>gi|26553597|ref|NP_757531.1| hypothetical protein MYPE1440 [Mycoplasma penetrans HF-2] >gi|26453603|dbj|BAC43935.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (159 aa)
Score = 592, Expect = 5.7e-60, Identities = 159/159 (100%), Positives = 159/159 (100%)
  Q:     1 MNMNNLASVFIEKSILGTSVQILQIGVVFIKDNKFKYFYKYIKNDIKNSNSAIDWQDAVKLLDKIISDKKIILKNDDNNDFKILNNSYKKFLNKDFNNFFYDIAKNSEYLGYKKFNIDYLSSVYDVKFKNTKGLPTSVFKAQKIFAIGSKMFKLGLKNV 159
           MNMNNLASVFIEKSILGTSVQILQIGVVFIKDNKFKYFYKYIKNDIKNSNSAIDWQDAVKLLDKIISDKKIILKNDDNNDFKILNNSYKKFLNKDFNNFFYDIAKNSEYLGYKKFNIDYLSSVYDVKFKNTKGLPTSVFKAQKIFAIGSKMFKLGLKNV
  S:     1 MNMNNLASVFIEKSILGTSVQILQIGVVFIKDNKFKYFYKYIKNDIKNSNSAIDWQDAVKLLDKIISDKKIILKNDDNNDFKILNNSYKKFLNKDFNNFFYDIAKNSEYLGYKKFNIDYLSSVYDVKFKNTKGLPTSVFKAQKIFAIGSKMFKLGLKNV 159