDVLSDMAKALGKEIVDDEIVTLYGGEVKMVYTSKEHYELASAFIKSIRGSDPDAALYYMARMLEVGEDPRFIARRLAILASEDVGLADPMAILIAIATAQAVELVGLPECVLNLSECVIYLSLAPKSNSSTLAISKAIESARETMNLSVPFNL----------LNVKDSGYKNPHHYG-GFLKKSYLPKGISDKVFYIPKEIGKEK 390
>gi|51244885|ref|YP_064769.1| recombination factor protein RarA [Desulfotalea psychrophila LSv54] >gi|50875922|emb|CAG35762.1| probable uncharacterized ATPase related to the helicase subunit of the Holliday junction resolvase [Desulfotalea psychrophila LSv54] (440 aa)
Score = 515, Expect = 3.4e-50, Identities = 127/392 (32%), Positives = 220/392 (56%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN--KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS--LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIKS 405
            +E+  ++ +  K SI+ +MIE +D  S + +G PG GK+   +FI       F   ++      ++  ++E     L  E  K ++ ++EIHR NK +QD  L Y+E   I++L  TTENP F+V  A+ SR  ++ ++ ++   +K  + + L+   +++ +S++ +  + E S  D R+   +L+ V +         + K +  I+      D+R   H++L+SA  KSIRGSDP AA+Y+LA++LESG D + + RRL  +  ED+GLA+     +  A  +A   LG+PEA   ++Q+ I L  +PKSN   +A  +A +   K      P  + +A      +L   K Y+Y HDY  SY  Q Y P+E++ +E+YKP+   + ++  K +D+W  +K+
  S:    28 LEEIHGQNKLLEKGSILRSMIEQDDYSSFILWGPPGTGKTTIARFIETHTKHIFASLSAVLTKIAEVKALMEQARFRLQAEGQKTLVFVDEIHRFNKSQQDAFLPYVESGAIVLLGATTENPSFEVISALLSRCHVFTLQPLSIEDIKSIMTRALKEIPREIHISDQALTMLAEKSGGDGRKALNHLETVARSGATGDSIDIEKAIQAISQRSLFYDKRGEEHFNLISALQKSIRGSDPQAAIYWLARMLESGEDPMYITRRLVRIATEDVGLADPQALVQAVACKDAVHFLGMPEANTVMTQLVIYLATAPKSNRVEIAYLQAREDALKTGQHKVPLDICNAPTRLMAELGYKKNYRYSHDYENSYSYQRYFPEEMEEQEYYKPSSFGFEKDIQKRLDWWQALKA 433
>gi|37521678|ref|NP_925055.1| fused recombination factor protein RarA/unknown domain-containing protein [Gloeobacter violaceus PCC 7421] >gi|35212676|dbj|BAC90050.1| glr2109 [Gloeobacter violaceus PCC 7421] (747 aa)
Score = 514, Expect = 4.1e-50, Identities = 125/374 (33%), Positives = 212/374 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN-------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S D+ + +  I     ++   I+ + L S++F+G PG GK+   + I      +F   N+      D+ E ++ A         + I+ ++E+HR NK +QD LL ++E   I+++  TTENPFF+VN A+ SR  L++++ + S  L+   ++ L +       + V+L  + +  +V+++  D R +   L++ ++      D  +   L     S      L D+    H+D +SA+ KS+RGSDP+AA+Y+LA+++ +G+    ++RRL     ED+GLA+      V A   A + +G+PE R  L+Q T+ L  +PKSNSA MA  +A+ +V  E  S  PN L+DA+       +  GY YPH Y   +V Q+YLP  L+ + FY+P
  S:    39 SLDQFVGQGHIVGPGRLLRRAIQADQLSSLIFYGPPGTGKTTLARIIAGTTRAHFIAINAVLAGVKDIREAIDEAKSRRGQFGRRTILFVDEVHRFNKSQQDALLPWIENGTIVLVGATTENPFFEVNKALVSRSRLFQLKLLESEDLRAVALQALADTERGYGKRNVRLDPEALAHLVDVAGGDARTLLNALELAVETTPADGDGAIRITLPVAEESIQRRAVLYDKEGDVHFDTISAYIKSLRGSDPDAALYWLARMIYAGEEPRFIFRRLLIQASEDVGLADPQALAVVVACAEAFDRVGMPEGRYHLAQATLYLATAPKSNSA-MAFFDALAAVEGERASDIPNPLKDANRDKEGFGHGAGYLYPHAYRDHWVAQQYLPTSLQGQLFYQP 431
>gi|118045611|ref|ZP_01514269.1| AAA ATPase, central region [Chloroflexus aggregans DSM 9485] >gi|117997846|gb|EAV12029.1| AAA ATPase, central region [Chloroflexus aggregans DSM 9485] (485 aa)
Score = 514, Expect = 4.2e-50, Identities = 123/374 (32%), Positives = 206/374 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + DE + +  I  +  ++   I N+ LFS++ +G PG GK+   Q I    N +F   ++ +   NDL  +++ A +       + ++ I+EIHR NK +QD +L Y+E   II++  TTENP F+VN A+ SR  ++ +E +    +   + + L ++       K+ L++   + ++ +S  D R     L+   +       +  L  +  I ++L       D+R   HYD +SA HKS+R SDP+ A+Y+L ++L+ G D + + RRL  +  ED+GLA+    P+  AA  A   LG PE  + L Q  + LCL+PKSN+   A +   + V +    P P HLR+A      +L   +GY+Y HD      +QE+LP  L  + +Y+P
  S:    33 TLDEFVGQTHIIGEGKLLRRAIANDQLFSLILWGPPGSGKTTLAQIIANSTNAHFEPLSAVSAGVNDLRRVVQEAKDRLGMFQQRTVVFIDEIHRFNKSQQDAILPYVEDGTIILIGATTENPSFEVNAALLSRARVFTLEALTDEEIGILIDRALSDRERGLGGMKIMLASDARKYLINMSNGDARTALNALEAAARSKPPAIGETRLITVDDIRDALQSRAVRYDKRGELHYDAISALHKSVRDSDPDGALYWLGRMLDGGEDPLYIARRLVRIAVEDVGLADPQALPQTIAAQQAVHFLGQPEGELALVQAVVYLCLAPKSNALYRAYNAVQRDVAETRNEPVPLHLRNAPTELMKRLGYGRGYEYAHDLPEGRSDQEHLPPNLVGRIYYEP 427
>gi|46580096|ref|YP_010904.1| recombination factor protein RarA [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120602446|ref|YP_966846.1| recombination factor protein RarA [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|46449512|gb|AAS96163.1| ATPase, AAA family [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120562675|gb|ABM28419.1| Recombination protein MgsA [Desulfovibrio vulgaris subsp. vulgaris DP4] (411 aa)
Score = 513, Expect = 5.5e-50, Identities = 131/372 (35%), Positives = 198/372 (53%)
  Q:    33 MIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           ++  N L S+L FG PG GKS     + K  + N    ++       L + L         I++++E+HR +K +QD  L  LE   I +LATTTENP F V   + SRL + R+  +  A L E   +    ++V++ + V++ +  +S  D R +   L+ V    ++K D   ++       S  D+   NHY+L SA  KSIRGSDP+AA+YYLA LLE G D   V RRL     ED+GLA+    P   A + A E +G+PE  IP++Q T+ L L+ KSNS   A   A + +  +     P HLR+       +    KGY+YPH Y   ++EQEYLP+ L+++ FY P +  + E +   +W K++
  S:    32 LLRANRLPSLLLFGPPGCGKSTLALLLAKARSANVLRLSAPEAGLQHLRKQLH-----GVDILVLDELHRFSKAQQDFFLPLLESGDITMLATTTENPSFSVTRQLLSRLHVLRLRPLGRAELLELGRRGAVAQEVQIEDDVLDLLASMSHGDARTMLNLLEYVAALPEDKRDIEGVRSAMPEIVSRHDKDGDNHYELASALIKSIRGSDPDAALYYLACLLEGGEDPRFVCRRLILSASEDVGLADPQALPLAVACMQAVEYVGMPEGFIPMAQTTVHLALARKSNSTYAAYINAARELKTQGRKGVPLHLRNPSTRLQKEWGYGKGYRYPHSYPEGWIEQEYLPEGLEDRRFYAPRENGE-EPRLSAWWRKLQ 400
>gi|118473523|ref|YP_887339.1| recombination factor protein RarA [Mycobacterium smegmatis str. MC2 155] >gi|118174810|gb|ABK75706.1| AAA ATPase, central region [Mycobacterium smegmatis str. MC2 155] (447 aa)
Score = 513, Expect = 5.9e-50, Identities = 118/373 (31%), Positives = 215/373 (57%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-----KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV--NKEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
            DE++ +  +    S +  ++E +   S++ +G PG GK+     I +   + F   ++ T    ++  +++ A        + ++ I+E+HR +K +QD LL  +E  +++++A TTENP F V   + SR L+ +++ +  A ++  + + + ++     +V+++++ V+ IV++S  D R+    L++  +  +  + + + + L K      DR    HYD++SAF KS+RGSD +AA++YLA++L +G D   V RRL  +  EDIG+A+        AA    + +G+PEA++ L+  T+ L  +PKSN+   A+  A+  +   K  L PP HLRD HY+ A KL +  GY+Y HD+    V Q+Y P EL   ++Y+P
  S:    40 LDEVVGQSHLLQAGSPLRRLVEGSGAASVILYGPPGTGKTTLASLISQATGRRFEALSALTAGVKEVRAVIDTARRAAVHGQQTVLFIDEVHRFSKTQQDALLAAVENRVVLLVAATTENPSFSVVAPLLSRSLILQLQPLTPADIEAVLRRAITDERGLGGRVEVTDEAVDLIVQLSAGDARRALTALEVAAEPGERVTVETIEQSLDKAAVRY-DRDGDQHYDVVSAFIKSVRGSDVDAALHYLARMLVAGEDPRFVARRLMILASEDIGMADPTALQTAVAAAQTVQLIGMPEAQLTLAHATVHLATAPKSNAVTTALGAAMNDIRAGKAGLVPP-HLRDGHYSGAAKLGHAVGYRYSHDHPDGVVAQQYPPDELVGVDYYQP 423
>gi|19552845|ref|NP_600847.1| recombination factor protein RarA [Corynebacterium glutamicum ATCC 13032] >gi|21324402|dbj|BAB99026.1| Uncharacterized ATPase related to the helicase subunit of the Holliday junction resolvase [Corynebacterium glutamicum ATCC 13032] (459 aa)
Score = 512, Expect = 7.8e-50, Identities = 129/392 (32%), Positives = 230/392 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI--DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEAL-SPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           + DE++ +  +  +   +  +IE +   S++ +G PG GK+     I       F   ++ ++   ++  ++E A  D     + ++ I+E+HR +K +QD LL  +E   ++++A TTENP F V   + SR LL ++E+++   +K  + K LE+++     +  +++ V+ +V ++  D R+   Y++   +  ++     +   +  +  +++  DR    HYD++SA+ KSIRGSD +AA++YLA+++++G D   + RRL     EDIG+A+        AA  A + +G+PEARI L+Q TI L L+PKSN+ IMA+D A+  V +  + + P HLRD HY  A KL N  GY YPHD     V QEYLP+ L+++ +Y+P  +   E +  +Y  +++
  S:    48 TLDEVVGQQHLLGEGRPLRRLIEGSGDASVILYGPPGTGKTTIASLISAAAGDRFVAMSALSSGVKEVRAVIERARMDLQLGQRTVLFIDEVHRFSKTQQDALLSAVENRTVLLVAATTENPSFSVVSPLLSRSLLLQLESLSDEDIKTVLNKALEDERGLAGRITATDEAVDQLVLLAGGDARRGLTYIEAAAEAVEDGGVLDIDTVMANVNRAVVRYDRDGDQHYDVVSAWIKSIRGSDVDAALHYLARMIDAGEDPRFIARRLVVHSSEDIGMADPSAMQVAIAAAQAVQLIGMPEARINLAQATIHLALAPKSNAVIMAMDAALTDVQQGHIGTVPAHLRDGHYEGAKKLGNAVGYSYPHDDPRGVVRQEYLPENLRDRVYYEPTTHG-GEKRIAEYIGRLR 452
>gi|62390516|ref|YP_225918.1| recombination factor protein RarA [Corynebacterium glutamicum ATCC 13032] >gi|145295755|ref|YP_001138576.1| recombination factor protein RarA [Corynebacterium glutamicum R] >gi|41325853|emb|CAF21642.1| Uncharacterized ATPase related to the helicase subunit of the Holliday junction resolvase [Corynebacterium glutamicum ATCC 13032] >gi|140845675|dbj|BAF54674.1| hypothetical protein [Corynebacterium glutamicum R] (472 aa)
Score = 511, Expect = 8.1e-50, Identities = 129/392 (32%), Positives = 230/392 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI--DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEAL-SPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           + DE++ +  +  +   +  +IE +   S++ +G PG GK+     I       F   ++ ++   ++  ++E A  D     + ++ I+E+HR +K +QD LL  +E   ++++A TTENP F V   + SR LL ++E+++   +K  + K LE+++     +  +++ V+ +V ++  D R+   Y++   +  ++     +   +  +  +++  DR    HYD++SA+ KSIRGSD +AA++YLA+++++G D   + RRL     EDIG+A+        AA  A + +G+PEARI L+Q TI L L+PKSN+ IMA+D A+  V +  + + P HLRD HY  A KL N  GY YPHD     V QEYLP+ L+++ +Y+P  +   E +  +Y  +++
  S:    61 TLDEVVGQQHLLGEGRPLRRLIEGSGDASVILYGPPGTGKTTIASLISAAAGDRFVAMSALSSGVKEVRAVIERARMDLQLGQRTVLFIDEVHRFSKTQQDALLSAVENRTVLLVAATTENPSFSVVSPLLSRSLLLQLESLSDEDIKTVLNKALEDERGLAGRITATDEAVDQLVLLAGGDARRGLTYIEAAAEAVEDGGVLDIDTVMANVNRAVVRYDRDGDQHYDVVSAWIKSIRGSDVDAALHYLARMIDAGEDPRFIARRLVVHSSEDIGMADPSAMQVAIAAAQAVQLIGMPEARINLAQATIHLALAPKSNAVIMAMDAALTDVQQGHIGTVPAHLRDGHYEGAKKLGNAVGYSYPHDDPRGVVRQEYLPENLRDRVYYEPTTHG-GEKRIAEYIGRLR 465
>gi|54025615|ref|YP_119857.1| recombination factor protein RarA [Nocardia farcinica IFM 10152] >gi|54017123|dbj|BAD58493.1| putative AAA ATPase [Nocardia farcinica IFM 10152] (451 aa)
Score = 511, Expect = 8.2e-50, Identities = 122/377 (32%), Positives = 215/377 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI--DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKY 389
           S +E++ +  +    S +  +IE +   S+L FG PG GK+     I +   + F   ++ +    ++  +++LA    T   + ++ I+E+HR +K +QD LL  +E  +++++  TTENP F V   + SR L+ ++ ++  A ++  + + L + +      ++++  ++ IV I+  D R+    L+   +   +   D+ L E   +  + +  DR    HYD++SAF KSIRGSD +AA++YLA++L +G D   + RRL     EDIG+A+        AA +  + +G+PEA++ L+  TI L  +PKS +   A+  A+  ++  +A + P HLRD HYA A KL N +GYKYPHD     + Q+Y P EL   ++Y+P  +
  S:    42 SLEEVVGQQHLLGPGSPLRRLIEGSGAASVLLFGPPGTGKTTLASLISQATGRRFEALSALSAGVKEVRAVIDLARRRLTAGERTVLFIDEVHRFSKTQQDALLAAVENRIVLLVGATTENPSFSVVSPLLSRSLVLQLRSLTDADIRTVLDRALADPRGFGGAYQVTDAALDHIVRIAGGDARRALTALEASAESSLDGVVDLDLVE-ASVDRAAVRYDRAGDQHYDVVSAFIKSIRGSDVDAALHYLARMLSAGEDPRFIARRLVISASEDIGMADPSALQTAVAAAHVVQLIGMPEAQLTLTHATIHLATAPKSGAVPAALGAAMADISAGKAGAVPPHLRDGHYAGAAKLGNAQGYKYPHDDPDGVLAQQYPPDELVGADYYRPTDH 431
>gi|124520547|ref|ZP_01695677.1| AAA ATPase, central region [Bacillus coagulans 36D1] >gi|124497503|gb|EAY45061.1| AAA ATPase, central region [Bacillus coagulans 36D1] (442 aa)
Score = 511, Expect = 8.4e-50, Identities = 131/374 (35%), Positives = 217/374 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLK--ELGKITNS---LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAI----DEAIQSVNKEALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + DE + +  +  K  ++  MIE++ L S++F+G PGVGK+   + I  +    F  F++ T+   D+  +++ A E      K I+ ++EIHR NK +QD  L Y+E   II++  TTENP F+VN A+ SR  ++ +  + S+ + E + + + N      +K+++ ++ + AI E S  D R     L++ +     + D I+++  +L ++ N    L D+    HY+++SA HKS+R SD NAAVY+L+++LE+G D + + RRL     EDIGLA++       +   A + +G+PE  + L+Q  I L L+PKSNSA +A      +A+ S+N+     P HLR+A       LN  KGYKY HD        + +P  L    +Y P
  S:    25 NLDEFVGQKHLIGKGKVLREMIEHDRLSSMIFWGPPGVGKTTLAKIIANQTQSEFINFSAVTSGIKDIRNVMKEAEERRQLGEKTILFLDEIHRFNKAQQDAFLPYVENGSIILIGATTENPSFEVNSALLSRTKVFVLHKLTSSEIVELLKQAIVNPHGYGLQKIEIEDQTLLAIAEFSDGDARTALNTLEMAVLNGHKQEDTIIIRKEDLSQMINRKSLLYDKNGEEHYNIISALHKSMRNSDVNAAVYWLSRMLEAGEDPLFIARRLVRFASEDIGLADNRALEIAVSVFQACQFIGMPECNVHLTQAVIYLSLAPKSNSAYLAYMSAKKDALNSMNEPV---PLHLRNAPTKLMKDLNYGKGYKYAHDTEEKLTTMQTMPDSLAGHAYYHP 416
>gi|72162480|ref|YP_290137.1| recombination factor protein RarA [Thermobifida fusca YX] >gi|71916212|gb|AAZ56114.1| Recombination protein MgsA [Thermobifida fusca YX] (441 aa)
Score = 511, Expect = 8.5e-50, Identities = 132/392 (33%), Positives = 219/392 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV--LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           + DE++ +  +  + S +  ++E++   ++L +G PG GK+     + +   + F   ++ T+   D+ +++     EL       ++ ++E+HR +K +QD LL  +E   +  +  TTENPFF V   + SR LL  +   +   ++  V + L +++       L+ + +  +V ++  D R+   YL+       ++++  V  ++     T    DR    HYD++SAF KS+RGSD +AA++YLA+++E+G D   + RRL     ED+G+A+        AA  A E +GLPEARI L+Q  I + L+PKSN+ I AID AI  V    L P P HLRD+HY  A  L +  GY+YPHDY    V Q YLP+ L   E+Y+P  +   E +F +   +IK
  S:    28 TLDEVVGQRHLLGEGSPLRRLVEDDAPMALLLWGPPGTGKTTLATVVSRATRRRFVELSAVTSGVKDIRDVVDEARRELGMRGVHTLLFVDEVHRFSKTQQDALLPAVENRWVSFIGATTENPFFSVISPLLSRSLLLTLHAHSDDDIRTVVRRALTDERGLAGRYTLTEEALHHLVRLAGGDARRSLTYLEAAALVAGDRTEITVADVERAADRTAVRYDRSGDQHYDVVSAFIKSMRGSDVDAALHYLARMIEAGEDPRFIARRLVVHASEDVGMADPTALQAAVAAAQAVELVGLPEARINLAQAVIHIALAPKSNAVITAIDRAISDVRAGKLGPVPAHLRDSHYRGAADLGHGAGYRYPHDYPGGVVAQRYLPEGLDGAEYYRPTTHGA-ERRFGEVLRRIK 433
>gi|85110657|ref|XP_963567.1| hypothetical protein NCU08706 [Neurospora crassa OR74A] >gi|9453819|emb|CAB99387.1| conserved hypothetical protein [Neurospora crassa] >gi|28925252|gb|EAA34331.1| hypothetical protein NCU08706 [Neurospora crassa OR74A] (622 aa)
Score = 511, Expect = 9.0e-50, Identities = 129/371 (34%), Positives = 220/371 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE----NKKVKLS----NKVVEAIVEISKSDFR------QIFFYLKIVLKYYQNKSDDIVLKELGK--ITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK---EALSPPNHLRDAHYASAVKLNVKG-YKYPHDYNFSYVEQEYLPKELKNKEF 383
           S D++  +D++ P + ++  +IE + + S++ +G  G GK+   + I ++    F   N+T++   +  +       EL     + II  +EIHR  K +QD+ L  +E   I ++  TTENP FKV PA+ SR   + ++ ++   L+  +++ L+    ++ + LS    ++++  +   +  D R      ++   L        +  D+ + KE  K  +T +L+ DR +  HYD +SAFHKSIRGSDP+A++YYLA++L+SG D + + RRL  +  ED+GLA++ L P   A   A++ +G+PEARIPL+  T+ LCL+PKS  A   ++ A  ++ +    AL  P HLR+A      ++     YKYP +Y    V+Q YLP EL  ++F
  S:   188 SLDDVFGQDLVGP-NGVLRALIETDRVPSMILWGGSGTGKTTIARCIAQRTGSRFIELNATSSGVAECKKYFGEAANELHLTGRRTIIFCDEIHRFTKAQQDIFLKPVEAGTITLIGATTENPSFKVVPALLSRCRTFTLQPLSRDDLQRILLRALKQEITDQHLPLSPLIDDELLSYLCAFADGDARTALNLLELALSLTTTTTTTTSSPDEPLTKESIKASLTKTLVYDRASDQHYDTISAFHKSIRGSDPDASLYYLARMLQSGEDPLFIARRLVVIASEDVGLADNSLLPLATATYTATQQIGMPEARIPLAHCTVALCLAPKSTRAYRGLNNAFSALREPGVAALPVPLHLRNAPTRLMKEMGYGAEYKYPPNYRNGRVKQSYLPGELVGRKF 584
>gi|163725458|ref|ZP_02132981.1| AAA ATPase, central domain protein [Desulfatibacillum alkenivorans AK-01] >gi|161401340|gb|EDQ25585.1| AAA ATPase, central domain protein [Desulfatibacillum alkenivorans AK-01] (441 aa)
Score = 511, Expect = 1.0e-49, Identities = 129/396 (32%), Positives = 220/396 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIF--FYLKIVLKYYQNKSDDIVLKE------LGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG-YKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIKSNNK 408
           + DE I ++ +  +  I+   +E++ LFS++F+G PG GK+   + +       F   ++  +    + E++E A +       K I+ ++EIHR NK +QD  L ++E  +I ++  TTENP F+V   + SR  +  ++ ++S  +K  +   +++++       V L  + +E + + +  D R+      L + L     +   +V  E        K  N   D+    H+D++SA HKS+RGSDP+AAVY+L ++L +G D + V RR+     ED+G A+        AAV + + LG PE  + L Q  + L  +PKSN+A MA+  A + +++    P P H+R+A      +L     YKYPHDY  +YV +EY+P+ L+   FY+P    Y     K +D+W+ IK N K
  S:    20 TLDEFIGQEAVVGEGGIVRRAVESDHLFSMIFWGPPGCGKTTLARIMANASQSYFMQISAVGSGVKQIREVVEEAKDRRNFHAQKSILFVDEIHRFNKAQQDGFLPHVESGIITLIGATTENPSFEVISPLLSRCRVVVLKPLSSDDMKTVIQNAVQDEEKGLGMYDVSLEEEALENLAQGADGDARKALNTLELAVFLARPDEEGRRVVTAEHVAQAWQKKQLN--YDKGGDQHFDIISALHKSLRGSDPDAAVYWLMRMLSAGEDPLYVARRMVRFASEDVGNADPHALVICMAAVQSYQFLGSPEGELALVQACLYLATAPKSNAAYMALKAAKKKISQTGAKPVPMHIRNAPTGLMKELGYGAEYKYPHDYEGAYVPEEYMPEGLEGTSFYRPTPRGYESVIKKRMDHWSGIKKNKK 438
>gi|169189989|ref|ZP_02849975.1| AAA ATPase central domain protein [Paenibacillus sp. JDR-2] >gi|169003349|gb|EDS50219.1| AAA ATPase central domain protein [Paenibacillus sp. JDR-2] (436 aa)
Score = 510, Expect = 1.1e-49, Identities = 129/373 (34%), Positives = 202/373 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN-----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKL-------SNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV--LKELGK--ITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYK 385
           + D+ I ++ I     ++   IE + + SIL +G PG GK+     I K+    F   N+   +  D+ E+++ A  +      K I+ ++E+HR N  +QD LL  +E+ +II +  TTENPF  VN A+ SR  L+++E +N     E + + L +K   L         + ++ I  ++  D R+    L++      ++ D  V    E+ +  I    +    +  YD+LSAFHKSIRGS   A  ++L  + + G D ++  RRL     EDIGLAN     +   A++A   +G PEA+  ++Q  +    SPKSN+A +AI +A+  +     +  P HLRD HY  A +L  +GYKYPHDY   YV Q+YLP  LK    YK
  S:    25 TLDDYIGQEHIIGAGKLLRRAIEGDQVSSILLYGPPGCGKTTLANIISKRTAGEFVKLNAVDASVKDVREVIDTAKTNKLMYGKKTILFLDEVHRFNTSRQDALLPAVEQGIIIFIGATTENPFHHVNGALLSRSTLFQLEPLNEKHALEAMKRALTDKDRGLGFMTLHAEEEALQHIAAMAGGDIRRALNALELAAVTTPSEPDGSVRITMEVAQESIRKPTVRADTSTQYDVLSAFHKSIRGSSDAALFWFLYAVEKLGMDPMTFLRRLIVACSEDIGLANPQAMVQAVTAMDAYHKIGWPEAKYNIAQAILFAVESPKSNAAAVAIGKAMSVIEGAGQAEVPLHLRDTHYKGAQQLGHEGYKYPHDYPGHYVNQQYLPDNLKGVTIYK 415
>gi|39997165|ref|NP_953116.1| recombination factor protein RarA [Geobacter sulfurreducens PCA] >gi|39984055|gb|AAR35443.1| ATPase, AAA family [Geobacter sulfurreducens PCA] (440 aa)
Score = 510, Expect = 1.1e-49, Identities = 128/397 (32%), Positives = 221/397 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK-----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEA-------IVEISKSDFRQIFFYLKIVLKYYQNKSDDI-VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKSNNKQ 409
           + DE + ++ +  +  ++  +IE++ L S++F+G PG GK+   + I      +F +F++  +   ++ EI++ A E+ K      I+ ++EIHR NK +QD  L Y+E+    ++  TTENP F+V   + SR  +  +  ++   +++ +   L + +  L    + A       + E S  D R     L+   +  +N   D+  ++E  +    L D+    HY+++SAF KS+RGSDP+ A+Y+LA+++E+G D + + RR+  +  EDIG A+        AA+   + +G+PE RI ++Q    L  +PKSN++   ID A+  V K  AL  P H+R+A       L   KGYKY HDY   Y  Q YLP+ L+ K FY P  + Y +   + +DY   +K N+ +
  S:    26 TLDEYVGQEHLLGEGKLLRRLIESDTLTSLIFWGPPGSGKTTLARVIANATKSHFIFFSAILSGIKEIREIVKEAEEEKKYRGRNTILFVDEIHRFNKSQQDAFLPYVERGTFTIIGATTENPSFEVVAPLLSRCKVLVLNPLSQENVEQILRSALADPERGLGASGLAADDDALAFMAEQSGGDGRVALNTLETAARLVKNGRIDLESVREAIQKKPLLYDKGGEEHYNVISAFIKSMRGSDPDGALYWLARMIEAGEDPLFILRRMVILASEDIGNADPRALQVAVAALQGFQLVGMPEGRIIIAQAATYLATAPKSNASYAGIDAALAEVRKSGALPVPLHIRNAPTRLMKDLGYHKGYKYAHDYEAGYTPQNYLPERLEGKRFYAPRGHGYEKTIKERMDYIRTLKENDSE 440
>gi|118580657|ref|YP_901907.1| recombination factor protein RarA [Pelobacter propionicus DSM 2379] >gi|118503367|gb|ABK99849.1| Recombination protein MgsA [Pelobacter propionicus DSM 2379] (448 aa)
Score = 510, Expect = 1.3e-49, Identities = 124/397 (31%), Positives = 223/397 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNK--SDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNEN--KFVDYWNKIKSNNKQ 409
           +  E   ++ +  +D I+  MIE + L S++F+G PG GK+     I ++   +F +F++  +   ++ EI      +A+   + I+ ++EIHR NK +QD  L Y+EK ++ ++  TTENP F+V   + SR  +  ++ +  + +   + + L +++       + +S + ++ +   +  D R     L++     + +  S + V + L K    L D+R   HY+++SAF KS+R SDP+AA+Y+LA++LE+G D + + RR+  +  EDIG A+        +A+ A + +G+PE RI ++Q    L  +PKSN++ + ID  +  V K   L  P H+R+A       L   KGY+Y HDY   Y  Q  LP EL  + FY+P  Y   ++  + +++  +IK   K+
  S:    35 TLTEFTGQEHLVGEDRILRRMIETDTLSSLIFWGPPGCGKTTLAHVIARETRAHFIFFSAILSGIKEIREIFREAEGVASRGRRTILFVDEIHRFNKSQQDAFLPYVEKGVVTMIGATTENPSFEVIAPLLSRCRVLTLKQLEPSTIAGLIGQALADRERGLGELGLDISEEGLDFLSRQAGGDARVALNTLEVAAGLARERLISLETVQEALQK-KALLYDKRGEEHYNVISAFIKSMRASDPDAALYWLARMLEAGEDPVFILRRMIILASEDIGNADPRALQLAVSALQAFQVIGMPEGRIIMAQAVTYLATAPKSNASYLGIDATLAEVRKSGGLGVPMHIRNAPTTLMKDLGYGKGYQYAHDYAEGYAGQPCLPDELAGRTFYEPKGYGYEKSIVERMEWLKRIKEERKK 448
>gi|152977760|ref|YP_001343389.1| recombination factor protein RarA [Actinobacillus succinogenes 130Z] >gi|150839483|gb|ABR73454.1| AAA ATPase central domain protein [Actinobacillus succinogenes 130Z] (439 aa)
Score = 509, Expect = 1.5e-49, Identities = 128/380 (33%), Positives = 220/380 (57%)
  Q:    29 IIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK----------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKE------LGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-----PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNK 408
           ++  +IEN+ + S++F+G PGVGK+   Q I       F  F++ T+   D+  I++ A ++     K I+ ++EIHR NK +QD  L ++EK  I+++  TTENP F++N A+ SR  ++ ++ + +A    +++K L+            +V + + ++E +   +  D R     L++V+   +++ + + + E      L + T  L D++   HY+L+SA HKS+R SD +AAVY+LA++LE+G D + V RR+     ED+GLA+        AA  A   +G+PE  + L+Q  + L L+PKSN    AID A     K+AL+      P H+R+A      +L+  KGY++ H Y       + LP  L  +E+Y+P +    E +F +   +IK   K
  S:    40 VLRRLIENDQISSMIFWGPPGVGKTTLAQIIANSTQAGFIEFSAVTSGIKDIRAIMQQAEQNRRYGAKTIVFVDEIHRFNKAQQDAFLPFVEKGSIVLIGATTENPSFEINGALLSRCKVFVLQPLETA----DIVKLLQRALTAPKGFGHLRVNMQSDMLEVLANFANGDARSALSTLEMVVLNGEHQGNAVTVTEETLSQCLSRKT-LLYDKKGEEHYNLISALHKSMRNSDADAAVYWLARMLEAGEDPLYVARRITRFASEDVGLADPRALEICIAAYQACHFIGMPECSVHLTQAVVYLSLAPKSN----AIDMAYHQARKDALTQLADPVPLHIRNAPTKLMKELDYGKGYEFAHHYEDKLTTMQCLPDSLLGREYYRPTEQGL-EGRFKNRLAEIKQWKK 436
>gi|148652069|ref|YP_001279162.1| recombination factor protein RarA [Psychrobacter sp. PRwf-1] >gi|148571153|gb|ABQ93212.1| Recombination protein MgsA [Psychrobacter sp. PRwf-1] (439 aa)
Score = 509, Expect = 1.6e-49, Identities = 129/394 (32%), Positives = 219/394 (55%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK-------PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN----KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS-----DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNV-----KGYKYPHDYNFSYVEQEYLPKELKNKEFYK--PNKYSQNENKFVDYWN-KIKSNN 407
            DE+I +  +    + I   +E+  L S++  G  G+GK+     +   + + FY  ++       L E+L+  +   +       P++ I+EIHR NK +QD LL  +E   I ++  TTENP F VN A+ SR  +YR++ ++   + E + + L       ++ +  + +  I  +++ D R+    L++ ++   +       DD +L  + + T    D+    HYD++SA  KS+RGSDP+AA+Y++A++L +G+    + RRL  +  EDIG AN       +AA+ + +A+G+PEARI L Q+ + L  S KSNS  +AI++A+Q   ++    P HLR+       KL       +GY YPHDY   Y  Q+YLP  L    FY+   N+  Q+  +F+ +   +  SNN
  S:    24 LDEVIGQTHLLAPGAPIQRFVEHGHLPSLILHGEAGIGKTTIAMLLADAVGRPFYPLSAINTGVKQLREVLDAGSSSGQGGLDFASPVVFIDEIHRFNKAQQDALLGAVESGDITLIGATTENPSFSVNNALLSRCQVYRLQPLDDTQIGELLQRALSQDEFLSQLSIDLQALPQIANLAQGDARKALNLLEMAVQASDHSKQPIVIDDALLSSVAQTTLQRYDKDGDQHYDIISAMIKSVRGSDPDAALYWMARMLVAGEPPEFIARRLVILASEDIGNANPNALLLADAALRSVKAIGMPEARIILGQVVVYLATSAKSNSTYLAINKAMQLAQQDQSPVPMHLRNG----VTKLMQSQGYGEGYIYPHDYPNHYQPQQYLPDNLVGTRFYEYADNQREQHSLQFMQWLQTQTPSNN 438
>gi|120437189|ref|YP_862875.1| recombination factor protein RarA [Gramella forsetii KT0803] >gi|117579339|emb|CAL67808.1| AAA family ATPase [Gramella forsetii KT0803] (424 aa)
Score = 508, Expect = 2.1e-49, Identities = 139/390 (35%), Positives = 226/390 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED------NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYL-----ENKKVKLSN---KVVEAIVEISKSDFRQIFFYLKIVLKYYQNK---SDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNK 402
           + ++ + +  +  K+  +   I+   + S++F+G PGVGK+     I  +  + F+  ++ ++   D+ E++E A +         PI+ I+EIHR +K +QD LL  +EK  + ++  TTENP F+V  A+ SR  +Y ++  +    KE++I  L     E+K +   N   K  EA++ +S  D R++    ++++   +     ++D+VL ++ + T  L D+    HYD++SAF KSIRGSDPNAAVY+LA+++E G D+  + RRL  +  EDIG AN       N +  A   +G PEARI LSQ    L  SPKSN+A  AI+EA   V K   LS P  +R+A       +   K YKY H++  ++V  E++P E++N   YKP   +Q EN   ++  K
  S:    13 TLEDYLSQQHLIGKNGALKQQIQQGIIPSMIFWGPPGVGKTTLANIIATESGRPFFTLSAISSGVKDVREVIEKAKKSEGLFTTKSPILFIDEIHRFSKSQQDSLLGAVEKGWVTLIGATTENPSFEVISALLSRCQVYILKPFS----KEDLIALLQRAIKEDKSIASKNVKLKETEALLRLSGGDARKLLNIFELLVTSAEKNVEITNDLVLSKVQQNT-VLYDKTGEQHYDIISAFIKSIRGSDPNAAVYWLARMIEGGEDVKFIARRLLILASEDIGNANPTALVIANNSFQAVNTIGYPEARIILSQCVTYLATSPKSNAAYKAINEAQSLVKKTGNLSVPLAIRNAPTKLMKDIGYGKDYKYAHNHEGNFVAAEFMPDEVRNTTLYKPGN-NQRENAQREFLRK 416
>gi|160936225|ref|ZP_02083598.1| hypothetical protein CLOBOL_01121 [Clostridium bolteae ATCC BAA-613] >gi|158441035|gb|EDP18759.1| hypothetical protein CLOBOL_01121 [Clostridium bolteae ATCC BAA-613] (438 aa)
Score = 507, Expect = 2.6e-49, Identities = 128/382 (33%), Positives = 212/382 (55%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKI-----VLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEA---IQSVNKEAL------SPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           +  D  + ++ +  K  ++  +IE + + S++F+G PGVGK+     I K+ N  F  F++ T+   ++ E++  A        K ++ ++EIHR NK +QD  L Y+EK  II++  TTENP F++N A+ SR  ++ ++ +    L   +   L++ K      V++++ +++ I   +  D R     L++     V+   +    + VLK+     + L D++   HY+L+SA HKS+R SDP+AAVY+LA++LE+G D + V RRL     EDIG+A+S       +A  A   LG+PE  + LS   I L ++PKSNSA MA + A    Q++  E +      +P   ++D HY         GY Y HD        + LP  L  +E+Y P      E
  S:    23 DDLDGFVGQEHLLGKGKLLRQLIEQDKIPSMIFWGPPGVGKTTLAGIIAKRTNAQFINFSAVTSGIKEIKEVMVQAENSRRMGIKTLLFVDEIHRFNKAQQDAFLPYVEKGSIILIGATTENPSFEINSALLSRCRVFVLQALTENDLARLIKTALKSPKGLGYLNVEITDPMIDMIAGFANGDARTALNTLEMAVTNGVISPDKTTVTEDVLKQCIGKKSLLYDKKGEEHYNLISALHKSMRNSDPDAAVYWLARMLEAGEDPLYVARRLVRFASEDIGMADSQALTLAVSAYQACHFLGMPECNVHLSHTVIYLSMAPKSNSAYMAYESARTDAQNMLAEPVPLTIRNAPTGLMKDLHYGD-------GYVYAHDTEEKIARMQCLPDSLAGREYYHPTDQGAEE 422
>gi|88803489|ref|ZP_01119014.1| putative AAA family ATPase protein [Polaribacter irgensii 23-P] >gi|88780501|gb|EAR11681.1| putative AAA family ATPase protein [Polaribacter irgensii 23-P] (423 aa)
Score = 507, Expect = 2.7e-49, Identities = 138/376 (36%), Positives = 222/376 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED------NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVI----------KYLENKKVKLSNKVVEAIVEISKSDFRQIF--FYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNVKG-YKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           + ++ + +  +  ++ I+  +I+   + S++ +G PG+GK+     I    N+ FY  ++ ++   D+ +++E A +         PI+ I+EIHR +K +QD LL  +EK  + ++  TTENP F+V PA+ SR  +Y + + +    KEE+I           +L +KK+ L  K  EA++++S  D R++   F L + +      ++++VL ++ K T +  D+    HYD++SAF KSIRGSDPNAAVY+LA+++E G D+  + RR+  +  EDIG AN       N    A   +G PE+RI LSQ  I L  S KSN++ +AI  A + V +   LS P +LR+A       L+    YKY HDY  S+V QE+LPK L   + Y P K
  S:    13 TLEDYVSQQHLVGENGILTKLIKQGIIPSLILWGPPGIGKTTLANIIATTSNRPFYTLSAISSGVKDVRDVIEKAKKSGGLFTAKNPILFIDEIHRFSKSQQDSLLGAVEKGWVTLIGATTENPSFEVIPALLSRCQIYILNSFD----KEELIALLHRAMEKDAFLSSKKIIL--KETEALLQVSGGDARKLLNIFELLVSVDDEVVITNELVLSKIQKNT-ARYDKSGPQHYDIVSAFIKSIRGSDPNAAVYWLARMIEGGEDVKFIARRMLILASEDIGNANPTALIMANNTFQAVAIVGNPESRIILSQCAIYLSNSAKSNASYLAIGAAQKLVQETGDLSVPLNLRNAPTKLMKDLDYGADYKYSHDYPNSFVAQEFLPKTLSGNKIYTPGK 402
>gi|167039928|ref|YP_001662913.1| recombination factor protein RarA [Thermoanaerobacter sp. X514] >gi|166854168|gb|ABY92577.1| AAA ATPase, central domain protein [Thermoanaerobacter sp. X514] (443 aa)
Score = 506, Expect = 3.1e-49, Identities = 133/374 (35%), Positives = 222/374 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSA---VLKEEVIKYLENK----KVKLSNKVVEAIVEISKSDFRQIFFYLKI------VLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + DE + ++ +  K  ++  +IE +++ S++ +G PGVGK+     I    N  F  F++  +   ++ EI+  A  D     + ++ I+EIHR NK +QD  L ++EK  II++  TTENP F+VN A+ SR  ++ ++ +      +L +  +K  +N     K+ ++++ ++ I   +  D R     L+I      V++  +  +DDI+   + K T  L D++   HY+L+SAFHKS+R SD +AAVY+LA++LE+G D + V RR+     EDIGLA+        AA NA   +G+PE  + L+Q+ I L L+PKSN+  +A ++A +   K  A S P HLR+A      +L   KGYKY HD+     + + LP  LK++++Y P
  S:    27 TLDEFVGQEHLLGKGKLLRELIEKDNITSMILWGPPGVGKTTLAMIIANMTNSKFVTFSAVLSGIKEIKEIMAKAELDAMYGTRTVVFIDEIHRFNKAQQDAFLPHVEKGNIILIGATTENPSFEVNSALLSRSKVFVMKPLTEEDLLILLKRALKDEQNGFGMYKIGITDEQLKKIALFANGDARVALNTLEIAVMGAKVIEGERIVTDDILADAMQKKT-LLYDKQGEEHYNLISAFHKSLRNSDWDAAVYWLARMLEAGEDPLYVARRMIRFASEDIGLADPQALEMAVAAYNACHYIGMPECSVNLAQVAIYLALAPKSNAVYVAYNKAKKDAEKTIAESVPMHLRNAPTKLMKELGYGKGYKYAHDFEEKVTDMQCLPDNLKDRKYYVP 419
>gi|86132532|ref|ZP_01051125.1| putative AAA family ATPase protein [Cellulophaga sp. MED134] >gi|85816774|gb|EAQ37959.1| putative AAA family ATPase protein [Dokdonia donghaensis MED134] (425 aa)
Score = 506, Expect = 3.4e-49, Identities = 131/353 (37%), Positives = 209/353 (59%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED------NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIEN---------INSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKE--LGKITNSLI--DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           S++ +G PG+GK+     I ++  + FY  ++  +   D+ E+++ A +         PI+ I+EIHR +K +QD LL  +E+  + ++  TTENP F+V PA+ SR  +Y ++          +N A+  +E++K     K  ++    EA++ +S  D R++    ++++   +N  D +V  +  L K+  +++  D+    HYD++SAF KSIRGSDPNAAVY+LA+++E G D+  + RRL     EDIG AN       N    A   +G PEARI LSQ    L  SPKSN+A MAI +A Q V +   LS P  LR+A      ++     YKY HDY  ++V+QE+LPKE+     Y+P   ++ +
  S:    41 SLILWGPPGIGKTTLATIIAEESKRPFYTLSAINSGVKDIREVIDKAKQSGGLFTQKNPILFIDEIHRFSKSQQDSLLGAVERGWVTLVGATTENPSFEVIPALLSRCQVYILKPFEKKDLILLLNRAINTDEILK-----KKNITLLETEALLRLSGGDARKLLNIFELIVTT-ENDKDVVVTNDMVLSKVQQNIVRYDKTGEQHYDIISAFIKSIRGSDPNAAVYWLARMIEGGEDVKFIARRLIIAAAEDIGNANPTALVIANNCFQAVTTIGYPEARIILSQCVTYLASSPKSNAAYMAIGKAQQLVKQTGDLSVPLPLRNAPTKLMKEIGYGNDYKYSHDYPGNFVQQEFLPKEISGTTLYEPTDNTREK 409
>gi|34483337|emb|CAE10335.1| conserved hypothetical protein [Wolinella succinogenes] (365 aa)
Score = 505, Expect = 5.0e-49, Identities = 127/346 (36%), Positives = 193/346 (55%)
  Q:    33 MIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKEL 378
           MIE+  L    F+G PG GK+++ + I K+L++ F  FN+TT    +L   L E      KP++ I+E+HRL+K++Q++LL  +E    I++  +TENP+F +  AIRSR +L+  + +    L+  + +  EN  + L N   + ++  S+ D R +   L       ++      LK    ++          HY+L SA  KSIRGSD NAA+YYLA+L+E G+    + RRL  +  EDIG AN        + + +   +G PEARI L+Q  I L  SPKSNSA  AI+EA++ V +KE L  P H++  H         +GY+YPHD+   +VEQ YL + L
  S:     1 MIEHGSLPHAFFYGPPGTGKTSAAKIIAKRLDRPFALFNATTFKIEELRSYLKEYKNALLKPLLFIDEVHRLSKNQQEVLLPLMENHEAIIIGASTENPYFAMTGAIRSRSMLFEFKPLGKKELEILLERVCENHSILLDNSARDYLLRSSEGDARAMLNLLDCAYSLGESPLSLETLKSFRPVSLHEGSSEGDTHYNLASAMIKSIRGSDENAAIYYLARLIEGGENPEFIARRLVILASEDIGNANPQALNLATSTLLSVAKIGYPEARIILAQCIIYLSASPKSNSAYKAINEALEFVRSKERLEIPPHIKSFH---------EGYRYPHDFG-GWVEQRYLERPL 339
>gi|171911243|ref|ZP_02926713.1| ATPase, AAA family protein [Verrucomicrobium spinosum DSM 4136] (466 aa)
Score = 505, Expect = 5.1e-49, Identities = 137/397 (34%), Positives = 220/397 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK-----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIEN---------INSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANS-GLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKSNNKQ 409
           S DE + ++ I  +  ++   I  +   S++F+G PGVGK+     I  + +  F   +   +N  ++  + + A ++ +      ++ ++EIHR NK +QD+LL +LE+  +  +  TT NPFF +N  + SR  ++ +E          I+ A+  EE  + L    V+++ +    +  +   D R+    L++        +D  V   L     S      + D     HYD +SAF KSIRGSDP+AA+Y+LA++L +G D+  + RRL     EDIG+A+S GL   V AA +A+E +G+PEA   L+  T+ L  +PKSN   +AI +A+  V N   L  P HLRD HY  A +  + +GYKY HDY   YV Q YLP E + + +Y P  N       + ++YW K    +K+
  S:    47 SMDEYVGQEHILGEGKLLRRAIMADRFSSLIFYGPPGVGKTTLATIISNETHSRFVTLSGVESNVAEIRMVADAAEKEERLNGIGTVLFVDEIHRFNKSQQDVLLPHLERGSLRFIGATTHNPFFYINSPLVSRSQVFTLEPLTVEHLERLIDQAIADEE--RGLGKLHVEITPEAKRHLAVVCDGDGRKCLNALELAALTTPAGADGKVHIHLAVAEESVQQKTVVYDGDGDAHYDTISAFIKSIRGSDPDAAIYWLAKMLYAGEDIRFLCRRLVISASEDIGMADSNGLRVAV-AAQHAAEFIGMPEAAHILAHCTVYLATAPKSNRTTVAIGKAMDDVKNGRTLPVPKHLRDGHYKGAKQFGHGEGYKYSHDYEGGYVPQSYLP-EGEGRIYYMPSDNGMEARVRERLEYWRKQFEESKK 465
>gi|121602885|ref|YP_989024.1| recombination factor protein RarA [Bartonella bacilliformis KC583] >gi|120615062|gb|ABM45663.1| ATPase, AAA family protein [Bartonella bacilliformis KC583] (439 aa)
Score = 504, Expect = 6.1e-49, Identities = 122/399 (30%), Positives = 225/399 (56%)
  Q:     6 EKVLVCNSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV----LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIK 404
           EK+  C S  E++ +  +   +  +  M+    L S++F+G PG GK+   + +  + N  F   ++      +L ++ E+A        K ++ ++EIHR N+ +QD+ L ++E   ++++  TTENP F +N A+  R+R+L +   +  S     +  + LE K + L +   + ++ IS  D R +   ++ +  +   +S +I+    L+E+ +    + D+   +HY+L+SA HKS+RGSDP+AA+YYLA++ ++G D + + RRL  +  EDIGLA+       NAA +A + LG PE  + L+Q  + L  +PKSN+  +A   A+    K  +L PP H+ +A      +     GY+Y HD   ++  QEY P++L  + +Y+P +  + +   K +++W K++
  S:    22 EKMRPC-SLSEVVGQSHLIGAEGFLSRMVAAGSLGSMIFWGAPGTGKTTVARLLALETNFAFEQVSAIFTGITELKKVFEVARARFMSGAKTLLFVDEIHRFNRAQQDIFLPFMEDGTVVLVGATTENPSFALNAALLSRARVLTFHTHDDESLRRLLKRAEELERKTLPLDDHAKDVLIRISDGDARAMLTLVEEI--WCITRSGEILNAEALQEVVQRRAPIYDKGRDSHYNLISALHKSVRGSDPDAALYYLARMFDAGEDPLYIGRRLVRIAVEDIGLADPQALVICNAAKDAYDYLGSPEGELALAQACLYLATAPKSNATYLAYKTAMHCARKNGSLPPPKHILNAPTKFMKEEGYGDGYRYDHDEPDAFSGQEYFPEKLGRQIYYQPQERGFEREIAKRLEWWKKLR 432
>gi|189220465|ref|YP_001941105.1| ATPase [Methylokorus infernorum V4] >gi|189187323|gb|ACD84508.1| ATPase [Methylacidiphilum infernorum V4] (454 aa)
Score = 504, Expect = 6.4e-49, Identities = 140/396 (35%), Positives = 226/396 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELAT-----EDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV-------EAIVEISKSDFRQIFFYLKI-VLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKF---VDYWNKIKSNNK 408
           + +E++ ++ I      +  +I+ + + S++ +G PG GK+   + I KK    F   N+     +D+ +++  A      E    ++ I+EIHR NK +QD+LL  LE  +I ++  TT NP F +   + SR  L+  + ++   L+  +++ L +K+  L N  V       E ++ + + D R++  YL+I VL   Q      V+  +  I N +       D     HYD +SAF KSIRGSDP++A+Y+LA+++ +G D   + RRL  +  EDIGLAN    P   AA  A E +G+PE RIPL+  T+ L LSPKSNSA  AID+AI+ + KEA +  P  L+D+HY+ A KL    GY Y H++  +   Q Y    ++   FY P    + E +F   ++Y  K+++  K
  S:    30 TLEELVGQEDILLPGKPLRRLIDADRIQSLILYGPPGTGKTTLAEIIAKKTKSFFARLNAVEAGVSDIRKVIGQAALRWKKEKKHTLLFIDEIHRFNKSQQDVLLPDLETGIIKLIGATTHNPCFYLTAPLLSRSHLFEFKPLSKQSLETLLLRALTDKERGLGNYEVSIEKEAKEFLLNLCEGDARRLLNYLEIAVLSSLQENQPAPVILNIETIQNLVQKKIPRYDHGEDEHYDTISAFIKSIRGSDPDSALYWLAKMISAGEDPRFIARRLVILATEDIGLANPQGLPIATAAFEAIEKIGMPEGRIPLAFATLYLALSPKSNSAYKAIDKAIEWIEKEATVEVPQMLKDSHYSGAKKLGKGVGYLYSHNFRDAVSPQRY---GIEPGTFYVPTDRGK-EKEFKERLEYIEKLRTEEK 446
>gi|160947516|ref|ZP_02094683.1| hypothetical protein PEPMIC_01450 [Peptostreptococcus micros ATCC 33270] >gi|158446650|gb|EDP23645.1| hypothetical protein PEPMIC_01450 [Peptostreptococcus micros ATCC 33270] (428 aa)
Score = 503, Expect = 7.1e-49, Identities = 140/379 (36%), Positives = 230/379 (60%)
  Q:    18 ICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIEN---------INSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKF 396
           I +D I   +S++ NMI+NN   S++ +G PG GK++    I    +  F   ++ T+   ++ EI+ELA ++      + I+ I+EIHR NK +QD LL ++EK  II +  TTENP ++VN A+ SR++++ ++          I++A+L +E   +L+NKK+  +   +  ++++S  D R    YL++++   +  S+D V+ E  KI N L       D+ +  HY+ +SAF KS+R  DP+A VYYLA +L SG+ I+ + RR+     EDIG AN       N+   + + +G+PEARI LSQ  I L  S KSNS+ +AI++A++ + +  L   P  L+ +    ++    + YKYPHDY      QEYLP+++K+ +FY P      +N F
  S:    31 IGQDNIIKNNSVLKNMIKNNRFSSMILYGPPGSGKTSLANIISSTTDNYFVKISAVTSGTKEIKEIIELAKDNLSMYNKRTILFIDEIHRFNKMQQDYLLEFVEKGDIIFIGATTENPAYEVNNALLSRVIVFELQALSFENLKDIIDNAILNDE---FLKNKKISYTEDGISYLIKMSNGDARTALNYLELIIDNLE--SEDKVISEY-KIRNILDKVKVYYDKNSDKHYNFISAFIKSMRIGDPDAVVYYLASMLISGEDINFIARRMIIFASEDIGNANPNALILANSCAESVKKIGMPEARIILSQCAIYLACSEKSNSSYLAINKALKFIKENGLEEVPIFLQTSR---SISKKNEEYKYPHDYENMVTGQEYLPEKIKDIKFYNPKNIGYEKNFF 422
>gi|108799292|ref|YP_639489.1| recombination factor protein RarA [Mycobacterium sp. MCS] >gi|119868408|ref|YP_938360.1| recombination factor protein RarA [Mycobacterium sp. KMS] >gi|108769711|gb|ABG08433.1| Recombination protein MgsA [Mycobacterium sp. MCS] >gi|119694497|gb|ABL91570.1| Recombination protein MgsA [Mycobacterium sp. KMS] (445 aa)
Score = 503, Expect = 7.9e-49, Identities = 124/374 (33%), Positives = 211/374 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSD----DIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S DE++ +  +   +S +  ++E +   S++ +G PG GK+     I     + F   ++ +    ++  ++E A +      + ++ I+E+HR +K +QD LL  +E  +++++A TTENP F V   + SR L+ +++ +    + E V + + + +     V +S+  V+ IV++S  D R+    L++  +           DIV + L K      DR    HYD++SAF KS+RGSD +AA++YLA++L +G D   + RRL  +  EDIG+A+    P   AA    + +G+PEA++ L+  T+ L  + KSN+   A+  A+  V N +A   P HLRD HY+ A KL N  GY Y HD+    V Q+Y P EL   ++Y+P
  S:    33 SLDEVVGQQHLLKPNSPLRRLVEGSGAASVILYGPPGTGKTTLASLISHATGRRFEALSALSAGVKEVRAVIETARQGILRGQQTVLFIDEVHRFSKTQQDALLAAVENRIVLLVAATTENPSFSVVAPLLSRSLILQLQPLAPDSITEVVRRAVADPRGLADSVDVSDDAVDLIVQLSAGDARRALTALEVAAESAAAADGRVTVDIVEQSLDKAAVRY-DRDGDQHYDVVSAFIKSVRGSDVDAALHYLARMLVAGEDPRFIARRLMILASEDIGMADPTALPLAVAAAQTVQLIGMPEAQLTLAHATVHLATAAKSNAVTTALGAAMSDVRNGKAGQVPAHLRDGHYSGAAKLGNAVGYVYAHDHPDGVVPQQYPPDELVGVDYYRP 421
>gi|86143957|ref|ZP_01062325.1| putative ATPase, AAA family protein [Flavobacterium sp. MED217] >gi|85829664|gb|EAQ48127.1| putative ATPase, AAA family protein [Leeuwenhoekiella blandensis MED217] (425 aa)
Score = 503, Expect = 8.0e-49, Identities = 137/381 (35%), Positives = 223/381 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-------LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS----AVLKEEVIK--YLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI-----------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           + D+ + ++ +      + + I++  + S++ +G PGVGK+     I ++  + FY  ++  +   D+ E+++       L T+ N P++ I+EIHR +K +QD LL  +EK  + ++  TTENP F+V PA+ SR  +Y +   ++    A+LK  + +   L  K+++L     EA++ IS  D R++    ++++      S+ +V      ITN+++           D+    HYD++SAF KSIRGSDPNAAVYYLA++LE G DL  + RRL  +  EDIG AN         A  A   +G PEARI LSQ    L  SPKSN++ MAI+ A Q V +    P P  LR+A      +L     YKY HD   +++ QE+LP+++ N++ Y P   ++ +
  S:    13 TLDDYLSQEHLVGDKGSLTSSIKSGVIPSLILWGPPGVGKTTLASIIAEESKRPFYVLSAINSGVKDVREVIDKAKNAGGLFTQKN-PLLFIDEIHRFSKSQQDSLLAAVEKGWVTLIGATTENPSFEVIPALLSRCQVYVLNPFSADDLRALLKRAMTQDSILSKKEIELQE--TEALLRISGGDARKLLNIFELLVT--TETSEKVV------ITNAMVQQKVQQNTVMYDKTGEQHYDIISAFIKSIRGSDPNAAVYYLARMLEGGEDLKFIARRLIILASEDIGNANPTALIMATNAFTAVTTIGYPEARIILSQCVTYLATSPKSNASYMAINRAQQLVKQTGDLPIPIALRNAPTKLMKELGYGDEYKYSHDGAGNFIAQEFLPEQITNQKLYDPGANARED 409
>gi|126434949|ref|YP_001070640.1| recombination factor protein RarA [Mycobacterium sp. JLS] >gi|126234749|gb|ABN98149.1| Recombination protein MgsA [Mycobacterium sp. JLS] (445 aa)
Score = 503, Expect = 8.1e-49, Identities = 124/374 (33%), Positives = 211/374 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSD----DIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S DE++ +  +   +S +  ++E +   S++ +G PG GK+     I     + F   ++ +    ++  ++E A +      + ++ I+E+HR +K +QD LL  +E  +++++A TTENP F V   + SR L+ +++ +    + E V + + + +     V +S+  V+ IV++S  D R+    L++  +           DIV + L K      DR    HYD++SAF KS+RGSD +AA++YLA++L +G D   + RRL  +  EDIG+A+    P   AA    + +G+PEA++ L+  T+ L  + KSN+   A+  A+  V N +A   P HLRD HY+ A KL N  GY Y HD+    V Q+Y P EL   ++Y+P
  S:    33 SLDEVVGQQHLLKPNSPLRRLVEGSGAASVILYGPPGTGKTTLASLISHATGRRFEALSALSAGVKEVRAVIETARQGILRGQQTVLFIDEVHRFSKTQQDALLAAVENRIVLLVAATTENPSFSVVAPLLSRSLILQLQPLAPDSIAEVVRRAVADPRGLADSVDVSDDAVDLIVQLSAGDARRALTALEVAAESAAAADGRVTVDIVEQSLDKAAVRY-DRDGDQHYDVVSAFIKSVRGSDVDAALHYLARMLVAGEDPRFIARRLMILASEDIGMADPTALPLAVAAAQTVQLIGMPEAQLTLAHATVHLATAAKSNAVTTALGAAMSDVRNGKAGQVPAHLRDGHYSGAAKLGNAVGYVYAHDHPDGVVPQQYPPDELVGVDYYRP 421
>gi|167730319|emb|CAO81231.1| ATPase, AAA family [Candidatus Cloacamonas acidaminovorans] (437 aa)
Score = 503, Expect = 8.3e-49, Identities = 134/396 (33%), Positives = 225/396 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA-----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNK---SDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKY--SQNENKFVDYWNKIKSNNK 408
           + +E++ +  +  ++S +  MIE+ +  S + +G PG GK+   + I K    NF  F++   + +D+  +++ A     T++ + I+ I+EIHR NK +QD  L Y+E   II++  TTENP F+V PA+ SR  ++ +E ++   LK  + +     K++   +++  + + +  D R++   L++VL Y Q K     + + K L K T    D+    HY+L+SA HKS+RGSDP A +Y+LA++LE+G D   + RRL     ED+GLA+     +  A   A   +G+PEA   L+Q+ + L  +PKSN+   A +EA +   K +    P H+R+A       LN  K Y Y H+Y + Y  Q+Y P+++  K +YKP  Y   +   K +D+W K+K   K
  S:    30 TLEELLGQTKLIAENSPLRQMIESGEYHSFILWGPPGSGKTTIARIIEKNSGYNFIRFSAVLASISDVKAVMKEADYLHRTQNKRSILFIDEIHRFNKSQQDAFLPYVESGAIILIGATTENPSFEVIPALLSRCTVFVLEALSENDLKIILKRGFAELKLEEDEEIINWMAQNAGGDARRVLNDLELVLPYLQKKPHPKTEELAKFLAKKT-MFYDKNREEHYNLISALHKSLRGSDPQAGLYWLARMLEAGEDPRYIVRRLIRFASEDVGLADPNALVQAIAVKEAVLFIGMPEASTALAQLVVYLATAPKSNALYTAYEEAAEDARKTSHYGVPLHIRNAPTQLMKDLNYGKDYHYDHEYEYKYYYQKYFPEQMPEKIYYKPGTYGFEKEIQKRIDWWAKLKKEQK 437
>gi|124009494|ref|ZP_01694169.1| ATPase, AAA family [Microscilla marina ATCC 23134] >gi|123984840|gb|EAY24808.1| ATPase, AAA family [Microscilla marina ATCC 23134] (429 aa)
Score = 502, Expect = 9.1e-49, Identities = 128/371 (34%), Positives = 213/371 (57%)
  Q:    26 KDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN--------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL-----IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKF 396
           K+ +I  +++++ + S++ +G PGVGK+   + I   +   F+  ++  +   ++ +++E A      I+ I+EIHR NK +QD LL  +E  +I ++  TTENP F+V  A++SR  +Y ++ ++     E +++ LEN        KK+ +  K  EA++ +S  D R++    ++V+  +    D +V+     ++ +       D+    HYD++SAF KSIRGSDPNAAVY+LA+++E G D   + RRL     EDIG AN            A   +G PEA I L+Q T  L  S KSN++ M+I +A + V K+   P P HLR+A      +    KGY+Y HDY  ++  QEYLP+ + +   Y P + ++ EN+ 
  S:    34 KNGVISKLLQSDKVPSMILWGPPGVGKTTLARLIGNHVKTPFFTLSAINSGVKEVRQVIEKAKTRAGSILFIDEIHRFNKAQQDALLGAVETGLITLIGATTENPSFEVISALQSRCQIYILQPLSP----ETLVEMLENAQKQDEWLKKLNIKLKETEALLNLSGGDARRLLNLFELVVSAFPANQDPLVITNEWVLSTAQQKTVRYDKTGEQHYDIVSAFIKSIRGSDPNAAVYWLARMIEGGEDPKFIARRLVISASEDIGNANPTALVIATNCFQAVTMVGYPEAEIILAQATTYLAASAKSNASYMSIKKAKELVRKKGDLPIPLHLRNAPTQLMREQGYGKGYQYAHDYPHNFSPQEYLPEAIAHTTLYDPGQNAR-ENEL 415
>gi|167464003|ref|ZP_02329092.1| recombination factor protein RarA [Paenibacillus larvae subsp. larvae BRL-230010] (434 aa)
Score = 502, Expect = 9.5e-49, Identities = 131/371 (35%), Positives = 207/371 (55%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN-----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEA-------IVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT------NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFY 384
            DE I ++ I     ++   IE + + SIL +G PG GK+     I K+    F   N+   +  D+ E++E A +       K I+ ++E+HR N  +QD LL  +E+ +I+ +  TTENPF  VN A+ SR  L+++  +        + + L +++  L    +EA       I   +  D R+    L++       + D  +   L     S+  RR T        YD+LS+FHKS+RGS   A  ++L  + + G D ++  RRL     EDIGLAN     +  +A++A   +G PE++  +SQ  +    SPKSNS  +AI +A++++N+  +   P HLRDAHY+ A KL   GYKYPHDY   +VEQ+YLP +LKN++F+
  S:    26 LDEYIGQEHIVGPGKLLRRAIEADQVTSILLYGPPGTGKTTLANIISKRTQGQFVKLNAVDASVKDVREVIEQAKQTKALYGRKTILFLDEVHRFNSARQDALLPAVEQGIIVFIGATTENPFHYVNGALLSRSTLFQLRALTPEHALLAMRRALADRERGLGFMDIEAEDEALAHIARTANGDIRRALNALELAALTTAPQGDGSIHITLEVAEESI--RRPTVKADESTQYDVLSSFHKSLRGSSDAALFWFLYAVEKLGMDPMTFIRRLVVACSEDIGLANPQAMVQAVSAMDAYHKIGWPESKYIISQAILFAVESPKSNSIPVAIFKAMEAMNRIGSAEVPLHLRDAHYSGAEKLGHIGYKYPHDYPHHFVEQQYLPDKLKNEQFF 414
>gi|167037129|ref|YP_001664707.1| recombination factor protein RarA [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855963|gb|ABY94371.1| AAA ATPase, central domain protein [Thermoanaerobacter pseudethanolicus ATCC 33223] (443 aa)
Score = 502, Expect = 9.5e-49, Identities = 132/374 (35%), Positives = 222/374 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSA---VLKEEVIKYLENK----KVKLSNKVVEAIVEISKSDFRQIFFYLKI------VLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + DE + ++ +  K  ++  +IE +++ S++ +G PGVGK+     I    N  F  F++  +   ++ EI+  A  D     + ++ I+EIHR NK +QD  L ++EK  II++  TTENP F+VN A+ SR  ++ ++ +      +L +  +K  +N     K+ ++++ ++ I   +  D R     L+I      V++  +  +DDI+   + K T  L D++   HY+L+SAFHKS+R SD +AAVY+LA++LE+G D + + RR+     EDIGLA+        AA NA   +G+PE  + L+Q+ I L L+PKSN+  MA ++A +   +  A S P HLR+A      +L   KGYKY HD+     + + LP  LK++++Y P
  S:    27 TLDEFVGQEHLLGKGKLLRELIEKDNITSMILWGPPGVGKTTLAMIIANMTNSKFITFSAVLSGIKEIKEIMAKAELDAMYGTRTVVFIDEIHRFNKAQQDAFLPHVEKGNIILIGATTENPSFEVNSALLSRSKVFVMKPLTEEDLLILLKRALKDEQNGFGMYKIGITDEQLKKIALFANGDARVALNTLEIAVMGAKVIEGERIVTDDILADAMQKKT-LLYDKQGEEHYNLISAFHKSLRNSDWDAAVYWLARMLEAGEDPLYIARRMIRFASEDIGLADPQALEMAVAAYNACHYIGIPECSVNLAQVAIYLALAPKSNAVYMAYNKAKKDAEETIAESVPIHLRNAPTKLMKELGYGKGYKYAHDFEEKVTDMQCLPDNLKDRKYYVP 419
>gi|34762825|ref|ZP_00143811.1| ATPase associated with chromosome architecture/replication [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887527|gb|EAA24611.1| ATPase associated with chromosome architecture/replication [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (407 aa)
Score = 502, Expect = 1.1e-48, Identities = 130/357 (36%), Positives = 212/357 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALS--PPNHLRDAHYASAVKLNVKGYKYPHDYNFSYV 369
           S ++ + ++ +  KD +I  +I N+ L + +F+G PG GKS+  + I   L+ NF   N+TT + +D+  ++E A  +      + I+ ++EIHR NK++QD LL Y E   + ++  TTENP++ +N A+ SR++++  + + +  + + + K L    + +S+K+ E IV+IS+ D R    Y+++    +   S+D +     +   S   ++  + YD++SAF KS+RGSDP+AAVY+LA+LL+ G D   + RRL+    EDIG+AN       +AA+NA E +G+PE RI L+  TI L +S KSNS   AID A+  + K  L   P N   D         NV GYKYPH+Y  ++V
  S:    22 SLEDFVGQEKLLGKDGVITRLILNSTLSNSIFYGPPGCGKSSLGEIISNTLDCNFEKLNATTASVSDIRNVVETARRNIELYNKRTILFLDEIHRFNKNQQDALLSYTEDGTLTLIGATTENPYYNINNALLSRVMVFEFKALTNEDILKLINKGLNFLNISMSDKIKEIIVDISQGDSRIALNYVEMYNNIHTQMSEDEIFSIFKERQVSFDKKQ--DKYDMISAFIKSVRGSDPDAAVYWLARLLDGGEDPKYMARRLFIEASEDIGMANPEALLIASAAMNACEKIGMPEVRIILAHATIYLAISSKSNSVYEAIDSALADIKKGELQEVPINICHD---------NV-GYKYPHNYTDNFV 374
>gi|152989818|ref|YP_001355540.1| recombination factor protein RarA [Nitratiruptor sp. SB155-2] >gi|151421679|dbj|BAF69183.1| ATPase, AAA family [Nitratiruptor sp. SB155-2] (391 aa)
Score = 501, Expect = 1.2e-48, Identities = 133/392 (33%), Positives = 213/392 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN-KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           S +E I +  +   ++    +++   L    FFG PG GK+   + + K+   +F+  N+T+    ++ +I+        KP++ I+E+HRL+K++Q++LL  +EK+  ++L  +TENPFF +  AIRSR +L+    +N   L + V +  +N++  +  +  E I+ IS+ D R +  +L       ++     +L+ L  ++          HYDL SA  KSIRGSD +AA+YYLA+L+E G+    + RRL     EDIG AN        + + A + +G PEARI LSQ  I L  SPKSN+A  AI++A++ V    + P P HL+   +        +GYKYPHDY   +VEQ Y  K LK    Y+ +     E + +D+  KIK
  S:     8 SLEEFIGQRQLLAPEAPFYKLLKQRALPHSFFFGPPGTGKTTLARIVAKEYESDFFELNATSLKIEEIRKIVHRYKGSFIKPLLFIDEVHRLSKNQQEVLLPIMEKEEALILGASTENPFFSLTAAIRSRSMLFEFRPLNEEDLNQLVHRVCQNEECSIDEEAKEYIIRISQGDARNLLKFLTKA-SLIESHITLQLLRSLAPMSYHEGSNSKETHYDLASALIKSIRGSDVDAALYYLARLIEGGEPPEFIARRLVIFASEDIGNANPNALNLATSTMIAVKHIGYPEARIILSQCVIYLASSPKSNAAYKAINKAMEMVKDGEIYPIPEHLKPPKF--------QGYKYPHDYG-GWVEQAYTTKPLK---IYESSGIGY-EKRLLDWLEKIK 388
>gi|169824318|ref|YP_001691929.1| ATPase related to the helicase subunit of the Holliday junction resolvase [Finegoldia magna ATCC 29328] >gi|167831123|dbj|BAG08039.1| ATPase related to the helicase subunit of the Holliday junction resolvase [Finegoldia magna ATCC 29328] (431 aa)
Score = 501, Expect = 1.2e-48, Identities = 139/374 (37%), Positives = 220/374 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYR--------IENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLID-----RRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEAL-SPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S D+   +  +  +  ++  +I+ + + S++F+G PG GK+   + I  + N  F   ++ +N   D+ E++      L+  + K ++ I+EIHR NK +QD LL Y+E   I ++  TTENPFF+VN A+ SR  +          I NI    L E+  K L+   +++  K ++ +V  +  D R     L+I ++     +  +++ E   I NS+        +  +HY+++SAF KS+RGSD +AA+YYLA+++ESG D   + RR+     EDIGLAN           NA   +GLPE RI LS   I L  S KSN++ +AID+A++ + +  +   P+HL+DAHY  A  LN   GYKYPH  + SY  Q+YLP ELKN+++Y P
  S:    26 SLDKYFGQSHVVGEGKLLNRLIKADKIPSMIFYGPPGTGKTTLAEIISNQTNSLFERLSAISNGVKDIREVISTAKTNLSMYNKKTVLFIDEIHRFNKSQQDALLGYVEDGTITLIGATTENPFFEVNKALLSRCQIIELKPLTDNDIRNIIENALTED--KKLKEMNIQIDEKAIDVLVNSANGDARSALNALEIAVESTDQVNGCLIIDE-DAIKNSVFKPVLKYDKEEDHYNVISAFIKSMRGSDIDAALYYLARMIESGEDPKFIARRMVIFASEDIGLANPEALTVAINVFNAVNLIGLPECRINLSNGVIYLASSEKSNTSYIAIDKALEDIRQNKIYDVPSHLKDAHYYGAKSLNRGLGYKYPHSDD-SY--QQYLPDELKNQKYYDP 414
>gi|21673587|ref|NP_661652.1| recombination factor protein RarA [Chlorobium tepidum TLS] >gi|21646700|gb|AAM71994.1| ATPase, AAA family [Chlorobium tepidum TLS] (451 aa)
Score = 501, Expect = 1.3e-48, Identities = 125/385 (32%), Positives = 219/385 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN-----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK----KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT------NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALS--PPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFV 397
           S DE+  ++ +      + + +E   + S++F+G PG GK+   +   + LN  F   ++T     D+  +LELA +       + ++ I+EIHR NK +QD LL  +E+ +I+++  TTENP F+VN A+ SR+ +Y +  ++ A ++  V + +E+        +  + +E ++  +  D R+    L+  L      +  +V+    ++  +L  R  T       HYD +SAF KS+RGSDP+AA++++A++++ G D   + RR+     EDIG A+        +  +A E +GLPEARI L+Q    L   PKSN++   I+EA+  V K A +  PP +LR+A      ++   KGY+YPH Y   +VE+ Y P++++ K +Y+P    +   KF+
  S:    37 SIDELFGQEHLVGPGGPVRSYLEQGRIPSMIFWGPPGSGKTTLAEICARSLNYRFEQLSATDAGVKDVRRVLELAQKSRSIDGRQMLLFIDEIHRFNKAQQDTLLHAIEQGLIVLIGATTENPSFEVNRALLSRMQVYILNPLSEAEVRRVVERAIESDPQLAAAGVEMRDMEFLLAYAAGDARKALNALEAALSLAPRGTAPVVIDRT-RLEQALQHRAPTYDKGGEAHYDTVSAFIKSMRGSDPDAALFWMAKMIDGGEDPKFIARRMVIFASEDIGNADPYALTLAVSVFHAVELIGLPEARINLAQGATYLASCPKSNASYEGINEALSDVKKGAANAVPPLYLRNAPTDLMKEIGYGKGYRYPHSYPGHFVEEHYFPEQMEPKAYYRPT--GEGREKFI 437
>gi|150025417|ref|YP_001296243.1| recombination factor protein RarA [Flavobacterium psychrophilum JIP02/86] >gi|149771958|emb|CAL43432.1| Putative AAA family ATPase [Flavobacterium psychrophilum JIP02/86] (425 aa)
Score = 501, Expect = 1.4e-48, Identities = 130/351 (37%), Positives = 204/351 (58%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED------NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENIN----SAVLKEEVI--KYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLK-----ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQ 391
           S++F+G PG GK+   Q I ++  + FY  ++  +   D+ +++E A +         PI+ I+EIHR +K +QD LL  +EK  I ++  TTENP F+V PA+ SR  +Y +   +     A+L   +    +L+ K ++L+    EA++ +S  D R++    ++V+       D I++      +L +    L D+    HYD++SAF KSIRGSDPN AVY+LA+++E G D+  + RR+  +  EDIG AN       N    A   +G PE+RI LSQ  + L  SPKSN++ +AI EA + V +    P P  LR+A      +L   + YKY HDY+ ++  QE+LP E+    FY P   S+
  S:    41 SLIFWGPPGTGKTTLSQIIAQESKRPFYILSAINSGVKDIRDVIEKAKQSGGLFTTKNPILFIDEIHRFSKSQQDSLLAAVEKGWITLIGATTENPSFEVIPALLSRCQVYILNAFSKQDLEALLHRAITTDTFLKTKNIELAE--TEALLRLSGGDGRKLLNIFELVVN--ATNEDHILITNEKVMQLVQKNTVLYDKTGEQHYDIVSAFIKSIRGSDPNGAVYWLARMIEGGEDVKFIARRMLILSSEDIGNANPTAFIMANNTFQAVTTIGYPESRIILSQCAVYLATSPKSNASYIAIGEAQKVVKQTGDLPVPIPLRNAPTKLMKELGYGEEYKYSHDYSNNFAAQEFLPNEISETVFYNPGNNSR 407
>gi|15643274|ref|NP_228318.1| fused recombination factor protein RarA/unknown domain-containing protein [Thermotoga maritima MSB8] >gi|20178177|sp|Q9WYX8|Y508_THEMA UPF0189 protein TM_0508 >gi|4981020|gb|AAD35593.1|AE001727_5 conserved hypothetical protein [Thermotoga maritima MSB8] (599 aa)
Score = 500, Expect = 1.6e-48, Identities = 129/383 (33%), Positives = 223/383 (58%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLAN-SGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKF 396
           F++ + +D IF    I+   ++  ++FS + +G PG GK++    + +  N    Y +ST +  +++  +L    +L     K ++ ++EIHRLNK++Q +L+ ++E+  I+++ATTTENP F + PA+ SR  +   + ++   L + + K  E   + L   V +AIV  S+ D R++   L+IV + ++NK   + L++L  +  ++      +HYD  SAF KS+RGSDPNAAVYYL +++E G D   + RR+     ED+GLA+ + L   V+ ++ A E +GLPE  + L +  + L L+PKSNS  +A+ + +Q +  E +  P  LR+       K    +GY YPHD+   +V+  YLP++LKN+  ++P +    E  F
  S:    17 FEDFVGQDHIFGNKGILRRTLKTGNMFSSILYGPPGSGKTSVFSLLKRYFNGEVVYLSSTVHGVSEIKNVLKRGEQLRKYGKKLLLFLDEIHRLNKNQQMVLVSHVERGDIVLVATTTENPSFVIVPALLSRCRILYFKKLSDEDLMKILKKATEVLNIDLEESVEKAIVRHSEGDARKLLNTLEIVHQAFKNKR--VTLEDLETLLGNVSGYTKESHYDFASAFIKSMRGSDPNAAVYYLVKMIEMGEDPRFIARRMIIFASEDVGLADPNALHIAVSTSI-AVEHVGLPECLMNLVECAVYLSLAPKSNSVYLAMKK-VQELPVEDV--PLFLRNPVTEEMKKRGYGEGYLYPHDFG-GFVKTNYLPEKLKNEVIFQPKRVGFEEELF 399
>gi|113954265|ref|YP_731698.1| fused recombination factor protein RarA/unknown domain-containing protein [Synechococcus sp. CC9311] >gi|113881616|gb|ABI46574.1| ATPase [Synechococcus sp. CC9311] (733 aa)
Score = 500, Expect = 1.8e-48, Identities = 127/376 (33%), Positives = 216/376 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV----EA---IVEISKSDFRQIFFYLKIVLKYYQN-------KSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           S +E   ++ I  +  ++   I  + + +++  G PGVGK+   + I       F   N+      DL E ++ A E       + I+ I+E+HR N  +QD LL ++E   + ++  TTENP+F+VN A+ SR  L+R++++ +  L + + + L +K+    N++V    EA   +V+++  D R +   L++ ++           K D  + +E  +    L D++   H+D +SAF KS+RGSD +AA+++LA++LE+G+    ++RR+     EDIGLA+      V A   A E +GLPE   PL+Q  + L  + KSNS  M + EAI+ V   +  + P+HLRDAH       + KGY+YPH Y   ++ Q YLP+ L+ + F+ P+K
  S:    28 SLEEFAGQNAILAEGRLLRRAIAADRVGNLILHGPPGVGKTTLARIIATHTRAQFSSLNAVLAGVKDLREQVDAAKERLERHGLRTILFIDEVHRFNSAQQDALLPWVENGTLTLIGATTENPYFEVNKALVSRSRLFRLQSLEANDLHQLLHRALHDKERGYGNRLVTITPEAEAHMVDVANGDARSLLNALELAVESTTTTDPEATIKIDLTIAEESIQERAVLYDKQGDAHFDTISAFIKSLRGSDADAALFWLARMLEAGENPRFIFRRMLISAGEDIGLADPQAVVVVEACAAAFERIGLPEGLYPLAQAALYLACAEKSNST-MGLFEAIRVVRTTQDQNVPSHLRDAHRDGEAFGDGKGYRYPHAYREHWIAQNYLPEALQGEVFWTPSK 423
>gi|163846016|ref|YP_001634060.1| recombination factor protein RarA [Chloroflexus aurantiacus J-10-fl] >gi|187602657|ref|ZP_02988880.1| AAA ATPase central domain protein [Chloroflexus sp. Y-400-fl] >gi|163667305|gb|ABY33671.1| AAA ATPase central domain protein [Chloroflexus aurantiacus J-10-fl] >gi|187485155|gb|EDU23133.1| AAA ATPase central domain protein [Chloroflexus sp. Y-400-fl] (497 aa)
Score = 499, Expect = 2.0e-48, Identities = 121/374 (32%), Positives = 204/374 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + +E + +  +  +  ++   I N+ LFS++ +G PG GK+   Q I      +F   ++ +   NDL  +++ A +       + ++ I+EIHR NK +QD +L Y+E   II++  TTENP F+VN A+ SR  ++++E +    +   + + L ++       K+ L+    + +V ++  D R     L+   +       +  L  +  I ++L       D+    HYD +SA HKS+R SDP+ A+Y+L ++L+ G D + + RRL  +  EDIGLA+    P+  AA  A   LG PE  + L+Q  + LCL+PKSN+   A     + V +    P P HLR+A      +L   KGY+Y HD      +QE+LP  L  + +Y+P
  S:    33 TLEEFVGQHHLVGEGKLLRRAIANDQLFSLILWGPPGSGKTTLAQIIAHSTKAHFEPISAVSAGVNDLRRVVQEAQDRLGMFQQRTVVFIDEIHRFNKSQQDAILPYVEDGTIILIGATTENPSFEVNSALLSRARVFKLEALTDEEIGVLIDRALTDRERGLGDLKIMLARDARDYLVNMANGDARTALNALEAAARSKPPAIGETRLITVDDIRDALQSRAVRYDKHGELHYDAISALHKSVRDSDPDGALYWLGRMLDGGEDPLYIARRLVRIAVEDIGLADPQALPQTIAAQQAVHFLGQPEGELALAQAVVYLCLAPKSNALYRAYGAVQRDVAETRNEPVPLHLRNAPTQLMKRLGYGKGYEYAHDLPEGRSDQEHLPPNLAGRIYYEP 427
>gi|34540836|ref|NP_905315.1| recombination factor protein RarA [Porphyromonas gingivalis W83] >gi|188995064|ref|YP_001929316.1| ATPase AAA family [Porphyromonas gingivalis ATCC 33277] >gi|34397150|gb|AAQ66214.1| ATPase, AAA family [Porphyromonas gingivalis W83] >gi|188594744|dbj|BAG33719.1| ATPase AAA family [Porphyromonas gingivalis ATCC 33277] (434 aa)
Score = 499, Expect = 2.1e-48, Identities = 131/378 (34%), Positives = 217/378 (57%)
  Q:    28 SIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL--------ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV----EAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVD----YWNKIKS 405
           +++  MIE     S++ +G PGVGK+   + I  +++  FY  ++ ++   ++ E++         L  +  + I+ I+EIHR +K +QD LL  +E+ ++ ++  TTENP F+V   + SR  +Y ++  +   L     + ++  ++  +   V    EA++  +  D R++   L ++     ++ +D ++    KI   L       D+    HYD+ SAF KSIRGSDP+AA+Y+LA+L++ G+  S + RRL     EDIGLAN        A   A + +G PE RIPL++ TI L  S KSNSA +AID A++ V +    P P HLR+A       L+  KGYKY HD+   +V Q+YLP +  N  F+ P  ++ +E K  +    +W + KS
  S:    29 AVLRQMIEQGQTPSMILWGPPGVGKTTLAEIIAHEVDAPFYTLSAVSSGVKEVREVIADIESNRGNLFDKGGRAILFIDEIHRFSKSQQDSLLAAVERGIVTLIGATTENPSFEVIRPLLSRCQVYVLKPQSDEDLLLLAHRAIDRDELLAAKHPVLEETEALLLYAGGDARKLLNILDLLAT---SEVEDRLVITNEKIRQRLQENPAAFDKGGELHYDIASAFIKSIRGSDPDAAIYWLARLIDGGEEPSFIARRLIISASEDIGLANPNAMLIAMACAEALDRIGWPEGRIPLAEATIYLATSEKSNSAYLAIDSALEYVRQSGNLPVPLHLRNAPTRLMADLDYGKGYKYSHDFPEHFVSQQYLPDKAANTSFWTPQMHTVHEAKLGERMKRWWKREKS 428
>gi|186457708|ref|ZP_02968018.1| AAA ATPase central domain protein [bacterium Ellin514] >gi|184205363|gb|EDU02412.1| AAA ATPase central domain protein [bacterium Ellin514] (457 aa)
Score = 499, Expect = 2.3e-48, Identities = 127/374 (33%), Positives = 212/374 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKP-IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT-------NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           +  E I +  I     ++   IE + + S++F+G PG GK++  Q I  + +  F   +   +N  D+  +L  A+       +P I+ ++EIHR NK +QD+LL  +E  +I ++  TT NPFF VN  + SR  ++ +  +    L + + + L++        K+ +    +  + ++S  D R+    L+I       +++ I+  +L  +    I R+A         HYD +SAF KS+RGSD +A +Y+LA+++ +G D   + RR+     ED+GLA+       NAA  A+E +G PEARIP+++  I +  + KSN++I AID A+  V     L  P HLRDAHYA A +L + KGY+Y HD+   +  Q+YL  +   K +Y+P
  S:    39 NLSEYIGQSHILGPGQLLRRAIEADRIQSLIFYGPPGTGKTSLAQIIALQTSSKFERLSGVESNVADMRRVLSAASNRLENTGQPTILFVDEIHRFNKSQQDVLLPDVESGVIRLIGATTHNPFFFVNSPLVSRSQIFELRPLTEEELYQLLQRSLQDPERGLGYMKIHVDEAALRHLAKLSDGDARKALNSLEIAALTTSPEANGIIHIDLA-VAEQSIQRKAVVYDGDGDAHYDTISAFIKSMRGSDADATLYWLAKMIHAGEDPRFISRRIVICAAEDVGLADPMALVLANAAHQAAEFIGWPEARIPIAEAAIYIATAIKSNTSITAIDAALADVRSGRTLPVPEHLRDAHYAGAERLGHGKGYEYAHDHPDHFASQDYLGAD---KHYYEP 430
>gi|158424151|ref|YP_001525443.1| recombination factor protein RarA [Azorhizobium caulinodans ORS 571] >gi|158331040|dbj|BAF88525.1| AAA ATPase [Azorhizobium caulinodans ORS 571] (469 aa)
Score = 499, Expect = 2.5e-48, Identities = 126/400 (31%), Positives = 222/400 (55%)
  Q:     7 KVLVCNSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLY---RIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS---LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNK---EFYKPNK--YSQNENKFVDYWNKIKSN 406
           +VL     +++I ++ +   +  I  M++   L S + +G PG GK+   + + + L   F   ++  +   DL +++E A +       +  + ++E+HR N+  QD LL ++E   I+++  TTENP F +  A+ SR  +Y   R+E  + A L E    +   + + L  +  EA+ E++  D R +   ++ +L        D+ L+ L +       + D+    HY+LLS FHKS+RGSD NAA+Y+ A+++  G D  +++RRL     ED+G+A+    P+V AA  A E +G PE R+ ++Q    +  +PKSN+A  A + A+    K  +L+PP H+ +A      +L    GY+Y HDY  +Y  QE+ P EL      + Y+PN+  + +   K +DYW ++K++
  S:    50 EVLRPQRLEDVIGQEHLLGPEGPIGRMVKGKRLSSFILWGPPGSGKTTIARLVARGLGFEFVQLSAVLSGVADLRKVVETARQLRTGSGRQTAVFVDELHRFNRTTQDALLPHVEDGTIVLIGATTENPSFSMVAALLSRAKVYTLRRLEKADLARLLERAEAH-AGRCLPLDAQAREALTEMADGDGRYLLGLVEELLAL--PPGPDLDLEALAQTVQKRAPVYDKAQEEHYNLLSCFHKSLRGSDVNAAMYWAARMMTGGEDPGTIFRRLACCASEDVGMADPQAMPQVIAAWTAFERVGWPEGRLFMAQAIAYVATAPKSNAAYSAFNAALALAQKTGSLAPPKHILNAPTKLMKELGYHAGYRYDHDYPDAYAGQEFFPDELAGDHRPDLYQPNERGFEREVKKRLDYWARLKAD 465
>gi|87125265|ref|ZP_01081111.1| putative ATPase, AAA family protein [Synechococcus sp. RS9917] >gi|86167034|gb|EAQ68295.1| putative ATPase, AAA family protein [Synechococcus sp. RS9917] (738 aa)
Score = 499, Expect = 2.5e-48, Identities = 120/375 (32%), Positives = 210/375 (56%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE-------NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
            D+ + +  I  +  ++   I  + + ++L  G PGVGK+   + I      +F   N+      +L   ++ A +       + I+ I+E+HR N  +QD LL ++E   + ++  TTENP+F+VN A+ SR  L+R++ + +  L   + + L        N+ V ++ +    +V+++  D R +   L++ ++      D  V  +L     S      L D++   H+D +SAF KS+RGSDP+AA+++LA+++E+G+    ++RR+     ED+GLA+      V A  +A E  GLPE   PL+Q  + L  + KSNS I  I EAI+SV + +    P+HLRDA+       + +GY+YPH +   +V Q+YLP  L+ + F+ P +
  S:    29 LDDFVGQGAILAEGRLLRRAIAADRVGNLLLHGPPGVGKTTLARIIANHTRAHFSSLNAVLAGVKELRAEVDAARQRLERHGLRTILFIDEVHRFNSAQQDALLPWVENGTLTLIGATTENPYFEVNKALVSRSRLFRLQALEAEDLHRLLQRALSDSERGYGNRAVSVTAEAAAHLVDVANGDARSLLNALELAVESTPTDDDGTVRIDLAIAEESIQQRAVLYDKQGDAHFDTISAFIKSLRGSDPDAALFWLARMVEAGENPRFIFRRMLIAAGEDVGLADPQAMVVVEACASAFERTGLPEGLYPLAQAALYLACTDKSNSTI-GIFEAIKSVRSAQKQDVPSHLRDANRDGDAFGDGQGYRYPHAFREHWVAQQYLPTALQGEAFWTPGR 422
>gi|72383277|ref|YP_292632.1| fused recombination factor protein RarA/unknown domain-containing protein [Prochlorococcus marinus str. NATL2A] >gi|72003127|gb|AAZ58929.1| Recombination protein MgsA [Prochlorococcus marinus str. NATL2A] (734 aa)
Score = 498, Expect = 2.6e-48, Identities = 128/377 (33%), Positives = 222/377 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK----VKLSNKVVEA---IVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKY 389
           + DE + +D I  +  ++   I  + + ++L +G PGVGK+   + I      +F   N+      DL   +E A +       + I+ I+E+HR N  +QD LL ++E   + ++  TTENP+F+VN A+ SR  L+R+ ++NS  L + + + L +KK    +KL N   EA   +V++   D R +   L++ ++      D  +  +L    +S      L D++   H+D +SAF KS+RGSDP+AA+++LA++LE+G+    ++RR+     EDIGLA+      V +   A + +GLPE   PL+Q T+ L  + KSNS + AI +A+Q V + +  + P+HL+D +       +  GY+YPH ++ ++V Q+YLP  L N+ F++P ++
  S:    28 TLDEFVGQDHILAQGRLLRRSIVADKVGNLLLYGPPGVGKTTLARIIALNTLSHFSVVNAALAGIKDLRSEIESAIDRLNKFGKRTILFIDEVHRFNTAQQDALLPWVENGTLTLIGATTENPYFEVNKALVSRSRLFRLNSLNSKALHQLLQRALNDKKRGYGLKLINLASEAEDHLVDVCNGDARVLLNALELAVESTIANQDTSINIDLKIAEDSIQERAVLYDKKGDAHFDTISAFIKSLRGSDPDAALFWLARMLEAGESPRFIFRRMLIAAGEDIGLADPNAIVIVESCAAAFDRIGLPEGVYPLAQATLYLASTEKSNS-VKAIFKAVQKVKDSQKQNVPSHLKDPNRDQESFGDGMGYRYPHSFSKNWVPQQYLPDTLLNEIFWEPTEH 423
>gi|116073846|ref|ZP_01471108.1| putative ATPase, AAA family protein [Synechococcus sp. RS9916] >gi|116069151|gb|EAU74903.1| putative ATPase, AAA family protein [Synechococcus sp. RS9916] (736 aa)
Score = 498, Expect = 2.6e-48, Identities = 122/376 (32%), Positives = 218/376 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSD------DIVLKELGKITNS-LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           + +E + +  I  +  ++   I  + + ++L  G PGVGK+   + I      +F   N+      DL   ++ A +       + I+ I+E+HR N  +QD LL ++E   + ++  TTENP+F+VN A+ SR  L+R++ + +  L++ + + L +++       V ++++ ++ +V+++  D R +   L++ ++     +D      D+ + E      + L D++   H+D +SAF KS+RGSDP+AA+++LA+++E+G+    ++RR+     EDIGLA+      V A   A E +GLPE   PL+Q  + L  + KSNS I  I EAI+ V   A    P+HLRDAH       + KGY+YPH +   +V Q+YLP  L+ + F+ P++
  S:    28 NLEEFVGQGAILAEGRLLRRAIAADRVGNLLLHGPPGVGKTTLARIIANHTRAHFSSLNAVLAGVKDLRTEVDAARQRLDRHGLRTILFIDEVHRFNSAQQDALLPWVENGTLTLIGATTENPYFEVNKALVSRSRLFRLQTLEADDLRDLLSRALSDQERGYGDRLVTITSEAIDHLVDVANGDARSLLNALELAVESTPADADSGTISIDLTIAEESIQQRAVLYDKQGDAHFDTISAFIKSLRGSDPDAALFWLARMVEAGENPRFIFRRMLISAGEDIGLADPQAVVVVEACAAAFERIGLPEGLYPLAQAALYLANTDKSNSTI-GIFEAIKHVQASARQDVPSHLRDAHRDGDAFGDGKGYRYPHAFREHWVAQQYLPTALQGEVFWTPSQ 423
>gi|124024855|ref|YP_001013971.1| fused recombination factor protein RarA/unknown domain-containing protein [Prochlorococcus marinus str. NATL1A] >gi|123959923|gb|ABM74706.1| Hypothetical protein NATL1_01421 [Prochlorococcus marinus str. NATL1A] (734 aa)
Score = 498, Expect = 2.7e-48, Identities = 128/377 (33%), Positives = 221/377 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK----VKLSNKVVEA---IVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKY 389
           + DE + +D I  +  ++   I  + + ++L +G PGVGK+   + I      +F   N+      DL   +E A +       + I+ I+E+HR N  +QD LL ++E   + ++  TTENP+F+VN A+ SR  L+R+ ++NS  L + + + L +KK    +KL N   EA   +V++   D R +   L++ ++      D  +  +L    +S      L D++   H+D +SAF KS+RGSDP+AA+++LA++LE+G+    ++RR+     EDIGLA+      V +   A + +GLPE   PL+Q T+ L  + KSNS + AI +A+Q V + +  + P+HL+D +       +  GY+YPH ++  +V Q+YLP  L N+ F++P ++
  S:    28 TLDEFVGQDHILAQGRLLRRSIVADKVGNLLLYGPPGVGKTTLARIIALNTLSHFSVVNAALAGIKDLRSEIESAIDRLNKFGKRTILFIDEVHRFNTAQQDALLPWVENGTLTLIGATTENPYFEVNKALLSRSRLFRLNSLNSKALHQLLQRALNDKKRGYGLKLINLASEAEDHLVDVCNGDARVLLNALELAVESTIANQDTSINIDLKIAEDSIQERAVLYDKKGDAHFDTISAFIKSLRGSDPDAALFWLARMLEAGESPRFIFRRMLIAAGEDIGLADPNAIVIVESCAAAFDRIGLPEGVYPLAQATLYLASTEKSNS-VKAIFKAVQKVKDSQKQNVPSHLKDPNRDQESFGDGMGYRYPHSFSKHWVPQQYLPDTLLNEIFWEPTEH 423
>gi|33860637|ref|NP_892198.1| recombination factor protein RarA [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|33633579|emb|CAE18536.1| putative ATPase, AAA family [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (429 aa)
Score = 498, Expect = 2.7e-48, Identities = 136/393 (34%), Positives = 225/393 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLK---EEVIKYL----ENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELG------KITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNS--AIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKS 405
           + D+   ++ I   DS++ N I N+ + +I+F G PGVGK+  I+ I      +    N+  ++  +L   +  A E     + K I+ I+E+HR    +QD LL  +E   I  +  TTENPFF VN A+ SR  ++ +  +N   LK   ++VIKY     ++K V++  + +  +++ S  D R +   L++ +   +   +++V+ +L       +  N + D+   NH+D++SAF KSIRGSDP+A +Y+LA ++E+G D   ++RRL     EDIGLA+      V +  +A + +G PE    LSQ ++ L +SPKSNS  +I    EAI++ N   +  PNHL++         N   Y  PH+Y   +++QEYLP +L+  +F+KP      +NK+ D   K KS
  S:    27 NLDDFFGQESILGHDSLLRNAILNDKVGNIIFSGPPGVGKTTLIEIISSNTRSSLIKLNAVLSSIKELRTEIANAKERLRSSNRKTILFIDEVHRFTSVQQDALLPSIENGTITFIGATTENPFFAVNKALISRARIFSLLPLNKNDLKKIIDKVIKYYSCLKDSKVVEIKEEAINHLIKFSGGDARNLINALELGISITKENKENLVVIDLAIAEDSIQKKNIVYDKNGQNHFDVISAFIKSIRGSDPDATLYWLANMVEAGEDPNFIFRRLLISACEDIGLADPNAIVVVQSCCDAFDRVGFPEGLFFLSQASLYLAISPKSNSTKSIFKALEAIKATNVSLV--PNHLKN---------NASNYLNPHNYQGKWLQQEYLPTDLQGIKFWKPKDSGWEKNKYEDLPKKQKS 429
>gi|170288230|ref|YP_001738468.1| appr-1-p processing domain-containing protein [Thermotoga sp. RQ2] >gi|170175733|gb|ACB08785.1| Appr-1-p processing domain protein [Thermotoga sp. RQ2] (599 aa)
Score = 498, Expect = 2.7e-48, Identities = 128/383 (33%), Positives = 221/383 (57%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLAN-SGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKF 396
           F++ + +D IF    I+   ++  ++FS + +G PG GK++    + +  N    Y +ST +  +++  +L    +L     K ++ ++EIHRLNK++Q +L+ ++E+  I+++ATTTENP F + PA+ SR  +   + ++   L + + K  E   + L   V +AIV  S+ D R++   L+IV + ++NK     L++L  +  ++      +HYD  SAF KS+RGSDPNAAVYYL +++E G D   + RR+     ED+GLA+ + L   V+ ++ A E +GLPE  + L +  I L L+PKSNS  +A+ +A + + ++    P  LR+       K    +GY YPHD+   +V+  YLP++LK +  ++P +    E  F
  S:    17 FEDFVGQDHIFGDKGILRRTLKTGNMFSSILYGPPGSGKTSVFSLLKRYFNGEVVYLSSTVHGVSEIKNVLKRGEQLRKYGKKLLLFLDEIHRLNKNQQMVLVSHVERGDIVLVATTTENPSFAIVPALLSRCRILYFKKLSDEDLMKILKKATEVLNIDLEETVEKAIVRYSEGDARKLLNTLEIVHQAFKNKR--ATLEDLETLLGNVSGYTKESHYDFASAFIKSMRGSDPNAAVYYLVKMIEMGEDPRFIARRMIIFASEDVGLADPNALHIAVSTSI-AVEHVGLPECLMNLVECAIYLSLAPKSNSVYLAMKKAQELLVEDV---PLFLRNPVTEEMKKRGYGEGYLYPHDFG-GFVKTNYLPEKLKGEVIFQPKRVGFEEELF 399
>gi|187734543|ref|YP_001876655.1| AAA ATPase central domain protein [Akkermansia muciniphila ATCC BAA-835] >gi|187424595|gb|ACD03874.1| AAA ATPase central domain protein [Akkermansia muciniphila ATCC BAA-835] (459 aa)
Score = 498, Expect = 3.0e-48, Identities = 121/374 (32%), Positives = 199/374 (53%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEI-----LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENI-------NSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKG-----YKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + DE+  +  +     ++   IE +   S++F+G PG GK+     I +  N +F   N   +N  D+ E      + ++    K ++ ++E+HR NK +QD+LL +LEK  +  +  TTENP+F +N  + SR  ++ +E +              + ++ L   +V +  + +  +   +  D R+    L++ +       D ++  ++     S+       DR   +HYD +SAF KS+RGSDP+AA+Y+L  +LE+G D+  + RRL     ED+GLA+S        A  A+E +G+PEARIPL+   + L  +PKSNSA M I+ A+  V N + L+ P HLR                   Y Y HDY   YV Q YLP   + + +Y P
  S:    34 TLDEVAGQKHLLAPGKLLRRAIETDRFTSLIFYGPPGCGKTTLAAVIARTTNAHFMMLNGVESNVADIREKIAQAQMRMSMHGRKTVLFVDELHRFNKAQQDVLLPHLEKGTVRFIGATTENPYFAINSPLLSRSQVFPMEPVPEEELAALLKRALADEVRGLGASRVDMEAEALNHLAAKADGDARKALTALEVAVLSTPAGKDGVIHVDISVAEESIQRKAIRYDRLGDSHYDTISAFIKSMRGSDPDAALYWLGMMLEAGEDIRFIGRRLVIAASEDVGLADSNALRVALDAARAAEMVGMPEARIPLAHAAVYLATAPKSNSAYMGINAAMDDVRNGKTLAVPEHLRTPTRKKLAAAGGADAARLEYLYSHDYPEHYVPQAYLP---EGRVYYTP 429
>gi|158320717|ref|YP_001513224.1| recombination factor protein RarA [Alkaliphilus oremlandii OhILAs] >gi|158140916|gb|ABW19228.1| AAA ATPase central domain protein [Alkaliphilus oremlandii OhILAs] (420 aa)
Score = 497, Expect = 3.6e-48, Identities = 140/393 (35%), Positives = 227/393 (57%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-ELAT--EDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVL---KEEVIKYLE---NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLK---YYQNKSDDIVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFY--KPNKYSQNENKFVDYWNKIKSN 406
            ++++ +  I     ++  ++E+  + +++F+G  G GK+     I +  NK FY  N T  N  D+  ++ ++ T    N  ++ I+E+H LNK +Q  +L Y+E   II++ +TTEN  F +  A+ SR  +   + ++   L    ++VI   E   N K+    + +  I E+S  D R+    L++++     Y  +  DI + +  + + S I   DR    HY+LLS F KSIRGSD  A+++ LA+L+++GDL S+ RRL  +  EDIGLA       V A  +++  LGLPEARIPL++ TI L   PKSNSA  AI  A+  +++ +    P HL D +  +++K N   Y YPHDY   YVEQ+Y+P  +K+K +Y    NK+ Q+      YW+KIK +
  S:    13 LEDIVGQKHILGSGKLLNRILESKAIPNMIFYGPSGTGKTTVANIIAQSSNKKFYKINGTNANIEDIKRVIAQIGTLHTMNGILLYIDELHYLNKRQQQSILEYIENGDIILIGSTTENVNFSIFNALLSRCTIMEFKPLSIEDLIFGLKKVISSEEHRLNIKISYEEEALHYIAEVSNGDLRRSLNTLELIINTYAIYNPQVIDIDIPKAVECSQSKIANYDRDGDAHYNLLSFFQKSIRGSDEQASIHALARLIKAGDLTSICRRLLVIAAEDIGLAYPQAITIVKACTDSALQLGLPEARIPLAEATILLASLPKSNSAYHAISAALNDLDRLDVGHVPYHLCDTNSNASIK-NKSEYLYPHDYPNHYVEQQYMPDNIKHKVYYVHGNNKFEQSMKT---YWDKIKKH 419
>gi|75675584|ref|YP_318005.1| recombination factor protein RarA [Nitrobacter winogradskyi Nb-255] >gi|74420454|gb|ABA04653.1| Recombination protein MgsA [Nitrobacter winogradskyi Nb-255] (443 aa)
Score = 497, Expect = 4.1e-48, Identities = 128/391 (32%), Positives = 227/391 (58%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKP----IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKY--LENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA--LSPPNHLRDAHYASAVKLNVK-----GYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIK 404
             +++ +D I   D  +  M+E   L S++F+G PG GK+   + +      +F   ++  +  NDL +  E A    +     ++ ++E+HR N+ +QD  L  +E   ++++  TTENP F++N A+  R+R+L++R  ++++  +++  ++   +E K + L  +   A+V ++  D R     L +V + +++  +  V  + G++   L       D+ A  HY+L+SA HKS+RGSDP+AA+YYLA+++E+G D + + RR+  +  EDIGLA+       NAA +A + LG PE  + ++Q  I L  +PKSN+A  A   A++ V K+A  L PP H+ +A      KL        GY+Y HD   ++  Q+Y P+ L  + FY P    + +   K +DYW K++
  S:    35 LSDVVGQDHILGPDGALTRMLETRTLGSLIFWGPPGTGKTTVARLLADATALHFEQLSAVFSGVNDLKKAFEAARARRESGTGTLLFVDEVHRFNRAQQDSFLPVMEDGTVVLVGATTENPSFELNAALLSRARVLVFR--SLDALAVEKLFVRAEEVEGKPLPLDAEARAALVRMADGDGRAA---LTLVEEVWRSAREGEVF-DAGQLQGVLQRRAPIYDKSADGHYNLISALHKSVRGSDPDAALYYLARMIEAGEDPLFLARRVVRMAVEDIGLADPQALVICNAAKDAYDFLGSPEGELAIAQAVIYLATAPKSNAAYKAFGAAMR-VAKDAGSLLPPKHILNA----PTKLMKSEGYGGGYQYDHDMPDAFSGQDYFPETLGRQTFYDPPDRGFEREIRKRMDYWAKLR 438
>gi|115525555|ref|YP_782466.1| recombination factor protein RarA [Rhodopseudomonas palustris BisA53] >gi|115519502|gb|ABJ07486.1| Recombination protein MgsA [Rhodopseudomonas palustris BisA53] (442 aa)
Score = 496, Expect = 5.0e-48, Identities = 119/393 (30%), Positives = 215/393 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKE--EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKS 405
           +  +++ +D I   D  +  M+E   L S++F+G PG GK+   + +      +F   ++  +   DL ++ + A    +     ++ ++E+HR NK +QD  L  +E   ++++  TTENP F++N A+ SR  +    +++ A +++  E  + +E KK+ L  +    +V ++  D R      + V +  +     D   L+++ +    + D+ A  HY+L+SA HKS+RGSDP+AA+YYL ++ ++G D + + RR+  +  EDIGLA+       NAA +A + LG PE  + ++Q  I L  +PKSN+A  A   A+++  +  +L PP H+ +A        N   GY+Y HD   ++  Q Y P  L   +FY P    + +   K +DYW K+++
  S:    34 ALSDVVGQDHILGPDGALTRMLETRSLGSLVFWGPPGTGKTTVARLLADATELHFEQISAVFSGVADLKKVFDAARARREMGRGTLLFVDEVHRFNKAQQDSFLPVMEDGTVVLVGATTENPSFELNAALLSRARVLVFSSLDPAAIEKLYENAEAVEGKKLPLDAEARAVLVRMADGDGRAALTLAEEVWRAARKGEVFDAAQLQDILQRRAPIYDKSADGHYNLISALHKSVRGSDPDAALYYLCRMFDAGEDPLFLARRVVRMAVEDIGLADPQALVICNAAKDAYDFLGSPEGELAIAQAVIYLATAPKSNAAYKAYGAAMRAAKEGGSLLPPKHILNAPTKLMKSENYGAGYQYDHDTPEAFSGQNYFPDALGRPQFYDPPDRGFEREIRKRLDYWAKLRA 439
>gi|75812394|ref|YP_320013.1| fused recombination factor protein RarA/unknown domain-containing protein [Anabaena variabilis ATCC 29413] >gi|75705150|gb|ABA24824.1| Recombination protein MgsA [Anabaena variabilis ATCC 29413] (739 aa)
Score = 496, Expect = 5.1e-48, Identities = 121/375 (32%), Positives = 217/375 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK-----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           + DE + +D I     ++   I  + L S++F+G PG GK+   + I      +F   N+  +   ++   ++ A E  K      I+ ++E+HR NK +QD LL ++E   +I++  TTENP+F+VN A+ SR  +++++ +N   L + V + L ++       KVK+ ++ ++ +V ++  D R +   L++ ++        +V   L     S      L D+    H+D +SAF KS+RGSDP+AA+Y+LA+++ +G D   ++RR+  +  ED+GLA+      VNA   A + +G+PE R  L+Q  + L  + KSNS +M   +A+ ++ +E  +  PN+L+DA+       +  GY YP+ Y   +V Q+YLP  L+ + FY+P+
  S:    26 TLDEFVGQDHIIGPGRLLRRAISLDQLSSLIFYGPPGTGKTTLARVIANTTRAHFLAINAVLSGVKEIRAAIDTAQEQRKFHNQRTILFVDEVHRFNKSQQDALLPWVENGTVILIGATTENPYFEVNKALVSRSRIFQLKALNDEDLYKVVEQTLTDEQRGYGCLKVKIDDEALKHLVNVANGDARSLLNALELAVETTPPDETGVVHINLAVAEESIQQRAVLYDKEGDVHFDTVSAFIKSLRGSDPDAALYWLAKMVYAGEDPRFIFRRMLILASEDVGLADPNAVVVVNACNEAFDRVGMPEGRYHLAQAALYLATAAKSNS-VMEFFDALAAIEQEKEAEVPNNLKDANRDKKGFGHGAGYLYPYAYRDHWVAQQYLPATLQGQVFYQPS 419
>gi|46117090|ref|XP_384563.1| hypothetical protein FG04387.1 [Gibberella zeae PH-1] (1226 aa)
Score = 495, Expect = 6.0e-48, Identities = 125/371 (33%), Positives = 211/371 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVK-----------LSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKEL-GKITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK---EALSPPNHLRDAHYASAVKLNVKG-YKYPHDYNFSYVEQEYLPKELKNKEF 383
           + DE+  +D++ P   ++ ++IE++ + S++ +G  G GK+   + I   +   F   N+T+   ++  +  + AT D      K II  +EIHR NK +QD+ L  +E   + ++  TTENP FKV  A+ SR   + + ++ +    E+V++ L+ + +K           L   +V  +   +  D R       + L     K + I  +++   +T +L+ DR    HYD +SAFHKS+RG+D +AA+YYLA++L+SG D + + RR+  +  ED+GLA++ L P   A   A++ +G+PEARIPL+   + LC +PKS  A  A++ A  ++ +     L  P HLR+A       +     YKYP +Y    V+Q YLP EL  + F
  S:   822 TLDEVCGQDLVGPT-GVLRSLIESSQVPSMILWGASGTGKTTIARCIAHMVGSRFIELNATSTGVSECKKYFQEATNDLALTGRKTIIFCDEIHRFNKAQQDVFLKPVEAGTVTLIGATTENPSFKVASALLSRCRTFTLRSLTT----EDVVRILQ-RAIKEEESVFPSTPLLDEAMVTYLARFADGDARTA--LNLLELALSLTKREGITQEDIKAALTKTLVYDRAGDQHYDTISAFHKSVRGNDADAALYYLARMLQSGEDPLFIARRMVVIASEDVGLADNTLLPLATATYTATQQIGMPEARIPLAHCAVALCNAPKSTKAYRALNNAYAALREPGVAGLPVPLHLRNAPTRLMRDMGYGAEYKYPPNYREGRVKQTYLPDELLGRRF 1207
>gi|116205431|ref|XP_001228526.1| hypothetical protein CHGG_10599 [Chaetomium globosum CBS 148.51] >gi|88176727|gb|EAQ84195.1| hypothetical protein CHGG_10599 [Chaetomium globosum CBS 148.51] (587 aa)
Score = 495, Expect = 6.2e-48, Identities = 126/372 (33%), Positives = 217/372 (58%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYL----ENKKVKLS----NKVVEAIVEISKSDFRQIFFYLKIVLKYYQ---NKSDDIVLKELGK--ITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK---EALSPPNHLRDAHYASAVKLNVKG-YKYPHDYNFSYVEQEYLPKELKNKEF 383
           ++ D +  +D++ P + ++ ++IE++ + S++ +G  G GK+   + I +++   F   N+T+    +  ++      EL     + II  +EIHR NK +QD+ L  +E   I ++  TTENP F+V  A+ SR   + ++++    ++  +++ L    E + ++LS     +++  +   +  D R     L++ L       +   + V KE  K  +T +L+ DR    HYD +SAFHKS+RGSD +AA+YYLA++L+SG D + + RR+  +  ED+GLA+S L P   AA  A++ +G+PEARIPL+   + LCL+PKS  A   ++ A+ ++ +    AL  P HLR+A       +     YKYP +Y    V Q YLP  L  + F
  S:   168 DTLDHVFGQDLVGP-NGVLRSLIESDRVPSMILWGGSGTGKTTIARCIARRVGCRFIELNATSTGVAECKKLFAEAANELGLTGRRTIIFCDEIHRFNKGQQDVFLKPVEAGTITLIGATTENPSFRVQAALLSRCRTFTLQSLTEDDIQHILLRALQQEVEQEGLELSPLIDQELLRYLSSFADGDARTALNLLELALSLTNRPPSSDSEPVTKESIKAALTKTLVYDRAGDQHYDTISAFHKSVRGSDADAALYYLARMLQSGEDPLFIARRMVVIASEDVGLADSTLLPLATAAYTATQQIGMPEARIPLAHCAVALCLAPKSTRAYRGLNNALSALQEPGVAALPVPLHLRNAPTRLMRDMGYGAEYKYPPNYRDGRVRQVYLPDGLVGRRF 562
>gi|169629937|ref|YP_001703586.1| hypothetical protein MAB_2853c [Mycobacterium abscessus] >gi|169241904|emb|CAM62932.1| Conserved hypothetical protein [Mycobacterium abscessus] (451 aa)
Score = 495, Expect = 6.4e-48, Identities = 119/393 (30%), Positives = 219/393 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL---IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV--NKEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKS 405
           + DE++ +  +  + S +  +++ +   S++ +G PG GK+     I     + F   ++ +    ++  ++E     LA    + ++ I+E+HR +K +QD LL  +E  +++++A TTENP F V   + SR L+ +++ +    ++E + + + +++     V +  + +  +V+++  D R+    L++  +        I ++ + +  +      DR    HYD++SAF KSIRGSD +AA++YLA++L +G D   V RRL  +  ED+G+A+    P   AA    + +G+PEA++ L+  TI L  +PKS +   A+  A+  +   K  L PP HLRD HY+ A KL N  GY YPH+     V Q+Y P EL   ++Y+P  +  NE +      K+++
  S:    36 TLDEVVGQGHLLKQGSPLRRLVDGSGAASVILYGPPGTGKTTLASLISGATGRRFEALSALSAGVKEVRAVIENSRTALAYHGQQTVLFIDEVHRFSKTQQDALLAAVENRVVLLVAATTENPSFSVVAPLLSRSLILQLQPLADNDIREVLTRAIADERGLGGAVAVDPEALSLLVQLAAGDARRALTALEVAFETAGGAGSVISVEVVEQSVDRAAVRYDRDGDQHYDVVSAFIKSIRGSDVDAALHYLARMLTAGEDPRFVARRLMILASEDVGMADPTALPLAVAAAQTVQLIGMPEAQLTLTHATIHLATAPKSGAVPAALGAAMGDIREGKAGLVPP-HLRDGHYSGAAKLGNAVGYVYPHNDRDGVVAQQYPPDELVGADYYQPTDHG-NEREIGSRLEKLRA 443
>gi|115391273|ref|XP_001213141.1| hypothetical protein ATEG_03963 [Aspergillus terreus NIH2624] >gi|114194065|gb|EAU35765.1| hypothetical protein ATEG_03963 [Aspergillus terreus NIH2624] (531 aa)
Score = 495, Expect = 7.1e-48, Identities = 130/371 (35%), Positives = 214/371 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLS-----------NKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGK-ITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK---EALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEF 383
           + DE+  +D++ P + ++  +IE + + S++ +G PG GK+   + I   +   F   NST+    +  +I      EL     K II  +EIHR +K +QD+ L  +E   + ++  TTENP FKV  A     LL R      A L +E +K + N+ +++            ++++  + + S  D R     L++ +    +K  DI  +EL + +T +L+ DR    HYD +SAFHKS+RGSDP+AA+YYLA++++SG D + + RRL  V  EDIGLA++ +     +  +A E +GLPEARI L+  T+ + L+ KS  +   ++ A  ++ +     L  P HLR+A      +L   K YKY  +Y    V QEYLP++L+ ++F
  S:   130 TLDEVCGQDLVGP-NGVLRGLIEQDRVPSMVLWGGPGTGKTTIARVIASMVGSRFVEINSTSTGVAECKKIFAEAKSELGLTGRKTIIFCDEIHRFSKSQQDVFLGPVESGQVTLIGATTENPSFKVQSA-----LLSRCRTFTLAKLTDEDVKSILNRALQVEGPNYSPSALVDDELITYLAKFSDGDARTSLNLLELAMDL--SKRPDITKEELKRSLTKTLVYDRAGDQHYDTISAFHKSLRGSDPDAALYYLARMIQSGEDPLYIARRLIVVASEDIGLADNSMLTLAISTHSAVEKIGLPEARINLAHATVAMALAKKSTRSYRGLNNAFAALQEPGVAGLPIPIHLRNAPTRLMKELGYGKEYKYNPNYVDGEVAQEYLPEQLRGRKF 515
>gi|57233987|ref|YP_182021.1| recombination factor protein RarA [Dehalococcoides ethenogenes 195] >gi|57224435|gb|AAW39492.1| ATPase, AAA family [Dehalococcoides ethenogenes 195] (457 aa)
Score = 495, Expect = 7.3e-48, Identities = 135/373 (36%), Positives = 212/373 (56%)
  Q:    34 IENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENIN----SAVLKE--EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSP----PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQN-ENKFVDYWNKIKSN 406
           IE + + S++F+G PG GK+     I ++L+ +F   ++ +    DL  ++E     L  E  + I+ I+EIHR NK +QD +L Y+E   ++++  TTENP F+VN A+ SR  +Y +  ++    S +LK   E    L N   +L  +  + I   ++ D R     L++ +       D   +  L ++ ++        D+    HYDL+SA HK++RGSDP+AAVY+L ++LE+G D + + RR+     ED+GLA+        AA  A   LG+PE ++ L++  I L  SPKSNS    +  A  SV KE A +P    P HLR+A       L   K YKY H+Y   +V+Q+ LP+ +KN  FY P K  Y  N  N+   +W   K++
  S:    52 IEGDKIPSLIFWGPPGSGKTTLANIIARRLDAHFSALSAVSAGVADLRRVVEEARERLKFERRRTILFIDEIHRFNKSQQDAILPYVEDGTVVLIGATTENPSFEVNSALLSRAQVYVLNPLSEKEISLILKRSLEDPSGLGNYHARLLEEAEKHISSFAQGDARIALNILELAVMTTPPDKDGWRVVGLPQVEDAAQKKSLRYDKSGEQHYDLISALHKTMRGSDPDAAVYWLGRMLEAGEDPLYIARRVIRFATEDVGLADPQGLVVAMAAQQAVHFLGMPEGKLALAEAVIYLAASPKSNS----VYTAYSSVQKEIARNPQADVPLHLRNAPTGLMKDLGYGKDYKYAHNYQNHFVKQQNLPEAIKNSRFYFPGKLGYELNIVNRLRAWWGNAKAD 447
>gi|33239543|ref|NP_874485.1| recombination factor protein RarA [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|33237068|gb|AAP99137.1| ATPase [Prochlorococcus marinus subsp. marinus str. CCMP1375] (446 aa)
Score = 494, Expect = 7.4e-48, Identities = 119/372 (31%), Positives = 214/372 (57%)
  Q:    15 DEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN-------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNS--AIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           DE + +D I  +  ++   IE + + +++F G PGVGK+   + I       F   N+      ++ + +E A E       K I+ ++E+HR N  +QD LL ++E    I++  TTENP+F+VN A+ SR  ++R+  I    L + +++ L +       K+VKLS+     +V+++  D R +   L++ ++     +  ++  +L     S      L D+    H+D +SAF KS+RGSDP+A+++++A++LE+G+    ++RR+     EDIGLA+      + +  +A + +GLPE    LS+  + L  + KSNS   I++   A+++  K+ +  P HLRD+H       +  GY YPH++  ++V Q YLP EL  ++F++P
  S:    30 DEFVGQDAILAEGRLLRRAIEADRVGNLIFHGPPGVGKTTLAKIIAANTRSYFSVLNAVLVGVKEIRKEVEDARERLGRYGLKTILFLDEVHRFNSAQQDALLPWVENGTFILIGATTENPYFEVNKALVSRSRIFRLTPIEPHHLHKLLVRALSDSEKGFGKKQVKLSSDAANHLVDVANGDARSLLNALELAVETTAIDAKGVINIDLQIAEESIQQRAVLYDKEGDAHFDTISAFIKSMRGSDPDASLFWMARMLEAGENPRYIFRRMLIAASEDIGLADPQAIVVIESCASAFDRVGLPEGIYFLSEAALYLACAEKSNSILGILSAQRAVRTTQKQDV--PRHLRDSHRDGVHSGDGDGYLYPHNFADNWVSQNYLPHELTKEKFWEP 420
>gi|163812060|ref|ZP_02203739.1| AAA ATPase, central domain protein [Dehalococcoides sp. VS] >gi|157404248|gb|EDO70289.1| AAA ATPase, central domain protein [Dehalococcoides sp. VS] (457 aa)
Score = 494, Expect = 7.9e-48, Identities = 135/373 (36%), Positives = 211/373 (56%)
  Q:    34 IENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENIN----SAVLKE--EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSP----PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQN-ENKFVDYWNKIKSN 406
           IE + + S++F+G PG GK+     I ++L+ +F   ++ +    DL  ++E     L  E  + I+ I+EIHR NK +QD +L Y+E   ++++  TTENP F+VN A+ SR  +Y +  ++    S +LK   E    L N   +L     + I   ++ D R     L++ +       D   +  L ++ ++        D+    HYDL+SA HK++RGSDP+AA+Y+L ++LE+G D + + RR+     ED+GLA+        AA  A   LG+PE ++ L++  I L  SPKSNS    +  A  SV KE A +P    P HLR+A       L   K YKY H+Y   +V+Q+ LP+ +KN  FY P K  Y  N  N+   +W   K+N
  S:    52 IEGDKIPSLIFWGPPGSGKTTLANIIARRLDAHFSALSAVSAGVADLRRVVEEARERLKFERRRTILFIDEIHRFNKSQQDAILPYVEDGTVVLIGATTENPSFEVNSALLSRAQVYVLNPLSEKEISLILKRSLEDQNGLGNYHARLLEDSEKHISSFAQGDARIALNILELAVMITPPDKDGCRVVGLPQVEDAAQKKSLRYDKSGEQHYDLISALHKTMRGSDPDAAIYWLGRMLEAGEDPLYIVRRVIRFATEDVGLADPQGLVVAMAAQQAVHFLGMPEGKLALAEAVIYLATSPKSNS----VYTAYSSVQKEIARNPQADVPLHLRNAPTGLMKDLGYGKDYKYAHNYQNHFVKQQNLPEAIKNSRFYFPGKLGYELNIVNRLRAWWGNAKAN 447
>gi|71064675|ref|YP_263402.1| recombination factor protein RarA [Psychrobacter arcticus 273-4] >gi|71037660|gb|AAZ17968.1| Recombination protein MgsA [Psychrobacter arcticus 273-4] (429 aa)
Score = 494, Expect = 8.1e-48, Identities = 129/395 (32%), Positives = 220/395 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENIN----SAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS-----DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLL---ESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYK--PNKYSQNENKFVDYWNKIKSNN 407
           + D +I ++ +    + +  ++E   L SI+  G  G+GK+     +   + + F+  ++       L E+L+  ++D+     P++ I+EIHR NK +QD LL  +E   I ++  TTENP F VN A+ SR  +YR+E +     SAVL+  +++    K++ +  +  + I +++  D R+    L++ ++    K      DD ++  + +      D+    HYD++SA  KS+RGSDP+AA+Y++A++L   E  D I+  RRL  +  EDIG AN       +AA+ + +++G+PEARI L Q+ + L  S KSNS   AI+ A+    K+A   P HLR+       +    + Y YPH+Y   Y  Q YLP +L    FY+   N+  Q+  +FVD+     ++N
  S:    19 TLDTIIGQEHLLAVGAPLRRLVEQGHLPSIILHGEAGIGKTTIAMLLADAVGRPFHALSALNTGVKQLREVLD--SKDSLSFESPVVFIDEIHRFNKAQQDALLGAVESGDITLIGATTENPSFSVNNALLSRCQVYRLEPLTPEQISAVLQRALLEDNVLKQLSIDLQAQQTISQLAHGDARKSLNLLELAIQTADTKQSPIIIDDALVARVAQTALVRYDKDGEQHYDIVSAMIKSVRGSDPDAALYWMARMLVGGEPADFIA--RRLVILASEDIGNANPNALLLADAALRSVQSIGMPEARIILGQVVVYLATSAKSNSTYNAINAAMSLAEKDASPVPLHLRNGVTKLMRQQGYGQDYVYPHNYPNHYYAQNYLPDKLIGTRFYEFADNQREQHSKQFVDWLKSQAASN 428
>gi|27380478|ref|NP_772007.1| recombination factor protein RarA [Bradyrhizobium japonicum USDA 110] >gi|27353642|dbj|BAC50632.1| bll5367 [Bradyrhizobium japonicum USDA 110] (445 aa)
Score = 494, Expect = 8.7e-48, Identities = 125/392 (31%), Positives = 226/392 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLK------EEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV----LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNVK-----GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIK 404
           +  E++ +D I   D  +  M+E   L S++F+G PG GK+   + +    + +F   ++  +   DL +  + A    +     ++ ++E+HR N+ +QD  L  +E   ++++  TTENP F++N A+  R+R+L++R  ++++A ++      EEV    E KK+ L  +    +V ++  D R      + V +    ++D+I     L+++ +    + D+ A  HY+L+SA HKS+RGSDP+AA+YYLA++L++G D + + RR+  +  EDIGLA+       NAA +A + LG PE  + ++Q  + L  +PKSN+   A   A+Q+  +  +L PP H+ +    S  KL         Y+Y HD   ++  Q+Y P+ L  + FY P +  + +   K +DYW K++
  S:    34 ALSEVVGQDHILGPDGALTRMLETRTLGSLVFWGPPGTGKTTVARLLADATDLHFEQISAVFSGVADLKKAFDAARARREMGKGTLLFVDEVHRFNRAQQDSFLPVMEDGTVVMVGATTENPSFELNAALLSRARVLVFR--SLDAAAIEKLFAHAEEV----EGKKLPLDAEARAVLVRMADGDGRASLTLAEEVWR--SARADEIFNAAQLQDILQRRAPIYDKSADGHYNLISALHKSVRGSDPDAALYYLARMLDAGEDPLFLARRVVRMAVEDIGLADPQALVIANAAKDAFDFLGHPEGELAIAQAVVYLATAPKSNAVYTAFGAAMQTAKQAGSLLPPKHILN----SPTKLMKSEGYGAAYEYDHDAPDAFSGQDYFPEALGRQTFYDPPERGFEREIRKRLDYWAKLR 438
>gi|25028305|ref|NP_738359.1| recombination factor protein RarA [Corynebacterium efficiens YS-314] >gi|23493589|dbj|BAC18559.1| conserved hypothetical protein [Corynebacterium efficiens YS-314] (452 aa)
Score = 494, Expect = 8.7e-48, Identities = 125/387 (32%), Positives = 219/387 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI--DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEAL-SPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDY 399
           + DE++ +  +      +  +IE +   S++ +G PG GK+     I       F   ++ ++   ++ E++  A  D     + ++ I+E+HR +K +QD LL  +E   ++++A TTENP F V   + SR LL ++E +    ++  + + L +++     +  S   ++ +V ++  D R+   Y++   +   +  +  +      +  +++  DR    HYD++SAF KSIRGSD +AA++YLA+++E+G D   + RRL     EDIG+A+ G      AA  A + +G+PEARI L+Q TI L  +PKSN+ I A+D A+  V +  + + P HLRD HY  A K+ N  GY YPHD     V Q+YLP+ L+++ +Y+P  +   E +  +Y
  S:    42 TLDEVVGQQHLLGPGRPLRRLIEGSGEASVILYGPPGTGKTTIASLISAATGDRFVALSALSSGVKEVREVINRARTDLIHGARTVLFIDEVHRFSKTQQDALLAAVENRTVLLVAATTENPSFSVVAPLLSRSLLLQLEPLTDDDVRTVLDRALVDERGLAGRITASAAALDQLVLLAGGDARRGLTYIEAAAEAVADGGELTLDTVRDNVNRAVVRYDRDGDQHYDVVSAFIKSIRGSDVDAALHYLARMMEAGEDPRFIARRLVIHASEDIGMADPGALQTAVAAAQAVQLIGMPEARITLAQATIHLATAPKSNAVITAMDSALADVKRGHIGTVPAHLRDGHYEGAKKMGNAVGYVYPHDDPRGVVRQDYLPENLRDRVYYQPTDHG-GEKRISEY 441
>gi|149277254|ref|ZP_01883396.1| ATPase, AAA family protein [Pedobacter sp. BAL39] >gi|149232131|gb|EDM37508.1| ATPase, AAA family protein [Pedobacter sp. BAL39] (426 aa)
Score = 494, Expect = 8.9e-48, Identities = 134/381 (35%), Positives = 221/381 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELAT--EDNK---PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENIN----SAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLK-----ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNV---KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           S DE + +  I   D+++   +++  L S++F+G PGVGK+     I + L++ F+  ++  +   D+ ++++ A   +D+    PI+ I+EIHR +K +QD LL  +E+ ++ ++  TTENP F+V  A+ SR  +Y ++ ++    S +L+  + K +  K  K++ K  EA++ +S  D R++   L+I +       D IVL      E  +   +L D+    HYD++SAF KSIRGSDPNAAVY+LA+++E G D + + RRL  +  EDIG AN       N    A   +G PE+RI LSQ    +  SPKSN++  AI++A Q++ K+  + P  L   +  + +  N+   K Y+Y H Y  ++  QEY P  L   + Y P K    E
  S:    15 SLDEYVGQQHIVGPDAVLRKALQSKQLPSMIFWGPPGVGKTTLAYIISQTLDRPFFNLSAINSGVKDIRDVIDRAALLKDSLMGLPILFIDEIHRFSKSQQDSLLGAVERGLVTLIGATTENPSFEVISALLSRCQVYILKALDEGELSGLLQTAIKKDVVLKTKKITIKEHEALIRLSGGDGRKLLNVLEIAINGI--GGDKIVLTNKNVLEHAQQNLALYDKAGEQHYDIISAFIKSIRGSDPNAAVYWLARMIEGGEDPLFIARRLLILASEDIGNANPNALLLANNCFQAVNVIGYPESRIILSQAVTYMASSPKSNASYEAINKA-QALVKQTGNLPVPLLIRNAPTKLMKNIGYGKDYQYSHGYEGNFSPQEYFPDVLSGTKLYDPGKNPAEE 410
>gi|152993934|ref|YP_001359655.1| recombination factor protein RarA [Sulfurovum sp. NBC37-1] >gi|151425795|dbj|BAF73298.1| ATPase, AAA family [Sulfurovum sp. NBC37-1] (393 aa)
Score = 494, Expect = 9.2e-48, Identities = 126/362 (34%), Positives = 209/362 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYL 374
           + DEM+ +  +  +++ +  +IE + L  I  +G PG GK+   + I  +L + FY  N+TT   +DL +I  E A    KP+I I+E+HRL+K++Q++LL ++E +  +V+  +TENP++ +  A+RSR  L+ +E +    +++ + K +  + + +    VE +V  S  D R +      +L+  Q  +  + L+ L +I    +      + +HY+L SA  KSIRGSD +AA+YYLA+L+E G+    + RRL  +  EDIG AN       ++A+N  + +G PEARI LSQ+ I L  SPKSNSA  AI+ A + +    + P P+H         +K + K Y YPH++   +V Q+YL
  S:    12 TLDEMVGQRHLLGEEAPLRKLIEADALPHIFLYGPPGCGKTTLARIIATQLGRPFYEMNATTLKIDDLRKIFKEYANALQKPLIFIDEVHRLSKNQQEVLLPFMENNAALVIGASTENPYYSLTAAMRSRSHLFELEALKQKEMQDYLAKIIALQAMDVEEDAVEYLVFSSGGDVRAMLN----LLESAQMVATPVTLETLKQIRPHAMQAGSSESESHYELTSAMIKSIRGSDIDAALYYLARLIEGGEPAEFIARRLAILASEDIGNANPPALNLASSALNIVKHIGYPEARISLSQLVIYLASSPKSNSAYKAINNAQKVIKNGEIHPIPDH---------IKTHAKSYLYPHNFG-GWVAQKYL 365
>gi|91216068|ref|ZP_01253036.1| putative AAA family ATPase protein [Psychroflexus torquis ATCC 700755] >gi|91185585|gb|EAS71960.1| putative AAA family ATPase protein [Psychroflexus torquis ATCC 700755] (425 aa)
Score = 494, Expect = 9.5e-48, Identities = 133/359 (37%), Positives = 217/359 (60%)
  Q:    30 IINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN------KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVI----------KYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNK----SDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA--LSPPNHLRDAHYASAVKLNVKG-YKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           I  MI+ + + SI+ +G PG+GK+     I K+  ++F+  ++ ++   D+ E+++ A +D        PI+ I+EIHR +K +QD LL  +EK  I ++  TTENP F+V PA+ SR  +Y +   +    KE++I          +YL  K + L  K   +++ +S  D R++    ++++    ++    ++D+V +++ + T +  D+    HYD++SAF KSIRGSDPNAAVY+LA+++E G D+  + RRL  +  EDIG AN       N    A   +G PEARI LSQ  I L  S KSN++  AI +A Q++ KE   LS P  LR+A       L     YKY H+Y  ++++ E++P++L +K  + P K
  S:    30 ISQMIKRDLIPSIILWGPPGIGKTTLANLISKETKRSFFTLSAISSGVKDVREVIQKAKQDQGLFEQKNPILFIDEIHRFSKSQQDSLLGAVEKGWITLIGATTENPSFEVIPALLSRCQVYTLNEFS----KEDLILLLNRAKSEDEYLSKKNITL--KETTSLLRLSGGDARKLLNMFELIVNSVDDENIIITNDLVEEKIQQKT-ARYDKTGGQHYDIISAFIKSIRGSDPNAAVYWLARMIEGGEDVKFIARRLIILSSEDIGNANPTALIMANNTFQAVNTIGFPEARIILSQCVIYLATSQKSNASYQAIKDA-QALIKETGDLSVPLTLRNAPTKLMKDLGYGNEYKYAHNYENNFIQTEFMPEDLTDKVLFNPGK 404
>gi|33863885|ref|NP_895445.1| fused recombination factor protein RarA/unknown domain-containing protein [Prochlorococcus marinus str. MIT 9313] >gi|33635468|emb|CAE21793.1| putative ATPase, AAA family [Prochlorococcus marinus str. MIT 9313] (735 aa)
Score = 493, Expect = 1.1e-47, Identities = 119/376 (31%), Positives = 212/376 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE-------NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           + +E + +  I  +  ++   I  + + ++L  G PGVGK+   + I      NF   N+      +L + ++ A +       + I+ I+E+HR N  +QD LL ++E   + ++  TTENP+F+VN A+ SR  L+R++ + +A L   +   L+       +++V LS      +V ++  D R +   L++ ++  +      +   L     S      L D+    H+D +SAF KS+RGSD +AA+++LA+++E+G+    ++RR+     EDIGLA+      V A   A E +GLPE   PL+Q T+ L  + KSNS ++   EA+++V + +    P+HLRD+H   A   +  GY+YPH +   +V Q+YLP  L+ + F++P++
  S:    28 TLEEFVGQGSILAEGRLLRRAIAADRVGNLLLHGPPGVGKTTLARIIAGHTRANFSSLNAVLAGVKELRQEVDAAKQRLERHGLRTILFIDEVHRFNSAQQDALLPWVENGTVTLIGATTENPYFEVNKALVSRSRLFRLQALENADLHRLLKHALQDCERGYGDRQVMLSTAAANHLVNVANGDARSLLNALELAVESSRPNEQGSIHINLAIAEESIQERAVLYDKHGDAHFDTISAFIKSLRGSDADAALFWLARMVEAGENPRFIFRRMLIAAGEDIGLADPQAIVVVEACAAAFERIGLPEGLYPLAQATLYLACAEKSNS-VLGFFEALRTVREAQHQDVPSHLRDSHRDGAAFGDGVGYRYPHAFAEHWVSQQYLPTSLQGEVFWQPSQ 422
>gi|190891389|ref|YP_001977931.1| putative ATPase protein [Rhizobium etli CIAT 652] >gi|190696668|gb|ACE90753.1| putative ATPase protein [Rhizobium etli CIAT 652] (438 aa)
Score = 493, Expect = 1.2e-47, Identities = 122/379 (32%), Positives = 218/379 (57%)
  Q:    26 KDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKY---LENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-----KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIK 404
           +D ++  MIE+  L S++F+G PG GK+   + +  +    F   ++  +   DL ++ E A     +  + ++ ++EIHR N+ +QD  L  +E   +I++  TTENP F++N A+  RSR+L ++  +  S    EE++K    +E K + L+ +   +++ ++  D R +    + V +  +     D   L  + +    + D+    HY+L+SA HKS+RGSDP+AA+YYLA++ ++G D + + RRL  +  EDIGLA+       NAA +A E LG PE  + L+Q  + L  +PKSN+   A   A Q+  +  +L PP H+ +A      KL       +GY+Y HD   ++  Q+Y P+++  + FY P +  + ++  K +++W K++
  S:    41 EDGVLKRMIESGSLGSMIFWGPPGTGKTTVARLLSGEAGLAFEQISAIFSGVADLKKVFETARLRRMDGRQTLLFVDEIHRFNRAQQDSFLPVMEDGTVILVGATTENPSFELNAALLSRSRVLTFKSHDEQSL---EELLKRAEAIEQKPLPLTEEARASLIRMADGDGRAVLTLAEEVWRAAREGESFDTEGLTRIVQRRAPVYDKAQDGHYNLISALHKSVRGSDPDAALYYLARMFDAGEDPLYLGRRLVRMAVEDIGLADPQALVICNAAKDAYEYLGSPEGELALAQACVYLATAPKSNAVYTAFKAASQAAKQNGSLLPPKHILNA----PTKLMKGEGYGEGYRYDHDEPDAFSGQDYFPEKMGRQTFYDPPERGFERDIRKRLEWWAKLR 432
>gi|85715102|ref|ZP_01046086.1| ATPase related to the helicase subunit of the Holliday junction resolvase [Nitrobacter sp. Nb-311A] >gi|85698017|gb|EAQ35890.1| ATPase related to the helicase subunit of the Holliday junction resolvase [Nitrobacter sp. Nb-311A] (443 aa)
Score = 493, Expect = 1.2e-47, Identities = 121/392 (30%), Positives = 223/392 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKP----IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIK--YLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA--LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIK 404
           +  +++ +D I   D  +  M+E   L S++F+G PG GK+   + +      +F   ++  +   DL ++ + A    +     ++ ++E+HR N+ +QD  L  +E   ++++  TTENP F++N A+  R+R+L++R  ++++A +++  ++   +E K + L  +   A+  ++  D R     ++ V +  +     +   L+ + +    + D+ A  HY+L+SA HKS+RGSDP+AA+YYLA++LE+G D + + RR+  +  EDIGLA+       NAA +A + LG PE  + ++Q  I L  +PKSN+A  A   A++ + K+A  L PP H+ +A            GY+Y HD   ++  Q+Y P+ L  + FY P    + +   K +DYW K++
  S:    34 TLPDVVGQDHILGPDGALTRMLETRSLGSLIFWGPPGTGKTTVARLLADATALHFEQLSAVFSGVADLKKVFDAARARRESGTGTLLFVDEVHRFNRAQQDSFLPVMEDGTVVLVGATTENPSFELNAALLSRARVLVFR--SLDAAAIEKLFVRAELVEGKPLPLDEEARAALARMADGDGRAALTLVEEVWRSAREGEAFNAGQLQSVLQRRAPIYDKSADGHYNLISALHKSVRGSDPDAALYYLARMLEAGEDPLFLARRVMRMAVEDIGLADPQALVICNAAKDAYDFLGSPEGELAIAQAVIYLATAPKSNAAYKAFGAAMR-IAKDAGSLLPPKHILNAPTGLMKSEGYGGGYQYDHDMPDAFSGQDYFPETLGRQTFYNPPDRGFEREIRKRMDYWAKLR 438
>gi|148269554|ref|YP_001244014.1| fused recombination factor protein RarA/unknown domain-containing protein [Thermotoga petrophila RKU-1] >gi|147735098|gb|ABQ46438.1| Appr-1-p processing domain protein [Thermotoga petrophila RKU-1] (599 aa)
Score = 492, Expect = 1.5e-47, Identities = 127/383 (33%), Positives = 221/383 (57%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLAN-SGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKF 396
           F++ + +D IF    I+   ++  ++FS + +G PG GK++    + +  N    Y +ST +  +++  +L    +L     K ++ ++EIHRLNK++Q +L+ ++E+  I+++ATTTENP F + PA+ SR  +   + ++   L + + K     K+ L     +AIV+ S+ D R++   L+IV + ++NK     L++L  +  ++      +HYD  SAF KS+RGSDPNAAVYYL +++E G D   + RR+     ED+GLA+ + L   V+ ++ A E +GLPE  + L +  I L L+PKSNS  +A+ +A + + ++    P  LR+       K    +GY YPHD+   +V+  YLP++LK +  ++P +    E  F
  S:    17 FEDFVGQDHIFGDKGILRRTLKTGNMFSSILYGPPGSGKTSVFSLLKRYFNGEVVYLSSTVHGVSEIKNVLKRGEQLRKYGKKLLLFLDEIHRLNKNQQMVLVSHVERGDIVLVATTTENPSFAIVPALLSRCRILYFKKLSDEDLMKILKKATRVLKLDLEETAEKAIVKHSEGDARKLLNTLEIVHQAFKNKR--ATLEDLETLLGNVSGYTKESHYDFASAFIKSMRGSDPNAAVYYLVKMIEMGEDPRFIARRMIIFASEDVGLADPNALHIAVSTSI-AVEHVGLPECLMNLVECAIYLSLAPKSNSVYLAMKKAQELLVEDV---PLFLRNPVTEEMKKRGYGEGYLYPHDFG-GFVKTNYLPEKLKGEVIFQPKRVGFEEELF 399
>gi|116493737|ref|YP_805471.1| recombination factor protein RarA [Lactobacillus casei ATCC 334] >gi|116103887|gb|ABJ69029.1| Recombination protein MgsA [Lactobacillus casei ATCC 334] (448 aa)
Score = 492, Expect = 1.6e-47, Identities = 125/397 (31%), Positives = 220/397 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLK-----ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           + DE + +  +  KD ++ N+IE++++ S++F+G PGVGK+   + I ++    F  F++ T+   ++ ++++ A ++     K I+ ++EIHR NK +QD  L Y+E+  II++  TTENP F+VN A+ SR  ++ +  + SA L + + + L++      +KVK+  K++  I + +  D R     L++ +   + K   I +      +L      L D+    HY+L+SA HKS+R SD +AA+Y+LA++LE+G D + V RRL     EDIG+A+S       A   A + +G+PE  + L+     L L+PKSN+   A + A +   +    P P  +R+        L   K Y+Y H+        + +P  L  K +Y P     +E K  +   +IK+ + Q
  S:    22 TLDEFVGQTHLLGKDKVLSNLIEHDEISSMIFWGPPGVGKTTLARIIARRTKAQFVTFSAVTSGIKEIKQVMKEAEQNRELGQKTIVFVDEIHRFNKAQQDAFLPYVERGSIILIGATTENPSFEVNAALLSRTRVFVLHGLTSAELVDLLQRALKDPRGYGLQKVKIGKKLLAQIADFANGDARIALNTLEMAVTNAETKGGVITVTQADVAQLLTKKALLYDKNGEEHYNLISALHKSMRNSDVDAAIYWLARMLEAGEDPLYVARRLVRFASEDIGMADSRALEITIAVYQACQFIGMPECTVHLTHAVTYLALAPKSNALYTAYEGAKKDATETLAEPVPLQIRNGVTDLMQDLGYGKDYQYAHNTKDKLTTMQTMPDNLIGKTYYHPTTQG-SEAKVKERLEQIKAWHAQ 435
>gi|163786201|ref|ZP_02180649.1| ATPase, AAA family protein [Flavobacteriales bacterium ALC-1] >gi|159878061|gb|EDP72117.1| ATPase, AAA family protein [Flavobacteriales bacterium ALC-1] (425 aa)
Score = 491, Expect = 1.7e-47, Identities = 128/368 (34%), Positives = 213/368 (57%)
  Q:    26 KDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED------NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN----KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNK----SDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           KD ++   I++  + S++ +G PG+GK+     I  +  + F+  ++  +   D+ E+++ A +         PI+ I+EIHR +K +QD LL  +EK  + ++  TTENP F+V  A+ SR  +Y +   + A L+  + + ++      K+K+  K  EA++  S  D R++    ++++  +  +    ++++V K++ +   +  D+    HYD++SAF KSIRGSDPNAAVYYLA+++E G D+  + RRL  +  EDIG AN       N    A   +G PE+RI LSQ T  L  SPKSN+A  AI++A Q V     LS P  +R+A      +L     YKY H Y+ ++ E E+LP E+ N + Y P   ++ +
  S:    26 KDGMLYQQIKSGVIPSLILWGPPGIGKTTLANIIANESERPFFKLSAINSGVKDIREVIDKAKKSGGLFTAKNPILFIDEIHRFSKSQQDSLLEAVEKGWVTLIGATTENPSFEVISALLSRCQVYTLNAFSKADLEALLQRAIKEDDTISKLKIKLKETEALLRFSGGDARKLLNIFELLVTSFDTEPIVITNELVTKQV-QNKAARYDKTGEQHYDIISAFIKSIRGSDPNAAVYYLARMIEGGEDVKFIARRLLILASEDIGNANPTALVIANNTFQAVSVIGNPESRIILSQCTTYLASSPKSNAAYEAINKAQQLVKDTGDLSVPLSIRNAPTKLMKELGYGDQYKYAHSYDNNFAEHEFLPDEIANTKLYNPGNNAREQ 409
>gi|52425453|ref|YP_088590.1| recombination factor protein RarA [Mannheimia succiniciproducens MBEL55E] >gi|52307505|gb|AAU38005.1| unknown [Mannheimia succiniciproducens MBEL55E] (449 aa)
Score = 491, Expect = 1.7e-47, Identities = 131/392 (33%), Positives = 216/392 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIE---NINSAVLKEEVIKYLEN---KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKE--LGKITNS---LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           S DE + +  +     ++  MI  ++L S++F+G  GVGK+   Q I  + N  F  F++  +   D+ +I+E A  D     K I+ I+EIHR NK +QD  L Y+EK  II++  TTENP F++N A+ SR  ++ +E   N +  +L ++ + + +     +V    K+++AI E +  D R     L++ +K  + + + + L E  L  I N+   + D+    HY+++SA HK++R SDP+AA+Y+L+++LE G D + + RRL     EDIGLA++           A   +G+PE  + L++  + L L+PKSN+   A  +  + V      P P HLR+A       L   KGYK  H Y       + +P  L  K++Y P +   NE +F     +IK
  S:    34 SLDEFVGQKHLLEPGKVLQQMIVQDELSSMIFWGPSGVGKTTLAQIIAHQTNAKFITFSAVVSGIKDIKKIMEEAETDREMGEKTIVFIDEIHRFNKAQQDAFLPYVEKGSIILIGATTENPSFEINSALLSRCKVFVLEALSNNDIVLLLKQALNHPQAFIPLEVNADEKLLQAIAEFANGDARIALNTLELAVKNVEKQGNSVHLSENLLADILNNRQIVYDKTGEEHYNIISALHKAMRNSDPDAAIYWLSRMLEGGEDPVYIARRLIRFAGEDIGLADTNALTLTTNVFQACRFIGMPECDVHLTEAVVYLSLAPKSNAIYQARCKVREDVKNTRNDPVPLHLRNAPTKLMKNLGYGKGYKLAHHYEDKLTTMQTMPDNLLGKQYYFPTE-EGNEQRFKARLAQIK 442
>gi|134098618|ref|YP_001104279.1| recombination factor protein RarA [Saccharopolyspora erythraea NRRL 2338] >gi|133911241|emb|CAM01354.1| AAA ATPase, central region [Saccharopolyspora erythraea NRRL 2338] (453 aa)
Score = 490, Expect = 2.2e-47, Identities = 126/374 (33%), Positives = 208/374 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQ-NKSDDIVLKELGKITNS---LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S DE+I +  +    + +  ++E     S+L +G PG GK+     +     + F   ++ ++   ++  ++E     L       ++ I+E+HR +K +QD LL  +E   ++++A TTENP F V   + SR L+ ++ +     ++E V + + +++     ++L  +    +V ++  D R+    L+   +      SD I L  +    +    L DR    HYD++SAF KSIRGSD +AA++YLA+++E+G D   + RRL     EDIG+A+        AA  A + +G+PE R+ L+Q TI L  +PKSN+ I AIDEA+  V      P P HLRD HYA A +L N +GY+YPH      + Q+Y P EL  +++Y P
  S:    37 SLDEVIGQKHLLGPGAPLRRLVEGAAPASVLLYGPPGTGKTTLANLVSLATGRRFVALSALSSGVKEVRAVIEEARRRLGRTAEATVLFIDEVHRFSKTQQDALLGAVEDRTVLLVAATTENPSFSVVAPLLSRSLVLQLRSHGEDDIRELVRRAVADERGLGGALELEPEAEAHLVSLAGGDARRALTALEAAAESAASTGSDKIDLTTVEATVDRAAVLYDRDGDQHYDVVSAFIKSIRGSDVDAALHYLARMVEAGEDPRFIARRLVVHASEDIGMADPTALQAAVAASQAVQFIGMPEGRLALAQATIHLATAPKSNAVITAIDEALGDVRAGKAGPVPPHLRDGHYAGASRLGNAQGYRYPHGRTEGVLAQQYPPSELVGRDYYNP 427
>gi|111024084|ref|YP_707056.1| recombination factor protein RarA [Rhodococcus sp. RHA1] >gi|110823614|gb|ABG98898.1| ATPase related to the helicase subunit of the Holliday junction resolvase [Rhodococcus sp. RHA1] (478 aa)
Score = 490, Expect = 2.3e-47, Identities = 123/357 (34%), Positives = 207/357 (57%)
  Q:    33 MIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK---------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI---VLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV--NKEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKY 389
           ++E +   S+L +G PG GK+     I     + F   ++ +    ++  ++ELA        + ++ I+E+HR +K +QD LL  +E  +++++A TTENP F V   + SR L+ +++++ +    +++   LE  +         ++++   ++ +V ++  D R+    L+       +++ D    VL +L  +  S+       DR    HYD++SAF KSIRGSD +AA++YLA++L +G D   + RRL     EDIG+A+        AA  A + +G+PEAR+ L+Q TI L  +PKS + I A+  A+  V      L PP HLRD HYA A KL N  GY+YPHD+    + Q+Y P EL   ++Y+P  +
  S:    73 LVEGSGAASVLLYGPPGTGKTTLASLISGATGRRFEALSALSAGVKEVRGVIELARRRLLAGEQTVLFIDEVHRFSKTQQDALLAAVENRIVLLVAATTENPSFSVVSPLLSRSLVLQLQSLTA----DDIENLLERARTDERGLGGEIEIAGDAMDHLVRLAAGDARRALTALEAAAGAALDQAGDTDRPVLLDLATVEASVDKAAVRYDRDGDQHYDVISAFIKSIRGSDVDAALHYLARMLTAGEDPRFIARRLVVHASEDIGMADPTALQTATAAAQAVQLIGMPEARLALAQATIHLATAPKSGAVIAALGAAMADVAAGNAGLVPP-HLRDGHYAGAAKLGNAVGYRYPHDHPDGVLAQQYPPDELVGVDYYQPTTH 450
>gi|148256359|ref|YP_001240944.1| recombination factor protein RarA [Bradyrhizobium sp. BTAi1] >gi|146408532|gb|ABQ37038.1| Recombination protein MgsA [Bradyrhizobium sp. BTAi1] (444 aa)
Score = 490, Expect = 2.4e-47, Identities = 121/393 (30%), Positives = 221/393 (56%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKP----IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKE--EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV----LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE--ALSPPNHLRDAHYASAVKLNV-----KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIK 404
           +   +++ +D I   D  +  M+E   L S++F+G PG GK+   + +      +F   ++  +   DL ++ + A    +     ++ ++E+HR N+ +QD  L  +E   ++++  TTENP F++N A+ SR  +    ++++A ++      + +E +K+ L ++    ++ ++  D R      + V +    + D+I     L+E+ +    + D+ A  HY+L+SA HKS+RGSDP+AA+YY A++L++G D + + RR+  +  EDIGLA+       NAA +A + LG PE  + ++Q  I +  +PKSN+A  A   A + V KE  +L PP H+ +A      KL        GY+Y HD   ++  Q+Y P+ L  + FY P +  + +   K +DYW K++
  S:    34 HKLSDVVGQDHILGPDGALTRMLETRTLGSLIFWGPPGTGKTTVARLLADATELHFEQISAVFSGVADLKKVFDAARARRETGQGTLLFVDEVHRFNRAQQDSFLPVMEDGTVVLVGATTENPSFELNAALLSRSRVLVFHSLDAAAIERLYSNAEAVEGRKLPLDDEARAVLIRMADGDGRAALTLAEEVWR--SARKDEIFNAVQLQEILQRRAPIYDKSADGHYNLISAMHKSVRGSDPDAALYYFARMLDAGEDPLFLARRIVRMAVEDIGLADPQALVIANAAKDAYDFLGSPEGELAIAQAVIYVATAPKSNAAYKAFGAA-KRVAKEGGSLLPPKHILNA----PTKLMQGEGYGTGYQYDHDAPDAFSGQDYFPEALGRQHFYDPPERGFEREIRKRLDYWAKLR 439
>gi|191636983|ref|YP_001986149.1| Chromosome segregation helicase (Putative) [Lactobacillus casei] >gi|190711285|emb|CAQ65291.1| Chromosome segregation helicase (Putative) [Lactobacillus casei BL23] (448 aa)
Score = 490, Expect = 2.5e-47, Identities = 124/397 (31%), Positives = 220/397 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLK-----ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           + DE + +  +  KD ++ N+IE++++ S++F+G PGVGK+   + I ++    F  F++ T+   ++ ++++ A ++     K I+ ++EIHR NK +QD  L Y+E+  II++  TTENP F+VN A+ SR  ++ +  + SA L + + + L++      +KVK+  K++  I + +  D R     L++ +   + K   + +      +L      L D+    HY+L+SA HKS+R SD +AA+Y+LA++LE+G D + V RRL     EDIG+A+S       A   A + +G+PE  + L+     L L+PKSN+   A + A +   +    P P  +R+        L   K Y+Y H+        + +P  L  K +Y P     +E K  +   +IK+ + Q
  S:    22 TLDEFVGQTHLLGKDKVLSNLIEHDEISSMIFWGPPGVGKTTLARIIARRTKAQFVTFSAVTSGIKEIKQVMKEAEQNRELGQKTIVFVDEIHRFNKAQQDAFLPYVERGSIILIGATTENPSFEVNAALLSRTRVFVLHGLTSAELVDLLQRALKDPRGYGLQKVKIGKKLLAQIADFANGDARIALNTLEMAVTNAETKGGVVTVTQADVAQLLTKKALLYDKNGEEHYNLISALHKSMRNSDVDAAIYWLARMLEAGEDPLYVARRLVRFASEDIGMADSRALEITIAVYQACQFIGMPECTVHLTHAVTYLALAPKSNALYTAYEGAKKDATETLAEPVPLQIRNGVTDLMQDLGYGKDYQYAHNTKDKLTTMQTMPDNLIGKTYYHPTTQG-SEAKVKERLEQIKAWHAQ 435
>gi|148657906|ref|YP_001278111.1| recombination factor protein RarA [Roseiflexus sp. RS-1] >gi|148570016|gb|ABQ92161.1| AAA ATPase, central domain protein [Roseiflexus sp. RS-1] (505 aa)
Score = 489, Expect = 2.8e-47, Identities = 127/374 (33%), Positives = 206/374 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLS--NKVVEA-----IVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + DE + +D I  +  ++   I N+ LFSI+ +G PG GK+   + I    N +F   ++ +    DL  +++ A +       + I+ I+EIHR NK +QD +L Y+E   II++  TTENP F+VNPA+RSR  ++ +E +    +   V + L + +  L   N ++ A     ++ +S  D R     L+              L  +  I ++L       D+    HYD +SA HKS+R SDP+AA+Y+L ++L+ G D + + RR+  +  EDIGLA+    P   AA  A   LG PE  + L+Q  + L  +PKSN+   A   A++ V +    P P HLR+A       L   +GY+Y HD + + V+QE+ P  L+ + +Y+P
  S:    31 TLDEFVGQDHIIGEGKVLRRAISNDALFSIILWGPPGSGKTTLARIIADTTNAHFEQLSAVSAGVADLRRVVKEAQDRLGMFQQRTIVFIDEIHRFNKAQQDAILPYVEDGTIILIGATTENPSFEVNPALRSRARVFVLEALTDDQIGVIVDRALSDTERGLGELNVLLAADARGYLINMSNGDARTALNALEAAALAKPPGVGGKRLITVEDIRDALQSRAVRYDKNGELHYDAISALHKSVRDSDPDAALYWLGRMLDGGEDPLYIARRVVRMAIEDIGLADPQALPLTIAAQQAVHFLGQPEGDLALAQAVVYLAQAPKSNAVYTAYAAALKDVAETRNEPVPLHLRNAPTPLMKGLGYGRGYQYAHDDDDARVDQEHFPPNLQGRRYYEP 425
>gi|118466446|ref|YP_882617.1| recombination factor protein RarA [Mycobacterium avium 104] >gi|118167733|gb|ABK68630.1| ATP/GTP-binding protein [Mycobacterium avium 104] (446 aa)
Score = 489, Expect = 2.8e-47, Identities = 116/374 (31%), Positives = 213/374 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELAT----EDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-----KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S DE++ +D +    S +  ++E + + S + +G PG GK+     I +   + F   ++ +    D+  ++E A        + ++ I+E+HR +K +QD LL  +E  +++++A TTENP F V   + SR L+ ++  +++  ++  V + +++      +V ++ + V+ +V ++  D R+    L++  +  ++ +   V + L +      DR    HYD++SAF KS+RGSD +AA++YLA++L +G D   + RRL  +  EDIG+A+S       AA      +G+PEA++ L+  T+ L  +PKSN+   A+  A+  +   +A   P HLRD HY+ A  L + +GY+Y HD+    V Q+Y P EL   ++Y+P
  S:    35 SLDEVVGQDHLLAPGSPLRRLVEGSGVASAILYGPPGSGKTTLAALISQATGRRFEALSALSAGVKDVRAVIESARTALLRGEQTVLFIDEVHRFSKTQQDALLSAVENRVVLLVAATTENPSFSVVAPLLSRSLILQLRPLSADDIRTVVRRAIDDPRGLGGRVPVAPEAVDLLVRLAAGDARRALTALEVAAEAGESVTVQTVEQSLDEAAVRY-DRDGDQHYDVISAFIKSVRGSDVDAALHYLARMLVAGEDPRFIARRLMILASEDIGMADSAALQVAVAAAQTVALIGMPEAQLTLAHCTVYLATAPKSNAVTTALGAAMSDIKAGKAGLVPAHLRDGHYSGAAALGHAQGYQYSHDHPDGVVAQQYPPDELVGVDYYRP 419
>gi|93004934|ref|YP_579371.1| recombination factor protein RarA [Psychrobacter cryohalolentis K5] >gi|92392612|gb|ABE73887.1| Recombination protein MgsA [Psychrobacter cryohalolentis K5] (429 aa)
Score = 489, Expect = 3.0e-47, Identities = 132/395 (33%), Positives = 225/395 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENIN----SAVLKEEVIK--YLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKE--LGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLL---ESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNV---KGYKYPHDYNFSYVEQEYLPKELKNKEFYK--PNKYSQNENKFVDYWNKIKSNN 407
           + D +I ++ +    + +  ++E   L SI+  G  G+GK+     +   + + F+  ++       L E+L+  ++D+     P++ I+EIHR NK +QD LL  +E   I ++  TTENP F VN A+ SR  +YR++ +     SAVL+  +++   L+N  V L  +  + I +++  D R+    L++ ++    K   I+L +  + +I  + +   D+    HYD++SA  KS+RGSDP+AA+Y++A++L   E  D I+  RRL  +  EDIG AN       +AA+ + +++G+PE+RI L Q+ + L  S KSNS   AI+ A+    K+A   P HLR+    + +  N    + Y YPHDY   Y  Q YLP  L    FY+   N+  Q+  +F+D+     ++N
  S:    19 TLDAIIGQEHLLAVGAPLRRLVEQGHLPSIILHGEAGIGKTTIAMLLADAVERPFHALSALNTGVKQLREVLD--SKDSLSFESPVVFIDEIHRFNKAQQDALLGAVESGDITLIGATTENPSFSVNNALLSRCQVYRLKPLTPEQISAVLQRALLEDNILKNLSVDLQAQ--DTISQLAHGDARKALNLLELAIQTADTKQSPIILDDTLVARIAQTALVRYDKDGEQHYDMVSAMIKSVRGSDPDAALYWMARMLVGGEPADFIA--RRLVILASEDIGNANPNALLLADAALRSVQSIGMPESRIILGQVVVYLATSAKSNSTYNAINAAMSLAEKDASPVPLHLRNG--VTKLMRNQGYGQDYVYPHDYPNHYYAQSYLPDNLIGTRFYEFADNQREQHSKQFIDWLKDQAASN 428
>gi|92117125|ref|YP_576854.1| recombination factor protein RarA [Nitrobacter hamburgensis X14] >gi|91800019|gb|ABE62394.1| Recombination protein MgsA [Nitrobacter hamburgensis X14] (446 aa)
Score = 488, Expect = 4.2e-47, Identities = 123/392 (31%), Positives = 221/392 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKP----IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIK--YLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA--LSPPNHLRDAHYASAVKLNVK-----GYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIK 404
           +  +++ +D I   D  +  M+E     S++F+G PG GK+   + +      +F   ++  +   DL +  + A    +     ++ ++E+HR NK +QD  L  +E   ++++  TTENP F++N A+  R+R+L++R  ++++A +++  ++   +E K + L  +    +V ++  D R     ++ V +  +     D   L+ + +    + D+ A  HY+L+SA HKS+RGSDP+AA+YYLA++ ++G D + + RR+  +  EDIGLA+       NAA +A + LG PE  + ++Q  I L  +PKSN+A  A   A+++  KEA  L PP H+ +A      KL        GY+Y HD    +  Q+Y P+ L  + FY P    + +   K +DYW K++
  S:    34 ALSDVVGQDHILGPDGALTRMLETRTFGSLVFWGPPGTGKTTVARLLADATALHFEQLSAVFSGVADLKKAFDAARARRESGTGTLLFVDEVHRFNKAQQDSFLPVMEDGTVVLVGATTENPSFELNAALLSRARVLVFR--SLDAAAIEKLFVRAEQVEGKPLPLDTEARSVLVRMADGDGRAALTLVEEVWRSAREGEVFDAEQLQGVLQRRAPIYDKSADGHYNLISALHKSVRGSDPDAALYYLARMFQAGEDPLFLARRVVRMAVEDIGLADPQALAICNAAKDAYDFLGSPEGELAIAQAVIYLATAPKSNAAYKAFGAAMRTA-KEAGSLLPPKHILNA----PTKLMKSEGYGGGYQYDHDTPDGFSGQDYFPEALGRRTFYDPPDRGFEREIRKRLDYWAKLR 438
>gi|124021978|ref|YP_001016285.1| fused recombination factor protein RarA/unknown domain-containing protein [Prochlorococcus marinus str. MIT 9303] >gi|123962264|gb|ABM77020.1| putative ATPase, AAA family protein [Prochlorococcus marinus str. MIT 9303] (735 aa)
Score = 488, Expect = 4.3e-47, Identities = 118/376 (31%), Positives = 211/376 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE-------NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           + +E + +  I  +  ++   I  + + ++L  G PGVGK+   + I      NF   N+      +L + ++ A +       + I+ I+E+HR N  +QD LL ++E   + ++  TTENP+F+VN A+ SR  L+R++ + +  L   +   L+       +++V LS      +V ++  D R +   L++ ++  +      +   L     S      L D+    H+D +SAF KS+RGSD +AA+++LA+++E+G+    ++RR+     EDIGLA+      V A   A E +GLPE   PL+Q T+ L  + KSNS ++   EA+++V + +    P+HLRD+H   A   +  GY+YPH +   +V Q+YLP  L+ + F++P++
  S:    28 TLEEFVGQGSILAEGRLLRRAIAADRVGNLLLHGPPGVGKTTLARIIAGHTRANFSSLNAVLAGVKELRQEVDAAKQRLERHGLRTILFIDEVHRFNSAQQDALLPWVENGTVTLIGATTENPYFEVNKALVSRSRLFRLQALENEDLHRLLKHALQDCERGYGDRQVMLSTAAANHLVNVANGDARSLLNALELAVESSRPNEQGSIHINLAIAEESIQERAVLYDKHGDAHFDTISAFIKSLRGSDADAALFWLARMVEAGENPRFIFRRMLIAAGEDIGLADPQAIVVVEACAAAFERIGLPEGLYPLAQATLYLACAEKSNS-VLGFFEALRTVREAQHQDVPSHLRDSHRDGAAFGDGVGYRYPHAFAEHWVSQQYLPTSLQGEVFWQPSQ 422
>gi|114704681|ref|ZP_01437589.1| hypothetical protein FP2506_07091 [Fulvimarina pelagi HTCC2506] >gi|114539466|gb|EAU42586.1| hypothetical protein FP2506_07091 [Fulvimarina pelagi HTCC2506] (464 aa)
Score = 488, Expect = 4.7e-47, Identities = 115/380 (30%), Positives = 216/380 (56%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELAT---EDNKP-IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNVK-----GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
             E++ ++ +  +  I+  M+   +L S++F+G PG GK+   + + K  +  F   ++      DL ++ E A     + +P ++ ++EIHR N+ +QD  L  +E   ++++  TTENP F++N A+  R+R+L ++  +  S  L     + +E K + L ++  + ++ ++  D R I    + V +  +++   D   L+E+ +    + D+    HY+L+SA HKS+RGSDP+AA+Y+L ++L++G D + + RRL  +  EDIGLA+        AA +A + LG PE  + L++ T+ L  +PKSN+   A  +A+++     +L PP H+ +A      KL  +     GY+Y HD   ++  Q+Y P  +K + FY+P ++   +
  S:    55 LSEVVGQEHLTGEGGILSRMLAGKNLGSMIFWGPPGTGKTTVARLLAKDSDYAFEQISAIFTGVADLKKVFESARMRRSNGRPTLLFVDEIHRFNRAQQDSFLPVMEDGTVVLVGATTENPSFELNAALLSRARVLTFKPHDTTSLSLLLNRAETIEEKALPLDDEARQVLLRLADGDGRAILSLAEEVWRAARDREIFDSAALQEIVQRRAPVYDKSQDGHYNLISALHKSVRGSDPDAALYWLCRMLDAGEDPLYLGRRLVRMASEDIGLADPNALRVTLAAKDAYDYLGSPEGELALAEATVYLAAAPKSNAVYTAYKQAMRAARANGSLLPPAHILNA----PTKLMKEEGYGSGYRYDHDEPDAFSGQDYFPAGMKRERFYRPTEFGAEQ 445
>gi|196228384|ref|ZP_03127251.1| AAA ATPase central domain protein [Chthoniobacter flavus Ellin428] >gi|196227787|gb|EDY22290.1| AAA ATPase central domain protein [Chthoniobacter flavus Ellin428] (426 aa)
Score = 487, Expect = 5.4e-47, Identities = 127/391 (32%), Positives = 217/391 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT-------NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVK-LNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKI 403
           S +E   ++ I     ++   IE + + SI+ FG PG GK+   + I       F   +   +N  DL  ++      L  +  K I+ I+EIHR NK +QD+LL  +E+  + ++  TT NPF+ +N  + SR  ++++E +  A L +   + L ++       K++++ + +  +  ++  D R+    L+I +   +     ++  +      S I ++A         HYD +SAF KS+RGSDP+AA+Y+LA++L +G D+  + RRL  +  EDIG+A+        AA  + E +GLPEA+IPL+  T+ L  +PKSN A   I  A + V +   L+ P HLRD     A K    +GY+Y HD+  +YV Q YLP   + + +Y+P+   Y +   + ++YW  +
  S:     5 SLEEYAGQEHILAPGKLLRRAIEADRISSIILFGPPGTGKTTLAEIIASATQSRFERLSGVESNVADLRRVIATAANRLTNKGEKTILFIDEIHRWNKAQQDVLLPDVERGTVRLIGATTHNPFYYINSPLVSRSQVFQLEPLTPADLVKLQKRALTDEERGFGKMKIEVAEEALLHLATVADGDARKCLNALEIAVVTTEPDKAGVIHIDRANAEES-IQKKAVVYDAGDDQHYDTISAFIKSVRGSDPDAALYWLAKMLYAGEDIRFLARRLVILASEDIGMADPQGIVIAVAAQQSVEFIGLPEAQIPLAHATVYLATAPKSNRAYAGILAAKKEVQEGVTLAVPRHLRDKSSKRAAKAFGHEGYQYSHDFEGAYVPQAYLP---EGRRYYEPSDQGYEKRVRERLEYWRAL 415
>gi|114327245|ref|YP_744402.1| recombination factor protein RarA [Granulibacter bethesdensis CGDNIH1] >gi|114315419|gb|ABI61479.1| ATPase, AAA family [Granulibacter bethesdensis CGDNIH1] (452 aa)
Score = 487, Expect = 5.4e-47, Identities = 122/392 (31%), Positives = 221/392 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKP----IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE--NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVL--KELGKITNS---LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLI-SVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKEL---KNKEFYKPNK--YSQNENKFVDYWNKIK 404
           S D+++ +D +   +  +  M E+  L SI+ +G PG GK+   + + +  + +F   ++  +   DL ++ E A +        ++  +EIHR N+ +QD  L  +E   + ++  TTENP F++N A+ SR  +  +  ++ A L+  +++  E   + + +S +  EA+V ++  D R   + L +V + Y     D VL  + LG        + D+    HYDLLS FHKS+RGSDP AA+YY A+++ +G+   +V+RRL     ED+G+A+     +V +A  A E +G PE R+ L+Q    +  +PKSN++  + +EA+    K A + PP H+ +A      +L    GY+Y HD   ++  QE+ P+ L   +  E Y+P++  + ++  K ++YW  ++
  S:    40 SLDDVVGQDHLLGAEGPLRRMTESRVLSSIILWGPPGTGKTTIARLLARSTDLHFEAISAIQSGVADLRKVFEAARQRRAAGKGTLLFCDEIHRFNRGQQDAFLPVVEDGTVTLVGATTENPSFELNSALLSRCRVMVLRRLDEAALERLLVRAEERMERPLPVSAEAREALVAMASGDGR---YMLNLVEQVYTFAGGDQVLDMQTLGHALQRRPPVHDKAGDGHYDLLSCFHKSLRGSDPQAALYYAARMMVAGEAAETVFRRLACAASEDVGMADPQAMVQVVSAWQAFERIGWPEGRLFLAQAINYVATAPKSNASYASFNEALALAEKTAHMPPPLHILNAPTRMMKELGYHAGYQYDHDAPDAFSGQEFFPEPLSGARRPELYRPHQRGFERDIRKRLEYWAGLR 447
>gi|42519086|ref|NP_965016.1| recombination factor protein RarA [Lactobacillus johnsonii NCC 533] >gi|41583373|gb|AAS08982.1| hypothetical protein LJ_1160 [Lactobacillus johnsonii NCC 533] (420 aa)
Score = 487, Expect = 5.4e-47, Identities = 124/374 (33%), Positives = 206/374 (55%)
  Q:    30 IINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN----KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNH-----LRDAHYASAVKLNVKGY-KYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           +  +I+N+   S+L +G PG GK++  Q I ++ +     FN++ +NK  L++I+      +  +++I+EIHR+    QD LL YLE   I+++  TTENP   + PA+RSR  ++  E ++   +   +I+ L+     ++ ++  + +  I   +  D R     L+ +     ++     +KE  K  +   DR+AT HYD L+A+  S+ GSD +AA+YYL  LL++GDL SV RRL  + Y  +GLAN     ++  A N +E +G+P+A+ PL   T+ +CLSPKS     A DE  + ++K+   P  H     LRD HY  + ++   G    P    F   +Q Y+PK L+ K +Y   K + NE K    + K+
  S:    32 LYQIIKNHVPISLLLWGPPGTGKTSLAQIIAREYDYPLATFNASVDNKAKLMQIINTYPYQSF-VLLIDEIHRMTTTLQDYLLPYLENGQILLIGATTENPIMSIVPAVRSRCQIFEFETLDDKDISHVLIRALKEVFHLEEKQIDKEAINIIARSADGDLRVALNLLETIHAINGDEISIESVKEFVKGQHFAYDRKATKHYDYLAAYSDSMAGSDTDAALYYLTVLLKNGDLPSVVRRLREIPYTYVGLANPEQVTQIVVAANQAEKIGMPKAKYPLMFATMLMCLSPKSG----AFDEIWEKLDKDTTHPNEHPMPRGLRDMHYKHSEEITGGGLIDNPFTQPFQIAKQNYMPKGLEGKRYYFA-KDNVNEKKLEQQYLKL 409
>gi|15965138|ref|NP_385491.1| recombination factor protein RarA [Sinorhizobium meliloti 1021] >gi|15074318|emb|CAC45964.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021] (436 aa)
Score = 487, Expect = 5.5e-47, Identities = 119/380 (31%), Positives = 215/380 (56%)
  Q:    27 DSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE---NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-----KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIKSN 406
           D ++  MI +  L S++F+G PG GK+   + +  +    F   ++  +   DL ++ E A        + ++ ++EIHR N+ +QD  L  +E   +I++  TTENP F++N A+ SR  +   +  + A L EE++K  E    K + L ++   +++ ++  D R +    + V +  + +   D   L+E+ +    + D+    HY+L+SA HKS+RGSDP+AA+YYL ++ ++G D + + RRL  +  EDIGLA+       NAA +A + LG PE  + L++  + L  +PKSN+   A   A+++  +  +L PP H+ +A      KL        GY+Y HD   ++  Q+Y P+++  K FY P +  + +   K +++WNK++ +
  S:    41 DGVLTRMIASGSLGSMIFWGPPGTGKTTVARLLSGEAGLAFEQISAIFSGVADLKKVFESARARRMSGRQTLLFVDEIHRFNRAQQDSFLPVMEDGTVILVGATTENPSFELNAALLSRARVLTFKPHDEASL-EELLKRAEAAEGKPLPLDDEARASLIRMADGDGRAVLTLAEEVWRAARREEIFDSAGLQEIVQRRAPVYDKGQDGHYNLISALHKSVRGSDPDAALYYLCRMFDAGEDPLYIGRRLVRMAVEDIGLADPQALAICNAAKDAYDYLGSPEGELALAEACVYLATAPKSNAVYTAYKAAMRAAKENGSLLPPKHILNA----PTKLMKGEGYGDGYRYDHDEPDAFSGQDYFPEKMGRKTFYDPPERGFEREIRKRLEWWNKLRRD 433
>gi|168701195|ref|ZP_02733472.1| recombination factor protein RarA [Gemmata obscuriglobus UQM 2246] (449 aa)
Score = 487, Expect = 5.9e-47, Identities = 128/374 (34%), Positives = 208/374 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYY----QNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKL--NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + DE + +        ++  M+  + L S++F+G PG GK+A    I K     F   N+      D+ E+L      L     + I+ ++EIHR N+ +QD+LL  +E  +II++  TT+NPFF +N  + SR  ++R E ++   ++  +++ + + +       V +++  +  +VE+   D R+    L+I +K        K+   +  +L    +S+       D     HYD  SAF KS+RGSDP+AA+Y++A++LE G D   V RRL     ED+G A+       NAA +A E +GLPE RI L+     L  + KSN++ MA + A + V +   L  P HLRD  Y  A ++  +  GYKY HD+   +VEQEY+P +    E+Y P
  S:    26 TLDEYVGQTHFLAPGKLLRRMLLADRLNSLIFYGPPGCGKTALAHVIAKHTKSRFKPLNAVAAGTKDVRELLAEARGHLEELGERTILFLDEIHRFNRAQQDVLLPDVEDGVIILIGATTQNPFFAINTPLLSRSQIFRFEPLSRDDVRTLLLRAVSDTERGLGKLNVTITDDALAFLVEVCDGDARRALTALEIGVKSSLAPENAKAASSIRFDLELAQDSIQQKVIEFDPTGDTHYDTASAFIKSLRGSDPDAALYWMARMLEGGEDPRFVARRLVIFASEDVGNADPFGVVLANAAWDAVEKVGLPECRINLAHAVTYLATAQKSNASYMAGEAAAKDVKEGRTLPVPLHLRDKGYRGAKEVFGHGVGYKYAHDFEGGWVEQEYIPTD---AEYYHP 422
>gi|163868623|ref|YP_001609832.1| recombination factor protein RarA [Bartonella tribocorum CIP 105476] >gi|161018279|emb|CAK01837.1| ATPase, AAA family [Bartonella tribocorum CIP 105476] (455 aa)
Score = 487, Expect = 6.1e-47, Identities = 122/403 (30%), Positives = 229/403 (56%)
  Q:     6 EKVLVCNSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNVK-----GYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKSNNK 408
           E++  C S +E++ +  +  +D ++  M+    + S++F+G PG GK+   + +  + N  F   ++     ++L +I E+A       +K ++ ++EIHR N+ +QD  L  +E   ++++  TTENP F++N A+  R+R+L +   +  S  +  +  + +E K + L +   + ++ +S  D R      + V    +++   D   L+++ +    + D+    HY+L+SA HKS+RGSDP+AA+YYLA++L++G D + + RRL  +  ED+GLA+       NAA +A + LG PE  + L+Q  + +  +PKSN+  +A   A++   K  +L PP H+ +A    A KL  +     GY Y HD   ++  QEY P++L  + +YKP    + +   K +++W +++   K
  S:    38 ERMRPC-SLNEVVGQKHLIGEDGLLSRMVAAGSIGSLIFWGPPGTGKTTVARLLALETNFAFEQVSAIFTGVSELKKIFEVAQRRFMSGDKTLLFVDEIHRFNRAQQDSFLPVMENGTVVLIGATTENPSFELNAALLSRARVLTFFSHDHESLGMLLKRAEEVEGKLLPLDDGARDVLIGMSDGDARVALTLAEEVWSVARSEEILDAGALQKVIQRRAPIYDKGRDGHYNLISALHKSVRGSDPDAALYYLARMLDAGEDPLYIGRRLVRMAVEDVGLADPQALVICNAAKDAYDYLGSPEGELALAQACLYVATAPKSNATYLAYKAALRCARKNGSLPPPKHILNA----ATKLMKEEGYGDGYCYDHDEPDAFSGQEYFPEKLGRQSYYKPVERGFEREIVKRLEWWKQLRQKRK 452
>gi|146341536|ref|YP_001206584.1| recombination factor protein RarA [Bradyrhizobium sp. ORS278] >gi|146194342|emb|CAL78366.1| putative polynucleotide enzyme with nucleotide triphosphate hydrolase domain [Bradyrhizobium sp. ORS278] (444 aa)
Score = 486, Expect = 6.4e-47, Identities = 121/393 (30%), Positives = 223/393 (56%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKP----IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKE--EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE--ALSPPNHLRDA--------HYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIK 404
           +   +++ +D I   D  +  M+E   L S++F+G PG GK+   + +      +F   ++  +   DL ++ + A    +     ++ ++E+HR N+ +QD  L  +E   ++++  TTENP F++N A+  RSR+L++   ++++A ++E     + +E +K+ L       ++ ++  D R      + V +  +     + + L+++ +    + D+ A  HY+L+SA HKS+RGSDP+AA+YY A++L++G D + + RR+  +  EDIGLA+       NAA +A + LG PE  + ++Q  I +  +PKSN+A  A   A + V KE  +L PP H+ +A         Y S       GY+Y HD   ++  Q+Y P+ L  + FY P +  + +   K +DYW K++
  S:    34 HKLSDVVGQDHILGPDGALTRMLETRTLGSLIFWGPPGTGKTTVARLLADATELHFEQISAVFSGVADLKKVFDAARARRETGQGTLLFVDEVHRFNRAQQDSFLPVMEDGTVVLVGATTENPSFELNAALLSRSRVLIF--HSLDAAAIEELYSHAEEVEGRKLPLDEDARHVLIRMADGDGRASLTLAEEVWRSARKGEIFNAVQLQDVLQRRAPIYDKSADGHYNLISAMHKSVRGSDPDAALYYFARMLDAGEDPLFLARRIVRMAVEDIGLADPQALVIANAAKDAYDFLGSPEGELAIAQAVIYVATAPKSNAAYKAFGAA-KRVAKEGGSLLPPKHILNAPTKLMQSEGYGS-------GYQYDHDAPDAFSGQDYFPEALGRQHFYDPPERGFEREIRKRLDYWAKLR 439
>gi|194336934|ref|YP_002018728.1| AAA ATPase central domain protein [Pelodictyon phaeoclathratiforme BU-1] >gi|194309411|gb|ACF44111.1| AAA ATPase central domain protein [Pelodictyon phaeoclathratiforme BU-1] (447 aa)
Score = 486, Expect = 7.5e-47, Identities = 123/375 (32%), Positives = 219/375 (58%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKP----IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLY--------RIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVL-KEL----GKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVN-KEALSPPNHLRDAHYASAVKLNV---KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           ++ D+M  ++ +   +  +   +    + S++F+G PG GK+   +     LN +F   ++  +   ++ + LE A +  +     I+ I+EIHR NK +QD LL  +E+ +I+++  TTENP F+VN A+ SR+ +Y         IE +    LKE+  + L +  +++++  ++ +++ S  D R+    ++  +  +   + ++VL +EL     +    + D+   NHYD++SAF KS+RGSDP+AA+++LA+++E G D   + RR+     EDIG A+        A   A   +G+PEARI L+Q    L  +PKSN++   I+EA++     + L+ P HLR+A   + +  N     GYKYPH Y F +V Q Y P+ ++ K +Y+P
  S:    34 HTLDDMAGQEHLVGANGPLRKFLSGGQMPSMIFWGPPGSGKTTLAEICATSLNYSFEQLSAIDSGVKEVRKALEQAEKSRRSGRRTILFIDEIHRFNKAQQDTLLHAIEQGLIVLIGATTENPSFEVNGALLSRMQVYILKPLGSEEIELVIRRALKED--RLLRDLSIEITD--LDFLLQFSGGDARKALNAVEAAISLFPEGASEMVLTRELLERALQYKAPIYDKGGENHYDIISAFIKSMRGSDPDAALFWLARMIEGGEDPKFIARRMVIFASEDIGNADPYAITLAIAVFQAVAMIGMPEARINLAQGVTYLASAPKSNASYQGINEAMREAKVMQDLAVPLHLRNA--PTKLMKNEGYGAGYKYPHSYPFHFVSQHYFPEGMEPKAYYRP 424
>gi|170789029|gb|EDT30073.1| AAA ATPase, central region [Oligotropha carboxidovorans OM5] (443 aa)
Score = 485, Expect = 8.5e-47, Identities = 116/393 (29%), Positives = 217/393 (55%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKP----IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKY--LENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA--LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIKSN 406
             +++ +D I   D  +  M+E   L S++F+G PG GK+   + +      +F   ++  +   DL ++ + A    +     ++ ++E+HR N+ +QD  L  +E   ++++  TTENP F++N A+ SR  +    +++ A +++   +   +E + + L       +V ++  D R     ++ V +  +     D   L+++ +    + D+ A  HY+L+SA HKS+RGSDP+AA+YY A++L++G D + + RR+  +  EDIG+A+       NAA +A + LG PE  + ++Q  + +  +PKSN+A  A   A+++  KEA  L PP H+ +A        +  +GY+Y HD    +  Q+Y P+ L  K FY P +  + +   K +DYW K++ +
  S:    35 LSDVVGQDHILGPDGALTRMLETRTLGSLVFWGPPGTGKTTVARLLADATELHFEQISAVFSGVADLKKVFDTARARRETGKGTLLFVDEVHRFNRAQQDSFLPVMEDGTVVLVGATTENPSFELNAALLSRARVLVFHSLDDAAIEKLYARAEEIEGRPLPLDADARAVLVRMADGDGRAALTLVEEVWRAARANEVFDAAQLQDILQRRAPIYDKSADGHYNLISALHKSVRGSDPDAALYYFARMLDAGEDPLFLARRVVRMAVEDIGMADPQALVVANAARDAYDFLGSPEGELAIAQAVVYVATAPKSNAAYRAFSAAMRTA-KEAGSLLPPKHILNAPTKLMKSESYGEGYEYDHDTPEGFSGQDYFPEALGRKTFYNPPERGFEREIRKRLDYWAKLRKD 440
>gi|183601785|ref|ZP_02963155.1| recombination factor protein RarA [Bifidobacterium animalis subsp. lactis HN019] >gi|183219391|gb|EDT90032.1| recombination factor protein RarA [Bifidobacterium animalis subsp. lactis HN019] (504 aa)
Score = 485, Expect = 9.6e-47, Identities = 112/347 (32%), Positives = 197/347 (56%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-----KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI-------VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           S++ FG PGVGK+     + K+  + +   ++ T+   DL E+L      L ++  + ++ I+E+HR +K +QD LL  +E   +  +A TTENP F V   + SR ++ ++E++    L+  + + + N      KV++    V+ I+ ++  D R+    L+           ++       V+  +  +     DR   +HYD++SAF KS+RGSD +A ++YLA+++ +G D   + RR+     E++G+A   +     AA  A + +G+PEARI LS+  I +  +PKSN++  AI++A+  V+   +   P H+R+A         N +GY Y HDY  + VEQ+Y+P  L  +E+Y PN
  S:    61 SVILFGPPGVGKTTLAHIVAKQSGRQYEELSAVTSGVKDLREVLRRAHERLVSQGKETVLFIDEVHRFSKSQQDALLPSVENRDVTFIAATTENPSFSVIKPLLSRSVVVKLESLEPEELRTVIERAVSNPRGLGGKVRVQGDAVDGIIRLAGGDARKSLTILEAAAGAVDESGSNVPAEITTDVVSTVMDVAAVRYDRNGDDHYDVISAFIKSMRGSDVDATLHYLARMIRAGEDPRFIARRIMIAAAEEVGMAAPQILQITVAAAQAVQMIGMPEARIILSEAAIAVATAPKSNASYTAINQALADVDAGLIGQVPLHIRNAPTTLMKSWGNHEGYHYAHDYPNAVVEQQYMPDVLVGREYYHPN 427
>gi|167761579|ref|ZP_02433706.1| hypothetical protein CLOSCI_03990 [Clostridium scindens ATCC 35704] >gi|167660722|gb|EDS04852.1| hypothetical protein CLOSCI_03990 [Clostridium scindens ATCC 35704] (437 aa)
Score = 485, Expect = 9.6e-47, Identities = 115/382 (30%), Positives = 218/382 (57%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN----------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELG-----KITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGD-LISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNE 393
           +S ++ + ++ +  K  ++  +IE + + S++F+G PGVGK+     I  +   +F  F++ T+   ++ E++  A E      + ++ ++EIHR NK +QD  L ++EK  I+++  TTENP F+VN A+ SR  ++ ++    A+ + +++K L N          + V+++ + ++AI   +  D R     L++ +   +  +D + +   G        + L D+    HY+L+SA HKS+R SDP+AA+Y++ ++LE G+  + + RRL     EDIG+A+S       AA  A   LG+PE  + L+     L ++PKSN+  MA +   + V N  A   P  +R+A  +   +L+  KGY+Y HD        + +P+ ++++++Y+P    + E
  S:    23 SSLEDFVGQEHLLGKGRMLRQLIERDQISSMIFWGPPGVGKTTLASIIAGRTKADFINFSAVTSGIKEIKEVMRQAEESRCMGIRTVLFVDEIHRFNKAQQDAFLPFVEKGSIVLIGATTENPSFEVNAALLSRCRVFVLK----ALEETDLVKLLTNALNSPAGLKDQNVRITQQQLKAIAAFANGDARTALNILEMAVINGEITADGMTVTNEGLEQCISKKSLLYDKNGEEHYNLISALHKSMRNSDPDAAIYWMCRMLEGGENPLYIARRLIRFASEDIGMADSHALQVAVAAYQACHFLGMPECDVHLTHAVTYLSVAPKSNALYMACEACKKDVKNLRAQPVPLQIRNAPTSLMKELDYGKGYEYAHDTEEKLTHMQCMPEGMEDRKYYRPTTQGEEE 422
>gi|116251573|ref|YP_767411.1| recombination factor protein RarA [Rhizobium leguminosarum bv. viciae 3841] >gi|115256221|emb|CAK07302.1| putative ATPase AAA family protein [Rhizobium leguminosarum bv. viciae 3841] (438 aa)
Score = 485, Expect = 1.0e-46, Identities = 121/379 (31%), Positives = 216/379 (56%)
  Q:    26 KDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKY---LENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-----KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIK 404
           +D ++  MIE+  L S++F+G PG GK+   + +  +    F   ++  +   DL ++ E A     +  + ++ ++EIHR N+ +QD  L  +E   +I++  TTENP F++N A+  R+R+L ++  +  S    EE++K    +E K + L+     +++ ++  D R +    + V +  +     D   L  + +    + D+    HY+L+SA HKS+RGSDP+AA+YYLA++ ++G D + + RRL  +  EDIGLA+       NAA +A E LG PE  + L+Q  + L  +PKSN+   A   A Q+  +  +L PP H+ +A      KL        GY+Y HD   ++  Q+Y P+++  + FY P +  + ++  K +++W K++
  S:    41 EDGVLKRMIESGSLGSMIFWGPPGTGKTTVARLLSGEAGLAFEQISAIFSGVADLKKVFETARLRRMDGRQTLLFVDEIHRFNRAQQDSFLPVMEDGTVILVGATTENPSFELNAALLSRARVLTFKSHDEESL---EELLKRAEAIEQKSLPLTEDARASLIRMADGDGRAVLTLAEEVWRAAREGESFDTEGLTRIVQRRAPVYDKAQDGHYNLISALHKSVRGSDPDAALYYLARMFDAGEDPLYLGRRLVRMAVEDIGLADPQALVICNAAKDAYEYLGSPEGELALAQACVYLATAPKSNAVYTAFKAASQAAKQNGSLLPPKHILNA----PTKLMKGEGYGDGYRYDHDEPDAFSGQDYFPEKMGRQIFYDPPERGFERDIRKRLEWWAKLR 432
>gi|41407170|ref|NP_960006.1| recombination factor protein RarA [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41395521|gb|AAS03389.1| hypothetical protein MAP_1072 [Mycobacterium avium subsp. paratuberculosis K-10] (450 aa)
Score = 484, Expect = 1.1e-46, Identities = 115/374 (30%), Positives = 212/374 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELAT----EDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-----KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S DE++ +D +    S +  ++E + + S + +G PG GK+     I +   + F   ++ +    D+  ++E A        + ++ I+E+HR +K +QD LL  +E  +++++A TTENP F V   + SR L+ ++  +++  ++  V + +++      +V ++ + V+ +V ++  D R+    L++  +  ++ +   V + L +      DR    HYD++SAF KS+RGSD +AA++YLA++L +G D   + RRL  +  EDIG+A+        AA      +G+PEA++ L+  T+ L  +PKSN+   A+  A+  +   +A   P HLRD HY+ A  L + +GY+Y HD+    V Q+Y P EL   ++Y+P
  S:    39 SLDEVVGQDHLLAPGSPLRRLVEGSGVASAILYGPPGSGKTTLAALISQATGRRFEALSALSAGVKDVRAVIESARTALLRGEQTVLFIDEVHRFSKTQQDALLSAVENRVVLLVAATTENPSFSVVAPLLSRSLILQLRPLSADDIRTVVRRAIDDPRGLGGRVPVAPEAVDLLVRLAAGDARRALTALEVAAEAGESVTVQTVEQSLDEAAVRY-DRDGDQHYDVISAFIKSVRGSDVDAALHYLARMLVAGEDPRFIARRLMILASEDIGMADPAALQVAVAAAQTVALIGMPEAQLTLAHCTVYLATAPKSNAVTTALGAAMSDIKAGKAGLVPAHLRDGHYSGAAALGHAQGYQYSHDHPDGVVAQQYPPDELVGVDYYRP 423
>gi|86357338|ref|YP_469230.1| recombination factor protein RarA [Rhizobium etli CFN 42] >gi|86281440|gb|ABC90503.1| putative ATPase associated with chromosome architecture/replication protein [Rhizobium etli CFN 42] (438 aa)
Score = 484, Expect = 1.2e-46, Identities = 116/379 (30%), Positives = 215/379 (56%)
  Q:    26 KDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKY--LENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-----KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIK 404
           +D ++  MIE+  L S++F+G PG GK+   + +  +    F   ++  +   DL ++ E A     +  + ++ ++EIHR N+ +QD  L  +E   +I++  TTENP F++N A+ SR  +   ++ +   L+E + +   +E + + L+ +   +++ ++  D R +    + V +  +     D   L  + +    + D+    HY+L+SA HKS+RGSDP+AA+YYLA++ ++G D + + RRL  +  EDIGLA+       NAA +A + LG PE  + L+Q  + L  +PKSN+   A   A Q+  +  +L PP H+ +A      KL       +GY+Y HD   ++  Q+Y P+++  + FY P +  + ++  K +++W K++
  S:    41 EDGVLKRMIESGSLGSMIFWGPPGTGKTTVARLLSGEAGLAFEQISAIFSGVADLKKVFEAARMRRMDGRQTLLFVDEIHRFNRAQQDSFLPVMEDGTVILVGATTENPSFELNAALLSRARVLTFKSHDEESLEELLTRAEAIEQRPLPLTGEARASLIRMADGDGRAVLTLAEEVWRAAREGESFDTEALTRIVQRRAPVYDKAQDGHYNLISALHKSVRGSDPDAALYYLARMFDAGEDPLYLGRRLVRMAVEDIGLADPQALVICNAAKDAYDYLGSPEGELALAQACVYLATAPKSNAVYTAFKAASQAAKQNGSLLPPKHILNA----PTKLMKGEGYGEGYRYDHDEPDAFSGQDYFPEKMGRQTFYDPPERGFERDIRKRLEWWAKLR 432
>gi|169609180|ref|XP_001798009.1| hypothetical protein SNOG_07677 [Phaeosphaeria nodorum SN15] >gi|111064023|gb|EAT85143.1| hypothetical protein SNOG_07677 [Phaeosphaeria nodorum SN15] (550 aa)
Score = 484, Expect = 1.2e-46, Identities = 132/371 (35%), Positives = 208/371 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKE-EVIKYLENKKVK-------LSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKE-LGKITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK---EALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEF 383
           S D++  ++++ P + I+  M+    L S++ +G PG GK+   + I       F   NST+    ++ +I   A  D      K I+  +E+HR +K +QD  L  +E  +I ++A TTENP FKV  A+ SR   + +++     LKE ++++ LE   V        +   +++     S  D R     L + +    +KS +I  ++ L  +T +L+ DR    HYD +SA HKSIRGSD NAA+YYLA++LESG D   + RRL  V  ED+GLA++ +     A  +A E +GLPE RI L+   I L LSPKS      ++ A++++ +    AL  P HLR+A       +   + YKY   Y    V+Q+YLP+E+K + F
  S:   142 SLDDVCGQELVGP-NGILRGMVNEGKLPSLVLWGRPGTGKTTIARLIANTSGARFVEINSTSTKLEEVRKIFGEAARDLQLTGRKTIVFCDELHRFSKTQQDAFLGPVESGIITLIAATTENPSFKVISALLSRCRTFTLDD-----LKEPDLVRILERAAVAEKCESPLIDKDMLQYFARFSDGDARTALNLLDLAMNL--SKSPEITKEKILQSLTKTLVYDRAGDQHYDSISAMHKSIRGSDANAALYYLARMLESGEDPRYIARRLIVVASEDVGLADNSMLSLATATYSACEKIGLPECRINLAHAVIALTLSPKSTRVYRGLNNAMEALKEPGVAALPIPYHLRNAPTRLMKDMGYGENYKYNPHYLDGKVKQDYLPEEIKGRTF 524
>gi|167365682|ref|ZP_02299826.1| AAA ATPase central domain protein [Rhodopseudomonas palustris TIE-1] >gi|192292006|ref|YP_001992611.1| AAA ATPase central domain protein [Rhodopseudomonas palustris TIE-1] >gi|192285755|gb|ACF02136.1| AAA ATPase central domain protein [Rhodopseudomonas palustris TIE-1] (443 aa)
Score = 484, Expect = 1.2e-46, Identities = 117/393 (29%), Positives = 221/393 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKY--LENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV-----LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV---KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKS 405
           S  +++ +D I   D  +  M++   L S++F+G PG GK+   + +       F   ++  +   DL ++ + A    +     ++ ++E+HR NK +QD  L  +E   ++++  TTENP F++N A+ SR  +   + +++A +++   K    E +K+ L ++    +  ++  D R     L +  + +++  +  V     L+E+ +    + D+ A  HY+L+SA HKS+RGSDP+AA+YYL ++L++G D + + RR+  +  ED+G+A+       NAA +A + LG PE  + ++Q  I +  +PKSN+A  A   A++   +  +L PPNH+ +A   + +  N     GY+Y HD    +  Q+Y P+ L  + FY P    + ++  K +DYW K+++
  S:    34 SLADVVGQDHILGPDGALTRMLQTRTLGSLVFWGPPGTGKTTVARLLADATELQFEQISAVFSGVADLKKVFDAARARREMGKGTLLFVDEVHRFNKAQQDSFLPVMEDGTVVMVGATTENPSFELNAALLSRARVLIFKPLDAAAIEQLFSKAEAAEGRKLPLDDEARAVLARMADGDGRA---SLTLAEEVWRSAREGEVFNAAQLQEILQRRAPIYDKSADGHYNLISALHKSVRGSDPDAALYYLCRMLDAGEDPLFLARRVVRMAVEDVGMADPQALVIANAAKDAYDFLGSPEGELAIAQAVIYVATAPKSNAAYSAYKSAMRLAKQAGSLLPPNHILNA--PTGLMKNEGYGSGYQYDHDTPEGFSGQDYFPETLGRQTFYDPPDRGFERDIRKRLDYWAKLRA 439
>gi|116629635|ref|YP_814807.1| recombination factor protein RarA [Lactobacillus gasseri ATCC 33323] >gi|116095217|gb|ABJ60369.1| Helicase subunit of the Holliday junction resolvase related ATPase [Lactobacillus gasseri ATCC 33323] (429 aa)
Score = 484, Expect = 1.3e-46, Identities = 128/374 (34%), Positives = 208/374 (55%)
  Q:    30 IINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN----KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNH-----LRDAHYASAVKLNVKGY-KYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           +  +I+ +   S+L +G PG GK++  Q I ++ +     FN++ +NK  L +I+      +  +++I+EIHR+    QD LL YLE   I+++  TTENP   + PA+RSR  ++  + ++   +++ +I+ L+     K   +  K V+ I   +  D R     L+ +    ++ S + V K+  K  +   DR+AT HYD L+A+  SI GSD +AA+YYLA LL++GDL SV RRL  + Y  IGLAN     ++  A N +E +G+P+A+ PL   T+ +CLSPKS       DE  Q ++++   P  H     LRD HY  + ++   G    P    F   +Q Y+PK L+ K +Y   K + +E KF   + K+
  S:    35 LYQIIKKHVPISLLLWGPPGTGKTSLAQIIAREFDYPLATFNASIDNKAKLTQIINTYPYQSF-VLLIDEIHRMTTTLQDFLLPYLENGRILLIGATTENPIMSIVPAVRSRCQIFEFKALSDEDIEQVLIRALKEVFHFKDENIDRKAVKIIAISADGDLRVALNLLETIHAVNEDLSVEEV-KQFVKGQHFAYDRKATKHYDYLAAYSDSIAGSDTDAALYYLAVLLKNGDLASVVRRLREIPYTYIGLANPEQATQIVIAANQAEKIGMPKAKYPLMFATMLMCLSPKSG----VFDEIWQKLDEDTDHPSKHPMPRGLRDMHYKHSEEITGGGLIDNPFAQPFQIAKQNYMPKGLEGKRYYFA-KDNASEKKFEQQYLKL 411
>gi|159902628|ref|YP_001549972.1| recombination factor protein RarA [Prochlorococcus marinus str. MIT 9211] >gi|159887804|gb|ABX08018.1| putative ATPase, AAA family [Prochlorococcus marinus str. MIT 9211] (455 aa)
Score = 484, Expect = 1.4e-46, Identities = 116/374 (31%), Positives = 213/374 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN-------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + D+ + +  I     ++   IE + + +ILF G PG+GK+   + I      +F   N+  +   +L + ++     L     + I+ I+E+HR    +QD LL ++E    I +  TTENP+F+VN A+ SR  ++R+  +    + + + + L++       K++KL+ +    +++++  D R +   L++ ++  Q      +  ++     S      L ++    H+D +SAF KS+RGSDP+AA+++LAQ+LE+G+    ++RR+     EDIGLA+      + +  +A + +GLPE    LS+  + L  + KSNS ++ I+ AI SV N +    PNHL+D+H  S        Y YPH+Y  ++V Q+YLP++L+ + F++P
  S:    28 TLDDFVGQQAILGPGRLLRRAIECDRVGNILFQGPPGIGKTTLSKIIASNTRAHFSELNAVLSGIKELRQEIDAAKNRLGQHGLRTILFIDEVHRFTTSQQDALLPWVENGTFIFIGATTENPYFEVNQALVSRSRVFRLRPLQEKDMYQILDRALKDIEKGYGAKEIKLTIQAKNHLIDVANGDARSLLNALELAVETTQADDKGCINIDISIAEESIQERAVLYNKNGDAHFDTISAFIKSLRGSDPDAALFWLAQMLEAGESPRYIFRRMLIAAAEDIGLADPNAIVVIESCASAFDRVGLPEGNYLLSEAALYLACTEKSNS-VLGINSAIHSVKNSQKQDVPNHLQDSHRDSEKSKARSDYLYPHNYQGNWVSQQYLPRDLQREVFWEP 420
>gi|149179070|ref|ZP_01857643.1| hypothetical protein PM8797T_19475 [Planctomyces maris DSM 8797] >gi|148842110|gb|EDL56500.1| hypothetical protein PM8797T_19475 [Planctomyces maris DSM 8797] (445 aa)
Score = 483, Expect = 1.4e-46, Identities = 121/374 (32%), Positives = 218/374 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S +E + +     +  ++  ++  + + S++F+G+PG GK++  + I ++ N+ F   N+ +    ++   L     ELAT   + I+ I+E+H  +K +QD+LL  +E  ++ ++  TT NPFF +  A+ SR  ++  + +    ++  + + L+++K       V +    ++ ++E+   D R+    L+I VL  + ++   D  V +E  +      D+    HYD  SA  KS+RGSDP+AA+Y+LA+++E+G D   + RR+     ED+G A+        +  NA E +G+PE RI LSQ    +  +PKSN++ +AIDEA+  V  ++L P P HL+D+HY  A +L + +GY+Y H     +V+Q+YL  E   KE+Y+P
  S:    26 SLEEFVGQSHFLGEGKLLRRILAADRIGSLIFYGSPGTGKTSLAELIARQSNRRFEALNAASAGIKEVRAALDRARDELATGGKQTILFIDELHHFSKVQQDVLLPDVESGVVALIGATTSNPFFSLVSALISRSQIFEFQPLTPEEIQTLMQRALQDEKRGLARYNVTVEQDALDFLIEVCDGDARRSLNALEIGVLSLHGSERVFDLDVAQESIQKKAIQYDQDGDAHYDSASALIKSMRGSDPDAALYWLARMIEAGEDPRFLARRIVIAASEDVGNADPTALTLAMSVFNAVEKIGMPEGRILLSQAVTYIATAPKSNASYVAIDEALHDVRNKSLLPVPIHLKDSHYKGASQLGHGEGYQYAHAAEEGWVDQDYLGVE---KEYYRP 414
>gi|169198878|ref|ZP_02858187.1| AAA ATPase central domain protein [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169088007|gb|EDS67722.1| AAA ATPase central domain protein [Rhizobium leguminosarum bv. trifolii WSM2304] (438 aa)
Score = 483, Expect = 1.6e-46, Identities = 121/379 (31%), Positives = 218/379 (57%)
  Q:    26 KDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKY---LENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-----KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIK 404
           +D ++  MIE++ L S++F+G PG GK+   + +  +    F   ++  +   DL ++ E A     +  + ++ ++EIHR N+ +QD  L  +E   +I++  TTENP F++N A+  R+R+L ++  +  S    EE++K    +E K + L+ +   +++ ++  D R +    + V +  +     D   L  + +    + D+    HY+L+SA HKS+RGSDP+AA+YYLA++ ++G D + + RRL  +  EDIGLA+       NAA +A E LG PE  + L+Q  + L  +PKSN+   A   A Q+     +L PP H+ +A      KL       +GY+Y HD   ++  Q+Y P+++  + FY P +  + ++  K +++W K++
  S:    41 EDGVLKRMIESDSLGSMIFWGPPGTGKTTVARLLSGEAGLAFEQISAIFSGVADLKKMFETARLRRMDGRQTLLFVDEIHRFNRAQQDSFLPVMEDGTVILVGATTENPSFELNAALLSRARVLTFKSHDEESL---EELLKRAEAIEQKPLPLTEEARLSLICMADGDGRAVLTLAEEVWRAAREGESFDTEGLTRIVQRRAPVYDKAQDGHYNLISALHKSVRGSDPDAALYYLARMFDAGEDPLYLGRRLVRMAVEDIGLADPQALVICNAAKDAYEYLGSPEGELALAQACVYLATAPKSNAVYTAFKAASQAAKHNGSLLPPKHILNA----PTKLMKGEGYGEGYRYDHDEPDAFSGQDYFPEKMGRQTFYDPPERGFERDIRKRLEWWEKLR 432
>gi|147669758|ref|YP_001214576.1| recombination factor protein RarA [Dehalococcoides sp. BAV1] >gi|146270706|gb|ABQ17698.1| AAA ATPase, central domain protein [Dehalococcoides sp. BAV1] (457 aa)
Score = 483, Expect = 1.8e-46, Identities = 124/372 (33%), Positives = 209/372 (56%)
  Q:    34 IENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE------NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQN-ENKFVDYWNKIKS 405
           +E++ + S++F+G PG GK+     I   L+ +F   ++ +    DL  ++E A E       + I+ I+EIHR NK +QD +L Y+E   ++++  TTENP F+VN A+ SR+ +Y + +++   L   + + LE      N   +L  +  + I   ++ D R     L++ +       D   +  L ++ ++        D+    HYDL+SA HK++RGSDP+AA+Y+L ++LE+G D + + RR+     ED+GLA+        AA  A   LG+PE ++ L++  I L  +PKSNS  +A     + + +   +  P HLR+A       L   K YKY HDY   +V+Q+ LP+ +K++ FY P K  Y  N  N+   +W   K+
  S:    52 LESDKIPSLIFWGPPGSGKTTLANIIAHSLDAHFSALSAVSAGVADLRRVVEEARERLKLYHRRTILFIDEIHRFNKSQQDAILPYVEDGTVVLIGATTENPSFEVNSALLSRVQVYVLNSLSEKELSVILKRSLEGENGLGNYHARLLEEAEKHISSFAQGDARIALNILELAVMTTLPDKDGWRVVGLPQVEDAAQKKSLRYDKSGEQHYDLISALHKTMRGSDPDAAIYWLGRMLEAGEDPLYIARRVIRFATEDVGLADPQGLVIAMAAQQAVHFLGMPEGKLALAEAVIYLAGAPKSNSVYVAYTNVQKEIARNPQADVPLHLRNAPTGLMKDLGYGKDYKYAHDYQNHFVKQQNLPEVIKDQRFYTPGKIGYELNILNRLRAWWGNAKA 446
>gi|167358179|ref|ZP_02292838.1| AAA ATPase central domain protein [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167075013|gb|EDR78830.1| AAA ATPase central domain protein [Rhizobium leguminosarum bv. trifolii WSM1325] (438 aa)
Score = 482, Expect = 2.0e-46, Identities = 121/379 (31%), Positives = 216/379 (56%)
  Q:    26 KDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIK---YLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-----KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIK 404
           +D ++  MIE+  L S++F+G PG GK+   + +  +    F   ++  +   DL ++ E A     +  + ++ ++EIHR N+ +QD  L  +E   +I++  TTENP F++N A+  R+R+L ++  +  S    EE++K    +E K + L+     +++ ++  D R +    + V +  +     D   L  + +    + D+    HY+L+SA HKS+RGSDP+AA+YYLA++ ++G D + + RRL  +  EDIGLA+       NAA +A E LG PE  + L+Q  + L  +PKSN+   A   A Q+  +  +L PP H+ +A      KL        GY+Y HD   ++  Q+Y P+++  + FY P +  + ++  K +++W K++
  S:    41 EDGVLKRMIESGSLGSMIFWGPPGTGKTTVARLLSGEAGLAFEQISAIFSGVADLKKVFETARLRRMDGRQTLLFVDEIHRFNRAQQDSFLPVMEDGTVILVGATTENPSFELNAALLSRARVLTFKSHDEESL---EELLKRAETIEQKPLPLTEDARVSLIRMADGDGRAVLTLAEEVWRAAREGESFDTEGLTRIVQRRAPVYDKAQDGHYNLISALHKSVRGSDPDAALYYLARMFDAGEDPLYLGRRLVRMAVEDIGLADPQALVICNAAKDAYEYLGSPEGELALAQACVYLATAPKSNAVYTAFKAASQAAKQNGSLLPPKHILNA----PTKLMKGEGYGDGYRYDHDEPDAFSGQDYFPEKMGRQIFYDPPERGFERDIRKRLEWWAKLR 432
>gi|158430699|pdb|2R9G|A Chain A, Crystal Structure Of The C-Terminal Fragment Of Aaa Atpase From Enterococcus Faecium >gi|158430700|pdb|2R9G|B Chain B, Crystal Structure Of The C-Terminal Fragment Of Aaa Atpase From Enterococcus Faecium >gi|158430701|pdb|2R9G|C Chain C, Crystal Structure Of The C-Terminal Fragment Of Aaa Atpase From Enterococcus Faecium >gi|158430702|pdb|2R9G|D Chain D, Crystal Structure Of The C-Terminal Fragment Of Aaa Atpase From Enterococcus Faecium >gi|158430703|pdb|2R9G|E Chain E, Crystal Structure Of The C-Terminal Fragment Of Aaa Atpase From Enterococcus Faecium >gi|158430704|pdb|2R9G|F Chain F, Crystal Structure Of The C-Terminal Fragment Of Aaa Atpase From Enterococcus Faecium >gi|158430705|pdb|2R9G|G Chain G, Crystal Structure Of The C-Terminal Fragment Of Aaa Atpase From Enterococcus Faecium >gi|158430706|pdb|2R9G|H Chain H, Crystal Structure Of The C-Terminal Fragment Of Aaa Atpase From Enterococcus Faecium >gi|158430707|pdb|2R9G|I Chain I, Crystal Structure Of The C-Terminal Fragment Of Aaa Atpase From Enterococcus Faecium >gi|158430708|pdb|2R9G|J Chain J, Crystal Structure Of The C-Terminal Fragment Of Aaa Atpase From Enterococcus Faecium >gi|158430709|pdb|2R9G|K Chain K, Crystal Structure Of The C-Terminal Fragment Of Aaa Atpase From Enterococcus Faecium >gi|158430710|pdb|2R9G|L Chain L, Crystal Structure Of The C-Terminal Fragment Of Aaa Atpase From Enterococcus Faecium >gi|158430711|pdb|2R9G|M Chain M, Crystal Structure Of The C-Terminal Fragment Of Aaa Atpase From Enterococcus Faecium >gi|158430712|pdb|2R9G|N Chain N, Crystal Structure Of The C-Terminal Fragment Of Aaa Atpase From Enterococcus Faecium >gi|158430713|pdb|2R9G|O Chain O, Crystal Structure Of The C-Terminal Fragment Of Aaa Atpase From Enterococcus Faecium >gi|158430714|pdb|2R9G|P Chain P, Crystal Structure Of The C-Terminal Fragment Of Aaa Atpase From Enterococcus Faecium (204 aa)
Score = 482, Expect = 2.2e-46, Identities = 92/184 (50%), Positives = 129/184 (70%)
  Q:   221 DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           D+    HYD++SAF KSIRGSD +AA++YLA+L+E+GDL S+ RRL  + YEDIGL N     +   AV A+E LGLPEARIPL+ + ++LCLSPKSNSA MA+D A+  + + +A   P+HLRD+HY  A  LN   GY+YPH ++ ++V Q+YLP +LKN ++Y+P    + E      + +IK
  S:     8 DKNGDAHYDVISAFQKSIRGSDVDAALHYLARLVEAGDLASICRRLMVIGYEDIGLGNPAAAARTVNAVLAAEKLGLPEARIPLADVVVDLCLSPKSNSAYMALDAALADIREGKAGDVPDHLRDSHYKGAKSLNRGVGYQYPHHFDQAWVNQQYLPDKLKNAQYYQPKDTGKYEQALGQQYYRIK 193
>gi|29833388|ref|NP_828022.1| recombination factor protein RarA [Streptomyces avermitilis MA-4680] >gi|29610511|dbj|BAC74557.1| putative ATP/GTP-binding protein [Streptomyces avermitilis MA-4680] (453 aa)
Score = 482, Expect = 2.4e-46, Identities = 131/358 (36%), Positives = 202/358 (56%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSD-DIVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVD 398
           S++ +G PG GK+     + K  NK F   ++ T    ++  +++ A         + ++ ++EIHR +K +QD LL  +E   + ++A TTENP+F V   + SR LL  +E +    L+  + + L +++     V L     E ++ I+  D R+    L+       +K + +I L+ L +  +      DR    HYD+ SA  KSIRGSD +AA++YLA+++E+G D   + RRL     EDIGL +    P   AA  A   +G PEA + LS  TI L L+PKSN+A MAI  A++ V K    P P HLRD HY  A KL + +GY YPHD       Q+Y P+ELK++E+Y P ++   E ++ D
  S:    66 SVILWGPPGTGKTTLAYVVSKATNKRFVELSAITAGVKEVRAVIDGARRATGGFGKETVLFLDEIHRFSKAQQDSLLPAVENRWVTLIAATTENPYFSVISPLLSRSLLLTLEPLTDDDLRGLLRRALTDERGLKEAVTLPADTEEHLLRIAGGDARRALTALEAAAGAALDKGEPEIGLQTLEETVDRAAVKYDRDGDQHYDVASALIKSIRGSDVDAALHYLARMIEAGEDPRFIARRLMISASEDIGLTDPHALPTAVAAAQAVAMIGFPEAALTLSHATIALALAPKSNAATMAIGAAMEDVRKGHAGPVPLHLRDGHYKGAAKLGHAQGYVYPHDLPEGIAAQQYAPEELKDREYYTPTRHGA-EARYAD 439
>gi|119194249|ref|XP_001247728.1| hypothetical protein CIMG_01499 [Coccidioides immitis RS] >gi|90306514|gb|EAS36145.1| hypothetical protein CIMG_01499 [Coccidioides immitis RS] (535 aa)
Score = 481, Expect = 2.6e-46, Identities = 135/371 (36%), Positives = 208/371 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKL-------SNKVVEAIVE----ISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGK-ITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDE---AIQSVNKEALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEF 383
           + DE +C   +  ++ ++  +IE + + S++ +G  G GK+   + I   +   F   NST++   +  +I      EL     K II  +EIHR +K +QD+ L  +E   + ++  TTENP FKV  A+ SR   + +    S +  +++I  L N+ ++L       +N V E ++      +  D R     L++ +    +K   +   EL K +T +L+ DR    HYD +SAFHKSIRGSDP+AA+YYLA++++SG D + + RRL  V  ED+GLA++ + P   AA  A E +GLPEARI L+  T+ L LS KS  A  A+     A+Q      L  P HLR+A       L   + YKY  DY    V Q YLP +L+ + F
  S:   133 TLDE-VCGQELVGQNGVLRGLIEADRVPSMILWGGAGTGKTTIARVIATMVGSRFVEINSTSSGVAECKKIFAEARNELRLAGRKTIIFCDEIHRFSKSQQDVFLGPVESGQVTLIGATTENPSFKVQNALLSRCRTFTL----SKLTDDDIISIL-NRALELEGPNYSPTNLVDEELIRYLAAFADGDARTSLNLLELAMDL--SKRPGMTKDELKKGLTRTLVYDRAGDQHYDTISAFHKSIRGSDPDAALYYLARMIQSGEDPLYIARRLIVVASEDVGLADNSMLPLAVAAYTAVEKIGLPEARINLAHATVALSLSQKSTRAYRALGNAFVALQEPGIAGLPIPIHLRNAPTKLMKGLGYGQEYKYNPDYAGGKVAQTYLPDKLQGRHF 518
>gi|67538894|ref|XP_663221.1| hypothetical protein AN5617.2 [Aspergillus nidulans FGSC A4] >gi|40743520|gb|EAA62710.1| hypothetical protein AN5617.2 [Aspergillus nidulans FGSC A4] (528 aa)
Score = 481, Expect = 2.6e-46, Identities = 127/371 (34%), Positives = 215/371 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVK-----------LSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGK-ITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK---EALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEF 383
           + DE+  ++++ P   ++  +IE + + S++ +G PG GK+   + I   +   F   NST+    +  +I      EL     K II  +EIHR +K +QD+ L  +E   + ++  TTENP FKV  A+ SR   + +       L +E I+ + N+ +K           + +++++ + + +  D R     L++ +    +K   I   E+ + +T +L+ DR    HYD +SAFHKSIRGSDP+AA+YYLA++++SG D + + RRL  V  EDIGLA++ +     +   A E +GLPEARI L+  T+ + LSPKS  A   ++ A  ++++     L  P HLR+A      +L   K YKY  ++    V Q+YLP++L++++F
  S:   125 TLDEVCGQELVGPT-GVLRGLIEEDRVPSMILWGGPGTGKTTIARVIASMVGSRFVEINSTSTGVAECKKIFADAKSELGLTGRKTIIFCDEIHRFSKSQQDVFLGPVESGQVTLIGATTENPSFKVQNALLSRCRTFTLSK-----LTDEDIRSILNRALKTEGPNYSPSALVDDELLDYLAKFADGDARTSLNLLELGMNL--SKRPGISKDEIKRALTKTLVYDRAGDQHYDTISAFHKSIRGSDPDAALYYLARMIQSGEDPLYIARRLIVVASEDIGLADNSMLTLAISTHAAVEKIGLPEARINLAHATVAMALSPKSTRAYRGLNNAFAALSEPGIAGLPIPIHLRNAPTRLMKELGYGKEYKYNPNFKDGKVVQDYLPEKLQDRKF 510
>gi|70993728|ref|XP_751711.1| AAA family ATPase [Aspergillus fumigatus Af293] >gi|66849345|gb|EAL89673.1| AAA family ATPase, putative [Aspergillus fumigatus Af293] >gi|159125367|gb|EDP50484.1| AAA family ATPase, putative [Aspergillus fumigatus A1163] (539 aa)
Score = 481, Expect = 2.9e-46, Identities = 128/371 (34%), Positives = 211/371 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLS------NKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGK-ITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK---EALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEF 383
           + DE+  ++++ P + ++  +IE + + S++ +G+ G GK+   + I   +   F   NST+    +  +I      EL     K I+  +EIHR +K +QD+ L  +E   I ++  TTENP FKV  A+ SR   + +  ++   +K  + + L  +    S      ++++E +   S  D R     L++ +    +K   +  +EL + +T +L+ DR    HYD +SAFHKSIRGSDP+AA+YYLA++L+SG D + + RRL  V  EDIGLA++ + P   A  +A E +GLPEARI L+  T+ + LS KS     A++    ++ +     L  P HLR+A      +L   K YKY  +Y    V Q+YLP++L  ++F
  S:   130 TLDEVCGQELVGP-NGVLRGLIEQDRVPSMILWGHAGTGKTTIARVIASMVGSRFVEINSTSTGVAECKKIFAEARSELGLTGRKTIVFCDEIHRFSKSQQDVFLGPVESGQITLIGATTENPSFKVQNALLSRCRTFTLSKLSDEDVKSILDRALRVEGPNYSPSSLVDDELIEYLARFSDGDARTSLNLLELAMDL--SKRPSMTKEELKRSLTKTLVYDRAGDQHYDTISAFHKSIRGSDPDAALYYLARMLQSGEDPLYIARRLVVVASEDIGLADNSMLPLAIATHSAVEKIGLPEARINLAHATVAMALSKKSTRVYRALNNTFAALAEPGVAGLPVPIHLRNAPTRLMKELGYGKEYKYNPNYLDGQVVQDYLPEKLLGRKF 515
>gi|189199446|ref|XP_001936060.1| DNA-dependent ATPase MGS1 [Pyrenophora tritici-repentis Pt-1C-BFP] >gi|187983159|gb|EDU48647.1| DNA-dependent ATPase MGS1 [Pyrenophora tritici-repentis Pt-1C-BFP] (534 aa)
Score = 481, Expect = 3.0e-46, Identities = 126/371 (33%), Positives = 200/371 (53%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVK-------LSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK---EALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEF 383
           S + +  ++++ PK  I+  M++   L S++ +G PG GK+   + I       F   NST+     +  I   A++D      K I+  +E+HR +K +QD  L  +E   I ++A TTENP FK+  A+ SR   + ++++     +++++K LE            L   ++      S  D R     L++ +    N+ D    K    +T +L+ DR    HYD +SA HKSIRGSDP+A++YYLA++LESG D   + RRL  V  ED+GLA++ +     A   A E +G+PE RI L+     L L+PKS      +  AI +V +    AL  P+H+R+A       +    GYKY  +Y    V+QEYLP+ L+ + F
  S:   127 SLEHVYGQELVGPK-GILRAMVDEGRLPSMVLWGRPGTGKTTIARLIANTSGSRFVEINSTSTRLEQVRAIFTEASQDLRLTGRKTIVFCDELHRFSKTQQDAFLGPVESGTITLIAATTENPSFKIISALLSRCRTFTLDDLK----EDDLVKILERAMTAESCTSPILDKPMLAYFARFSDGDARTALNLLELAMSL-ANQPDMTKEKIQQSLTKTLVYDRAGDQHYDSISALHKSIRGSDPHASLYYLARMLESGEDPRYIARRLIVVASEDVGLADNSMLSLATATYAACENIGMPECRINLAHAVTALTLAPKSTRVYRGLKNAIDAVKEPGMAALPIPHHIRNAPTKLMKDMGYGDGYKYNPNYLDGKVKQEYLPEALRGRSF 509
>gi|110770030|ref|XP_001122859.1| PREDICTED: similar to Werner helicase interacting protein 1, partial [Apis mellifera] (326 aa)
Score = 481, Expect = 3.1e-46, Identities = 114/293 (38%), Positives = 179/293 (61%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRI-----ENINSAV---LKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQ--------NKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLS 305
           + +E++ +  +     II  M+E   L S++ +G PG+GK++    I       F   N+ T++K  L ++          I++++EIHRL+K KQD LL  LE   II++  TTENP+  ++PAIRSR  ++ +     E++N A+   LK++    L N  VKL+N   E +V+    D R     L++ ++  +        N  D+I + +  ++ NS+       D +   HYDL+SAF KSIRGSD +AA++YLA+L+ESGDL+++ RRL  + YEDIGLAN         A+ A++ LG PEARIPL+
  S:    12 NLNEVVGQQHLIGPGKIIRRMVEAKMLSSMILYGPPGIGKTSIASAIAGSTKYAFRQLNAATDSKKQLEQVAAEGKLSGTVILLLDEIHRLDKTKQDFLLPLLESGQIILIGATTENPYIAISPAIRSRCQIFELKPLAKEDVNKAIGRALKDDK-NGLGNYHVKLTNDARELLVQKGNGDLRATLNGLELAVRSTKQEMIAAGKNDEDEITINQ-DEMANSIQLRSQNFDAKGDGHYDLVSAFQKSIRGSDTDAALHYLARLIESGDLVAICRRLSVISYEDIGLANPAAVQHAQIAIQAAKNLGFPEARIPLA 324
>gi|90424905|ref|YP_533275.1| recombination factor protein RarA [Rhodopseudomonas palustris BisB18] >gi|90106919|gb|ABD88956.1| Recombination protein MgsA [Rhodopseudomonas palustris BisB18] (442 aa)
Score = 480, Expect = 3.1e-46, Identities = 119/394 (30%), Positives = 221/394 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKP----IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKE--EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV----LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKSN 406
           + ++++ +D I   D  +  M+E   L S++F+G PG GK+   + +      +F   ++  +   DL ++ + A    +     ++ ++E+HR NK +QD  L  +E   ++++  TTENP F++N A+ SR  +    ++++  +++     + +E KK+ L  +    +V ++  D R      + V +    ++D++     L+E+ +    + D+ A  HY+L+SA HKS+RGSDP+AA+YYL ++L++G D + + RR+  +  EDIGLA+       NAA +A + LG PE  + ++Q  I L  +PKSN+A  A   A+++  +  +L PP H+ +A        +   GY+Y HD    +  QEY P  L ++ FY P    + +   K +DYW K++++
  S:    34 ALEDVVGQDHILGPDGALTRMLETRTLGSLVFWGPPGTGKTTVARLLADTTELHFEQISAVFSGVADLKKVFDAARARRQTGRGTLLFVDEVHRFNKAQQDSFLPVMEDGTVVLVGATTENPSFELNAALLSRARVLVFHSLDAQAIEKLYAHAETVEAKKLPLDAEARAVLVRMADGDGRAALTLAEEVWR--AARADEVFNAEQLQEILQRRAPIYDKSADGHYNLISALHKSVRGSDPDAALYYLCRMLDAGEDPLFLARRVVRMAVEDIGLADPQALVICNAAKDAYDFLGSPEGELAIAQAVIYLATAPKSNAAYKAYKAAMRAAKQGGSLLPPKHILNAPTKLMKSEDYGAGYQYDHDTPEGFSGQEYFPDALGHQTFYDPPDRGFEREIRKRLDYWAKLRNS 440
>gi|118617371|ref|YP_905703.1| recombination factor protein RarA [Mycobacterium ulcerans Agy99] >gi|118569481|gb|ABL04232.1| conserved alanine, valine and leucine rich protein [Mycobacterium ulcerans Agy99] (452 aa)
Score = 480, Expect = 3.3e-46, Identities = 123/374 (32%), Positives = 209/374 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYY----QNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVN--KEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S DE++ +  +    + +  ++E + + S++ +G PG GK+     I     + F   ++ +    D+  ++E A +      + ++ I+E+HR +K +QD LL  +E  +++++A TTENP F V   + SR L+ ++  + +  ++  V +  ++ +     V ++    + +V++S  D R+    L++  +         S +I+ + L K      DR    HYD++SAF KS+RGSD +AA++YLA++L +G D   V RRL  +  EDIGLA+    P   AA      +GLPEA++ L+  TI L  +PKSN+   A+  A+  +   K  L PP HLRD HY+ A  L + +GYKY HD     V Q+Y P EL    +Y+P
  S:    39 SLDEVVGQGHLLAPGAPLRRLVEGSGVASVILYGPPGSGKTTLAALISHATGRRFEALSALSAGVKDVRAVIETARQVLRRGEQTVLFIDEVHRFSKTQQDALLSAVENRVVLLVAATTENPSFSVVAPLLSRSLILQLHPLGAEDIRAVVQRAAQDPRGLGGRVAIAPDATDLLVQLSAGDARRALTALEVAAEAAQAAGSQVSVEIIEQSLDKAAVRY-DRDGDQHYDVVSAFIKSVRGSDVDAALHYLARMLVAGEDPRFVARRLMILASEDIGLADPTALPTAVAAAQTVALIGLPEAQLTLAHATIHLATAPKSNAVTTALAAAMADIKAGKAGLVPP-HLRDGHYSGAAALGHAQGYKYSHDDPDGVVAQQYPPDELVGTNYYRP 427
>gi|32475212|ref|NP_868206.1| recombination factor protein RarA [Rhodopirellula baltica SH 1] >gi|32445753|emb|CAD78484.1| conserved hypothetical protein-putative a helicase [Rhodopirellula baltica SH 1] (439 aa)
Score = 480, Expect = 3.8e-46, Identities = 126/373 (33%), Positives = 202/373 (54%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENIN----SAVLKEEVIKY---LENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
             E + +  I  +  ++  +I +  + SIL  G PG GK+     I  + N      N+ ++   D+ E+L  A +     D +P++ I+EIHR NK +QD LL  +E  +I ++  TT NP+F VN A+ SR  L+ +E ++     ++LK  +      L N+ V +    ++ +   S  D R+    L++ +  ++N    I   ++ +   S I   D    +HYDL SA  KSIRGSD +A++Y+LA++LE G D+  + RRL  +  EDIG A+        +A+ A E +GLPEA++ LSQ    L L+PKSN+   AI  A + V    + P P  LR  HY  A +L +  GYK  H+      + +YL  +   + +YKP
  S:    27 LSEFVGQQHILGEGKLLRRLIASGRVGSILLHGPPGTGKTTLAHLIASEQNSELITLNAISSGVKDVREVLAKARDRVSAGDPRPLLFIDEIHRFNKSQQDALLADVESGIISLIGATTSNPYFAVNAALISRSQLFGLEPVSVEDMRSLLKRAITDRECGLGNQNVTIDEDAIDYLSSASDGDARKALTALEVAVHSHENPKASITRDDVAESMTSRIAGYDATGDDHYDLASALIKSIRGSDVDASLYWLARMLEGGEDIRFLCRRLVILASEDIGNADPQALIIAVSAMQACEMIGLPEAQLTLSQTVAYLSLAPKSNATTSAISAARRDVRDRQVIPVPKMLRCGHYTGAEELGHGDGYKSAHNTEEGVAKLDYLGVD---RRYYKP 414
>gi|169771463|ref|XP_001820201.1| hypothetical protein [Aspergillus oryzae RIB40] >gi|83768060|dbj|BAE58199.1| unnamed protein product [Aspergillus oryzae] (527 aa)
Score = 480, Expect = 3.8e-46, Identities = 126/371 (33%), Positives = 213/371 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE------NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGK-ITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK---EALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEF 383
           + D++  +D++ P   ++  +IE++ + S++ +G PG GK+   + I   +   F   NST++   +  +I      EL     K II  +EIHR +K +QD+ L  +E   + ++  TTENP FKV  A+ SR   + +  +    +K  + + L+      +    + ++++  + + S  D R     L++ +    +K   I  +EL + +T +L+ DR    HYD +SAFHKS+RGSDP+AA+YYLA++++SG D + + RRL  V  EDIGLA++ +     +  +A E +GLPEARI L+  T+ + LS KS  +   ++ A  ++ +     L  P HLR+A      +L   K YKY  +Y    V QEYLP+EL+ ++F
  S:   124 TLDDVCGQDLVGPH-GVLRGLIEHDRVPSMILWGGPGTGKTTIARVIASMVGSRFVEINSTSSGVAECKKIFSDAKSELNLTGRKTIIFCDEIHRFSKSQQDVFLGPVESGQVTLIGATTENPSFKVQNALLSRCRTFTLTKLTDEDVKSILDRALQVEGPNYSPSALVDDELINYLAKFSDGDARTSLNLLELAMDL--SKRPGITKEELKRSLTKTLVYDRAGDQHYDTISAFHKSLRGSDPDAALYYLARMIQSGEDPLYIARRLIVVASEDIGLADNSMLTLAISTHSAVEKIGLPEARINLAHATVAMALSKKSTRSYRGLNNAFAALAEPGIAGLPIPIHLRNAPTRLMKELGYGKEYKYNPNYLNGEVAQEYLPEELQGRKF 509
>gi|123965322|ref|YP_001010403.1| recombination factor protein RarA [Prochlorococcus marinus str. MIT 9515] >gi|123199688|gb|ABM71296.1| putative ATPase, AAA family [Prochlorococcus marinus str. MIT 9515] (428 aa)
Score = 479, Expect = 4.1e-46, Identities = 136/393 (34%), Positives = 223/393 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLK---EEVIKY---LEN-KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELG------KITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNS--AIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKS 405
           + D+   ++ I   +S++ N I N+ + +I+F G PGVGK+  I+ I           N+  ++  +L   +  A E     + K I+ I+E+HR    +QD LL  +E   I  +  TTENPFF VN A+ SR  ++ +  +N+  L+   E+V+ Y   LE+ K ++++ + +  +++ S  D R +   L+  +   +   D +V  +L       +  N + D+   NH+D++SAF KSIRGSDP+A +Y+LA ++E+G D   ++RRL     EDIGLA+      V +  +A + +GLPE    LSQ ++ L +SPKSNS  +I    EAI++ N   +  PNHL++         N   Y  PH+Y+ + + QEYLP ELK  +F++       +NK+ D   K KS
  S:    26 TLDDFFGQESILGNNSLLRNAILNDKVGNIIFSGPPGVGKTTLIEIISSNTRSALIKLNAVLSSIKELRTEIANAKERLLSSNRKTILFIDEVHRFTSIQQDALLPSIENGTITFIGATTENPFFAVNKALISRARVFSLIPLNTNDLRKIIEKVVNYYACLEDPKAIEITEEAISHLIKYSGGDARNLINALESGISITKENKDKLVFIDLSIAEDSIQKKNIVYDKNGQNHFDVISAFIKSIRGSDPDATLYWLANMVEAGEDPNFIFRRLLISASEDIGLADPNAIVVVQSCCDAFDRVGLPEGLFFLSQASLYLAISPKSNSTKSIFKAVEAIKTTNVSLV--PNHLKN---------NASNYLNPHNYHENLLSQEYLPTELKGIKFWQHKNSGWEKNKYDDLVKKRKS 428
>gi|157736320|ref|YP_001489003.1| recombination factor protein RarA [Arcobacter butzleri RM4018] >gi|157698174|gb|ABV66334.1| ATPase, AAA family protein [Arcobacter butzleri RM4018] (394 aa)
Score = 479, Expect = 4.2e-46, Identities = 131/356 (36%), Positives = 201/356 (56%)
  Q:    23 IFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVN---ASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKEL 378
           I  KD  +  +I+  D+  + F+G PG GK+   + I K++  ++YYFN+T+    DL ++ +       KP+I I+E+HRL+K++Q++LL  +E    I++  +TENPFF +  AIRSR  LY  +      + + +   L++  + +S+   E ++  S  D R +   L    K  ++ + D+ LKEL +         +  HYDL SA  KS+RGS+ + A+YY+A+L+  G+ +  + RRL     EDIG AN      +N AVN   A   +G PE+RI LSQ  I L  SPKSNSA  AI++A++ + N + L  P HL   H          GY YPHD+   YVEQEYL ++L
  S:    22 IISKDKALYKLIKQKDIPHLFFYGKPGTGKTTLAKIIAKEIGTDYYYFNATSIKVEDLRKVFDKYKGALIKPLIFIDEVHRLSKNQQEVLLPIMENYDAIIIGASTENPFFTLTNAIRSRSFLYEFKPFTKDEMNKILYIALKDIDINISDGAKEYLIISSSGDARAMLTLLNFSYKVSKDINIDL-LKELRENVIGDGVSSSDTHYDLASAMIKSLRGSNVDGALYYMARLINGGESVDFITRRLVIFASEDIGNANPN---ALNLAVNTMMACNKIGYPESRIMLSQCAIYLASSPKSNSAYKAINKALEQIKNGKILDIPKHLDSQHI---------GYLYPHDFG-GYVEQEYLKEDL 369
>gi|183982180|ref|YP_001850471.1| hypothetical protein MMAR_2167 [Mycobacterium marinum M] >gi|183175506|gb|ACC40616.1| conserved alanine, valine and leucine rich protein [Mycobacterium marinum M] (452 aa)
Score = 479, Expect = 4.3e-46, Identities = 123/374 (32%), Positives = 209/374 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYY----QNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVN--KEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S DE++ +  +    + +  ++E + + S++ +G PG GK+     I     + F   ++ +    D+  ++E A +      + ++ I+E+HR +K +QD LL  +E  +++++A TTENP F V   + SR L+ ++  + +  ++  V +  ++ +     V ++    + +V++S  D R+    L++  +         S +I+ + L K      DR    HYD++SAF KS+RGSD +AA++YLA++L +G D   V RRL  +  EDIGLA+    P   AA      +GLPEA++ L+  TI L  +PKSN+   A+  A+  +   K  L PP HLRD HY+ A  L + +GYKY HD     V Q+Y P EL    +Y+P
  S:    39 SLDEVVGQGHLLAPGAPLRRLVEGSGVASVILYGPPGSGKTTLAALISHATGRRFEALSALSAGVKDVRAVIETARQVLRRGEQTVLFIDEVHRFSKTQQDALLSAVENRVVLLVAATTENPSFSVVAPLLSRSLILQLHPLGADDIRAVVQRAAQDPRGLGGRVAIAPDATDLLVQLSAGDARRALTALEVAAEAAQAAGSQVSVEIIEQSLDKAAVRY-DRDGDQHYDVVSAFIKSVRGSDVDAALHYLARMLVAGEDPRFVARRLMILASEDIGLADPTALPTAVAAAQTVALIGLPEAQLTLAHATIHLATAPKSNAVTTALAAAMADIKAGKAGLVPP-HLRDGHYSGAAALGHAQGYKYSHDDPDGVVAQQYPPDELVGTNYYRP 427
>gi|182413522|ref|YP_001818588.1| ATPase central domain-containing protein [Opitutus terrae PB90-1] >gi|177840736|gb|ACB74988.1| AAA ATPase central domain protein [Opitutus terrae PB90-1] (448 aa)
Score = 479, Expect = 4.6e-46, Identities = 136/394 (34%), Positives = 220/394 (55%)
  Q:    16 EMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE--DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSA----VLKEEVI---KYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI-----------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVD---YWNKIKSNNKQ 409
           E++ +  I    S++  ++  N   S++F+G PG GK++  + I ++ N  F   N+  +N  +L EIL  A        I+ I+E+HR NK +QDLLL  +E+  + ++  TT NP F VNP + SR  L+R+E ++ A    VLK+ +    + L  +KV   +KV+  +  +   D R+    L++++         + L E G IT + +           D     HYD +SAF KS RGSDP+AA+Y+LA++L  G D   + RRL  +  ED+GLA+    P   AA +A + +GLPEA + L+  T+ +  + KSNSA +A+ EA +++ ++ +   P  LR     +  ++   +GY Y HD+  +   Q+YL K L     Y P      E K VD    W ++KS  +Q
  S:    40 EVVGQSHILKPGSLLPRLVAQNRFGSLIFYGPPGCGKTSIAEAIAQETNSRFVRVNAVMSNVAELREILHSARRLPQASTILFIDELHRFNKSQQDLLLPDVEEGTVRLIGATTHNPGFYVNPPLLSRSHLFRLEPLSPAAVTGVLKKALADEERGLGARKVTADDKVLADLAVLCDGDLRRALNALEVLV---------LGLPEGGVITPAELEVFARERRIRYDADEDEHYDTISAFIKSCRGSDPDAALYWLAKMLAGGEDPRFIARRLVILASEDVGLADPQALPLTVAAHHAVDFIGLPEAELTLAHATLYIATAAKSNSATLALGEAHRALKEQPVQTIPAALRSKSGQANKRIGQGQGYLYSHDHQENISGQDYLEKPLT---LYTPKPVGW-EAKIVDRLARWKELKSRLQQ 446
>gi|110634002|ref|YP_674210.1| recombination factor protein RarA [Mesorhizobium sp. BNC1] >gi|110284986|gb|ABG63045.1| Recombination protein MgsA [Mesorhizobium sp. BNC1] (440 aa)
Score = 479, Expect = 5.1e-46, Identities = 113/391 (28%), Positives = 215/391 (54%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIK 404
            DE++ ++ +   +  +  MI +  L S++F+G PG GK+   + +  + +  F   ++  +   DL ++ E A    ++  + ++ ++EIHR N+ +QD  L  +E   ++++  TTENP F++N A+  R+R+L++     NS     +  +  E +K+ L+ +    ++ ++  D R +    + V +        D   L+ + +    + D+    +Y+L+SA HKS+RGSDP+AA+YYL ++ ++G D + + RRL  +  EDIGLA+       NAA +A + LG PE  + L+Q  + L  +PKSN+   A   A+++  +  +L PP H+ +A      +     GY+Y HD   ++  Q+Y P+ +  + FY P    + +   K ++YW K++
  S:    29 LDEVVGQEHLTGPEGALTRMIRSGSLGSLVFWGPPGTGKTTVARLLAGETSMAFEQISAIFSGVADLKKVFEAARLRRSQGRQTLLFVDEIHRFNRAQQDSFLPVMEDGTVVLVGATTENPSFELNAALLSRARVLVFHSLEANSLENLLQRAEEAEGRKLPLTEEARAVLLRMADGDGRAVLTLAEEVWRAANEGEVFDAEALQRIVQRPAPIYDKGQDGYYNLISALHKSVRGSDPDAALYYLCRMFDAGEDPLYLGRRLVRMAVEDIGLADPQALVIANAAKDAYDYLGSPEGELALAQACVYLATAPKSNAVYTAFKAAMRAAKEHGSLLPPKHILNAPTKLMKETGYGSGYQYDHDMPDAFSGQDYFPEAMDRQSFYNPPDRGFEREIRKRLEYWKKLR 432
>gi|150385817|ref|ZP_01924414.1| AAA ATPase, central domain protein [Victivallis vadensis ATCC BAA-548] >gi|150257810|gb|EDM95125.1| AAA ATPase, central domain protein [Victivallis vadensis ATCC BAA-548] (455 aa)
Score = 479, Expect = 5.2e-46, Identities = 134/396 (33%), Positives = 217/396 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLL-EILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS----AVLKEEVI--KYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI--VLKELGK--ITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIKSNNK 408
           S DE I ++ +     ++   I+ +   S++  G PG GK++  + I +  N  F   +  T++  D+  EI +  T       + I+ ++EIHR ++ +QD LL  +E   + ++  TT NP F V  A+ SR L++ ++ +       +L+  V   +    ++V+L     E I    + D R+    L+I +      +D +  V +E+ +  +   +I      HYD  SAF KS+RGSD +AA+YYLA++L +G D+  + RRL     ED+G A+        +A+ A E +GLPEA + LSQ T+    +PKSNSA  AI  A   V K+ + P P HLRD+HYA A ++ N  GY+YPHD+   +V Q+YL  E   K +Y+P    Y     + V+YW  ++   K
  S:    37 SLDEYIGQNHLLAPGKLLRRAIDADRFSSVILSGPPGTGKTSLAEVIARVSNSEFVRLSGVTSSVADVRKEIAQAVTRRRINGRRTILFVDEIHRFSRSQQDSLLPDVENGNVRLIGATTHNPQFYVVGALLSRSLVFLLQPLTEDDILTLLRRAVADPRSFPGRRVELEPDAAEFIARTCEGDGRRSLNALEIAVLTSDPGADGVTRVTREVAESSVQKKMIVYGDDGHYDTASAFIKSMRGSDADAAIYYLAKMLHAGEDIRFIARRLVIFAAEDVGNADPRALQLATSAMQAVEMIGLPEANLILSQATLYCATAPKSNSATTAIIAAQADVEKDRVQPVPLHLRDSHYAGAREMGNGVGYQYPHDHEGGFVVQDYLSVE---KRYYEPKNSGYESKIKERVEYWRSLREYGK 449
>gi|86741903|ref|YP_482303.1| recombination factor protein RarA [Frankia sp. CcI3] >gi|86568765|gb|ABD12574.1| Recombination protein MgsA [Frankia sp. CcI3] (519 aa)
Score = 478, Expect = 5.8e-46, Identities = 130/375 (34%), Positives = 216/375 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-----KVKLSNKVVEAIVEISKSDFRQIFFYLKI---------------------------VLKYYQNKSDDIVLKELGKITNSL---IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSG-LGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           + DE++ +  +    S +  ++E     S++ +G PG GK+     + +   + F   ++ T    D+  +++     L+T   + ++ I+E+HR  + +QD LL  +E+  + ++A TTENPFF V   + SR LL  +E +    ++  + + L +      ++ +S++  E +V ++  D R+    L+                              + + N    + L  L +  N      DR    HYD++SAF KS+RG D +AA++YLA++LE+G D   V RR+  +  EDIG+A+ G LG  V AA  A E +GLPEAR+ L+Q  I L L+PKSN+ I AID A   V      P P HLRDAHY  A ++ +  GY+YPH+   + V Q+Y P  L + ++Y+P+
  S:    61 TLDEVVGQRHLLGPGSPLRRLVEGGATTSVVLWGPPGTGKTTLAHIVSRATGRRFRELSAVTAGVKDVRAVIDEARETLSTSGARTVLFIDEVHRFTRTQQDALLPSVERGWVTLVAATTENPFFSVVSPLLSRSLLLTLEPLTDDDIRGVLTRALRDPRGYDGRLSVSDEAREHVVRLAGGDARRALTTLEAGAEALLEAHECESGPGGKAGAGADAGADAEAFVNPRPRLDLDLLERAVNRAAVRYDRSGDQHYDVISAFIKSMRGGDVDAALHYLARMLEAGEDPRFVARRMIILASEDIGMADPGALGVAV-AASQALEFVGLPEARLALAQAVIHLALAPKSNAVIRAIDAATSDVRAGRAGPVPAHLRDAHYRGARRVGHGAGYRYPHEAPGNVVRQQYPPDGLTSTDYYQPS 478
>gi|148322894|gb|EDK88144.1| RuvB family helicase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (407 aa)
Score = 478, Expect = 6.2e-46, Identities = 131/357 (36%), Positives = 213/357 (59%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALS--PPNHLRDAHYASAVKLNVKGYKYPHDYNFSYV 369
           S ++ + ++ +  KD +I  +I N+ L + +F+G PG GKS+  + I   L+ NF   N+TT + +D+  ++E A  +      + I+ ++EIHR NK++QD LL Y E   + ++  TTENP++ +N A+ SR++++  + + +  + + + K L    + +S+K+ E I++IS+ D R    Y+++    +   S+D +     +   S   ++  + YD++SAF KSIRGSDP+AAVY+LA+LL+ G D   + RRL+    EDIG+ANS      NAA+NA E +G+PE RI L+  TI L +S KSNS   AID A+  + K  +   P N   D         NV GYKYPH+Y  ++V
  S:    22 SLEDFVGQEKLLGKDGVIRRLILNSTLSNSIFYGPPGCGKSSLGEIISNTLDCNFEKLNATTASVSDIRNVVETARRNIELYNKRTILFLDEIHRFNKNQQDALLSYTEDGTLTLIGATTENPYYNINNALLSRVMVFEFKALTNDDISKLIDKGLNFLNISMSDKIKEIIIDISQGDSRIALNYVEMYNNIHSQMSEDEIFSIFKERQVSFDKKQ--DKYDMISAFIKSIRGSDPDAAVYWLARLLDGGEDPKYMARRLFIEASEDIGMANSEALLVANAAMNACERIGMPEVRIILAHATIYLAISSKSNSVYEAIDGALADIKKGEVQEVPMNICHD---------NV-GYKYPHNYTDNFV 374
>gi|86749444|ref|YP_485940.1| recombination factor protein RarA [Rhodopseudomonas palustris HaA2] >gi|86572472|gb|ABD07029.1| Recombination protein MgsA [Rhodopseudomonas palustris HaA2] (444 aa)
Score = 478, Expect = 6.2e-46, Identities = 116/390 (29%), Positives = 216/390 (55%)
  Q:    16 EMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVI--KYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV-----LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKS 405
           +++ +D I   D  +  M+    L S++F+G PG GK+   + +      +F   ++  +   DL ++ + A    +     ++ ++E+HR NK +QD  L  +E   ++++  TTENP F++N A+ SR  +   +++++A +++     +  E +K+ L  +    +V ++  D R     L +  + +++  D  +     L+++ +    + D+ A  HY+L+SA HKS+RGSDP+AA+YYL ++ ++G D + + RR+  +  EDIGLA+       NAA +A + LG PE  + ++Q  I L  +PKSN+A  A   A+++  +  +L PP H+ +A            GY+Y HD    +  QEY P  L ++ FY P    + +   K +DYW K+++
  S:    37 DVVGQDHILGPDGALTRMLATRTLGSLVFWGPPGTGKTTVARLLADATELHFEQISAVFSGVADLKKVFDAARARREMGRGTLLFVDEVHRFNKAQQDSFLPVMEDGTVVLVGATTENPSFELNAALLSRARVLVFQSLDAAAIEKLFAHAEAAEGRKLPLDAEARAVLVRMADGDGRA---SLTLAEEVWRSARDGEIFNAAQLQDILQRRAPIYDKSADGHYNLISALHKSVRGSDPDAALYYLCRMFDAGEDPLFLARRVVRMAVEDIGLADPQALVICNAAKDAYDFLGSPEGELAIAQAVIYLATAPKSNAAYTAYKAAMRAAKQGGSLLPPKHILNAPTGLMKSEGYGGGYQYDHDTPEGFSGQEYFPDALGHQTFYDPPDRGFEREIRKRLDYWAKLRA 439
>gi|39936283|ref|NP_948559.1| recombination factor protein RarA [Rhodopseudomonas palustris CGA009] >gi|39650138|emb|CAE28661.1| AAA ATPase [Rhodopseudomonas palustris CGA009] (443 aa)
Score = 478, Expect = 6.8e-46, Identities = 116/393 (29%), Positives = 220/393 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKY--LENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV-----LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV---KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKS 405
           S  +++ +D I   D  +  M++   L S++F+G PG GK+   + +       F   ++  +   DL ++ + A    +     ++ ++E+HR NK +QD  L  +E   ++++  TTENP F++N A+ SR  +   + +++A +++   K    E +K+ L ++    +  ++  D R     L +  + +++  +  V     L+E+ +    + D+ A  HY+L+SA HKS+RGSDP+AA+YYL ++L++G D + + RR+  +  ED+G+A+       NAA +A + LG PE  + ++Q  I +  +PKSN+A  A   A++   +  +L PP H+ +A   + +  N     GY+Y HD    +  Q+Y P+ L  + FY P    + ++  K +DYW K+++
  S:    34 SLADVVGQDHILGPDGALTRMLQTRTLGSLVFWGPPGTGKTTVARLLADATELQFEQISAVFSGVADLKKVFDAARARREMGKGTLLFVDEVHRFNKAQQDSFLPVMEDGTVVMVGATTENPSFELNAALLSRARVLIFKPLDAAAIEQLFSKAEAAEGRKLPLDDEARAVLARMADGDGRA---SLTLAEEVWRSAREGEVFNAAQLQEILQRRAPIYDKSADGHYNLISALHKSVRGSDPDAALYYLCRMLDAGEDPLFLARRVVRMAVEDVGMADPQALVIANAAKDAYDFLGSPEGELAIAQAVIYVATAPKSNAAYSAYKSAMRLAKQAGSLLPPKHILNA--PTGLMKNEGYGSGYQYDHDTPEGFSGQDYFPETLGRQTFYDPPDRGFERDIRKRLDYWAKLRA 439
>gi|89891667|ref|ZP_01203170.1| ATPase related to the helicase subunit of the holliday junction resolvase [Flavobacteria bacterium BBFL7] >gi|89516002|gb|EAS18666.1| ATPase related to the helicase subunit of the holliday junction resolvase [Flavobacteria bacterium BBFL7] (431 aa)
Score = 478, Expect = 6.8e-46, Identities = 131/365 (35%), Positives = 209/365 (57%)
  Q:    34 IENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED------NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKV----KLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI-----------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVD 398
           I N  + S++ +G PG GK+     I ++  + FY  ++  +   D+ E+++ A           PI+ I+EIHR +K +QD LL  +EK  + ++  TTENP F+V PA+ SR  +Y ++    A L++ + + L+  +V     ++ +  EA++ IS  D R++    ++V+      S  IV      ITN L+           D+    HYD++SAF KSIRGSDPNAAVY+LA+++E G DL  + RR+  +  EDIG AN       N    A   +G PE+RI LSQ  I L  S KSN++ +AI +A Q V +    P P  LR+A      +L   + YKY HD+  ++ + ++LP E+   + + P  N   Q + +F++
  S:    35 ILNGTIPSLILWGPPGTGKTTLANIIAQESKRPFYTLSAINSGVKDVREVIDKAKSAGGLFTAKNPILFIDEIHRFSKSQQDSLLAAVEKGWVTLIGATTENPSFEVIPALLSRCQVYVLDAFAKADLEQLLHRALKIDEVLSIKDITIQETEALLRISGGDARKLLNIFELVIN--SQPSGPIV------ITNELVFEQVQSNPARYDKTGEQHYDIISAFIKSIRGSDPNAAVYWLARMIEGGEDLKFIARRMLILASEDIGNANPTALIMANNTFQAVSTIGYPESRIILSQCAIYLATSIKSNASYLAIGQAQQIVKQTGDLPVPLGLRNAPTKLMKELGYGQEYKYAHDHPGNFAQFDFLPTEISGTKIFNPGNNPREQAQREFLE 417
>gi|78188604|ref|YP_378942.1| recombination factor protein RarA [Chlorobium chlorochromatii CaD3] >gi|78170803|gb|ABB27899.1| Recombination protein MgsA [Chlorobium chlorochromatii CaD3] (453 aa)
Score = 477, Expect = 8.4e-46, Identities = 119/373 (31%), Positives = 208/373 (55%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIK-------YLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVL-----KELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
            DE+  +  +   ++ +   +E+  + S++F+G PG GK+   +     L  +F   ++      ++ + L++AT       + ++ I+EIHR NK +QD LL  LE+ +I+++  TTENP F+VN A+ SR+ +Y ++ + +  L E+VI+           + ++L++  +E +      D R+    ++     +      + L     +   +    L D+   NHYD++SAF KS+RGSDP+AA+++LA+++E G D   + RR+     ED+G A+        +   A   +GLPEARI L+Q    L  +PKSN++  AI+EA+  V +  A + P HLR+A            GY YPH+Y   +VEQ Y P+ ++ K +Y+P
  S:    42 LDEVAGQQHLVGANAPLRRFLESGQMPSVIFWGAPGCGKTTLAEICASTLQCHFEQLSAVDAGVKEVRKALDIATRVRQAGQRCLLFIDEIHRFNKSQQDTLLHALEQGLILLIGATTENPSFEVNGALLSRMQVYTLKPLTAEEL-EQVIRRALATDALFRERSIELAD--LEVLWHYCAGDARKALNAIEAAFALFPTNQSSVQLTREHFEAALQQKAPLYDKSGENHYDVISAFIKSMRGSDPDAALFWLARMIEGGEDAKFIARRMVIFASEDVGNADPYALTLALSVFQAVSVIGLPEARINLAQGVTYLASAPKSNASYQAINEAMAEVKSTTATTVPLHLRNAPTKFMKNEGYGAGYCYPHNYPSHFVEQHYFPEGMEPKAYYRP 430
>gi|28378233|ref|NP_785125.1| recombination factor protein RarA [Lactobacillus plantarum WCFS1] >gi|28271068|emb|CAD63973.1| chromosome segregation helicase (putative) [Lactobacillus plantarum WCFS1] (420 aa)
Score = 476, Expect = 9.1e-46, Identities = 121/384 (31%), Positives = 208/384 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSA----VLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNH-----LRDAHYASAVKLNVKG-----YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKF 396
           S ++M+ +  +      +  +I+ +    ++ +G PG GK++  Q I  + +  F  FN++T NK  L + +    E +  +++I+EIHR+ K  QD LL YLE   ++++ +TTENP   + PAIRSR  ++  + ++       L+  V         ++  K +  I   ++ D R     L+ +    Q +     ++   +  +   DR+AT HYD LSA+  S+ GSD +AA+YYL  LL++ DL SV RRL  + Y  IGLAN     ++  A N +E +G+P+A+ PL   T+ +C+SPKS S     D++ + ++++  +P  H     LRD HY  + ++   G     ++ PH       +Q Y+PK L  + +Y P K ++NE K 
  S:    15 SLEQMVGQQDLLKAGQPLRQIIDQHVNIPLILWGPPGTGKTSLAQIIASQDDYPFVAFNASTENKAQLTKAIAQYPEQSF-VLLIDEIHRMTKTLQDFLLPYLENGHVMLIGSTTENPIMSIVPAIRSRCQIFEFQPLSDTDIEIALRRAVTDIYNLTDDQVDAKALNLIAISAEGDLRIALNILETLHAIDQKQITVAAVQHFAQQQHFSYDRKATKHYDYLSAYSDSMAGSDTDAALYYLTILLKNDDLPSVVRRLREIPYTYIGLANPEQVTQIVVAANQAEKIGMPKAKYPLMFATMLMCISPKSGS----FDQSWEKLDQDTQNPSQHPMPRGLRDMHYKHSEEITGGGLIDNPFQMPH----QIAQQNYMPKGLAGRRYYYP-KDNENERKL 402
>gi|91977623|ref|YP_570282.1| recombination factor protein RarA [Rhodopseudomonas palustris BisB5] >gi|91684079|gb|ABE40381.1| Recombination protein MgsA [Rhodopseudomonas palustris BisB5] (443 aa)
Score = 476, Expect = 9.4e-46, Identities = 116/397 (29%), Positives = 215/397 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVI--KYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKSNNKQ 409
           +  +++ +D I   D  +  M+    L S++F+G PG GK+   + +      +F   ++  +   DL ++ + A    +     ++ ++E+HR NK +QD  L  +E   ++++  TTENP F++N A+ SR  +   +++++A +++     + +E + + L  +    +V ++  D R      + V +  +     +   L+E+ +    + D+ A  HY+L+SA HKS+RGSDP+AA+YYL ++ ++G D + + RR+  +  EDIGLA+       NAA +A + LG PE  + ++Q  I L  +PKSN+A  A   A+++  +  +L PP H+ +A            GY+Y HD    +  QEY P  L ++ FY P    + +   K +DYW K+++   Q
  S:    34 ALGDVVGQDHILGPDGALTRMLATRTLGSLVFWGPPGTGKTTVARLLADATELHFEQISAVFSGVADLKKVFDAARARREMGTGTLLFVDEVHRFNKAQQDSFLPVMEDGTVVLVGATTENPSFELNAALLSRARVLVFQSLDAAAIEQLFANAERVEGRALPLDAEARAVLVRMADGDGRASLTLAEEVWRSAREGEIFNAAQLQEILQRRAPIYDKSADGHYNLISALHKSVRGSDPDAALYYLCRMFDAGEDPLFLARRVVRMAVEDIGLADPQALVICNAAKDAYDFLGSPEGELAIAQAVIYLATAPKSNAAYTAYKAAMRAAKQGGSLLPPKHILNAPTGLMKSEGYGGGYQYDHDTPEGFSGQEYFPDALGHQIFYDPPDRGFEREIRKRLDYWAKLRAMKDQ 443
>gi|116071416|ref|ZP_01468685.1| ATPase [Synechococcus sp. BL107] >gi|116066821|gb|EAU72578.1| ATPase [Synechococcus sp. BL107] (726 aa)
Score = 476, Expect = 1.1e-45, Identities = 121/374 (32%), Positives = 210/374 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV---NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + +E   +  I  +  ++   I+ + + +++  G PGVGK+   + +      +F   N+      DL   ++ A +       + I+ I+E+HR N  +QD LL ++E   + ++  TTENPFF+VN A+ SR  L+R+  +    L + + + L +++       V L       +V+++  D R +   L++ ++  +  SD  +   L     S      L D++   HYD +SAF KS+RGSD +AA+++LA+++E+G+    ++RR+     EDIGLA+      V A   A E +GLPE   PL+Q  + L  + KSNS I+   +A++SV   N++ + P  HLRDA+       +  GY+YPH Y   +VEQ+YLP  L+ + F++P
  S:    29 TLEEFEGQQGILAEGRLLQRAIKADRVGNLILHGPPGVGKTTLARIVANHTRAHFSNLNAVLAGVKDLRAEVDAAQQRLERHGLRTILFIDEVHRFNSAQQDALLPWVENGTVTLIGATTENPFFEVNKALVSRSRLFRLLPLEPKDLHQLLQRALTDQERGYGERSVVLDTDAANHLVDVAGGDARSLLNALELAVESSEPASDGTIAISLTTAEESIQQRAVLYDKQGDAHYDTISAFIKSLRGSDADAALFWLARMVEAGENPRFIFRRMLIAAGEDIGLADPQAMVVVEACAAAFERVGLPEGLYPLAQAALYLAGTEKSNS-ILGFFDALKSVRDANRQDVPP--HLRDANRDGDAFGDGVGYRYPHAYAEHWVEQQYLPTALQGEVFWQP 421
>gi|193212966|ref|YP_001998919.1| AAA ATPase central domain protein [Chlorobaculum parvum NCIB 8327] >gi|193086443|gb|ACF11719.1| AAA ATPase central domain protein [Chlorobaculum parvum NCIB 8327] (452 aa)
Score = 476, Expect = 1.1e-45, Identities = 122/385 (31%), Positives = 216/385 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN-----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKV----VEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRA-------TNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALS--PPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFV 397
           S DE+  ++ +      + + +E   + S++F+G PG GK+   +     LN  F   ++T     D+  +LE+A +       + ++ I+EIHR NK +QD LL  +E+ +I+++  TTENP F+VN A+ SR+ +Y +  ++ A ++  V + + +     +  V    +E ++  +  D R+    L+  L      +  +V+    K+    +  RA         HYD +SAF KS+RGSDP+AA++++A++++ G D   + RR+     EDIG A+        +  +A E +GLPEARI L+Q    L   PKSN++   I+EA+  V K A +  PP +LR+A      ++   KGY+YPH +   +V++ Y P++++ K +Y+P    +   KF+
  S:    38 SIDELFGQEHLVGPGGPVRSYLEQGRIPSMIFWGPPGSGKTTLAEICAGSLNYRFEQLSATDAGVKDVRRVLEVAQKSRSIDGRQMLLFIDEIHRFNKAQQDTLLHAIEQGLIVLIGATTENPSFEVNRALLSRMQVYILNPLSEAEVQRVVERAIGSDPQLAAAGVEVRDMEFLLAYAAGDARKALNALEAALSLAPLGTAPMVIDR--KLLEQALQHRAPAYDKGGEAHYDTVSAFIKSMRGSDPDAALFWMAKMIDGGEDPKFIARRMVIFASEDIGNADPYALTLAVSVFHAVELIGLPEARINLAQGATYLASCPKSNASYQGINEALSEVKKGAANAVPPLYLRNAPTDLMKEIGYGKGYRYPHSFPGHFVDEHYFPEQMEPKAYYRPT--GEGREKFI 438
>gi|148240504|ref|YP_001225891.1| fused recombination factor protein RarA/unknown domain-containing protein [Synechococcus sp. WH 7803] >gi|147849043|emb|CAK24594.1| ATPase related to the helicase subunit of the Holliday junction resolvase [Synechococcus sp. WH 7803] (737 aa)
Score = 476, Expect = 1.1e-45, Identities = 118/375 (31%), Positives = 206/375 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDL-LEILE----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN-------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           + DE + +  I  +  ++   I  + + +++  G PGVGK+   + I      +F   N+      DL  E+ E    L     + I+ I+E+HR N  +QD LL ++E   + ++  TTENP+F+VN A+ SR  L+R++ +    L + +   L++       +K+K+  +    +V+++  D R +   L++ +       + +V  +LG    S      L D++   H+D +SAF KSIRGSDP+AA+++LA+++E+G+    ++RR+     ED+GLA+      V A   A E +GLPE   PL+Q  + L  + KSNS     +   Q  + +    P HLRDA+       + +GY+YPH +   +V Q+YLP  L+ + F+ P+
  S:    32 NLDEFVGQGAILAEGRLLRRAIAADRVGNLILHGPPGVGKTTLARIIANHTRAHFSSLNAVLAGVKDLRAEVSEAGQRLERHGLRTILFIDEVHRFNSAQQDALLPWVENGTLTLIGATTENPYFEVNKALVSRSRLFRLQALTPGDLSKLLNSALKDPERGYGDRKIKIEPEAAAHLVDVASGDARSLLNALELAVDSTPADENGLVRIDLGIAEESIQQRAVLYDKQGDAHFDTISAFIKSIRGSDPDAALFWLARMVEAGENPRFIFRRMLISAGEDVGLADPQAVVVVEACAAAFERIGLPEGLYPLAQAALYLAGTDKSNSTGGFFEALRQVRSAQRQDVPTHLRDANRDGDAFGDGQGYRYPHAFREHWVAQQYLPDALQGEAFWAPS 425
>gi|73748992|ref|YP_308231.1| recombination factor protein RarA [Dehalococcoides sp. CBDB1] >gi|73660708|emb|CAI83315.1| ATPase, AAA family [Dehalococcoides sp. CBDB1] (457 aa)
Score = 475, Expect = 1.3e-45, Identities = 126/372 (33%), Positives = 207/372 (55%)
  Q:    34 IENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENIN----SAVLKE--EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQN-ENKFVDYWNKIKS 405
           +E++ + S++F+G PG GK+     I   L+ +F   ++ +    DL  ++E A E       + I+ I+EIHR NK +QD +L Y+E   ++++  TTENP F+VN A+ SR  +Y + +++    S +LK   E    L N   +L  +  + I   ++ D R     L++ +       D   +  L ++ ++        D+    HYDL+SA HK++RGSDP+AA+Y+L ++LE G D + + RR+     ED+GLA+        AA  A   LG+PE ++ L++  I L  +PKSNS  +A     + + +   +  P HLR+A       L   K YKY HDY   +V+Q+ LP+ +K+  FY P K  Y  N  N+   +W   K+
  S:    52 LESDKIPSLIFWGPPGSGKTTLANIIAHSLDAHFSALSAVSAGVADLRRVVEEARERLKLYHRRTILFIDEIHRFNKSQQDAILPYVEDGTVVLIGATTENPSFEVNSALLSRAQVYVLNSLSEKEISVILKRSLEGENGLGNYHARLLEEAEKHISSFAQGDARIALNILELAVMTTLPDKDGWRVVGLPQVEDAAQKKSLRYDKSGEQHYDLISALHKTMRGSDPDAAIYWLGRMLEVGEDPLYIARRVIRFATEDVGLADPQGLVIAMAAQQAVHFLGMPEGKLALAEAVIYLAGAPKSNSVYVAYTNVQKEIARNPQADVPLHLRNAPTGLMKDLGYGKDYKYAHDYQNHFVKQQNLPEVIKDHRFYTPGKIGYELNILNRLRAWWGNAKA 446
>gi|88807186|ref|ZP_01122698.1| putative ATPase, AAA family protein [Synechococcus sp. WH 7805] >gi|88788400|gb|EAR19555.1| putative ATPase, AAA family protein [Synechococcus sp. WH 7805] (759 aa)
Score = 475, Expect = 1.4e-45, Identities = 117/375 (31%), Positives = 207/375 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDL-LEILE----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN-------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           + DE + +  I  +  ++   I  + + +++  G PGVGK+   + I      +F   N+      DL  E+ E    L     + I+ I+E+HR N  +QD LL ++E   + ++  TTENP+F+VN A+ SR  L+R++ +    L + +   L++       + +KL  +    +V+++  D R +   L++ ++      + ++  +LG    S      L D++   H+D +SAF KSIRGSD +A +++LA+++E+G+    ++RR+     ED+GLA+      V A   A E +GLPE   PL+Q  + L  + KSNS      EA+++V   +    P HLRDA+       + +GY+YPH +   +V Q+YLP  L+ + F+ P+
  S:    54 NLDEFVGQGAILAEGRLLRRAIAADRVGNLILHGPPGVGKTTLARIIANHTRAHFSSLNAVLAGVKDLRAEVSEAGQRLERHGLRTILFIDEVHRFNSAQQDALLPWVENGTLTLIGATTENPYFEVNKALVSRSRLFRLQTLTPEDLNKLLDSALKDPERGYGGRNIKLEPEAAAHLVDVASGDARSLLNALELAVESTPADDNGVIRIDLGIAEESIQQRAVLYDKQGDAHFDTISAFIKSIRGSDADATLFWLARMIEAGENPRFIFRRMLISAGEDVGLADPQAMVVVEACAAAFERVGLPEGLYPLAQAALYLACTDKSNST-GGFFEALRTVRTAQRQDVPTHLRDANRDGDAFGDGQGYRYPHAFREHWVAQQYLPDALQGEAFWAPS 447
>gi|78183967|ref|YP_376402.1| fused recombination factor protein RarA/unknown domain-containing protein [Synechococcus sp. CC9902] >gi|78168261|gb|ABB25358.1| Recombination protein MgsA [Synechococcus sp. CC9902] (733 aa)
Score = 475, Expect = 1.5e-45, Identities = 120/374 (32%), Positives = 209/374 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN-------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV---NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + +E   +  I  +  ++   I+ + + +++  G PGVGK+   + +      +F   N+      DL   ++ A +       + I+ I+E+HR N  +QD LL ++E   + ++  TTENPFF+VN A+ SR  L+R+  +    L + + + L +       + V L       +V+++  D R +   L++ ++  +  +D  +   L     S      L D++   HYD +SAF KS+RGSD +AA+++LA+++E+G+    ++RR+     EDIGLA+      V A   A E +GLPE   PL+Q  + L  + KSNS I+   +A++SV   N++ + P  HLRDA+       +  GY+YPH Y   +VEQ+YLP  L+ + F++P
  S:    29 TLEEFEGQQGILAEGRLLQRAIKADRVGNLILHGPPGVGKTTLARIVANHTRAHFSNLNAVLAGVKDLRAEVDAAQQRLERHGLRTILFIDEVHRFNSAQQDALLPWVENGTVTLIGATTENPFFEVNKALVSRSRLFRLLPLEPKDLHQLLQRALTDQDRGYGERSVVLDTDAANHLVDVAGGDARSLLNALELAVESSEPTTDGTIAINLATAEESIQQRAVLYDKQGDAHYDTISAFIKSLRGSDADAALFWLARMVEAGENPRFIFRRMLIAAGEDIGLADPQAMVVVEACAAAFERVGLPEGLYPLAQAALYLAGTEKSNS-ILGFFDALKSVRDANRQDVPP--HLRDANRDGDAFGDGVGYRYPHAYADHWVEQQYLPTALQGEVFWQP 421
>gi|184155391|ref|YP_001843731.1| helicase [Lactobacillus fermentum IFO 3956] >gi|183226735|dbj|BAG27251.1| helicase [Lactobacillus fermentum IFO 3956] (448 aa)
Score = 474, Expect = 1.6e-45, Identities = 115/371 (30%), Positives = 205/371 (55%)
  Q:    16 EMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVL-----KYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           E   +D +     ++  +IE + L S++ +G PGVGK+   + I +K    F  F++  ++  D+ +++E AT ++    + ++ I+EIHR NK +QD  L Y+E+  II++  TTENP F++N A+ SR  ++ +  ++   L + + + L +       ++ + + V+EAI   +  D R     L++ +       +Q K  +  L +L    +   DR    HYDL+SA HKSIR SD +AAVY+ +++L  G + + + RRL     ED+GLA++           A + LG+PE  + L++  I L  +PKSN+   A + A + + +    P P  +R+A      +L+  KGY+Y HD +      + +P E+   + Y+P
  S:    29 EFFGQDQLVGTGKVLSELIEQDRLPSLILWGPPGVGKTTLAEIIAQKTKAKFITFSAVNSSIKDIKQVMEAATANHQFGERTVVFIDEIHRFNKAQQDAFLPYVERGEIILIGATTENPSFELNAALLSRCKVFVLRALDKGALVKILHRALHHPNGFADLEITVEDGVLEAIANFANGDARMALNTLEMAVLNGQRNGHQVKLTNADLTQLTSTRSLRYDRAGDEHYDLISALHKSIRNSDVDAAVYWCSRMLAGGEEPLYIARRLVRFAAEDVGLADTNALQVATNTFQACQFLGMPECDVHLTECVIYLAAAPKSNAVYAARNRAKKIIKQTGNLPVPLQIRNAPTKLMKELDYGKGYQYAHDSSDRLTTMQTMPDEISGAKLYRP 417
>gi|154301803|ref|XP_001551313.1| hypothetical protein BC1G_10053 [Botryotinia fuckeliana B05.10] >gi|150855715|gb|EDN30907.1| hypothetical protein BC1G_10053 [Botryotinia fuckeliana B05.10] (558 aa)
Score = 474, Expect = 1.8e-45, Identities = 122/371 (32%), Positives = 206/371 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENIN--------SAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKEL-GKITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA---LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEF 383
           S DE+  ++++ P+  ++ ++IE + + S++ +G  G GK+   + +   +   F   NST++   ++ +I      EL     K II  +EIHR +K +QD+ L  +E   I ++  TTENP FKV  A+ SR   + +  +            LK E   Y     V    ++++ +   S  D R     L++ +    +   +I  +++   +T +L+ DR    HYD +SAFHKS+RG D +AA+YYLA++L+SG D + + RR+  +  ED+GLA++ +     +   A E +G+PE RI ++  T+ LCL+PKS  A   ++ A  ++ +     LS P HLR+A      +L     YKY  +Y    V QEYLP EL+ ++F
  S:   157 SLDEVCGQELVGPQ-GVLRSLIEQDRVPSMILWGGAGTGKTTIARCVATMVGSRFVEINSTSSGVGEVKKIFTEARGELGLTGRKTIIFCDEIHRFSKSQQDVFLGPVESGQITLIGATTENPSFKVQNALLSRCRTFTLSKLTDDDILVILERALKTEGQNYTPTDLV--DTELLKYLSTFSDGDARTALNLLELAMGL--STRPNITKEDIKASLTKTLVYDRAGDQHYDTISAFHKSVRGGDADAALYYLARMLQSGEDPLYIARRMVVMASEDVGLADNTMLTLATSTYTACEKIGMPECRITMAHTTVALCLAPKSTRAYRGLNNAFSALREPGVANLSIPIHLRNAPTKLMKELGYGDQYKYNPNYKEGRVVQEYLPDELRGRKF 542
>gi|119500324|ref|XP_001266919.1| AAA family ATPase, putative [Neosartorya fischeri NRRL 181] >gi|119415084|gb|EAW25022.1| AAA family ATPase, putative [Neosartorya fischeri NRRL 181] (539 aa)
Score = 474, Expect = 1.8e-45, Identities = 126/371 (33%), Positives = 210/371 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLS------NKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGK-ITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK---EALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEF 383
           + DE+  ++++ P + ++  +IE + + S++ +G+ G GK+   + I   +   F   NST+    +  +I      EL     K I+  +EIHR +K +QD+ L  +E   I ++  TTENP FKV  A+ SR   + +  ++   ++  + + L  +    S      ++++E +   S  D R     L++ +    +K   +  +EL + +T +L+ DR    HYD +SAFHKSIRGSDP+AA+YYLA++L+SG D + + RRL  V  EDIGLA++ + P   A  +A E +GLPEARI L+  T+ + LS KS      ++    ++ +     L  P HLR+A      +L   K YKY  +Y    V Q+YLP++L  ++F
  S:   130 TLDEVCGQELVGP-NGVLRGLIEQDRVPSMILWGHAGTGKTTIARVIASMVGSRFVEINSTSTGVAECKKIFAEARSELGLTGRKTIVFCDEIHRFSKSQQDVFLGPVESGQITLIGATTENPSFKVQNALLSRCRTFTLSKLSDEDVRSILDRALRVEGPNYSPSSIVDDELIEYLARFSDGDARTSLNLLELAMDL--SKRPRMTKEELKRSLTKTLVYDRAGDQHYDTISAFHKSIRGSDPDAALYYLARMLQSGEDPLYIARRLVVVASEDIGLADNSMLPLAIATHSAVEKIGLPEARINLAHATVAMALSKKSTRVYRGLNNTFAALGEPGVAGLPVPIHLRNAPTRLMKELGYGKEYKYNPNYLDGQVVQDYLPEKLLGRKF 515
>gi|118586319|ref|ZP_01543772.1| ATPase, AAA family [Oenococcus oeni ATCC BAA-1163] >gi|118433245|gb|EAV39958.1| ATPase, AAA family [Oenococcus oeni ATCC BAA-1163] (467 aa)
Score = 474, Expect = 1.8e-45, Identities = 124/375 (33%), Positives = 214/375 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN----------KKVKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYYQNKSDDIV----LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           + ++ + ++ +     ++  +IE + + S++F+G PGVGK+   + I  +    F  F++ T+   ++ +I++ A  +     + I+ I+EIHR NK +QD  L Y+EK  II++  TTENP F++N A+ SR  ++ +  + S+    +++K LEN          +K+ +S++ ++ I + +  D R     L++ VL  +  K+   +    LK+L    + L D+    HY+++SA HKS+R SD +AA+Y+LA++LESG D + V RRL     EDIGLA+S       AA  AS+ +G+PE  + L+Q    L L+PKSNS   A  EA     K    P P  +R+A      +L+  + Y+Y H         + +P+ L    +Y P+
  S:    48 TLEQFVGQENLLGPGKVLRELIEKDQISSMIFWGPPGVGKTTLAEIIAHRSKAKFITFSAATSGIKEIRKIMKDAENNRQFGVRTIVFIDEIHRFNKAQQDSFLPYVEKGSIILIGATTENPSFEINSALLSRSKVFVLRQLKSS----DIVKLLENALKNPHGFAKQKISISSRTLQLIADFANGDARTALNTLEMAVLNGHHTKNGTEIKTEDLKQLITKKSLLYDKHGEEHYNIISALHKSMRNSDVDAAIYWLARMLESGEDPLYVARRLIRFASEDIGLADSRALEITVAAYQASQLIGMPECTVNLTQAVTYLALAPKSNSLYTAYGEAKSDAQKSFAEPVPLQIRNAPTKLMKELHYGENYQYAHSSQDKLTSMQTMPENLLGHHYYHPS 440
>gi|118591151|ref|ZP_01548550.1| AAA ATPase, central region [Stappia aggregata IAM 12614] >gi|118436227|gb|EAV42869.1| AAA ATPase, central region [Stappia aggregata IAM 12614] (434 aa)
Score = 474, Expect = 1.9e-45, Identities = 116/387 (29%), Positives = 214/387 (55%)
  Q:    16 EMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKY--LENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV-----LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNVK-----GYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNK 402
           +++ +D +   +  +  M++   L S++F+G PG GK+   + +  + +  F   ++  +   DL ++ E A          ++ ++EIHR N+ +QD  L  +E   I ++  TTENP F++N A+ SR  +    ++++  +++ + +   LE +K+ L       ++ ++  D R     L +    ++    D V     L+E+ +    + D+ A  HY+L+SA HKS+RGSDP+AA+Y+  ++L+ G D + + RRL  +  EDIGLA+     + NAA +A + LG PE  + L+Q  I L  +PKSN A +A   A++      +L PP H+ +A      KL  +     GY+Y HD    +  Q+Y P+++  K +Y P +  + +   K +++W+K
  S:    29 DVVGQDHLLGPEGTLSRMLKTRTLGSLIFWGPPGTGKTTIARLLANETDLAFEQISAIFSGVADLKKVFEAARARRMSGRATLLFVDEIHRFNRAQQDSFLPVMEDGTITLVGATTENPSFELNAALLSRSHVMTFHSLSAEAIEKLLARAEELEERKLPLDEDARRVLIRMADGDGRS---SLTLAEDVWRAAGQDEVFDAERLQEIVQRRAPIYDKSADGHYNLISALHKSVRGSDPDAALYWFCRMLDGGEDPLYLARRLIRMAVEDIGLADPNALVQANAARDAYQMLGSPEGELALAQSVIYLATAPKSNGAYVAYKAAMRDAKSSGSLLPPKHILNA----PTKLMKQEGYGDGYQYDHDAPDGFSGQDYFPEQMGRKTYYDPPQRGFERELRKRLEFWDK 428
>gi|150396236|ref|YP_001326703.1| recombination factor protein RarA [Sinorhizobium medicae WSM419] >gi|150027751|gb|ABR59868.1| AAA ATPase central domain protein [Sinorhizobium medicae WSM419] (436 aa)
Score = 473, Expect = 2.2e-45, Identities = 120/380 (31%), Positives = 213/380 (56%)
  Q:    27 DSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKYLE---NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-----KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIKSN 406
           D  +  MI +  L S++F+G PG GK+   + +  +    F   ++  +   DL ++ E A        + ++ ++EIHR N+ +QD  L  +E   +I++  TTENP F++N A+  R+R+L ++  + +S    EE++K  E    K + L      +++ ++  D R I    + V +  +     D   L+E+ +    + D+    HY+L+SA HKS+RGSDP+AA+YYL ++ ++G D + + RRL  +  EDIGL +       NAA +A + LG PE  + L+Q  + L  +PKSN+   A   A+++  +  +L PP H+ +A      KL        GY+Y HD   ++  Q+Y P+++  K FY P +  + +   K +++WNK++ +
  S:    41 DGGLTRMIASGSLGSMIFWGPPGTGKTTVARLLSGEAGLAFEQISAIFSGVADLKKVFESARARRMSGRQTLLFVDEIHRFNRAQQDSFLPVIEDGTVILVGATTENPSFELNAALLSRARVLTFKPHDESSL---EELLKRAEAAEGKSLPLDGDARASLIRMADGDGRAILTLAEEVWRAARPDELFDVAALQEIVQRRAPVYDKGQDGHYNLISALHKSVRGSDPDAALYYLCRMFDAGEDPLYIGRRLVRMAVEDIGLGDPQALVICNAAKDAYDYLGSPEGELALAQACVYLATAPKSNAVYTAYKAAMRAARENGSLLPPKHILNA----PTKLMKGEGYGDGYRYDHDEPDAFSGQDYFPEKMGRKTFYDPPERGFEREIRKRLEWWNKLRRD 433
>gi|116491207|ref|YP_810751.1| recombination factor protein RarA [Oenococcus oeni PSU-1] >gi|116091932|gb|ABJ57086.1| Recombination protein MgsA [Oenococcus oeni PSU-1] (445 aa)
Score = 473, Expect = 2.4e-45, Identities = 124/375 (33%), Positives = 213/375 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN----------KKVKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYYQNKSDDIV----LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           + ++ + ++ +     ++  +IE + + S++F+G PGVGK+   + I  +    F  F++ T+   ++ +I++ A  +     + I+ I+EIHR NK +QD  L Y+EK  II++  TTENP F++N A+ SR  ++ +  + S+    +++K LEN          +K+ +S++ ++ I   +  D R     L++ VL  +  K+   +    LK+L    + L D+    HY+++SA HKS+R SD +AA+Y+LA++LESG D + V RRL     EDIGLA+S       AA  AS+ +G+PE  + L+Q    L L+PKSNS   A  EA     K    P P  +R+A      +L+  + Y+Y H         + +P+ L    +Y P+
  S:    26 TLEQFVGQENLLGPGKVLRELIEKDQISSMIFWGPPGVGKTTLAEIIAHRSKAKFITFSAATSGIKEIRKIMKDAENNRQFGVRTIVFIDEIHRFNKAQQDSFLPYVEKGSIILIGATTENPSFEINSALLSRSKVFVLRQLKSS----DIVKLLENALKNPHGFAKQKISISSRTLQLIANFANGDARTALNTLEMAVLNGHHTKNGTEIKTEDLKQLITKKSLLYDKHGEEHYNIISALHKSMRNSDVDAAIYWLARMLESGEDPLYVARRLIRFASEDIGLADSRALEITVAAYQASQLIGMPECTVNLTQAVTYLALAPKSNSLYTAYGEAKSDAQKSFAEPVPLQIRNAPTKLMKELHYGENYQYAHSSQDKLTSMQTMPENLLGHHYYHPS 418
>gi|110598474|ref|ZP_01386745.1| AAA ATPase, central region [Chlorobium ferrooxidans DSM 13031] >gi|110339924|gb|EAT58428.1| AAA ATPase, central region [Chlorobium ferrooxidans DSM 13031] (447 aa)
Score = 472, Expect = 2.8e-45, Identities = 129/374 (34%), Positives = 213/374 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDF---------RQIFFYLKIVLKYYQNKSDDIVL-KELGKIT----NSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAI-QSVNKEALSPPNHLRDAHYASAVKLNVK-----GYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S D+M  ++ +      +   I +  L S++F+G PG GK+   +     LN  F   ++  +   D+ + L+ A +      + I+ I+EIHR NK +QD LL  +E+ +I+++  TTENP F+VN A+ SR+ +Y ++ + S    EE++  +  + +K      E  +EI+  DF         R+    ++  L        +IVL +EL +        + D+   NHYD++SAF KS+RGSDP+AA+++LA+++E G D   + RR+     EDIG A+        +  +A E +G+PEARI L+Q    L  + KSN++  AI+EA+ +S   + L+ P HLR+A      KL  +     GY+YPH Y   +V Q+Y P  +  K +Y+P
  S:    35 SLDDMAGQEHLVGPSGPLRRFISSGQLPSMIFWGPPGSGKTTLAEICAASLNYRFEQLSAIDSGVKDVRKALDNAQKSRASGLRTILFIDEIHRFNKGQQDTLLHAIEQGLIVLIGATTENPSFEVNAALLSRMQVYILKPLQS----EEILAVIR-RALKEDRLFGELQIEIADPDFLLQFAGGDARKALNAVETALSLLPQDQTEIVLDRELLERALQHRAPVYDKGGENHYDVISAFIKSMRGSDPDAALFWLARMIEGGEDPKFIARRMVIFASEDIGNADPYAITLAISIFHAVELIGMPEARINLAQGVTYLASAAKSNASYQAINEALRESGPMQDLAVPLHLRNA----PTKLMKQEGYGAGYQYPHSYPGHFVRQDYFPDGMDPKPYYRP 424
>gi|119716631|ref|YP_923596.1| recombination factor protein RarA [Nocardioides sp. JS614] >gi|119537292|gb|ABL81909.1| Recombination protein MgsA [Nocardioides sp. JS614] (456 aa)
Score = 472, Expect = 3.0e-45, Identities = 122/392 (31%), Positives = 219/392 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG-YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           + DE++ +  +    S +  ++E +   S+L +G PG GK+     + ++ ++ F   ++ +    ++   +     ELA    + ++ ++E+HR +K +QD LL  +E   + ++A TTENPFF V   + SR LL R+E+++   ++  + + + +++     V + +  +  +V ++  D R+   YL+        +  + V  +L     ++       DR+   HYD++SAF KS+RGSD +AA++YLA+++E+G D   + RRL  +  ED+GLA+    P   AA    + +G+PEA++ L+  TI L ++PKSN+   AI  A+  V    +   P HLRDAHY+ A KL     YKY HD  F   EQ+Y P  + + E+Y+P      E    + W +++
  S:    38 TLDELVGQAQLRAAGSPLRRLVEGDQSMSLLLWGPPGTGKTTIAAIVSQQTDRRFVEVSAVSAGVKEVRAAIDAARAELAGGGRETVLFVDEVHRFSKAQQDALLPGVENRWVTLIAATTENPFFSVISPLLSRSLLLRLESLDDDDVRAVLDRAITDERGLAGSVGVDDDALGHLVRLAGGDARRSLTYLEAAAGAALAQGLETV--DLATAETAVDRAAVRYDRQGDQHYDVVSAFIKSVRGSDADAALHYLARMIEAGEDPRFIARRLMILASEDVGLADPTALPTAVAAAQTVQLIGMPEAQLTLAHATIALAVAPKSNAVTTAIGAALADVRAGKIGQVPPHLRDAHYSGAKKLGHGARYKYSHDEPFGIAEQQYAPDVVADAEYYRPTTLGA-EAAIKERWERVR 445
>gi|154509637|ref|ZP_02045279.1| hypothetical protein ACTODO_02170 [Actinomyces odontolyticus ATCC 17982] >gi|153799271|gb|EDN81691.1| hypothetical protein ACTODO_02170 [Actinomyces odontolyticus ATCC 17982] (563 aa)
Score = 472, Expect = 3.0e-45, Identities = 122/376 (32%), Positives = 217/376 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN------KKVKLSNKVVEAIVEISKSDFRQIFFYLK-IVLKYYQNKSDDIV----LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEA---LGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHD-YNFSYVEQEYLPKELKNKEFYKPNK 388
           S DE++ +         + +MIE +   S++F+G PGVGK+   + I +  + +F  F++ T+   ++ E+++ A    +   + I+ ++EIHR NK +QD  L ++EK  II++  TTENP F++N A+ SR  ++ +  +    L + + + L++      ++V++  K++ AI   +  D R     L+ +VL   ++     V    +++L    +   D+    HY+++SA HKS+R SDP+AAVY+LA++LE G D + V RR+     ED+GLA++     +N A+NA +A   +G+PE  + L+Q  I L L+PKSNS+ +A + A +        P P  +R+A       L   +GY+  HD  +    +   LP  L + E+Y+P +
  S:    28 SLDEVVGQSHQIGPGKALRSMIEADRTPSMIFWGPPGVGKTTLARVIARHTHASFIDFSAVTSGIKEIREVMKQADAQASMGRRTIVFVDEIHRFNKAQQDAFLPFVEKGSIILIGATTENPSFEINNALLSRCKVFVLHGLTEEDLVDLMRRALKDPRGFGGREVRIEEKLLRAIATFADGDARVALSTLEMVVLNGVEDGGVTTVGPETVRQLTSTKSLRYDKDGEEHYNIISALHKSMRNSDPDAAVYWLARMLEGGEDPLYVARRITRFASEDVGLADTN---ALNVAINAFQAAQFIGMPECSVHLAQAVIYLSLAPKSNSSYVAYEHAKKDALHTLAEPVPMAIRNAPTRLMKDLGYGRGYRLAHDEADKVAADMRCLPNSLASAEYYRPTE 422
>gi|126724895|ref|ZP_01740738.1| ATPase, AAA family protein [Rhodobacterales bacterium HTCC2150] >gi|126706059|gb|EBA05149.1| ATPase, AAA family protein [Rhodobacterales bacterium HTCC2150] (438 aa)
Score = 472, Expect = 3.1e-45, Identities = 126/356 (35%), Positives = 200/356 (56%)
  Q:    33 MIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSR---LLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNAS----EALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALS-PPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           M+E   L S++F+G PGVGK+   + +   ++  F   ++  +   DL ++ + AT  ++     ++ ++EIHR NK +QD  L Y+E   I+++  TTENP F++N A+ SR   L+L R+  I+   L +   K LE KK+ L+N   +A++E++  D R +   ++ V  +  N S   D + K L +   S  D+    HY+L+SA HKS+RGSDP+AA+Y+ A++L  G D   + RR+  +  EDIGLA+    P+  A    S    E LG PE  + LSQ  + L L+PKSN+  +A   A  S  K     PP H+ +A      +     GY Y HD    +  Q Y P+ +K   +Y+P +
  S:    49 MLEAKSLSSLIFWGPPGVGKTTIARLLADHVDLAFVQISAIFSGVADLKKVFQAATIRHQNGQGTLLFVDEIHRFNKAQQDGFLPYMENGTILLVGATTENPSFELNAALLSRSQVLVLERLSLIDLEFLAQRAEKLLE-KKLPLTNDSRDALLEMADGDGRTLLNLIEQVSAWKLNASLDRDALAKRLMR-RASKYDKNGEEHYNLISALHKSVRGSDPDAALYWFARMLNGGEDPRFLARRITRMAVEDIGLAD----PQAQAVCLQSWETFERLGSPEGELALSQAVVYLALAPKSNANYVAYKAARASATKTGSEPPPKHILNAPTKLMAEQGYGDGYAYDHDAEDGFSGQNYFPETMKRGVYYQPKE 414
>gi|116334669|ref|YP_796196.1| recombination factor protein RarA [Lactobacillus brevis ATCC 367] >gi|116100016|gb|ABJ65165.1| Recombination protein MgsA [Lactobacillus brevis ATCC 367] (439 aa)
Score = 472, Expect = 3.3e-45, Identities = 125/397 (31%), Positives = 216/397 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-----KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV-----LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEA---LGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKG-YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           + D+ + +  +     I+  +IEN+ + S++F+G PGVGK+   + I ++    F  F++  ++ + + +I+  A  D     + I+ ++EIHR NK +QD  L Y+E+  II++  TTENP F+VN A+ SR  ++ ++ + +A + + +   L N      +V + +  + AI E +  D R     L++ +     + D +      LK+L      L D+    HY+++SA HKS+R SDP+AA+Y+L ++L  G D + V RRL     EDIGLA++     +N A+N  +A   LG+PE  + L +    L L+PKSN+   A   A + V +    P P  LR+A       L     Y+Y H+        + LP+ L+   +Y+P +  + E +F     +IK   +Q
  S:    24 TLDQFVGQAHLLGPGKILRELIENDQVSSMIFWGPPGVGKTTLAEIIARQTQATFLSFSAVDSSISKIKKIMHQAEADREIGEQTIVFVDEIHRFNKAQQDAFLPYVERGSIILIGATTENPSFEVNSALLSRCKVFVLKALATADIDQLLRNALTNPAGFSGRVTIGDAELRAIAEFANGDARMALNTLEMAVLNGDKQGDQVTVTQADLKQLITQKFVLYDKTGEEHYNIISALHKSMRNSDPDAAIYWLTRMLSGGEDPLYVARRLVRFASEDIGLADTN---ALNVAINVFQACQFLGMPECNVHLVEAVTYLSLAPKSNAIYKASQAAQKDVQQTRDEPVPLQLRNAPTKLMKDLGYGADYQYAHESAAKLTTMQTLPEALRGHVYYEPTEQGR-EGRFKARLAEIKRWQQQ 436
>gi|31793742|ref|NP_856235.1| recombination factor protein RarA [Mycobacterium bovis AF2122/97] >gi|121638444|ref|YP_978668.1| recombination factor protein RarA [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|31619336|emb|CAD94774.1| CONSERVED HYPOTHETICAL ALANINE LEUCINE VALINE RICH PROTEIN [Mycobacterium bovis AF2122/97] >gi|121494092|emb|CAL72570.1| Conserved hypothetical alanine leucine valine rich protein [Mycobacterium bovis BCG str. Pasteur 1173P2] (452 aa)
Score = 472, Expect = 3.3e-45, Identities = 115/374 (30%), Positives = 214/374 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN-----KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL---IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S DE++ +D +    S +  ++E + + S++ +G PG GK+     I +   + F   ++ +    ++  ++E + +      + ++ I+E+HR +K +QD LL  +E  +++++A TTENP F V   + SR L+ ++  + +   +  V + +++     + V ++ + V+ +V+++  D R+    L++  +  Q   + + ++ + +  +      DR    HYD++SAF KS+RGSD +AA++YLA++L +G D   + RRL  +  EDIG+A+        AA      +G+PEA++ L+  TI L  +PKSN+   A+  A+  +   +A   P HLRD HY+ A  L N +GYKY HD     V Q+Y P EL + ++Y+P
  S:    39 SLDEVVGQDHLLAPGSPLRRLVEGSGVASVILYGPPGSGKTTLAALISQATGRRFEALSALSAGVKEVRAVIENSRKALLHGEQTVLFIDEVHRFSKTQQDALLSAVEHRVVLLVAATTENPSFSVVAPLLSRSLILQLRPLTAEDTRAVVQRAIDDPRGLGRAVAVAPEAVDLLVQLAAGDARRALTALEVAAEAAQAAGELVSVQTIERSVDKAAVRYDRDGDQHYDVVSAFIKSVRGSDVDAALHYLARMLVAGEDPRFIARRLMILASEDIGMADPSALQVAVAAAQTVALIGMPEAQLTLAHATIHLATAPKSNAVTTALAAAMNDIKAGKAGLVPAHLRDGHYSGAAALGNAQGYKYSHDDPDGVVAQQYPPDELVDVDYYRP 427
>gi|46447333|ref|YP_008698.1| recombination factor protein RarA [Candidatus Protochlamydia amoebophila UWE25] >gi|46400974|emb|CAF24423.1| conserved hypothetical protein [Candidatus Protochlamydia amoebophila UWE25] (422 aa)
Score = 471, Expect = 3.5e-45, Identities = 123/396 (31%), Positives = 226/396 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPI------IIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN-KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI-VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDL-ISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKSNNK 408
           + ++++ +D I  ++ +I   IE+    S++ +G PG GK++  +   +  N  F   ++  +   DL + ++ A   N+P+      + ++EIHR NK +QD  L ++E   II++  TTENP F +N A+ SRL +  I  ++   L++ + +Y +    + L+ +    ++  ++ D R ++  ++  L+Y   +  DI +L+++ +  + L D+R   HY+L+SA HKS+RGSDPNAA+Y+  ++LE G+  + + RRL  +  EDIGL++    P   AA +A E LG PE  + L+++ I L L+PKSN+   A   A +S +K + L+PP  + +A       L   K Y+Y  D   ++  Q Y P  L+ + FY+P    + +   K ++Y+ +++   K
  S:    16 NLNDIVGQDHILGENGLITKTIESQIPLSVILWGPPGCGKTSIARLYAQAFNMQFISMSAIFSGVADLKKTIKEA--QNQPLFHKGTLLFVDEIHRFNKSQQDAFLPFVENGTIILIGATTENPSFYLNGALLSRLRVLPIYPLDGFSLEQLLERYEKQFAPLPLTAEARHWLITCAQGDGRYLYNLIE-NLRYASKQILDIPLLEKIFQKRSPLFDKRGDQHYNLISALHKSVRGSDPNAAIYWFTRMLEGGEEPLFLARRLIRMAVEDIGLSDPQALPLAIAAKDAYEMLGSPEGELALAEVVIYLALAPKSNAVYRAFGMAKESASKTSYLNPPLTILNAPTKMMKNLGYGKDYQYDPDLPEAFSGQNYFPDSLEKQHFYEPVERGFERELKKRLEYFEQLRLKKK 421
>gi|87301395|ref|ZP_01084236.1| ATPase [Synechococcus sp. WH 5701] >gi|87284363|gb|EAQ76316.1| ATPase [Synechococcus sp. WH 5701] (742 aa)
Score = 471, Expect = 3.7e-45, Identities = 116/376 (30%), Positives = 213/376 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN-------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAID--EAIQSVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           S +E + +  I     ++   I  + + +++  G PGVGK+   + I      +F   N+      DL   +E A +       + ++ I+E+HR N  +QD LL ++E   + ++  TTENP+F+VN A+ SR  L+R++ +    L+  + + L +       + V+L+ +  + +++++  D R +   L++ ++     +  ++  +L     S      L D++   H+D +SAF KS+RGSDP+AA+++LA+++E+G+    ++RR+     EDIGLA+      V A   A E +GLPE   PL+Q  + L  + KSNS +   D  +++++ N++ +  P+HLRDA+   A   +  GY+YPH Y   +V Q YLP  L+ + F+ P +
  S:    27 SLEEFVGQAEILGPGRLLRRAIRADRVGNLILHGPPGVGKTTLARIIASSTRAHFTSLNAVLAGVKDLRVEVEAARQRLERHGLRTLLFIDEVHRFNVAQQDALLPWVENGTVTLIGATTENPYFEVNKALVSRSRLFRLQPLEPRDLRVLLERALADGERGYGGRPVELTPEAADHLLDVAGGDARSLLNALELAVESSAADASGVIRIDLEIAEQSIQQRAVLYDKQGDAHFDTISAFIKSLRGSDPDAALFWLARMVEAGENPRFIFRRMLISAGEDIGLADPQAMVVVEACAAAFERVGLPEGLYPLAQAALYLAGAEKSNSLLGFFDALKSVRATNRQEV--PSHLRDANRDGAAFGDGVGYRYPHAYAEHWVAQTYLPAALQGEVFWLPGR 421
>gi|78213812|ref|YP_382591.1| fused recombination factor protein RarA/unknown domain-containing protein [Synechococcus sp. CC9605] >gi|78198271|gb|ABB36036.1| ATPase [Synechococcus sp. CC9605] (721 aa)
Score = 471, Expect = 3.7e-45, Identities = 114/355 (32%), Positives = 202/355 (56%)
  Q:    34 IENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN-------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           I+ + + +++  G PGVGK+   + I      +F   N+      +L   ++ A +       + I+ I+E+HR N  +QD LL ++E   + ++  TTENP+F+VN A+ SR  L+R+  +    L+  + + L +       + + +S+     +V+++  D R +   L++ ++  +   D ++   L     S      L D+    HYD +SAF KS+RGSD +AA+++LA+++E+G+    ++RR+     EDIGLA+      V A   A E +GLPE   PL+Q  + L  + KSNS ++   +A+++V + +    P HLRDA+   A   +  GY+YPH Y   +VEQ+YLP  L+ + F++P +
  S:    49 IKADRVGNLILHGPPGVGKTTLARIIANHTRAHFSSLNAVLAGVKNLRTEVDAARQRLERHGLRTILFIDEVHRFNSAQQDALLPWVENGTVTLIGATTENPYFEVNKALVSRSRLFRLLPLEPEDLQRLLQRALADNERGYGDRAIAISSDAANHLVDVAGGDARSLLNALELAVESSEPDGDGVIQINLAIAEESIQQRAVLYDKHGDAHYDTISAFIKSLRGSDSDAALFWLARMVEAGENPRFIFRRMLIAAGEDIGLADPQAIVVVEACAAAFERVGLPEGLYPLAQAALYLASTEKSNS-VLGFFDALKTVRDAQKQDVPGHLRDANRDGAAFGDGVGYRYPHAYAEHWVEQQYLPTALQGEVFWQPGE 422
>gi|33866690|ref|NP_898249.1| fused recombination factor protein RarA/unknown domain-containing protein [Synechococcus sp. WH 8102] >gi|33633468|emb|CAE08673.1| putative ATPase, AAA family [Synechococcus sp. WH 8102] (751 aa)
Score = 471, Expect = 3.9e-45, Identities = 116/376 (30%), Positives = 212/376 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDL-LEI----LELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN-------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAID--EAIQSVNKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           + +E   +  I  +  ++   I+ + + +++  G PGVGK+   + +      +F   N+      DL  E+    L L     + I+ I+E+HR N  +QD LL ++E   + ++  TTENP+F+VN A+ SR  L+R+  +    L + + + L +       ++V ++      +V+++  D R +   L++ ++  + + D ++   L     S      L D++   HYD +SAF KS+RGSD +AA+++L++++E+G+    ++RR+     EDIGLA+      V A   A E +GLPE   PL+Q  + L  + KSNS +   D  ++++  N++ +  P+HLRDA+       +  GY+YPH Y   +VEQ+YLP  L+ + F++P +
  S:    45 TLEEFEGQQGILAQGRLLRRAIKADRVGNLILHGPPGVGKTTLARIVANHTRAHFSSLNAVLAGVKDLRAEVDAAKLRLERHGLRSILFIDEVHRFNSAQQDALLPWVENGTVTLIGATTENPYFEVNKALVSRSRLFRLLPLEPDDLHQLLQRALNDEERGYGTRRVTVTPDAAAHLVDVAGGDARSLLNALELAVESSEPEPDGVIQINLAIAEESIQQRAVLYDKQGDAHYDTISAFIKSLRGSDADAALFWLSRMVEAGENPRFIFRRMLIAAGEDIGLADPQAIVVVEACAAAFERVGLPEGLYPLAQAALYLAGTEKSNSVLGFFDALKSVREANRQDV--PSHLRDANRDGDSFGDGVGYRYPHAYAEHWVEQQYLPTALQGEVFWQPGQ 439
>gi|83949758|ref|ZP_00958491.1| ATPase, AAA family protein [Roseovarius nubinhibens ISM] >gi|83837657|gb|EAP76953.1| ATPase, AAA family protein [Roseovarius nubinhibens ISM] (437 aa)
Score = 471, Expect = 4.1e-45, Identities = 123/393 (31%), Positives = 220/393 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELAT----EDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSR---LLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVL--KYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNVK-----GYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKS 405
           S  E+I ++ +   ++ +  M+EN  L S++ +G PGVGK+   + +  + + +F   ++      +L ++ E A          ++ ++EIHR NK +QD  L ++E   I+++  TTENP F++N A+ SR   L+L R+ N +   L +   K ++ + + L+ +  E +++++  D R +   ++ V+  K  Q    + + K L K   S+ D+    HY+L+SA HKS+RGSDP+AA+Y+ A++L+ G D   + RR+  +  EDIGLA+     +   A    E LG PE  + L+Q  + L L+PKSN+A +A   A++   +  +L PP H+R+A      KL  +     GY Y HD    +  Q Y P+++     Y P    + +   K +D++ K+++
  S:    30 SLGEVIGQEQVLGPEAPLGVMLENGSLGSLILWGPPGVGKTTIARLLAAETDLHFVQISAIFTGVPELRKVFEEARMRHGNGRGTLLFVDEIHRFNKAQQDGFLPHMEDGTILLVGATTENPSFELNAALLSRAQVLVLERLANRDLERLVQRAEKMMD-RALPLTGEAREVLLDMADGDGRALLNLVEQVMAWKSAQKLDPEALSKRLMK-RASVYDKNGEEHYNLISALHKSVRGSDPDAALYWFARMLKGGEDPRYLARRITRMAVEDIGLADPQAQAQCLQAWETYERLGSPEGELALAQALVYLALAPKSNAAYVAYKTAMREAGRTGSLPPPKHIRNA----PTKLMKEQGYGAGYAYDHDAEDGFSGQNYFPEDMPRMAAYFPVERGFERELRKRLDFFAKLRA 434
>gi|189501780|ref|YP_001957497.1| hypothetical protein Aasi_0336 [Candidatus Amoebophilus asiaticus 5a2] >gi|189497221|gb|ACE05768.1| hypothetical protein Aasi_0336 [Candidatus Amoebophilus asiaticus 5a2] (431 aa)
Score = 470, Expect = 5.1e-45, Identities = 124/374 (33%), Positives = 215/374 (57%)
  Q:    33 MIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSR---LLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV-LKELGKITNS---LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-----KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIKSN 406
           M ++  L S++ +G PG GK+   + + K  +  F   ++  +   DL ++ E A E  K     ++ ++EIHR N+ +QD  L ++E   +I++  TTENP F++N A+ SR   L+L R+E+ +  +L +    YLE K++ L       +  ++  D R ++  ++++    Q  S  I+ +++L ++ +    L D+    HY+L+SA HKS+RGSDP+AA+Y+ A++LE G D + + RRL     ED+GL++     +  AA  A E LG PE  + ++Q  + L  +PKSN+   A + A +S  +  +  PP  + +A      KL       +GY Y HD   S+  Q Y P E+K +EFY P +  + +   K +DYW +++S+
  S:    41 MRKSGQLSSLILWGPPGCGKTTLARLLAKTSDLEFEPISAIESGVADLKKVFERAQERKKMGRGTLLFVDEIHRFNRTQQDSFLPHVENGTVILIGATTENPSFELNSALLSRTQVLVLRRLESSHLEILYQRAQSYLE-KELPLDVAGRALLYAMADGDGRALYNMIEVL---SQLPSRPILSVEDLTQVLSRRAPLYDKNKEGHYNLISALHKSLRGSDPDAALYWFARMLEGGEDPLYIARRLIRFASEDVGLSDPQALIQTIAATEAYERLGSPEGELSIAQAVLYLATAPKSNAVYKAYNRARKSAKETGSFMPPKIILNA----PTKLMRGEGYGEGYIYDHDTKESFSGQNYFPDEMKRQEFYSPPQRGFEREIKKRLDYWARLRSS 426
>gi|15609696|ref|NP_217075.1| recombination factor protein RarA [Mycobacterium tuberculosis H37Rv] >gi|15842097|ref|NP_337134.1| recombination factor protein RarA [Mycobacterium tuberculosis CDC1551] >gi|148662398|ref|YP_001283921.1| recombination factor protein RarA [Mycobacterium tuberculosis H37Ra] >gi|148823755|ref|YP_001288509.1| recombination factor protein RarA [Mycobacterium tuberculosis F11] >gi|167968830|ref|ZP_02551107.1| recombination factor protein RarA [Mycobacterium tuberculosis H37Ra] >gi|194544732|ref|YP_002079761.1| conserved hypothetical alanine leucine valine rich protein [Mycobacterium tuberculosis C] >gi|2496491|sp|Q50739|Y2559_MYCTU Uncharacterized AAA domain-containing protein Rv2559c/MT2636 >gi|1460081|emb|CAB01045.1| CONSERVED HYPOTHETICAL ALANINE LEUCINE VALINE RICH PROTEIN [Mycobacterium tuberculosis H37Rv] >gi|13882379|gb|AAK46948.1| ATPase, AAA family [Mycobacterium tuberculosis CDC1551] >gi|124601739|gb|EAY60749.1| conserved hypothetical alanine leucine valine rich protein [Mycobacterium tuberculosis C] >gi|148506550|gb|ABQ74359.1| conserved hypothetical alanine,leucine and valine rich protein [Mycobacterium tuberculosis H37Ra] >gi|148722282|gb|ABR06907.1| conserved alanine, leucine and valine rich protein [Mycobacterium tuberculosis F11] (452 aa)
Score = 470, Expect = 5.4e-45, Identities = 115/374 (30%), Positives = 213/374 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN-----KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL---IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S DE++ +D +    S +  ++E + + S++ +G PG GK+     I +   + F   ++ +    ++  ++E + +      + ++ I+E+HR +K +QD LL  +E  +++++A TTENP F V   + SR L+ ++  + +   +  V + +++     + V ++ + V+ +V+++  D R+    L++  +  Q   + + ++ + +  +      DR    HYD++SAF KS+RGSD +AA++YLA++L +G D   + RRL  +  EDIG+A         AA      +G+PEA++ L+  TI L  +PKSN+   A+  A+  +   +A   P HLRD HY+ A  L N +GYKY HD     V Q+Y P EL + ++Y+P
  S:    39 SLDEVVGQDHLLAPGSPLRRLVEGSGVASVILYGPPGSGKTTLAALISQATGRRFEALSALSAGVKEVRAVIENSRKALLHGEQTVLFIDEVHRFSKTQQDALLSAVEHRVVLLVAATTENPSFSVVAPLLSRSLILQLRPLTAEDTRAVVQRAIDDPRGLGRAVAVAPEAVDLLVQLAAGDARRALTALEVAAEAAQAAGELVSVQTIERSVDKAAVRYDRDGDQHYDVVSAFIKSVRGSDVDAALHYLARMLVAGEDPRFIARRLMILASEDIGMAGPSALQVAVAAAQTVALIGMPEAQLTLAHATIHLATAPKSNAVTTALAAAMNDIKAGKAGLVPAHLRDGHYSGAAALGNAQGYKYSHDDPDGVVAQQYPPDELVDVDYYRP 427
>gi|148263766|ref|YP_001230472.1| recombination factor protein RarA [Geobacter uraniireducens Rf4] >gi|146397266|gb|ABQ25899.1| Recombination protein MgsA [Geobacter uraniireducens Rf4] (435 aa)
Score = 469, Expect = 6.3e-45, Identities = 115/377 (30%), Positives = 205/377 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK-----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI-VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKY 389
           +  E + ++ +     ++  +IE + L S++F+G PG GK+   + I      +F +F++  +   ++ EI++ A +  K      I+ ++EIHR NK +QD  L Y+E+ +  ++  TTENP F+V   + SR  +  +  +    +   + + L +K+       + + +  +  + E +  D R     L+   +   N    +   +E  +    L D+    HY+++SAF KS+RGSDP+ A+Y+LA+++E+G D I + RR+  +  EDIG A+         A+   + +G+PE RI + Q    L  +PKSN++ + ID A+  V K  AL  P H+R+A       L    GY+Y HDY   YV Q+YLP ++K +++Y P  +
  S:    26 TLAEYVGQEHLLGPGKLLRQLIETDQLTSLIFWGPPGSGKTTLARIIAGATKSHFIFFSAILSGIKEIREIVKEADDIRKFHGKRTILFVDEIHRFNKSQQDAFLPYVERGVFTIIGATTENPSFEVIAPLLSRCKVLVLNPLTEEEITGILRQALADKERGLGALDLAIEDDALTFMAEQAGGDARVALNTLETASRLTSNGVVSLDTAREAVQKKPLLYDKGGEEHYNVISAFIKSMRGSDPDGALYWLARMIEAGEDPIFILRRMVILASEDIGNADPRALQVAVTALQGFQLVGMPEGRIIIGQAVTYLATAPKSNASYVGIDAALAEVRKSGALPVPLHIRNAPTRLMKDLGYGTGYRYAHDYAEGYVAQDYLPDQIKGRKYYDPTGH 418
>gi|13470578|ref|NP_102147.1| recombination factor protein RarA [Mesorhizobium loti MAFF303099] >gi|14021320|dbj|BAB47933.1| mlr0329 [Mesorhizobium loti MAFF303099] (435 aa)
Score = 469, Expect = 6.4e-45, Identities = 115/389 (29%), Positives = 218/389 (56%)
  Q:    16 EMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRI---ENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIK 404
           E++ ++ +   D  +  +I +  L S++F+G PG GK+   + +  + +  F   ++  +   DL ++ E A        + ++ ++EIHR N+ +QD  L  +E   ++++  TTENP F++N A+  R+R++++     E+I   +++ E     E + + L ++    ++ +S  D R      + V +  +     D   L+ + +    + D+    HY+L+SA HKS+RGSDP+AA+YYLA++ ++G D + + RRL  +  EDIGLA+       NAA +A + LG PE  +  ++ T+ L  +PKSN+   A   A Q+  +  +L PP H+ +A      + +   GY+Y HD   ++  Q+Y P+++  + FY P +  + ++  K +DYW K++
  S:    30 EVVGQEHLTGPDGALTRLIGSGSLGSMIFWGPPGTGKTTVARLLAGETSLAFEQISAVFSGVADLKKVFETAKLRRANGRQTLLFVDEIHRFNRAQQDSFLPVMEDGTVVLVGATTENPSFELNAALLSRARVMVFHSLGEESIAKLMVRAEET---EGRALPLDDEARAMLIRMSDGDGRASLTLAEEVWRAAKPGEVFDPEGLQRIVQRRAPIYDKGQDGHYNLISALHKSVRGSDPDAALYYLARMFDAGEDPLYLGRRLVRMAMEDIGLADPQALVVANAAKDAYDYLGSPEGELAFAEATVYLATAPKSNAVYTAFKAATQAAKQHGSLLPPKHILNAPTKLMKEEDYGAGYRYDHDEPDAFSGQDYFPEKMGRQTFYDPPERGFERDIRKRLDYWAKLR 431
>gi|50954757|ref|YP_062045.1| recombination factor protein RarA [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50951239|gb|AAT88940.1| ATPase related to the helicase subunit [Leifsonia xyli subsp. xyli str. CTCB07] (446 aa)
Score = 468, Expect = 8.1e-45, Identities = 129/349 (36%), Positives = 197/349 (56%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE--LATED---NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIF------FYLKIVLKYYQNKSDDIVLKEL--GKITNSLI--DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKY 389
           S++ +G PG GK+   Q I     + F   ++ T    D+  +++  L+T D      ++ ++EIHR  K +QD LL  +E   +I++A TTENP F V   + SR LL  +E +    L   + + + + +       L +    A+V ++  D R+              L    +K    +  EL    +  +L+  DR    HYD++SAF KSIRGSD +AA++YLA++LE+G D   + RR+     EDIG+A+        AA +A + LGLPE RIPL+Q  + L  +PKSN+A  A+D AI  V    +   P HLRD HY  A +L + KGY+YPHD     +EQ+YLP EL +  +Y P ++
  S:    55 SVILWGPPGTGKTTLAQAIAHSSGRRFVELSAVTAGVKDVRLVMDEALSTRDLYGVSTVLFLDEIHRFTKAQQDALLPGVENGWVILVAATTENPSFSVISPLLSRSLLLTLETLGDDDLGLVIDRAVADNRGLAGQFSLDDDGRAALVRLASGDARRALTALEAASVAAAALTPATSKKKPAITAELVAQAVDRALLRYDRNGDEHYDVISAFIKSIRGSDVDAALHYLARMLEAGEDPRFIARRIVISASEDIGMADPQALVIAVAAADAVQFLGLPEGRIPLAQAVVHLATAPKSNAAYTALDAAIADVRAGRIGRVPKHLRDGHYPGAKRLGHGKGYRYPHDDALGVLEQQYLPDELSDTVYYHPTEH 426
>gi|88856257|ref|ZP_01130917.1| ATPase related to the helicase subunit [marine actinobacterium PHSC20C1] >gi|88814576|gb|EAR24438.1| ATPase related to the helicase subunit [marine actinobacterium PHSC20C1] (472 aa)
Score = 467, Expect = 1.1e-44, Identities = 130/346 (37%), Positives = 201/346 (58%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN-----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV---EA---IVEISKSDFRQIFFYLKIVLKYYQNKSDD----IVLKE--LGKITNSLI--DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           SI+ +G PG GK+   + I +   + F   ++ T    D+ + +E A           ++ ++EIHR  K +QD LL  +E   II++A TTENP F V   + SR LL  +  ++   + E V + + + +  L N VV   EA   +V +S  D R+    L+       N SD     +V  E     +  +L+  DR+   HYD++SAF KS+RGSD +AA++YLA+++E+G D   + RR+     ED+G+A+        AA +A + +G+PE RIPL++  + L  +PKSN+A +A+D AI  V    +   P  LRDAHY  A +L + KGY+Y HD  +  V+Q+YLP  LK  E+Y P
  S:    83 SIILWGPPGTGKTTIAKAIARGSQRKFVELSAVTAGVKDVRQTIEEALTARDLYGVSTVLFLDEIHRFTKAQQDALLPGVENGWIILIAATTENPSFSVISPLLSRSLLLTLNQLDDDEVGELVDRAVTDAR-GLKNAVVLEPEARALLVRLSSGDARRALTALEASAVSAANHSDAQSPAVVTAEHVASAVDRALLRYDRQGDEHYDVISAFIKSVRGSDVDAAIHYLARMIEAGEDPRFIARRIIISAAEDVGVADPQALVIAVAAADAVQMIGMPEGRIPLAEAVVYLATAPKSNAAYVALDAAIADVRAGKIGRVPKPLRDAHYPGAKRLGHGKGYQYSHDSEYGVVKQQYLPDILKGTEYYTP 449
>gi|15889208|ref|NP_354889.1| recombination factor protein RarA [Agrobacterium tumefaciens str. C58] >gi|15157031|gb|AAK87674.1| ATPase, AAA family protein [Agrobacterium tumefaciens str. C58] (438 aa)
Score = 467, Expect = 1.1e-44, Identities = 120/379 (31%), Positives = 214/379 (56%)
  Q:    26 KDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLY--RIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS---LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-----KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIK 404
           ++ ++  MI++  L S++F+G PG GK+   + +  +    F   ++  +   DL ++ E A        + ++ ++EIHR N+ +QD  L  +E   II++  TTENP F++N A+  R+R+L +    E+  S +LK    +  E K + L+ +   +++ ++  D R +    + V +  + K +    + L +I      + D+    HY+L+SA HKS+RGSDP+AA+YYLA++ ++G D + + RRL  +  EDIGLA+       NAA +A + LG PE  + L+Q  + L  +PKSN+   A   A+++  +  +L PP H+ +A      KL        GY+Y HD   ++  Q+Y P+++    FY P    + +   K +D+W K++
  S:    41 EEGVLRRMIDSGSLGSMIFWGPPGTGKTTVARLLSGEAGLAFEQISAIFSGVADLKKVFEAARTRRMNGRQTLLFVDEIHRFNRAQQDSFLPVMEDGTIILVGATTENPSFELNAALLSRARVLTFGSHDEDSLSELLKRA--EEAEGKPLPLTEEARASLLRMADGDGRAVLTLAEEVWRAAR-KDETFDTEGLTRIVQRRAPVYDKSQDGHYNLISALHKSVRGSDPDAALYYLARMFDAGEDPLYLGRRLVRMAVEDIGLADPQALAVCNAAKDAYDYLGSPEGELALAQACVYLATAPKSNAVYTAFKAAMRAAKENGSLVPPKHILNA----PTKLMKGEGYGDGYRYDHDEPDAFSGQDYFPEKMGRTTFYDPPDRGFEREIRKRLDWWAKLR 432
>gi|158313527|ref|YP_001506035.1| recombination factor protein RarA [Frankia sp. EAN1pec] >gi|158108932|gb|ABW11129.1| AAA ATPase central domain protein [Frankia sp. EAN1pec] (465 aa)
Score = 466, Expect = 1.4e-44, Identities = 126/376 (33%), Positives = 212/376 (56%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFY-----------------------------LKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSG-LGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKY 389
            DE++ +  +  + S +  ++E     S++ +G PG GK+     + +   + F   ++ T    D+  +++ A E       + ++ I+E+HR  + +QD LL  +E+  + ++A TTENPFF V   + SR LL  +E +  A + E   + + + +     + L+ +  E +V ++  D R+                                 +++ L   +   D   ++          DR    HYD++SAF KS+RG D +AA++YLA++LE+G D   V RR+  +  ED+G+A+ G LG  V+AA  A E +GLPEAR+ L+Q  I L L+PKSN+ I A+D A   +    + P P HLRDAHY  A +L + + Y+YPHD+    V Q+Y P  L   ++Y P  +
  S:    27 LDEVVGQRHLLAEGSPLRRLVEGGGTTSVVLWGPPGTGKTTLAHIVSRATRRRFRELSAVTAGVKDVRAVVDEARETLSMSGVRTVLFIDEVHRFTRTQQDALLPSVERGWVTLVAATTENPFFCVVSPLLSRSLLLTLEPLTDADIAELAERAVTDPRGYGGRLVLAEEAREHLVRVAGGDARRALTALEAGAEAALAAAGPDGAGPDGAGPDGAGPVRLELDLLERAVDRAAVR---------YDREGDQHYDVVSAFIKSMRGGDVDAALHYLARMLEAGEDPRFVARRMIILASEDVGMADPGALGVAVSAA-QALELVGLPEARLALAQAVIHLTLAPKSNAVITALDAATADIRSGRVGPVPPHLRDAHYRGAARLGHGERYRYPHDHPDGVVRQQYAPDVLAGSDYYHPTGH 435
>gi|20808203|ref|NP_623374.1| recombination factor protein RarA [Thermoanaerobacter tengcongensis MB4] >gi|20516797|gb|AAM24978.1| uncharacterized ATPase related to the helicase subunit of the Holliday junction resolvase [Thermoanaerobacter tengcongensis MB4] (440 aa)
Score = 466, Expect = 1.5e-44, Identities = 121/374 (32%), Positives = 210/374 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYY-----QNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + DE + ++ I  K   +  +IE + + S++ +G PGVGK+     I    N  F  F++  +   ++ EI+  A  D     + ++ I+EIHR NK +QD  L ++EK  II++  TTENP F+VN A+ SR  ++ ++ ++   +   + + L++++       V++  + +E I   S  D R     L++ +        +    D +L ++ +    L D+    HY+L+SAFHKS+R SD +AA+Y++A++LE+G D + + RR+     ED+GLA+        AA  AS  +G+PE  + L+Q  + L L+PKSN+  +A +   +   +    P P HLR+A      +L   +GYKY HD+     + E LP+ LK + +Y P
  S:    26 TLDEFVGQEHILGKGKALRELIEKDSITSMILWGPPGVGKTTLAMIIANMTNSKFVNFSAVLSGIKEIKEIMAQAERDAMYGQRTVVFIDEIHRFNKAQQDAFLPHVEKGNIILIGATTENPSFEVNSALLSRSKVFMMKPLDVKDIMIILKRALKDEERGLGLYNVEIDEEKLEKIALFSNGDARVALNTLEMAVMAANVVNGKRVVTDEILSDVMQKKALLYDKAGEEHYNLISAFHKSLRNSDWDAALYWMARMLEAGEDPLYIARRMIRFASEDVGLADPQALSVAIAAYEASHYIGMPECSVNLAQAAVYLALAPKSNALYVAYNRVKKDAEETFAEPVPMHLRNAPTKLMKELGYGEGYKYAHDFEEKVTDMECLPENLKGRRYYIP 418
>gi|83814895|ref|YP_445120.1| recombination factor protein RarA [Salinibacter ruber DSM 13855] >gi|83756289|gb|ABC44402.1| ATPase, AAA family protein [Salinibacter ruber DSM 13855] (456 aa)
Score = 465, Expect = 1.8e-44, Identities = 113/375 (30%), Positives = 203/375 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE-------NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           + DE + ++    +  ++   IE + + S+LF G PG GK+   + I +    +F   N+  +   DL E ++     L     + I+ I+E+HR N  +QD LL ++E   +  +  TTENP+F+VN A+ SR  ++ +E +    L++     L        ++ V+++ + ++ ++  +  D R +   L++ ++     ++  V  +L    +S      L D+    H+D +SAF KS+RGSDP+AA+Y+LA++L +G+    + RR+     ED+GLA+        +A    + +G+PE +  +++  + L  +PKSNS     D A+  V +E     P HL+D         + +GYKYPH Y   Y  Q+YLP E++   FY P+
  S:    27 TLDEFVGQEHFIGEGKLLRRAIEADRVTSVLFCGPPGTGKTTLARIIARTTEAHFTSLNAVLSGVTDLREAIQKAKNRLKHHQTRTILFIDEVHRFNTAQQDALLPHVEDGTVTFIGATTENPYFEVNDALVSRSRVFELEPLEEEHLRQVAAMALTDAERGYGDRDVEITEEALDHLIGTANGDARSVLNALELAVETTAPDAEGTVYIDLDVAEDSIQQRAVLYDKEGDAHFDTISAFIKSLRGSDPDAALYWLARMLYAGEEPRFILRRMLIFAAEDVGLADPQALQVAQSAAEGFDYVGMPEGQFLIAECCLYLATAPKSNSTFAYFD-ALDHVREEQTDDIPQHLKDPSRDQDGLGHGEGYKYPHAYREHYTPQQYLPNEMQGTYFYDPS 420
>gi|71733913|ref|YP_275261.1| recombination factor protein RarA [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554466|gb|AAZ33677.1| ATPase, AAA family [Pseudomonas syringae pv. phaseolicola 1448A] (440 aa)
Score = 465, Expect = 2.0e-44, Identities = 114/378 (30%), Positives = 215/378 (56%)
  Q:     9 LVCNSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE------NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSD-DI-VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVE-QEYLPKELKNKEFYKP 386
           L   + DE + ++ +      +   +E   L S++F+G PGVGK+   + + K  + +F   ++      ++ + +E+A +       + I+ ++E+HR NK +QD  L Y+E   +I +  TTENP F++N A+ SR  +Y +++++ A L++ V + L        +++ LS++    ++  +  D R++   L+      ++ S+ D+ +L+ L   +    D+     YD +SA HKSIRGSDP+AA+Y+ A++++ G D + + RR+  +  EDIG A+    P   +A +  E LG PE  + ++Q  + L  +PKSN+  MA   A++   + ++L  P HLR+A      +L   + Y+Y HD   +Y   ++Y P EL+ +++Y+P
  S:    17 LRATNLDEYVGQEHVLAHGKPLREALEQGALHSMIFWGPPGVGKTTLARLLAKVSDAHFETVSAVLAGVKEIRQAVEVAKQQAGQYGKRTILFVDEVHRFNKSQQDAFLPYVEDGTLIFIGATTENPSFELNNALLSRARVYVLKSLDEAALRKLVHRALTEERGLGKRQLTLSDEGFTILMAAADGDGRRMLNLLENASDLAEDGSEIDVELLQSLLGDSRRRFDKGGEAFYDQISALHKSIRGSDPDAALYWFARMIDGGCDPLYLARRVVRMASEDIGNADPRALPLCMSAWDVQERLGSPEGELAVAQAIVYLACAPKSNAVYMAFKAAMREAGEHDSLEVPLHLRNAPTKLMKQLGYGEEYRYAHDEPEAYAAGEDYFPDELEPRQYYQP 411
>gi|78357041|ref|YP_388490.1| recombination factor protein RarA [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78219446|gb|ABB38795.1| Recombination protein MgsA [Desulfovibrio desulfuricans G20] (375 aa)
Score = 465, Expect = 2.0e-44, Identities = 121/362 (33%), Positives = 188/362 (51%)
  Q:    39 LFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV---KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYW 400
           L S+LFFG PG GKS     + +   + +   ++       L + L         I++++E+HR +K +QD  L  LE   + +LA+TTENP F V   + SR+ + R++ +  + L     +  E +   L + V E +  ++  D R +   ++ V    + K     +K          D+   +HY++ SA  KSIRGSDP+AA+YYLA LLE G D   + RRL     EDIGLA+    P   +   A E +G+PE  IPL++  + L L+PKSNS   A   A + +      P P HLR+   +S ++ +    KGY YPH+Y   +VEQ YLP  L+ + FY P + + +E +   +W
  S:     6 LPSLLFFGPPGCGKSTIALLLARNTGQKYIRISAPEAGLQQLRKSLA-----GVRILVLDELHRFSKAQQDFFLPVLESGEVTLLASTTENPSFSVTRQLLSRMHVLRLKPLAHSDLLTLARRGAEAQGAALKDDVCEMLATVAHGDARTLLNLVEYVAGLPEEKQTPEAVKAALPELVMRHDKDGDSHYEIASALIKSIRGSDPDAALYYLACLLEGGEDPRFICRRLILSASEDIGLADPQALPMAVSCQQAVEFVGMPEGFIPLAETAVYLALAPKSNSTYAAYLNASKEIRLNGPKPVPMHLRNP--SSKLQKDWGYGKGYLYPHNYPEGWVEQTYLPDGLQERAFYHPRE-NGHEQRMAAWW 364
>gi|75764869|ref|ZP_00744233.1| ATPase, AAA family [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74487644|gb|EAO51496.1| ATPase, AAA family [Bacillus thuringiensis serovar israelensis ATCC 35646] (330 aa)
Score = 465, Expect = 2.1e-44, Identities = 104/292 (35%), Positives = 177/292 (60%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-------VKLSNKVVEAIVEISKSDFRQIFFYLKI-VLKYY--QNKSDDIVLK---ELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPL 304
           +  E+I +  +  +  I+  M++ N   S++ +G PG GK++    I       F   N+ T+NK D+  +++ A      ++I++E+HRL+K KQD LL +LE  ++ ++  TT NPF  +N AIRSR  ++ +  +    +   + + LE+K+       V ++++ +      S  D R  +  L++ VL  +   +++ +I L+   E  +  + + D+    HYD+LSAF KS+RGSD NAA++YLA+L+E+GDL S+ RRL  + YEDIGLA+   GP+  AA+ ++E +G PEARI L
  S:    13 NIQEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIAGSTGTPFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLLTLIGATTSNPFHAINSAIRSRCQIFELHALTEDDILIGLKRALEDKEKGLGEYAVTITDEALHHFTNASGGDMRSAYNALELAVLSSFTTDDQAAEITLEIAEECLQKKSFVHDKGGDAHYDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSIGRRLLIMAYEDIGLASPQAGPRTLAAIESAERVGFPEARIHL 317
>gi|196478148|gb|ACG77676.1| ATPase, AAA family [Phenylobacterium zucineum HLK1] (434 aa)
Score = 465, Expect = 2.2e-44, Identities = 118/373 (31%), Positives = 202/373 (54%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYL--ENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKI---TNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
            +E++ +D +   D  I  M E   L S++ +G PG GK+   + + K+    F   ++  +   DL +  E            ++ ++EIHR N+ +QD  L ++E+ ++ ++  TTENP F++N A+ SR  +Y ++ ++ A L+  + K    E + + L      A+  ++  D R +    + +      K   +  KELG+I    +   D+    HY+L+SA HKSIRGSDP+AA+Y+LA++L+ G D + + RRL     EDIG A+       NAA +  + LG PE  I L+Q+ + L  +PKSN+   A   A+++  +  +L PP+H+ +A       L   +GY Y HD    +  Q Y P+ ++ ++FYKP
  S:    27 LEEVVGQDHLLGPDGPIRRMAEARRLSSMILWGPPGTGKTTIARLLAKEAGYEFQQLSAVFSGVADLKKAFEQARARRAAGQATLLFVDEIHRFNRAQQDGFLPFVEEGIVTLVGATTENPSFELNGALLSRCQVYVLKRLDEAALEALLAKAEAHEGRPLPLEPDARAALTALADGDGRYLLTLSETLFNIASAKP--LTTKELGQILQKRSPAYDKDREEHYNLVSALHKSIRGSDPDAALYWLARMLQGGEDPLFIARRLIRAAAEDIGEADPMSLVLANAAKDTYDFLGSPEGEIALAQLVVHLAAAPKSNAVYKAFGAAMKAAKETGSLMPPSHILNAPTRLMKDLGYGRGYAYDHDTAEGFSGQNYFPEGMERRQFYKP 409
>gi|188527230|ref|YP_001909917.1| recombination factor protein RarA [Helicobacter pylori Shi470] >gi|188143470|gb|ACD47887.1| recombination factor protein RarA [Helicobacter pylori Shi470] (391 aa)
Score = 464, Expect = 2.3e-44, Identities = 133/366 (36%), Positives = 201/366 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN---KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKI-TNSLIDRRATN--HYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKEL 378
           S ++ + ++ +  KD+ +   +++       F+G PGVGK++  Q I + L +    FN+T     DL   L+L    N   KP+I I+E HRLNK +Q+ LL  +EKD  ++L  +T++P + ++ AIRSR  ++ +  +N + L +   K L   K ++       ++  S  D R +   L +  K      D I L+ L  +  +SL D   ++  HY+L SA  KS+RGSD NA++YYLA+L+  G+    + RRL     EDIG AN        + + + + +G PEARI LSQ  I L  SPKSN+A  AI++A+  V K +L P P HL           N K Y YPHDYN  YV+Q+YL K L
  S:    11 SLEDFLGQEHLIGKDAPLFKALQSKHFPHAFFYGPPGVGKTSLAQIIARMLERPILLFNATDFKLEDLR--LKLKNYQNTLLKPVIFIDETHRLNKTQQEFLLPIMEKDHALILGASTQDPNYSLSHAIRSRSFIFELTPLNKSDLDKLCAKALTLLKKQIEPGAKTYLLNNSAGDARALLNLLDLSAKI----EDPITLETLQSLRPHSLNDGSYSDDTHYNLTSALIKSLRGSDENASIYYLARLIAGGENPEFIARRLVVFASEDIGNANPNALNLAASCLLSVKQIGYPEARIILSQCVIYLACSPKSNTAYRAINQALDCVQKGSLYPIPKHLLP---------NAKDYLYPHDYN-GYVKQDYLEKPL 368
>gi|15645640|ref|NP_207816.1| recombination factor protein RarA [Helicobacter pylori 26695] >gi|2314168|gb|AAD08068.1| conserved hypothetical helicase-like protein [Helicobacter pylori 26695] (391 aa)
Score = 464, Expect = 2.7e-44, Identities = 134/366 (36%), Positives = 199/366 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN---KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKI-TNSLIDRRATN--HYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKEL 378
           S ++ + ++ +  KD+ +   +++       F+G PGVGK++  Q I   L +    FN+T     DL   L+L    N   KP++ I+E HRLNK +Q+ LL  +EKD  ++L  +T++P + ++ AIRSR  ++ +  +N + L     K L   K ++       ++  S  D R +   L +  K      D I LK L  +  +SL D   ++  HY+L SA  KS+RGSD NA++YYLA+L+  G+    + RRL     EDIG AN        + + A + +G PEARI LSQ  I L  SPKSN+A  AI++A+  V K +L P P HL           N K Y YPHDYN  YV+Q+YL K L
  S:    11 SLEDFLGQEHLVGKDAPLFKALQSKHFPHAFFYGPPGVGKTSLAQIIAYMLERPILLFNATDFKLEDLR--LKLKNYQNTLLKPVVFIDETHRLNKTQQEFLLPIMEKDHALILGASTQDPNYSLSHAIRSRSFIFELTPLNKSDLDRLCAKALTLLKKQIEPGAKTYLLNNSAGDARALLNLLDLSAKI----EDPITLKTLQSLRPHSLNDGSYSDDTHYNLTSALIKSLRGSDENASIYYLARLIAGGENPEFIARRLVIFASEDIGNANPNALNLAASCLFAVKQIGYPEARIILSQCVIYLACSPKSNTAYRAINQALDCVQKGSLYPIPKHLLP---------NAKDYLYPHDYN-GYVKQDYLEKPL 368
>gi|148559570|ref|YP_001259126.1| recombination factor protein RarA [Brucella ovis ATCC 25840] >gi|163843471|ref|YP_001627875.1| recombination factor protein RarA [Brucella suis ATCC 23445] >gi|148370827|gb|ABQ60806.1| ATPase, AAA family [Brucella ovis ATCC 25840] >gi|163674194|gb|ABY38305.1| AAA ATPase central domain protein [Brucella suis ATCC 23445] (437 aa)
Score = 463, Expect = 3.0e-44, Identities = 110/383 (28%), Positives = 213/383 (55%)
  Q:    27 DSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLN---VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIKSNNKQ 409
           + ++  MI +  L S++F+G PG GK+   + +  + +  F   ++  +   DL  + E A        + ++ ++EIHR N+ +QD  L  +E   +I++  TTENP F++N A+  R+R+L +   +  S     +  +  E + + L ++   +++ ++  D R      + V +  +     D   L+++ +    + D+    HY+L+SA HKS+RGSDP+AA+YYL+++ ++G D + + RRL  +  EDIGLA+       NAA +A + LG PE  + L+Q  + L  +PKSN+  +A   ++++  +  +L PP H+ +A   + +  N    +GY Y HD   ++  Q+Y P+ +  + FY P +  + +   K ++YW +++   ++
  S:    41 EGVLTRMIASGSLGSMVFWGPPGTGKTTVARLLAGETDLAFEQISAIFSGVADLKRVFEAARARRMSGRQTLLFVDEIHRFNRAQQDSFLPVMEDGTVILIGATTENPSFELNAALLSRARVLTFHPHDSESIATLLKRAEEQEGQALPLDDEARASLIRMADGDGRAALTLAEEVWRAVRPGEVFDAAKLQDVVQRRAPVYDKSQDGHYNLISALHKSVRGSDPDAALYYLSRMFDAGEDPLYIGRRLVRMAVEDIGLADPQALAICNAAKDAYDYLGSPEGELALAQACVYLATAPKSNAVYVAFKNSMRAAKENGSLLPPKHILNA--PTKLMKNEGYSEGYAYDHDQPDAFSGQDYFPEAMGRQVFYNPPERGFEREIRKRLEYWARLRQERQR 436
>gi|149184120|ref|ZP_01862456.1| YrvN [Bacillus sp. SG-1] >gi|148848172|gb|EDL62486.1| YrvN [Bacillus sp. SG-1] (251 aa)
Score = 463, Expect = 3.1e-44, Identities = 94/183 (51%), Positives = 124/183 (67%)
  Q:   221 DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKI 403
           D+    HYD+LS F KSIRGSD NAA++YL +L+E+GD+ S+ RRL  + YEDIGLA+   G +  AAV  +E +G PEARIPL+   IELCLSPKSNSAI AID A+Q +   ++   P HL+DAHYA A +L  +G  YK+PHDY   +V+Q+YLP  LK   +Y P +  + E      + KI
  S:    63 DKDGDAHYDVLSGFQKSIRGSDVNAALHYLGRLVEAGDMPSITRRLLVIAYEDIGLASPQAGQRTLAAVETAEKIGFPEARIPLANAVIELCLSPKSNSAISAIDAALQDIRSGKSGEVPAHLKDAHYAGAKELG-RGIEYKFPHDYPSGWVKQQYLPDTLKKARYYDPKETGKFEAAISQVYKKI 247
>gi|117924970|ref|YP_865587.1| recombination factor protein RarA [Magnetococcus sp. MC-1] >gi|117608726|gb|ABK44181.1| Recombination protein MgsA [Magnetococcus sp. MC-1] (447 aa)
Score = 463, Expect = 3.1e-44, Identities = 116/369 (31%), Positives = 207/369 (56%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSA----VLKEEVI---KYLENKKVKLSNKVVEAIVEISKSDFRQIF----FYLKIVLKYYQNKSDDIVLKELGKITN---SLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDL-ISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEA-IQSVNKEALSPPNHLRDAHYASAVKLNVK-GYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKSNNKQ 409
           S++ +G PG GK+   + I  ++   F   ++      ++  +++ A E        I+ ++EIHR NK +QD  L Y+E   II++  TTENP F++N A+ SR  +  ++ ++ A    +L+  ++   + LE  K+ +  + ++ + +++  D R        ++++  K    +   + L+ L        +L D+    HY+L+SA HKS+RGSD +AA+Y+LA++LE G+  + + RRL     ED+G A+         A +A   LG PE  + L+Q  + L  +PKSNS   A   A  +++   A++PP H+ +A  A+   L    GY+Y HDY   +V Q+YLP  L+ + FY P    + ++  K + YW+K++   K+
  S:    50 SMILWGPPGCGKTTIARMIATQVTLRFESLSAVLAGVKEVRLVVDRAREARVLGQGTILFVDEIHRFNKAQQDAFLPYVESGDIILIGATTENPSFELNGALLSRCRVVELKPLHEAALVTLLQRALVDQERGLERYKLAVEPEALQHMAQLAAGDGRYALNLLETFVELAAKSGVARGSQLTLERLKNSLQRRAALYDKAGDGHYNLISALHKSLRGSDVDAALYWLARMLEGGEEGLYIARRLVRFATEDVGNADPRALSLAMDARDAYHFLGAPEGELALAQCVVYLATAPKSNSVYTAFKAARKRAIESGAMAPPKHILNAPTATMQALGYGVGYQYAHDYEEGFVAQQYLPDALQGERFYYPVERGFERDIAKRMAYWDKLREQAKE 441
>gi|28870511|ref|NP_793130.1| recombination factor protein RarA [Pseudomonas syringae pv. tomato str. DC3000] >gi|28853759|gb|AAO56825.1| ATPase, AAA family [Pseudomonas syringae pv. tomato str. DC3000] (440 aa)
Score = 463, Expect = 3.1e-44, Identities = 115/378 (30%), Positives = 214/378 (56%)
  Q:     9 LVCNSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE------NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSD-DI-VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVE-QEYLPKELKNKEFYKP 386
           L   + DE + ++ +      +   +E   L S++F+G PGVGK+   + + K  + +F   ++      ++ + +E+A +       + I+ ++E+HR NK +QD  L Y+E   +I +  TTENP F++N A+ SR  +Y +++++ A L++ V + L        +K+ LS++    ++  +  D R++   L+      ++ S+ DI +L+ L   +    D+     YD +SA HKSIRGS+P+AA+Y+ A++++ G D + + RR+  +  EDIG A+    P   +A +  E LG PE  + ++Q  + L  +PKSN+  MA   A++   +  +L  P HLR+A      +L   + Y+Y HD   +Y   ++Y P EL+ +++Y+P
  S:    17 LRATNLDEYVGQEHVLAHGKPLREALEQGALHSMIFWGPPGVGKTTLARLLAKVSDAHFETVSAVLAGVKEIRQAVEVAKQQAGQYGKRTILFVDEVHRFNKSQQDAFLPYVEDGTLIFIGATTENPSFELNNALLSRARVYVLKSLDEAALRKLVNRALTEDRGLGQRKLTLSDEGFAMLMAAADGDGRRMLNLLENASDLAEDGSEIDIELLQSLLGDSRRRFDKGGEAFYDQISALHKSIRGSNPDAALYWFARMIDGGCDPLYLARRVVRMASEDIGNADPRALPLCMSAWDVQERLGSPEGELAVAQAIVYLACAPKSNAVYMAFKAAMREAGEHGSLEVPLHLRNAPTKLMKQLGYGEEYRYAHDEPEAYAAGEDYFPDELEPRQYYQP 411
>gi|83941468|ref|ZP_00953930.1| ATPase, AAA family protein [Sulfitobacter sp. EE-36] >gi|83847288|gb|EAP85163.1| ATPase, AAA family protein [Sulfitobacter sp. EE-36] (435 aa)
Score = 463, Expect = 3.7e-44, Identities = 123/396 (31%), Positives = 214/396 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELAT----EDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSR---LLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATN-------HYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALS-PPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKSNNK 408
           S  E+I +  +   D+ +  M+++  L S++F+G PGVGK+   + +  + + +F   ++  +   +L ++ + A          ++ ++EIHR NK +QD  L ++E   I+++  TTENP F++N A+ SR   L+L R+   +   L +   K L  + + L     E ++E++  D R +   ++ V  +      D      GK  ++ + RRA         HY+L+SA HKS+RGSDP+AA+Y+LA++LE G D   + RR+  +  EDIGLA+         +    E LG PE  + ++Q    L L+PKSN+A +A   A ++  +   S PP H+ +A      +     GY Y HD    +  Q Y P  ++  +FY+P    + ++  K VDY+ K+++  K
  S:    27 SLGEVIGQSQVLGPDAPLTVMLQSGSLGSLIFWGPPGVGKTTIARLLADETDLHFVQISAIFSGVPELRKVFDAAKIRRQNGRGTLLFVDEIHRFNKAQQDGFLPHMEDGTILLVGATTENPSFELNAAVLSRSQVLVLERLPLADLERLAQRAEKEL-GRGLPLDGPARENLLEMADGDGRALLNLIEQVAAWKVEGKLD------GKALSARLMRRAAQYDKGGDAHYNLISALHKSVRGSDPDAALYWLARMLEGGEDPRYLMRRITRMAVEDIGLADPQAQSVCLQSWETYERLGSPEGELAIAQALTYLALAPKSNAAYVAYKAARRTAKQTGSSLPPKHIMNAPTKMMKEQGYGAGYAYDHDAEDGFSGQNYFPDGMERPQFYQPVERGFERDLKKRVDYFEKLRATRK 434
>gi|17987067|ref|NP_539701.1| recombination factor protein RarA [Brucella melitensis 16M] >gi|17982724|gb|AAL51965.1| ATPase associated with chromosome architecture/replication [Brucella melitensis 16M] (457 aa)
Score = 463, Expect = 3.7e-44, Identities = 110/383 (28%), Positives = 213/383 (55%)
  Q:    27 DSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLN---VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIKSNNKQ 409
           + ++  MI +  L S++F+G PG GK+   + +  + +  F   ++  +   DL  + E A        + ++ ++EIHR N+ +QD  L  +E   +I++  TTENP F++N A+  R+R+L +   +  S     +  +  E + + L ++   +++ ++  D R      + V +  +     D   L+++ +    + D+    HY+L+SA HKS+RGSDP+AA+YYL+++ ++G D + + RRL  +  EDIGLA+       NAA +A + LG PE  + L+Q  + L  +PKSN+  +A   ++++  +  +L PP H+ +A   + +  N    +GY Y HD   ++  Q+Y P+ +  + FY P +  + +   K ++YW +++   ++
  S:    61 EGVLTRMIASGSLGSMVFWGPPGTGKTTVARLLAGETDLAFEQISAIFSGVADLKRVFEAARARRMSGRQTLLFVDEIHRFNRAQQDSFLPVMEDGTVILIGATTENPSFELNAALLSRARVLTFHPHDSESIATLLKRAEEQEGQALPLDDEARASLIRMADGDGRAALTLAEEVWRAVRPGEVFDAAKLQDVVQRRAPIYDKSQDGHYNLISALHKSVRGSDPDAALYYLSRMFDAGEDPLYIGRRLVRMSVEDIGLADPQALAICNAAKDAYDYLGSPEGELALAQACVYLATAPKSNAVYVAFKNSMRAAKENGSLLPPKHILNA--PTKLMKNEGYSEGYAYDHDQPDAFSGQDYFPEAMGRQVFYNPPERGFEREIRKRLEYWARLRQERQR 456
>gi|121707934|ref|XP_001271981.1| AAA family ATPase, putative [Aspergillus clavatus NRRL 1] >gi|119400129|gb|EAW10555.1| AAA family ATPase, putative [Aspergillus clavatus NRRL 1] (539 aa)
Score = 463, Expect = 3.8e-44, Identities = 128/371 (34%), Positives = 209/371 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYR--------IENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGK-ITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK---EALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEF 383
           + DE+  ++++ PK  ++  +IE + + S++ +G+ G GK+   + I   +   F   NST++   +  +I      EL     K II  +EIHR +K +QD+ L  +E   + ++  TTENP FKV  A+ SR   +         +E+I    L+ E   Y  +  V   ++++  +   +  D R     L++ +    +K  ++   EL + +T +L+ DR    HYD +SAFHKSIRGSDP+AA+YYLA++L+SG D + + RRL  V  EDIGLA++ +     +  +A E +GLPEARI L+  T+ + LS KS  +   +  A  ++ +     L  P HLR+A      +L   K YKY  +Y    V Q+YLP+ L  ++F
  S:   130 TLDEVCGQELVGPK-GVLRGLIEQDRVPSMILWGHAGTGKTTIARVIASMVGSRFVEINSTSSGVAECKKIFAEARSELNLTGRKTIIFCDEIHRFSKSQQDVFLGPVESGQVTLIGATTENPSFKVQNALLSRCRTFTLSKLTDRDVESILHRALRVEGPNYSPSALV--DDELISYLARFADGDARTSLNLLELAMDL--SKRSEMTKDELKRSLTKTLVYDRAGDQHYDTISAFHKSIRGSDPDAALYYLARMLQSGEDPLFIARRLVVVASEDIGLADNSMLTLAMSTHSAVEKIGLPEARINLAHATVAMALSKKSTRSYRGLKNAFAALEEPGVAGLPIPIHLRNAPTRLMKELGYGKEYKYNPNYLEGQVVQDYLPETLIGRKF 515
>gi|158523435|gb|ABW70832.1| AAA-family ATPase [Francisella philomiragia subsp. philomiragia] (408 aa)
Score = 462, Expect = 4.0e-44, Identities = 127/392 (32%), Positives = 216/392 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENIN---------SAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS-----DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIK 404
           S +E+I ++ I  K   +  ++  + + S++  G PGVGK+   + I       F+  ++  +   D+ +I+         ++ ++EIHR NK +QDLLL Y+E   II++  TTENP + +N A+ SR+ + R++ +N          A+ K+E+   L     ++ + +  AI   S+ D R+I   L+ +       +      D+  + +G+ +     R     Y+ LSAFHKS+RG+DP+AA+++L+ +L++G D + + RR+  +  EDIG A+         A NA E LG+PE R+ LSQ  I L ++PKSN+   A+ +A Q V     +  P HL++   ++        Y YPH+Y  +YV Q+YLPK + ++ FY PN   +       +D  NKIK
  S:    10 SIEEVIGQEHILSKSGSLTKILAGDGICSLILCGKPGVGKTTLAKIIASSKRLEFFELSAVDSGVKDVKKIIADNQHLGSFVLFLDEIHRFNKSQQDLLLPYVESGKIILIGATTENPTYYLNNALVSRVFILRLKRLNISETRKLIQRAITKDEL---LAKHSFEIDDDLYNAIHNYSEGDCRKILNLLERMFLISDRTNTIHLDKDLFDRAVGEASRDF-HREGKEFYEQLSAFHKSVRGTDPDAAIFWLSVMLDNGADPLVIARRMLCIASEDIGNADPQALRVAIDAWNAYEKLGMPEGRLVLSQAAIYLAVAPKSNACYKALADAQQIVKSLGNIEVPQHLKNYKDSN--------YLYPHNYPNAYVVQQYLPKNI-SQTFYTPNTAGFESKIKMKLDSINKIK 406
>gi|151572519|gb|EDN38173.1| hypothetical protein FTDG_00976 [Francisella tularensis subsp. novicida GA99-3548] (412 aa)
Score = 462, Expect = 4.7e-44, Identities = 127/392 (32%), Positives = 222/392 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKV------KLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVL-KEL-----GKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIK 404
           S DE++ ++ +  +  I+  ++  + + S++  G PGVGK++  + I       F+  ++  +   D+ +++      +  ++ ++EIHR NK +QD+LL Y+E   II++  TTENP + +N A+ SRL + R++ ++    ++ + K L   +V      K+ + +  A+   S+ D R+I   L+ +      + D+I L KEL     G+ T+    R     Y+ LSAFHKS+RG+DP+AA+++L+ +L++G D + + RR+  +  EDIG A+         A NA E LG+PE R+ L+Q  I L ++PKSN+   A+ +A Q V     ++ P HL++   ++        Y YPH+Y  SYV Q+YLP  +  + FY+P    +       +D  NKIK
  S:    14 SIDEIVGQEHLLSQHGILTKILAGDGICSLVLCGKPGVGKTSLARIIASSKKLEFFELSAVDSGVKDIKKLITDNQHLDSFVLFLDEIHRFNKSQQDILLPYVESGKIILIGATTENPTYYLNDALVSRLFILRLKRLSLVATQKLIEKTLSQDEVLAKHKFKIDDGLYNAMHNYSEGDCRKILNLLERMF-LISTRGDEIYLNKELFDQAVGE-TSRDFHREGKEFYEQLSAFHKSVRGTDPDAAIFWLSVMLDNGVDPLVIARRMLCIASEDIGNADPQALRVAMDAWNAYEKLGMPEGRLVLAQAAIYLAVAPKSNACYKALAQAQQLVKSLGNINVPQHLKNYKDSN--------YLYPHNYPNSYVIQQYLPDNII-QNFYQPTASGFEAKIKTKLDSINKIK 410
>gi|56459774|ref|YP_155055.1| recombination factor protein RarA [Idiomarina loihiensis L2TR] >gi|56178784|gb|AAV81506.1| Uncharacterized ATPase related to the helicase subunit of the Holliday junction resolvase [Idiomarina loihiensis L2TR] (446 aa)
Score = 462, Expect = 4.8e-44, Identities = 112/353 (31%), Positives = 207/353 (58%)
  Q:    34 IENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELAT-----EDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN-------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSD----DIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLE-SGDLISVYRRLYAVVYEDIGLANSGLGPK-VNAAVNASEA---LGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDA----HYASAVKLNVKGYKYPHDYNFSYVEQE-YLPKELKNKEFYKP 386
           +E   L S++ +G PG GK+   + I  + N      ++ T+   D+ + +E A      +  + I+ ++E+HR NK +QD  L ++E   I+ +  TTENP F++N A+ SR  +YR++ ++   L++ +   L +       ++++L  +    +++++  D R++  YL++V  + ++ S     +++   +G+   +  D +  ++YD+LSAFHKS+RGS P+ A+Y+ A+LL   GD + + RRL A+  EDIG A+    P+ +  A+NA +    +G  E    ++Q  I    + KSN+   A   A+++  + + +P P HLR+A    H A     +   Y+Y H+Y  +YV  E YLP E+ + +FY P
  S:    44 VEQGHLHSMILWGPPGTGKTTLAELIATQANATVSRISAVTSGVKDIRKAIEEAKLLAQQQGRRTILFVDEVHRFNKSQQDAFLPHIEDGTIVFIGATTENPGFELNNALLSRARVYRLQTLSKTDLEQALESALTDAERGLGQRQLQLEGEARAKLLDLAGGDARRLLNYLEVVADFVESSSQPITPELITAAIGEKATAF-DHQGDHYYDVLSAFHKSVRGSSPDGALYWYARLLTGGGDALVIARRLLAIASEDIGNAD----PRALQLALNAWDTYHRVGPAEGERAIAQAVIYCACAAKSNAVYNAFKSALRTAKEHSDAPVPEHLRNAPTKVHKAQGYGAD---YQYAHNYPNAYVPGERYLPSEIADTQFYAP 415
>gi|94969641|ref|YP_591689.1| recombination factor protein RarA [Acidobacteria bacterium Ellin345] >gi|94551691|gb|ABF41615.1| Recombination protein MgsA [Acidobacteria bacterium Ellin345] (447 aa)
Score = 461, Expect = 5.0e-44, Identities = 117/374 (31%), Positives = 208/374 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEA-------IVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + DE   ++ I      +   I+ +D+ S++F+G PGVGK+   + I    + +F  F++  +   ++ +++  A        + I+ ++EIHR N+ +QD  L ++E+  I ++  TTENP F+VN A+ SR  +Y +  +    +   + + L + +  L+   V A       I   +  D R  +  L++  +     S+ I+ +++  + ++L       D+    HY+L+SA HKS+R SDP+AA+Y+LA+++ESG D + + RR+  +  EDIGLA+        AA +A + LG+PEA + L+Q  + L ++PKSN+   A  +    V K A  P P HLR+A      ++    GY+Y HD      + + LP  LK++ +Y P
  S:    26 TLDEFAGQEHILAPGKPLRVQIDRDDIGSLIFWGPPGVGKTTLAKIIAAMTHADFIEFSAVLSGIKEIKQVMADAERVRQYGTRTILFVDEIHRFNRAQQDAFLPHVERGNIKLIGATTENPSFEVNSALLSRSRVYTLTPLTEEQIVGLLRRALTDTERGLAELHVTAEDIALARIAAYASGDARSGYNVLEVAAQAAGATSERIITEQI--VADALQRRVLRYDKSGEEHYNLISALHKSVRNSDPDAALYWLARMIESGEDALYIARRVVRMAVEDIGLADPNALALTLAAKDAIDFLGMPEANLALAQAVVYLSIAPKSNALYTAYGDVQADVEKTAADPVPLHLRNAPTKLMKEIGYGSGYQYAHDLEAKVADMQCLPDNLKDRVYYHP 417
>gi|167627500|ref|YP_001678000.1| recombination factor protein RarA [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167597501|gb|ABZ87499.1| AAA family-ATPase [Francisella philomiragia subsp. philomiragia ATCC 25017] (411 aa)
Score = 461, Expect = 5.4e-44, Identities = 123/377 (32%), Positives = 210/377 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENIN---------SAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS-----DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKY 389
           S +E+I ++ I  K+  +  ++  + + S++  G PGVGK+   + I       F+  ++  +   D+ +++         ++ ++EIHR NK +QDLLL Y+E   II++  TTENP + +N A+ SR+ + R++ +N          A+ K+E+   L     ++ + +  AI   S+ D R+I   L+ +       +      D+  + +G+ +     R     Y+ LSAFHKS+RG+DP+AA+++L+ +L++G D + + RR+  +  EDIG A+         A NA E LG+PE R+ LSQ  I L ++PKSN+   A+ +A Q V     +  P HL++   ++        Y YPH+Y  SYV Q+YLPK LK + FY P  +
  S:    14 SIEEVIGQEHILSKNGSLTKILAGDGICSLILCGKPGVGKTTLAKIIASSKQLEFFELSAVDSGVKDVKKLIADNQHLGSFVLFLDEIHRFNKSQQDLLLPYVESGKIILIGATTENPTYYLNNALVSRVFILRLKRLNISETRKLIQRAITKDEL---LAKHSFEIDDDLYNAIHNYSEGDCRKILNLLERMFLISDRTNTIHLDKDLFDQAVGEASRDF-HREGKEFYEQLSAFHKSVRGTDPDAAIFWLSVMLDNGADPLVIARRMLCIASEDIGNADPQALRVAIDAWNAYEKLGMPEGRLVLSQAAIYLAVAPKSNACYKALADAQQIVKSLGNIEVPQHLKNYKDSN--------YLYPHNYPNSYVIQQYLPKNLK-RSFYNPTSH 393
>gi|189500549|ref|YP_001960019.1| AAA ATPase central domain protein [Chlorobium phaeobacteroides BS1] >gi|189495990|gb|ACE04538.1| AAA ATPase central domain protein [Chlorobium phaeobacteroides BS1] (445 aa)
Score = 461, Expect = 5.5e-44, Identities = 124/385 (32%), Positives = 213/385 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK-----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV----EAIVEISKSDFRQIFFYLKIVLKYYQNKSDDI-----VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVN-KEALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFV 397
           + D+M  ++ +   +  +   I    L S++F+G PG GK+   +     L+  F   ++      ++ + LELA    +      ++ I+EIHR NK +QD LL  +E+ +++++  TTENP F+VN A+ SR+ +Y +  +  A L+  V   L    +    +VV      +++ S  D R+    ++  L      +  +     +L+ + +    + D++  +HYD++SAF KS+RGSDP+AA+++LA++L+ G D   + RR+     ED+G A+        +  +A E +GLPEARI L+Q    L  +PKSN++  AI+EA +     + LS P HLR+A      +    +GYKYPHDY   +V + YLP+ L +  FY P +  +   KF+
  S:    35 NLDDMYGQEHLIGAEGPLRKFIAQGRLPSMIFWGPPGSGKTTLAEICANSLDFRFDSLSAVDAGVREVRKSLELAASAQRLDGLRTLLFIDEIHRFNKAQQDSLLHAIEQGVVVLIGATTENPSFEVNAALMSRMQVYVLNALEDAALQAVVRCALAGDPLIAPYEVVIDDWAFLLQFSAGDARKALNAVEAALSMVDLSTVPVHLSRTLLERVLQKKLPVYDKKGASHYDVISAFIKSLRGSDPDAALFWLARMLDGGEDPKFIARRMVIFASEDVGNADPYALTLAVSVFHAVEMIGLPEARINLAQGVTYLAGAPKSNASYQAINEAQRHAGMHQELSVPMHLRNAPTKYMKESGYGEGYKYPHDYPEHFVAETYLPEGL-DAVFYHPTE--EGREKFI 433
>gi|15893618|ref|NP_346967.1| recombination factor protein RarA [Clostridium acetobutylicum ATCC 824] >gi|15023171|gb|AAK78307.1|AE007547_4 ATPase related to the helicase subunit of Holliday junction resolvase [Clostridium acetobutylicum ATCC 824] (443 aa)
Score = 461, Expect = 5.6e-44, Identities = 128/374 (34%), Positives = 220/374 (58%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS----AVLKEEV--IKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIV-----LKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANS-GLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP--PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           +  + I ++ I  K   + NM+E + + S++ +G PGVGK+     I      NF  F++ T+   ++ +I+  A +D     + ++ I+EIHR NK +QD  L ++EK  II++  TTENP F+VN A+ SR  ++ ++ +++     +LK  +   +  +NK +++S  ++  I   S  D R     L++      L++     +  +L++  +    + D+    HY+L+SA HKS+R SD +AA+Y+LA++LE G D + + RRL     EDIG+A++  L   VN   N+   +G+PE  + L++  + L L+PKSNS  MA ++A +   KE L+   P HLR+A       L   KGYKY HD++   V+ + LP  LK++++Y P
  S:    25 NLSDYIGQEHILEKGKALRNMLEKDSITSMILWGPPGVGKTTLAMIIASTTKCNFVEFSAATSGIKEIKDIMIKAEKDRLFGIRTLLFIDEIHRFNKSQQDTFLPHVEKGDIILIGATTENPSFEVNSALLSRCRVFVLKPLSNNDIVKLLKNALTDTRGFKNKNIQISEDLLTLIAVYSNGDARTALNVLEMAVLSSKLEHGVVTINKGILEDCMQNKALIYDKNGEEHYNLISALHKSMRNSDVDAAIYWLARMLEGGEDPLYIARRLIRFSSEDIGVADTNALNVTVN-VYNSCHYIGMPECSVNLTEAVVYLSLAPKSNSIYMAYEKAKKDA-KETLASGVPLHLRNAPTKLMSDLGYSKGYKYAHDFDNKVVDMQCLPDNLKDEKYYFP 416
>gi|154287624|ref|XP_001544607.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1] >gi|150408248|gb|EDN03789.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1] (547 aa)
Score = 460, Expect = 7.2e-44, Identities = 125/371 (33%), Positives = 213/371 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLS-----------NKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGK-ITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP---PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEF 383
           S D++  +++I P   ++  +IE + + S++ +G  G GK+   + I K +   F   NST +   +  ++      EL+    K II  +EIHR +K +QD+ L  +E   I ++  TTENP FKV  A+ SR   + +     A L +E I  + N+ +K+            +++++ +   +  D R     L++ +    ++ + +  ++L K +T +L+ DR    HYD +SAFHKSIRG+DP+A++YYLA++++SG D + + RRL  V  EDIGLA++ +     +A  A E +G+PEARI L+  T+ L LS KS      ++ A+  + +  ++    P HLR+A      ++   K YKY  +Y    V Q YLP++L  K+F
  S:   139 SLDDIYGQELIGPS-GVLRGLIEQDRVPSMILWGGAGTGKTTIARVIAKMVGSRFVEINSTNSGVAECKKLFAEAKNELSLSGRKTIIFCDEIHRFSKSQQDVFLGPVESGQITLIGATTENPSFKVQNALLSRCRTFTL-----AKLTDEDIVSILNRALKVEGPNYSPSPLVDDELIKYLAAFADGDARTSLNLLELAMDL--SRREGMTREDLKKSLTRTLVYDRAGDQHYDTISAFHKSIRGNDPDASLYYLARMIQSGEDPLYIARRLIVVASEDIGLADNSMLSLATSAYIAVEKIGMPEARINLAHATVALALSKKSTRTYRGLNNALAVLEEPGMAGLPIPIHLRNAPTRLMKEMGYGKEYKYNPNYVDGKVAQVYLPEKLLGKKF 524
>gi|159037439|ref|YP_001536692.1| recombination factor protein RarA [Salinispora arenicola CNS-205] >gi|157916274|gb|ABV97701.1| AAA ATPase central domain protein [Salinispora arenicola CNS-205] (502 aa)
Score = 460, Expect = 7.4e-44, Identities = 119/377 (31%), Positives = 203/377 (53%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKP-----IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSD---DIVLKELGKITNSL-IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKY 389
           S DE+I +D +    + +  ++      S++ +G PG GK+     +    ++ F   ++      D+  ++E A    +      ++ I+E+HR +K +QD LL  +E   + +LA TTENP+F V   + SR +L  ++ ++   ++  + + + + +       L+    E +V ++  D R+    L+              D+   E    + ++  DR    HYD+ SAF KS+RGSD +AA+++LA++L +G D   + RR+     ED+G+A+ G      AA +A E +GLPEA++ L+Q  I L  +PKSNSA  AI  A+  V      P P  LRDAHY  A  L +  GY+YPHD     V Q+Y P +L   ++Y+P+++
  S:    45 SLDELIGQDHLRAPGAPLHQLVSGAAPMSVILWGPPGSGKTTIAHLVAGATDRRFVAMSALNAGVKDVRAVIEAARRQRRTGGPPTVLFIDEVHRFSKTQQDSLLAAVEDRTVTLLAATTENPYFSVISPLLSRCVLLTLQPLDDDAVRSLLRRAVVDGRGLGGTPALAPDAEEHLVRLAAGDVRKALTALEAAAASATAVGASHIDLSTAEQAVDSAAVRYDRDGDGHYDVTSAFIKSMRGSDVDAALHWLARMLVAGEDPRFIARRMVIFASEDVGMADPGALGVATAAAHAVEYVGLPEAQLNLAQAVIHLSTAPKSNSATTAIGAALADVRAGRGGPVPRVLRDAHYPGAKGLGHGTGYRYPHDDQRGVVHQQYAPDDLVGADYYRPSQH 438
>gi|117928540|ref|YP_873091.1| recombination factor protein RarA [Acidothermus cellulolyticus 11B] >gi|117649003|gb|ABK53105.1| Recombination protein MgsA [Acidothermus cellulolyticus 11B] (500 aa)
Score = 459, Expect = 8.5e-44, Identities = 118/365 (32%), Positives = 200/365 (54%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELAT-----EDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSL--IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKS 405
           S+L +G PG GK+     +     + F   ++      D+ +++  A           ++ ++E+HR +K +QD LL  +E  ++ ++  TTENP F V   + SR +L  ++ ++   L+  + + + + +       L+    E ++ ++  D R+   YL+   +  Q   D  V +  G  + +L   DR+   HYD+ SA  KS+RGSD +AA++YLA++LE+G D   + RRL  +  EDIGLA+    P   AA +A   +GLPEA + L+   I L ++PKSN+   A+  A+  V      P P H+RDAHY  A +L +  GY+YPHD     V Q+Y P +L  + +Y+P+++  +E K  D    I++
  S:    73 SLLLWGPPGSGKTTLAYLVSHASGRRFVELSAVAAGVKDVRDVIAAARRERAASGRGTVLFLDEVHRFSKAQQDSLLPAVENGIVTLIGATTENPSFSVIGPLLSRAVLLTLQPLSDDELRTVIRRAVVDPRGLAGRHTLTPAAEERLIRLAGGDARRALTYLEAAAQPDQPVID--VAEVEGAASRALPSYDRQGDQHYDVASALIKSVRGSDVDAALHYLARMLEAGEDPRFIARRLVILASEDIGLADPAALPTAVAAYHAVAFIGLPEAGLTLAHAVIALAVAPKSNAVTRALSAALDDVRAGLAGPVPLHVRDAHYPGAARLGHGVGYRYPHDDPAGIVAQQYAPDQLAGRVYYQPSRHG-HEAKIADRLAAIRA 449
>gi|49474377|ref|YP_032419.1| recombination factor protein RarA [Bartonella quintana str. Toulouse] >gi|49239881|emb|CAF26279.1| ATPase, aaa family [Bartonella quintana str. Toulouse] (439 aa)
Score = 459, Expect = 9.5e-44, Identities = 113/392 (28%), Positives = 217/392 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELAT----EDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIK 404
           S  ++  ++ +  +  ++  M+    + S++F+G PG GK+   + +  +    F   ++     ++L +I E+A        K ++ ++EIHR N+ +QD  L ++E   +I++  TTENP F++N A+  R+R+L +   +  S  +  +  + +E K + L +   + ++ +S  D R      + V    Q     D   L+++ +    + D+    HY+L+SA HKS+RGSDP+AA+YYLA++ ++G D + + RRL  +  ED+GLA+       NAA +A + LG PE  + L+Q  + +  +PKSN+  +A   A+ S  K  +  PP H+ +A      +     GY+Y HD   ++  QEY P++L ++ +Y+P +  + +   K +++W +++
  S:    28 SLKDVTGQNHLLGEKGLLSRMVVAGSIGSMIFWGPPGTGKTTVARLLALEKEFAFEQVSAIFTGVSELKKIFEVAQARFMSGCKMLLFVDEIHRFNRAQQDSFLPFMEDGTVILIGATTENPSFELNAALLSRARVLTFLPHDNESLSMLLKRAEKVEGKILPLDDDARDVLIGMSDGDARAALTLAEEVWSVAQPGEIFDAGTLQKIIQRRAPIYDKGRDGHYNLISALHKSVRGSDPDAALYYLARMFDAGEDPLYIGRRLVRMAVEDVGLADPQALVICNAAKDAYDYLGSPEGELALAQACLYVATAPKSNATYLAYKAAMHSARKNGSFPPPRHILNAPTKFMKEEGYGHGYRYDHDEPDAFSGQEYFPEQLGHQIYYQPRERGFEREIAKRLEWWKQLR 432
>gi|145594367|ref|YP_001158664.1| recombination factor protein RarA [Salinispora tropica CNB-440] >gi|145303704|gb|ABP54286.1| Recombination protein MgsA [Salinispora tropica CNB-440] (477 aa)
Score = 459, Expect = 1.0e-43, Identities = 122/376 (32%), Positives = 207/376 (55%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKP-----IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS----AVLKEEVI--KYLENKKVKLSNKVVEAIVEISKSDFRQIFFYL-------------KIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKY 389
            DE+I +D +    + +  ++      S++ +G PG GK+     +    ++ F   ++      D+  +++ A    +      ++ I+E+HR +K +QD LL  +E   + +LA TTENP+F V   + SR +L  ++ ++     ++L+  V+  + L    V L+ +  E +V ++  D R+    L             +I L   +   D   ++          DR   +HYD+ SAF KS+RGSD +AA+++LA++L +G D   + RR+     ED+G+A+ G      AA +A E +GLPEA++ L+Q  I L  +PKSNSA  AI  A+  V      S P  LRDAHY  A  L +  GY+YPHD     V Q+Y+P +L   ++Y+P+++
  S:    22 LDELIGQDHLRAPGAPLHQLVSGAAPMSVILWGPPGSGKTTIAHLVAGATDRRFVAMSALNAGVKDVRAVIDAARRQRRAGGPQTVLFIDEVHRFSKTQQDSLLAAVEDRTVTLLAATTENPYFSVISPLLSRCVLLTLQPLDDDAVRSLLRRAVVDGRGLGGTPV-LAPEAEEHLVRLAAGDVRKALTALEAAAASATAVGARRIDLPTAEQAVDSAAVR---------YDRDGDSHYDVTSAFIKSMRGSDVDAALHWLARMLVAGEDPRFIARRMVIFASEDVGMADPGALGVATAAAHAVEYVGLPEAQLNLAQAVIHLTTAPKSNSATTAIGAALADVRAGRGGSVPRGLRDAHYPGAKGLGHGTGYRYPHDDQRGVVNQQYVPDDLVGTDYYRPSQH 414
>gi|194333665|ref|YP_002015525.1| AAA ATPase central domain protein [Prosthecochloris aestuarii DSM 271] >gi|194311483|gb|ACF45878.1| AAA ATPase central domain protein [Prosthecochloris aestuarii DSM 271] (454 aa)
Score = 459, Expect = 1.1e-43, Identities = 117/353 (33%), Positives = 202/353 (57%)
  Q:    34 IENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA-----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVV----EAIVEISKSDFRQIFFYLKIVLKYYQNKSD-----DIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLN-VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           +E   L S++F+G PG GK+   +     L+  F   ++      D+ + LE A      E  + ++ I+EIHR NK +QD LL  +E+ +++++  TTENP F+VN A+ SR+ +YR++ ++   LK+ V++ L+  ++     +V    + ++E S  D R+    +        N        +++++ L +   S  D++   HYD++SAF KS+RGSDP+AA+++LA++LE G D   + RR+     ED+G A+        +  +A E +GLPEARI L+Q    L    KSN++  A+++A Q   +    P P HL +A      +    +GY+YPHD+   +VE+ Y P+ + +  FY+P
  S:    57 LEEGRLPSLIFWGPPGSGKTTLAEICAHWLDFRFAKLSAVDAGVKDVRQALEQADKARRIEGQRSLLFIDEIHRFNKAQQDSLLHAIEQGIVVLIGATTENPSFEVNAALMSRMQVYRLKPLDRDELKQVVMRALKTDQLLSDAGIVIDDWDVLLEFSAGDARKALNAVDAAAAMAPNVGSVHINRELLMQVLQQKLPSY-DKKGAYHYDIISAFIKSLRGSDPDAALFWLAKMLEGGEDPKFIARRMVIFSSEDVGNADPYALTLAVSVFHAVEMIGLPEARINLAQGVTYLASCSKSNASYRALNDAQQFAARHQDEPVPMHLCNAPTTFMKQAGYAQGYRYPHDHPGHFVEERYFPEGV-DATFYRP 424
>gi|118497986|ref|YP_899036.1| ATPase, AAA family [Francisella tularensis subsp. novicida U112] >gi|194323209|ref|ZP_03056993.1| ATPase, AAA family protein [Francisella tularensis subsp. novicida FTE] >gi|118423892|gb|ABK90282.1| AAA family-ATPase [Francisella tularensis subsp. novicida U112] >gi|194322573|gb|EDX20053.1| ATPase, AAA family protein [Francisella tularensis subsp. novicida FTE] (412 aa)
Score = 459, Expect = 1.1e-43, Identities = 126/392 (32%), Positives = 221/392 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKV------KLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVL-KEL-----GKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA-LSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIK 404
           S DE++ ++ +  +  I+  ++  + + S++  G PGVGK++  + I       F+  ++  +   D+ +++      +  ++ ++EIHR NK +QD+LL Y+E   II++  TTENP + +N A+ SRL + R++ ++    ++ + K L   +V      K+ + +  ++   S+ D R+I   L+ +      + D+I L KEL     G+ T+    R     Y+ LSAFHKS+RG+DP+AA+++L+ +L++G D + + RR+  +  EDIG A+         A NA E LG+PE R+ L+Q  I L ++PKSN+   A+ +A Q V     +  P HL++   ++        Y YPH+Y  SYV Q+YLP  +  + FY+P    +       +D  NKIK
  S:    14 SIDEIVGQEHLLSQHGILTKILAGDGICSLVLCGKPGVGKTSLARIIASSKKLEFFELSAVDSGVKDIKKLITDNQHLDSFVLFLDEIHRFNKSQQDILLPYVESGKIILIGATTENPTYYLNDALVSRLFILRLKRLSLVATQKLIEKTLSQDEVLAKHKFKIDDGLYNSMHNYSEGDCRKILNLLERMF-LISTRGDEIYLNKELFDQAVGE-TSRDFHREGKEFYEQLSAFHKSVRGTDPDAAIFWLSVMLDNGVDPLVIARRMLCIASEDIGNADPQALRVAMDAWNAYEKLGMPEGRLVLAQAAIYLAVAPKSNACYKALAQAQQLVKSLGNIDVPQHLKNYKDSN--------YLYPHNYPNSYVIQQYLPDNII-QNFYQPTASGFEAKIKTKLDSINKIK 410
>gi|116328835|ref|YP_798555.1| recombination factor protein RarA [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331744|ref|YP_801462.1| recombination factor protein RarA [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116121579|gb|ABJ79622.1| Holliday junction resolvase helicase subunit-like ATPase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116125433|gb|ABJ76704.1| Holliday junction resolvase helicase subunit-like ATPase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (423 aa)
Score = 458, Expect = 1.1e-43, Identities = 123/367 (33%), Positives = 207/367 (56%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENIN---SAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLK-IVLKYYQNKSDDIVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE--ALSPPNHLRDA-HYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNK--EFYKPNKYSQNENKFVDY----WNKIKSNN 407
           SI+ +G PG GKS     + +K N  F  +N+ +   +++ ++LE A  +   ++ ++EIHR +  +QD LL  +E   ++++  TTENP F++   + SR  + +IE ++    ++L E  I+ LE   + L+    E ++  S  D R++   L+ +   + +N +  I   ++ +   S +   D+   +HYD++SAF KS+RGSDP+AA+YYLA LLE G D + + RRL  +  ED+G A+    P   + ++A EA+G+PE R+ L+ +T  L   PKSN++   I  A+  V ++   +  PN LR+A  +    +   +GY YPHD+   + EQ Y P E       FY P   +  E K  +Y    W K  S +
  S:    43 SIILYGPPGTGKSTLAGILCRKWNLPFVEYNAVSTGVSEIKKLLERAEREGTILLFLDEIHRFSASQQDSLLKGVETGHLVLIGATTENPAFRITRPLLSRCQILKIEPLSWEEQSLLLERGIQNLE-YSIHLNPGAKETLIRFSGGDGRKLLSNLEGLSFSFPENHT--ISKSDVEEYLESRVIEYDKSGESHYDVISAFIKSVRGSDPDAALYYLAVLLEGGEDPLFIMRRLIILASEDVGNASVNGLPLAVSGLHALEAIGMPEGRLVLAHVTTFLASCPKSNASYKGIGAALSFVREKGTGIKIPNRLRNAPTFLHKKEGASQGYLYPHDFG-GFKEQNYFPDEFAENPPRFYFPTG-NGAELKLKEYLDRVWEKFSSRD 421
>gi|157363945|ref|YP_001470712.1| recombination factor protein RarA [Thermotoga lettingae TMO] >gi|157314549|gb|ABV33648.1| AAA ATPase central domain protein [Thermotoga lettingae TMO] (436 aa)
Score = 458, Expect = 1.2e-43, Identities = 126/390 (32%), Positives = 225/390 (57%)
  Q:    15 DEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS----AVLKEEVI--KYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDR--RATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNVKG--YKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNEN---KFVDYWNKIK 404
           ++++ +  +  K+ I+   +E   +FS + +G PG GKS+  + I K ++  F++F+   +  ND+ + +  A E      + II I+EIHRLNK +QDLLL  +E   I ++  TTENP F++ P + SR  +  ++ +++     ++K  +I  + + + ++ ++++V +AI ++S+ D R     L+I ++  +  +  IV   + + ++       R   HYD  SAF KS+RGSDP+AA+YY+A++++SG D + + RR+  +  EDIGLA+        +A  A E +GLPE  + L+Q  I L  +PKSNS  +A+++A     +   +  P  LR+      +K +  G  Y YPH+    +V++ Y+P EL   + Y P    + EN   +  + W K K
  S:    20 EDLVGQQHVMGKEGILRKALEKGMMFSCVLYGPPGCGKSSIAELIRKHVDAEFFFFSGALHGANDIKQAMNRAQEMKRYGKQTIIFIDEIHRLNKAQQDLLLSKVEDGTITLIGATTENPSFEIIPPLLSRCRVIFLKPLSNEELIKIMKRAIIVDEKIASYEINVTDEVFQAIAQMSQGDARFALNTLEIAIEAARGMNQKIVDFNVLQASSGYKPHGYRKEEHYDFASAFIKSLRGSDPDAALYYMARMIDSGEDPMFIARRMIILASEDIGLADPMALLVATSAAQAVEYVGLPECALNLAQAAIYLAAAPKSNSVYLALEKAKDVAKRSTGVQVPLFLRNP-VTKLMKNSGYGEEYIYPHETG-GFVKRSYMPDELSRIKIYTPKSIGKEENIKKRLEELWGKEK 426
>gi|162312526|ref|NP_594449.2| DNA replication ATPase [Schizosaccharomyces pombe] >gi|74626620|sp|O13984|YEG2_SCHPO Uncharacterized AAA domain-containing protein C26H5.02c >gi|62867681|emb|CAB16188.2| DNA replication ATPase [Schizosaccharomyces pombe] (504 aa)
Score = 458, Expect = 1.2e-43, Identities = 126/381 (33%), Positives = 214/381 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENI---------NSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS---DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAID--EAIQSVNKEA--LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYK-PNKYSQNE 393
           S DE + ++ +  +  II N+IE +   S++ +G+ G GK+   + I       F   ++T+    D  +I E     L     K II ++E+HR N+ +QD+ L  +EK ++ ++  TTENP F++N A+ SR  ++ ++ +         N A L E   + L +    +   +++ I  I+  D R     L++ +   +      +DI  K+    +++L DR    HYD +SAFHKS+RGSD +A +YYL ++LESG D + V RR+  +  EDIG+A++ + P  ++   A + +G+PEA + L+   + L L+PKS     + +  ++  S + +A     P H+R+A      +L   KGYKY  DY    V QEYLP  +K  +FYK P +  ++E
  S:    94 SLDEYVGQEELVGERGIIRNLIEQDRCNSMILWGSAGTGKTTLARLIAVTTKSRFIEISATSTTVADCRKIFEDSQNYLTLTGRKTIIFLDEVHRFNRAQQDIFLPMVEKGLVTLIGATTENPSFRLNSALISRCPVFVLKKLTRDNVKKILNHACLLES--ERLGSSMPNVETSIIDYISAITDGDARMALNALEMSIGMLRQGPLSLEDI--KDKLVRSSALYDRVGDVHYDTISAFHKSVRGSDVDATLYYLGRMLESGEDPLYVARRMVRIASEDIGIADNSMLPLASSTFTAVQQVGMPEADVILAHCAVALALAPKSVDVYRSYNAVKSFLSSHPDAGRAEIPMHIRNAPTNLMKQLGYHKGYKYNPDYKDGLVMQEYLPDSIKGTKFYKLPIELKEDE 494
>gi|161507635|ref|YP_001577589.1| recombination factor protein RarA [Lactobacillus helveticus DPC 4571] >gi|160348624|gb|ABX27298.1| putative chromosome segregation helicase [Lactobacillus helveticus DPC 4571] (441 aa)
Score = 458, Expect = 1.3e-43, Identities = 126/393 (32%), Positives = 224/393 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS-----DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEA---LGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKS 405
           + D+ + ++ +     I+ ++IE + + S++ +G PG GK+   + I K+   +F  F++ T++  D+ +I+E A ++     + I+ I+EIHR NK +QD  L ++E+  I ++  TTENP+F+VN A+ SR  ++ + ++    +   + + L+N        VK+S++ ++ I      D R     L+I +   +        DD VLK+L  + +   D+    HY+L+SA HKS+R SD +AAVY++ +++E G D + + RRL     ED+GLA++     +N A+N  +A   +GLPE  + L++  I L  +PKSNS  +A ++A + + K    P P  +R+A       L+  K Y+Y  D        + +P EL+ K FY P+    NE +F     +IK+
  S:    26 NLDDFVGQENLIGHGKILRDLIEKDRVPSLILWGPPGTGKTTLAEIIAKRTKAHFITFSAVTSSIKDIRKIMEEAEQNRQFGERNIVFIDEIHRFNKAQQDAFLPFVEQGSITLIGATTENPYFEVNSALLSRAKVFVLHSLKVDDIVLLLKRALKNPNGFPDLNVKVSDEALKQIAIFGNGDARSSLNTLEIAVLNGKKSGKDVVIDDAVLKQLINVKSLRYDKHGEEHYNLISALHKSMRNSDVDAAVYWVNRMIEGGEDPLYIARRLIRFASEDVGLADTN---SLNVAINTFQACKYIGLPECGVHLTECVIYLACTPKSNSVYVAQEKAKKLIKKTGNLPVPLQIRNAPTKLMKDLHYGKDYQYAQDSPDKLTNMKTMPPELEGKTFYHPSNQG-NEIRFQKRLAQIKA 435
>gi|188579618|ref|YP_001923063.1| AAA ATPase central domain protein [Methylobacterium populi BJ001] >gi|179343116|gb|ACB78528.1| AAA ATPase central domain protein [Methylobacterium populi BJ001] (440 aa)
Score = 458, Expect = 1.4e-43, Identities = 115/395 (29%), Positives = 216/395 (54%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKP----IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA--LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKF---VDYWNKIKSNNK 408
             E++ ++ +   D  +  ++ +  L S++F+G PG GK+   + +  +   +F   ++  +   DL ++ E A +        ++ ++EIHR N+ + D  L  +E   + ++  TTENP F++N A+  R+R+LL+R  +  +        + +E + + L  +   A++ ++  D R      + V +  +     D   L+ L +    + D+    HY+L+SA HK++RGSDP+AA+YYL ++L++G D + + RRL  +  EDIGLA+       NAA +A + LG PE  + L+Q+T+ L  +PKSN A+ +  +A   V K A  L+PP  + +A      ++   +GY+Y HD   ++  Q+Y P+ L  + FY+P      E ++   + YW +++   +
  S:    30 LSEVVGQEHLTGPDGALTRLLASRSLGSLVFWGPPGTGKTTVARLLAHETELHFEQISAIFSGIADLRKVFEAARKRRATGQGTLLFVDEIHRFNRSQLDAFLPVMEDGTVTLVGATTENPSFELNAALLSRARVLLFRALDATALARLLARAEEMEGQALPLDEEARAALIRMADGDGRAALTLAEEVWRSARPGEILDAEKLQTLVQRRAPIYDKAQEGHYNLISALHKTVRGSDPDAALYYLCRMLDAGEDRLFIARRLVRMAVEDIGLADPQALVVANAAKDAFDFLGSPEGELALAQVTVYLACAPKSN-AVYSAYKAATRVAKAAGSLAPPRTILNAPTGLMKRIGYGEGYRYDHDEPDAFSGQDYWPEALGRQHFYEPTDRGM-ETRYRERLAYWERLRQERR 437
>gi|66046406|ref|YP_236247.1| recombination factor protein RarA [Pseudomonas syringae pv. syringae B728a] >gi|63257113|gb|AAY38209.1| AAA ATPase, central region [Pseudomonas syringae pv. syringae B728a] (440 aa)
Score = 458, Expect = 1.4e-43, Identities = 113/378 (29%), Positives = 214/378 (56%)
  Q:     9 LVCNSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE------NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSD-DI-VLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVE-QEYLPKELKNKEFYKP 386
           L   + DE + ++ +      +   +E   L S++F+G PGVGK+   + + K  + +F   ++      ++ + +E+A +       + I+ ++E+HR NK +QD  L Y+E   +I +  TTENP F++N A+ SR  +Y +++++ A L++ V + L        +++ LS++    ++  +  D R++   L+      ++ S+ D+ +L+ L   +    D+     YD +SA HKSIRGS+P+AA+Y+ A++++ G D + + RR+  +  EDIG A+    P   +A +  E LG PE  + ++Q  + L  +PKSN+  MA   A++   +  +L  P HLR+A      +L   + Y+Y HD   +Y   ++Y P EL+ +++Y+P
  S:    17 LRATNLDEYVGQEHVLAHGKPLREALEQGALHSMIFWGPPGVGKTTLAKLLAKVSDAHFETVSAVLAGVKEIRQAVEVARQQAGQYGKRTILFVDEVHRFNKSQQDAFLPYVEDGTLIFIGATTENPSFELNNALLSRARVYVLKSLDEAALRKLVNRALTEERGLGKRQLTLSDEGFAILMSAADGDGRRMLNLLENASDLAEDGSEIDVGLLQSLLGDSRRRFDKGGEAFYDQISALHKSIRGSNPDAALYWFARMIDGGCDPLYLARRVVRMASEDIGNADPRALPLCMSAWDVQERLGSPEGELAVAQAIVYLACAPKSNAVYMAFKAAMREAGEHGSLEVPLHLRNAPTKLMKQLGYGEEYRYAHDEPDAYAAGEDYFPDELEPRQYYQP 411
>gi|108803881|ref|YP_643818.1| recombination factor protein RarA [Rubrobacter xylanophilus DSM 9941] >gi|108765124|gb|ABG04006.1| AAA ATPase, central region [Rubrobacter xylanophilus DSM 9941] (429 aa)
Score = 458, Expect = 1.4e-43, Identities = 117/374 (31%), Positives = 204/374 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK-----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           S DE++ +  +  +   +    E   + S++ +G PG GK+   + +   + + F   ++ T+   DL   L+ A E  K      ++ ++E+HR NK +QD LL  LE+ ++  +  TTENP F+V   + SR  + R+  ++   L+  + + L    V +S +  + ++ ++  D R++   L++     +      + + LG+     +      HYD++SAF KS+RG DP+AA++YLA+++E+G D + + RRL  +  ED+G A+    P   AA  A   +G+PE RIPL+Q    L  +PKSN+A   IDEA+  V + A    P HLR+A      +    +GY+Y HD     + Q YLP+EL+++ +Y+P
  S:    26 SLDEVVGQPHLAGEGGPLREAAERGRVGSVILWGPPGTGKTTLARVLAASVEEEFVPLSAVTSGVRDLRAALDGARERLKYEGRGTLLFVDEVHRFNKAQQDALLPALEEGLVDFIGATTENPSFEVTAPLLSRSRVLRLRPLSKGDLEALLERGLSELGVGISGEARDYLLRLAGGDARRMLNALEVAASGRREVGVAEIERALGQ---RALRYGREEHYDVVSAFIKSVRGGDPDAALHYLARMIEAGEDPVFIARRLVILASEDVGNADPRALPLAVAAAEAVRMVGMPEGRIPLAQAAAYLASAPKSNAAYAGIDEALADVRRGATPEVPLHLRNAPTGLMREEGYGEGYRYAHDDEPEGMNQRYLPEELRDRVYYRP 404
>gi|62290117|ref|YP_221910.1| recombination factor protein RarA [Brucella abortus bv. 1 str. 9-941] >gi|82700040|ref|YP_414614.1| recombination factor protein RarA [Brucella melitensis biovar Abortus 2308] >gi|189024355|ref|YP_001935123.1| ATPase, AAA family [Brucella abortus S19] >gi|62196249|gb|AAX74549.1| ATPase, AAA family [Brucella abortus biovar 1 str. 9-941] >gi|82616141|emb|CAJ11184.1| Shikimate kinase:Replication factor C conserved domain:ATP/GTP-binding site motif A (P-loop):AAA ATPase:AAA ATPase, central r... [Brucella melitensis biovar Abortus 2308] >gi|189019927|gb|ACD72649.1| ATPase, AAA family [Brucella abortus S19] (437 aa)
Score = 457, Expect = 1.6e-43, Identities = 109/383 (28%), Positives = 212/383 (55%)
  Q:    27 DSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLN---VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIKSNNKQ 409
           + ++  MI +  L S++F+G PG GK+   + +  + +  F   ++  +   DL  + E A        + ++ ++EIHR N+ +QD  L  +E   +I++  TTENP F++N A+  R+R+L +   +  S     +  +  E + + L ++   +++ ++  D R      + V +  +     D   L+++ +    + D+    HY+L+SA HKS+RGSDP+AA+YYL+++ ++G D + +  RL  +  EDIGLA+       NAA +A + LG PE  + L+Q  + L  +PKSN+  +A   ++++  +  +L PP H+ +A   + +  N    +GY Y HD   ++  Q+Y P+ +  + FY P +  + +   K ++YW +++   ++
  S:    41 EGVLTRMIASGSLGSMVFWGPPGTGKTTVARLLAGETDLAFEQISAIFSGVADLKRVFEAARARRMSGRQTLLFVDEIHRFNRAQQDSFLPVMEDGTVILIGATTENPSFELNAALLSRARVLTFHPHDSESIATLLKRAEEQEGQALPLDDEARASLIRMADGDGRAALTLAEEVWRAVRPGEVFDAAKLQDVVQRRAPVYDKSQDGHYNLISALHKSVRGSDPDAALYYLSRMFDAGEDPLYIGHRLVRMAVEDIGLADPQALAICNAAKDAYDYLGSPEGELALAQACVYLATAPKSNAVYVAFKNSMRAAKENGSLLPPKHILNA--PTKLMKNEGYSEGYAYDHDQPDAFSGQDYFPEAMGRQVFYNPPERGFEREIRKRLEYWARLRQERQR 436
>gi|90417739|ref|ZP_01225651.1| ATPase, AAA family [Aurantimonas sp. SI85-9A1] >gi|90337411|gb|EAS51062.1| ATPase, AAA family [Aurantimonas sp. SI85-9A1] (452 aa)
Score = 457, Expect = 1.7e-43, Identities = 114/371 (30%), Positives = 210/371 (56%)
  Q:    16 EMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGD-LISVYRRLYAVVYEDIGLAN-SGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNH--------LRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           E++ ++ +  +  ++  M+E   L S++F+G PG GK+   + +  +++  F   ++  +   DL ++ E A    +   + ++ ++EIHR N+ +QD  L  +E   ++++  TTENP F++N A+  R+R+L ++     S V   E  +  E   + L+ +    ++ ++  D R      + V +  +     D   L+E+ +    + D+    HY+L+SA HKS+RGSDP+AA+Y+L ++L++G+  + + RRL  +  EDIGLA+   LG  + AA +A + LG PE  + L++ T+ L  +PKSN+   A   A+++  +  +L PP H        +RD  Y S       GY Y HD   ++  Q+Y P E+  ++FY+P
  S:    44 EVVGQEHLTGEGGVLSRMLEATSLGSMIFWGPPGTGKTTVARLLAHEVDYAFEQISAIFSGVADLKKMFETARLRRSNGRRTLLFVDEIHRFNRAQQDSFLPVMEDGTVVLVGATTENPSFELNAALLSRARVLTFKPHGSASLVKLLERAEATEGMALPLNEQARAVLLRMADGDGRAALTLAEEVWRASRKGEIFDAAGLQEIVQRRAPVYDKGQDGHYNLISALHKSVRGSDPDAALYWLCRMLDAGENPLYLGRRLVRMASEDIGLADPRALGIAL-AAKDAFDYLGSPEGELALAEATVYLASAPKSNAVYTAYKAAMRAAKEHGSLLPPKHILNAPTALMRDEGYGS-------GYAYDHDAPDAFSGQDYFPDEMDRQQFYRP 425
>gi|145258000|ref|XP_001401914.1| hypothetical protein An04g05500 [Aspergillus niger] >gi|134074518|emb|CAK38812.1| unnamed protein product [Aspergillus niger] (531 aa)
Score = 457, Expect = 1.7e-43, Identities = 123/371 (33%), Positives = 211/371 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLS-----------NKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGK-ITNSLI-DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK---EALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEF 383
           + D++  ++++ P + ++  +IE + + S++ +G PG GK+   + I   +   F   NST++   +  +I      EL     K II  +EIHR +K +QD+ L  +E   + ++  TTENP FKV  A+ SR   + +       L +E IK + ++ ++L             ++++ +   +  D R     L++ +    +K   +   E+ + +T +L+ DR    HYD +SAFHKSIRGSDP+AA+YYLA++++SG D + + RRL  V  EDIGLA++ +     +   A E +GLPEARI L+  T+ + LS KS  +   ++ A  ++ +     L  P HLR+A      +L   K YKY  +Y    V Q+YLP+++  ++F
  S:   130 TLDDVCGQELVGP-NGVLRGLIEQDRVPSMILWGGPGTGKTTIARVIASMVGSRFVEINSTSSGVAECKKIFSDAKSELGLTGRKTIIFCDEIHRFSKSQQDVFLGPVESGQVTLIGATTENPSFKVQNALLSRCRTFTLSK-----LTDEDIKSILHRALRLEGPNYSPSELVDEELIDYLARFADGDARTSLNLLELAMDL--SKRPGMTKDEIKRSLTKTLVYDRAGDQHYDTISAFHKSIRGSDPDAALYYLARMIQSGEDPLYIARRLIVVASEDIGLADNSMLTLAISTHAAVEKIGLPEARINLAHATVAMALSKKSTRSYRGLNNAFAALAEPGVAGLPVPIHLRNAPTRLMKELGYGKEYKYNPNYVDGEVVQDYLPEKILGRKF 515
>gi|145618923|ref|ZP_01774978.1| AAA ATPase, central domain protein [Geobacter bemidjiensis Bem] >gi|144944849|gb|EDJ79919.1| AAA ATPase, central domain protein [Geobacter bemidjiensis Bem] >gi|197088184|gb|ACH39455.1| AAA ATPase central domain protein [Geobacter bemidjiensis Bem] (434 aa)
Score = 457, Expect = 1.7e-43, Identities = 119/356 (33%), Positives = 202/356 (56%)
  Q:    33 MIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-----------KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKY-YQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLAN-SGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           +IE++ L S++F+G PG GK+   + I      +F +F++  +   ++ E+++     L  +  + I+ ++EIHR NK +QD  L ++E+    ++  TTENP F+V   + SR  +  ++ ++     E+++K LEN            ++  + + +  + E +  D R     L+   +  +Q +      +E  +    L D+    HY+++SAF KS+RGSDP+AA+Y+LA++LE+G D I + RR+     ED+G A+  GL   V +A+ A + +G+PE RI L Q    L  +PKSN++   I+EA+  V K    P P  +R+A       L   KGY YPHD+    V Q YLP+ L  + FY P +
  S:    43 LIESDRLTSLIFWGPPGSGKTTLARIIANATRSHFIFFSAIMSGIKEIREVVKEAEDTLKYQGKRTILFVDEIHRFNKSQQDAFLPHVERGTFTIIGATTENPSFEVIAPLLSRCKVLVLQPLSD----EDLLKILENALADRERGLGELELSATAEALAFMAEQAAGDARVALNTLETASRLAHQGEITLESAREAVQKKPLLYDKGGEEHYNVISAFIKSMRGSDPDAALYWLARMLEAGEDPIFILRRMVIFASEDVGNADPRGLQLAV-SALQAFQLVGMPEGRIILGQAVTYLATAPKSNASYNGINEALAEVRKSGAQPVPMEIRNAPTKLMKGLGYGKGYLYPHDHQ-GVVRQNYLPEALAGRRFYTPKE 413
>gi|126737037|ref|ZP_01752772.1| ATPase [Roseobacter sp. SK209-2-6] >gi|126721622|gb|EBA18325.1| ATPase [Roseobacter sp. SK209-2-6] (437 aa)
Score = 456, Expect = 2.1e-43, Identities = 130/391 (33%), Positives = 212/391 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN-KPIII-IEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENK-----KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQN----KSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN--KYSQNENKFVDYWNKI 403
           S DE++ +  +  K S++   I  N L SI+ +G PGVGK++  + + + LNK F   ++T     D   I +LA E   +PI+I ++E+HR +  + D LL   E+     +  TT+NP+  +  A+ SR  + ++E I    ++  + + LE+      +V L+ + +  I   S  D R     L+ +   + +    K  D +L+E+ +      DR    HYD++SAF KS+RG DP A +Y+LA+L+  G D   + RR+     ED+GLA++       AA  A E +G PEARI L+   + +  +PKS SA   I  A+ +V  E   P P HLRDAHY  A +L   GY+ PH+    +V+Q Y P  ++   FY+    + +  E +  +YW ++
  S:    24 SLDEVVGQKTLTAKGSVLRRRIAANQLGSIVLYGPPGVGKTSIARAVGEMLNKEFKQLHATRAGVKD---IRQLADEARIRPILIFVDEVHRFSATQADDLLSICEEGTADFIGATTQNPYTALPKALVSRSTILKLEPIAIEDMEAVLARGLEHLAEMGIEVVLAPEQLRIIAGRSGGDARSALTTLESLAIGHGDSGSVKVTDDMLEEVYRAAPVNHDRSGDQHYDIISAFIKSMRGGDPEAVLYWLARLIHGGEDPRFIARRIMIQASEDVGLADNTALQTAVAAAQAVEMIGYPEARIILAHAALHVTRAPKSGSANHGISAALSAVGSEPPLPVPLHLRDAHYQGAEQLGHGGYRSPHNDPRGWVDQTYAPG-MQPGRFYQSEAREAATFEKRADEYWERV 425
>gi|85859697|ref|YP_461899.1| recombination factor protein RarA [Syntrophus aciditrophicus SB] >gi|85722788|gb|ABC77731.1| ATPase, AAA family [Syntrophus aciditrophicus SB] (478 aa)
Score = 456, Expect = 2.1e-43, Identities = 122/390 (31%), Positives = 208/390 (53%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA-----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEA-------IVEISKSDFRQIFFYLKIV---LKYYQNKSDDIV---LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKEL--KNKEFYKPNK--YSQNENKFVDYWNK 402
           + DE   ++ +  K S++   IE + LFS++F+G PG GK+   + +  +    F  F++  +   +L +++E A         K ++ ++EIHR NK +QD  L ++E  +I ++  TTENP F+V   + SR  +  ++  +   L   + + L +++  L N  +E        +V  +  D R     L+ V   L   + +S  I    ++E  +      D+    HY+L+SAFHKS+RGSDP+AA+Y+L ++L +G D + + RR+     ED+G A+         A+ A   +GLPE  + L+Q  + L  +PKSN+          ++      P P H+R+A       L   + Y+Y HDY  ++V QEYLP  L  K  EFY+P    Y +   + ++ W K
  S:    49 TLDEFFGQEHLLKKHSLLRRAIEEDRLFSVIFWGPPGSGKTTLARIVAGETKAYFAAFSAVLSGVKELRKVVEEAEARWQNNRQKTVLFVDEIHRFNKAQQDAFLPHVESGLITLIGATTENPSFEVIAPLLSRCRVLVLKPFSDEDLVRILNRVLRDRRRGLGNLGLELDQDALAYLVHTADGDARTALNSLEAVASLLAAGEGQSSRISRVQVEEALQKKGLQYDKSGAEHYNLISAFHKSLRGSDPDAALYWLGRMLTAGEDPLYIARRMVRFASEDVGNADPMALSIAMTAMQAFHFIGLPEGELALAQAAVYLATAPKSNALYAGYGRVKAAIAATGTLPVPLHIRNAPTRLMKDLGYGRDYRYAHDYEGAWVPQEYLPDALLAKEHEFYRPTDRGYERTIRERLEKWKK 463
>gi|108562846|ref|YP_627162.1| recombination factor protein RarA [Helicobacter pylori HPAG1] >gi|107836619|gb|ABF84488.1| conserved hypothetical helicase-like protein [Helicobacter pylori HPAG1] (391 aa)
Score = 456, Expect = 2.2e-43, Identities = 132/366 (36%), Positives = 201/366 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDN---KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKI-TNSLIDRRATN--HYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKEL 378
           S ++ + ++ +  KD+ +   +++    +  F+G PGVGK++  Q I + L +    FN+T     DL   L+L    N   KP++ I+E HRLNK +Q+ LL  +EKD  ++L  +T++P + ++ AIRSR   + +  +N + L +   K L   K ++       ++  S  D R +   L +  K      + I LK L  +  +SL D   ++  HY+L SA  KS+RGSD NA++YYLA+L+  G+    + RRL     EDIG AN        + + + + +G PEARI LSQ  I L  SPKSN+A  AI++A+  V K +L P P HL           N K Y YPHDYN  YV+Q+YL K L
  S:    11 SLEDFLGQEHLIGKDAPLFKALQSKHFPNAFFYGPPGVGKTSLAQIIARSLERPILSFNATDFKLEDLR--LKLKNYQNTLLKPVVFIDETHRLNKTQQEFLLPIMEKDHALILGASTQDPNYSLSHAIRSRSFTFELTPLNKSDLDKLCDKALALLKKQIEPDAKTYLLNNSAGDARALLNLLDLSAKI----ENPITLKTLQSLRPHSLNDGSYSDDTHYNLTSALIKSLRGSDENASIYYLARLIAGGENPEFIARRLVIFASEDIGNANPNALNLAASCLFSVKQIGYPEARIILSQCVIYLACSPKSNTAYRAINQALDCVQKGSLYPIPKHLLP---------NAKDYLYPHDYN-GYVKQDYLEKPL 368
>gi|84496693|ref|ZP_00995547.1| conserved ATP/GTP binding protein [Janibacter sp. HTCC2649] >gi|84383461|gb|EAP99342.1| conserved ATP/GTP binding protein [Janibacter sp. HTCC2649] (457 aa)
Score = 456, Expect = 2.2e-43, Identities = 130/392 (33%), Positives = 213/392 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENND----LFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQN-----KSDDIVLK-ELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV--NKEALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNK-EFYKPNKYSQNENKFVDYWNKIK 404
           S DE+  +D +    S +  +IE +       S + +G PG GK+     +    N+ F   ++ T    D+  ++E A       D + ++ ++EIHR  K +QD LL  +E   +I++A TTENP F V   + SR +L  + +++ A + E +   + + +       LS++  E +V IS  D R+    L+       +     +SDD  ++  L     ++       D+    HYD+ SAF KS+RGSD +AA++YLA+ LE+G D   + RR+     ED+G+ +        AA++A   +G+PEARI L+Q  +   L+PKSN+A   I+ AI  +   +    PP HLR + YA A +L + KGY Y HD       Q+YLP +L  K ++Y+P      E +  + W  +K
  S:    31 SIDEVRGQDAVLRPGSPLRRLIEGSGGTAGSLSAILWGPPGTGKTTLAHLVATAANREFVELSAVTAGVKDVRAVMEAAARNRDLYDRQTVLFLDEIHRFTKAQQDALLPGVETRQVILVAATTENPSFSVIAPLLSRSMLITLTSLDDAQVAEVLDSAVTDARGLDAAYALSSEAREHLVRISGGDARRALTSLEAAAGVALDDAPAGRSDDTPIEITLAHAEQAVAQASVRYDKTGDQHYDVASAFIKSMRGSDVDAALHYLARQLEAGEDPRFIARRIVISASEDVGMGDPTALQTAVAAMHAVAQVGMPEARIILAQAVVHNTLAPKSNAAYAGINAAIADIRGGRGGAVPP-HLRGSGYAGATRLGHGKGYVYAHDEADGVARQQYLPDDLHGKTDYYQPTDRG-FEARLQERWTWLK 451
>gi|23502083|ref|NP_698210.1| recombination factor protein RarA [Brucella suis 1330] >gi|161619161|ref|YP_001593048.1| recombination factor protein RarA [Brucella canis ATCC 23365] >gi|23348042|gb|AAN30125.1| ATPase, AAA family [Brucella suis 1330] >gi|161335972|gb|ABX62277.1| AAA ATPase central domain protein [Brucella canis ATCC 23365] (437 aa)
Score = 456, Expect = 2.4e-43, Identities = 109/383 (28%), Positives = 212/383 (55%)
  Q:    27 DSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLN---VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIKSNNKQ 409
           + ++  MI +  L S++F+G PG GK+   + +  + +  F   ++  +   DL  + E A        + ++ ++EIHR N+ +QD  L  +E   +I++  TTENP F++N A+  R+R+L +   +  S     +  +  E + + L ++   +++ ++  D R      + V +  +     D   L+++ +    + D+    HY+L+SA HKS+RGSDP+AA+YYL+++ ++G D + + RRL  +  EDIGLA+       NAA +A + LG PE  + L+Q  + L  +PKSN+  +A   ++++  +  +L PP H+ +A   + +  N    +GY Y H    ++  Q+Y P+ +  + FY P +  + +   K ++YW +++   ++
  S:    41 EGVLTRMIASGSLGSMVFWGPPGTGKTTVARLLAGETDLAFEQISAIFSGVADLKRVFEAARARRMSGRQTLLFVDEIHRFNRAQQDSFLPVMEDGTVILIGATTENPSFELNAALLSRARVLTFHPHDSESIATLLKRAEEQEGQALPLDDEARASLIRMADGDGRAALTLAEEVWRAVRPGEVFDAAKLQDVVQRRAPVYDKSQDGHYNLISALHKSVRGSDPDAALYYLSRMFDAGEDPLYIGRRLVRMAVEDIGLADPQALAICNAAKDAYDYLGSPEGELALAQACVYLATAPKSNAVYVAFKNSMRAAKENGSLLPPKHILNA--PTKLMKNEGYSEGYAYDHGQPDAFSGQDYFPEAMGRQVFYNPPERGFEREIRKRLEYWARLRQERQR 436
>gi|49475767|ref|YP_033808.1| recombination factor protein RarA [Bartonella henselae str. Houston-1] >gi|49238574|emb|CAF27815.1| ATPase, aaa family [Bartonella henselae str. Houston-1] (439 aa)
Score = 455, Expect = 2.5e-43, Identities = 112/393 (28%), Positives = 216/393 (54%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELAT----EDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIK 404
           +S +++  +  +  +  ++  ++    + S++F+G PG GK+   + +  + N  F   ++      +L +I E A       ++ ++ ++EIHR N+ +QD  L  +E   +I++  TTENP F++N A+  R+R+L +   +  S  +  +  + LE K + L +   + ++++S  D R      + V    +     D   L+++ +    + D+    HY+L+SA HKS+RGSDP+AA+YYLA++ ++G D + + RRL  +  ED+GLA+       NAA +A + LG PE  + L+Q  + +  +PKSN+  +A   A++   K  +L PP H+ +A      +     GY Y HD   ++  QEY P++L  + +Y+P    + +   K +++W +++
  S:    27 HSLNDVTGQSHLVGEKGLLSRIVAAGSIGSMIFWGPPGTGKTTVARLLALETNFAFEQVSAIFTGVAELKKIFESAQARFMSGSQTVLFVDEIHRFNRAQQDSFLPVMEDGTVILIGATTENPSFELNAALLSRARVLTFLPHDNESLGMLLKRAEALEEKTLPLDDNARDVLIDMSDGDARAALTLAEEVWSVARPGEIFDAAALRKIVQRRAPIYDKGRDGHYNLISALHKSVRGSDPDAALYYLARMFDAGEDPLYIGRRLVRMAVEDVGLADPQALVICNAAKDAYDYLGSPEGELALAQACLYVATAPKSNATYLAYKAAMRCARKNGSLPPPKHILNAPTKFMKEEGYGHGYCYDHDEPDAFSGQEYFPEKLGRQSYYQPVERGFEREIAKRLEWWKQLR 432
>gi|196012762|ref|XP_002116243.1| hypothetical protein TRIADDRAFT_30677 [Trichoplax adhaerens] >gi|190581198|gb|EDV21276.1| hypothetical protein TRIADDRAFT_30677 [Trichoplax adhaerens] (478 aa)
Score = 455, Expect = 2.6e-43, Identities = 133/378 (35%), Positives = 226/378 (59%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILK----KLNKNFYYFNSTTNNKNDLLEILELATEDN-----KPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSA----VLKE---EVIKYLE-------NK-KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLK----YYQNKS-----DDIVLKELGKITNSLI-----------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK---EALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKY 389
           N   + I +D +    + + ++IE+ D+ S++F+G PG GK+     I K    K N  F   ++T++    + E++++A +D      + I+ ++EIHR NK +QD+ L Y+E   I+++  TTENP F +N A+ SR  +  ++ ++SA    +LK     +  YL+       NK K+K  ++ ++A+      D R+    L++ ++     Y N+      DD  L  +  +T   +           DR    HY+++SA HKS+RG D NAA+Y+L ++L+ G+  + + RRL     ED+GLA++       AA +A + +G+PE  + L+Q  + L  +PKS    MA D   +++N+      S P HLR+A  +   KL   KGYKY  DY+   V+Q+YLP  L N +F+K  K+
  S:    51 NVLTDYIGQDDVLGGKTSLRSLIESGDIHSMIFWGPPGCGKTTLANIIAKSGKSKANMRFIQLSATSSGTQKVREVIDIAQKDRTMFNRQTILFMDEIHRFNKAQQDVFLPYVENGTIVLIGATTENPSFSLNNALLSRCHVITLQKLSSANVVTILKSALNNIEDYLDLDDFTTGNKYKIKADDQALKALGNFCDGDARKALNGLEMAIRSKIIIYNNRDITQPIDDERLPTIIAVTEKDVLESLQRSHLQYDRSGEEHYNIISALHKSMRGGDENAAMYWLCRMLKGGEQPTYIARRLIRFASEDVGLADNQALFIAVAAYHACQFIGMPECEVNLAQTVVYLARAPKSVECYMAYDRVKKNINEWKGPLPSVPLHLRNAPTSLMQKLGYGKGYKYNPDYD-KPVQQDYLPSCLLNIDFFKERKF 476
>gi|23464657|ref|NP_695260.1| recombination factor protein RarA [Bifidobacterium longum NCC2705] >gi|23325217|gb|AAN23896.1| widely conserved hypothetical protein with possible helicase and ATP binding domains [Bifidobacterium longum NCC2705] (459 aa)
Score = 455, Expect = 2.6e-43, Identities = 118/347 (34%), Positives = 206/347 (59%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGK---ITNSLI-----------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-----NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           S++ FG PGVGK+     +  +  + F   ++ T+   D+ ++L      L +   + ++ I+E+HR +K +QD LL  +E   +  +  TTENP F +   + SR ++ ++E++    L E V + L + +     VK +++ +  IV ++  D R+    L I+       + D   K+  +   IT+ ++           D+   +HYD++SAF KS+RGSDP+AA++YLA++L++G D   + RR+     E++G+A   +     AA  A   +G+PEARI L++ TI +  +PKSN++  AI++A+  V+   +   P +LR+A      KL     N +GYKY HD+  +   QEY+P+EL+  E+Y PN
  S:    62 SVILFGPPGVGKTTLATIVAGQSGRVFEELSAVTSGVKDVRDVLTRAHERLVSRGRETVLFIDEVHRFSKSQQDALLPAVENRDVTFIGATTENPSFSIIKPLLSRSVVVKLESLEPDQLTELVQRALTDDRGLRGEVKATDEAIADIVRMAGGDARK---SLTILEAAAGAVTGDEARKKGARRPIITSEIVATVMDTATVRYDKDGDDHYDVISAFIKSMRGSDPDAAIHYLARMLKAGEDPRFIARRIMIAASEEVGMAAPQILQVTVAAAQAVALVGMPEARIILAEATIAVATAPKSNASYNAINQALADVDTGKIGAVPLYLRNA----PTKLMKEWGNHEGYKYAHDWPGAVAPQEYMPEELRGTEYYHPN 432
>gi|149196409|ref|ZP_01873464.1| ATPase, AAA family protein [Lentisphaera araneosa HTCC2155] >gi|149140670|gb|EDM29068.1| ATPase, AAA family protein [Lentisphaera araneosa HTCC2155] (430 aa)
Score = 455, Expect = 2.8e-43, Identities = 130/382 (34%), Positives = 222/382 (58%)
  Q:    28 SIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKE-------EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGK-ITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPK-VNAAVNASEA---LGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKSNNKQ 409
           S++   IEN+   SI+F G PG GK++    I K    +F   ++  ++ +++ + ++ A E       K ++ ++EIHR NK +QD LL  +E   +  +  TT NP F + PA+ SR L++ ++ + ++ +K        +++K LE  +++   + ++ + E  + D R+    +++ +K  Q  SD I L+EL + +        A  HY+  SAF KS+RGSDP+AAVY+LA +LE+G D+  + RR+     ED+G A+    P+ +  AV+AS+A   +G+PEARI LSQ       +PKSN+A  A++ A++ V N+ +   P HLRD   +S        Y YPH+   +YV+QEY+  E K   +Y+P    Y     + +DYW  ++  + +
  S:    35 SLLRRSIENDCFSSIIFTGPPGTGKTSLASIISKHTEADFIALSAIDSSVSEVRKAVKAADEARKFSGRKTVLFVDEIHRFNKAQQDSLLKDIENGTVRFIGATTHNPGFYLTPALCSRSLIFTLKPLEASAVKSLLEAKMTKIMKALE-AELQFDEEGLKFLSENCEGDARRALTVIELAVKTAQ--SDKIGLEELRECLQVKSYKYDADAHYNAASAFIKSMRGSDPDAAVYWLAYMLEAGEDIRFIARRIMIFASEDVGNAD----PRALQLAVSASQAVDIVGMPEARIILSQAVTYCATAPKSNAAYKAVNLALEDVKNQRSQVIPMHLRDPR-SSGYNPEEGDYVYPHNSKEAYVKQEYIGVESK---YYQPVERGYETKIKERMDYWQSLRGEDDR 426
>gi|153009313|ref|YP_001370528.1| recombination factor protein RarA [Ochrobactrum anthropi ATCC 49188] >gi|151561201|gb|ABS14699.1| AAA ATPase central domain protein [Ochrobactrum anthropi ATCC 49188] (438 aa)
Score = 455, Expect = 2.9e-43, Identities = 111/382 (29%), Positives = 214/382 (56%)
  Q:    27 DSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV----LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV---KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIKSNNK 408
           + ++  MI +  L S++F+G PG GK+   + +  + +  F   ++  +   DL ++ E A        + ++ ++EIHR N+ +QD  L  +E   +I++  TTENP F++N A+  R+R+L +   +  S        +  E + + L  +   ++V ++  D R      + V +    + D++     L+++ +    + D+    HY+L+SA HKS+RGSDP+AA+YYL+++ ++G D + + RRL  +  EDIGLA+       NAA +A + LG PE  + L+Q  + L  +PKSN+  +A   ++++  +  +L PP H+ +A   + +  N     GY Y HD   ++  Q+Y P+ +  ++FY P +  + ++  K ++YW +++   +
  S:    41 EGVLTRMIASGSLGSMIFWGPPGTGKTTVARLLAGETDLAFEQISAIFSGVADLKKVFETARARRMSGRQTLLFVDEIHRFNRAQQDSFLPVMEDGTVILIGATTENPSFELNAALLSRARVLTFHPHDGESIATLLTRAEEQEERPLPLDEEARVSLVRMADGDGRAALTLAEEVWR--AARPDEVFTAEKLQDVVQRRAPVYDKGQDGHYNLISALHKSVRGSDPDAALYYLSRMFDAGEDPLYLGRRLVRMAVEDIGLADPQALVICNAAKDAYDYLGSPEGELALAQACVYLATAPKSNAVYVAYKASMRAAKENGSLLPPKHILNA--PTKLMKNEGYGDGYAYDHDQPDAFSGQDYFPESMGRQKFYDPPERGFERDIRKRLEYWARLRQERQ 435
>gi|133930607|gb|ABO43874.1| ATPase protein [Lactobacillus reuteri] (204 aa)
Score = 454, Expect = 3.8e-43, Identities = 92/185 (49%), Positives = 119/185 (64%)
  Q:   221 DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKF-VDYWNKIKS 405
           D+    HYD++SAF KSIRGSD +AA++YLA+L+E+GDL  + RRL    YEDIGLAN     +   AV  +E +G PEARIPL+   IELCLSPKSNS I AIDEA+  V +      P HL+DAHY  A KL +   Y YPHDY   +V Q+YLP  +K+ ++Y+P    + E      YW   K+
  S:     4 DKDGDAHYDVISAFQKSIRGSDTDAALHYLARLIEAGDLPIIARRLMITAYEDIGLANMPAVQRAVTAVQTAERVGFPEARIPLADAVIELCLSPKSNSGINAIDEALAQVRQGGFGDVPAHLKDAHYKGAAKLGHGLDYDYPHDYPQDWVAQQYLPDRIKDAQYYQPKNNGRFEASLGRQYWQLRKA 191
>gi|600046|emb|CAA55489.1| N1302 [Saccharomyces cerevisiae] >gi|2253183|emb|CAA96120.1| unnamed protein product [Saccharomyces cerevisiae] (472 aa)
Score = 454, Expect = 3.9e-43, Identities = 142/372 (38%), Positives = 225/372 (60%)
  Q:    27 DSIIINMIENNDLFSILFFGNPGVGKSASIQFILK-------KLNKNFYYF----NSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS-----------AVLKE--EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIV-LKYYQNKSD----------DIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDE--AIQSVNKEALSP---PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVD 398
           +  +   I+   + S++ +G PGVGK++  + + K       + N    YF    ++T  N  +L  I E + ++      + ++ I+EIHR NK +QDLLL ++E   II++  TTENP F++N A+ SR L++ +E +N            A+L +  + +  +EN  +KLS  ++E +V++S  D R+    L+++ +   + K+D          DI+        N+  D +  NHYD +SAFHKSIRG D NA++YYLA++L+ G D + V RR+  +  EDIGL +S L P   AA +A   +GLPEA + L+Q  + L  +PKS     A  +  A+ S N  +L+    P H+R+A      +L   KGYKY  DY    V+Q+Y PKE+  K    PNK    + KF+D
  S:    43 NGTLFKYIKQGTIPSMILWGPPGVGKTSLARLLTKTATTSSNESNVGSRYFMIETSATKANTQELRGIFEKSKKEYQLTKRRTVLFIDEIHRFNKVQQDLLLPHVENGDIILIGATTENPSFQLNNALISRCLIFVLEKLNVNELCIVLSRGIALLNKCRKQVWNIEN-PLKLSRSILEYVVDLSVGDTRRALNMLEMIEVSTRERKADEEELSIDDVRDIIKNNSSNGLNTYYDPKGDNHYDTISAFHKSIRGGDENASLYYLARMLQGGEDPLYVARRMIRIASEDIGLRDSSLLPLAVAAHDAVMKVGLPEADLALAQCCVALARAPKSVELYRAWKKLRAMMSENMYSLASSEIPMHIRNAPTKLMEELGYHKGYKYNPDYIEGKVQQDYFPKEVLEK---CPNK---TDLKFLD 454
>gi|121606099|ref|YP_983428.1| recombination factor protein RarA [Polaromonas naphthalenivorans CJ2] >gi|120595068|gb|ABM38507.1| Recombination protein MgsA [Polaromonas naphthalenivorans CJ2] (432 aa)
Score = 453, Expect = 4.4e-43, Identities = 119/375 (31%), Positives = 202/375 (53%)
  Q:    35 ENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELAT-----EDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKV----KLSNKVVEAIVEISKSDFRQIFFYLKIV-----LKYYQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQE-YLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           E+ +  S + +G PGVGK+   + +    + +F   ++      D+ E +E AT        + I+ ++E+HR NK +QD  L ++E  +   +  TTENP F+VN A+ SR ++Y ++ +    LK+ + + L  + +     ++ + V+ +V  +  D R++   L+ +      +     +D  +LK LG+      D+     YD +SA HKS+RGSDPNAA+Y+  ++L+ G +   + RRL  +  EDIGLA+         A    E LG PE  + L+Q  + L ++PKSN+   A +EA   + K+   P P HLR+A      +L+  K Y+Y HD +  +   E Y P+ + +  FY+P      E K  D  N++K+ N Q
  S:    40 ESGEPHSCILWGPPGVGKTTIARLMASSFDAHFITISAVLGGVKDIREAVEQATIWQGQGGRRTIVFVDEVHRFNKSQQDAFLPHVESGLFTFIGATTENPSFEVNSALLSRAVVYVLQPLTEDDLKQIIARVLSERALPAIETIAVEAVDRLVAYADGDARRLLNTLESLSVAARAEKITGVTDAWLLKVLGERLRRY-DKGGEKFYDTISALHKSVRGSDPNAALYWFMRMLDGGAEPRYMARRLIRMASEDIGLADPRALRLALDAAEVYERLGSPEGELALAQCVVYLAVAPKSNAVYQAFNEAKAFIKKDGTRPVPLHLRNAPTKLMKELDYGKNYRYAHDEDGGFAAGENYFPEGMVDPGFYRPVNRGL-EIKIADKLNELKAKNHQ 430
>gi|191162417|ref|ZP_03024297.1| AAA ATPase central domain protein [Geobacter sp. M21] >gi|190996527|gb|EDV71975.1| AAA ATPase central domain protein [Geobacter sp. M21] (434 aa)
Score = 453, Expect = 4.4e-43, Identities = 122/356 (34%), Positives = 202/356 (56%)
  Q:    33 MIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE----NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNS-----------LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLAN-SGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           +IE++ L S++F+G PG GK+   + I    + +F +F++  +   ++ E+++     L  +  + I+ ++EIHR NK +QD  L ++E+    ++  TTENP F+V   + SR  +  ++ ++     E+++K LE    +++  L +  + A  E       Q     ++ L   +  S    L   G+IT             L D+    HY+++SAF KS+RGSDP+AA+Y+LA++LE+G D I + RR+     ED+G A+  GL   V +A+ A + +G+PE RI L Q    L  +PKSN++   I+EA+  V K    P P  +R+A       L   KGY YPHD+    V Q YLP+ L  + FY P +
  S:    43 LIESDRLTSLIFWGPPGSGKTTLARIIANATSSHFIFFSAIMSGIKEIREVVKEAEDTLKYQGKRTILFVDEIHRFNKSQQDAFLPHVERGTFTIIGATTENPSFEVIAPLLSRCKVLVLQPLSD----EDLLKILEIALADRERGLGDLELGATAEALAFMAEQAAGDARVALNTLETASR---LAHHGEITLESAREAVQKKPLLYDKGGEEHYNVISAFIKSMRGSDPDAALYWLARMLEAGEDPIFILRRMVIFASEDVGNADPRGLQLAV-SALQAYQLVGMPEGRIILGQAVTYLATAPKSNASYNGINEALAEVRKSGAQPVPMEIRNAPTKLMKGLGYGKGYLYPHDHQ-GVVRQNYLPEALAGRRFYTPKE 413
>gi|91789641|ref|YP_550593.1| recombination factor protein RarA [Polaromonas sp. JS666] >gi|91698866|gb|ABE45695.1| Recombination protein MgsA [Polaromonas sp. JS666] (427 aa)
Score = 453, Expect = 4.5e-43, Identities = 121/375 (32%), Positives = 204/375 (54%)
  Q:    35 ENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELAT-----EDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKV----KLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNK-----SDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQE-YLPKELKNKEFYKPNKYSQNENKFVDYWNKIKSNNKQ 409
           E+    S + +G PGVGK+   + +    + +F   ++      D+ E +E A+        + I+ ++E+HR NK +QD  L ++E  +   +  TTENP F+VN A+ SR ++Y ++ +  A LK  V+K LE + +     +++  V+ +V  +  D R++   L+ +    +++     +D  +LK LG+      D+     YD +SA HKS+RGSDP+AA+Y+  ++L+ G +   + RRL  +  EDIGLA+         A    E LG PE  + L+Q  I L ++PKSN+   A +EA   + K+   P P HLR+A      +L+  K Y+Y HD    +   E Y P+ L+  ++Y+P      E +  D  N++K  N Q
  S:    35 ESGQPHSCILWGPPGVGKTTLARLMASSFDAHFITISAVLGGVKDIREAVEQASIWQGQGGRRTIVFVDEVHRFNKSQQDAFLPHVESGLFTFIGATTENPSFEVNSALLSRAVVYVLQPLVEADLKRIVVKVLEERALPAIESIADAAVDRLVAYADGDARRLLNTLESLGVAARSEKITVVTDAWLLKVLGERLRRY-DKGGEQFYDTISALHKSVRGSDPDAALYWFMRMLDGGAEPRYMARRLIRMASEDIGLADPRALRLALDAAEVYERLGSPEGELALAQCVIYLAVAPKSNAVYKAFNEAKAFIRKDGTRPVPLHLRNAPTRLMKELDYGKDYRYAHDEEDGFAAGENYFPEGLRAPDWYRPVNRGL-EIRISDKLNELKLKNNQ 425
>gi|84685387|ref|ZP_01013285.1| ATPase, AAA family protein [Rhodobacterales bacterium HTCC2654] >gi|84666544|gb|EAQ13016.1| ATPase, AAA family protein [Rhodobacterales bacterium HTCC2654] (436 aa)
Score = 453, Expect = 4.5e-43, Identities = 120/396 (30%), Positives = 214/396 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSR---LLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKY-YQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNA----AVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEA-IQSVNKEALSPPNH--------LRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKSNNK 408
           + D++I ++ +   +  +  M+ +  L S++ +G PGVGK+   + +    + +F   ++      DL ++ E A    +     ++ ++EIHR NK +QD  L ++E   I+++  TTENP F++N A+ SR   + L R+E  +   + +   + L+ + + L+ +  EA++E++  D R +   ++ V+ +    K D   L        +  D+    HY+L+SA HKS+RGSDP+AA+Y+  ++LE G D   + RRL  +  EDIGLA+    P+ N     A    E LG PE  + L+Q  + L L+PKSN+  +A   A  Q+    +  PP H        ++D  Y S       GY+Y HD    +  Q Y P ++K   +Y+P    + +   K VD++  +++  +
  S:    28 ALDQVIGQEAVLGPEGPLGVMLASGSLGSLILWGPPGVGKTTIARLLADVTDLHFIQISAIFTGVTDLRKVFEAAKMRRQNGKGTLLFVDEIHRFNKAQQDGFLPHMEDGTILLVGATTENPSFELNAAVLSRAQVITLKRLEPADLERMAQRAERELD-RALPLTGEGREALIEMADGDGRALLNLIEQVMAWRVDGKLDRDALATRLMRRAAQYDKSGDGHYNLISALHKSVRGSDPDAALYWFTRMLEGGEDPRFLARRLTRMAVEDIGLAD----PQANGICIDAWETYERLGSPEGELALAQAVVYLALAPKSNAGYVAYKAARAQAKQTGSAPPPKHILNAPTRLMKDEGYGS-------GYQYEHDAEDGFSGQNYFPDDVKRPVYYQPVERGFERELKKRVDFFAGLRAKRQ 435
>gi|171743312|ref|ZP_02919119.1| hypothetical protein BIFDEN_02443 [Bifidobacterium dentium ATCC 27678] >gi|171278926|gb|EDT46587.1| hypothetical protein BIFDEN_02443 [Bifidobacterium dentium ATCC 27678] (458 aa)
Score = 453, Expect = 4.6e-43, Identities = 115/347 (33%), Positives = 201/347 (57%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-----LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE-----NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSD------------DIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           SI+ FG PGVGK+     + K+  + F   ++ T+   D+ ++L+     L  E  + ++ I+E+HR +K +QD LL  +E   +  +A TTENP F V   + SR ++ ++E++    L+  + + +E     N +V++ +  V+ I+ ++  D R+    L+          +            D+V K +  +     D+   +HYD++SAF KS+RGSDP+A ++YLA++L +G D   + RR+     E++G+A   +     AA  A   +G+PEARI L++  + +  +PKSN++  AI+ A+  V+   +   P HLR+A  A      N +GY+Y HD+  +   Q+Y+P ELK +E+Y PN
  S:    61 SIILFGPPGVGKTTLAYIVAKQSGRVFEELSAVTSGVKDVRDVLKRAHDRLVAEGKETVLFIDEVHRFSKSQQDALLPSVENRDVTFIAATTENPSFSVIKPLLSRSVVVKLESLEPDDLRTLINRAVEDERGLNNEVRIRDDAVDEIIRMASGDARKTLTILEAAAGALTGDKERKKGAKRPVITPDVVSKVM-DVATVRYDKDGDDHYDVISAFIKSMRGSDPDATMHYLARMLRAGEDPRFIARRIMIAASEEVGMAAPQILQVTVAAAQAVAMIGMPEARIILAEAALAVATAPKSNASYNAINSALADVDAGLIGQVPLHLRNAPTALMKSWGNHEGYRYAHDWPGAVAPQQYMPDELKGREYYHPN 431
>gi|156741065|ref|YP_001431194.1| recombination factor protein RarA [Roseiflexus castenholzii DSM 13941] >gi|156232393|gb|ABU57176.1| AAA ATPase central domain protein [Roseiflexus castenholzii DSM 13941] (544 aa)
Score = 453, Expect = 5.1e-43, Identities = 132/374 (35%), Positives = 212/374 (56%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLS--NKVVEA-----IVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKEL---GKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLN----------------------------------------VKGYKYPHDYNFSYVEQEYLPKELKNKEFYKP 386
           + DE + +D I  +  ++   I N+ LFSI+ +G PG GK+   + I    + +F   ++ +    DL  +++ A +       + I+ I+EIHR NK +QD +L Y+E   II++  TTENP F+VNPA+RSR  ++ +E++    +   V + L + +  L   N ++ A     ++ +S  D R     L  +      KS  I  K L     I ++L       D+    HYD +SA HKS+R SDP+AA+Y+L ++L+ G D + + RR+  +  EDIG+A+    P   AA  A   LG PE  + L+Q  + L  +PKSN+  +A   A+  V +    P P HLR+A  A   +L                                          +GYKY HD + + VEQE+ P  L+ + +Y+P
  S:    31 ALDEFVGQDHIVGEGKLLRRAITNDALFSIILWGPPGSGKTTLARIIADTTHAHFEQLSAVSAGVADLRRVVKEAQDRLGMFQQRTIVFIDEIHRFNKAQQDAILPYVEDGTIILIGATTENPSFEVNPALRSRARVFVLESLTDEQIGVIVDRALTDAERGLGALNVLLAADARGYLINMSNGDART---ALNALEAAALAKSPGIGGKRLLTVDDIRDALQSRAVQYDKNGELHYDAISALHKSVRDSDPDAALYWLGRMLDGGEDPLYIARRVVRMAIEDIGMADPHALPLTIAAQQAVHFLGQPEGDLALAQAVVYLAQAPKSNAVYVAYAAALNDVAETRNEPVPLHLRNAPTALMKRLGYARGYKYAHDDDDAQAETRNEPVPLHLRNAPTALMKRLGYARGYKYAHDDDDAQVEQEHFPPNLRGRRYYEP 464
>gi|156449666|ref|ZP_02056048.1| AAA ATPase, central domain protein [Methylobacterium chloromethanicum CM4] >gi|156191400|gb|EDO23587.1| AAA ATPase, central domain protein [Methylobacterium chloromethanicum CM4] (437 aa)
Score = 453, Expect = 5.4e-43, Identities = 114/393 (29%), Positives = 216/393 (54%)
  Q:    16 EMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKP----IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA--LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKF---VDYWNKIKSNNK 408
           E++ ++ +   D  +  ++ +  L S++F+G PG GK+   + +  +   +F   ++  +   DL ++ E A +        ++ ++EIHR N+ + D  L  +E   + ++  TTENP F++N A+  R+R+LL+R  + ++        + ++ + + L  +   A++ ++  D R      + V +  +     D   L+ L +    + D+    HY+L+SA HK++RGSDP+AA+YYL ++L++G D + + RRL  +  EDIGLA+       NAA +A + LG PE  + L+Q+T+ L  +PKSN+   A   A + V K A  L+PP  + +A      ++   +GY+Y HD   ++  Q+Y P+ L  + FY+P      E ++   + YW +++   +
  S:    29 EVVGQEHLTGPDGALTRLLASRSLGSLVFWGPPGTGKTTVARLLAHETALHFEQISAIFSGIADLRKVFEAARKRRATGQGTLLFVDEIHRFNRAQLDAFLPVMEDGTVTLVGATTENPSFELNAALLSRARVLLFRALDASALARLLARAEEMDGQPLPLDEEARAALIRMADGDGRAALTLAEEVWRSARPGEILDAETLQSLVQRRAPIYDKAQEGHYNLISALHKTVRGSDPDAALYYLCRMLDAGEDRLFIARRLVRMAVEDIGLADPQALVVANAAKDAFDFLGSPEGELALAQVTVYLACAPKSNAVYNAYKAATR-VAKAAGSLAPPRTILNAPTGLMRRIGYGEGYRYDHDEPDAFSGQDYWPEALGRQHFYEPTDRGM-ETRYRERLAYWERLRQERR 434
>gi|50842656|ref|YP_055883.1| recombination factor protein RarA [Propionibacterium acnes KPA171202] >gi|50840258|gb|AAT82925.1| uncharacterized ATPase related to the helicase subunit of the holliday junction resolvase [Propionibacterium acnes KPA171202] (461 aa)
Score = 452, Expect = 5.7e-43, Identities = 125/393 (31%), Positives = 216/393 (54%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATED---NKP-IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLEN---------KKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLIDRRAT-------NHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIKS 405
           + DE++ +  +    S +  + E     S+  +G PGVGK+     +    N+ F   ++ T    D+   L+ A       +P ++ ++E+HR +K +QD+LL  +E   + ++A TTENP F V   + SR LL  ++ +  A +   + + L +         ++  L +     +++++  D R+   YL+           D +  +   I ++ +DR A         HYD++SAF KS+RGSD +AA++YLA+++E+G D   + RRL  +  EDIG+A   +     AA  A + +G+PEAR+ L+Q TI    +PKSN+ I AID A+  V   +    P HLRDAHY+SA  L +  GY+Y H++     +Q+YLP ++ +  +Y P  +  NE       ++I++
  S:    39 TIDEIVGQQHLLTPGSPLRRLAEGTGAMSVFLWGPPGVGKTTIASVVSHATNRRFVEISAVTAGVKDIRRELDTARRQLALGQPTVLFVDEVHRFSKAQQDVLLPAVENRTVTLIAATTENPSFSVISPLLSRSLLLTLKPLTEADVSSLLDRALSDPRGLRTESDRRYVLEDDARADLLQLAAGDARRALTYLEEAAAGASAAGTDTITSQ---IVSTAVDRAAVRYDRDGDQHYDVISAFIKSVRGSDVDAALHYLARMIEAGEDPRFIARRLIILASEDIGMAAPSVLQTCVAAAQAVQLIGMPEARLNLAQATIAAATAPKSNAVITAIDGALADVRAGKGGEVPAHLRDAHYSSAHDLGHGVGYRYAHNFPHGVAKQQYLPDDIASTRYYDPTDHG-NEAAIAQRLSQIRA 450
>gi|88798710|ref|ZP_01114293.1| hypothetical protein MED297_15939 [Reinekea sp. MED297] >gi|88778473|gb|EAR09665.1| hypothetical protein MED297_15939 [Reinekea sp. MED297] (439 aa)
Score = 452, Expect = 5.9e-43, Identities = 111/353 (31%), Positives = 196/353 (55%)
  Q:    34 IENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKE--EVIKYLENKKVKLS--NKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS----DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSV-NKEALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQE-YLPKELKNKEFYKP 386
           +EN +L S++F+G PGVGK+     I   +   F   ++      D+  + E A +        ++ ++E+HR NK +QD  L Y+E    I +  TTENP F++N A+ SR  +Y +++      ++  +  + L+ +  KL+  N  ++ +++ +  D R+   +L+I + ++ +++    DDI  +EL        D+   N YD +SAFHKS+RGS P+ A+Y+L ++L+ G D + + RR+  +  EDIG A+         A ++ E LG PE  + L+Q  + L  +PKSN+   A +  + +V +  +   P HLR+A  +    L+  + Y+Y HD   +Y   E YLP  ++ + FY P
  S:    43 LENRNLHSMIFWGPPGVGKTTLANVISNTVEARFEVLSAVQAGVKDIKLVAEKAKQAQAYGEVTVLFVDEVHRFNKAQQDAFLPYVENGTFIFIGATTENPSFELNSALLSRARVYVLKSFTDDDFRQLWQRARSLDERIAKLAIENDALDGLIQFADGDARRFLNFLEIAIDFFTSEAVITLDDI--RELLSHQPRRFDKGGENFYDQISAFHKSVRGSSPDGALYWLCRMLDGGIDPLYLARRMVRIASEDIGNADPRALTLALNAWDSQERLGSPEGELSLAQAAVYLASAPKSNAVYTAFNAMMSAVRSSHSAEVPLHLRNAPTSLMKDLDYGRDYRYAHDEPHAYAAGEVYLPDHMQGQRFYDP 409
>gi|114766058|ref|ZP_01445068.1| AAA ATPase [Roseovarius sp. HTCC2601] >gi|114541693|gb|EAU44733.1| AAA ATPase [Roseovarius sp. HTCC2601] (434 aa)
Score = 452, Expect = 6.1e-43, Identities = 125/375 (33%), Positives = 209/375 (55%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIII-IEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEV---IKYLENK--KVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALS-PPNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           + D++I +  I  + SI+   I+   L S++ +G PG+GK+   + +   L K F   ++T +   +L +I + A    +P++I ++E+HR +  + D LL   E+     +  TT NP+  + PA+ SR  + ++E ++   +++ V   I +L +    V+++ + V  +   S  D R+    L+ +   +     +I    L +   S     DR    HYD++SAF KS+RGSDP+A +Y+LA+++ +G D   + RR+     ED+GLA++       AA  A E +G PEARI L+   + +  +PKSNSA   I  A+ +V + A +  P HLRDAHYA A KL   GY++PHD    +VEQEY+P  LK    Y+ +
  S:    24 TLDDVIGQPAITAEGSILRRRIKAGALGSLILYGPPGIGKTTIARAVGTMLGKEFRPLHATRDGVKELRKIADEARI--RPLLIFVDEVHRFSATQADDLLSICEEGTADFVGATTGNPYHALPPALVSRSTILKLEPMSLEDMEQVVRRGIDHLHSTGLDVEMTPEQVRLVAGRSGGDARRALTTLESLAVGHPGGRIEITEAMLEEAYASAAINHDRSGDQHYDVVSAFVKSMRGSDPDATLYWLARMIHAGEDPRYIARRIMIHASEDVGLADNTALQTAVAAATAVEKIGYPEARIILAHAALHVARAPKSNSACRGIGAALAAVEQGAPALVPKHLRDAHYAGAAKLGHVGYQFPHDDPRGWVEQEYVPG-LKPGSLYQSD 406
>gi|189346365|ref|YP_001942894.1| AAA ATPase central domain protein [Chlorobium limicola DSM 245] >gi|189340512|gb|ACD89915.1| AAA ATPase central domain protein [Chlorobium limicola DSM 245] (449 aa)
Score = 452, Expect = 6.5e-43, Identities = 121/375 (32%), Positives = 214/375 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENIN----SAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVL-KELGKITNSL------IDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           + D++  +  +  KD  + + +E+  L S++ +G PG GK+   +     L+  F   ++      ++ + L+ A +      + I+ I+EIHR NK +QD LL  +E+ +I ++  TTENP F+VN A+ SR+ +Y ++ ++     AV++  V   +  K+ +L  +    +++ +  D R+    ++        +S ++VL +EL  +  +L       D+ A  HYD +SAF KS+RGSDP+AA+++LA+++E G D + + RR+     EDIG A+        +   A + +GLPEARI L+Q    L  SPKSN++   I+EA+++    +    P HLR+A       +   +GY+YPH Y   +VEQ Y P+ +  + FY+P+
  S:    37 TLDDLSGQAHLVGKDGPLRSFLESGRLPSMILWGPPGSGKTTLAEICATSLHYRFEQLSAIDAGVKEVRKALDGARQARRSGQRTILFIDEIHRFNKAQQDTLLHAIEQGLITLIGATTENPSFEVNGALLSRMQVYILQPLSEQDIEAVIRRAVACDVIMKEKRLVLEDPAFVLQFAGGDARKALNAVEAAAALVPLESSEVVLTREL--LERALQHKAPHYDKGAEAHYDTISAFIKSMRGSDPDAALFWLARMIEGGEDPLFIARRMVIFASEDIGNADPFALSLAVSVFQAVQMIGLPEARINLAQGVTYLAGSPKSNASYEGINEAMRAAKAFQDAGVPLHLRNAPTTLMKTVGYGEGYRYPHQYPGHFVEQHYFPEGVPTQLFYRPS 427
>gi|21220007|ref|NP_625786.1| recombination factor protein RarA [Streptomyces coelicolor A3(2)] >gi|8249965|emb|CAB93386.1| conserved ATP/GTP binding protein [Streptomyces coelicolor A3(2)] (451 aa)
Score = 452, Expect = 7.1e-43, Identities = 127/358 (35%), Positives = 196/358 (54%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIV----LKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVD 398
           S++ +G PG GK+     + K  NK F   ++ T    ++  +++ A         + ++ ++EIHR +K +QD LL  +E   + ++A TTENP+F V   + SR LL  +E +    +++ + + L +++     V L     E ++ I+  D R+    L+       +K +  V    L+E         DR    HYD+ SA  KSIRGSD +AA++YLA+++E+G D   + RRL     EDIGLA+        AA  A   +G PEA + LS  TI L L+PKSN+A  AI  A+  V K    P P HLRD+HY  A KL + +GY YPHD       Q+Y P  LK++ +Y P ++   E ++ D
  S:    64 SVILWGPPGTGKTTLAYVVSKATNKRFVELSAITAGVKEVRAVIDGARRAVGGYGKETVLFLDEIHRFSKAQQDSLLPAVENRWVTLIAATTENPYFSVISPLLSRSLLLTLEPLTDDDVRDLLRRALTDERGLKGAVTLPGDTEEHLLRIAGGDARRALTALEAAAGAALDKGEAEVGLTTLEETVDRAAVKYDRDGDQHYDVASALIKSIRGSDVDAALHYLARMVEAGEDPRFIARRLMISASEDIGLADPNALQIAVAAAQAVAMIGFPEAALTLSHATIALALAPKSNAATTAIGAALDDVRKGHTGPVPAHLRDSHYKGAGKLGHGQGYVYPHDLPEGIAAQQYAPDGLKDRTYYTPTRHGA-EARYAD 437
>gi|158522144|ref|YP_001530014.1| recombination factor protein RarA [Desulfococcus oleovorans Hxd3] >gi|158510970|gb|ABW67937.1| AAA ATPase central domain protein [Desulfococcus oleovorans Hxd3] (459 aa)
Score = 451, Expect = 7.9e-43, Identities = 121/383 (31%), Positives = 201/383 (52%)
  Q:    27 DSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISK-------SDFRQIFFYLKIV-LKYYQNKSDDIVLKELGKITNS---LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLAN-SGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIKSNNKQ 409
           DS++ + +E   LFS++ +G PG GK+   + +       +   ++  +   ++ E++E A           I+ ++E+HR NK +QD  L ++E  ++ ++  TTENP F+V PA+ SR  L  +  +    +++ +++ L + +  L    +E   E           D R     L+   L         I L  + +  +    L D+    HY+L+SA HKS+RGSDP+AAVY+L ++L  G D   + RR+     EDIG A+ S LG  +N A+ A   LG PE  + + Q  + L  +PKSNS      E  + V +    P P H+R+A       L   KGYKY HD+  ++V Q+YLP++L    FY P +  Y +   + +D W  +K   ++
  S:    41 DSLLRSALEKGTLFSMILWGPPGCGKTTLARILAGMTGAAYVQISAVLSGVKEIREVVEAARRRRGEFQKDTILFVDEVHRFNKSQQDAFLPHVESGLVTLIGATTENPSFEVIPALMSRCRLIVLNPVPEEAVRQVLLRALADTEKGLGKMGLEIEPEALAHLAALADGDVRTALNNLEAAALLRPAGTGVTITLAGVEQALDKKALLYDKSGEEHYNLISALHKSLRGSDPDAAVYWLERMLSGGEDPFYILRRMVRFASEDIGNADPSALGVTLN-AMEAYRFLGSPEGDLAIVQAAVYLATAPKSNSLYTMHGEIKRVVKQTGYLPVPKHIRNAPTNLMKDLGYGKGYKYAHDFKEAFVPQDYLPEKLAGSLFYHPTQRGYEKTVKERLDKWRALKKRYRE 444
>gi|119503243|ref|ZP_01625327.1| hypothetical protein MGP2080_11283 [marine gamma proteobacterium HTCC2080] >gi|119460889|gb|EAW41980.1| hypothetical protein MGP2080_11283 [marine gamma proteobacterium HTCC2080] (444 aa)
Score = 451, Expect = 7.9e-43, Identities = 120/377 (31%), Positives = 206/377 (54%)
  Q:    12 NSFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS----AVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS-----DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPK-VNAAVNA---SEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQE-YLPKELKNKEFYKPNK 388
           +S    + ++ I   D+ +   +E  +L S L +G PGVGK+   +         FY  ++  +   ++ +++E A    ++  + ++ ++E+HR NK +QD  L ++E   I  +  TTENP F+VN A+ SR+ +YR+  +       +LK  +   L   ++    K++EA+   +  D R+    L+I     + +      D  VL+ELG+ +    D+     YD +SA HKS+RGSDP+A++Y+  ++L+ G D + + RR+  +  EDIG A+    P+ +  A+NA    E LG PE  + L+Q  I L  + KSN+   A +EA + V+ + +L  PNHLR+A  A          Y+Y HD    Y   E Y P+ +   +FY+P +
  S:    26 SSLASFVGQEHILGPDAPLAMALEAGNLHSFLLWGPPGVGKTTLARLCAGTAKAQFYPISAVLSGVKEIRQVIESARVGLSQGLRTVLFVDEVHRFNKAQQDAFLPHVEDGTITFIGATTENPSFEVNAALLSRVRVYRLRGLEQHHLVTILKRALAAEL--PELHAETKILEALALQADGDARRALGQLEIAADLARVEDGRKTIDQKVLEELGQGSPRRFDKGGDAFYDQISALHKSVRGSDPDASLYWFVRMLDGGCDPLYIARRVVRMASEDIGNAD----PRALEIALNAWQIQERLGSPEGELTLAQAIIYLACAAKSNAVYNAFNEAKRLVDSQGSLEVPNHLRNAPSALMRDQGFGDNYRYAHDEPEGYAANERYFPEGMTATQFYRPTE 417
>gi|151944326|gb|EDN62604.1| protein with DNA-dependent ATPase and ssDNA annealing activities involved in maintenance of genome [Saccharomyces cerevisiae YJM789] (587 aa)
Score = 451, Expect = 8.1e-43, Identities = 142/372 (38%), Positives = 225/372 (60%)
  Q:    27 DSIIINMIENNDLFSILFFGNPGVGKSASIQFILK-------KLNKNFYYF----NSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS-----------AVLKE--EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIV-LKYYQNKSD----------DIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDE--AIQSVNKEALSP---PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVD 398
           +  +   I+   + S++ +G PGVGK++  + + K       + N    YF    ++T  N  +L  I E + ++      + ++ I+EIHR NK +QDLLL ++E   II++  TTENP F++N A+ SR L++ +E +N            A+L +  + +  +EN  +KLS  ++E +V++S  D R+    L+++ +   + K+D          DI+        N+  D +  NHYD +SAFHKSIRG D NA++YYLA++L+ G D + V RR+  +  EDIGL +S L P   AA +A   +GLPEA + L+Q  + L  +PKS     A  +  A+ S N  +L+    P H+R+A      +L   KGYKY  DY    V+Q+Y PKE+  K    PNK    + KF+D
  S:   158 NGTLFKYIKQGTIPSMILWGPPGVGKTSLARLLTKTATTSSNESNVGSRYFMIETSATKANTQELRGIFEKSKKEYQLTKRRTVLFIDEIHRFNKVQQDLLLPHVENGDIILIGATTENPSFQLNNALISRCLIFVLEKLNVNELCIVLSRGIALLNKCRKQVWNIEN-PLKLSRSILEYVVDLSVGDTRRALNMLEMIEVSTRERKADEEELSIDDVRDIIKNNSSNGLNTYYDPKGDNHYDTISAFHKSIRGGDENASLYYLARMLQGGEDPLYVARRMIRIASEDIGLRDSSLLPLAVAAHDAVMKVGLPEADLALAQCCVALARAPKSVELYRAWKKLRAMMSENMYSLASSEIPMHIRNAPTKLMEELGYHKGYKYNPDYIEGKVQQDYFPKEVLEK---CPNK---TDLKFLD 569
>gi|6324111|ref|NP_014181.1| Protein with DNA-dependent ATPase and ssDNA annealing activities involved in maintenance of genome; interacts functionally with DNA polymerase delta; homolog of human Werner helicase interacting protein (WHIP); Mgs1p [Saccharomyces cerevisiae] >gi|1730822|sp|P40151|MGS1_YEAST DNA-dependent ATPase MGS1 (Maintenance of genome stability protein 1) >gi|1302233|emb|CAA96121.1| unnamed protein product [Saccharomyces cerevisiae] >gi|51013831|gb|AAT93209.1| YNL218W [Saccharomyces cerevisiae] >gi|190409192|gb|EDV12457.1| DNA-dependent ATPase MGS1 [Saccharomyces cerevisiae RM11-1a] (587 aa)
Score = 451, Expect = 8.4e-43, Identities = 142/372 (38%), Positives = 225/372 (60%)
  Q:    27 DSIIINMIENNDLFSILFFGNPGVGKSASIQFILK-------KLNKNFYYF----NSTTNNKNDLLEILELATED-----NKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINS-----------AVLKE--EVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIV-LKYYQNKSD----------DIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDE--AIQSVNKEALSP---PNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVD 398
           +  +   I+   + S++ +G PGVGK++  + + K       + N    YF    ++T  N  +L  I E + ++      + ++ I+EIHR NK +QDLLL ++E   II++  TTENP F++N A+ SR L++ +E +N            A+L +  + +  +EN  +KLS  ++E +V++S  D R+    L+++ +   + K+D          DI+        N+  D +  NHYD +SAFHKSIRG D NA++YYLA++L+ G D + V RR+  +  EDIGL +S L P   AA +A   +GLPEA + L+Q  + L  +PKS     A  +  A+ S N  +L+    P H+R+A      +L   KGYKY  DY    V+Q+Y PKE+  K    PNK    + KF+D
  S:   158 NGTLFKYIKQGTIPSMILWGPPGVGKTSLARLLTKTATTSSNESNVGSRYFMIETSATKANTQELRGIFEKSKKEYQLTKRRTVLFIDEIHRFNKVQQDLLLPHVENGDIILIGATTENPSFQLNNALISRCLIFVLEKLNVNELCIVLSRGIALLNKCRKQVWNIEN-PLKLSRSILEYVVDLSVGDTRRALNMLEMIEVSTRERKADEEELSIDDVRDIIKNNSSNGLNTYYDPKGDNHYDTISAFHKSIRGGDENASLYYLARMLQGGEDPLYVARRMIRIASEDIGLRDSSLLPLAVAAHDAVMKVGLPEADLALAQCCVALARAPKSVELYRAWKKLRAMMSENMYSLASSEIPMHIRNAPTKLMEELGYHKGYKYNPDYIEGKVQQDYFPKEVLEK---CPNK---TDLKFLD 569
>gi|189438904|ref|YP_001953985.1| ATPase for Holliday junction resolvase [Bifidobacterium longum DJO10A] >gi|32700050|gb|AAP86675.1| putative GTP-binding protein [Bifidobacterium longum bv. Infantis] >gi|189427339|gb|ACD97487.1| ATPase for Holliday junction resolvase [Bifidobacterium longum DJO10A] (459 aa)
Score = 451, Expect = 9.2e-43, Identities = 118/347 (34%), Positives = 205/347 (59%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGK---ITNSLI-----------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-----NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           S++ FG PGVGK+     +  +  + F   ++ T+   D+ ++L      L +   + ++ I+E+HR +K +QD LL  +E   +  +  TTENP F +   + SR ++ ++E++    L E V + L + +     VK +++ +  IV ++  D R+    L I+       + D   K+  +   IT  ++           D+   +HYD++SAF KS+RGSDP+AA++YLA++L++G D   + RR+     E++G+A   +     AA  A   +G+PEARI L++ TI +  +PKSN++  AI++A+  V+   +   P +LR+A      KL     N +GYKY HD+  +   QEY+P+EL+  E+Y PN
  S:    62 SVILFGPPGVGKTTLATIVAGQSGRVFEELSAVTSGVKDVRDVLTRAHERLVSRGQETVLFIDEVHRFSKSQQDALLPAVENRDVTFIGATTENPSFSIIKPLLSRSVVVKLESLEPDQLIELVQRALTDDRGLRGEVKATDEAIADIVRMAGGDARK---SLTILEAAAGAVTGDEARKKGARRPIITPEIVATVMDTATVRYDKDGDDHYDVISAFIKSMRGSDPDAAIHYLARMLKAGEDPRFIARRIMIAASEEVGMAAPQILQVTVAAAQAVALVGMPEARIILAEATIAVATAPKSNASYNAINQALADVDAGKIGAVPLYLRNA----PTKLMKEWGNHEGYKYAHDWPGAVAPQEYMPEELRGTEYYHPN 432
>gi|46190307|ref|ZP_00206422.1| COG2256: ATPase related to the helicase subunit of the Holliday junction resolvase [Bifidobacterium longum DJO10A] (436 aa)
Score = 450, Expect = 9.5e-43, Identities = 118/347 (34%), Positives = 205/347 (59%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEIL-----ELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGK---ITNSLI-----------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKL-----NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPN 387
           S++ FG PGVGK+     +  +  + F   ++ T+   D+ ++L      L +   + ++ I+E+HR +K +QD LL  +E   +  +  TTENP F +   + SR ++ ++E++    L E V + L + +     VK +++ +  IV ++  D R+    L I+       + D   K+  +   IT  ++           D+   +HYD++SAF KS+RGSDP+AA++YLA++L++G D   + RR+     E++G+A   +     AA  A   +G+PEARI L++ TI +  +PKSN++  AI++A+  V+   +   P +LR+A      KL     N +GYKY HD+  +   QEY+P+EL+  E+Y PN
  S:    39 SVILFGPPGVGKTTLATIVAGQSGRVFEELSAVTSGVKDVRDVLTRAHERLVSRGQETVLFIDEVHRFSKSQQDALLPAVENRDVTFIGATTENPSFSIIKPLLSRSVVVKLESLEPDQLIELVQRALTDDRGLRGEVKATDEAIADIVRMAGGDARK---SLTILEAAAGAVTGDEARKKGARRPIITPEIVATVMDTATVRYDKDGDDHYDVISAFIKSMRGSDPDAAIHYLARMLKAGEDPRFIARRIMIAASEEVGMAAPQILQVTVAAAQAVALVGMPEARIILAEATIAVATAPKSNASYNAINQALADVDAGKIGAVPLYLRNA----PTKLMKEWGNHEGYKYAHDWPGAVAPQEYMPEELRGTEYYHPN 409
>gi|114773805|ref|ZP_01450806.1| Uncharacterized ATPase [alpha proteobacterium HTCC2255] (440 aa)
Score = 450, Expect = 1.1e-42, Identities = 113/374 (30%), Positives = 199/374 (53%)
  Q:    34 IENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK------VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNK--SDDIVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLES-GDLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASA-VKLNVKGYKYPHDYNFSY-VEQEYLPKELKNKEFYKPNKYS-----QNENKFVDYWNKIKSNN 407
           +EN  + S+L +G PG GK+   Q I K ++ N    ++ T+   D+ + + +       I+ ++E+HR NK +QD  L ++E   I  +  TTENP F  N A+ SR  +Y ++ +  A + +   + L N +      V + +  +  +  +S  D R+   YL++  +  Q+   S  +  + + +     +   D++  ++YD+LSAFHKS+RGS  + A+Y+ A+ L +  D + + RRL A+  EDIGLA+         A +    +G  E    ++Q  +   L+PKSN+   A   A ++  +    P PNHLR+A    A  + +  GY+Y H+ + +    Q YLP  L ++ FY+PN        + + +F+D  NK   +N
  S:    38 LENGHIHSMLLWGPPGTGKTTLAQIIAKHIDANLIVLSAVTSGVKDIRDAMAMTHPGVVTIVFVDEVHRFNKSQQDAFLPFIESGAITFIGATTENPSFSCNNALLSRCRVYVLQALTDADIIQICQQALANDEWLCACAVSIDDDALMTLASLSSGDARRALLYLELAAQLSQSADGSHRVTQQHVAQAAGQKVAQFDQQGDHYYDVLSAFHKSVRGSSSDGALYWFARYLTANSDPVPIMRRLLAIASEDIGLADPRALTLCLNAWDTYHRVGAVEGERAIAQACVYCALAPKSNALYNAFKAAKRAAQETCDMPVPNHLRNAPTELAKSQGHGDGYRYSHNEDHAVSAGQRYLPDNLSDQGFYQPNPRGLEQKLRQKQEFLDDLNKTAYHN 431
>gi|163849727|ref|YP_001637770.1| recombination factor protein RarA [Methylobacterium extorquens PA1] >gi|163661332|gb|ABY28699.1| AAA ATPase central domain protein [Methylobacterium extorquens PA1] (437 aa)
Score = 450, Expect = 1.2e-42, Identities = 114/393 (29%), Positives = 215/393 (54%)
  Q:    16 EMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNKP----IIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEA--LSPPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKF---VDYWNKIKSNNK 408
           E++ ++ +   D  +  ++ +  L S++F+G PG GK+   + +  +   +F   ++  +   DL ++ E A +        ++ ++EIHR N+ + D  L  +E   + ++  TTENP F++N A+  R+R+LL+R  +  +        + ++ + + L  +   A++ ++  D R      + V +  +     D   L+ L +    + D+    HY+L+SA HK++RGSDP+AA+YYL ++L++G D + + RRL  +  EDIGLA+       NAA +A + LG PE  + L+Q+T+ L  +PKSN+   A   A + V K A  L+PP  + +A      ++   +GY+Y HD   ++  Q+Y P+ L  + FY+P      E ++   + YW +++   +
  S:    29 EVVGQEHLTGPDGALTRLLASRSLGSLVFWGPPGTGKTTVARLLAHETALHFEQISAIFSGIADLRKVFEAARKRRATGQGTLLFVDEIHRFNRAQLDAFLPVMEDGTVTLVGATTENPSFELNAALLSRARVLLFRALDAPALARLLARAEEMDGQPLPLDEEARAALIRMADGDGRAALTLAEEVWRSARPGEILDAETLQSLVQRRAPIYDKAQEGHYNLISALHKTVRGSDPDAALYYLCRMLDAGEDRLFIARRLVRMAVEDIGLADPQALVVANAAKDAFDFLGSPEGELALAQVTVYLACAPKSNAVYNAYKAATR-VAKAAGSLAPPRTILNAPTGLMRRIGYGEGYRYDHDEPDAFSGQDYWPEALGRQHFYEPTDRGM-ETRYRERLAYWERLRQERR 434
>gi|194342496|gb|EDX23462.1| ATP/GTP binding protein [Streptomyces sp. Mg1] (451 aa)
Score = 449, Expect = 1.2e-42, Identities = 128/364 (35%), Positives = 198/364 (54%)
  Q:    41 SILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE-----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKK-----VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSD-DIVLKELGKITNS---LIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKE-ALSPPNHLRDAHYASAVKL-NVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNKYSQNENKFVDYWNKIK 404
           S++ +G PG+GK+     + +   K F   ++ T    ++  ++E A         + ++ ++EIHR +K +QD LL  +E   + ++A TTENP+F +   + SR LL  +E++    L   + + LE ++     V L       ++ I+  D R+    L+        K + +I L+ L +  +      DR    HYD+ SA  KSIRGSD +AA++YLA+++E+G D   + RRL     EDIGLA+    P   AA  A   +G PEA + LS  TI L L+PKSN+A  AI  A+  V    A + P HLRD HY  A KL +  GY YPHD       Q+Y P E+  K +Y+P +Y   E ++ D   K++
  S:    64 SVILWGPPGIGKTTLAYVVSQATQKRFVELSAITAGVKEVRAVIEGAKRAAGGYGKETVLFLDEIHRFSKAQQDSLLPAVENRWVTLIAATTENPYFSIISPLLSRSLLLTLESLTDEDLSALMRRALEEERGLGGAVTLPADAEAHLLRIAGGDARRALTALEAGAGSAIAKGEAEISLQTLEEAVDRAAVTYDRDGDQHYDVASALIKSIRGSDVDAALHYLARMIEAGEDPRFIARRLMISASEDIGLADPTALPIAVAAAQAVAMIGFPEAALTLSHATIALALAPKSNTATTAIGAALADVRAGLAGAVPTHLRDGHYKGAAKLGHAVGYVYPHDVPGGIAAQQYAPDEIHGKRYYEPTRYGA-EARYADVVEKVR 443
>gi|193215466|ref|YP_001996665.1| AAA ATPase central domain protein [Chloroherpeton thalassium ATCC 35110] >gi|193088943|gb|ACF14218.1| AAA ATPase central domain protein [Chloroherpeton thalassium ATCC 35110] (439 aa)
Score = 449, Expect = 1.4e-42, Identities = 123/376 (32%), Positives = 215/376 (57%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATEDNK----PIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKV-VEA---IVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI-----------DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNV---KGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK 388
           + DE+I +  +    S     + + D  S++ +G PGVGK+     + +     +   ++  +   ++  ++  A +++K      + I+EIHR NK +QD LL  +EK  + ++  TTENP F+V PA+ SR ++Y ++ + +  ++  V + LE+ ++ +   + +EA   +  ++  D R+    L+I +   +      VL     IT SL+           D++  +HYD++SAF KS+RGSDP+AA+++LA++L++G D   + RR+     EDIG A++       +   A E +G+PEARI L+Q    L    KSN++ + I++A+ +V K    S P HLR+A   + +  N    K YKYPHD+   +V + Y P+ L  K FYKP +
  S:    28 TLDEVIGQPHLTDSHSPFRQFLSSGDFPSMILWGPPGVGKTTLALLLSRNSGYEYMQISAIDSGVKEVRSVITQALQNHKRGKKTSLFIDEIHRFNKAQQDALLGAVEKGTLKLIGATTENPSFEVIPALLSRSVVYLLKPLENEDIRRVVNQALESDEILMQKTIQIEAWDFLFRLASGDARRALNTLEIAINAAEKSKKQPVL-----ITESLLEKTLQQQALRYDKKGDSHYDVISAFIKSLRGSDPDAALFWLAKMLDAGEDPKFIARRMIIFASEDIGNADTYALTLAVSVFRAVEIIGMPEARINLAQGVTYLASCKKSNASYLGIEKALDAVKKVPNASVPLHLRNA--PTQLMKNSGFGKEYKYPHDFQGHFVPENYFPENLAEKSFYKPTE 420
>gi|85706692|ref|ZP_01037784.1| ATPase, AAA family protein [Roseovarius sp. 217] >gi|85668750|gb|EAQ23619.1| ATPase, AAA family protein [Roseovarius sp. 217] (435 aa)
Score = 449, Expect = 1.5e-42, Identities = 119/389 (30%), Positives = 208/389 (53%)
  Q:    16 EMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELA----TEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSR---LLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKY-YQNKSDDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESG-DLISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALS-PPNHLRDAHYASAVKLNV-KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIK 404
           ++I +D +   ++ +  M+ +  L S++F+G PGVGK+   + +  + + +F   ++      +L ++ E A    T+    ++ ++EIHR NK +QD  L ++E   I+++  TTENP F++N A+ SR   L+L R+   +   L +   + L ++ + L     EA++E++  D R +   ++ V  +  + K D   L        +  D+    HY+L+SA HKS+RGSDP+AA+Y+LA++L  G D   + RR+  +  EDIGLA+         A    E +G PE  + L+Q    L L+PKSN+  MA   A++   K     PP H+ +A      +    +GY Y HD    +  Q Y P+ +K    Y+P    + +   K +DY+ K++
  S:    31 DVIGQDQVLGPEAPLGVMLASGSLSSLVFWGPPGVGKTTIARLLADETDLHFIQISAIFTGVPELRKVFEEAKHRRTQGRGTLLFVDEIHRFNKAQQDGFLPHMEDGTILLVGATTENPSFELNAALLSRAQVLVLTRLVLADLERLAQRAEQEL-SRALPLDGPAREALLEMADGDGRALLNLIEQVAAWKVEGKLDSSALATRLMKRAAKYDKSGDEHYNLISALHKSVRGSDPDAALYWLARMLTGGEDPRYLARRILRMAIEDIGLADPQAQSICLHAWETYERIGSPEGELALAQAVAYLALAPKSNAGYMAYKAALREAKKTGSEPPPKHILNAPTRLMKEQGYGEGYAYDHDAEDGFSGQNYFPETMKRPVLYQPVERGFERELKKRLDYFAKLR 431
>gi|32267139|ref|NP_861171.1| recombination factor protein RarA [Helicobacter hepaticus ATCC 51449] >gi|32263192|gb|AAP78237.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449] (411 aa)
Score = 449, Expect = 1.5e-42, Identities = 130/396 (32%), Positives = 208/396 (52%)
  Q:    13 SFDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILE-LATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKE---EVIKYLENKK---VKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKITNSLI---DRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKELKNKEFYKPNK--YSQNENKFVDYWNKIKSNNK 408
           S  + I ++ I    + +  M++++ +    F+G PG GK+   + I K+LNK F  FN+TT    +L + ++       +P+I I+E+HRLN  +Q++LL  +E    I+   +T NPF  +  AIRSR  ++ ++ ++   L++     + YL N+K   VKL+ +  E I+  S  D R +   L         K   I  + L  +    +      A  HY L+SA  KSIRGSD NA++YYLA+L+  G+    + RRL  +  EDIG AN        + + A   +G PE+RI LSQ  I L  SPKSN+A  AI++A+ SV +  + P P H+             + Y YPHD+   +VEQ YL    +  EF +     + +  N+++     I+  N+
  S:    12 SLQDFIGQEHIIAPHTPLFKMLQHHTIAHCFFYGPPGSGKTTLAKLIAKELNKPFANFNATTFKIEELRKFIKNYEGGLYQPLIFIDEVHRLNTLQQEVLLPIMESHTAIIFGASTYNPFHSLTNAIRSRSFIFELKPLSPIHLEQILQYALTYLHNQKHLKVKLAPQAQEFIISSSAGDARAMLNLLDAACDTLNEKECLITYQALQSLRPYTLHDGSSEAQTHYSLISAMIKSIRGSDANASIYYLARLIAGGENPEFIARRLVILASEDIGNANPNALNLATSTMVAVSKIGYPESRIILSQCVIYLACSPKSNTAYNAINKALDSVKQGCILPIPKHIMP---------EAQKYLYPHDFG-GWVEQNYLEDAKEPLEFVESTTKGFEKTLNEWLSKIKNIREKNE 411
>gi|109947662|ref|YP_664890.1| recombination factor protein RarA [Helicobacter acinonychis str. Sheeba] >gi|109714883|emb|CAJ99891.1| conserved hypothetical helicase-like protein [Helicobacter acinonychis str. Sheeba] (393 aa)
Score = 449, Expect = 1.5e-42, Identities = 132/365 (36%), Positives = 203/365 (55%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDL-LEILELATEDNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAIRSRLLLYRIENINSAVLKEEVIKYLE--NKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKSDDIVLKELGKI-TNSLIDRRATN--HYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDLIS-VYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNKEALSP-PNHLRDAHYASAVKLNVKGYKYPHDYNFSYVEQEYLPKEL 378
            ++ + ++ +  KD+ +   +++       F+G PGVGK++  Q I   L +    FN+T    +DL L++        KPI+ I+E HRLNK +Q+ LL  +EKD  ++L  +T++P + ++ AIRSR  ++ +  +N + L +   K L   NK+++ S K    ++  S  D R +   L +  K      D I L+ L  +  +SL D   ++  HY+L SA  KS+RGSD NA++YYLA+L+  G+    + RRL     EDIG AN        + + + + +G PEARI LSQ  I L  SPKSN+A  AI++A++ V K  L P P HL           + K Y YPHDYN  YV+Q+YL K L
  S:    12 LEDFLGQEHLIGKDTPLFKALQSKHFPHAFFYGPPGVGKTSLAQIIAHSLERPILSFNATDFKLDDLRLKLKNYQHALLKPIVFIDETHRLNKTQQEFLLPIMEKDHALILGASTQDPNYSLSHAIRSRSFIFELTPLNESDLDKLCSKALTLLNKQIEPSAKTY--LLNNSTGDARALLNLLDLSAKI----EDPITLETLKSLRPHSLNDGSYSDDTHYNLTSALIKSLRGSDENASLYYLARLIAGGENPEFIARRLVIFASEDIGNANPNALNLAASCLFSVKQIGYPEARIILSQCVIYLACSPKSNTAYKAINQALECVQKGLLYPIPKHLLP---------DSKDYLYPHDYN-GYVKQDYLEKPL 368
>gi|154248687|ref|YP_001419645.1| recombination factor protein RarA [Xanthobacter autotrophicus Py2] >gi|154162772|gb|ABS69988.1| AAA ATPase central domain protein [Xanthobacter autotrophicus Py2] (436 aa)
Score = 448, Expect = 1.6e-42, Identities = 112/392 (28%), Positives = 211/392 (53%)
  Q:    14 FDEMICKDVIFPKDSIIINMIENNDLFSILFFGNPGVGKSASIQFILKKLNKNFYYFNSTTNNKNDLLEILELATE----DNKPIIIIEEIHRLNKDKQDLLLMYLEKDMIIVLATTTENPFFKVNPAI--RSRLLLYRIENINSAVLKEEVIKYLENKKVKLSNKVVEAIVEISKSDFRQIFFYLKIVLKYYQNKS--DDIVLKELGKITNSLIDRRATNHYDLLSAFHKSIRGSDPNAAVYYLAQLLESGDL-ISVYRRLYAVVYEDIGLANSGLGPKVNAAVNASEALGLPEARIPLSQITIELCLSPKSNSAIMAIDEAIQSVNK-EALSPPNHLRDAHYASAVKLNV-----KGYKYPHDYNFSYVEQEYLPKELKNKEFYKP--NKYSQNENKFVDYWNKIKS 405
             E++ +D +   D ++  M+E   L S++ +G PG GK+   + +    + +F   ++  +   DL ++ E A          ++ ++EIHR N+ +QD  L  +E   + ++  TTENP F++N A+  R+R+L+++  + ++        + +E K + L+     A++ ++  D R      + V +  +     D   L ++ +    + D+    HY+L+SA HK++RGSDP+AA+YY A++L++G+  + + RR+  +  EDIG A+       NAA +A + LG PE  + L+Q  + +  +PKSN+   A   A ++  +  +L PP H+ +A      KL        GY+Y HD   ++  Q Y P+ L  + FY P    + +   K +DYW ++++
  S:    27 LSEVVGQDHLVGPDGVLTRMLETRSLGSLILWGPPGTGKTTVARLLASATDLHFEQISAIFSGVADLKKVFEQARARRLVGKATLLFVDEIHRFNRAQQDSFLPVMEDGTVTLVGATTENPSFELNAALLSRARVLVFKSLDADAIARLLTRAEEVEGKALPLTEDARFALLNMADGDGRASLTLAEEVWRAARPGEVFDVAALADVVQRRAPIYDKSEDGHYNLISALHKAVRGSDPDAALYYFARMLDAGEAPLFLARRIVRMAVEDIGNADPQALVVCNAAKDAFDFLGSPEGELALAQAVVYVATAPKSNAVYKAFSAAKRAAKEGGSLMPPKHILNA----PTKLMKGEGYGAGYRYDHDQPDAFSGQNYFPEALGRQSFYHPVERGFEREIRKRMDYWARLRA 431