>gi|26553598|ref|NP_757532.1| peptidyl-tRNA hydrolase [Mycoplasma penetrans HF-2] >gi|46576820|sp|Q8EWQ8|PTH_MYCPE Peptidyl-tRNA hydrolase (PTH) >gi|26453604|dbj|BAC43936.1| peptidyl-tRNA hydrolase [Mycoplasma penetrans HF-2] (187 aa)
Score = 911, Expect = 9.9e-97, Identities = 187/187 (100%), Positives = 187/187 (100%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV
  S:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
>gi|56418581|ref|YP_145899.1| peptidyl-tRNA hydrolase [Geobacillus kaustophilus HTA426] >gi|68052880|sp|Q5L3U7|PTH_GEOKA Peptidyl-tRNA hydrolase (PTH) >gi|56378423|dbj|BAD74331.1| stage V sporulation protein C (peptidyl-tRNA hydrolase) [Geobacillus kaustophilus HTA426] (186 aa)
Score = 443, Expect = 1.5e-42, Identities = 87/182 (47%), Positives = 122/182 (67%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L VGLGNPG EYE+T+HNVGF  IDEL K   + L  +KF G F       +++ + KP+TYMN SGE V  +  +Y I   +++VIYDD+D   GKIR++ KGSSGG NG+KS+I  + TE+ KRIRIGIG+P     +T +VL +F+ E+   V +A+++A DAC + +    F ++MN FN
  S:     3 LFVGLGNPGKEYEQTRHNVGFFVIDELAKRWNVSLKTAKFRGLFGTASVSGEKVALCKPLTYMNLSGECVRPLMDYYDIAIDDVIVIYDDLDLPPGKIRLRLKGSSGGHNGVKSLIHHLGTEQFKRIRIGIGRPAGGQPVTDYVLGRFTEEEKPAVDKAVLRAADACEQAVK-APFIQVMNDFN 185
>gi|13357634|ref|NP_077908.1| peptidyl-tRNA hydrolase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167971017|ref|ZP_02553294.1| peptidyl-tRNA hydrolase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168282151|ref|ZP_02689818.1| peptidyl-tRNA hydrolase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308309|ref|ZP_02690984.1| peptidyl-tRNA hydrolase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762127|ref|YP_001752157.1| peptidyl-tRNA hydrolase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|189038172|sp|B1AI63|PTH_UREP2 Peptidyl-tRNA hydrolase (PTH) >gi|14195087|sp|Q9PR67|PTH_UREPA Peptidyl-tRNA hydrolase (PTH) >gi|11279559|pir||B82937 peptidyl-tRNA hydrolase UU078 [imported] - Ureaplasma urealyticum >gi|6899029|gb|AAF30483.1|AE002107_7 peptidyl-tRNA hydrolase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827704|gb|ACA32966.1| peptidyl-tRNA hydrolase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902841|gb|EDT49130.1| peptidyl-tRNA hydrolase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675955|gb|EDT87860.1| peptidyl-tRNA hydrolase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700816|gb|EDU19098.1| peptidyl-tRNA hydrolase [Ureaplasma parvum serovar 6 str. ATCC 27818] (186 aa)
Score = 439, Expect = 5.2e-42, Identities = 97/186 (52%), Positives = 130/186 (69%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           M KYL+VGLGNPG  Y KT+HNVGFM I+E+  +  L L++SKFNG F K       +F  +P TYMN SGEFV ++  FY I  +N++VIYDD+DT +G I+++ KGSSGGQNGIK+II+ + T++IKRIRIGI K  H  L  +VL+ F  ++ + ++ AIIK   A    +   DFDK+MNKFN
  S:     1 MEKYLIVGLGNPGSNYAKTRHNVGFMVINEICNKLNLSLDSSKFNGIFTKTIYNNSIVFFCQPTTYMNLSGEFVIKMLNFYNIPIKNLIVIYDDVDTKLGTIKLRKKGSSGGQNGIKNIINILKTDEIKRIRIGIDKDPHIKLDQYVLSNFKIDELVIIKPAIIKGALATLAAIGE-DFDKVMNKFN 186
>gi|163938059|ref|YP_001642943.1| peptidyl-tRNA hydrolase [Bacillus weihenstephanensis KBAB4] >gi|163860256|gb|ABY41315.1| Aminoacyl-tRNA hydrolase [Bacillus weihenstephanensis KBAB4] (207 aa)
Score = 436, Expect = 1.2e-41, Identities = 87/182 (47%), Positives = 126/182 (69%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG EYE T+HN+GFM IDEL K  ++ LN  KF G F       +++ + KP+TYMN SGE +  +  +YKI  ++ +V+YDD+D  VGK+R++ KGS+GG NG+KS IS + T++ +RIR+GI +P + +    +VL +F++E+   V Q+I  A DAC E+LN   F +IMN FN
  S:    24 LIVGLGNPGREYELTRHNIGFMAIDELAKRWSISLNEQKFKGVFGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYKIDVEDFIVMYDDLDIPVGKLRLRMKGSAGGHNGVKSTISHLGTQEFQRIRMGIDRPKNGMKVVDYVLGRFTSEEISGVNQSIENAADACEEWLNK-PFLQIMNTFN 206
>gi|65317511|ref|ZP_00390470.1| COG0193: Peptidyl-tRNA hydrolase [Bacillus anthracis str. A2012] >gi|165872550|ref|ZP_02217182.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. A0488] >gi|167635053|ref|ZP_02393370.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. A0442] >gi|167641506|ref|ZP_02399754.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. A0193] >gi|170688886|ref|ZP_02880088.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. A0465] >gi|170707529|ref|ZP_02897982.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. A0389] >gi|177655322|ref|ZP_02936851.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. A0174] >gi|190568956|ref|ZP_03021857.1| peptidyl-tRNA hydrolase [Bacillus anthracis Tsiankovskii-I] >gi|196036361|ref|ZP_03103758.1| peptidyl-tRNA hydrolase [Bacillus cereus W] >gi|196041774|ref|ZP_03109064.1| peptidyl-tRNA hydrolase [Bacillus cereus NVH0597-99] >gi|196047390|ref|ZP_03114603.1| peptidyl-tRNA hydrolase [Bacillus cereus 03BB108] >gi|164711678|gb|EDR17223.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. A0488] >gi|167510491|gb|EDR85889.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. A0193] >gi|167529527|gb|EDR92277.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. A0442] >gi|170127525|gb|EDS96399.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. A0389] >gi|170667110|gb|EDT17871.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. A0465] >gi|172080163|gb|EDT65256.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. A0174] >gi|190559880|gb|EDV13864.1| peptidyl-tRNA hydrolase [Bacillus anthracis Tsiankovskii-I] >gi|195990991|gb|EDX54962.1| peptidyl-tRNA hydrolase [Bacillus cereus W] >gi|196021792|gb|EDX60486.1| peptidyl-tRNA hydrolase [Bacillus cereus 03BB108] >gi|196027394|gb|EDX66011.1| peptidyl-tRNA hydrolase [Bacillus cereus NVH0597-99] (207 aa)
Score = 433, Expect = 2.3e-41, Identities = 87/182 (47%), Positives = 125/182 (68%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG EYE T+HN+GFM IDEL K   + LN  KF G F       +++ + KP+TYMN SGE +  +  +YKI  ++ +V+YDD+D  VGK+R++ KGS+GG NG+KS IS + T++ +RIR+GI +P + +    +VL +F++E+   V  +I KA DAC E+LN   F +IMN FN
  S:    24 LIVGLGNPGREYELTRHNIGFMAIDELAKRWNISLNEQKFKGLFGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYKIDVEDFVVLYDDLDIPVGKLRLRMKGSAGGHNGVKSTISHLGTQEFQRIRMGIDRPKNGMKVVDYVLGRFTSEEIPDVNHSIEKAADACEEWLNK-PFLQIMNTFN 206
>gi|42779130|ref|NP_976377.1| peptidyl-tRNA hydrolase [Bacillus cereus ATCC 10987] >gi|42735045|gb|AAS38985.1| peptidyl-tRNA hydrolase [Bacillus cereus ATCC 10987] (210 aa)
Score = 433, Expect = 2.7e-41, Identities = 87/182 (47%), Positives = 125/182 (68%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG EYE T+HN+GFM IDEL K   + LN  KF G F       +++ + KP+TYMN SGE +  +  +YKI  ++ +V+YDD+D  VGK+R++ KGS+GG NG+KS IS + T++ +RIR+GI +P + +    +VL +F++E+   V  +I KA DAC E+LN   F +IMN FN
  S:    27 LIVGLGNPGREYELTRHNIGFMAIDELAKRWNISLNEQKFKGVFGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYKIDVEDFVVLYDDLDIPVGKLRLRMKGSAGGHNGVKSTISHLGTQEFQRIRMGIDRPKNGMKVVDYVLGRFTSEEIPGVNHSIEKAADACEEWLNK-PFLQIMNTFN 209
>gi|152973899|ref|YP_001373416.1| peptidyl-tRNA hydrolase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189038278|sp|A7GJW3|PTH_BACCN Peptidyl-tRNA hydrolase (PTH) >gi|152022651|gb|ABS20421.1| Aminoacyl-tRNA hydrolase [Bacillus cereus subsp. cytotoxis NVH 391-98] (186 aa)
Score = 431, Expect = 3.7e-41, Identities = 85/182 (46%), Positives = 126/182 (69%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG EYE T+HN+GFM IDEL K   + LN  KF G F       +++ + KP+TYMN SGE +  +  +YKI  ++ +++YDD+D  VGK+R++ KGS+GG NG+KS I+ + T++ +RIR+GI +P + +    +VL +F+AE+ + V  AI KA +AC E+LN   F ++MN FN
  S:     3 LIVGLGNPGREYELTRHNIGFMAIDELAKRWNISLNEQKFKGMFGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYKIDLEDFIIMYDDLDLPVGKLRLRMKGSAGGHNGVKSTIAHLGTQEFQRIRMGIDRPKNGMKVVDYVLGRFTAEEMVDVNHAIEKAANACEEWLNK-SFLQVMNDFN 185
>gi|30018322|ref|NP_829953.1| peptidyl-tRNA hydrolase [Bacillus cereus ATCC 14579] >gi|75759613|ref|ZP_00739699.1| Peptidyl-tRNA hydrolase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|168138206|ref|ZP_02581435.1| peptidyl-tRNA hydrolase [Bacillus cereus B4264] >gi|29893862|gb|AAP07154.1| Peptidyl-tRNA hydrolase [Bacillus cereus ATCC 14579] >gi|74492904|gb|EAO56034.1| Peptidyl-tRNA hydrolase [Bacillus thuringiensis serovar israelensis ATCC 35646] (210 aa)
Score = 431, Expect = 4.2e-41, Identities = 87/182 (47%), Positives = 125/182 (68%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG EYE T+HN+GFM IDEL K   + LN  KF G F       +++ + KP+TYMN SGE +  +  +YKI  ++ +V+YDD+D  VGK+R++ KGS+GG NG+KS IS + T++ +RIR+GI +P + +    +VL +F++E+   V  +I KA DAC E+LN   F +IMN FN
  S:    27 LIVGLGNPGREYELTRHNIGFMAIDELAKRWNISLNEQKFKGVFGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYKIDVEDFVVMYDDLDIPVGKLRLRMKGSAGGHNGVKSTISHLGTQEFQRIRMGIDRPKNGMKVVDYVLGRFTSEEIPDVNHSIEKAADACEEWLNK-PFLQIMNTFN 209
>gi|30260242|ref|NP_842619.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. Ames] >gi|47525304|ref|YP_016653.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183085|ref|YP_026337.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. Sterne] >gi|49481760|ref|YP_034404.1| peptidyl-tRNA hydrolase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|38372419|sp|Q81VY9|PTH_BACAN Peptidyl-tRNA hydrolase (PTH) >gi|68052958|sp|Q6HPW6|PTH_BACHK Peptidyl-tRNA hydrolase (PTH) >gi|30253563|gb|AAP24105.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. Ames] >gi|47500452|gb|AAT29128.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49177012|gb|AAT52388.1| peptidyl-tRNA hydrolase [Bacillus anthracis str. Sterne] >gi|49333316|gb|AAT63962.1| aminoacyl-tRNA hydrolase (peptidyl-tRNA hydrolase);stage V sporulation protein C [Bacillus thuringiensis serovar konkukian str. 97-27] (186 aa)
Score = 430, Expect = 5.5e-41, Identities = 87/182 (47%), Positives = 125/182 (68%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG EYE T+HN+GFM IDEL K   + LN  KF G F       +++ + KP+TYMN SGE +  +  +YKI  ++ +V+YDD+D  VGK+R++ KGS+GG NG+KS IS + T++ +RIR+GI +P + +    +VL +F++E+   V  +I KA DAC E+LN   F +IMN FN
  S:     3 LIVGLGNPGREYELTRHNIGFMAIDELAKRWNISLNEQKFKGLFGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYKIDVEDFVVLYDDLDIPVGKLRLRMKGSAGGHNGVKSTISHLGTQEFQRIRMGIDRPKNGMKVVDYVLGRFTSEEIPDVNHSIEKAADACEEWLNK-PFLQIMNTFN 185
>gi|47569900|ref|ZP_00240567.1| peptidyl-tRNA hydrolase [Bacillus cereus G9241] >gi|52145164|ref|YP_081663.1| peptidyl-tRNA hydrolase [Bacillus cereus E33L] >gi|68052912|sp|Q63HI2|PTH_BACCZ Peptidyl-tRNA hydrolase (PTH) >gi|47553434|gb|EAL11818.1| peptidyl-tRNA hydrolase [Bacillus cereus G9241] >gi|51978633|gb|AAU20183.1| aminoacyl-tRNA hydrolase (peptidyl-tRNA hydrolase);stage V sporulation protein C [Bacillus cereus E33L] (186 aa)
Score = 430, Expect = 5.8e-41, Identities = 87/182 (47%), Positives = 125/182 (68%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG EYE T+HN+GFM IDEL K   + LN  KF G F       +++ + KP+TYMN SGE +  +  +YKI  ++ +V+YDD+D  VGK+R++ KGS+GG NG+KS IS + T++ +RIR+GI +P + +    +VL +F++E+   V  +I KA DAC E+LN   F +IMN FN
  S:     3 LIVGLGNPGREYELTRHNIGFMAIDELAKRWNISLNEQKFKGVFGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYKIDVEDFVVLYDDLDIPVGKLRLRMKGSAGGHNGVKSTISHLGTQEFQRIRMGIDRPKNGMKVVDYVLGRFTSEEIPDVNHSIEKAADACEEWLNK-PFLQIMNTFN 185
>gi|68052974|sp|Q73FF7|PTH_BACC1 Peptidyl-tRNA hydrolase (PTH) (186 aa)
Score = 429, Expect = 7.1e-41, Identities = 87/182 (47%), Positives = 125/182 (68%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG EYE T+HN+GFM IDEL K   + LN  KF G F       +++ + KP+TYMN SGE +  +  +YKI  ++ +V+YDD+D  VGK+R++ KGS+GG NG+KS IS + T++ +RIR+GI +P + +    +VL +F++E+   V  +I KA DAC E+LN   F +IMN FN
  S:     3 LIVGLGNPGREYELTRHNIGFMAIDELAKRWNISLNEQKFKGVFGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYKIDVEDFVVLYDDLDIPVGKLRLRMKGSAGGHNGVKSTISHLGTQEFQRIRMGIDRPKNGMKVVDYVLGRFTSEEIPGVNHSIEKAADACEEWLNK-PFLQIMNTFN 185
>gi|38372414|sp|Q81J96|PTH_BACCR Peptidyl-tRNA hydrolase (PTH) (186 aa)
Score = 429, Expect = 7.3e-41, Identities = 87/182 (47%), Positives = 125/182 (68%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG EYE T+HN+GFM IDEL K   + LN  KF G F       +++ + KP+TYMN SGE +  +  +YKI  ++ +V+YDD+D  VGK+R++ KGS+GG NG+KS IS + T++ +RIR+GI +P + +    +VL +F++E+   V  +I KA DAC E+LN   F +IMN FN
  S:     3 LIVGLGNPGREYELTRHNIGFMAIDELAKRWNISLNEQKFKGVFGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYKIDVEDFVVMYDDLDIPVGKLRLRMKGSAGGHNGVKSTISHLGTQEFQRIRMGIDRPKNGMKVVDYVLGRFTSEEIPDVNHSIEKAADACEEWLNK-PFLQIMNTFN 185
>gi|167036598|ref|YP_001664176.1| peptidyl-tRNA hydrolase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855432|gb|ABY93840.1| Aminoacyl-tRNA hydrolase [Thermoanaerobacter pseudethanolicus ATCC 33223] (184 aa)
Score = 414, Expect = 3.5e-39, Identities = 87/183 (47%), Positives = 123/183 (67%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           Y++ GLGNPG EYE T+HNVGFM IDEL K+  + +   KF     + +   ++I + KP T++N+SGE +Y+   FYKI  +N++VIYDD D DVGKIR++ KGSSGG NG+ SII  +N+E+  R+RIGIGKP  +L  HVL KF   +   + +A+IKA DA  + + +   +  M+KFN
  S:     2 YVIAGLGNPGREYEGTRHNVGFMVIDELAKKLGMNVTKLKFKSLVGEGNFKGEKIILLKPQTFVNSSGEALYDAVNFYKIPLENVIVIYDDKDLDVGKIRIRKKGSSGGHNGMNSIIYLLNSEEFPRVRIGIGKPQKDLVSHVLGKFEESEKKLIDEAVIKAADAVIDIIEN-GIEHAMSKFN 183
>gi|15671994|ref|NP_266168.1| peptidyl-tRNA hydrolase [Lactococcus lactis subsp. lactis Il1403] >gi|13878665|sp|Q9CJI1|PTH_LACLA Peptidyl-tRNA hydrolase (PTH) >gi|12722848|gb|AAK04110.1|AE006240_8 peptidyl-tRNA hydrolase (EC 3.1.1.29) [Lactococcus lactis subsp. lactis Il1403] (188 aa)
Score = 410, Expect = 1.1e-38, Identities = 85/182 (46%), Positives = 122/182 (67%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGNPG +YEKTKHN+GFM +D L KE  + F     F           +++F+ KP+T+MN SG  V  + K+Y I E ++ V++DD+D+ VG++R++ KGSSGGQNGIKS+I+ + ++   R++IGIG+P H +T  +HVL+ F  ED    Q  I KA DA   +L + DF K MNKFN
  S:     4 MIVGLGNPGDKYEKTKHNMGFMALDLLAKELNVDFKEEKPFMSLVASTFVNGEKLFLVKPLTFMNESGRSVAPLLKYYNIDEADLTVMHDDLDSPVGRVRLRQKGSSGGQNGIKSVITHVGSQTFNRVKIGIGRPKHGMTVGNHVLSGFDNEDKEIAQDGIFKAVDAMKFYLENGDFQKTMNKFN 188
>gi|16077121|ref|NP_387934.1| peptidyl-tRNA hydrolase [Bacillus subtilis subsp. subtilis str. 168] >gi|586021|sp|P37470|PTH_BACSU Peptidyl-tRNA hydrolase (PTH) (Stage V sporulation protein C) >gi|467442|dbj|BAA05288.1| stage V sporulation [Bacillus subtilis] >gi|2632320|emb|CAB11829.1| peptidyl-tRNA hydrolase [Bacillus subtilis subsp. subtilis str. 168] (188 aa)
Score = 408, Expect = 1.8e-38, Identities = 81/182 (44%), Positives = 123/182 (67%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++ GLGNPG  YE T+HNVGFM ID+L KE  + LN +KFNG +        ++ + KP+TYMN SGE +  +  +Y +  +++ VIYDD+D   GKIR++ KGS+GG NGIKS+I  + T +  RIRIGIG+PV+ +    +VL  F+ E++ ++++A+ K+  AC   L+   F ++MN+FN
  S:     3 VIAGLGNPGKNYENTRHNVGFMVIDQLAKEWNIELNQNKFNGLYGTGFVSGKKVLLVKPLTYMNLSGECLRPLMDYYDVDNEDLTVIYDDLDLPTGKIRLRTKGSAGGHNGIKSLIQHLGTSEFDRIRIGIGRPVNGMKVVDYVLGSFTKEEAPEIEEAVDKSVKACEASLSK-PFLEVMNEFN 185
>gi|116510853|ref|YP_808069.1| peptidyl-tRNA hydrolase [Lactococcus lactis subsp. cremoris SK11] >gi|123126037|sp|Q033H5|PTH_LACLS Peptidyl-tRNA hydrolase (PTH) >gi|116106507|gb|ABJ71647.1| peptidyl-tRNA hydrolase [Lactococcus lactis subsp. cremoris SK11] (188 aa)
Score = 406, Expect = 3.6e-38, Identities = 84/182 (46%), Positives = 121/182 (66%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGNPG +YEKTKHN+GFM +D L  E  + F     F           +++F+ KP+T+MN SG  V  + K+Y I E ++ V++DD+D+ VG++R++ KGSSGGQNGIKS+I+ + ++   R++IGIG+P H +T  +HVL+ F  ED    Q  I KA DA   +L + DF K MNKFN
  S:     4 MIVGLGNPGDKYEKTKHNMGFMALDLLANELNVDFKEEKPFMSLVASTFVNGEKLFLVKPLTFMNESGRAVAPLLKYYNIDEADLTVMHDDLDSPVGRVRLRQKGSSGGQNGIKSVITHVGSQTFNRVKIGIGRPKHGMTVVNHVLSGFDNEDKEIAQDGIFKAVDAMKFYLENGDFQKTMNKFN 188
>gi|150014977|ref|YP_001307231.1| peptidyl-tRNA hydrolase [Clostridium beijerinckii NCIMB 8052] >gi|189038283|sp|A6LPJ5|PTH_CLOB8 Peptidyl-tRNA hydrolase (PTH) >gi|149901442|gb|ABR32275.1| Aminoacyl-tRNA hydrolase [Clostridium beijerinckii NCIMB 8052] (191 aa)
Score = 404, Expect = 5.7e-38, Identities = 83/183 (45%), Positives = 122/183 (66%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +L+VGLGNPG EYE T+HN+GF  ID + KE+ + +N  KF G + +      ++ + KP TYMN SGE V E+  FY ++   ILVIYDDI  +VGK+R++ KGS+GG NGIKSII+ +N+E   RI++G+G+P  +L  HVL KF+ E++  + ++I  +  A  E + + D    MN+FN
  S:     2 FLIVGLGNPGNEYENTRHNIGFKVIDNIAKEYNIEINRQKFKGMYGEGFINGKKVMLLKPTTYMNLSGESVREVVDFYNLNNDEILVIYDDISLEVGKLRIREKGSAGGHNGIKSIIAHLNSEIFSRIKVGVGQPNGDLVKHVLGKFTKEETAILSESIEASTKAAAEIIKN-DVKTAMNQFN 183
>gi|52078548|ref|YP_077339.1| peptidyl-tRNA hydrolase [Bacillus licheniformis ATCC 14580] >gi|52783910|ref|YP_089739.1| peptidyl-tRNA hydrolase [Bacillus licheniformis ATCC 14580] >gi|68052915|sp|Q65PG8|PTH_BACLD Peptidyl-tRNA hydrolase (PTH) >gi|52001759|gb|AAU21701.1| peptidyl-tRNA hydrolase [Bacillus licheniformis ATCC 14580] >gi|52346412|gb|AAU39046.1| SpoVC [Bacillus licheniformis DSM 13] (188 aa)
Score = 403, Expect = 7.1e-38, Identities = 82/179 (45%), Positives = 118/179 (65%)
  Q:     8 GLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           GLGNPG  YE T+HNVGFM IDEL KE  + L+ +KFNGQ+        ++ + KP+TYMN SGE +  +  +Y+I   N+ VIYDD+D   G+IR++ KGS+GG NGIKS I  + T +  RIRIGIG+PV+ +    +VL  F+ E+   +++A+ ++  AC   L    F ++MN+FN
  S:     6 GLGNPGKTYENTRHNVGFMTIDELSKEWNIPLDKTKFNGQYGIGFVSGKKVLLVKPLTYMNLSGECLRPLLDYYEIPVDNLKVIYDDLDLPTGRIRLRTKGSAGGHNGIKSTIQHLGTSEFNRIRIGIGRPVNGMKVVDYVLGAFTDEEEPAIKEAVRQSAKACEASLEK-PFLEVMNEFN 185
>gi|15899954|ref|NP_344558.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae TIGR4] >gi|111658625|ref|ZP_01409275.1| hypothetical protein SpneT_02000215 [Streptococcus pneumoniae TIGR4] >gi|148984549|ref|ZP_01817837.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae SP3-BS71] >gi|148993580|ref|ZP_01823051.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae SP9-BS68] >gi|148997953|ref|ZP_01825466.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae SP11-BS70] >gi|168487225|ref|ZP_02711733.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae CDC1087-00] >gi|168489340|ref|ZP_02713539.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae SP195] >gi|168576115|ref|ZP_02722020.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae MLV-016] >gi|169833645|ref|YP_001693439.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae Hungary19A-6] >gi|194397946|ref|YP_002036726.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae G54] >gi|21263855|sp|Q97TD1|PTH_STRPN Peptidyl-tRNA hydrolase (PTH) >gi|14971469|gb|AAK74198.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae TIGR4] >gi|147755963|gb|EDK63006.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae SP11-BS70] >gi|147923326|gb|EDK74440.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae SP3-BS71] >gi|147927801|gb|EDK78823.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae SP9-BS68] >gi|168996147|gb|ACA36759.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae Hungary19A-6] >gi|183569906|gb|EDT90434.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae CDC1087-00] >gi|183572322|gb|EDT92850.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae SP195] >gi|183578086|gb|EDT98614.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae MLV-016] >gi|194357613|gb|ACF56061.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae G54] (189 aa)
Score = 402, Expect = 8.4e-38, Identities = 81/182 (44%), Positives = 126/182 (69%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y +TKHNVGFM ID+L K+  + F ++  F           ++I++ KP T+MN SG+ V+ +  +Y +   ++L+IYDD+D +VGKIR++AKGS+GG NGIKSII  + T+   R++IGIG+P + ++  HHVL+KF  +D I + Q++ K  D+ N +L   +F+K M ++N
  S:     4 LLVGLGNPGDKYFETKHNVGFMLIDQLAKKQNVTFTHDKIFQADLASFFLNGEKIYLVKPTTFMNESGKAVHALLTYYGLDIDDLLIIYDDLDMEVGKIRLRAKGSAGGHNGIKSIIQHIGTQVFNRVKIGIGRPKNGMSVVHHVLSKFDRDDYIGILQSVDKVDDSVNYYLQEKNFEKTMQRYN 188
>gi|15902049|ref|NP_357599.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae R6] >gi|116515731|ref|YP_815426.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae D39] >gi|168484303|ref|ZP_02709255.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae CDC1873-00] >gi|168491775|ref|ZP_02715918.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae CDC0288-04] >gi|122279574|sp|Q04N59|PTH_STRP2 Peptidyl-tRNA hydrolase (PTH) >gi|46576814|sp|Q8DRQ2|PTH_STRR6 Peptidyl-tRNA hydrolase (PTH) >gi|15457533|gb|AAK98809.1| Peptidyl-tRNA hydrolase [Streptococcus pneumoniae R6] >gi|116076307|gb|ABJ54027.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae D39] >gi|172042402|gb|EDT50448.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae CDC1873-00] >gi|183573988|gb|EDT94516.1| peptidyl-tRNA hydrolase [Streptococcus pneumoniae CDC0288-04] (189 aa)
Score = 402, Expect = 1.0e-37, Identities = 82/182 (45%), Positives = 125/182 (68%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y +TKHNVGFM ID+L K+  + F ++  F           ++I++ KP T+MN SG+ V+ +  +Y +   ++L+IYDD+D +VGKIR++AKGS+GG NGIKSII  + T+   R++IGIG+P + ++  HHVL+KF  +D I + Q+I K  D+ N +L    F+K M ++N
  S:     4 LLVGLGNPGDKYFETKHNVGFMLIDQLAKKQNVTFTHDKIFQADLASFFLNGEKIYLVKPTTFMNESGKAVHALLTYYGLDIDDLLIIYDDLDMEVGKIRLRAKGSAGGHNGIKSIIQHIGTQVFNRVKIGIGRPKNGMSVVHHVLSKFDRDDYIGILQSIDKVDDSVNYYLQEKKFEKTMQRYN 188
>gi|16799322|ref|NP_469590.1| peptidyl-tRNA hydrolase [Listeria innocua Clip11262] >gi|21263851|sp|Q92F62|PTH_LISIN Peptidyl-tRNA hydrolase (PTH) >gi|16412674|emb|CAC95478.1| pth [Listeria innocua] (184 aa)
Score = 399, Expect = 2.1e-37, Identities = 77/182 (42%), Positives = 120/182 (65%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+ GLGNPG +YE+T+HNVGFM +DEL   H      SKFNG   +++   +++ + KP+T+MN SGE +  +  +Y I  +++L++YDD+D  VGKIR++ KGS+GG NG+KSII  + T++  RIR+G+ +P+   + H+VL  F   +   +  AI K+ DA  +F     F ++MNK+N
  S:     3 LIAGLGNPGKKYERTRHNVGFMVVDELSFRHQTPWKKSKFNGMVSEINVGGEKMILVKPLTFMNASGECIRPLMDYYNIQIEDVLIVYDDLDLPVGKIRLRQKGSAGGHNGMKSIIQHVKTQEFNRIRVGVSRPLKGEVIHYVLGDFPKAEQPDIIAAIQKSADAIEDFA-QTPFIEVMNKYN 184
>gi|28209961|ref|NP_780905.1| peptidyl-tRNA hydrolase [Clostridium tetani E88] >gi|46576800|sp|Q899I4|PTH_CLOTE Peptidyl-tRNA hydrolase (PTH) >gi|28202396|gb|AAO34842.1| peptidyl-tRNA hydrolase [Clostridium tetani E88] (188 aa)
Score = 396, Expect = 4.2e-37, Identities = 78/183 (42%), Positives = 120/183 (65%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +L+VGLGNPG EYEKT+HN+GF  +D++  E+ + +   +F G F       +++ + KP TYMN SGE + EI ++Y I   N++VIYDD+D +VG++R++ KGS+GG NGIKSII  +N+E   R+RIG+GKP  ++  HVL KF+ ED   +++ +    +     +N     + MNK+N
  S:     2 FLLVGLGNPGKEYEKTRHNIGFEAVDKISYEYNIPIKRERFKGVFGDGRISNEKVILLKPTTYMNLSGESLREIIEYYNIPITNVIVIYDDVDLEVGRLRIRTKGSAGGHNGIKSIIYNLNSEDFIRLRIGVGKPQRDMVSHVLGKFAKEDEKNIEEVLKIIPELAYTIINQGP-QEAMNKYN 183
>gi|89100523|ref|ZP_01173384.1| peptidyl-tRNA hydrolase [Bacillus sp. NRRL B-14911] >gi|89084789|gb|EAR63929.1| peptidyl-tRNA hydrolase [Bacillus sp. NRRL B-14911] (187 aa)
Score = 396, Expect = 4.4e-37, Identities = 80/182 (43%), Positives = 122/182 (67%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L VGLGNPG EYEKT+HN+GF  ID L  +  + L+ +KF G F       +++F+ KP+TYMN SGE +  +  +Y I  +++ VIYDD+D   GKIR++ KGS+GG NGIKS I+   T++  RIR+GIG+P   +  T +VL +F+AE+   + +A  ++ DAC +++    F ++MN++N
  S:     3 LFVGLGNPGKEYEKTRHNIGFDVIDRLSGKLNIPLDQAKFKGVFGMGRVDGEKVFLLKPLTYMNLSGESIRPLMDYYDIDTEDLAVIYDDLDLPPGKIRLRQKGSAGGHNGIKSTIAHTGTQEFSRIRVGIGRPEGGMKVTDYVLGRFTAEEQKVMDEAADRSADACIDWIRK-PFLEVMNQYN 185
>gi|27262436|gb|AAN87499.1| Peptidyl-tRNA hydrolase [Heliobacillus mobilis] (190 aa)
Score = 395, Expect = 6.1e-37, Identities = 81/181 (44%), Positives = 118/181 (65%)
  Q:     6 VVGLGNPGLEYEKTKHNVGFMCIDELLKE--HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +VGLGNPG +YEKT+HN+GFM +D+L +   H  F   +KF G F +V     ++F+ KP TYMN SG+    +  FYK+  ++ILV+YDD+D   GK+R + KGSSGG NGIKS+I+ + +E   R+++GIG+P        +VL  F AE+   +Q+AI  A DA   +L      ++MN+FN
  S:     4 IVGLGNPGRDYEKTRHNIGFMVVDQLAERWGHDGF--KAKFQGSFSEVRLGGQKVFLLKPQTYMNLSGQAASAMAAFYKLAPEDILVVYDDLDLPPGKLRGRTKGSSGGHNGIKSLIACLGSENFPRLKLGIGRPASRQPSASYVLESFRAEELADIQKAIDLACDAVELWLER-GMIEVMNRFN 185
>gi|18311467|ref|NP_563401.1| peptidyl-tRNA hydrolase [Clostridium perfringens str. 13] >gi|110798942|ref|YP_697173.1| peptidyl-tRNA hydrolase [Clostridium perfringens ATCC 13124] >gi|168205745|ref|ZP_02631750.1| peptidyl-tRNA hydrolase [Clostridium perfringens E str. JGS1987] >gi|168209723|ref|ZP_02635348.1| peptidyl-tRNA hydrolase [Clostridium perfringens B str. ATCC 3626] >gi|168213409|ref|ZP_02639034.1| peptidyl-tRNA hydrolase [Clostridium perfringens CPE str. F4969] >gi|168217602|ref|ZP_02643227.1| peptidyl-tRNA hydrolase [Clostridium perfringens NCTC 8239] >gi|169343257|ref|ZP_02864268.1| peptidyl-tRNA hydrolase [Clostridium perfringens C str. JGS1495] >gi|182624327|ref|ZP_02952112.1| peptidyl-tRNA hydrolase [Clostridium perfringens D str. JGS1721] >gi|21263844|sp|Q8XHJ8|PTH_CLOPE Peptidyl-tRNA hydrolase (PTH) >gi|119390927|sp|Q0TMG7|PTH_CLOP1 Peptidyl-tRNA hydrolase (PTH) >gi|18146151|dbj|BAB82191.1| stage V sporulation protein C [Clostridium perfringens str. 13] >gi|110673589|gb|ABG82576.1| peptidyl-tRNA hydrolase [Clostridium perfringens ATCC 13124] >gi|169298555|gb|EDS80636.1| peptidyl-tRNA hydrolase [Clostridium perfringens C str. JGS1495] >gi|170662744|gb|EDT15427.1| peptidyl-tRNA hydrolase [Clostridium perfringens E str. JGS1987] >gi|170712152|gb|EDT24334.1| peptidyl-tRNA hydrolase [Clostridium perfringens B str. ATCC 3626] >gi|170715077|gb|EDT27259.1| peptidyl-tRNA hydrolase [Clostridium perfringens CPE str. F4969] >gi|177910545|gb|EDT72918.1| peptidyl-tRNA hydrolase [Clostridium perfringens D str. JGS1721] >gi|182380300|gb|EDT77779.1| peptidyl-tRNA hydrolase [Clostridium perfringens NCTC 8239] (188 aa)
Score = 393, Expect = 9.7e-37, Identities = 80/182 (43%), Positives = 121/182 (66%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +YE+T+HN+GF  ID +  ++ + +N  KF G   +      ++ + KP+TYMN SGE + E+  FYK+ +  I+V+YDDI  D+G++R++ KGS+GG NGIKSII  +  +K  R+++G+G+P  NL +HVL KFS ED   +++ I    DA  E + + D  + MNKFN
  S:     3 LIVGLGNPGKQYEQTRHNIGFDVIDYMANKYNIDVNREKFKGICGEGFIENKKVILLKPLTYMNLSGESIRELANFYKLEDDEIIVVYDDISLDIGRLRIREKGSAGGHNGIKSIIQNLGGDKFPRVKVGVGQPKDNLVNHVLGKFSKEDREHIEKVIPVVSDAIVEIVKN-DAKESMNKFN 183
>gi|110803012|ref|YP_699741.1| peptidyl-tRNA hydrolase [Clostridium perfringens SM101] >gi|119390928|sp|Q0SQ66|PTH_CLOPS Peptidyl-tRNA hydrolase (PTH) >gi|110683513|gb|ABG86883.1| peptidyl-tRNA hydrolase [Clostridium perfringens SM101] (188 aa)
Score = 393, Expect = 1.1e-36, Identities = 81/182 (44%), Positives = 120/182 (65%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +YEKT+HN+GF  ID +  ++ + +N  KF G   +      ++ + KP+TYMN SGE + E   FYK+ +  I+V+YDDI  D+G++R++ KGS+GG NGIKSII  +  +K  R+++G+G+P  NL +HVL KFS ED   +++ I    DA  E + + D  + MNKFN
  S:     3 LIVGLGNPGKQYEKTRHNIGFDVIDYMANKYNIDVNREKFKGICGEGFIENKKVILLKPLTYMNLSGESIREFVNFYKLEDDEIIVVYDDISLDIGRLRIREKGSAGGHNGIKSIIQNLGGDKFPRVKVGVGQPKDNLVNHVLGKFSKEDREHIEKVIPVVSDAIVEIVKN-DAKESMNKFN 183
>gi|81096418|ref|ZP_00874763.1| Peptidyl-tRNA hydrolase [Streptococcus suis 89/1591] >gi|80977557|gb|EAP41095.1| Peptidyl-tRNA hydrolase [Streptococcus suis 89/1591] (189 aa)
Score = 389, Expect = 3.3e-36, Identities = 81/182 (44%), Positives = 118/182 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK-FNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L++GLGNPG  Y +TKHNVGFM +D++ K   +  N+ K F           ++I++ KP T+MN SG+ V+ +  +Y +   +ILV YDD+D  VGKIR + KGS+GG NGIKSI+  + T++  RI+IGIG+P   ++  +HVL+ F  ED I++  A+ K   A N +L   DFD +M KFN
  S:     4 LIIGLGNPGDRYFETKHNVGFMLLDKIAKRENVTFNHDKIFQADIGTTFIDGEKIYLVKPTTFMNESGKAVHALMAYYGLDATDILVAYDDLDMAVGKIRFRQKGSAGGHNGIKSIVKHIGTQEFDRIKIGIGRPKGKMSVVNHVLSGFDTEDRIEIDLALDKLDKAVNVYLEEDDFDTVMRKFN 188
>gi|15896464|ref|NP_349813.1| peptidyl-tRNA hydrolase [Clostridium acetobutylicum ATCC 824] >gi|21263854|sp|Q97E97|PTH_CLOAB Peptidyl-tRNA hydrolase (PTH) >gi|15026289|gb|AAK81153.1|AE007817_7 Stage V sporulation protein C, peptidyl-tRNA hydrolase [Clostridium acetobutylicum ATCC 824] (187 aa)
Score = 388, Expect = 4.3e-36, Identities = 79/183 (43%), Positives = 124/183 (67%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +L+VGLGNPGL+YE T+HN+GF  I+ +  +H + ++   F G + K     +++ + KP TYMN SGE V E   +YKI+++NI+VIYDDI  DVGKIR++ KGS+GG NGIK+I+  +++E+  R+++G+G+P  NL ++VL KFS ++  K+++ +    +A  E +        MNKFN
  S:     2 FLIVGLGNPGLKYEHTRHNMGFDAIENIAAKHNISIDKKGFKGLYGKGIIDGEKVILLKPYTYMNLSGESVVEAANYYKINKENIVVIYDDISLDVGKIRIRTKGSAGGHNGIKNIVLHLSSEEFPRVKVGVGEPTENLVNYVLGKFSQDERKKIEEVLNIVTEAV-ECMVVDGVQNAMNKFN 183
>gi|46906445|ref|YP_012834.1| peptidyl-tRNA hydrolase [Listeria monocytogenes str. 4b F2365] >gi|47093155|ref|ZP_00230930.1| peptidyl-tRNA hydrolase [Listeria monocytogenes str. 4b H7858] >gi|153165177|ref|ZP_01926195.1| peptidyl-tRNA hydrolase [Listeria monocytogenes FSL N1-017] >gi|153200649|ref|ZP_01942756.1| peptidyl-tRNA hydrolase [Listeria monocytogenes HPB2262] >gi|167213601|ref|ZP_02283908.1| peptidyl-tRNA hydrolase [Listeria monocytogenes FSL R2-503] >gi|167452920|ref|ZP_02319143.1| peptidyl-tRNA hydrolase [Listeria monocytogenes FSL J2-064] >gi|67460688|sp|Q724K0|PTH_LISMF Peptidyl-tRNA hydrolase (PTH) >gi|46879709|gb|AAT03011.1| peptidyl-tRNA hydrolase [Listeria monocytogenes str. 4b F2365] >gi|47018462|gb|EAL09220.1| peptidyl-tRNA hydrolase [Listeria monocytogenes str. 4b H7858] >gi|133728496|gb|EBA30194.1| peptidyl-tRNA hydrolase [Listeria monocytogenes FSL N1-017] >gi|133736597|gb|EBA38295.1| peptidyl-tRNA hydrolase [Listeria monocytogenes HPB2262] (186 aa)
Score = 387, Expect = 4.5e-36, Identities = 76/182 (41%), Positives = 119/182 (65%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+ GLGNPG +YE+T+HNVGFM +DEL   H      SKFNG   ++    +++ + KP+T+MN SGE +  +  +Y I  ++++++YDD+D  VGKIR++ KGS+GG NG+KSII  + T++  RIR+G+ +P+   + H+VL  F   +   +  AI K+ DA  +F     F ++MNK+N
  S:     3 LIAGLGNPGKKYERTRHNVGFMVVDELSFRHQTPWKKSKFNGMTSEIIVGGEKMILVKPLTFMNASGECIRPLMDYYNIPIEDVVIVYDDLDLPVGKIRLRQKGSAGGHNGMKSIIQHVKTQEFNRIRVGVSRPLKGEVIHYVLGDFPKAEQPDIIAAIQKSADAIEDFA-QTPFIEVMNKYN 184
>gi|56808861|ref|ZP_00366572.1| COG0193: Peptidyl-tRNA hydrolase [Streptococcus pyogenes M49 591] >gi|71902672|ref|YP_279475.1| peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS6180] >gi|94987636|ref|YP_595737.1| peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS9429] >gi|94989514|ref|YP_597614.1| peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS10270] >gi|94991502|ref|YP_599601.1| peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS2096] >gi|71801767|gb|AAX71120.1| peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS6180] >gi|94541144|gb|ABF31193.1| peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS9429] >gi|94543022|gb|ABF33070.1| Peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS10270] >gi|94545010|gb|ABF35057.1| Peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS2096] (204 aa)
Score = 387, Expect = 4.7e-36, Identities = 78/182 (42%), Positives = 123/182 (67%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGNPG +YEKTKHN+GFM ID ++K     F ++  F  Q        ++++  KP T+MNNSG  V  +  +Y I   +++VIYDD+D +V K+R+++KGS+GG NGIKSII+ + T++  RI++GIG+P+  +T  +HV+ +F+ ED+I +   + +  +A   +L   DF+K M KFN
  S:    19 MIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTFTDDKNFKAQIGSTFINHEKVYFVKPTTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDMEVSKLRLRSKGSAGGHNGIKSIIAHIGTQEFNRIKVGIGRPLKGMTVINHVMGQFNTEDNIAISLTLDRVVNAVKFYLQENDFEKTMQKFN 203
>gi|50913351|ref|YP_059323.1| peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS10394] >gi|94993401|ref|YP_601499.1| peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS10750] >gi|50902425|gb|AAT86140.1| Peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS10394] >gi|94546909|gb|ABF36955.1| Peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS10750] (204 aa)
Score = 387, Expect = 4.8e-36, Identities = 78/182 (42%), Positives = 122/182 (67%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGNPG +YEKTKHN+GFM ID ++K     F ++  F  Q        ++++  KP T+MNNSG  V  +  +Y I   +++VIYDD+D +V K+R+++KGS+GG NGIKSII+ + T++  RI++GIG+P+  +T   HV+ +F+ ED+I +   + +  +A   +L   DF+K M KFN
  S:    19 MIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTFTDDKNFKAQIGSTFINHEKVYFVKPTTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDMEVSKLRLRSKGSAGGHNGIKSIIAHIGTQEFNRIKVGIGRPLKGMTVISHVMGQFNTEDNIAISLTLDRVVNAVKFYLQENDFEKTMQKFN 203
>gi|19745205|ref|NP_606341.1| peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS8232] >gi|139472893|ref|YP_001127608.1| peptidyl-tRNA hydrolase [Streptococcus pyogenes str. Manfredo] >gi|166229458|sp|A2RBX7|PTH_STRPG Peptidyl-tRNA hydrolase (PTH) >gi|24418601|sp|Q8P327|PTH_STRP8 Peptidyl-tRNA hydrolase (PTH) >gi|68052905|sp|Q5XEM3|PTH_STRP6 Peptidyl-tRNA hydrolase (PTH) >gi|119391021|sp|Q1J956|PTH_STRPF Peptidyl-tRNA hydrolase (PTH) >gi|19747294|gb|AAL96840.1| putative peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS8232] >gi|134271139|emb|CAM29349.1| peptidyl-tRNA hydrolase [Streptococcus pyogenes str. Manfredo] (189 aa)
Score = 386, Expect = 7.3e-36, Identities = 78/182 (42%), Positives = 122/182 (67%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGNPG +YEKTKHN+GFM ID ++K     F ++  F  Q        ++++  KP T+MNNSG  V  +  +Y I   +++VIYDD+D +V K+R+++KGS+GG NGIKSII+ + T++  RI++GIG+P+  +T   HV+ +F+ ED+I +   + +  +A   +L   DF+K M KFN
  S:     4 MIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTFTDDKNFKAQIGSTFINHEKVYFVKPTTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDMEVSKLRLRSKGSAGGHNGIKSIIAHIGTQEFNRIKVGIGRPLKGMTVISHVMGQFNTEDNIAISLTLDRVVNAVKFYLQENDFEKTMQKFN 188
>gi|15674255|ref|NP_268428.1| peptidyl-tRNA hydrolase [Streptococcus pyogenes M1 GAS] >gi|71909819|ref|YP_281369.1| peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS5005] >gi|21263859|sp|Q9A206|PTH_STRP1 Peptidyl-tRNA hydrolase (PTH) >gi|119391018|sp|Q1JEA1|PTH_STRPB Peptidyl-tRNA hydrolase (PTH) >gi|119391019|sp|Q1JP56|PTH_STRPC Peptidyl-tRNA hydrolase (PTH) >gi|119391020|sp|Q1JJA3|PTH_STRPD Peptidyl-tRNA hydrolase (PTH) >gi|119391022|sp|Q48VW8|PTH_STRPM Peptidyl-tRNA hydrolase (PTH) >gi|13621330|gb|AAK33150.1| putative peptidyl-tRNA hydrolase [Streptococcus pyogenes M1 GAS] >gi|71852601|gb|AAZ50624.1| peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS5005] (189 aa)
Score = 385, Expect = 7.8e-36, Identities = 78/182 (42%), Positives = 123/182 (67%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGNPG +YEKTKHN+GFM ID ++K     F ++  F  Q        ++++  KP T+MNNSG  V  +  +Y I   +++VIYDD+D +V K+R+++KGS+GG NGIKSII+ + T++  RI++GIG+P+  +T  +HV+ +F+ ED+I +   + +  +A   +L   DF+K M KFN
  S:     4 MIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTFTDDKNFKAQIGSTFINHEKVYFVKPTTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDMEVSKLRLRSKGSAGGHNGIKSIIAHIGTQEFNRIKVGIGRPLKGMTVINHVMGQFNTEDNIAISLTLDRVVNAVKFYLQENDFEKTMQKFN 188
>gi|20808916|ref|NP_624087.1| peptidyl-tRNA hydrolase [Thermoanaerobacter tengcongensis MB4] >gi|22095992|sp|Q8R757|PTH_THETN Peptidyl-tRNA hydrolase (PTH) >gi|20517576|gb|AAM25691.1| Peptidyl-tRNA hydrolase [Thermoanaerobacter tengcongensis MB4] (185 aa)
Score = 385, Expect = 8.4e-36, Identities = 81/183 (44%), Positives = 121/183 (66%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           Y++ GLGNPG EYE T+HNVGFM ID L K+  + ++  KF     +     +++ + KP T+MN SGE +Y+   FYKI  +N++V+YDD D +VGKIR++ KGSSGG NG+ SII  +N+E   R+RIGIGKP   +L  HVL +FS E+   + +A+ +A +A  + + +   +  M++FN
  S:     2 YIIAGLGNPGKEYEGTRHNVGFMVIDALSKKLGIEVSRLKFKSLMGEGHFKGEKVILLKPQTFMNLSGEALYDAVNFYKIPLENVIVVYDDKDLEVGKIRIRRKGSSGGHNGMNSIIYLLNSEDFPRVRIGIGKPEDGDLVRHVLGRFSDEEKKVIDEAVERAAEAVIDIMEN-GIEHAMSRFN 184
>gi|21909541|ref|NP_663809.1| peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS315] >gi|28894917|ref|NP_801267.1| peptidyl-tRNA hydrolase [Streptococcus pyogenes SSI-1] >gi|25091008|sp|Q8K8Z7|PTH_STRP3 Peptidyl-tRNA hydrolase (PTH) >gi|21903721|gb|AAM78612.1| putative peptidyl-tRNA hydrolase [Streptococcus pyogenes MGAS315] >gi|28810162|dbj|BAC63100.1| putative peptidyl-tRNA hydrolase [Streptococcus pyogenes SSI-1] (189 aa)
Score = 382, Expect = 2.0e-35, Identities = 78/182 (42%), Positives = 122/182 (67%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGNPG +YEKTKHN+GFM ID ++K     F ++  F  Q        +++   KP T+MNNSG  V  +  +Y I   +++VIYDD+D +V K+R+++KGS+GG NGIKSII+ + T++  RI++GIG+P+  +T  +HV+ +F+ ED+I +   + +  +A   +L   DF+K M KFN
  S:     4 MIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTFTDDKNFKAQIGSTFINHEKVCFVKPTTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDMEVSKLRLRSKGSAGGHNGIKSIIAHIGTQEFNRIKVGIGRPLKGMTVINHVMGQFNTEDNIAISLTLDRVVNAVKFYLQENDFEKTMQKFN 188
>gi|29374897|ref|NP_814050.1| peptidyl-tRNA hydrolase [Enterococcus faecalis V583] >gi|46576784|sp|Q839C0|PTH_ENTFA Peptidyl-tRNA hydrolase (PTH) >gi|29342355|gb|AAO80121.1| peptidyl-tRNA hydrolase [Enterococcus faecalis V583] (188 aa)
Score = 381, Expect = 2.3e-35, Identities = 76/182 (41%), Positives = 118/182 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGNPG +Y++TKHN+GF+ +DE+     +  NNS F     +     +++ + KP+T+MN SG  V  +  ++ + E++++VIYDD+D ++GKIR++ KGS+GG NGIKS+I+ + T    RI+IGIG+P  N T  HHVL+ F  E   ++  A+ KA DA         F + MN+FN
  S:     3 VIVGLGNPGSKYKETKHNIGFITLDEIAYRQNVSFNNSNFEADIAEFFIGTEKVLLVKPLTFMNESGRSVGPLLTYFGVDEEDLIVIYDDLDLEIGKIRLRQKGSAGGHNGIKSLIAHLGTNVFPRIKIGIGRPSKNDTVIHHVLSTFPKETHEEMLLAVKKAADAALYACEGHTFVETMNQFN 186
>gi|16802259|ref|NP_463744.1| peptidyl-tRNA hydrolase [Listeria monocytogenes EGD-e] >gi|47096206|ref|ZP_00233805.1| peptidyl-tRNA hydrolase [Listeria monocytogenes str. 1/2a F6854] >gi|153177868|ref|ZP_01931633.1| peptidyl-tRNA hydrolase [Listeria monocytogenes F6900] >gi|153186165|ref|ZP_01936549.1| peptidyl-tRNA hydrolase [Listeria monocytogenes J0161] >gi|153189380|ref|ZP_01937055.1| peptidyl-tRNA hydrolase [Listeria monocytogenes J2818] >gi|167211252|ref|ZP_02281559.1| peptidyl-tRNA hydrolase [Listeria monocytogenes LO28] >gi|21263846|sp|Q8YAD1|PTH_LISMO Peptidyl-tRNA hydrolase (PTH) >gi|16409578|emb|CAD00740.1| pth [Listeria monocytogenes] >gi|47015454|gb|EAL06388.1| peptidyl-tRNA hydrolase [Listeria monocytogenes str. 1/2a F6854] >gi|126941304|gb|EBA19193.1| peptidyl-tRNA hydrolase [Listeria monocytogenes J0161] >gi|127766816|gb|EBA27141.1| peptidyl-tRNA hydrolase [Listeria monocytogenes J2818] >gi|133733943|gb|EBA35641.1| peptidyl-tRNA hydrolase [Listeria monocytogenes F6900] (186 aa)
Score = 380, Expect = 3.3e-35, Identities = 75/182 (41%), Positives = 119/182 (65%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+ GLGNPG +YE+T+HNVGFM +DEL   H      SKFNG   ++    +++ + KP+T+MN SGE +  +  +Y I  ++++++YDD+D  VGKIR++ KGS+GG NG+KSII  + T++  RIR+G+ +P+   + ++VL  F   +   +  AI K+ DA  +F     F ++MNK+N
  S:     3 LIAGLGNPGKKYERTRHNVGFMVVDELSFRHQTPWKKSKFNGMTSEIIVGGEKMILVKPLTFMNASGECIRPLMDYYNIPIEDVVIVYDDLDLPVGKIRLRQKGSAGGHNGMKSIIQHVKTQEFNRIRVGVSRPLKGEVINYVLGDFPKAEQPDIIAAIQKSADAIEDFA-QTPFIEVMNKYN 184
>gi|172056087|ref|YP_001812547.1| aminoacyl-tRNA hydrolase [Exiguobacterium sibiricum 255-15] >gi|171988608|gb|ACB59530.1| Aminoacyl-tRNA hydrolase [Exiguobacterium sibiricum 255-15] (185 aa)
Score = 380, Expect = 3.6e-35, Identities = 73/181 (40%), Positives = 117/181 (64%)
  Q:     6 VVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +VGLGNPG +Y  T+HN+GF+ ID L KEH + L  SKF   F       +++ + KP+TYMN SGE V  +  FYKI  +++LVIYDD+D  + K+R+++KGS+GG NG+KS+I  + T+ IKR+++G+G+P     +   VL  F+  +   +Q  +  + +   +F++   F  +MN++N
  S:     4 IVGLGNPGAKYTNTRHNIGFLAIDALAKEHGIKLTESKFKAVFGTGMIKGERVVLVKPLTYMNLSGEAVRPLLDFYKIAVEDVLVIYDDLDLPLEKMRLRSKGSAGGHNGVKSLIQHLGTQDIKRLKLGVGRPPAPIQVIDWVLMPFAKSEQTTLQHVLSDSVNIATDFID-TPFLALMNRYN 185
>gi|69245442|ref|ZP_00603437.1| Peptidyl-tRNA hydrolase [Enterococcus faecium DO] >gi|68195824|gb|EAN10260.1| Peptidyl-tRNA hydrolase [Enterococcus faecium DO] (186 aa)
Score = 378, Expect = 5.9e-35, Identities = 73/182 (40%), Positives = 116/182 (63%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGNPG +Y+ TKHN+GFM +D++ +EH      + F  +  +     ++I + KP T+MN SG  V  +  ++ I+ + ++VIYDD+D  VGKIR++ KGS+GG NGIKSIIS +NT    RI++GIG+P     +  HVL+ FS E+   +++++ ++  A    +    F   MN+FN
  S:     3 MIVGLGNPGTKYQYTKHNIGFMVVDKIAREHQATFKKNPFEAEVAEFFHNGEKILLVKPQTFMNESGRAVGPLMTYFGIYPEELVVIYDDLDLAVGKIRLRQKGSAGGHNGIKSIISHLNTNVFDRIKVGIGRPEGKKTVVQHVLSPFSKENQPLIEESMCQSVKAVEYLIEGHSFVDAMNRFN 186
>gi|55820108|ref|YP_138550.1| peptidyl-tRNA hydrolase [Streptococcus thermophilus LMG 18311] >gi|55821998|ref|YP_140439.1| peptidyl-tRNA hydrolase [Streptococcus thermophilus CNRZ1066] >gi|116626978|ref|YP_819597.1| peptidyl-tRNA hydrolase [Streptococcus thermophilus LMD-9] >gi|122268417|sp|Q03N21|PTH_STRTD Peptidyl-tRNA hydrolase (PTH) >gi|68052882|sp|Q5M222|PTH_STRT1 Peptidyl-tRNA hydrolase (PTH) >gi|68052883|sp|Q5M6L4|PTH_STRT2 Peptidyl-tRNA hydrolase (PTH) >gi|55736093|gb|AAV59735.1| peptidyl-tRNA hydrolase [Streptococcus thermophilus LMG 18311] >gi|55737983|gb|AAV61624.1| peptidyl-tRNA hydrolase [Streptococcus thermophilus CNRZ1066] >gi|116100255|gb|ABJ65401.1| peptidyl-tRNA hydrolase [Streptococcus thermophilus LMD-9] (189 aa)
Score = 376, Expect = 8.7e-35, Identities = 79/182 (43%), Positives = 117/182 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK-FNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           LVVGLGNPG +Y +T+HNVGFM ID + KE  L  +  K F  +        ++++  KP T+MN SG  V  +  +Y I  ++ +VIYDD+D +VGK+R + KGS+GG NGIKSII++  T++  RI+IGIG+P   +T  +HVL KFS +D   +   + K + A + +L   DF+  M ++N
  S:     4 LVVGLGNPGSKYHETRHNVGFMAIDLMAKELGLTFSEEKTFKAEVASTFLNGEKVYFVKPTTFMNLSGLAVRALLAYYNIPMEDFIVIYDDLDMEVGKLRFRQKGSAGGHNGIKSIIAETGTQEFDRIKIGIGRPQKGMTVVNHVLGKFSEDDYAMILLTLDKVETALHHYLKTNDFEDTMRRYN 188
>gi|70727508|ref|YP_254424.1| peptidyl-tRNA hydrolase [Staphylococcus haemolyticus JCSC1435] >gi|119391015|sp|Q4L3F9|PTH_STAHJ Peptidyl-tRNA hydrolase (PTH) >gi|68448234|dbj|BAE05818.1| peptidyl-tRNA hydrolase [Staphylococcus haemolyticus JCSC1435] (190 aa)
Score = 376, Expect = 8.8e-35, Identities = 75/181 (41%), Positives = 117/181 (64%)
  Q:     6 VVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +VGLGN G  +E T+HN+GF  ID +LK+H   L+  KF G +       D++   +PMT MN SGE V  +  +Y +  ++++V+YDD+D   G+IR++ KGS+GG NG+KSII  + T++ KRIRIG+G+P + ++   +VL KFS E+ I + + I  +  A   F+    FD +MN++N
  S:     4 IVGLGNIGKRFELTRHNIGFEVIDYILKKHNFSLDKQKFKGAYTIERLNGDKVLFIEPMTMMNLSGEAVGPLMDYYNVEVEDLIVLYDDLDLSQGQIRLRQKGSAGGHNGMKSIIKHLGTDQFKRIRIGVGRPTNGMSVPDYVLQKFSKEEMITMDKVIEHSAHAVEAFIESSRFDHVMNQYN 186
>gi|26398421|sp|Q8RLD7|PTH_MYCGA Peptidyl-tRNA hydrolase (PTH) >gi|19699030|gb|AAL91134.1| peptidyl-tRNA hydrolase [Mycoplasma gallisepticum] (183 aa)
Score = 376, Expect = 8.9e-35, Identities = 83/182 (45%), Positives = 123/182 (67%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGI-GKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFL-NHVDFDKIMNKFN 186
           L+VGLGNPG EYE T+HN+GF  ID+LL    L LN S+FNG +VK     D   IAKP+TYMN SG F+ ++  FYKI   +ILVI+D++  ++G +R+K  GS+ GQ G+ +IIS++ T+  KR+R+GI  + + N+   VL+KF+  + I ++ AI  A     +FL ++  F K+MN++N
  S:     3 LIVGLGNPGFEYEHTRHNIGFKIIDKLLDVLNLELNKSQFNGLYVK----HDDFIIAKPLTYMNLSGNFIRQLVNFYKIQIDDILVIHDELAFNLGVVRLKQNGSANGQKGVANIISQLGTQNFKRLRVGIKNEDLKNIASFVLSKFAPNELILLESAIASASVIAYDFLKSNKSFSKLMNEYN 182
>gi|28377423|ref|NP_784315.1| peptidyl-tRNA hydrolase [Lactobacillus plantarum WCFS1] >gi|38257843|sp|Q88Z39|PTH_LACPL Peptidyl-tRNA hydrolase (PTH) >gi|28270255|emb|CAD63156.1| aminoacyl-tRNA hydrolase [Lactobacillus plantarum WCFS1] (185 aa)
Score = 376, Expect = 9.2e-35, Identities = 76/182 (41%), Positives = 114/182 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGN G +Y +T+HNVGFM +DEL  +  +    SKF  Q     Q  ++I + KP TYMN+SG  V  +  +Y +   ++LVI+DD+D  +GK+R+K KGS+GG NGIKSIIS +  +  KR+++GI  P   ++  +VL KF+  +  K   A I A  A   +L + DF  +MN++N
  S:     3 MIVGLGNIGRQYAQTRHNVGFMIVDELASKLNVTFQTSKFEAQVATAFQDGEKILLVKPATYMNDSGRAVGPLMSYYNVDPADLLVIHDDLDLPLGKVRLKQKGSAGGHNGIKSIISHVGDQHFKRVKVGIDHPQKMSVVDYVLGKFTPAEVAKFDDAKITALAAVEAWLANDDFTAVMNQYN 185
>gi|31544870|ref|NP_853448.1| peptidyl-tRNA hydrolase [Mycoplasma gallisepticum R] >gi|31541716|gb|AAP57016.1| PTH [Mycoplasma gallisepticum R] (188 aa)
Score = 376, Expect = 1.0e-34, Identities = 83/182 (45%), Positives = 123/182 (67%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGI-GKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFL-NHVDFDKIMNKFN 186
           L+VGLGNPG EYE T+HN+GF  ID+LL    L LN S+FNG +VK     D   IAKP+TYMN SG F+ ++  FYKI   +ILVI+D++  ++G +R+K  GS+ GQ G+ +IIS++ T+  KR+R+GI  + + N+   VL+KF+  + I ++ AI  A     +FL ++  F K+MN++N
  S:     8 LIVGLGNPGFEYEHTRHNIGFKIIDKLLDVLNLELNKSQFNGLYVK----HDDFIIAKPLTYMNLSGNFIRQLVNFYKIQIDDILVIHDELAFNLGVVRLKQNGSANGQKGVANIISQLGTQNFKRLRVGIKNEDLKNIASFVLSKFAPNELILLESAIASASVIAYDFLKSNKSFSKLMNEYN 187
>gi|15923492|ref|NP_371026.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus Mu50] >gi|15926179|ref|NP_373712.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus N315] >gi|21282186|ref|NP_645274.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus MW2] >gi|49482729|ref|YP_039953.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49485366|ref|YP_042587.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57650043|ref|YP_185434.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus COL] >gi|87160087|ref|YP_493189.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus USA300] >gi|88194262|ref|YP_499054.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148266961|ref|YP_001245904.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus JH9] >gi|150393007|ref|YP_001315682.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus JH1] >gi|151220677|ref|YP_001331499.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156978830|ref|YP_001441089.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus Mu3] >gi|161508742|ref|YP_001574401.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728146|ref|ZP_02760423.1| aminoacyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|166229456|sp|A7WYQ5|PTH_STAA1 Peptidyl-tRNA hydrolase (PTH) >gi|172048769|sp|A6QEF5|PTH_STAAE Peptidyl-tRNA hydrolase (PTH) >gi|189038168|sp|A6TYX7|PTH_STAA2 Peptidyl-tRNA hydrolase (PTH) >gi|189038169|sp|A5IQ55|PTH_STAA9 Peptidyl-tRNA hydrolase (PTH) >gi|189038170|sp|A8Z0Z1|PTH_STAAT Peptidyl-tRNA hydrolase (PTH) >gi|54038906|sp|P65868|PTH_STAAN Peptidyl-tRNA hydrolase (PTH) >gi|54038907|sp|P65869|PTH_STAAW Peptidyl-tRNA hydrolase (PTH) >gi|54041592|sp|P65867|PTH_STAAM Peptidyl-tRNA hydrolase (PTH) >gi|56749398|sp|Q6GBY6|PTH_STAAS Peptidyl-tRNA hydrolase (PTH) >gi|56749427|sp|Q6GJG9|PTH_STAAR Peptidyl-tRNA hydrolase (PTH) >gi|56749435|sp|Q6YP15|PTH_STAAU Peptidyl-tRNA hydrolase (PTH) >gi|68052875|sp|Q5HIH3|PTH_STAAC Peptidyl-tRNA hydrolase (PTH) >gi|119391012|sp|Q2FJD9|PTH_STAA3 Peptidyl-tRNA hydrolase (PTH) >gi|119391013|sp|Q2G0R9|PTH_STAA8 Peptidyl-tRNA hydrolase (PTH) >gi|13700392|dbj|BAB41690.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus N315] >gi|14246270|dbj|BAB56664.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus Mu50] >gi|21203622|dbj|BAB94322.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus MW2] >gi|21307671|gb|AAK61416.1| peptidyl-tRNA hydrolase [Staphylococcus aureus] >gi|49240858|emb|CAG39525.1| putative peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49243809|emb|CAG42234.1| putative peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57284229|gb|AAW36323.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus COL] >gi|87126061|gb|ABD20575.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201820|gb|ABD29630.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740030|gb|ABQ48328.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus JH9] >gi|149945459|gb|ABR51395.1| Aminoacyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus JH1] >gi|150373477|dbj|BAF66737.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156720965|dbj|BAF77382.1| peptidyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus Mu3] >gi|160367551|gb|ABX28522.1| aminoacyl-tRNA hydrolase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (190 aa)
Score = 376, Expect = 1.1e-34, Identities = 72/181 (39%), Positives = 121/181 (66%)
  Q:     6 VVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +VGLGN G  +E T+HN+GF  +D +L+++   L+  KF G +       D++   +PMT MN SGE V  I  +Y ++ ++++V+YDD+D + G++R++ KGS+GG NG+KSII  + T++ KRIRIG+G+P + +T   +VL +FS ++ + +++ I  A  A  +F+    FD +MN+FN
  S:     4 IVGLGNIGKRFELTRHNIGFEVVDYILEKNNFSLDKQKFKGAYTIERMNGDKVLFIEPMTMMNLSGEAVAPIMDYYNVNPEDLIVLYDDLDLEQGQVRLRQKGSAGGHNGMKSIIKMLGTDQFKRIRIGVGRPTNGMTVPDYVLQRFSNDEMVTMEKVIEHAARAIEKFVETSRFDHVMNEFN 186
>gi|81429217|ref|YP_396218.1| peptidyl-tRNA hydrolase [Lactobacillus sakei subsp. sakei 23K] >gi|119390954|sp|Q38V72|PTH_LACSS Peptidyl-tRNA hydrolase (PTH) >gi|78610860|emb|CAI55912.1| Aminoacyl-tRNA hydrolase (Peptidyl-tRNA hydrolase) [Lactobacillus sakei subsp. sakei 23K] (185 aa)
Score = 375, Expect = 1.1e-34, Identities = 75/182 (41%), Positives = 120/182 (65%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN-LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGNPG +Y KTKHN+GFM ID+L +++ + LN   F  ++       + + + KP+T+MN+SG  V  +  +Y++    +LVI DD+D  +GK+R++ KGS+GG NGIKSII+   ++  KR++IGI  P  + + + VLT F  + +  + QAI +A +A +++  + DF K MNKFN
  S:     3 MIVGLGNPGSKYAKTKHNIGFMVIDQLCEKYNVTLNKHDFEAEYGSFKYEGETVLLVKPLTFMNDSGRSVGPLMSYYQVGIDELLVIQDDMDLTMGKLRLRQKGSAGGHNGIKSIIAHTKSQTFKRLKIGIQHPQKSTVVNWVLTPFDKDGAPVINQAIDQACEAIDDWCQNDDFMKTMNKFN 185
>gi|104773516|ref|YP_618496.1| peptidyl-tRNA hydrolase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513511|ref|YP_812417.1| peptidyl-tRNA hydrolase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122275719|sp|Q04C43|PTH_LACDB Peptidyl-tRNA hydrolase (PTH) >gi|119390952|sp|Q1GBP4|PTH_LACDA Peptidyl-tRNA hydrolase (PTH) >gi|103422597|emb|CAI97200.1| Peptidyl-tRNA hydrolase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116092826|gb|ABJ57979.1| peptidyl-tRNA hydrolase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (185 aa)
Score = 375, Expect = 1.2e-34, Identities = 77/182 (42%), Positives = 111/182 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+V LGNPGL+YEKTKHN GFM +D  L E  L L+  KF   + K     + +   +P TYMN SG  V    KF+KI   +ILVI+DD+D  + K+R++A G SGG NGIKSII+ + TEK  R++IGI  P   ++   VLT F+ +   +++ +  K     ++F+   D   +MN++N
  S:     3 LIVALGNPGLKYEKTKHNTGFMALDHYLDEKGLRLDRDKFTALYAKEKVAGEDVIFMEPQTYMNESGRAVGAAAKFFKIDPSDILVIHDDMDMPIAKLRIRAGGKSGGHNGIKSIIACLGTEKFNRLKIGIRHPDKQSVVSWVLTPFNPDQQKELEASFAKVDQIIDDFIAGKDAQYLMNRYN 185
>gi|15612631|ref|NP_240934.1| peptidyl-tRNA hydrolase [Bacillus halodurans C-125] >gi|14195082|sp|Q9KGJ3|PTH_BACHD Peptidyl-tRNA hydrolase (PTH) >gi|10172680|dbj|BAB03787.1| stage V sporulation protein C (peptidyl-tRNA hydrolase) [Bacillus halodurans C-125] (185 aa)
Score = 375, Expect = 1.4e-34, Identities = 74/182 (40%), Positives = 116/182 (63%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y+ T+HNVGF  +D + +   + +  SK NG + +     ++IF+ KP T+MN SGE V    ++Y +  +++LVIYDD+D  VGKIR++ KGS+GG NG+KS+I+ + T   KRIR+G+ +P     +  HVL ++  E+   + +AI  + +A   F     F ++MN FN
  S:     3 LIVGLGNPGAKYDGTRHNVGFDVVDAVARRLNIEIKQSKANGLYGEGRIDGEKIFLLKPQTFMNRSGESVRPFLEYYNMEVEDLLVIYDDLDLPVGKIRLRQKGSAGGHNGMKSLIAHLGTSDFKRIRVGVDRPAPGETVVQHVLGRYRPEEKDAISEAIDLSAEAAEAFTKK-PFLEVMNTFN 185
>gi|82750209|ref|YP_415950.1| peptidyl-tRNA hydrolase [Staphylococcus aureus RF122] >gi|119391014|sp|Q2YVY3|PTH_STAAB Peptidyl-tRNA hydrolase (PTH) >gi|82655740|emb|CAI80139.1| peptidyl-tRNA hydrolase [Staphylococcus aureus RF122] (190 aa)
Score = 374, Expect = 1.6e-34, Identities = 72/181 (39%), Positives = 121/181 (66%)
  Q:     6 VVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +VGLGN G  +E T+HN+GF  +D +L+++   L+  KF G +       D++   +PMT MN SGE V  I  +Y ++ ++++V+YDD+D + G++R++ KGS+GG NG+KSII  + T++ KRIRIG+G+P + +T   +VL +FS ++ + +++ I  A  A  +F+    FD +MN+FN
  S:     4 IVGLGNIGKRFELTRHNIGFEVVDYILEKNNFSLDKQKFKGAYTIERMNGDKVLFIEPMTMMNLSGEAVAPIMDYYNVNPEDLIVLYDDLDLEQGQVRLRQKGSAGGHNGMKSIIKMLGTDQFKRIRIGVGRPTNGMTVPDYVLQRFSNDEMVTMEKVIEHAGRAIEKFVETSRFDHVMNEFN 186
>gi|27469199|ref|NP_765836.1| peptidyl-tRNA hydrolase [Staphylococcus epidermidis ATCC 12228] >gi|57866046|ref|YP_187736.1| peptidyl-tRNA hydrolase [Staphylococcus epidermidis RP62A] >gi|38257850|sp|Q8CQU9|PTH_STAES Peptidyl-tRNA hydrolase (PTH) >gi|68052877|sp|Q5HRQ3|PTH_STAEQ Peptidyl-tRNA hydrolase (PTH) >gi|27316748|gb|AAO05923.1|AE016751_218 peptidyl-tRNA hydrolase [Staphylococcus epidermidis ATCC 12228] >gi|57636704|gb|AAW53492.1| peptidyl-tRNA hydrolase [Staphylococcus epidermidis RP62A] (190 aa)
Score = 373, Expect = 2.3e-34, Identities = 71/181 (39%), Positives = 119/181 (65%)
  Q:     6 VVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +VGLGN G  +E T+HN+GF  +D++L+ H   L+  KF G +       +++   +PMT MN SG+ V  +  +Y +  ++++V+YDD+D + G++R++ KGS+GG NG+KSII  + T++ KRIRIG+G+P + ++   +VL KFS E+ I +++ I  +  A   F+    FD +MN+FN
  S:     4 IVGLGNIGKRFELTRHNIGFEVVDDILERHQFTLDKQKFKGAYTIERLNGEKVLFIEPMTMMNLSGQAVAPLMDYYNVDVEDLIVLYDDLDLEQGQVRLRQKGSAGGHNGMKSIIKMLGTDQFKRIRIGVGRPTNGMSVPDYVLQKFSKEEMIIMEKVIEHSARAVESFIESSRFDHVMNEFN 186
>gi|24378537|ref|NP_720492.1| peptidyl-tRNA hydrolase [Streptococcus mutans UA159] >gi|46576815|sp|Q8DWN5|PTH_STRMU Peptidyl-tRNA hydrolase (PTH) >gi|24376385|gb|AAN57798.1|AE014853_5 putative peptidyl-tRNA hydrolase [Streptococcus mutans UA159] (189 aa)
Score = 370, Expect = 4.3e-34, Identities = 80/182 (43%), Positives = 118/182 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y +TKHNVGFM +D ++K  +  F  N  F  + V      ++I+  KP T+MN SG  V     +Y +  ++++VIYDD+D +VGKIR + KGS+GG NGIKSII ++ T++  RI+IGIG+P   +T  ++VL KF  +D I +   + K   A N +L   +F++ M KFN
  S:     4 LIVGLGNPGSKYHETKHNVGFMALDRIVKPLNVQFTENKTFKAETVATFINGEKIYFIKPTTFMNASGLAVRAFLAYYNLTVEDLIVIYDDLDMEVGKIRFRQKGSAGGHNGIKSIIKEIGTQEFDRIKIGIGRPKDKMTVVNYVLGKFDKKDEITIFNTLDKVDKAVNYYLQTKNFEQTMQKFN 188
>gi|56961863|ref|YP_173585.1| peptidyl-tRNA hydrolase [Bacillus clausii KSM-K16] >gi|68052898|sp|Q5WAD6|PTH_BACSK Peptidyl-tRNA hydrolase (PTH) >gi|56908097|dbj|BAD62624.1| peptidyl-tRNA hydrolase stage V sporulation protein C [Bacillus clausii KSM-K16] (185 aa)
Score = 369, Expect = 6.4e-34, Identities = 78/182 (42%), Positives = 114/182 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           LVVGLGNPG +YE T+HN+GF  ID   ++  L L+  KF   + +     +++ + KP+TYMN SGE V     ++ I    ++VIYDD+D  VGKIR++ KGS+GG NGIKS+I+ + TE   RIR+GIG+P H   + H+VL  +  E+   + +A  K+  A   +L    F ++MN FN
  S:     3 LVVGLGNPGKKYEHTRHNIGFDIIDRCAQKLDLPLDKQKFKAIYGEKRIGSEKVVLLKPLTYMNLSGEAVRPFMDYFNISNDELVVIYDDLDLPVGKIRLRKKGSAGGHNGIKSLIAHLGTEDFNRIRVGIGRPAHGEPVVHYVLDTYRKEELAFMNEAAEKSAKAIEAWLEK-PFLEVMNTFN 185
>gi|126701126|ref|YP_001090023.1| peptidyl-tRNA hydrolase [Clostridium difficile 630] >gi|145952660|ref|ZP_01801669.1| hypothetical protein CdifQ_04004039 [Clostridium difficile QCD-32g58] >gi|168697793|ref|ZP_02730070.1| peptidyl-tRNA hydrolase [Clostridium difficile QCD-37x79] >gi|168714936|ref|ZP_02747213.1| peptidyl-tRNA hydrolase [Clostridium difficile QCD-63q42] >gi|168726427|ref|ZP_02758704.1| peptidyl-tRNA hydrolase [Clostridium difficile QCD-76w55] >gi|168730125|ref|ZP_02762402.1| peptidyl-tRNA hydrolase [Clostridium difficile QCD-97b34] >gi|196125010|ref|ZP_03116759.1| peptidyl-tRNA hydrolase [Clostridium difficile ATCC 43255] >gi|196162227|ref|ZP_03122788.1| peptidyl-tRNA hydrolase [Clostridium difficile CIP 107932] >gi|119390926|sp|Q181A2|PTH_CLOD6 Peptidyl-tRNA hydrolase (PTH) >gi|115252563|emb|CAJ70406.1| peptidyl-tRNA hydrolase [Clostridium difficile 630] (186 aa)
Score = 369, Expect = 6.6e-34, Identities = 80/183 (43%), Positives = 117/183 (63%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           Y+VVGLGNPG +YEKT+HNVGF  ID L KE+ + +   K      +     +++ + KP TYMN SGE + +I K+YK+   NI+V+YDDID +VGKIR++ KGS G  NG+KSI   + +    R+R+G+ KP    +L   VL++F  E+S  + +A+ KA DA +  +   + D  MNK+N
  S:     2 YVVVGLGNPGKKYEKTRHNVGFDVIDILAKEYNISVTKIKHKALIGEGRVGTEKVLLVKPQTYMNLSGETLIDIYKYYKVDLSNIVVVYDDIDLEVGKIRIRKKGSGGTHNGMKSITKCLGSNDFPRVRVGVSKPEAGQDLADFVLSRFRKEESDNINEALEKAADAIDSIIRE-NIDMSMNKYN 185
>gi|47459376|ref|YP_016238.1| peptidyl-tRNA hydrolase [Mycoplasma mobile 163K] >gi|47458706|gb|AAT28027.1| peptidyl-tRNA hydrolase [Mycoplasma mobile 163K] (190 aa)
Score = 366, Expect = 1.4e-33, Identities = 83/182 (45%), Positives = 119/182 (65%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L++GLGNP  +Y+K +HNVG+M +D++L+   L +N  KF+G FVK ++      IAKP TYMN SG+FV  I  ++K+   NIL+IYDD+  +VG+  +K KG S GQNGIK I+ KMNTE+I R++IGIGK       HVL+ F+ E+   +   I +A +A   FL + D   +MN +N
  S:    14 LIIGLGNPDPKYQKNRHNVGYMVVDKILENLRLKINKEKFSGIFVKTEE----FIIAKPTTYMNLSGDFVKNISTYFKVSPNNILIIYDDMSYEVGQAAIKPKGGSNGQNGIKDILLKMNTEEIPRLKIGIGKN-QEAAKHVLSDFTLEEFKIIDLVINQAAEAAISFLFN-DIRIVMNSYN 189
>gi|68052960|sp|Q6KHA3|PTH_MYCMO Peptidyl-tRNA hydrolase (PTH) (179 aa)
Score = 366, Expect = 1.4e-33, Identities = 83/182 (45%), Positives = 119/182 (65%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L++GLGNP  +Y+K +HNVG+M +D++L+   L +N  KF+G FVK ++      IAKP TYMN SG+FV  I  ++K+   NIL+IYDD+  +VG+  +K KG S GQNGIK I+ KMNTE+I R++IGIGK       HVL+ F+ E+   +   I +A +A   FL + D   +MN +N
  S:     3 LIIGLGNPDPKYQKNRHNVGYMVVDKILENLRLKINKEKFSGIFVKTEE----FIIAKPTTYMNLSGDFVKNISTYFKVSPNNILIIYDDMSYEVGQAAIKPKGGSNGQNGIKDILLKMNTEEIPRLKIGIGKN-QEAAKHVLSDFTLEEFKIIDLVINQAAEAAISFLFN-DIRIVMNSYN 178
>gi|58336611|ref|YP_193196.1| peptidyl-tRNA hydrolase [Lactobacillus acidophilus NCFM] >gi|68052870|sp|Q5FMA9|PTH_LACAC Peptidyl-tRNA hydrolase (PTH) >gi|58253928|gb|AAV42165.1| peptidyl-tRNA hydrolase [Lactobacillus acidophilus NCFM] (185 aa)
Score = 364, Expect = 2.2e-33, Identities = 77/182 (42%), Positives = 111/182 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++ GLGNPG +Y+KTKHN GFM +D  L +  L LN  KF G + K     + +   +P TYMN SG  V +I  F+K+  +++L+I DD+D  +GKIR++A G SGG NGIKSII  + TEK  R++IGI  P +  +   VLT F+ E    +  A   + D  ++F+   D   +MNK+N
  S:     3 IIAGLGNPGQKYDKTKHNTGFMTMDHYLDKKGLTLNKDKFEGHWTKEKINGEDVIFLEPQTYMNESGRSVSQIANFFKVAPEDVLIIQDDMDMPIGKIRIRANGKSGGHNGIKSIIRDLGTEKFNRLKIGIRHPKNATVVSWVLTPFNDEQQKLMDDAFDTSVDIIDDFIAGRDSQYLMNKYN 185
>gi|78043715|ref|YP_359068.1| peptidyl-tRNA hydrolase [Carboxydothermus hydrogenoformans Z-2901] >gi|85681884|sp|Q9F8Q3|PTH_CARHZ Peptidyl-tRNA hydrolase (PTH) >gi|77995830|gb|ABB14729.1| peptidyl-tRNA hydrolase [Carboxydothermus hydrogenoformans Z-2901] (187 aa)
Score = 364, Expect = 2.2e-33, Identities = 74/183 (40%), Positives = 113/183 (61%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +++ GLGNPG EYE T+HN GFM +DEL K+H + +   KF     + +    ++ + KP TYMN SG  V E   FYK+    ++V+YDD+D  +GKIR++ KGS+GG  G+ SIIS + +E+I R++IGIG+P V ++  +VL  F+  +   ++  +  A +A    L    F+K M  FN
  S:     2 FIIAGLGNPGQEYENTRHNAGFMVVDELAKKHGILITKRKFKSLVGEGEILGVKVLLLKPQTYMNLSGTAVQEAVSFYKLPLSRLVVVYDDLDLPLGKIRLRLKGSAGGHRGMGSIISCLGSEEIPRLKIGIGRPAVGDVKDYVLQPFTGAEREILEPTLKLAAEAITVALTE-GFNKAMTDFN 184
>gi|22536192|ref|NP_687043.1| peptidyl-tRNA hydrolase [Streptococcus agalactiae 2603V/R] >gi|25010082|ref|NP_734477.1| peptidyl-tRNA hydrolase [Streptococcus agalactiae NEM316] >gi|77414473|ref|ZP_00790623.1| peptidyl-tRNA hydrolase [Streptococcus agalactiae 515] >gi|46576816|sp|Q8E2I1|PTH_STRA5 Peptidyl-tRNA hydrolase (PTH) >gi|46576817|sp|Q8E7Y8|PTH_STRA3 Peptidyl-tRNA hydrolase (PTH) >gi|22533009|gb|AAM98915.1|AE014191_7 peptidyl-tRNA hydrolase [Streptococcus agalactiae 2603V/R] >gi|23094433|emb|CAD45652.1| Unknown [Streptococcus agalactiae NEM316] >gi|77159483|gb|EAO70644.1| peptidyl-tRNA hydrolase [Streptococcus agalactiae 515] (191 aa)
Score = 364, Expect = 2.3e-33, Identities = 78/182 (42%), Positives = 118/182 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGNPG +Y  TKHN+GFM +D ++K+  + F  +  F  +        ++I+  KP T+MNNSG  V  +  +Y I  +++++IYDD+D +VGKIR + KGS+GG NGIKSII+ + T++  RI++GIG+P   +T  +HVL KF   D I +   + K  +A N +L   DF K M K+N
  S:     4 MIVGLGNPGSKYNDTKHNIGFMAVDRIVKDLDVNFTEDKNFKAEIGSDFINGEKIYFIKPTTFMNNSGIAVKALLTYYNISIKDMIIIYDDLDMEVGKIRFRQKGSAGGHNGIKSIIAHLGTQEFDRIKVGIGRPNGRMTVINHVLGKFDKNDEIMILNTLDKVDNAVNYYLQTNDFQKTMQKYN 188
>gi|77407704|ref|ZP_00784459.1| peptidyl-tRNA hydrolase [Streptococcus agalactiae COH1] >gi|77173703|gb|EAO76817.1| peptidyl-tRNA hydrolase [Streptococcus agalactiae COH1] (191 aa)
Score = 364, Expect = 2.4e-33, Identities = 78/182 (42%), Positives = 118/182 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGNPG +Y  TKHN+GFM +D ++K+  + F  +  F  +        ++I+  KP T+MNNSG  V  +  +Y I  +++++IYDD+D +VGKIR + KGS+GG NGIKSII+ + T++  RI++GIG+P   +T  +HVL KF   D I +   + K  +A N +L   DF K M K+N
  S:     4 MIVGLGNPGSKYNDTKHNIGFMAVDRIVKKLDVNFTEDKNFKAEIGSDFINGEKIYFIKPTTFMNNSGIAVKALLTYYNISIKDMIIIYDDLDMEVGKIRFRQKGSAGGHNGIKSIIAHLGTQEFDRIKVGIGRPNGRMTVINHVLGKFDKNDEIMISNTLDKVDNAVNYYLQTNDFQKTMQKYN 188
>gi|89211704|ref|ZP_01190054.1| Peptidyl-tRNA hydrolase [Halothermothrix orenii H 168] >gi|89158697|gb|EAR78395.1| Peptidyl-tRNA hydrolase [Halothermothrix orenii H 168] (187 aa)
Score = 363, Expect = 3.1e-33, Identities = 80/183 (43%), Positives = 115/183 (62%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNN-SKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           YLVVGLGNPG +Y +T+HN+GF  I+ L ++H +   N  KF     +      ++ +A+P+TYMNNSG  V +I  +Y     NI++IYDD+D   GKIR++ KGSSGG NG+KSII+ ++T +  RIRIGIG+P    N+  +VL  FS+EDS  +   +    +A    L     ++ MN FN
  S:     2 YLVVGLGNPGDKYAETRHNIGFQVIERLARKHKIKAKNYPKFEALCGRGMIRGQKVMLAQPLTYMNNSGRAVRKIIDYYDFSLDNIIIIYDDLDLPPGKIRIRKKGSSGGHNGVKSIINCLDTREFPRIRIGIGRPPAGVNVVDYVLGYFSSEDSEVMSDVLDTTVEAVETILEK-GLEQAMNIFN 186
>gi|77411304|ref|ZP_00787653.1| peptidyl-tRNA hydrolase [Streptococcus agalactiae CJB111] >gi|77162640|gb|EAO73602.1| peptidyl-tRNA hydrolase [Streptococcus agalactiae CJB111] (191 aa)
Score = 363, Expect = 3.2e-33, Identities = 78/182 (42%), Positives = 117/182 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGNPG +Y  TKHN+GFM +D ++K   + F  +  F  +        ++I+  KP T+MNNSG  V  +  +Y I  +++++IYDD+D +VGKIR + KGS+GG NGIKSII+ + T++  RI++GIG+P   +T  +HVL KF   D I +   + K  +A N +L   DF K M K+N
  S:     4 MIVGLGNPGSKYNDTKHNIGFMAVDRIVKNLDVNFTEDKNFKAEIGSDFINGEKIYFIKPTTFMNNSGIAVKALLTYYNISIKDMIIIYDDLDMEVGKIRFRQKGSAGGHNGIKSIIAHLGTQEFDRIKVGIGRPNGRMTVINHVLGKFDKNDEIMISNTLDKVDNAVNYYLQTNDFQKTMQKYN 188
>gi|146296228|ref|YP_001179999.1| aminoacyl-tRNA hydrolase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|167011991|sp|A4XIS3|PTH_CALS8 Peptidyl-tRNA hydrolase (PTH) >gi|145409804|gb|ABP66808.1| peptidyl-tRNA hydrolase [Caldicellulosiruptor saccharolyticus DSM 8903] (189 aa)
Score = 362, Expect = 3.6e-33, Identities = 75/183 (40%), Positives = 111/183 (60%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           Y++ GLGNPG  Y  T+HN GF+ ID L +     ++  KF G     +  + ++ + KPMTYMN+SG+ + E   FYK+  + ++VIYDDI  DVG ++++ KGS GG NG+KSII ++ TE+  RIRIGIG P  ++  +VL++F   +  K+ +AI KA       L     D+ MN  N
  S:     3 YIIAGLGNPGERYTFTRHNAGFLAIDYLAQAFNTKVDKIKFKGLTGSFEYADKKVLLLKPMTYMNSSGDSIVEAVNFYKVKPEKLIVIYDDIAFDVGVVKMRKKGSDGGHNGVKSIIQRLGTEEFPRIRIGIGVPKEDMVKYVLSEFEDYEKQKIFRAIEKAAQGIKILLES-GIDRAMNYIN 184
>gi|15605860|ref|NP_213237.1| peptidyl-tRNA hydrolase [Aquifex aeolicus VF5] >gi|6647697|sp|O66677|PTH_AQUAE Peptidyl-tRNA hydrolase (PTH) >gi|2983032|gb|AAC06642.1| peptidyl-tRNA hydrolase [Aquifex aeolicus VF5] (192 aa)
Score = 362, Expect = 4.6e-33, Identities = 76/165 (46%), Positives = 106/165 (64%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKA 165
           M   LVVGLGNPG EYEKT+HNVGFM IDEL+K         +      K      ++ +AKPMTYMNNSG  VY + + YK+  + ++V+YDD+D  +G +R++ KGSSGG  G++SII  + T+   R+RIGIG+P    ++  +VL+ FS E+   + Q I KA
  S:     1 MDIKLVVGLGNPGKEYEKTRHNVGFMVIDELVKALRAKGPFEEALSHVYKARIGGKEVILAKPMTYMNNSGAAVYNLLEEYKLSPEQMIVVYDDLDLPLGHMRLRLKGSSGGHRGVESIIKYIGTQNFPRLRIGIGRPKKKEDVVKYVLSPFSPEEEKVISQVIKKA 167
>gi|160878271|ref|YP_001557239.1| aminoacyl-tRNA hydrolase [Clostridium phytofermentans ISDg] >gi|189038285|sp|A9KR32|PTH_CLOPH Peptidyl-tRNA hydrolase (PTH) >gi|160426937|gb|ABX40500.1| Aminoacyl-tRNA hydrolase [Clostridium phytofermentans ISDg] (191 aa)
Score = 359, Expect = 9.4e-33, Identities = 78/183 (42%), Positives = 117/183 (63%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKI-MNKFN 186
           Y+++GLGNP  EYE T+HN+GF  I  L  ++ + L+  K      K     +++ +AKP TYMN SGE V E+  FYK+ ++ I+VIYDDI  DVG++R++ KGS+GG NGIK+II+ + +++  RI+IG+G    N  L  +VL +F  E+   +++A+ K   AC   L   D  K+ MN FN
  S:     2 YIIIGLGNPTREYEATRHNIGFDAITRLADDNNISLDTKKHKAICGKGMIGGEKVILAKPQTYMNLSGESVRELIDFYKVTKEEIIVIYDDISLDVGQLRIRTKGSAGGHNGIKNIIAHLGSDEFCRIKIGVGDKPKNWDLADYVLARFPKEEEPAIREALEKVSKACETILR--DGAKVAMNLFN 185
>gi|76787164|ref|YP_328734.1| peptidyl-tRNA hydrolase [Streptococcus agalactiae A909] >gi|77405628|ref|ZP_00782717.1| peptidyl-tRNA hydrolase [Streptococcus agalactiae H36B] >gi|119391017|sp|Q3K419|PTH_STRA1 Peptidyl-tRNA hydrolase (PTH) >gi|76562221|gb|ABA44805.1| peptidyl-tRNA hydrolase [Streptococcus agalactiae A909] >gi|77175772|gb|EAO78552.1| peptidyl-tRNA hydrolase [Streptococcus agalactiae H36B] (191 aa)
Score = 359, Expect = 1.0e-32, Identities = 78/182 (42%), Positives = 116/182 (63%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGNPG +Y  TKHN+GFM ID ++K   + F  +  F  +        ++I+  KP T+MNNSG  V  +  +Y I  +++++IYDD+D +VGKIR + KGS+GG NGIKSII+ + T++  RI++GIG+P   +T  +HVL KF   D I +   + K  +A   +L   DF K M K+N
  S:     4 MIVGLGNPGSKYNDTKHNIGFMAIDRIVKNLDVNFTEDKNFKAEIGSDFINGEKIYFIKPTTFMNNSGIAVKALLTYYNISIKDMIIIYDDLDMEVGKIRFRQKGSAGGHNGIKSIIAHLGTQEFDRIKVGIGRPNGRMTVINHVLGKFDKNDEIMISNTLDKVDNAVKYYLQTNDFQKTMQKYN 188
>gi|134297988|ref|YP_001111484.1| aminoacyl-tRNA hydrolase [Desulfotomaculum reducens MI-1] >gi|172044208|sp|A4J0Q6|PTH_DESRM Peptidyl-tRNA hydrolase (PTH) >gi|134050688|gb|ABO48659.1| peptidyl-tRNA hydrolase [Desulfotomaculum reducens MI-1] (206 aa)
Score = 358, Expect = 1.1e-32, Identities = 67/164 (40%), Positives = 101/164 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDA 168
           L+VGLGNPG EY KT+HN+GFM ID L  E  +    ++   Q  ++    +++ +AKP TYMN SG+ V  +  +YK+    + VI DD+D   G +R++  GS+GGQ G+K+II  + T++  R+R+GIG+P H    HVL K S  ++  +  AI  A +A
  S:     3 LIVGLGNPGTEYAKTRHNIGFMVIDRLADESRVSTEKNQHKAQICQITIGSEKVILAKPQTYMNLSGQSVVALMNWYKLSPDELFVITDDMDLPPGVLRIRKNGSAGGQRGLKNIIELLGTQQFPRMRVGIGRPEHGAVDHVLGKISEAEAELINPAIQTAVEA 166
>gi|21674075|ref|NP_662140.1| peptidyl-tRNA hydrolase [Chlorobium tepidum TLS] >gi|26398419|sp|Q8KD05|PTH_CHLTE Peptidyl-tRNA hydrolase (PTH) >gi|21647228|gb|AAM72482.1| peptidyl-tRNA hydrolase [Chlorobium tepidum TLS] (187 aa)
Score = 357, Expect = 1.5e-32, Identities = 76/182 (41%), Positives = 114/182 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIG---KPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNP L +  T+HN+GF  ID L    T   ++ K N +F K+  P   + + KPMTYMN SG  V     F+KI  +N+LVI DD++  +G IR++AKGS+GGQNG+K II  + +E+  R+R+G+G    P  +L+  VL+KF+AE+   + + I    DA  +F + +  +  M K+N
  S:     3 LIVGLGNPELRHAATRHNIGFDVIDHLAGSSTF--SSGKGNYRFTKITAPGGPLILVKPMTYMNLSGHAVVAAMNFWKIERENLLVICDDVNIPLGTIRIRAKGSAGGQNGLKHIIQSLGSEEFARLRVGVGGENMPA-SLSSFVLSKFTAEERKCIDKVIPVCADAVLDFAS-LGVEHAMTKYN 183
>gi|75910645|ref|YP_324941.1| peptidyl-tRNA hydrolase [Anabaena variabilis ATCC 29413] >gi|119390911|sp|Q3M4P0|PTH_ANAVT Peptidyl-tRNA hydrolase (PTH) >gi|75704370|gb|ABA24046.1| peptidyl-tRNA hydrolase [Anabaena variabilis ATCC 29413] (213 aa)
Score = 356, Expect = 1.9e-32, Identities = 73/168 (43%), Positives = 116/168 (69%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPED-QIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL-------THHVLTKFSAEDS---------------IKVQQAIIKAKDACNEF 172
           L+VGLGNP  +Y++T+HN+GF  +D L +   + L  N KF GQ+ +   P   +I + KP+TYMN SG+ +  +  +YK+  +++LVIYDD+D  +GK R++  GS+GG NG+KS I+ ++T+   R+RIGIGKP + +         HVL KFSA ++               + ++Q + KA + CN +
  S:    15 LIVGLGNPEPKYDQTRHNIGFAAVDALARAWNISLAENRKFQGQYGEGTAPGGVKIRLLKPLTYMNRSGQAIQAVTSWYKLSGESVLVIYDDLDLPLGKTRLRLSGSAGGHNGMKSAIAHLSTQNFPRLRIGIGKPKNAVNGDNSETVSHVLGKFSATETQLMSLVLQFVVECVELSLKQGVEKAMNRCNSY 206
>gi|17228339|ref|NP_484887.1| peptidyl-tRNA hydrolase [Nostoc sp. PCC 7120] >gi|21263848|sp|Q8YYK4|PTH_ANASP Peptidyl-tRNA hydrolase (PTH) >gi|17130189|dbj|BAB72801.1| peptidyl-tRNA hydrolase [Nostoc sp. PCC 7120] (203 aa)
Score = 355, Expect = 2.3e-32, Identities = 75/186 (40%), Positives = 119/186 (63%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPED-QIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL-------THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           M   L+VGLGNP  +Y++T+HN+GF  +D L +   + L  N KF GQ+ +   P   +I + KP+TYMN SG+ +  +  +YK+  +++LVIYDD+D  +GK R++  GS+GG NG+KS I+ ++T+   R+RIGIGKP + +         HVL KFSA ++ ++   +++    C E       +K MN+ N
  S:     1 MIPQLIVGLGNPEPKYDQTRHNIGFAAVDALARAWNISLAENRKFQGQYGEGTAPGGVKIRLLKPLTYMNRSGQAIQAVTSWYKLSGESVLVIYDDLDLPLGKTRLRLSGSAGGHNGMKSAIAHLSTQNFPRLRIGIGKPKNAVNGDNSETVSHVLGKFSATET-QLMSLVLQFVVECVELSLKQGVEKAMNRCN 194
>gi|90962333|ref|YP_536249.1| peptidyl-tRNA hydrolase [Lactobacillus salivarius UCC118] >gi|119390953|sp|Q1WSG3|PTH_LACS1 Peptidyl-tRNA hydrolase (PTH) >gi|90821527|gb|ABE00166.1| Peptidyl-tRNA hydrolase [Lactobacillus salivarius UCC118] (185 aa)
Score = 352, Expect = 5.3e-32, Identities = 70/182 (38%), Positives = 117/182 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGN   +YE T+HNVGFM ++  ++EH    N  KF+    ++    ++I + KP TYMN SG  V  +  ++ +  ++I++ +DD+D ++G +R++ KGS+GG NGIKSIIS + TEK KR+R+GI  P   ++   VL++F+ E   K+   + +A  A ++++ + DF   MN+FN
  S:     3 MIVGLGNIEKKYEGTRHNVGFMVVERFVEEHGGNFNKEKFDSLISELFINGEKIIVIKPTTYMNESGRAVRPLMDYFNLTTEDIIICHDDMDLEIGHLRLRQKGSAGGHNGIKSIISHVGTEKFKRVRVGIDHPQKMSVVDWVLSRFTKEQEAKLDDGLTRAVAALDDWIENDDFMNTMNRFN 185
>gi|73663563|ref|YP_302344.1| peptidyl-tRNA hydrolase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|119391016|sp|Q49V11|PTH_STAS1 Peptidyl-tRNA hydrolase (PTH) >gi|72496078|dbj|BAE19399.1| peptidyl-tRNA hydrolase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (190 aa)
Score = 348, Expect = 1.5e-31, Identities = 70/181 (38%), Positives = 117/181 (64%)
  Q:     6 VVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +VGLGN G  +E+T+HN+GF  ID +L+++   L+  KF G +       +++   +PMT MN SGE V  + K+Y I  ++++V+YDD+D   G+IR++ KGS+GG NG+KSII  + T++ KRIRIG+ +P + +    +VL KFS ++   + + I  +  A   ++    FD++MN++N
  S:     4 IVGLGNIGKRFEQTRHNIGFEVIDFMLEQNRFSLDKQKFKGAYTIERLAGEKVMFIEPMTMMNLSGEAVAPLMKYYDIDIEDLIVLYDDLDLPQGEIRLRQKGSAGGHNGMKSIIQMLGTDQFKRIRIGVDRPSNGMAIVDYVLQKFSNQEMETMNKVIEHSARAIEAYIESNRFDRVMNEYN 186
>gi|37520107|ref|NP_923484.1| peptidyl-tRNA hydrolase [Gloeobacter violaceus PCC 7421] >gi|46576719|sp|Q7NN75|PTH_GLOVI Peptidyl-tRNA hydrolase (PTH) >gi|35211099|dbj|BAC88479.1| peptidyl-tRNA hydrolase [Gloeobacter violaceus PCC 7421] (198 aa)
Score = 348, Expect = 1.6e-31, Identities = 73/186 (39%), Positives = 115/186 (61%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGK--PVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHV---DFDKIMNKFN 186
           M   L VGLGNPGL+Y +T+HN GF+ +D L K     ++  S+F G   +   P  +  + KP TYMN+SG+ V  +  ++++  Q +LV+YD++   +GKIR++ +GS+ G NGIKS+I  + T +  R+RIGIG+  P   LT++VL KF+ E+    Q+ +    D C E +  V     +K M+ +N
  S:     1 MELRLFVGLGNPGLQYTQTRHNAGFLAVDALAKRWQCSWVEKSRFKGYLAEGAGPGGRAILLKPTTYMNHSGQSVRAVADYFRLPPQQLLVLYDEVALPLGKIRLRPEGSAAGHNGIKSLIEHLGTNQFARLRIGIGREPPPPVLTNYVLGKFAPEE----QEQLPAILDGCVEAVEAVLAKGLEKAMSIYN 188
>gi|51894373|ref|YP_077064.1| peptidyl-tRNA hydrolase [Symbiobacterium thermophilum IAM 14863] >gi|68052923|sp|Q67JD0|PTH_SYMTH Peptidyl-tRNA hydrolase (PTH) >gi|51858062|dbj|BAD42220.1| Stage V sporulation protein C, peptidyl-tRNA hydrolase [Symbiobacterium thermophilum IAM 14863] (189 aa)
Score = 348, Expect = 1.8e-31, Identities = 70/182 (38%), Positives = 115/182 (63%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQF--VKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG  Y  T+HN G+M +D   ++H + +    F G +  ++     +++ + KP+TYMN SG  V +  +FY+I   +ILV++DD+D + G++R++AKGS+GG NG+KS+I+++ T +  R+RIGIG+P     +   VL  F  +D+  V  A+ +A +A   FL        MN++N
  S:     4 LIVGLGNPGPRYAATRHNAGWMLLDAFARKHGVAIEQRGFEGLYGELRWGAEAEKVILLKPLTYMNLSGRSVAQAARFYRIAPADILVLFDDLDLEPGRLRLRAKGSAGGHNGVKSVIAELGTAEFPRLRIGIGRPAPGWEVIDWVLAPFGPDDAAAVAAALPRAVEAVECFLTE-GILAAMNRYN 188
>gi|194334187|ref|YP_002016047.1| Aminoacyl-tRNA hydrolase [Prosthecochloris aestuarii DSM 271] >gi|194312005|gb|ACF46400.1| Aminoacyl-tRNA hydrolase [Prosthecochloris aestuarii DSM 271] (192 aa)
Score = 346, Expect = 3.1e-31, Identities = 75/182 (41%), Positives = 110/182 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIG--KPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           LV GLGNP   YE T+HN+GF  +DEL + H    ++ K N  + K+    + I + KPMTYMN SG  V     FYKI  Q+ILV+ DD++  +G IR++AKGS+GGQNG+K II  +  +   R+R+GI    PV + +  VL KF+AE+     + +  + +A  +F+ H   +  MN +N
  S:     3 LVAGLGNPEARYENTRHNIGFEVVDELARLHQSSFSSGKGNFLYSKIIHRNEPILLLKPMTYMNLSGNAVIAAMTFYKIEYQDILVVCDDLNIALGTIRMRAKGSAGGQNGLKHIIQCLKRDDFARLRVGIAPDHPVSSYSSFVLGKFNAEERKITDRMVSLSAEAALDFVAH-GVEHAMNHYN 185
>gi|150388005|ref|YP_001318054.1| peptidyl-tRNA hydrolase [Alkaliphilus metalliredigens QYMF] >gi|167011987|sp|A6TJM7|PTH_ALKMQ Peptidyl-tRNA hydrolase (PTH) >gi|149947867|gb|ABR46395.1| Aminoacyl-tRNA hydrolase [Alkaliphilus metalliredigens QYMF] (185 aa)
Score = 345, Expect = 3.5e-31, Identities = 73/183 (39%), Positives = 115/183 (62%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           Y++VGLGNPG +Y  T+HNVGF  ID L     + +N  K    + +     +++ +AKP T+MN SGE + E+ +FYKI  +N++VIYDDID  VG +R++  GS+G  NG+KS I ++ T+   RIRIG+G+P   +L+++VL  F+ +D I + +  ++      E +     DK MN++N
  S:     2 YIIVGLGNPGKKYSGTRHNVGFDVIDLLAHRLGITVNKLKHKALYGEARIGGEKVILAKPQTFMNLSGESIREMMQFYKIDPENLIVIYDDIDVKVGSLRIRQSGSAGTHNGMKSTIYQLQTDAFPRIRIGVGRPEFGDLSNYVLGSFT-KDEIPLMKESLERATLTVESIVIDGIDKAMNRYN 184
>gi|113476455|ref|YP_722516.1| peptidyl-tRNA hydrolase [Trichodesmium erythraeum IMS101] >gi|119391035|sp|Q110N1|PTH_TRIEI Peptidyl-tRNA hydrolase (PTH) >gi|110167503|gb|ABG52043.1| peptidyl-tRNA hydrolase [Trichodesmium erythraeum IMS101] (219 aa)
Score = 344, Expect = 4.4e-31, Identities = 75/182 (41%), Positives = 121/182 (66%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPE-DQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT---------HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNP  +Y++T+HN+GF  ID +     + L+ N KF G+F +  +P+ ++I++ KP+TYMN SGE +  +  +YK+    +L+IYDD+D  +G++R++  GS+GG NG+KS I+ + T++  R+RIGIGKP  N+T          HVL KFS +++  + Q +    DA    L     +K M+ +N
  S:    15 LIVGLGNPEPKYDQTRHNIGFTGIDTIANIWQVSLSENRKFKGEFGEGRRPKAEKIYLLKPLTYMNRSGEAISAVVNWYKLPPSCVLIIYDDMDLPMGRLRLRLSGSAGGHNGMKSAIAHLGTQEFPRLRIGIGKP-KNITAERGEAKTISHVLGKFSPKENKLMTQVLELVVDAVELSLKQ-GIEKAMSLYN 205
>gi|15791680|ref|NP_281503.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|86149181|ref|ZP_01067413.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88597200|ref|ZP_01100435.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. jejuni 84-25] >gi|157414609|ref|YP_001481865.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. jejuni 81116] >gi|172047038|sp|A8FKA1|PTH_CAMJ8 Peptidyl-tRNA hydrolase (PTH) >gi|14195085|sp|Q9PII7|PTH_CAMJE Peptidyl-tRNA hydrolase (PTH) >gi|85840539|gb|EAQ57796.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88190261|gb|EAQ94235.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. jejuni 84-25] >gi|112359677|emb|CAL34463.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|157385573|gb|ABV51888.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. jejuni 81116] (181 aa)
Score = 344, Expect = 4.5e-31, Identities = 84/183 (45%), Positives = 115/183 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLF-LNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           LVVGLGN G+EYE T+HNVGFM ID LLKE     L NSKF G+  K+      + + KP TYMNNSG  V  +  FYK   + ++VI+DDID ++G +R K  GSSGG NG+KS I  +     +R+RIG+GK   N+  HVL KF +E+ I + + +  AK A  E + + D   I +K+++
  S:     3 LVVGLGNIGVEYENTRHNVGFMLIDLLLKESNFTNLTNSKFKGELFKIGS---SLLLLKPSTYMNNSGLSVKAVNDFYKC--ERMIVIHDDIDINLGALRFKKGGSSGGHNGLKS-IDTLCGNDYERVRIGVGKG-ENVISHVLGKFKSEEEITLSKVLEHAKKALLELIENDDLSAISSKYSL 179
>gi|163847223|ref|YP_001635267.1| aminoacyl-tRNA hydrolase [Chloroflexus aurantiacus J-10-fl] >gi|187601517|ref|ZP_02987745.1| Aminoacyl-tRNA hydrolase [Chloroflexus sp. Y-400-fl] >gi|189038282|sp|A9WBS1|PTH_CHLAA Peptidyl-tRNA hydrolase (PTH) >gi|163668512|gb|ABY34878.1| Aminoacyl-tRNA hydrolase [Chloroflexus aurantiacus J-10-fl] >gi|187486195|gb|EDU24168.1| Aminoacyl-tRNA hydrolase [Chloroflexus sp. Y-400-fl] (188 aa)
Score = 343, Expect = 5.8e-31, Identities = 66/183 (36%), Positives = 111/183 (60%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIH-EQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +L+VGLGNPG  Y +T+HN+GF  +D L + H L     + N Q  + +    ++ +AKP TYMN SG+ V  +C +YKI   + +LVIYDD+D    K+R++ +GS+G  NG++SI++++ T +  R+R+GIG+P   +    +VL +F+ ++   +   + +  DA    L        MN++N
  S:     2 WLIVGLGNPGERYARTRHNIGFRSVDTLAERHGLTFRPQRANSQLAEGNIYGQRVVLAKPQTYMNLSGQAVVALCNWYKIDPARELLVIYDDLDLPFAKLRIRERGSAGTHNGMRSIVAQLGTTEFPRLRVGIGQPPGKMDAADYVLGRFTPDEEAALPDLLGRIADAVEVILRE-GLTTAMNRYN 186
>gi|67925084|ref|ZP_00518461.1| Peptidyl-tRNA hydrolase [Crocosphaera watsonii WH 8501] >gi|67853058|gb|EAM48440.1| Peptidyl-tRNA hydrolase [Crocosphaera watsonii WH 8501] (204 aa)
Score = 342, Expect = 9.2e-31, Identities = 75/182 (41%), Positives = 112/182 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQ-IFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNP  +Y+KT+HN+GF  +D L +   L +    +F G   + +    Q I++ KP TYMN SG+ V  +  +YK+  +N+LVIYDD+D  +G++R++  GS+GG NG+KSIIS +  +   R+RIGIGK   V N   HVL +FS E+   + +      DA    L     +K M++FN
  S:    14 LIVGLGNPEPKYDKTRHNIGFEIVDILAETWQLSWKETRRFQGMIAEGNSRNQQKIYLLKPSTYMNRSGQSVRAVTDWYKLKSENVLVIYDDMDLPIGRLRMRLSGSAGGHNGMKSIISHLGGQNFPRLRIGIGKSNQVDNTIPHVLGRFSPEERKIIDKTYPLVVDAIETTLKE-GVEKAMSQFN 198
>gi|89892925|ref|YP_516412.1| peptidyl-tRNA hydrolase [Desulfitobacterium hafniense Y51] >gi|89332373|dbj|BAE81968.1| hypothetical protein [Desulfitobacterium hafniense Y51] (196 aa)
Score = 341, Expect = 1.0e-30, Identities = 68/182 (37%), Positives = 114/182 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+ GLGNPG +Y +T+HN GF+ +D L +E  L     KF G   +     +++++ KP T+MN SG  + E+ +FYKI  ++I+V+YDD+D  +G++R+++ GS+GG NGIKS I+++ TE   R+++GIG+P    +   +VL  F+ E+   +++ + K   A   +      DK MN +N
  S:    14 LIAGLGNPGGQYAETRHNAGFLLLDCLAEELKLDFR-PKFQGLVAETMMGGEKVYLLKPQTFMNLSGRSIRELAQFYKIAPKDIMVVYDDMDLPIGRLRLRSSGSAGGHNGIKSTIAELGTEDFWRLKVGIGRPTAGWDSARYVLASFTKEELPVLEEILDKGIKAVTLWAKE-GGDKAMNLYN 195
>gi|42518363|ref|NP_964293.1| peptidyl-tRNA hydrolase [Lactobacillus johnsonii NCC 533] >gi|68052979|sp|Q74LA8|PTH_LACJO Peptidyl-tRNA hydrolase (PTH) >gi|41582648|gb|AAS08259.1| peptidyl-tRNA hydrolase [Lactobacillus johnsonii NCC 533] (185 aa)
Score = 341, Expect = 1.0e-30, Identities = 69/182 (37%), Positives = 118/182 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+ GLGNPG +Y++TKHN GFM +D  L+++ L L+ +KF G + K     + +   +P T+MN+SG+ + ++  F+KI  ++ILVI+DD+D  +GKIR++A G SGG NGIKSI++ + T    R++IGI  P + ++   VL+ F+ +    +  A   +++  N+F+   +   +MN++N
  S:     3 LITGLGNPGRKYDQTKHNTGFMALDHYLEKNGLTLDKNKFEGLWTKQKINGEDVIFLEPQTFMNDSGKSIAQVANFFKIKPEDILVIHDDMDMPIGKIRIRANGKSGGHNGIKSIMACLGTNNFNRLKIGIRHPENESVVSWVLSPFNNDQQKLMDAAFETSENVINDFIKGKNAQYLMNQYN 185
>gi|109647766|ref|ZP_01371669.1| peptidyl-tRNA hydrolase [Desulfitobacterium hafniense DCB-2] >gi|119390936|sp|Q251S4|PTH_DESHY Peptidyl-tRNA hydrolase (PTH) >gi|109640856|gb|EAT50411.1| peptidyl-tRNA hydrolase [Desulfitobacterium hafniense DCB-2] (185 aa)
Score = 341, Expect = 1.0e-30, Identities = 68/182 (37%), Positives = 114/182 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+ GLGNPG +Y +T+HN GF+ +D L +E  L     KF G   +     +++++ KP T+MN SG  + E+ +FYKI  ++I+V+YDD+D  +G++R+++ GS+GG NGIKS I+++ TE   R+++GIG+P    +   +VL  F+ E+   +++ + K   A   +      DK MN +N
  S:     3 LIAGLGNPGGQYAETRHNAGFLLLDCLAEELKLDFR-PKFQGLVAETMMGGEKVYLLKPQTFMNLSGRSIRELAQFYKIAPKDIMVVYDDMDLPIGRLRLRSSGSAGGHNGIKSTIAELGTEDFWRLKVGIGRPTAGWDSARYVLASFTKEELPVLEEILDKGIKAVTLWAKE-GGDKAMNLYN 184
>gi|86153854|ref|ZP_01072057.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. jejuni HB93-13] >gi|121613036|ref|YP_001000022.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. jejuni 81-176] >gi|148927013|ref|ZP_01810689.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. jejuni CG8486] >gi|167004980|ref|ZP_02270738.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. jejuni 81-176] >gi|166199322|sp|A1VY31|PTH_CAMJJ Peptidyl-tRNA hydrolase (PTH) >gi|85842815|gb|EAQ60027.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87250186|gb|EAQ73144.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. jejuni 81-176] >gi|145844421|gb|EDK21530.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. jejuni CG8486] (181 aa)
Score = 340, Expect = 1.5e-30, Identities = 83/183 (45%), Positives = 114/183 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLF-LNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           LVVGLGN G+EYE T+HNVGFM ID LLKE     L NSKF G+  K+      + + KP TYMNNSG  V  +  FYK   + ++VI+DDID ++G +R K  GSSGG NG+KS I  +     +R+RIG+GK   N+  HVL KF +E+ I + + +   K A  E + + D   I +K+++
  S:     3 LVVGLGNIGVEYENTRHNVGFMLIDLLLKESNFTNLTNSKFKGELFKIGS---SLLLLKPSTYMNNSGLSVKAVNDFYKC--ERMIVIHDDIDINLGALRFKKGGSSGGHNGLKS-IDTLCGNDYERVRIGVGKG-ENVISHVLGKFKSEEEITLSKVLEHTKKALLELIENDDLSAISSKYSL 179
>gi|116493281|ref|YP_805016.1| peptidyl-tRNA hydrolase [Pediococcus pentosaceus ATCC 25745] >gi|122265255|sp|Q03DZ8|PTH_PEDPA Peptidyl-tRNA hydrolase (PTH) >gi|116103431|gb|ABJ68574.1| peptidyl-tRNA hydrolase [Pediococcus pentosaceus ATCC 25745] (185 aa)
Score = 339, Expect = 1.7e-30, Identities = 74/182 (40%), Positives = 113/182 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVD--QPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV-HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGN G EY+KT+HN GFM +DEL K+H +  NN K     +  D     +++ + KP TYMN+SG  V  +  +Y +   +++V YDD+D  VGKIR++ KGS+GG NGIKSII+ + T+   R+R+GI  P   ++  +VL KF  E     +  +  A  A  ++    +F ++MNK+N
  S:     3 MIVGLGNIGKEYDKTRHNTGFMVVDELAKKHDI--NNFKVQSDALIADFRVNGEKVLLVKPTTYMNDSGRAVRPLMDYYDVDLNDMIVAYDDMDMPVGKIRLRQKGSAGGHNGIKSIIAHVGTQSFNRVRVGIDHPTKESVVDYVLGKFRKEQITDFEIGVQNAVAALEDWTTIENFSQLMNKYN 185
>gi|116628944|ref|YP_814116.1| peptidyl-tRNA hydrolase [Lactobacillus gasseri ATCC 33323] >gi|122274058|sp|Q046E4|PTH_LACGA Peptidyl-tRNA hydrolase (PTH) >gi|116094526|gb|ABJ59678.1| peptidyl-tRNA hydrolase [Lactobacillus gasseri ATCC 33323] (185 aa)
Score = 339, Expect = 1.7e-30, Identities = 70/182 (38%), Positives = 115/182 (63%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV-HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+ GLGNPG +Y++TKHN GFM +D  L ++ L L+  KF G + K     + +   +P T+MN+SG+ + ++  F+KI  ++ILVI+DD+D  +GKIR++A G SGG NGIKSI++ + T    R++IGI  P   ++   VL+ F+ E    +  A   +++  N+F+   +   +MN++N
  S:     3 LIAGLGNPGKKYDQTKHNTGFMALDHYLSKNNLDLDKDKFEGLWTKQKVNGEDVIFLEPQTFMNDSGKSIAQVANFFKIAPEDILVIHDDMDMPIGKIRIRANGKSGGHNGIKSIMACLGTNNFNRLKIGIRHPQKESVVSWVLSPFNDEQQKLMDAAFEVSENIINDFIKGKNAQYLMNQYN 185
>gi|57237363|ref|YP_178376.1| peptidyl-tRNA hydrolase [Campylobacter jejuni RM1221] >gi|86151320|ref|ZP_01069535.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. jejuni 260.94] >gi|68052878|sp|Q5HWF9|PTH_CAMJR Peptidyl-tRNA hydrolase (PTH) >gi|57166167|gb|AAW34946.1| peptidyl-tRNA hydrolase [Campylobacter jejuni RM1221] >gi|85841667|gb|EAQ58914.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. jejuni 260.94] (181 aa)
Score = 339, Expect = 1.8e-30, Identities = 83/183 (45%), Positives = 113/183 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLF-LNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           LVVGLGN G+EYE T+HNVGFM ID LLKE     L NSKF G+  K+      + + KP TYMNNSG  V  +  FYK   + ++VI+DDID ++G +R K  GSSGG NG+KS I  +     +R+RIG+GK   N+  HVL KF  E+ I + + +   K A  E + + D   I +K+++
  S:     3 LVVGLGNIGVEYENTRHNVGFMLIDLLLKESNFTNLTNSKFKGELFKIGS---SLLLLKPSTYMNNSGLSVKAVNDFYKC--ERMIVIHDDIDINLGALRFKKGGSSGGHNGLKS-IDTLCGNDYERVRIGVGKG-ENVISHVLGKFKPEEEITLSKVLEHTKKALLELIENDDLSAISSKYSL 179
>gi|10802611|gb|AAG23529.1|AF244580_1 peptidyl-tRNA hydrolase [Carboxydothermus hydrogenoformans] (186 aa)
Score = 339, Expect = 2.1e-30, Identities = 71/178 (39%), Positives = 108/178 (60%)
  Q:     9 LGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +GNPG EYE T+HN GFM +DEL K+H + +   KF     + +    ++ + KP TYMN SG  V E   FYK+    ++V+YDD+D  +GKI ++ KGS+GG  G+ SIIS + +E+I R++IGIG+P V ++  +VL  F+  +   ++  +  A +A    L    F+K M  FN
  S:     6 IGNPGQEYENTRHNAGFMVVDELAKKHGILITKRKFKSLVGEGEILGVKVLLLKPQTYMNLSGTAVQEAVSFYKLPLSRLVVVYDDLDLPLGKICLRLKGSAGGHRGMGSIISCLGSEEIPRLKIGIGRPAVGDVKDYVLQPFTGAEREILEPTLKLAAEAITVALTE-GFNKAMTDFN 183
>gi|153952327|ref|YP_001398643.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. doylei 269.97] >gi|166199321|sp|A7H563|PTH_CAMJD Peptidyl-tRNA hydrolase (PTH) >gi|152939773|gb|ABS44514.1| peptidyl-tRNA hydrolase [Campylobacter jejuni subsp. doylei 269.97] (181 aa)
Score = 338, Expect = 2.3e-30, Identities = 83/183 (45%), Positives = 112/183 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLF-LNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           LVVGLGN G+EYE T+HNVGFM ID LLKE     L NSKF G+  K+      + + KP TYMNNSG  V  +  FYK   + ++VI+DDID ++G +R K  GSSGG NG+KS I  +     +R+RIG+GK   N+  HVL KF  E+ I + + +   K A  E +   D   I +K+++
  S:     3 LVVGLGNIGVEYENTRHNVGFMLIDLLLKESNFTNLTNSKFKGELFKIGS---SLLLLKPSTYMNNSGLSVKAVNDFYKC--ERMIVIHDDIDINLGALRFKKGGSSGGHNGLKS-IDALCGNDYERVRIGVGKG-ENVISHVLDKFKPEEEITLSKVLEHTKKALLELIEKDDLSAISSKYSL 179
>gi|78484739|ref|YP_390664.1| peptidyl-tRNA hydrolase [Thiomicrospira crunogena XCL-2] >gi|119391032|sp|Q31IN3|PTH_THICR Peptidyl-tRNA hydrolase (PTH) >gi|78363025|gb|ABB40990.1| peptidyl-tRNA hydrolase [Thiomicrospira crunogena XCL-2] (192 aa)
Score = 338, Expect = 2.4e-30, Identities = 68/182 (37%), Positives = 111/182 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +YE+T+HN GF  ++++ +++ + F   +KF G+  ++      +++ KPMT+MN SG+ +  I KFYKI  + ILV++D++D D G  R+K  G  GG NG++  I+ + T+  KR+R+GIG P   + +  +VL   S  D   +  AI  A     + LN  D  + MN+ +
  S:     6 LIVGLGNPGGQYEQTRHNAGFWFVEDVARQYNVQFRPETKFLGEAARIQSNGLDVWLLKPMTFMNRSGQSIQAIAKFYKIAPEEILVVHDELDLDPGVARLKTSGGHGGHNGLRDTIAALGTKDFKRLRLGIGHPGDRNQVVDYVLKAPSKTDRALIDDAIYDATRVLPDLLND-DMARAMNELH 189
>gi|54020384|ref|YP_115690.1| peptidyl-tRNA hydrolase [Mycoplasma hyopneumoniae 232] >gi|71893556|ref|YP_279002.1| peptidyl-tRNA hydrolase [Mycoplasma hyopneumoniae J] >gi|68052908|sp|Q601M5|PTH_MYCH2 Peptidyl-tRNA hydrolase (PTH) >gi|119390963|sp|Q4AAD0|PTH_MYCHJ Peptidyl-tRNA hydrolase (PTH) >gi|53987557|gb|AAV27758.1| peptidyl-tRNA hydrolase [Mycoplasma hyopneumoniae 232] >gi|71851683|gb|AAZ44291.1| peptidyl-tRNA hydrolase [Mycoplasma hyopneumoniae J] (184 aa)
Score = 338, Expect = 2.4e-30, Identities = 78/182 (42%), Positives = 120/182 (65%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y KTKHNVG+  +D L ++  L  +    NG +VK  QP+    +AKP T+MN SG+FV E+ KFYKI+ Q++++IYDD++ +VG+  +K  GS+GGQ G+  II K  T++IKR++IGI +   N   +VL+ F  +D+ K++  I +A +    +L++  F   + KFN
  S:     3 LIVGLGNPGEKYAKTKHNVGYWVLDLLAEKLALSFDQKTENGIYVK--QPD--FILAKPTTFMNKSGDFVEELIKFYKINTQDLMIIYDDMNFEVGQAAIKTTGSAGGQRGMAHIIEKCKTKEIKRLKIGISRG-ENAKEYVLSPFLPKDNAKIKLVIEEAANILIFYLSN-SFITTIEKFN 178
>gi|186684439|ref|YP_001867635.1| peptidyl-tRNA hydrolase [Nostoc punctiforme PCC 73102] >gi|186466891|gb|ACC82692.1| peptidyl-tRNA hydrolase [Nostoc punctiforme PCC 73102] (213 aa)
Score = 338, Expect = 2.4e-30, Identities = 69/166 (41%), Positives = 114/166 (68%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPED-QIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV-------HNLTHHVLTKFSAEDS---------------IKVQQAIIKAKDACN 170
           L+VGLGNP  +Y++T+HN+GF  ++ L +   + L  N KF G++ +   P   +I + KP+TYMN SG+ +  +  +YK+  +++L+IYDD+D  +GK R++  GS+GG NG+KS I+ ++T+   R+RIGIGKP         N   HVL +FS+ ++               + ++Q + KA + CN
  S:    15 LIVGLGNPESKYDQTRHNIGFAAVEALSRSWRISLAENRKFQGEYGEGMAPGGGKIRLLKPLTYMNRSGQSIQAVTSWYKLPPESVLIIYDDMDLPLGKTRLRLSGSAGGHNGMKSAIAHLSTQNFPRLRIGIGKPKGAADNDDSNTVSHVLGRFSSAENQQMSLVLQFVVECIELSLKQGVEKAMNVCN 204
>gi|125975113|ref|YP_001039023.1| peptidyl-tRNA hydrolase [Clostridium thermocellum ATCC 27405] >gi|125715338|gb|ABN53830.1| peptidyl-tRNA hydrolase [Clostridium thermocellum ATCC 27405] (196 aa)
Score = 337, Expect = 3.0e-30, Identities = 82/183 (44%), Positives = 121/183 (66%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +++VGLGNPG +YE T+HNVGF  ++ L K H + L   K        +    ++ +AKP T+MN SGE V EI ++YKI  +NI++IYDDID  VGK+R++ KGS+G  NG++S+I ++ +E+  RIRIGI KP    +L  +VL++FSA++  K+ +A+ KA DA    L     D  MNK+N
  S:    12 FVIVGLGNPGAKYENTRHNVGFDTVEFLSKRHDIRLGKLKHKALIGDGEIGGRKVILAKPQTFMNLSGESVREIVEWYKIPVKNIIIIYDDIDLPVGKLRLRPKGSAGTHNGMRSVIYQLQSEEFPRIRIGIDKPPEGWDLISYVLSRFSADERKKIDEAVEKAADAVETILKS-GIDSAMNKYN 195
>gi|72080543|ref|YP_287601.1| peptidyl-tRNA hydrolase [Mycoplasma hyopneumoniae 7448] >gi|119390962|sp|Q4A8G1|PTH_MYCH7 Peptidyl-tRNA hydrolase (PTH) >gi|71913667|gb|AAZ53578.1| peptidyl-tRNA hydrolase [Mycoplasma hyopneumoniae 7448] (184 aa)
Score = 337, Expect = 3.2e-30, Identities = 78/182 (42%), Positives = 120/182 (65%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y KTKHNVG+  +D L ++  L  +    NG +VK  QP+    +AKP T+MN SG+FV E+ KFYKI+ Q++++IYDD++ +VG+  +K  GS+GGQ G+  II K  T++IKR++IGI +   N   +VL+ F  +D+ K++  I +A +    +L++  F   + KFN
  S:     3 LIVGLGNPGEKYAKTKHNVGYWVLDLLAEKLALSFDQKTENGIYVK--QPD--FILAKPTTFMNKSGDFVEELIKFYKINTQDLMIIYDDMNFEVGQAAIKTTGSAGGQRGMAHIIEKCKTKEIKRLKIGISRG-KNAKEYVLSPFLPKDNAKIKLVIEEAANILIFYLSN-SFITTIEKFN 178
>gi|189500048|ref|YP_001959518.1| Aminoacyl-tRNA hydrolase [Chlorobium phaeobacteroides BS1] >gi|189495489|gb|ACE04037.1| Aminoacyl-tRNA hydrolase [Chlorobium phaeobacteroides BS1] (189 aa)
Score = 337, Expect = 3.5e-30, Identities = 75/182 (41%), Positives = 106/182 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGK--PVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNP   +E T+HN+GF  IDE+ +     +   K N    K+      + + KPMTYMN SG  V     FYKI  + ILVI DD++  +G IR++AKGS+GGQNG+K II  +  E   R+R+GIG+  P  + +  VL KFS E+       I +  +A  +F+ H   +  MN+FN
  S:     3 LIVGLGNPEKRHENTRHNIGFEVIDEMARLFQTGMTTGKGNFHHAKITHRGKGVIVLKPMTYMNLSGHAVVAAMNFYKIPVEEILVICDDLNIPLGSIRLRAKGSAGGQNGLKHIIQCLGREDFARLRVGIGRDHPSGSYSSFVLGKFSEEERKTADSIIPECAEAALDFVVH-GIEHAMNRFN 185
>gi|32476152|ref|NP_869146.1| peptidyl-tRNA hydrolase [Rhodopirellula baltica SH 1] >gi|46576732|sp|Q7UKV0|PTH_RHOBA Peptidyl-tRNA hydrolase (PTH) >gi|32446696|emb|CAD76532.1| peptidyl-tRNA hydrolase [Rhodopirellula baltica SH 1] (190 aa)
Score = 337, Expect = 3.6e-30, Identities = 66/182 (36%), Positives = 115/182 (63%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           LVVGLGNPG +Y++T+HN+GFM  D L++ +      +KF G+  +     +++ +  P TYMN SG+ V +   FYK+  ++ILVI DD++ + G++R++  GS+GGQ G+  II  + +E+  R++IGIG+P     ++ +VL KF   +  +++ AI+ + DA   ++      + MN++N
  S:     3 LVVGLGNPGRKYDQTRHNIGFMVADALVRRYVGSPPTTKFEGEISECRIENEKVLVLCPQTYMNASGQSVRKAMDFYKLSPEDILVICDDLNLETGRVRLRRSGSAGGQKGLVDIIRHLGSEQWARLKIGIGRPPAKWQVSDYVLGKFDKTELEEMEHAIVHSCDATACWVAD-GVTEAMNRYN 185
>gi|7388025|sp|O85235|PTH_LACSK Peptidyl-tRNA hydrolase (PTH) >gi|3511016|gb|AAD03811.1| unknown [Lactobacillus sakei] (177 aa)
Score = 336, Expect = 3.7e-30, Identities = 68/167 (40%), Positives = 107/167 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN-LTHHVLTKFSAEDSIKVQQAIIKAKDACNE 171
           ++VGLGNPG +Y KTKHN+GFM ID+L +++ + LN   F  ++       + + + KP+T+MN+SG  V  +  +Y++    +LVI DD+D  +GK+R++ KGS+GG NGIKSII+   ++  KR++IGI  P  + + + VLT F  + +  + QAI     AC E
  S:     3 MIVGLGNPGSKYAKTKHNIGFMVIDQLCEKYNVTLNKHDFEAEYGSFKYEGETVLLVKPLTFMNDSGRSVGPLMSYYQVGIDELLVIQDDMDLTMGKLRLRQKGSAGGHNGIKSIIAHTKSQTFKRLKIGIQHPQKSTVVNWVLTPFDKDGAPVINQAI---DQACEE 167
>gi|16331675|ref|NP_442403.1| peptidyl-tRNA hydrolase [Synechocystis sp. PCC 6803] >gi|2499989|sp|Q59989|PTH_SYNY3 Peptidyl-tRNA hydrolase (PTH) >gi|1001232|dbj|BAA10473.1| peptidyl-tRNA hydrolase [Synechocystis sp. PCC 6803] (194 aa)
Score = 335, Expect = 4.8e-30, Identities = 71/186 (38%), Positives = 115/186 (61%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDEL-LKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           M   L+VGLGNP  +Y++T+HN+GF  +D L +     + ++ +F G F +      +  + KP TYMN SG+ V  +  +YK+  Q++LV+YDD+D  +G++R++  GS+GG NG+KS+IS + T+   R+R+GIGK     +   HVL KFS  +   V++++  A +A    L+H    K M+ FN
  S:     1 MIPKLIVGLGNPEPKYDQTRHNIGFAVVDALAITWQCSWYDHKRFQGWFGEGLMAGQKTCLLKPRTYMNRSGQAVRAVVDWYKLDPQSVLVVYDDMDLPLGRLRLRQTGSAGGHNGMKSLISHLGTQDFPRLRLGIGKSDGSKDTIAHVLGKFSPSELPIVEKSLDLATEAIAHSLHH-GIAKTMSLFN 188
>gi|56751295|ref|YP_171996.1| peptidyl-tRNA hydrolase [Synechococcus elongatus PCC 6301] >gi|81299038|ref|YP_399246.1| peptidyl-tRNA hydrolase [Synechococcus elongatus PCC 7942] >gi|68052884|sp|Q5N2J4|PTH_SYNP6 Peptidyl-tRNA hydrolase (PTH) >gi|119391026|sp|Q31RR0|PTH_SYNP7 Peptidyl-tRNA hydrolase (PTH) >gi|56686254|dbj|BAD79476.1| peptidyl-tRNA hydrolase [Synechococcus elongatus PCC 6301] >gi|81167919|gb|ABB56259.1| peptidyl-tRNA hydrolase [Synechococcus elongatus PCC 7942] (208 aa)
Score = 334, Expect = 7.1e-30, Identities = 73/182 (40%), Positives = 118/182 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPE-DQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP------VHNLT-HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y +T+HN+GFM ID L ++  + L+ + KF G++ +   P   +I + KP T+MN SG  +  +  +YK+  Q ILVIYDD+D  +G++R++  GS+G  NG+KSIIS ++++   R+R+GI  P       H+ T  HVL KF+  +   ++Q +  A++A    L     +  MN++N
  S:     8 LLVGLGNPGQKYAETRHNIGFMLIDRLAQDWGVKLSEDRKFQGEYGETAVPGLGKIRLLKPTTFMNQSGRSLRAVLDWYKLTPQQILVIYDDMDLPLGRLRLRQSGSAGTHNGMKSIISHLSSKDFPRLRLGISLPRSQSNDRHDATVSHVLGKFAVSEQSLLKQVLDLAQEATETALRS-GVETAMNRYN 197
>gi|57168448|ref|ZP_00367582.1| peptidyl-tRNA hydrolase [Campylobacter coli RM2228] >gi|57020256|gb|EAL56930.1| peptidyl-tRNA hydrolase [Campylobacter coli RM2228] (180 aa)
Score = 334, Expect = 7.9e-30, Identities = 83/183 (45%), Positives = 113/183 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLF-LNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           LVVGLGN G EYE T+HNVGFM ID LLKE     L NSKF G+  K+        + KP TYMNNSG  V  +  FYK   + I+V++DDID ++G +R K  GSSGG NG+KS I  +     +R+RIG+GK   N+  HVL KF AE+ + + + +  +K A  E + + D   I +K+++
  S:     3 LVVGLGNIGKEYEDTRHNVGFMLIDLLLKEGNFTNLTNSKFKGELFKMGSS----LLLKPHTYMNNSGLSVKAVNDFYKC--ERIIVVHDDIDINLGALRFKRGGSSGGHNGLKS-IDNLCGSDYERVRIGVGKG-ENVISHVLGKFRAEEELILSKVLEHSKKALLELIRNDDLSAISSKYSL 178
>gi|23097516|ref|NP_690982.1| peptidyl-tRNA hydrolase [Oceanobacillus iheyensis HTE831] >gi|34222739|sp|Q8CXP8|PTH_OCEIH Peptidyl-tRNA hydrolase (PTH) >gi|22775739|dbj|BAC12017.1| stage V sporulation protein C (peptidyl-tRNA hydrolase (PTH)) [Oceanobacillus iheyensis HTE831] (187 aa)
Score = 333, Expect = 8.4e-30, Identities = 74/182 (40%), Positives = 118/182 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +++KT+HN+GF  IDELL+ H   LNNSKF G +       +++ + +P TYMN SG+ +  +  ++ I   +++V+YDD+D   GKIR++ KG  GG NG++S I  + T+  KR+R+GIG+P +   +  +VL KF  +++  V  ++ KA DA   ++    F ++MN FN
  S:     3 LIVGLGNPGRKFKKTRHNIGFFVIDELLQRHKWKLNNSKFEGDYSIEHFDGEKVILLQPQTYMNLSGKSISPLMDYFDIDVDDVIVVYDDLDLPTGKIRLRQKGGHGGHNGVRSTIDHLGTKDFKRVRLGIGRPTNATPVIDYVLGKFPKQETTAVTDSVEKAADAIEAWIKGKPFLEVMNDFN 186
>gi|148543498|ref|YP_001270868.1| peptidyl-tRNA hydrolase [Lactobacillus reuteri F275] >gi|184152906|ref|YP_001841247.1| aminoacyl-tRNA hydrolase [Lactobacillus reuteri F275] >gi|167011995|sp|A5VI57|PTH_LACRF Peptidyl-tRNA hydrolase (PTH) >gi|148530532|gb|ABQ82531.1| peptidyl-tRNA hydrolase [Lactobacillus reuteri F275] >gi|183224250|dbj|BAG24767.1| aminoacyl-tRNA hydrolase [Lactobacillus reuteri F275] (186 aa)
Score = 333, Expect = 9.0e-30, Identities = 73/182 (40%), Positives = 117/182 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPE---------DQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGN G  Y++T+HN GFM +D+L +++ L        G F  + Q           +++ + KP T+MN+SG  V  +  +Y I   +++++ DD+D  VGK+R+K  G+SGG NG+KSIIS + T+   R+++GI  P H  +  HVL KFS E+  K  QA+ +A+ A  +++N  DF K+MN +N
  S:     3 MIVGLGNIGTRYDETRHNTGFMVVDQLARDYHL--------GAFTHLKQEAVAVSGVINGEKVMLVKPTTFMNDSGRAVGPLVDYYDIDLDDLVIVNDDLDMPVGKVRLKTHGASGGHNGLKSIISVLGTKNFNRVKVGIDHPQHGTVVSHVLGKFSKEERPKFDQAVEQAEHALEDWINGEDFAKLMNAYN 186
>gi|91204544|emb|CAJ70772.1| similar to peptidyl-tRNA hydrolase [Candidatus Kuenenia stuttgartiensis] (186 aa)
Score = 333, Expect = 9.7e-30, Identities = 67/182 (36%), Positives = 112/182 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHH-VLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGNPG +Y +T+HN+GFM IDE  ++  +     KF   F K +   ++I + KP T+MN SG  V E+   YK   ++++V+ DD+D  +GK+R++  G  GG  G++S+ S + T    R+RIGIG+P  N T   VL+ FSAE+ +++ +++ +A  A   ++ +   +  MN+ N
  S:     5 MIVGLGNPGEKYLRTRHNLGFMVIDEFSQQLEMGGVQHKFQSLFCKKEVEHEEIILLKPQTFMNLSGIAVQEVANMYKCQPRDVMVVCDDLDLPLGKLRIRRSGGCGGHRGLESVASSLGTADFPRLRIGIGRPKFNDTSRFVLSMFSAEEDVEIAKSLQEACKALKTWV-YKGIESCMNENN 186
>gi|194467673|ref|ZP_03073660.1| Aminoacyl-tRNA hydrolase [Lactobacillus reuteri 100-23] >gi|194454709|gb|EDX43606.1| Aminoacyl-tRNA hydrolase [Lactobacillus reuteri 100-23] (186 aa)
Score = 332, Expect = 1.2e-29, Identities = 73/182 (40%), Positives = 117/182 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPE---------DQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGN G  Y++T+HN GFM +D+L +++ L        G F  + Q           +++ + KP T+MN+SG  V  +  +Y I   +++++ DD+D  VGK+R+K  G+SGG NG+KSIIS + T+   R+++GI  P H  +  HVL KFS E+  K  QA+ +A+ A  +++N  DF K+MN +N
  S:     3 MIVGLGNIGTRYDETRHNTGFMVVDQLARDYHL--------GAFTHLKQEAVAVSGVINGEKVMLVKPTTFMNDSGRAVGPLVDYYDIDLDDLVIVNDDLDMPVGKVRLKTHGASGGHNGLKSIISVLGTKNFNRVKVGIDHPQHGTVVSHVLGKFSKEERPKFDQAVEQAEHALEDWINGEDFAKLMNTYN 186
>gi|116751072|ref|YP_847759.1| peptidyl-tRNA hydrolase [Syntrophobacter fumaroxidans MPOB] >gi|116700136|gb|ABK19324.1| peptidyl-tRNA hydrolase [Syntrophobacter fumaroxidans MPOB] (201 aa)
Score = 332, Expect = 1.2e-29, Identities = 67/181 (37%), Positives = 104/181 (57%)
  Q:     6 VVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           VVGLGNPG +YE T+HN GFM +D L     + +   KF   +        ++ +AKP+TYMN SG  V EI K++    + +LV++DD+D   G++R+  KG +GG  GI SI++ +NT    R+++GIG+P+H   +  +VL    AED+ K +  I+  ++     L        MN +N
  S:    14 VVGLGNPGPQYEHTRHNAGFMVVDRLAAGFGIAMQERKFRASWGTGFVEGRKVLLAKPLTYMNLSGAAVGEILKYFGFPSERVLVVHDDLDLPCGRVRLARKGGAGGHKGIASIMAHLNTRDFPRLKLGIGRPLHGEPVESYVLQPPYAEDARKFEDMILLGEEVVRSVLA-AGLSSSMNDYN 195
>gi|78189056|ref|YP_379394.1| peptidyl-tRNA hydrolase [Chlorobium chlorochromatii CaD3] >gi|78171255|gb|ABB28351.1| peptidyl-tRNA hydrolase [Chlorobium chlorochromatii CaD3] (217 aa)
Score = 332, Expect = 1.4e-29, Identities = 72/182 (39%), Positives = 102/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGK---PVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L++GLGNPG EY+ T+HN+GF   D L   H    +  K      K+    + + I KPMTYMN+SG  V     FYK+    I+VI DD++  VG +R++ KGS+GGQNG+K II    + +  R+RIGIG    P    +  VL KFS ++  ++    + A+D   +F  H      MN FN
  S:    30 LIIGLGNPGTEYDGTRHNIGFAVADALAAHHNASFSKEKGRYLSAKIKLGSESVGIIKPMTYMNHSGHAVVAAMNFYKVARTEIVVICDDLNLPVGTMRLRPKGSAGGQNGLKHIIECFGSNEFARLRIGIGSQNMPKGGFSSFVLGKFSEQEKSEIAIMTVSARDCAIDFALH-GLGHAMNHFN 213
>gi|158321664|ref|YP_001514171.1| peptidyl-tRNA hydrolase [Alkaliphilus oremlandii OhILAs] >gi|167011988|sp|A8MK43|PTH_ALKOO Peptidyl-tRNA hydrolase (PTH) >gi|158141863|gb|ABW20175.1| Aminoacyl-tRNA hydrolase [Alkaliphilus oremlandii OhILAs] (185 aa)
Score = 331, Expect = 1.7e-29, Identities = 72/183 (39%), Positives = 114/183 (62%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +++VGLGNPG +Y+ T+HN+GF  ID L K + + +   K      +     +++ + KP T+MN SG+ + +I +FYK+  +NI+V+YDDID  VG +R++ KGSSG  NG+KSII  + T++  RIRIG+GKP   +L  +VL +F  E+   + + + +A  A  E L        MN++N
  S:     2 HIIVGLGNPGKKYDATRHNIGFEAIDMLAKRNNIEVKKLKHKALCGEGTIGGNKVLLVKPQTFMNLSGQSLLDIVQFYKVDPKNIVVLYDDIDIPVGTLRIREKGSSGTHNGMKSIIYLLQTDQFPRIRIGVGKPQFGDLADYVLGRFPKEEIPTMLETLERASQAV-ETLVKDGIAVSMNRYN 184
>gi|57242054|ref|ZP_00369994.1| peptidyl-tRNA hydrolase [Campylobacter upsaliensis RM3195] >gi|57017246|gb|EAL54027.1| peptidyl-tRNA hydrolase [Campylobacter upsaliensis RM3195] (181 aa)
Score = 329, Expect = 3.0e-29, Identities = 76/182 (41%), Positives = 116/182 (63%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE--HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           LVVGLGN G EYE T+HNVGFM ID +L E      L++SKF G+  K+D       + KP TYMN+SG  V  +C FYK   + ++VI+DDID ++G +R K  GSSGG NG+KS I  +     +R+RIG+G+    ++ HVL +F++E+ + + + +++AK+A    +   +  KI + ++
  S:     3 LVVGLGNIGREYENTRHNVGFMLIDMILSEENQAKILSHSKFKGELYKIDSS----LLLKPHTYMNHSGISVKAVCDFYKC--ERLIVIHDDIDLNLGTLRFKKGGSSGGHNGLKS-IDHLCGNNYERVRIGVGRGKDTIS-HVLGQFTSEEKVILGEILLRAKEALFALMQGDNLSKISSLYS 178
>gi|119357218|ref|YP_911862.1| peptidyl-tRNA hydrolase [Chlorobium phaeobacteroides DSM 266] >gi|166199323|sp|A1BGB1|PTH_CHLPD Peptidyl-tRNA hydrolase (PTH) >gi|119354567|gb|ABL65438.1| peptidyl-tRNA hydrolase [Chlorobium phaeobacteroides DSM 266] (190 aa)
Score = 327, Expect = 4.1e-29, Identities = 70/182 (38%), Positives = 105/182 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGI---GKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           LVVGLGNP   Y  T+HNVGF  +D L           K N    K+      + + KPMTYMN SG  V     FYK+ E  +L++ DD++   G IR++AKGS+GGQNG+K II  + +E   R+R+GI    +P+H+ +  VL KF+ E+ I +++ I   ++A  + + +   +  MN +N
  S:     3 LVVGLGNPEPRYAGTRHNVGFDVLDTLAATFQTRFGKGKGNYLSTKISHRNRSVILLKPMTYMNLSGHAVVAAMNFYKVSESGLLIVCDDLNLPAGSIRLRAKGSAGGQNGLKHIIECLGSEGFARLRVGIRPLDRPLHSFSSFVLGKFTEEERIVMEKVIPVCREAALDVVVN-GIEHAMNNYN 186
>gi|72383452|ref|YP_292807.1| peptidyl-tRNA hydrolase [Prochlorococcus marinus str. NATL2A] >gi|119390978|sp|Q46HC4|PTH_PROMT Peptidyl-tRNA hydrolase (PTH) >gi|72003302|gb|AAZ59104.1| peptidyl-tRNA hydrolase [Prochlorococcus marinus str. NATL2A] (202 aa)
Score = 326, Expect = 5.3e-29, Identities = 74/182 (40%), Positives = 116/182 (63%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN-------LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG EYEKT+HNVGFM ++E+ +++   F  + K  G+  +     ++  +  P TYMN SG+ V     ++      ++V+ DD+D  +GKIRV++KGSSGG NG+KSII+ + T + KR++IGIG P ++          HVL +FS E+ I +   II+   +C E +   +++KI  + N
  S:     8 LLVGLGNPGTEYEKTRHNVGFMVLEEIARKNNCSFRESKKLFGRTCEYGSGIEKTRLLMPNTYMNESGKSVRSAKDWFDFQNNQLIVLVDDMDLPLGKIRVRSKGSSGGHNGLKSIINHLGTAEFKRLKIGIGAPSNDQQERKSKTVSHVLGRFSKEEFI-ILNFIIQEIISCIESITSNNWEKISTRLN 196
>gi|58743494|gb|AAW81735.1| Putative Putative Pepidyl-tRNA hydrolase family protein [Brassica oleracea] (291 aa)
Score = 326, Expect = 5.5e-29, Identities = 66/151 (43%), Positives = 97/151 (64%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMN-TEKIKRIRIGIGKPVHNL--THHVLTKFSAED 154
           +L+VGLGNPG +Y+ T+HNVGF  +D L +   + +N   F   F K       I +AKP T+MN SGE V +I  FYKI  + +LVIYDD+D   GK+R+  KG  GG NG++SII ++  +    R+RIGIG+P   +   ++VL +F+ ++
  S:    98 WLIVGLGNPGKKYQGTRHNVGFEMVDALAEAEGISMNTVNFKALFGKGVIGNIPIMLAKPQTFMNASGESVGQIVSFYKIPLKQVLVIYDDLDLPFGKLRLLPKGGHGGHNGMRSIIDRLKGSRDFPRLRIGIGRPPGKMDTANYVLRQFNKQE 251
>gi|23335260|ref|ZP_00120497.1| COG0193: Peptidyl-tRNA hydrolase [Bifidobacterium longum DJO10A] >gi|23465593|ref|NP_696196.1| peptidyl-tRNA hydrolase [Bifidobacterium longum NCC2705] >gi|189439641|ref|YP_001954722.1| Peptidyl-tRNA hydrolase [Bifidobacterium longum DJO10A] >gi|46576826|sp|Q8G5I6|PTH_BIFLO Peptidyl-tRNA hydrolase (PTH) >gi|23326261|gb|AAN24832.1| peptidyl-tRNA hydrolase [Bifidobacterium longum NCC2705] >gi|189428076|gb|ACD98224.1| Peptidyl-tRNA hydrolase [Bifidobacterium longum DJO10A] (199 aa)
Score = 325, Expect = 7.0e-29, Identities = 72/183 (39%), Positives = 107/183 (58%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK----FNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHH------VLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +L+ GLGNPG +YE T+HN+GFM  D L +  T+   + K         + +D    + F+AKP+TYMN+SG  V  I  +Y+I   +I+VI+DD+D + G+I+VKA GS+GG NGIKSI   + T K  R+R+G+G        H      VL  F  +   ++ + +    DA  + + H    K   KFN
  S:     6 WLIAGLGNPGKKYEDTRHNMGFMTADVLAERWTVNFADHKGLAMLGKSVMNLDGRTVKFFLAKPLTYMNDSGNAVASISAYYQIEPDHIVVIHDDMDLEFGRIKVKAGGSAGGHNGIKSIDRSLGTPKYARVRMGVGHSKRGANAHDNTVNWVLGGFGPDQRKQLPEFLADGADAAEDIIFH-GLAKTQEKFN 197
>gi|86605936|ref|YP_474699.1| peptidyl-tRNA hydrolase [Synechococcus sp. JA-3-3Ab] >gi|119391024|sp|Q2JV16|PTH_SYNJA Peptidyl-tRNA hydrolase (PTH) >gi|86554478|gb|ABC99436.1| peptidyl-tRNA hydrolase [Synechococcus sp. JA-3-3Ab] (225 aa)
Score = 325, Expect = 8.4e-29, Identities = 70/182 (38%), Positives = 111/182 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTH--HVLTKFS-AEDSI--KVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y  T+HN GFM +D+L +   + L    +F G + +      +  + KP TYMN SGE V  +  +YK+   ++LV+YDD+D  +G++R++  GS+GG NG+KS+I  + +E   R+R+G+G+P  N     HVL  F  AE ++  +V +A + A + C +          MN+FN
  S:    16 LIVGLGNPGPQYANTRHNCGFMVVDQLAERWGIPLALEKRFQGSYGEGFALGGKRRLLKPETYMNRSGEAVRAVLDWYKLDPASVLVVYDDMDLPLGRLRLRGSGSAGGHNGMKSVIEHLGSEAFPRLRLGVGRPKGNQDRVGHVLGSFEPAEQAVLDRVLRAAVAAVECCLQ----EGLKTAMNRFN 199
>gi|114565645|ref|YP_752799.1| aminoacyl-tRNA hydrolase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|119391030|sp|Q0B0S6|PTH_SYNWW Peptidyl-tRNA hydrolase (PTH) >gi|114336580|gb|ABI67428.1| peptidyl-tRNA hydrolase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (183 aa)
Score = 324, Expect = 1.0e-28, Identities = 63/182 (34%), Positives = 106/182 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGNPG +Y  T+HN+GF  ++EL + H +    S+++     +   ++++ + KP+T+MN SG+ V  +  ++K+    +LV+YDD+D   G +R++A G +GG  G++SI   + +    RIRIGIG+P       VL +FS  +   +Q AI KA  A   ++     D  MN +N
  S:     3 MLVGLGNPGKKYSHTRHNIGFKVLEELARRHQIEKEESRYDAIVGHLRINQEKLLLVKPLTFMNLSGKAVRPLFNWFKLELSELLVVYDDMDLPPGTVRIRASGGTGGHKGMQSICESLGSRDFPRIRIGIGRPPGGAIDWVLGEFSESEKPLMQDAIEKAASAIECWVKS-GIDASMNAYN 183
>gi|19704918|ref|NP_602413.1| peptidyl-tRNA hydrolase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|22095993|sp|Q8RIJ5|PTH_FUSNN Peptidyl-tRNA hydrolase (PTH) >gi|19712813|gb|AAL93712.1| Peptidyl-tRNA hydrolase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (191 aa)
Score = 323, Expect = 1.3e-28, Identities = 76/182 (41%), Positives = 113/182 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIH-EQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +V+GLGNPG +YEKT+HN+GF+ +D L K+  +     KF     + +   +++   KP T+MN SG  V EI  FYK+  +++I+VIYDD+D   G IR++ KGSSGG NGIKSIIS +  E I RI+ GIG    +   HVL +F+  +   + + + K  +   E L+  + D+IM K+N
  S:     3 VVIGLGNPGKKYEKTRHNIGFIAVDNLRKKFNISDEREKFQALVSEKNIDGEKVIFFKPQTFMNLSGNSVIEIINFYKLDPKKDIIVIYDDMDLSFGDIRIREKGSSGGHNGIKSIISHIGEEFI-RIKCGIGAKERDAVEHVLGEFNQTEQKDLDEILEKINNCVIEMLSVQNLDRIMQKYN 184
>gi|83320028|ref|YP_424097.1| peptidyl-tRNA hydrolase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|119390961|sp|Q2ST16|PTH_MYCCT Peptidyl-tRNA hydrolase (PTH) >gi|83283914|gb|ABC01846.1| peptidyl-tRNA hydrolase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (186 aa)
Score = 323, Expect = 1.3e-28, Identities = 74/182 (40%), Positives = 114/182 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +++GLGN G EYEKT+HN GF+ ID LL+++       +FN           ++   KP+T+MNNSG  V +I  FYKI   +++VI+DD D ++ +I+ K  GSS G NGIKSII+ +NT+   R+RIGI KP +   +   VL+KFS ++   ++++     +  N+F N+  F  +MNK+N
  S:     3 VIIGLGNIGKEYEKTRHNAGFIAIDLLLEKYKYNSIKEEFNSLVYTSIINNQKVLFVKPLTFMNNSGLTVKQIINFYKIDLNDLIVIHDDKDLNISRIQFKKDGSSAGHNGIKSIINNLNTQDFYRLRIGINKPANQWKIVDWVLSKFSDDELNLLKESFNNKSEFINDFTNNKTFTYLMNKYN 186
>gi|189346690|ref|YP_001943219.1| Aminoacyl-tRNA hydrolase [Chlorobium limicola DSM 245] >gi|189340837|gb|ACD90240.1| Aminoacyl-tRNA hydrolase [Chlorobium limicola DSM 245] (190 aa)
Score = 322, Expect = 1.6e-28, Identities = 73/182 (40%), Positives = 109/182 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGI---GKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEF-LNHVDFDKIMNKFN 186
           LV+GLGNP  +Y  T+HNVGF  ID L +   +     K    F K++     I + KPMTYMN SG  V     FYKI  Q+ILVI DD++   G +R++AKGS+GGQNG+K II  +  ++  R+R+GI    +P+ + +  VL KFS ++   +++ +    DA  +F +N +  +  MN +N
  S:     3 LVIGLGNPESKYSGTRHNVGFDVIDRLSESFQIPFTAGKGKYHFAKINWRNTAIVLLKPMTYMNLSGHAVVAAMNFYKIQRQDILVICDDLNLPSGTLRLRAKGSAGGQNGLKHIIECLGNDEFARMRVGIRLEDQPLSSFSSFVLGKFSEDEKKTMEKILPVCADAALDFSVNGI--EHAMNHYN 186
>gi|71894626|ref|YP_278734.1| peptidyl-tRNA hydrolase [Mycoplasma synoviae 53] >gi|119390964|sp|Q4A5E8|PTH_MYCS5 Peptidyl-tRNA hydrolase (PTH) >gi|71851414|gb|AAZ44023.1| peptidyl-tRNA hydrolase [Mycoplasma synoviae 53] (187 aa)
Score = 321, Expect = 2.1e-28, Identities = 75/182 (41%), Positives = 116/182 (63%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y+ T+HNVGF+ ID + ++  + L+  K +G + K +       IAKP TYMN SG FV E+  F+KI   +ILVI+D+ D ++GK  +K  GS G  NG+  +I+K+NT+  KR++IGIG+     L  +VL +FS E+   ++  + +A D C ++ +  D   +MNK+N
  S:     3 LIVGLGNPGDKYKFTRHNVGFLVIDLICQKLKITLDKEKTHGSYAKFED----FIIAKPNTYMNLSGNFVLELANFFKIAPDDILVIHDEKDFELGKSAIKIGGSGGSHNGVLDVINKLNTQNFKRLKIGIGQNQEMALKDYVLQRFSLEEFSVLEPVLNQAADVCIQY-SFNDIHYLMNKYN 180
>gi|53804632|ref|YP_113533.1| peptidyl-tRNA hydrolase [Methylococcus capsulatus str. Bath] >gi|68052909|sp|Q60A14|PTH_METCA Peptidyl-tRNA hydrolase (PTH) >gi|53758393|gb|AAU92684.1| peptidyl-tRNA hydrolase [Methylococcus capsulatus str. Bath] (187 aa)
Score = 318, Expect = 4.5e-28, Identities = 70/183 (38%), Positives = 112/183 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFL-NHVDFDKIMNKFNV 187
           L+VGLGNPG  Y++T+HN GF  ID L   H   L   S+F+G+   ++  E  + +  P+T+MN SG  V  + +FYKI  ++ILV++D++D   G +R+K  G  GG NG++ I++++ +    R+RIGIG+P  ++    +VL   S  D   +  AI KA    +E L  HV  +++MN+ +V
  S:     4 LIVGLGNPGPAYDRTRHNAGFWFIDRLAAAHGCVLREESRFHGRVGAINLTE-PVHLLAPLTFMNRSGLAVAAMARFYKIAPEHILVVHDELDFGPGVVRIKRDGGHGGHNGLRDIMAQLGSGGFLRLRIGIGRPAGSMAVADYVLAAPSVSDRQAISGAIEKALACLSELLAGHV--EQVMNRLHV 187
>gi|87306412|ref|ZP_01088559.1| peptidyl-tRNA hydrolase [Blastopirellula marina DSM 3645] >gi|87290591|gb|EAQ82478.1| peptidyl-tRNA hydrolase [Blastopirellula marina DSM 3645] (184 aa)
Score = 318, Expect = 4.9e-28, Identities = 67/182 (36%), Positives = 111/182 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV---HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           LVVGLGNPG +Y+KT+HNVGF  +D       +    +KFNG  +++   E++  +  P T+MNNSG  V     F+K+  +++LV+ DD +  VG +R ++ GS+GGQ G+  I+ K+ T  + R+RIGIG P+    ++T  VL KF+ ++  ++   + +A     +++ H D    MN++N
  S:     3 LVVGLGNPGPKYDKTRHNVGFEALDRFAAGSGV-TPRAKFNGNILELGVGEEKTILLYPHTFMNNSGTSVRAALDFFKLPSESVLVVCDDFNLPVGTLRFRSGGSAGGQKGLADILRKVGTNDVPRLRIGIG-PLPQSRDVTSFVLGKFAPQERAEIDFTLDRAIRGVADWIAH-DLKYCMNQYN 184
>gi|86608210|ref|YP_476972.1| peptidyl-tRNA hydrolase [Synechococcus sp. JA-2-3B'a(2-13)] >gi|119391025|sp|Q2JNF7|PTH_SYNJB Peptidyl-tRNA hydrolase (PTH) >gi|86556752|gb|ABD01709.1| peptidyl-tRNA hydrolase [Synechococcus sp. JA-2-3B'a(2-13)] (224 aa)
Score = 318, Expect = 5.4e-28, Identities = 72/186 (38%), Positives = 113/186 (60%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFS-AEDSI--KVQQAIIKAKDAC-NEFLNHVDFDKIMNKFN 186
           +S  LVVGLGNPG +Y  T+HN GFM +D L +   +  +   +F G + +      +  + KP TYMN SG+ V  +  +YK+   ++LV+YDD+D  +G++R++  GS+GG NG+KSII  + +E   R+R+G+GKP    ++  HVL  F+ AE  +  +V    ++A + C  E L        MN+FN
  S:    12 ISLQLVVGLGNPGPQYANTRHNCGFMVVDRLAQRWGIPLVLEKRFQGSYGEGFALGGKRRLLKPETYMNRSGQSVRAVLDWYKLDLASVLVVYDDMDLPLGRLRLRGSGSAGGHNGMKSIIQHLGSEAFPRLRLGVGKPKGSQDVVGHVLGGFAPAEQEVLERVLDVAVEAVECCWQEGLRTA-----MNRFN 199
>gi|30685853|ref|NP_173279.2| peptidyl-tRNA hydrolase family protein [Arabidopsis thaliana] >gi|134035412|sp|Q8GW64|PTHC_ARATH Peptidyl-tRNA hydrolase, chloroplast precursor (C-PTH) (288 aa)
Score = 318, Expect = 5.5e-28, Identities = 65/151 (43%), Positives = 95/151 (62%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMN-TEKIKRIRIGIGKPVHNL--THHVLTKFSAED 154
           +L+VGLGNPG +Y+ T+HNVGF  +D L     + +N   F   F K       I +AKP T+MN SGE V +I  FYKI  + +LV+YDD+D   GK+R+  KG  GG NG++SII ++  +    R+RIGIG+P   +   + VL +F+ ++
  S:    95 WLIVGLGNPGKKYQGTRHNVGFEMVDALADAEGISMNTVNFKALFGKGVIGNIPIMLAKPQTFMNLSGESVGQIVSFYKIPLKQVLVVYDDLDLPFGKLRLLPKGGHGGHNGMRSIIDRLKGSRDFPRLRIGIGRPPGKMDTANFVLRQFNRQE 248
>gi|42561470|ref|NP_975921.1| peptidyl-tRNA hydrolase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|68052964|sp|Q6MS28|PTH_MYCMS Peptidyl-tRNA hydrolase (PTH) >gi|42492969|emb|CAE77563.1| Peptidyl-tRNA hydrolase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (186 aa)
Score = 317, Expect = 6.0e-28, Identities = 72/182 (39%), Positives = 114/182 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +++GLGN G EYEKT+HN GF+ ID LL+++       +FN           ++ + KP+T+MNNSG  V +I  FYKI+  ++++I+DD D ++ +I+ K  GSS G NGIKSII+ + T+   R+RIG+ +      +   VL+KFS E+   ++Q+ I   +  N+F N+  F  +MNK+N
  S:     3 VIIGLGNIGKEYEKTRHNAGFIAIDLLLEKYNYSSVKQEFNSLIYTTIINNQKVLLVKPLTFMNNSGLAVRQIINFYKINLNDLIIIHDDKDLNISRIQFKKDGSSAGHNGIKSIINNLQTQNFYRLRIGVNQVPKEWKIVDWVLSKFSDEELNLLKQSFIDKIEFINDFTNNKTFIYLMNKYN 186
>gi|85707108|ref|ZP_01038196.1| peptidyl-tRNA hydrolase [Roseovarius sp. 217] >gi|85668394|gb|EAQ23267.1| peptidyl-tRNA hydrolase [Roseovarius sp. 217] (228 aa)
Score = 317, Expect = 7.4e-28, Identities = 61/151 (40%), Positives = 92/151 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDS 155
           L VGLGNPG +YE  +HN+GFM +D +  EH      SKF G   + D  +D++ + KPMT+MN SG+ V E  +FYK+   ++ V +D++D   GK+R K  G   G NG++S+   +  E   R+R+GIG P H   + H+VL  F+  ++
  S:     3 LFVGLGNPGAKYENNRHNIGFMALDRIADEHGFGPWRSKFQGMVSEGDLGDDKVILLKPMTFMNLSGQSVGEALRFYKLTPADVTVFHDELDLAPGKLRCKTGGGHAGHNGLRSLHQHIG-ETYGRVRLGIGHPGHKDRVAHYVLQDFAKSET 154
>gi|26453108|dbj|BAC43630.1| unknown protein [Arabidopsis thaliana] >gi|28950849|gb|AAO63348.1| At1g18440 [Arabidopsis thaliana] (288 aa)
Score = 313, Expect = 2.0e-27, Identities = 64/151 (42%), Positives = 95/151 (62%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMN-TEKIKRIRIGIGKPVHNL--THHVLTKFSAED 154
           +L+VGLGNPG +Y+ T+HNVGF  +D L     + +N   F   F K       I +AKP T+M+ SGE V +I  FYKI  + +LV+YDD+D   GK+R+  KG  GG NG++SII ++  +    R+RIGIG+P   +   + VL +F+ ++
  S:    95 WLIVGLGNPGKKYQGTRHNVGFEMVDALADAEGISMNTVNFKALFGKGVIGNIPIMLAKPQTFMDLSGESVGQIVSFYKIPLKQVLVVYDDLDLPFGKLRLLPKGGHGGHNGMRSIIDRLKGSRDFPRLRIGIGRPPGKMDTANFVLRQFNRQE 248
>gi|57234607|ref|YP_181337.1| peptidyl-tRNA hydrolase [Dehalococcoides ethenogenes 195] >gi|119390932|sp|Q3Z8W2|PTH_DEHE1 Peptidyl-tRNA hydrolase (PTH) >gi|57225055|gb|AAW40112.1| peptidyl-tRNA hydrolase [Dehalococcoides ethenogenes 195] (189 aa)
Score = 312, Expect = 2.2e-27, Identities = 68/182 (37%), Positives = 106/182 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-----NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L++GLGNPG EY   +HNVGF C+    K++ +  +      +       +++I +AKP TYMN SG+   ++ + Y +   +I+V+ DD+D   GKIR++  GS+GG NGI SII+ + T++  R++IGIGKP        +  HVL  F  E+   + +AI +A +A    L     D   N+FN
  S:     3 LIIGLGNPGKEYSGNRHNVGFQCLSRFAKDNHISFDKKCCLSRTGSGRINDEEIVLAKPQTYMNLSGKAASQLLRRYNLKAADIIVVQDDLDLPAGKIRLRLGGSAGGHNGISSIITDIGTKEFIRLKIGIGKPDSRNNGTEVVDHVLGNFGGEEREIMDKAITRASEALTCLLT-FGLDTASNRFN 188
>gi|110597362|ref|ZP_01385649.1| peptidyl-tRNA hydrolase [Chlorobium ferrooxidans DSM 13031] >gi|110340906|gb|EAT59377.1| peptidyl-tRNA hydrolase [Chlorobium ferrooxidans DSM 13031] (227 aa)
Score = 312, Expect = 2.3e-27, Identities = 71/182 (39%), Positives = 106/182 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGI---GKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEF----LNHVDFDKIMNKFN 186
           LV GLGNP   Y  T+HN+GF  ++++        +  K      K+   ++Q+ + KPMTYMN SG  V     FYKI   +ILVI DD++   G IR+++KGS+GGQNG+K II  + +++  R+RIGI    +P+ + +  VL KFS E+   +   +   +DA  +F    +NH      MN FN
  S:    40 LVAGLGNPESRYTGTRHNIGFEAVEKIADFFQEGFSAGKGKYLAAKIRHEKEQVILIKPMTYMNLSGHAVVAAMNFYKIAASDILVICDDLNLPAGSIRLRSKGSAGGQNGLKHIIESLGSDEFARLRIGIKPQDQPLGSFSSFVLGKFSEEERSVMAGVLPVCRDAALDFAVNGINHA-----MNHFN 223
>gi|119025661|ref|YP_909506.1| peptidyl-tRNA hydrolase [Bifidobacterium adolescentis ATCC 15703] >gi|166199308|sp|A1A141|PTH_BIFAA Peptidyl-tRNA hydrolase (PTH) >gi|118765245|dbj|BAF39424.1| peptidyl-tRNA hydrolase [Bifidobacterium adolescentis ATCC 15703] (199 aa)
Score = 311, Expect = 3.6e-27, Identities = 72/183 (39%), Positives = 109/183 (59%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK----FNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIG---KPVH---NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFD---KIMNKFN 186
           +L+ GLGNPG +YE T+HN+GFM  D L +  ++  ++ K         + +     + F+AKP+TYMN SG  V  I  +Y+I   +I+VI+DD+D D G+I+VKA GS+GG NGIKSI   + T K  R+R+G+G   +  H   N  + VL  F  +   ++ + +    DA    +    FD   K   +FN
  S:     6 WLIAGLGNPGSKYEGTRHNMGFMTADVLAERWSVNFSDHKGLAMLGKGVMNLSGRNVKFFLAKPLTYMNESGNAVASISAYYQIEPDHIVVIHDDMDLDFGRIKVKAGGSAGGHNGIKSIDRSLGTPKYARVRMGVGHAQRGAHAHDNTVNWVLGGFGPDQRKQLPEFLADGADAAETII----FDGLAKAQERFN 197
>gi|159902816|ref|YP_001550160.1| peptidyl-tRNA hydrolase [Prochlorococcus marinus str. MIT 9211] >gi|159887992|gb|ABX08206.1| Peptidyl-tRNA hydrolase [Prochlorococcus marinus str. MIT 9211] (206 aa)
Score = 309, Expect = 5.6e-27, Identities = 69/182 (37%), Positives = 107/182 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDEL-LKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL-------THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y  T+HNVGFM +++L  KE   F  + K  GQ  ++     +  +  P TYMN SG  V     ++ +   +IL+I DDID  +GK+R++ +G +GG NG+KSII+ + T+   R+R+GIGKPV            HVL  F++++ + +Q  + +     N  +  V  +K  N  N
  S:     9 LLVGLGNPGSKYSSTRHNVGFMVLEKLATKECASFSTSKKLFGQLAEIGIGAQKRRLLMPDTYMNESGRAVKAAMHWFGLQPNHILIIVDDIDLPLGKLRLRYQGGAGGHNGLKSIINNLGTQNFSRLRVGIGKPVIAFEEKQVRTVSHVLGAFNSKEQLVMQSVLNEVVLGLN-LIQEVGLEKAANHLN 197
>gi|34762679|ref|ZP_00143670.1| Peptidyl-tRNA hydrolase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887636|gb|EAA24714.1| Peptidyl-tRNA hydrolase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (191 aa)
Score = 308, Expect = 6.7e-27, Identities = 73/178 (41%), Positives = 108/178 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIH-EQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIM 182
           +V+GLGNPG +YE+T+HN+GF+ +D L K+  +     KF     + +   D++   KP T+MN SG  V EI  FYK+  +++I+VIYDD+D   G IR++ KGSSGG NGIKSIIS +  E I RI+ GIG    +   HVL +F+  +   + + +    +   E L   + D+IM
  S:     3 VVIGLGNPGKKYERTRHNMGFIVVDSLRKKLNINDEREKFQALVSEKNIDGDKVIFFKPQTFMNLSGNAVIEIINFYKLDPKKDIIVIYDDMDLSFGDIRIREKGSSGGHNGIKSIISHIGEEFI-RIKCGIGAKEKDAVEHVLGEFNQTEQKDLDEILEIVDNCVIEILTVQNLDRIM 180
>gi|33864102|ref|NP_895662.1| peptidyl-tRNA hydrolase [Prochlorococcus marinus str. MIT 9313] >gi|46576737|sp|Q7V4V4|PTH_PROMM Peptidyl-tRNA hydrolase (PTH) >gi|33635686|emb|CAE22010.1| Peptidyl-tRNA hydrolase [Prochlorococcus marinus str. MIT 9313] (206 aa)
Score = 308, Expect = 6.7e-27, Identities = 61/158 (38%), Positives = 100/158 (63%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-------VHNLTHHVLTKFSAEDSIKVQQAI 162
           L+VGLGNPG +Y  T+HN+GFM +D+L  + ++ F   +KF+G   +V    +++ +  P TYMN SG  +     ++ +    +LV+ DD+D  +G++R++A+GS+GG NG++S I  + T+   R+RIGIG P             HVL  FS ++S+ V Q +
  S:     8 LLVGLGNPGSKYVGTRHNIGFMALDKLAAQKSVSFRPQTKFHGLMAEVAVGSERVRLLMPQTYMNESGRAIRAAIDWFGLEVDQLLVLVDDMDLSLGRLRLRAQGSAGGHNGLRSAIQHLGTQDFCRLRIGIGAPGCTSEERRARTVSHVLGVFSRQESLLVDQVL 173
>gi|110634507|ref|YP_674715.1| peptidyl-tRNA hydrolase [Mesorhizobium sp. BNC1] >gi|119390958|sp|Q11GC5|PTH_MESSB Peptidyl-tRNA hydrolase (PTH) >gi|110285491|gb|ABG63550.1| peptidyl-tRNA hydrolase [Mesorhizobium sp. BNC1] (239 aa)
Score = 305, Expect = 1.5e-26, Identities = 62/150 (41%), Positives = 91/150 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAED 154
           L+ GLGNPG +Y+  +HNVGFM  D + + H+    + KF+    +     +++ + KP T+MN SG+ V E  +FYK+   +I+V YD++D   GK+RVK    SGG NGIKSI +    +  +R+RIGIG P     +T HVL  F+  D
  S:     3 LLAGLGNPGPQYQNHRHNVGFMAADAIFRRHSFSPWSKKFSALVAEGRVGTEKLLLVKPQTFMNLSGQAVGEAMRFYKLQPSDIIVFYDELDLAPGKVRVKRGSGSGGHNGIKSIDAHCG-QDYRRVRIGIGHPGDKARVTPHVLGDFAKAD 153
>gi|148655155|ref|YP_001275360.1| aminoacyl-tRNA hydrolase [Roseiflexus sp. RS-1] >gi|166229447|sp|A5US07|PTH_ROSS1 Peptidyl-tRNA hydrolase (PTH) >gi|148567265|gb|ABQ89410.1| peptidyl-tRNA hydrolase [Roseiflexus sp. RS-1] (217 aa)
Score = 305, Expect = 1.8e-26, Identities = 61/165 (36%), Positives = 103/165 (62%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIH-EQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGK--PVHNLTHHVLTKFSAEDSIKVQQAIIKAKDA 168
           +L+VGLGNPG  Y +T+HN+GF  + EL + H L   + + + +  +      ++ +A P TYMN SG+ V  + ++YKI     +LV+YDD+D   G +R++ +GS+G  NG++SII+ + ++   R+RIGI +  P  +L  +VL +F+ E   ++   + KA DA
  S:     2 WLIVGLGNPGDTYARTRHNIGFRVVSELAQRHRLEFTHKRAHARIAEGIIAGQRVALALPQTYMNLSGQAVVGLRQWYKIDPATELLVVYDDVDLPFGVLRLRERGSAGTHNGMRSIITLLGSQVFPRLRIGIDRPPPAWDLADYVLGRFTPEQEAQLPDIMQKAADA 169
>gi|94987180|ref|YP_595113.1| peptidyl-tRNA hydrolase [Lawsonia intracellularis PHE/MN1-00] >gi|119390955|sp|Q1MQD5|PTH_LAWIP Peptidyl-tRNA hydrolase (PTH) >gi|94731429|emb|CAJ54792.1| Peptidyl-tRNA hydrolase [Lawsonia intracellularis PHE/MN1-00] (201 aa)
Score = 304, Expect = 2.0e-26, Identities = 66/171 (38%), Positives = 105/171 (61%)
  Q:     3 KYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLF-LNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGK---PVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFL 173
           K ++ GLGNPG +YEKT+HN+GFM I++L+   +   L+  KF  +  K     D   +AKP TYMN SGE ++ + ++Y I + N+LVI+D++D  +GK++++  G + G NG+KSII  + T+   R+RIGIG+   P  N  + VL   S ++   +        DA + F+
  S:     4 KGIIAGLGNPGGQYEKTRHNIGFMVINKLITITSASKLSGKKFYCELWKTTTIIDNYLLAKPQTYMNLSGEAIHPLVEWYNITKDNLLVIHDELDLPIGKMKLQQGGGTAGHNGLKSIIHNLGTKDFYRLRIGIGRSPLPSENTVNWVLGHLSMKELTTLNNLFPTIFDALSFFI 178
>gi|116490295|ref|YP_809839.1| peptidyl-tRNA hydrolase [Oenococcus oeni PSU-1] >gi|116091020|gb|ABJ56174.1| peptidyl-tRNA hydrolase [Oenococcus oeni PSU-1] (190 aa)
Score = 304, Expect = 2.3e-26, Identities = 68/184 (36%), Positives = 105/184 (57%)
  Q:     3 KYLVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN---LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           K +VVGLGN G +Y   +HNVGFM +DEL  +    F      +         E+++++ KP T MN+SG  V  +  ++     +++V  DDID D G++R+K  G+SGG NG+KSI+S++ +++  RIRIG G+P HN   +  HVL  FS      VQ  I     A  + +N    + + N++N
  S:     2 KKIVVGLGNIGAKYAHNRHNVGFMAVDELAARLQANFSLKQNLHAFVASTHIEEEKVYLVKPTTMMNDSGIAVKAVLNYFGGDVNDLIVFVDDIDRDYGQLRIKKSGASGGHNGLKSIVSQIASQEFLRIRIGTGRPAHNPQAVIKHVLGDFSPLQLELVQPEIDNGVSAALDIINGTALNVVTNRYN 189
>gi|13507960|ref|NP_109909.1| peptidyl-tRNA hydrolase [Mycoplasma pneumoniae M129] >gi|2499986|sp|P78034|PTH_MYCPN Peptidyl-tRNA hydrolase (PTH) >gi|1674312|gb|AAB96258.1| peptidyl-tRNA hydrolase [Mycoplasma pneumoniae M129] (188 aa)
Score = 304, Expect = 2.3e-26, Identities = 68/182 (37%), Positives = 112/182 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGI-GKPVHNLTHH-VLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           LVVGLGN G +Y +T+HN GF  ID LL  + + L      G+F+ + +   ++ +AKP TYMN+SG+FV   C+ + I    ++V+YD++   +G +R+K +GS+   NGIKS+I+ +NTE   R+R GI      N+ H  V+++F+  +   ++ A+ KA +A   +++ V   K+M  FN
  S:     6 LVVGLGNLGKQYAETRHNAGFKVIDRLLSLYHVQLEERNNLGEFILLRK--HKVVLAKPNTYMNHSGKFVKWACQNWNIKPDKVMVVYDELAFPLGTVRLKMQGSANNHNGIKSVIAHLNTEHFNRLRFGIKSDNTSNILHEVVMSEFTPAERNLLETALTKAIEALKGYIDGVTMLKLMEVFN 187
>gi|113953631|ref|YP_729546.1| peptidyl-tRNA hydrolase [Synechococcus sp. CC9311] >gi|119391027|sp|Q0IDC6|PTH_SYNS3 Peptidyl-tRNA hydrolase (PTH) >gi|113880982|gb|ABI45940.1| peptidyl-tRNA hydrolase [Synechococcus sp. CC9311] (207 aa)
Score = 303, Expect = 2.8e-26, Identities = 61/164 (37%), Positives = 98/164 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTH-------HVLTKFSAEDSIKVQQAIIKAKDA 168
           LVVGLGNPG  Y  T+HNVGFM ++ L  +E   F +  K  GQ   +   + ++ +  P T+MN+SG  +     ++      +LV+ DD+D  +G++R++A+GS+GG NG+KS I  + T+   R+RIGIG P  N +        HVL  FS ++   + + +++  D 
  S:     8 LVVGLGNPGNRYANTRHNVGFMALERLASREGGGFRSMPKLQGQLADLGSGDKRLRLLMPQTFMNDSGRSIRAALDWFGFELHQLLVLVDDMDLPLGRLRLRARGSAGGHNGLKSTIQHLGTQDFARLRIGIGAPGQNPSERKARTVSHVLGSFSRDEEPLLDKVLLEVVDG 179
>gi|78357171|ref|YP_388620.1| peptidyl-tRNA hydrolase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|119390935|sp|Q30ZH1|PTH_DESDG Peptidyl-tRNA hydrolase (PTH) >gi|78219576|gb|ABB38925.1| peptidyl-tRNA hydrolase [Desulfovibrio desulfuricans G20] (201 aa)
Score = 303, Expect = 2.8e-26, Identities = 63/158 (39%), Positives = 96/158 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE---------HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAEDSIKVQQAI 162
           L+VGLGNPG EYE T+HN+GFM  D LL E          +L     K++              +AKP+T+MN SG+ V  IC FY+I  + ILV++D++D  +G+++ K  G   G NG+KSI  +  ++   R+R+GIGKP     T +VL +F  ++   V++ +
  S:     6 LIVGLGNPGKEYENTRHNLGFMLADALLDEVRRTAPHAVTSLGTGKKKYDLWKCAPLTGGSSWLVAKPLTFMNRSGDAVAHICGFYRIPPEKILVLHDELDLPLGRMKFKTAGGLAGHNGLKSIAERTGSKDFHRLRLGIGKPQSGQTTGYVLGRFGKDEQALVEKVL 173
>gi|33864807|ref|NP_896366.1| peptidyl-tRNA hydrolase [Synechococcus sp. WH 8102] >gi|46576729|sp|Q7U9I5|PTH_SYNPX Peptidyl-tRNA hydrolase (PTH) >gi|33632330|emb|CAE06786.1| putative peptidyl-tRNA hydrolase (PTH) [Synechococcus sp. WH 8102] (203 aa)
Score = 302, Expect = 3.8e-26, Identities = 60/154 (38%), Positives = 95/154 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN-------LTHHVLTKFSAEDSIKV 158
           LVVGLGNPG +YE T+HN+GFM ++++  +E   F   SK +G   +    E ++ +  P TYMN+SG  +     ++    + +LV+ DD+D  +G++R++ +GS+GG NG++S I  + T+   R+RIGIG P  N          HVL  FS  +  +V
  S:     7 LVVGLGNPGTKYEGTRHNIGFMALEQMASREGFSFRQQSKLHGLVAEHGIGESRLRLLMPQTYMNDSGRSIRAALDWFGFTPEQLLVLVDDMDIPLGRLRLRGQGSAGGHNGLRSTIQHLGTQAFPRLRIGIGAPADNPAERRARTVSHVLGSFSRAEQPEV 168
>gi|89898002|ref|YP_515112.1| peptidyl-tRNA hydrolase [Chlamydophila felis Fe/C-56] >gi|119390923|sp|Q255S1|PTH_CHLFF Peptidyl-tRNA hydrolase (PTH) >gi|89331374|dbj|BAE80967.1| tRNA hydrolase peptidyl [Chlamydophila felis Fe/C-56] (183 aa)
Score = 302, Expect = 3.9e-26, Identities = 60/161 (37%), Positives = 94/161 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHT--LFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH---NLTHHVLTKFSAEDSIKVQQAIIKA 165
           LVV +GNPG +Y  T+HN+GF+C D LL+E +   F    K      KV+  +  +   KP TY+N SG+ V  + ++Y I    ILV+ DD++   GK+R++     GG  GIKSI   + +    ++R+G+G+P      L+  VL +F+ E+ I +Q   I+A
  S:     4 LVVAIGNPGRQYTWTRHNIGFLCADRLLQEFSGVHFKETPKLFSDIAKVESSQGTVIFIKPRTYVNLSGKAVLAVKEYYNIATDRILVLADDVNQPFGKVRLRQSAGGGGHKGIKSITQSLGSNDYWQLRLGVGRPQREDVELSDFVLGQFTEEEQIGIQSLFIEA 169
>gi|15644374|ref|NP_229426.1| peptidyl-tRNA hydrolase [Thermotoga maritima MSB8] >gi|7388026|sp|Q9X1W1|PTH_THEMA Peptidyl-tRNA hydrolase (PTH) >gi|4982199|gb|AAD36693.1|AE001806_3 peptidyl-tRNA hydrolase [Thermotoga maritima MSB8] (186 aa)
Score = 302, Expect = 3.9e-26, Identities = 74/182 (40%), Positives = 113/182 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQ----FVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIG-KPV-HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +VVGLGNPG  Y  T+HNVGF+ +D        FL N  +  +    + K++   +++ + KP+TYMN SG  +  + KF+     +I+V+YDD+   +GKIR++ KGS GG NG+KSII  + T++IKRIR+GIG KP   +L + VL +FS E+ I + +     K+A    L     +K M+ +N
  S:     2 VVVGLGNPGPRYAFTRHNVGFLFLD--------FLKNKDWKTEKYFAWNKINLAGNEVALVKPLTYMNLSGLAMPHVLKFFSASLDDIIVVYDDVSLKLGKIRIRKKGSDGGHNGMKSIIQALGTQEIKRIRVGIGDKPEGMDLVNFVLGEFSDEEWIILNKVFEVMKEALEVILVE-GIEKAMSIYN 180
>gi|78187065|ref|YP_375108.1| peptidyl-tRNA hydrolase [Pelodictyon luteolum DSM 273] >gi|119390974|sp|Q3B3L6|PTH_PELLD Peptidyl-tRNA hydrolase (PTH) >gi|78166967|gb|ABB24065.1| peptidyl-tRNA hydrolase [Pelodictyon luteolum DSM 273] (190 aa)
Score = 301, Expect = 4.6e-26, Identities = 64/182 (35%), Positives = 106/182 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGI---GKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L++GLGNP   Y  T+HN+GF  +D L        ++ K      K+   ++ + + KP TYMN SG  V     F+K+ + +ILV+ DD++   G +R++AKGS+GGQNG+K II  + +++  R+RIGI     P  + +  VL KFSAE+ + + + +   ++A  +F  +   +  MN +N
  S:     3 LIIGLGNPESRYNNTRHNIGFDLVDSLAAAFGSSFSSGKGKYLAAKITHRQETLMLIKPTTYMNLSGHAVVAAMNFHKVQKNDILVVCDDLNLPSGTMRLRAKGSAGGQNGLKHIIESLGSDEFARLRIGIRLGEMPPGSFSSFVLGKFSAEERVVMDRTLESCREAVLDFAKN-GIEHAMNHYN 186
>gi|59800823|ref|YP_207535.1| peptidyl-tRNA hydrolase [Neisseria gonorrhoeae FA 1090] >gi|194098115|ref|YP_002001163.1| peptidyl-tRNA hydrolase [Neisseria gonorrhoeae NCCP11945] >gi|68052868|sp|Q5F9L4|PTH_NEIG1 Peptidyl-tRNA hydrolase (PTH) >gi|59717718|gb|AAW89123.1| putative peptidyl-tRNA hydrolase [Neisseria gonorrhoeae FA 1090] >gi|193933405|gb|ACF29229.1| peptidyl-tRNA hydrolase [Neisseria gonorrhoeae NCCP11945] (192 aa)
Score = 301, Expect = 5.1e-26, Identities = 69/170 (40%), Positives = 105/170 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLN 174
           +VVGLGNPG EYE+T+HN GF  +DEL  K    F    KF G+  +   P+  +++ KP T+MN SG+ V  + +FYKI  + ILV++D++D   G+I+ K  G +GG NG+K I +K+ T    R+R+GIG P     +  +VL K SAE   ++  A+ K+  A  + ++
  S:     7 MVVGLGNPGKEYEQTRHNAGFWFLDELAWKWKASFKEEKKFFGEVARAALPDGDVWLLKPATFMNRSGQAVAALAQFYKIKPEEILVVHDELDIPCGRIKFKLGGGNGGHNGLKDIQAKLGTADYYRLRLGIGHPGDRNLVVGYVLNKPSAEHRRQIDDAVAKSLQAVPDIIS 179
>gi|27382551|ref|NP_774080.1| peptidyl-tRNA hydrolase [Bradyrhizobium japonicum USDA 110] >gi|46576801|sp|Q89DJ9|PTH_BRAJA Peptidyl-tRNA hydrolase (PTH) >gi|27355723|dbj|BAC52705.1| peptidyl-tRNA hydrolase [Bradyrhizobium japonicum USDA 110] (201 aa)
Score = 301, Expect = 5.2e-26, Identities = 59/151 (39%), Positives = 93/151 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTH-HVLTKFSAEDS 155
           L VGLGNPG +Y + +HN+GFM +DE+ + H       +F G+  +     +++ + KP TYMN+SG  V E   F+KI   ++ V +D+++   GK+RVK  G   G NG++SI + +  +  +R+R+GIG P V  L H HVL+ F+  D+
  S:     3 LFVGLGNPGAKYARNRHNIGFMAVDEIARRHGFSPWRRRFQGETSEGALGTERVILLKPTTYMNDSGRSVQEAAGFFKIAPGDVTVFHDELELPPGKVRVKVGGGIAGHNGLRSISAHIGND-YRRVRLGIGHPGVKELVHGHVLSDFAKADN 154
>gi|78211817|ref|YP_380596.1| peptidyl-tRNA hydrolase [Synechococcus sp. CC9605] >gi|119391029|sp|Q3AMZ1|PTH_SYNSC Peptidyl-tRNA hydrolase (PTH) >gi|78196276|gb|ABB34041.1| peptidyl-tRNA hydrolase [Synechococcus sp. CC9605] (205 aa)
Score = 300, Expect = 5.8e-26, Identities = 65/161 (40%), Positives = 97/161 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHT--LFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN-------LTHHVLTKFSAEDSIKVQQAIIKA 165
           LVVGLGNPG +Y  T+HN+GFM + ELL E +   F   +K +G        E ++ +  P TYMN+SG  +     ++ +    +LV+ DD+D  +G++R++A+GS+GG NG++S I  + T+   R+RIGIG P  N          HVL  FS     KV+Q  + A
  S:     7 LVVGLGNPGAKYAGTRHNIGFMAL-ELLGERSGFSFRQQAKLHGLAADTGVGEQRLRLLMPQTYMNDSGRAIRAALDWFGLEPHQLLVLVDDMDLPLGRLRLRAQGSAGGHNGLRSTIQHLGTQAFPRLRIGIGAPAENPAERRVRTVSHVLGPFS-----KVEQPCVGA 170
>gi|62422026|gb|AAX82595.1| putative peptidyl-tRNA hydrolase [Lactobacillus reuteri] (186 aa)
Score = 300, Expect = 5.8e-26, Identities = 69/182 (37%), Positives = 113/182 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPE---------DQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGN G  Y++T+HN GFM +D+L +++ L        G F  + Q           +++ + KP T+MN+SG     +  +Y I   +++++ DD+D   GK+R+K  G+SGG NG+KSIIS + T+   R++ GI  P H  +  HVL +FS E+  K  QA  +A+ A  +++N  +F K+MN +N
  S:     3 MIVGLGNIGTRYDETRHNTGFMVVDQLARDYHL--------GAFTHLKQEAVAVSGVINGEKVMLVKPTTFMNDSGRAGGPLVDYYDIDLDDLVIVNDDLDMPGGKVRLKTHGASGGDNGLKSIISALGTKNFNRVKGGIDHPQHGTVGSHVLGEFSKEERAKFDQAGEQAEHALEDWINGENFAKLMNAYN 186
>gi|82701725|ref|YP_411291.1| peptidyl-tRNA hydrolase [Nitrosospira multiformis ATCC 25196] >gi|119390969|sp|Q2YBH2|PTH_NITMU Peptidyl-tRNA hydrolase (PTH) >gi|82409790|gb|ABB73899.1| peptidyl-tRNA hydrolase [Nitrosospira multiformis ATCC 25196] (191 aa)
Score = 299, Expect = 8.0e-26, Identities = 61/158 (38%), Positives = 95/158 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAI 162
           L+VGLGNPG EY  T+HN G   +  L  +  + L  + KF+G   ++ Q E + ++  P TYMN SG  V  +C+FY+I  + +LV++D++D   G  R+K  G  GG NG+K I++ + T +  R+RIGIG P   H + ++VL     E++  +  AI
  S:     3 LIVGLGNPGREYAATRHNAGAWWVVRLADQLGVTLKADGKFHGLCARIGQGESESWLLNPQTYMNASGRAVAALCRFYRIQPEQMLVVHDELDLPPGVSRLKLDGGLGGHNGLKDIVAHLGTREFWRLRIGIGHPGEKHAVVNYVLQPPRKEEAALIDTAI 163
>gi|15793960|ref|NP_283782.1| peptidyl-tRNA hydrolase [Neisseria meningitidis Z2491] >gi|14195079|sp|Q9JV42|PTH_NEIMA Peptidyl-tRNA hydrolase (PTH) >gi|121051921|emb|CAM08227.1| putative peptidyl-tRNA hydrolase [Neisseria meningitidis Z2491] (192 aa)
Score = 298, Expect = 1.1e-25, Identities = 69/169 (40%), Positives = 103/169 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFL 173
           +VVGLGNPG EYE+T+HN GF  +DEL  K    F    KF G+  +   P+  +++ KP T+MN SG+ V  + +FYKI  + ILV++D++D   G+I+ K  G +GG NG+K I +K+ T    R+R+GIG P     +  +VL K S E   ++  A+ K+  A  + L
  S:     7 MVVGLGNPGKEYEQTRHNAGFWFLDELAWKWKASFKEEKKFFGEVARATLPDGDVWLLKPTTFMNRSGQAVAALAQFYKIKPEEILVVHDELDIPCGRIKFKLGGGNGGHNGLKDIQAKLGTADYYRLRLGIGHPGDRNLVVGYVLNKPSTEHRRQIDDAVAKSLQAIPDIL 178
>gi|15676693|ref|NP_273837.1| peptidyl-tRNA hydrolase [Neisseria meningitidis MC58] >gi|121634588|ref|YP_974833.1| peptidyl-tRNA hydrolase [Neisseria meningitidis FAM18] >gi|166229428|sp|A1KT53|PTH_NEIMF Peptidyl-tRNA hydrolase (PTH) >gi|14195080|sp|Q9K029|PTH_NEIMB Peptidyl-tRNA hydrolase (PTH) >gi|7226028|gb|AAF41208.1| peptidyl-tRNA hydrolase [Neisseria meningitidis MC58] >gi|120866294|emb|CAM10035.1| putative peptidyl-tRNA hydrolase [Neisseria meningitidis FAM18] (192 aa)
Score = 298, Expect = 1.1e-25, Identities = 69/169 (40%), Positives = 103/169 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFL 173
           +VVGLGNPG EYE+T+HN GF  +DEL  K    F    KF G+  +   P+  +++ KP T+MN SG+ V  + +FYKI  + ILV++D++D   G+I+ K  G +GG NG+K I +K+ T    R+R+GIG P     +  +VL K S E   ++  A+ K+  A  + L
  S:     7 MVVGLGNPGKEYEQTRHNAGFWFLDELAWKWKASFKEEKKFFGEVARAALPDGDVWLLKPATFMNRSGQAVAALAQFYKIKPEEILVVHDELDIPCGRIKFKLGGGNGGHNGLKDIQAKLGTADYYRLRLGIGHPGDRNLVVGYVLNKPSTEHRRQIDDAVAKSLQAIPDIL 178
>gi|83588952|ref|YP_428961.1| peptidyl-tRNA hydrolase [Moorella thermoacetica ATCC 39073] >gi|119390960|sp|Q2RMC1|PTH_MOOTA Peptidyl-tRNA hydrolase (PTH) >gi|83571866|gb|ABC18418.1| peptidyl-tRNA hydrolase [Moorella thermoacetica ATCC 39073] (190 aa)
Score = 297, Expect = 1.5e-25, Identities = 69/182 (37%), Positives = 110/182 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +VVGLGNPG  Y  T+HN GFM +D L  +  + L+ ++      +     +++ + KP TYMNNSG+ V  + ++Y I  + ILVI+DD+D   G++R++  GSSGG  G++SII+ + T  + R++IGIG+P    N+  +VL  FS  D   ++  +++A  A    L     D+ MN+FN
  S:     6 MVVGLGNPGPRYATTRHNAGFMVVDLLADDLGITLDRTREQALTGQGLVGNNRVLLVKPQTYMNNSGQAVAPLARWYGIAPEAILVIHDDLDLAPGRLRLRRGGSSGGHRGLQSIITHLGTTAVPRLKIGIGRPPLGQNVIDYVLKPFSEGDWELIRPVLLEAARAARFLLEGGSMDEAMNRFN 189
>gi|194336257|ref|YP_002018051.1| Aminoacyl-tRNA hydrolase [Pelodictyon phaeoclathratiforme BU-1] >gi|194308734|gb|ACF43434.1| Aminoacyl-tRNA hydrolase [Pelodictyon phaeoclathratiforme BU-1] (190 aa)
Score = 297, Expect = 1.5e-25, Identities = 71/182 (39%), Positives = 106/182 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT---HHVLTKFSAEDSIKVQQAIIKAKDACNEF-LNHVDFDKIMNKFN 186
           L+VGLGNP   Y  T+HN+GF  ++++        +  K      K+    +Q+ I KPMTYMN SG  V     FYKI   +IL+I DD++   G IR++AKGS+GGQNG+K II  + +E+  R+RIGI     +LT     VL KFS  + + +++ +    DA  +F +N +  +  MN +N
  S:     3 LIVGLGNPESRYIGTRHNIGFSAVEKIAASFGANFSKGKGKSLEAKITHRGEQVIIIKPMTYMNLSGHAVVAAMNFYKIVRNDILIICDDLNLPSGTIRLRAKGSAGGQNGLKHIIESLGSEEFARLRIGIRVDETSLTSFSSFVLGKFSENEKVVMEKILPITSDAALDFTINGI--EHAMNNYN 186
>gi|46579984|ref|YP_010792.1| peptidyl-tRNA hydrolase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120602604|ref|YP_967004.1| peptidyl-tRNA hydrolase [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166199329|sp|A1VDR1|PTH_DESVV Peptidyl-tRNA hydrolase (PTH) >gi|68052972|sp|Q72BR1|PTH_DESVH Peptidyl-tRNA hydrolase (PTH) >gi|46449400|gb|AAS96051.1| peptidyl-tRNA hydrolase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120562833|gb|ABM28577.1| peptidyl-tRNA hydrolase [Desulfovibrio vulgaris subsp. vulgaris DP4] (201 aa)
Score = 297, Expect = 1.6e-25, Identities = 68/173 (39%), Positives = 98/173 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE--HTLFLNNSKFNGQFVKVD-------QPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVD 177
           L++GLGNPG EY++T+HN GFM ID LL+E     F    + +G   K D       + +    +AKP T+MN SGE V  I  FY++    ++V +D++D  +G++R K  G + G NG+KSI   + T    R+R+GIGKP      T  VL +FS  D+  V   +  A      F    D
  S:     6 LIIGLGNPGREYDRTRHNFGFMFIDALLEEAQRNPFARCEQLSGGKKKYDLWRCDIVEGQAPWLLAKPQTFMNLSGEAVLAIASFYRVKPAAMVVAHDELDLPLGRMRFKMGGGNAGHNGLKSITQCLGTPDFHRLRLGIGKPPAGGETTGWVLGRFSQSDTAMVDAVLEAAIQGIRTFATEGD 189
>gi|196157383|ref|YP_002126872.1| peptidyl-tRNA hydrolase [Alteromonas macleodii 'Deep ecotype'] >gi|88771893|gb|EAR03208.1| peptidyl-tRNA hydrolase [Alteromonas macleodii 'Deep ecotype'] >gi|196113162|gb|ACG66878.1| peptidyl-tRNA hydrolase [Alteromonas macleodii 'Deep ecotype'] (193 aa)
Score = 296, Expect = 1.7e-25, Identities = 71/182 (39%), Positives = 106/182 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG EYE T+HN G   +++L   +   L   +KF G+  ++      I +  P T+MN SG+ V  +  FY+I  + ILV +D++D   G  + K  GSS  QNG++ I+++M N +   R+RIGIG P H   +T HVL K SAE+   ++ AI +A   C E L   D  +  N+ +
  S:     6 LIVGLGNPGPEYENTRHNAGEWFLNQLADTYNAPLKPETKFFGKTARITIDGKDIRLLYPTTFMNKSGQAVAALANFYRIEPEQILVAFDELDLPPGVAKYKVGGSSS-QNGVRDIVARMGNNKNFLRLRIGIGHPGHKSRVTGHVLGKPSAEEKTAIESAIDEAV-RCTEILLKEDLKQAQNRLH 189
>gi|75676695|ref|YP_319116.1| peptidyl-tRNA hydrolase [Nitrobacter winogradskyi Nb-255] >gi|119390971|sp|Q3SPM7|PTH_NITWN Peptidyl-tRNA hydrolase (PTH) >gi|74421565|gb|ABA05764.1| peptidyl-tRNA hydrolase [Nitrobacter winogradskyi Nb-255] (202 aa)
Score = 296, Expect = 1.8e-25, Identities = 57/147 (38%), Positives = 92/147 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTH-HVLTKFS 151
           L VGLGNPG +Y+  +HN+GFM +DE+ + H       +F G+  +     +++ + KP TYMNNSG  V +  +F+K+ E +++V +D+I+    K+RVK  G   G NG++SI + +  +  +R+R+G+G P V  L H HVL  F+
  S:     3 LFVGLGNPGTKYQGNRHNIGFMVVDEIARRHGFAPWRRRFQGEASEGTLDRERVIVLKPATYMNNSGNAVQDAVQFFKLKEADVVVFHDEIELPPAKVRVKVGGGIAGHNGLRSISAHIGND-YRRVRLGVGHPGVKELVHAHVLNDFA 150
>gi|15829252|ref|NP_326612.1| peptidyl-tRNA hydrolase [Mycoplasma pulmonis UAB CTIP] >gi|21263857|sp|Q98PE2|PTH_MYCPU Peptidyl-tRNA hydrolase (PTH) >gi|14090196|emb|CAC13954.1| PEPTIDYL-TRNA HYDROLASE (PTH) [Mycoplasma pulmonis] (186 aa)
Score = 296, Expect = 1.8e-25, Identities = 79/179 (44%), Positives = 120/179 (67%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN-LTHHVLTKFSAEDSIKVQQAIIKAKDAC-----NEFLNHVDFDKIMN 183
           L+VGLGNPG EY+KT+HN+GFM ID++ ++  + L+  KFNG F K     +   I+KP+TYMNNSG FVY+I  F+ I   NI++IYD+ID  VG+  +K KGS+ GQ G++SII K+ TE IKRI+IG+ +P++  ++ ++L K    +    ++ I +  D       N+F   ++  K+ N
  S:     3 LIVGLGNPGDEYDKTRHNLGFMVIDKIAEKLNVKLDKEKFNGIFYK----GENYIISKPLTYMNNSGNFVYDIKNFFDIEIDNIIIIYDEIDLKVGQASIKIKGSANGQRGMQSIIEKLKTENIKRIKIGVSRPLYEPVSSYILKKIPENEKETFEKVIDELADKLLTYIFNDFKTFINVSKLKN 183
>gi|110004198|emb|CAK98536.1| probable peptidyl-trna hydrolase protein [Spiroplasma citri] (189 aa)
Score = 296, Expect = 1.9e-25, Identities = 73/182 (40%), Positives = 107/182 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHH-VLTKFS-AEDSIKVQQAIIKAKDACNEFL-NHVDFDKIMNKFN 186
           L+VGLGNPG EY  T+HN+GF+ I +L+ +  L    + FN    +     +++   +P T+MN SG  VY+I +FYK+  ++I+VIYDD D     I++K  GSS G NGIK +I K+ +E   RIRIGIGK     T + VL  FS A+  I     + +      ++L     FDK+M+ +N
  S:     3 LIVGLGNPGNEYTYTRHNIGFLAIAKLVDKFDLAKPKNAFNALIWETTINNEKVLFCQPQTFMNLSGTAVYQIKQFYKLIWEDIIVIYDDKDIPFNVIKLKKNGSSAGHNGIKDLIQKLGSENFLRIRIGIGKDFQIPTRNWVLGNFSPAQLEIINNDLLERVYQIMVQYLVKATSFDKLMSLYN 187
>gi|78778637|ref|YP_396749.1| peptidyl-tRNA hydrolase [Prochlorococcus marinus str. MIT 9312] >gi|119390977|sp|Q31CT2|PTH_PROM9 Peptidyl-tRNA hydrolase (PTH) >gi|78712136|gb|ABB49313.1| peptidyl-tRNA hydrolase [Prochlorococcus marinus str. MIT 9312] (200 aa)
Score = 296, Expect = 1.9e-25, Identities = 75/186 (40%), Positives = 109/186 (58%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-------NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           M++  ++GLGNPG +Y  ++HN+GF+ ++ L K++ + FL   K    + +    +    +  P T+MNNSGE V  I  +YKI+   I VI DD D  +GKIR + KGSSGG NG+KSII K+ T    RIRIGIG P         N   HVL   S E+   + +  ++  ++  E LN    + I+NK N
  S:     1 MNEIYLIGLGNPGKKYSNSRHNIGFLLLENLSKKYNSSFLLKDKLKSFYSEFKANDSTYRLFLPNTFMNNSGEAVLAILDWYKINLNQIFVIVDDKDLPLGKIRFRKKGSSGGHNGLKSIIEKLQTHDFNRIRIGIGSPPSTKETNNFNTISHVLGNISREEKSILDKVYVRVIESL-EQLNTKKEEYIINKLN 193
>gi|88808009|ref|ZP_01123520.1| peptidyl-tRNA hydrolase [Synechococcus sp. WH 7805] >gi|88788048|gb|EAR19204.1| peptidyl-tRNA hydrolase [Synechococcus sp. WH 7805] (201 aa)
Score = 295, Expect = 2.4e-25, Identities = 58/150 (38%), Positives = 91/150 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN-------LTHHVLTKFSAED 154
           +VVGLGNPG  Y  T+HNVGF  +++L  +EH  F   +K  G    +    D++ +  P T+MN SG  +     ++ +    ++V+ DD+D  +G++R++A+GS+GG NG+KS I  + T+   R+RIGIG P  +          HVL  FS E+
  S:     1 MVVGLGNPGDRYASTRHNVGFRVLEQLAAQEHARFRAMAKLQGDLANIGAGPDRLRLLMPKTFMNESGRSIRATLDWFGLSLGQVIVLVDDMDLPLGRLRLRARGSAGGHNGLKSTIQHLGTQDFARLRIGIGAPGRSPEERRARTVSHVLGAFSREE 158
>gi|49473973|ref|YP_032015.1| peptidyl-tRNA hydrolase [Bartonella quintana str. Toulouse] >gi|68052956|sp|Q6G0F9|PTH_BARQU Peptidyl-tRNA hydrolase (PTH) >gi|49239476|emb|CAF25828.1| Peptidyl-tRNA hydrolase [Bartonella quintana str. Toulouse] (193 aa)
Score = 294, Expect = 2.8e-25, Identities = 62/151 (41%), Positives = 93/151 (61%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTH-HVLTKFSAED 154
           +L+ GLGNPGL+Y+  +HN+GFM ID + +  +    + KF  +        ++ F+ KP T+MN SG+ + E+ +FYK+  +N +VI D++D   GK+RVK  G + G NGIKSI +   T+   R+R+GIG P    L H HVL  F+  D
  S:     2 WLIAGLGNPGLQYQNNRHNIGFMVIDAIYQSFSFSPWSKKFQAEISNGLIDGEKTFLIKPQTFMNLSGQAIGEVLRFYKLDLKNFIVICDELDLPPGKVRVKTAGGNNGHNGIKSIDAHCGTDYC-RVRLGIGHPGSKELVHQHVLGNFTKSD 153
>gi|145222528|ref|YP_001133206.1| peptidyl-tRNA hydrolase [Mycobacterium gilvum PYR-GCK] >gi|189038156|sp|A4T6N5|PTH_MYCGI Peptidyl-tRNA hydrolase (PTH) >gi|145215014|gb|ABP44418.1| peptidyl-tRNA hydrolase [Mycobacterium gilvum PYR-GCK] (192 aa)
Score = 294, Expect = 2.8e-25, Identities = 63/164 (38%), Positives = 97/164 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQ-IFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDA 168
           LVVGLGNPG +Y  T+HN+GFM  D L           K +G  V   +   + + +AKP  YMN SG  V  + KFY I   ++++I+D++D D G+IR+KA G   G NG++S+ S ++T   +R+R+GIG+P    +    VL  F++ +  ++   I +A DA
  S:     6 LVVGLGNPGPQYATTRHNIGFMVADVLADRMGETFKVHKKSGAEVTTGRLAGRPVVLAKPRVYMNESGRQVGPLAKFYSIAPTDVVIIHDELDIDFGRIRLKAGGGVAGHNGLRSVGSALSTNDFQRVRVGIGRPPGQKSGASFVLEPFNSRERPELGTIIEQAADA 172
>gi|32266994|ref|NP_861026.1| peptidyl-tRNA hydrolase [Helicobacter hepaticus ATCC 51449] >gi|46576744|sp|Q7VG29|PTH_HELHP Peptidyl-tRNA hydrolase (PTH) >gi|32263046|gb|AAP78092.1| peptidyl-tRNA hydrolase [Helicobacter hepaticus ATCC 51449] (223 aa)
Score = 294, Expect = 3.0e-25, Identities = 70/180 (38%), Positives = 106/180 (58%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDK 180
           M   LV GLGNP  +Y+ T+HN+GFM +D L KE    F  + KFN +   ++    ++F  KP T+MN SGE +    +++ I   +  VI+DDID   G +R K  GSSGG NG+KSI S M  +   R+R G+G+  + N+  +VL+ F+A++  +++  I  AK+A   F N   + K
  S:     1 MPCLLVAGLGNPSAKYQNTRHNIGFMVLDFLSKELDFDFSFDKKFNAEVGAINIGPHKVFFLKPQTFMNLSGEAINPFVRYFDI--THTFVIHDDIDIGFGDMRFKYGGSSGGHNGLKSIDSFMG-DTYFRLRFGVGRSANKNVVEYVLSDFNAQEREQLEGLIAHAKEAVMSFCNMAQYPK 179
>gi|85716024|ref|ZP_01047001.1| peptidyl-tRNA hydrolase [Nitrobacter sp. Nb-311A] >gi|85697222|gb|EAQ35103.1| peptidyl-tRNA hydrolase [Nitrobacter sp. Nb-311A] (204 aa)
Score = 294, Expect = 3.2e-25, Identities = 57/147 (38%), Positives = 92/147 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTH-HVLTKFS 151
           L VGLGNPG +Y+  +HN+GFM +DE+ + H       +F G+  +     +++ + KP TYMNNSG  V +  +F+K+ E +++V +D+I+    K+RVK  G   G NG++SI + +     +R+R+G+G P V +L H HVL  F+
  S:     3 LFVGLGNPGTKYQGNRHNIGFMVVDEIARRHGFAPWRRRFQGEASEGTLDRERVILLKPATYMNNSGNAVQDAVRFFKLTEGDVVVFHDEIELPSAKVRVKVGGGIAGHNGLRSISAHIGN-GYRRVRLGVGHPGVKDLVHAHVLNDFA 150
>gi|87125090|ref|ZP_01080937.1| Peptidyl-tRNA hydrolase [Synechococcus sp. RS9917] >gi|86167410|gb|EAQ68670.1| Peptidyl-tRNA hydrolase [Synechococcus sp. RS9917] (207 aa)
Score = 294, Expect = 3.3e-25, Identities = 62/163 (38%), Positives = 101/163 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN-------LTHHVLTKFS-AEDSI--KVQQAIIKAKD 167
           L+VGLGNPG  Y  T+HNVGFM ++ L + + + F + +K  GQ  ++     ++ +  P T+MN SG  +     +++     +LV+ DD+D  +G++R++AKG +GG NG++S I  + TE   R+RIGIG P             HVL +FS AE  +  +V +A+++  D
  S:     8 LLVGLGNPGDRYHGTRHNVGFMALEALARRNASAFRSMAKLQGQVAEIGFGPGRLRLLMPQTFMNESGRSIRAALDWFQFDVNQVLVVVDDMDLPLGRLRLRAKGGAGGHNGLRSTIQHLGTEAFARLRIGIGAPGRTAEERRARTVSHVLGRFSQAEQPLLDQVIEAVVQGVD 181
>gi|145219565|ref|YP_001130274.1| peptidyl-tRNA hydrolase [Prosthecochloris vibrioformis DSM 265] >gi|189038158|sp|A4SE63|PTH_PROVI Peptidyl-tRNA hydrolase (PTH) >gi|145205729|gb|ABP36772.1| peptidyl-tRNA hydrolase [Prosthecochloris vibrioformis DSM 265] (190 aa)
Score = 293, Expect = 3.6e-25, Identities = 68/182 (37%), Positives = 103/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIG---KPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDF-----DKIMNKFN 186
           L++GLGNP   Y  T+HN+GF  ++ L        +  K      K+    +Q+ + KPMTYMN SG  V     F+K    +ILVI DD++   G +R+++KGS+GGQNG+K II  + +E+  R+RIGIG   KP    +  VL KFS ++    +  + +  + C E +  +DF        MN +N
  S:     3 LIIGLGNPEARYSNTRHNIGFEAVEALAAAFGAPFSKGKGKYLVAKIRHRGEQLMLVKPMTYMNLSGHAVVAAMNFHKALRSDILVICDDMNLPSGTLRLRSKGSAGGQNGLKHIIESLGSEEFARLRIGIGLEEKPQGGYSSFVLGKFSTDE----RNVMNRTLEVCTEAI--LDFAVNGISHAMNHYN 186
>gi|51473783|ref|YP_067540.1| peptidyl-tRNA hydrolase [Rickettsia typhi str. Wilmington] >gi|68052927|sp|Q68WD4|PTH_RICTY Peptidyl-tRNA hydrolase (PTH) >gi|51460095|gb|AAU04058.1| aminoacyl-tRNA hydrolase; Peptidyl-tRNA hydrolase. [Rickettsia typhi str. Wilmington] (185 aa)
Score = 293, Expect = 4.0e-25, Identities = 70/171 (40%), Positives = 104/171 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNH 175
           LV+GLGNPG+ Y+ T+HN+GF+ I+ +  K H  F    KFN +  +      +I   KP TYMN SG+ V  +  +Y I+ + + VI+DDID ++G+I+ K  GS+GG NG+KSI S + +    RIRIGIG+P   H++  +VL+ FS  +   V Q+I    +     L H
  S:     3 LVIGLGNPGIVYQYTRHNIGFIAIERIANKYHLSFSTKQKFNCKIAEAIIDRQKICFIKPTTYMNLSGKSVILVKTYYNINYEKVFVIHDDIDLEIGRIKFKTGGSNGGHNGLKSIDSIIGSH-YNRIRIGIGRPQNNHDVADYVLSNFSESEYKTVMQSIDNVANNFGLILEH 175
>gi|72160821|ref|YP_288478.1| peptidyl-tRNA hydrolase [Thermobifida fusca YX] >gi|119391031|sp|Q47SW2|PTH_THEFY Peptidyl-tRNA hydrolase (PTH) >gi|71914553|gb|AAZ54455.1| peptidyl-tRNA hydrolase [Thermobifida fusca YX] (213 aa)
Score = 293, Expect = 4.4e-25, Identities = 59/166 (35%), Positives = 97/166 (58%)
  Q:     3 KYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDA 168
           ++LVVGLGNPG +Y   +HNVGFM +DEL  +        K + Q V+    +  + +AKP +YMN SG  V ++  FYK+    I+V++D++D    ++++K  G S G NG++SI + + +    R+R+GIG+P   +     VL  FS  +  ++   + +A DA
  S:    34 RWLVVGLGNPGPKYAGNRHNVGFMVVDELAAQRGERWRLHKAHAQVVETRVGDAPVVLAKPASYMNLSGGPVAKLSAFYKVPVDRIIVVHDELDIPFARLKLKRGGGSAGHNGLRSITASLGSPDYVRVRVGIGRPPGRMDAASFVLQDFSTAERKELDVHVARAADA 201
>gi|108757656|ref|YP_633231.1| peptidyl-tRNA hydrolase [Myxococcus xanthus DK 1622] >gi|119390966|sp|Q1D292|PTH_MYXXD Peptidyl-tRNA hydrolase (PTH) >gi|108461536|gb|ABF86721.1| peptidyl-tRNA hydrolase [Myxococcus xanthus DK 1622] (191 aa)
Score = 292, Expect = 4.8e-25, Identities = 68/182 (37%), Positives = 109/182 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV-----HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG EYE+ +HN+GFM ++ LL      LN  KF  +  +     +++   +P T+MN SG  V E  +F+K+   ++LVI+D++D  +G++++KA G SGG NG+KSI+S +  E   R+R GIGKP        ++ +VL+ F   +  ++   I +A D    ++        MN+FN
  S:     3 LIVGLGNPGREYERHRHNIGFMVVEALLSRARAQLNQEKFAAKVGQGTLAGERVLFVEPQTFMNLSGRSVAEAARFFKVPVADVLVIHDELDLPLGRLQLKAGGGSGGHNGLKSIVSSLGDESFIRLRFGIGKPEGPNARERVSDYVLSNFDDGERREMDALIDRAMDMTELWIRE-GLSVAMNRFN 188
>gi|62185393|ref|YP_220178.1| peptidyl-tRNA hydrolase [Chlamydophila abortus S26/3] >gi|81312457|sp|Q5L564|PTH_CHLAB Peptidyl-tRNA hydrolase (PTH) >gi|62148460|emb|CAH64230.1| peptidyl-tRNA hydrolase [Chlamydophila abortus S26/3] (183 aa)
Score = 292, Expect = 5.0e-25, Identities = 60/161 (37%), Positives = 92/161 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEH--TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH---NLTHHVLTKFSAEDSIKVQQAIIKA 165
           LVV +GNPG +Y  T+HNVGF+C+D L+++     F    K      KV+  +  +   KP TY+N SG+ V  +  +Y I    ILVI DD++   G +R++     GG  GIKSI   + +    ++R+GIG+P      L+  VL +F+ E+ I +Q   I+A
  S:     4 LVVAIGNPGRQYVWTRHNVGFLCVDRLVQQFPGVHFKEAPKLFSDIAKVESSQGSMVFIKPRTYVNLSGKAVLAVKGYYNIATDRILVIADDVNQPFGNVRLRQSAGGGGHKGIKSITQSLGSNDYWQLRLGIGRPQRENVELSDFVLGQFTEEEQIGIQSVFIEA 169
>gi|118474844|ref|YP_891539.1| peptidyl-tRNA hydrolase [Campylobacter fetus subsp. fetus 82-40] >gi|166199319|sp|A0RMV6|PTH_CAMFF Peptidyl-tRNA hydrolase (PTH) >gi|118414070|gb|ABK82490.1| peptidyl-tRNA hydrolase [Campylobacter fetus subsp. fetus 82-40] (181 aa)
Score = 291, Expect = 6.8e-25, Identities = 72/183 (39%), Positives = 111/183 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           LV GLGN G EYE T+HNVGFM ID +LK+     +++ KF G+  K    +  + + KP T+MN SG  +  +  FYK    NI+VI+DD+D   G +R K  GSSGG NGIKSI + +  +   R+RIGIG+  +++  +VL +F  ++  +++  +   K+A  E ++  D  +I +KF +
  S:     3 LVAGLGNIGKEYENTRHNVGFMLIDTMLKDGGFNSVSSGKFQGELFK----KGSLLLLKPSTFMNLSGNSLKAVNDFYK--PDNIIVIHDDLDLPFGTVRFKRGGSSGGHNGIKSIDNLIGND-YDRVRIGIGRGNNSVISYVLGEFIDDEKDRLKDVLAHCKNAVLELISCGDITQISSKFTL 179
>gi|29840576|ref|NP_829682.1| peptidyl-tRNA hydrolase [Chlamydophila caviae GPIC] >gi|33301429|sp|Q821W6|PTH_CHLCV Peptidyl-tRNA hydrolase (PTH) >gi|29834926|gb|AAP05560.1| peptidyl-tRNA hydrolase [Chlamydophila caviae GPIC] (183 aa)
Score = 291, Expect = 6.9e-25, Identities = 59/161 (36%), Positives = 93/161 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLK--EHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH---NLTHHVLTKFSAEDSIKVQQAIIKA 165
           L+V +GNPG +Y  T+HN+GF+C D+LL+      F    K      KV+ P+  +   KP TY+N SG+ V  + ++Y I    ILV+ DD++   G +R++     GG  GIKSI   + +    ++R+GIG+P      L+  VL +F+ E+ I +Q   I+A
  S:     4 LIVAIGNPGRQYTWTRHNIGFLCADKLLQGFPEAQFKEARKLFSDIAKVESPQGSMVFIKPRTYVNLSGKAVSAVKEYYGIPIDRILVLADDVNHPFGNVRLRQNAGGGGHKGIKSITQSLGSNDYWQLRLGIGRPQREDIELSDFVLGQFTEEEQIGIQSLFIEA 169
>gi|91787187|ref|YP_548139.1| peptidyl-tRNA hydrolase [Polaromonas sp. JS666] >gi|119390976|sp|Q12E01|PTH_POLSJ Peptidyl-tRNA hydrolase (PTH) >gi|91696412|gb|ABE43241.1| peptidyl-tRNA hydrolase [Polaromonas sp. JS666] (204 aa)
Score = 291, Expect = 7.2e-25, Identities = 63/169 (37%), Positives = 100/169 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK-FNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFL 173
           L VGLGNPG EYE T+HN GF  ID L +E    L   K ++GQ  +       +++ KP+T+MN SG+ V  + +F+KI    +LV +D++D   G++++K  GS  G NG++ I +++ T+   R+RIG+G P     + + VL K S E  + +++ I +A  A    L
  S:     4 LFVGLGNPGAEYEATRHNAGFWWIDALSRELQAPLTLDKSYHGQVARTTLNGKTVWLLKPLTFMNVSGKSVAALARFFKIAPDEVLVAHDELDIVPGQVKLKFGGSHAGHNGLRDIHAQLGTDDYWRLRIGVGHPGVKAEVINWVLKKPSQEHRVAIEECIDRALKAVPALL 175
>gi|147669215|ref|YP_001214033.1| peptidyl-tRNA hydrolase [Dehalococcoides sp. BAV1] >gi|189038288|sp|A5FRL3|PTH_DEHSB Peptidyl-tRNA hydrolase (PTH) >gi|146270163|gb|ABQ17155.1| peptidyl-tRNA hydrolase [Dehalococcoides sp. BAV1] (189 aa)
Score = 291, Expect = 7.3e-25, Identities = 59/150 (39%), Positives = 93/150 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-----VHNLTHHVLTKFSAED 154
           L++GLGNPG EY   +HNVGF C+    KE+ +  +      +       +++I +AKP TYMN SG+ V ++ + Y +   +I+V+ DD+D   GK+R++  GS+GG NG+ SII+ + T++  R++IGIGKP        +  HVL  F  E+
  S:     3 LIIGLGNPGKEYSGNRHNVGFQCLSRFAKENHISFDKKCCLSRTGSGRINDEEIVLAKPQTYMNLSGKAVNQLLRRYNLKAADIIVVQDDLDLPAGKLRLRLGGSAGGHNGVSSIITDIGTKEFIRLKIGIGKPDARNNGAEVVDHVLGNFGGEE 157
>gi|115439337|ref|NP_001043948.1| Os01g0693900 [Oryza sativa (japonica cultivar-group)] >gi|75285812|sp|Q5N9Q7|PTHM_ORYSJ Peptidyl-tRNA hydrolase, mitochondrial precursor (M-PTH) >gi|56785144|dbj|BAD81799.1| Peptidyl-tRNA hydrolase-like [Oryza sativa Japonica Group] >gi|113533479|dbj|BAF05862.1| Os01g0693900 [Oryza sativa (japonica cultivar-group)] (250 aa)
Score = 291, Expect = 7.5e-25, Identities = 57/138 (41%), Positives = 86/138 (62%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEK-IKRIRIGIGKP 138
           +  +L VGLGNPG  Y+ T+HNVGF  ID + +   + L++ +F     K    +  I +AKP T+MN SGE V ++  ++KI    +LV+YDD+D    K+R+  KG  GG NG++SII+ +   +   R+RIGIG+P
  S:    53 LKPWLFVGLGNPGKVYQGTRHNVGFEMIDVIAEAEGISLSSMQFKAMVGKGRIGDAPIMLAKPQTFMNASGESVGQLVSYFKIPLNQVLVMYDDLDLPFAKLRLLPKGGHGGHNGVRSIINHLKQNRDFPRLRIGIGRP 191
>gi|73748435|ref|YP_307674.1| peptidyl-tRNA hydrolase [Dehalococcoides sp. CBDB1] >gi|119390933|sp|Q3ZX09|PTH_DEHSC Peptidyl-tRNA hydrolase (PTH) >gi|73660151|emb|CAI82758.1| peptidyl-tRNA hydrolase [Dehalococcoides sp. CBDB1] (189 aa)
Score = 291, Expect = 7.7e-25, Identities = 59/150 (39%), Positives = 93/150 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-----VHNLTHHVLTKFSAED 154
           L++GLGNPG EY   +HNVGF C+    KE+ +  +      +       +++I +AKP TYMN SG+ V ++ + Y +   +I+V+ DD+D   GK+R++  GS+GG NG+ SII+ + T++  R++IGIGKP        +  HVL  F  E+
  S:     3 LIIGLGNPGKEYSGNRHNVGFQCLSRFAKENHISFDKKCCLSRTGSGRINDEEIVLAKPQTYMNLSGKAVNQLLRRYNLKATDIIVVQDDLDLPAGKLRLRLGGSAGGHNGVSSIITDIGTKEFIRLKIGIGKPDARNNGAEVVDHVLGNFGGEE 157
>gi|86136041|ref|ZP_01054620.1| peptidyl-tRNA hydrolase [Roseobacter sp. MED193] >gi|85826915|gb|EAQ47111.1| peptidyl-tRNA hydrolase [Roseobacter sp. MED193] (248 aa)
Score = 290, Expect = 8.5e-25, Identities = 57/150 (38%), Positives = 90/150 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAED 154
           L+VGLGNPG +Y + +HN+GFM +DE+  +H      +KF  Q  +      ++ + KP T+MN SG+ V E  +FYK+  Q++ V++D++D   GK RVK  G   G NG++S+ S +  +   R+R+G+G P H   +  +VL  F   D
  S:     3 LLVGLGNPGAKYARNRHNIGFMALDEIASDHGFSPWKTKFQAQICEGTLGGVKVLLLKPQTFMNLSGQSVGEAMRFYKLTSQDVTVLHDELDLAPGKCRVKQGGGHAGHNGLRSLHSHIGAD-YGRVRLGVGHPGHKDAVAGYVLRDFPKAD 153
>gi|91978461|ref|YP_571120.1| peptidyl-tRNA hydrolase [Rhodopseudomonas palustris BisB5] >gi|119390993|sp|Q131M0|PTH_RHOPS Peptidyl-tRNA hydrolase (PTH) >gi|91684917|gb|ABE41219.1| peptidyl-tRNA hydrolase [Rhodopseudomonas palustris BisB5] (207 aa)
Score = 290, Expect = 1.0e-24, Identities = 60/150 (40%), Positives = 88/150 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTH-HVLTKFSAED 154
           L VGLGNPG +Y+  +HN+GFM IDE+ + H       +F G+        ++I + KP+TYMN SG  V E   FYKI    + V +D+I+    K+RVK  G   G NG++SI + +  + + R+R+G+G P V  L H HVL  F+  +
  S:     3 LFVGLGNPGSKYQDNRHNIGFMVIDEIARRHGFSPWRRRFQGETADGSLDGERITLLKPLTYMNESGRAVQEAVSFYKIGHGEVAVFHDEIELPPAKLRVKVGGGIAGHNGLRSISAHIGNDYL-RVRLGVGHPGVKELVHGHVLGDFAKSE 153
>gi|92118570|ref|YP_578299.1| peptidyl-tRNA hydrolase [Nitrobacter hamburgensis X14] >gi|119390968|sp|Q1QIV8|PTH_NITHX Peptidyl-tRNA hydrolase (PTH) >gi|91801464|gb|ABE63839.1| peptidyl-tRNA hydrolase [Nitrobacter hamburgensis X14] (204 aa)
Score = 289, Expect = 1.1e-24, Identities = 56/150 (37%), Positives = 92/150 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTH-HVLTKFSAED 154
           L VGLGNPG +Y+  +HN+GFM +DE+ + H       +F G+  +    ++++ + KP TYMN SG  V +  +F+K+ E +++V +D+I+    K+RVK  G   G NG++SI + +  E  +R+R+G+G P V    H HVL  F+  +
  S:     3 LFVGLGNPGTKYQGNRHNIGFMVVDEIARRHGFAPWRRRFQGEASEGALDQERVVLLKPATYMNESGNAVQDAARFFKLTEGDVVVFHDEIELPPAKVRVKVGGGIAGHNGLRSISAHIGNE-YRRVRLGVGHPGVKERVHAHVLNDFAKSE 153
>gi|115523457|ref|YP_780368.1| peptidyl-tRNA hydrolase [Rhodopseudomonas palustris BisA53] >gi|122297067|sp|Q07RP6|PTH_RHOP5 Peptidyl-tRNA hydrolase (PTH) >gi|115517404|gb|ABJ05388.1| peptidyl-tRNA hydrolase [Rhodopseudomonas palustris BisA53] (201 aa)
Score = 289, Expect = 1.2e-24, Identities = 57/147 (38%), Positives = 91/147 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTH-HVLTKFS 151
           L+VGLGNPG +Y+  +HN+GFM +DE+ + H       +F G+        +++ + KP+T+MN+SG  V +   F+K+    I+V++D+I+    K+RVK  G   G NG++SI + +  E  +R+RIG+G P V  L H HVL  F+
  S:     3 LLVGLGNPGAKYQGNRHNIGFMALDEIARRHGFSPWRRRFQGETADGSIGGERVTLLKPLTFMNDSGRAVQDAASFFKLGLPEIIVLHDEIELPAAKLRVKVGGGIAGHNGLRSISAHIGNE-YRRVRIGVGHPGVKELVHGHVLNDFA 150
>gi|90422927|ref|YP_531297.1| peptidyl-tRNA hydrolase [Rhodopseudomonas palustris BisB18] >gi|119390992|sp|Q219F8|PTH_RHOPB Peptidyl-tRNA hydrolase (PTH) >gi|90104941|gb|ABD86978.1| peptidyl-tRNA hydrolase [Rhodopseudomonas palustris BisB18] (201 aa)
Score = 289, Expect = 1.3e-24, Identities = 60/161 (37%), Positives = 98/161 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTH-HVLTKFSAEDSIKVQQAIIKA 165
           L+VGLGNPG +Y+  +HN+GFM +DE+ + H       +F G+        +++ + KP+TYMN+SG  V +   F+K+   +I V++D+I+    K+RVK  G   G NG++SI + +  +  +R+RIG+G P    L H HVL  F+  +   V +A+I+A
  S:     3 LLVGLGNPGAKYQGNRHNIGFMVLDEMARRHGFSPWRRRFQGETADGSIGGERVTLLKPLTYMNDSGRAVQDAASFFKLGLPDITVVHDEIELPAAKLRVKVGGGIAGHNGLRSISAHVGND-YRRVRIGVGHPGAKELVHGHVLNDFAKSERPWV-EAMIEA 163
>gi|108801218|ref|YP_641415.1| peptidyl-tRNA hydrolase [Mycobacterium sp. MCS] >gi|119870369|ref|YP_940321.1| peptidyl-tRNA hydrolase [Mycobacterium sp. KMS] >gi|126437198|ref|YP_001072889.1| peptidyl-tRNA hydrolase [Mycobacterium sp. JLS] >gi|166229423|sp|A3Q5H1|PTH_MYCSJ Peptidyl-tRNA hydrolase (PTH) >gi|166229424|sp|A1UL23|PTH_MYCSK Peptidyl-tRNA hydrolase (PTH) >gi|119390965|sp|Q1B425|PTH_MYCSS Peptidyl-tRNA hydrolase (PTH) >gi|108771637|gb|ABG10359.1| peptidyl-tRNA hydrolase [Mycobacterium sp. MCS] >gi|119696458|gb|ABL93531.1| peptidyl-tRNA hydrolase [Mycobacterium sp. KMS] >gi|126236998|gb|ABO00399.1| peptidyl-tRNA hydrolase [Mycobacterium sp. JLS] (192 aa)
Score = 288, Expect = 1.4e-24, Identities = 62/164 (37%), Positives = 96/164 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAIIKAKDA 168
           LVVGLGNPG  Y KT+HNVGF+  D L  +  + F  + K              + +AKP TYMN SG  V  + KFY +   +++VI+D++D D G+IR+K  G   G NG+KS+ + + T+  +R+R+G+G+P    +   +VL  F++ +  +V     +A DA
  S:     6 LVVGLGNPGPNYAKTRHNVGFVVADLLAGRIGSGFKAHRKSGADIATGRLAGRAVVLAKPRTYMNESGRNVGPLAKFYSVAPADVIVIHDELDIDFGRIRLKFGGGVAGHNGLKSVAAALGTKDFQRVRVGVGRPPGRKDAATYVLEPFTSVERPEVPTICEQAADA 172
>gi|78185646|ref|YP_378080.1| peptidyl-tRNA hydrolase [Synechococcus sp. CC9902] >gi|119391028|sp|Q3AUQ0|PTH_SYNS9 Peptidyl-tRNA hydrolase (PTH) >gi|78169940|gb|ABB27037.1| peptidyl-tRNA hydrolase [Synechococcus sp. CC9902] (206 aa)
Score = 288, Expect = 1.5e-24, Identities = 57/147 (38%), Positives = 90/147 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN-------LTHHVLTKFS 151
           LVVGLGNPG +Y+ T+HN+GFM ++ L +     F   +K +G        + ++ +  P T+MN+SG  V     +Y    + I+++ DD+D  +G++R++A+GS+GG NG++S I  + T+   R+RIGIG P  N          HVL  FS
  S:     8 LVVGLGNPGSKYDGTRHNIGFMALERLARREGFSFRQQAKLHGLSADKGFGDQRLRLLMPQTFMNDSGRSVRAALDWYGFQPEEIVLLVDDMDLPLGRLRLRAQGSAGGHNGLRSTIQHLGTQVFPRLRIGIGAPAENPAERRARTVSHVLGPFS 162
>gi|94971564|ref|YP_593612.1| peptidyl-tRNA hydrolase [Acidobacteria bacterium Ellin345] >gi|94553614|gb|ABF43538.1| peptidyl-tRNA hydrolase [Acidobacteria bacterium Ellin345] (228 aa)
Score = 287, Expect = 1.8e-24, Identities = 71/182 (39%), Positives = 109/182 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFN-----GQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIH-EQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT---HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG++Y+ T HN+GF+ +D + +++ + + N         G    VD     + +AKP TYMN SG  V E+    +I   ++++VIYDD+D   G IRV+ +GS+GG NG++SII  ++T++  RIRIGI  P   L+    +VL++        V QA+  A +A    L        MN+FN
  S:    30 LIVGLGNPGMQYQFTPHNLGFLAVDRIAEKYGIRVANRNCKALTGRGVIEGVD-----VVLAKPETYMNLSGASVQELVSELEIDGTKDMIVIYDDLDLPYGSIRVRERGSAGGHNGVQSIIGALDTQEFLRIRIGIA-PEFKLSDGASYVLSQLKKSQLPVVDQALDDAAEAVKVILREGP-GPAMNRFN 213
>gi|110639010|ref|YP_679219.1| peptidyl-tRNA hydrolase [Cytophaga hutchinsonii ATCC 33406] >gi|119390930|sp|Q11RT7|PTH_CYTH3 Peptidyl-tRNA hydrolase (PTH) >gi|110281691|gb|ABG59877.1| peptidyl-tRNA hydrolase [Cytophaga hutchinsonii ATCC 33406] (188 aa)
Score = 287, Expect = 1.8e-24, Identities = 68/184 (36%), Positives = 104/184 (56%)
  Q:     3 KYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           KYL++GLGN G EY +T+HN+GFM +D+L +E  +  +  K +    +V      + + KP TYMN SG+ V    +  KI  +NILVI DD+    G +R++ KGSSGG NG+  I   + +    R+R+G+G          +VL  FSAE+  ++   + +AKDA   F   +  ++ MN  N
  S:     2 KYLIIGLGNIGSEYHETRHNIGFMVLDDLAQEKGVTFD-LKRHAHIAEVKVKGRTLILVKPTTYMNLSGKAVQYWMQEEKIALENILVITDDLALPFGTLRMRMKGSSGGHNGLSHIEQTLASANYTRLRMGVGSDFAKGQQVDYVLAPFSAEEQKEMPDVLKRAKDAVTGFAT-IGVERAMNAVN 185
>gi|58427818|gb|AAW76855.1| peptidyl tRNA hydrolase [Xanthomonas oryzae pv. oryzae KACC10331] (204 aa)
Score = 287, Expect = 2.1e-24, Identities = 62/163 (38%), Positives = 95/163 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKD 167
           L+VGLGNPG E+ +T+HN GF  +D L+ +    +  +SK  G+  KVD     +++ KP T+MN SG+ +    +F+KI  +++LV +D++D   G  R+K  G  GGQNG++  I  +   K  R+R+GIG P H   +   VL +   ED   +  AI  A D
  S:    16 LIVGLGNPGQEHAQTRHNAGFRFVDSLIERSGARWALDSKLFGETAKVDIAGQPVWLLKPATFMNLSGKSITAALRFWKIEPEHLLVAHDELDLAPGTARLKFDGGHGGQNGLRDTIGLLGHGKFHRLRVGIGHPGHKDRVVPWVLGRAGREDDAAIGTAIDAAID 181
>gi|84625060|ref|YP_452432.1| peptidyl-tRNA hydrolase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|122879276|ref|YP_202240.6| peptidyl-tRNA hydrolase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|188575472|ref|YP_001912401.1| peptidyl-tRNA hydrolase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|68052873|sp|Q5GWR6|PTH_XANOR Peptidyl-tRNA hydrolase (PTH) >gi|119391037|sp|Q2NZW9|PTH_XANOM Peptidyl-tRNA hydrolase (PTH) >gi|84369000|dbj|BAE70158.1| Peptidyl-tRNA hydrolase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188519924|gb|ACD57869.1| peptidyl-tRNA hydrolase [Xanthomonas oryzae pv. oryzae PXO99A] (194 aa)
Score = 287, Expect = 2.1e-24, Identities = 62/163 (38%), Positives = 95/163 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKD 167
           L+VGLGNPG E+ +T+HN GF  +D L+ +    +  +SK  G+  KVD     +++ KP T+MN SG+ +    +F+KI  +++LV +D++D   G  R+K  G  GGQNG++  I  +   K  R+R+GIG P H   +   VL +   ED   +  AI  A D
  S:     6 LIVGLGNPGQEHAQTRHNAGFRFVDSLIERSGARWALDSKLFGETAKVDIAGQPVWLLKPATFMNLSGKSITAALRFWKIEPEHLLVAHDELDLAPGTARLKFDGGHGGQNGLRDTIGLLGHGKFHRLRVGIGHPGHKDRVVPWVLGRAGREDDAAIGTAIDAAID 171
>gi|77164044|ref|YP_342569.1| peptidyl-tRNA hydrolase [Nitrosococcus oceani ATCC 19707] >gi|119390970|sp|Q3JDQ7|PTH_NITOC Peptidyl-tRNA hydrolase (PTH) >gi|76882358|gb|ABA57039.1| peptidyl-tRNA hydrolase [Nitrosococcus oceani ATCC 19707] (193 aa)
Score = 287, Expect = 2.2e-24, Identities = 55/161 (34%), Positives = 97/161 (60%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAI 162
           + +L++GLGNPG EY +T+HN GF  +D    E  + F   +KF G + + +     +++ KP T+MN SG+ V  +  +Y+I  +++L+ +DD+D   G  ++K  G  GG NG++ II+++      R+R+G+G P    ++  +VL + S ED   ++ AI
  S:     4 TTWLLIGLGNPGTEYAQTRHNAGFWWLDAFASELGINFKPGAKFFGDYARANWRGHDLWLLKPATFMNRSGQAVLALLNYYQIPLEHLLIAHDDLDLPPGVAKLKRAGGHGGHNGLRDIINRLGRRDFLRLRLGVGHPGSGQDVVSYVLNRPSREDRQAIEAAI 167
>gi|94265982|ref|ZP_01289705.1| Aminoacyl-tRNA hydrolase [delta proteobacterium MLMS-1] >gi|93453448|gb|EAT03864.1| Aminoacyl-tRNA hydrolase [delta proteobacterium MLMS-1] (196 aa)
Score = 286, Expect = 2.5e-24, Identities = 60/150 (40%), Positives = 91/150 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNN-SKF---NGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAED 154
           LV GLGNPG +YE T+HN+GF+ ID L   H + L   SK+   +G+     QP   + + KP+TYMN SG  V  + +FY+I  + + V +D++D   G  RV     +GG NG++S+I  + +    R R+G+G+P   H    +VL+ FS E+
  S:     3 LVAGLGNPGAKYEDTRHNIGFLFIDHLALRHGISLKEESKWEAASGRGTLWGQP---VMLVKPLTYMNLSGRAVGRLARFYRIEAEAVAVFHDELDLPFGSARVAKGRGAGGHNGVRSLIDHLGSRDFVRFRLGVGRPPEQHPTAGYVLSSFSPEE 155
>gi|50364892|ref|YP_053317.1| peptidyl-tRNA hydrolase [Mesoplasma florum L1] >gi|68052954|sp|Q6F240|PTH_MESFL Peptidyl-tRNA hydrolase (PTH) >gi|50363448|gb|AAT75433.1| peptidyl-tRNA hydrolase [Mesoplasma florum L1] (186 aa)
Score = 286, Expect = 2.9e-24, Identities = 64/182 (35%), Positives = 104/182 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGN G +YE T+HN G++ +D+L++++      ++ N          +++   KP TYMNNSG  +  I  +YKI  +++++++D+ D  VGK + K  GS+ G NGIKS+I  + T+   R RIGIG+P     +   VL+KF  E+   +  A     +  N++     F  IMN +N
  S:     3 LIVGLGNYGSQYEATRHNAGWIALDQLIEKYGFTQQKNEHNSIIFFSTVNNEKVLFVKPQTYMNNSGIAIQAIMHYYKIEIKDLVILHDEKDFPVGKNQFKMNGSAAGHNGIKSVIQYLGTQNFNRYRIGIGQPEQGWKIIDWVLSKFKPEELENIILASKSISNFVNDWTKGTTFQNIMNLYN 186
>gi|12044935|ref|NP_072745.1| peptidyl-tRNA hydrolase [Mycoplasma genitalium G37] >gi|66880310|ref|ZP_00405292.1| COG0193: Peptidyl-tRNA hydrolase [Mycoplasma genitalium G-37] >gi|1346896|sp|P47329|PTH_MYCGE Peptidyl-tRNA hydrolase (PTH) >gi|3844670|gb|AAC71301.1| peptidyl-tRNA hydrolase [Mycoplasma genitalium G37] >gi|166078836|gb|ABY79454.1| peptidyl-tRNA hydrolase [synthetic Mycoplasma genitalium JCVI-1.0] (189 aa)
Score = 286, Expect = 3.0e-24, Identities = 65/182 (35%), Positives = 110/182 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGI-GKPVHNLTH-HVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGN G +YEKT+HN GFM +D L     L  + +   G ++ +   E    +AKP T+MNNSG FV  +   ++I   NI++++D+I  D+G IR+K +GS+   NGIKS+I  ++TE+  R+R GI  +   N+ H  V+++F   +  K++ AI K+ +    ++   +  ++M  ++
  S:     6 LIVGLGNLGKKYEKTRHNAGFMVLDRLASLFHLNFDKTNKLGDYLFIK--EKAAILAKPATFMNNSGLFVKWLQDHFQIPLANIMIVHDEIAFDLGVIRLKMQGSANNHNGIKSVIRHLDTEQFNRLRFGIKSQNTSNILHEQVMSEFQNSELTKLEVAITKSVELLKRYIEGEELQRLMEYYH 187
>gi|86751267|ref|YP_487763.1| peptidyl-tRNA hydrolase [Rhodopseudomonas palustris HaA2] >gi|119390991|sp|Q2ISF8|PTH_RHOP2 Peptidyl-tRNA hydrolase (PTH) >gi|86574295|gb|ABD08852.1| peptidyl-tRNA hydrolase [Rhodopseudomonas palustris HaA2] (207 aa)
Score = 285, Expect = 3.1e-24, Identities = 59/150 (39%), Positives = 89/150 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTH-HVLTKFSAED 154
           L VGLGNPG +Y+  +HN+GFM IDE+ + H       +F G+        ++I + KP+TYMN SG  V E   FYKI +  + V +D+I+    K+RVK  G   G NG++SI + +  + + R+R+G+G P V  + H HVL  F+  +
  S:     3 LFVGLGNPGTKYQDNRHNIGFMVIDEIARRHGFSPWRRRFQGETSDGALDGERITLLKPLTYMNESGRAVQEAASFYKIGQGEVAVFHDEIELPPAKVRVKVGGGIAGHNGLRSISAHIGNDYL-RVRLGVGHPGVKEMVHGHVLGDFAKSE 153
>gi|109898885|ref|YP_662140.1| peptidyl-tRNA hydrolase [Pseudoalteromonas atlantica T6c] >gi|119390980|sp|Q15SQ2|PTH_PSEA6 Peptidyl-tRNA hydrolase (PTH) >gi|109701166|gb|ABG41086.1| peptidyl-tRNA hydrolase [Pseudoalteromonas atlantica T6c] (194 aa)
Score = 285, Expect = 3.2e-24, Identities = 73/182 (40%), Positives = 106/182 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPGLEY+ T+HN G   ++ L + H   L+  SKF G   +V      I +  P TYMN SG+ V  +  FY+I  ++ILV YD++D   G  + K  GSS  QNGI+ I+S + N +   R+R+GIG P H   ++ +VL K  A++  ++  AI +    C E L   D  K MN+ +
  S:     6 LIVGLGNPGLEYKYTRHNAGTWLVENLARMHNCTLSLQSKFFGYTGRVTIGGQDIRLLIPTTYMNKSGQAVAALAGFYRIPPESILVAYDELDLPPGIAKFKLGGSSS-QNGIRDIVSSLGNNKDFYRLRVGIGHPGHKGKVSGYVLGKAPAKEQEQMDAAIDEGV-RCIEILIKDDMKKAMNRLH 189
>gi|120405738|ref|YP_955567.1| peptidyl-tRNA hydrolase [Mycobacterium vanbaalenii PYR-1] >gi|166229427|sp|A1TEG1|PTH_MYCVP Peptidyl-tRNA hydrolase (PTH) >gi|119958556|gb|ABM15561.1| peptidyl-tRNA hydrolase [Mycobacterium vanbaalenii PYR-1] (192 aa)
Score = 285, Expect = 3.2e-24, Identities = 60/164 (36%), Positives = 96/164 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQ-IFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDA 168
           LVVGLGNPG +Y  T+HN GFM +D L           K +G  V   +   + + +AKP  YMN SG  V  + KFY +   ++++++D++D D G+IR+KA G   G NG++S+ S +     +R+R+GIG+P  + +    VL  F++ +  +V   + +A DA
  S:     6 LVVGLGNPGPQYATTRHNAGFMVVDILADRMGEKFKVHKKSGAEVATGRLAGRPVVLAKPRVYMNESGRQVGPLAKFYSVAPADVVIVHDELDIDFGRIRLKAGGGVAGHNGLRSVASALGGNDFQRVRVGIGRPPGHKSGASFVLENFNSVERKEVPTILEQAADA 172
>gi|42524124|ref|NP_969504.1| peptidyl-tRNA hydrolase [Bdellovibrio bacteriovorus HD100] >gi|68052963|sp|Q6MJR3|PTH_BDEBA Peptidyl-tRNA hydrolase (PTH) >gi|39576332|emb|CAE80497.1| pth [Bdellovibrio bacteriovorus HD100] (187 aa)
Score = 285, Expect = 3.3e-24, Identities = 65/183 (35%), Positives = 104/183 (56%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH---NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +L+VGLGNPG EY+ T+HN+GFM +D L++        ++F  +  +    +  +   KP TYMN SGE V  +  FYKI  + ++VI+D+ID    +++++     GG NGIKSI   M +    R+R+G+G+P +    +  +VL KF+ E+  ++   + KA DA    +      K   KFN
  S:     2 WLIVGLGNPGGEYKLTRHNIGFMAVDFLMEGLGNPPIKNQFKAEIAQAKIKDHPVIFCKPQTYMNLSGESVQPLMGFYKIPLERLIVIHDEIDQPFAQMKIQKNRGHGGHNGIKSISGLMGSMDYTRLRLGVGRPANPNIPVPDYVLGKFTKEEFAQMPDFLNKAGDAVESIILD-GIQKASTKFN 186
>gi|94264422|ref|ZP_01288212.1| Aminoacyl-tRNA hydrolase [delta proteobacterium MLMS-1] >gi|93455179|gb|EAT05397.1| Aminoacyl-tRNA hydrolase [delta proteobacterium MLMS-1] (196 aa)
Score = 285, Expect = 3.4e-24, Identities = 59/147 (40%), Positives = 90/147 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNN-SKF---NGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFS 151
           LV GLGNPG +YE T+HN+GF+ ID L + H + L   SK+   +G+     QP   + + KP+TYMN SG  V  + +FY+I  + + V +D++D   G  RV     +GG NG++S+I  + +    R R+G+G+P   H    +VL+ FS
  S:     3 LVAGLGNPGAKYEDTRHNIGFLFIDHLARRHGISLKEESKWEAASGRGTLWGQP---VMLVKPLTYMNLSGRAVGRLARFYRIEAEAVAVFHDELDLPFGSARVAKGRGAGGHNGVRSLIDHLGSRDFVRFRLGVGRPPEQHPTAGYVLSSFS 152
>gi|83815615|ref|YP_444949.1| peptidyl-tRNA hydrolase [Salinibacter ruber DSM 13855] >gi|119391001|sp|Q2S4D2|PTH_SALRD Peptidyl-tRNA hydrolase (PTH) >gi|83757009|gb|ABC45122.1| peptidyl-tRNA hydrolase [Salinibacter ruber DSM 13855] (188 aa)
Score = 285, Expect = 3.5e-24, Identities = 71/182 (39%), Positives = 100/182 (54%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK--FNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGK--PVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L +GLGNPG EYE T+HNVG   ID L     + L +      G    VDQ   +I +A P+TYMN SG+ V  +   Y +    +LVI DD+   VG IR++  GSSGG NG+  +  ++ T +  R+R+GIG   P    + +VL+ F+ E     + A   A+DA    +   D D  MN+FN
  S:     7 LAIGLGNPGAEYEDTRHNVGHQVIDGLSGRLDISLQHQSDALVGWGRYVDQ---KIGLAVPLTYMNRSGDAVAGLRAHYDLPIDRLLVIVDDLHLPVGTIRLRPTGSSGGHNGLAHVAQRLGTTEFSRLRVGIGNDFPEGRQSDYVLSPFTDEQRPAARSAREDAEDAVLT-MARDDIDAAMNRFN 188
>gi|121603806|ref|YP_981135.1| peptidyl-tRNA hydrolase [Polaromonas naphthalenivorans CJ2] >gi|120592775|gb|ABM36214.1| peptidyl-tRNA hydrolase [Polaromonas naphthalenivorans CJ2] (230 aa)
Score = 285, Expect = 3.5e-24, Identities = 62/169 (36%), Positives = 99/169 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFL 173
           L VGLGNPG EYE T+HN GF  ID L +E    L+ +  ++GQ  +       +++ KP+T+MN SG+ V  + +F+KI    ILV +D++D   G++++K  GS  G NG++ I +++ +    R+RIG+G P     + + VL K S E  + ++  I +   A  E L
  S:    25 LFVGLGNPGPEYEATRHNAGFWWIDALSRELKAPLSLDKNYHGQVARTTVNGQTVWLLKPLTFMNLSGKSVAALARFFKISPAEILVAHDELDIVPGQVKLKFGGSHAGHNGLRDIHAQLGSADYWRLRIGVGHPGVKAEVINWVLKKPSQEHRVAIEDCIDRCLKAVPELL 196
>gi|83953527|ref|ZP_00962249.1| peptidyl-tRNA hydrolase [Sulfitobacter sp. NAS-14.1] >gi|83842495|gb|EAP81663.1| peptidyl-tRNA hydrolase [Sulfitobacter sp. NAS-14.1] (243 aa)
Score = 285, Expect = 3.7e-24, Identities = 61/179 (34%), Positives = 101/179 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMN 183
           L+VGLGNPG +Y   +HN+GFM +D + ++H      +K NG  V+     D++ + KP T+MNNSG+ V    +F+K+   +++V++D+ID   GK++ K  G   G NG++SI + +  +   R+R+G+G P H   +  +VL  F+  +   +   +    D   E L   D  K MN
  S:     3 LIVGLGNPGAKYAGNRHNIGFMALDRIAQDHGFAGWKTKHNGLTVEGRFGADRVVLLKPETFMNNSGQSVQSAMRFHKLEPADVIVLHDEIDLAPGKVKCKTGGGHAGHNGLRSIHAHIGPD-YDRVRLGVGHPGHKDAVPGYVLRDFAKAEQDWLDDVLRGISDGAAE-LARGDTAKFMN 181
>gi|83943887|ref|ZP_00956344.1| peptidyl-tRNA hydrolase [Sulfitobacter sp. EE-36] >gi|83845134|gb|EAP83014.1| peptidyl-tRNA hydrolase [Sulfitobacter sp. EE-36] (243 aa)
Score = 285, Expect = 3.7e-24, Identities = 61/179 (34%), Positives = 101/179 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMN 183
           L+VGLGNPG +Y   +HN+GFM +D + ++H      +K NG  V+     D++ + KP T+MNNSG+ V    +F+K+   +++V++D+ID   GK++ K  G   G NG++SI + +  +   R+R+G+G P H   +  +VL  F+  +   +   +    D   E L   D  K MN
  S:     3 LIVGLGNPGAKYAGNRHNIGFMALDRIAQDHGFAGWKTKHNGLTVEGRFGADRVVLLKPETFMNNSGQSVQSAMRFHKLEPADVIVLHDEIDLAPGKVKCKTGGGHAGHNGLRSIHAHIGPD-YDRVRLGVGHPGHKDAVPGYVLRDFAKAEQDWLDDVLRGISDGAAE-LARGDTAKFMN 181
>gi|76797994|ref|ZP_00780253.1| peptidyl-tRNA hydrolase [Streptococcus agalactiae 18RS21] >gi|76586674|gb|EAO63173.1| peptidyl-tRNA hydrolase [Streptococcus agalactiae 18RS21] (167 aa)
Score = 285, Expect = 3.8e-24, Identities = 64/161 (39%), Positives = 100/161 (62%)
  Q:    26 MCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT--HHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           M +D ++K+  + F  +  F  +        ++I+  KP T+MNNSG  V  +  +Y I  +++++IYDD+D +VGKIR + KGS+GG NGIKSII+ + T++  RI++GIG+P   +T  +HVL KF   D I +   + K  +A N +L   DF K M K+N
  S:     1 MAVDRIVKDLDVNFTEDKNFKAEIGSDFINGEKIYFIKPTTFMNNSGIAVKALLTYYNISIKDMIIIYDDLDMEVGKIRFRQKGSAGGHNGIKSIIAHLGTQEFDRIKVGIGRPNGRMTVINHVLGKFDKNDEIMILNTLDKVDNAVNYYLQTNDFQKTMQKYN 164
>gi|94986155|ref|YP_605519.1| peptidyl-tRNA hydrolase [Deinococcus geothermalis DSM 11300] >gi|119390934|sp|Q1IWN4|PTH_DEIGD Peptidyl-tRNA hydrolase (PTH) >gi|94556436|gb|ABF46350.1| Aminoacyl-tRNA hydrolase [Deinococcus geothermalis DSM 11300] (214 aa)
Score = 284, Expect = 4.0e-24, Identities = 58/171 (33%), Positives = 104/171 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQ---PEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNH 175
           LVVGLGNPG +Y +T+HNVG++ +DE+ +      +  K + +  ++     P +++ + KP T+MN+SG  V  +  FYK+    +LV+ DD+D+  G ++ +  G  GGQNG++ II  + T+   R++IGI +P    N    VL+++ AE++  + + +    DA   +++H
  S:     3 LVVGLGNPGSQYAQTRHNVGWLVVDEVARRWGAVWHPDK-DAEVAELRMGAAPGEKVLLVKPQTFMNSSGRAVGPLFAFYKLEPAALLVVQDDLDSPFGLLKFRLGGRHGGQNGVRDIIRVLGTQDFARLKIGISRPPAGWNPADWVLSRWRAEEAETLAELVRLGADAVEVWVSH 177
>gi|33595507|ref|NP_883150.1| peptidyl-tRNA hydrolase [Bordetella parapertussis 12822] >gi|33599892|ref|NP_887452.1| peptidyl-tRNA hydrolase [Bordetella bronchiseptica RB50] >gi|46576755|sp|Q7W179|PTH_BORPA Peptidyl-tRNA hydrolase (PTH) >gi|46576761|sp|Q7WNY2|PTH_BORBR Peptidyl-tRNA hydrolase (PTH) >gi|33565585|emb|CAE40228.1| peptidyl-tRNA hydrolase [Bordetella parapertussis] >gi|33567489|emb|CAE31402.1| peptidyl-tRNA hydrolase [Bordetella bronchiseptica RB50] (215 aa)
Score = 284, Expect = 4.1e-24, Identities = 53/134 (39%), Positives = 80/134 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           L+VGLGNPG +YE T+HN GF   D L  +  T F     F G   K     + + + KP+TYMN SG+ V  + +FYK+  + +LV++D++D   G++++K  G   G NG+K I + + +    R+RIGIG P
  S:    24 LIVGLGNPGPDYETTRHNAGFWLADHLADDLRTAFALEKGFFGMLAKARHAGENVVLLKPITYMNRSGQSVGAVARFYKLAPEQVLVLHDELDLLPGQVKIKQGGGHAGHNGLKDIQAALGSPNFWRLRIGIGHP 158
>gi|110681038|ref|YP_684045.1| peptidyl-tRNA hydrolase [Roseobacter denitrificans OCh 114] >gi|119390998|sp|Q161I4|PTH_ROSDO Peptidyl-tRNA hydrolase (PTH) >gi|109457154|gb|ABG33359.1| peptidyl-tRNA hydrolase [Roseobacter denitrificans OCh 114] (233 aa)
Score = 284, Expect = 5.0e-24, Identities = 55/150 (36%), Positives = 89/150 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAED 154
           L+VGLGNPG +Y   +HN+GFM +D +  +H       K  G   +     D+  + KP+T+MNNSG+ V    +FYK+  ++++V++D+ID   GK++ K  G   G NG++SI + +  E   R+R+G+G P H   +  +VL  F+  D
  S:     3 LIVGLGNPGPKYAGHRHNIGFMALDRIAADHGFGAWKDKHQGSLSEGRFGSDRAVLLKPLTFMNNSGQSVQAAMRFYKLEPEDVIVLHDEIDLAPGKVKYKTGGGHAGHNGLRSIHAHIGPE-YARVRLGVGHPGHKDRVPGYVLHDFAKAD 153
>gi|39937415|ref|NP_949691.1| peptidyl-tRNA hydrolase [Rhodopseudomonas palustris CGA009] >gi|192293198|ref|YP_001993803.1| Aminoacyl-tRNA hydrolase [Rhodopseudomonas palustris TIE-1] >gi|68052965|sp|Q6N1P9|PTH_RHOPA Peptidyl-tRNA hydrolase (PTH) >gi|39651274|emb|CAE29796.1| putative peptidyl-tRNA hydrolase [Rhodopseudomonas palustris CGA009] >gi|192286947|gb|ACF03328.1| Aminoacyl-tRNA hydrolase [Rhodopseudomonas palustris TIE-1] (206 aa)
Score = 283, Expect = 5.5e-24, Identities = 60/150 (40%), Positives = 89/150 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-----VHNLTHHVLTKFSAED 154
           L VGLGNPG +Y+  +HN+GFM IDE+ + H       +F G+        ++I + KP+TYMN SG  V +   FYKI +  I V +D+I+    K+RVK  G   G NG++SI + +  + + R+R+G+G P     VHN   HVL  F+  +
  S:     3 LFVGLGNPGAKYQGNRHNIGFMVIDEIARRHGFSPWRRRFQGETADGVLDGERITLLKPLTYMNESGRAVQDAASFYKIGQNEIAVFHDEIELPPAKVRVKVGGGIAGHNGLRSISAHIGNDYL-RVRLGVGHPGAKELVHN---HVLGDFAKSE 153
>gi|154173637|ref|YP_001408880.1| peptidyl-tRNA hydrolase [Campylobacter curvus 525.92] >gi|166199318|sp|A7H088|PTH_CAMC5 Peptidyl-tRNA hydrolase (PTH) >gi|112803759|gb|EAU01103.1| peptidyl-tRNA hydrolase [Campylobacter curvus 525.92] (181 aa)
Score = 283, Expect = 6.1e-24, Identities = 70/183 (38%), Positives = 106/183 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           L+VGLGNP  +YE T+HN+GFM ID L   +   +++SKF G+  K       + + KP T+MN SG  V  +  FYK   + I+VI+DD+D   G ++ K  GSSGG NGI+SI + +  +  +R+RIGIG+   N  + VL +FS E+   + + +     A NE +   D + +  KF +
  S:     3 LIVGLGNPTSKYENTRHNIGFMLIDALKNSNFTDVSSSKFQGELFKY----SNLLLLKPTTFMNLSGNSVKAVNDFYK--PERIIVIHDDLDLPFGAMKFKKGGSSGGHNGIRSIDTLIGND-YERVRIGIGRS-GNAANFVLGEFSPEEKEHLAEILEYGTQAVNELIKS-DIESVAQKFTI 176
>gi|85373994|ref|YP_458056.1| peptidyl-tRNA hydrolase [Erythrobacter litoralis HTCC2594] >gi|123409639|sp|Q2NAN2|PTH_ERYLH Peptidyl-tRNA hydrolase (PTH) >gi|84787077|gb|ABC63259.1| peptidyl-tRNA hydrolase [Erythrobacter litoralis HTCC2594] (189 aa)
Score = 283, Expect = 6.5e-24, Identities = 66/176 (37%), Positives = 99/176 (56%)
  Q:     8 GLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMN 183
           GLGNPG +Y   +HNVGFM  D + + H       KF G   +     +++ + KP T+MN SG  + E  +FYK+  Q++ V YD++D +  KI+VK  G + G NGI+S I  +  E  +RIRIGIG P H   +T HVL  ++  +   + Q ++ A  A  E+L   D  + M+
  S:     6 GLGNPGPKYALHRHNVGFMACDVIAEMHGFEPVQKKFQGWVQEGRIGSEKVLLLKPGTFMNESGRAIGEAMRFYKLEPQDVTVFYDELDLEPFKIKVKRGGGAAGHNGIRSTIRHIG-EDFRRIRIGIGHPGHKDRVTGHVLGNYAKAEQDDLVQ-MLGAIGAEAEWLAKGDDARFMS 181
>gi|58696922|ref|ZP_00372423.1| peptidyl-tRNA hydrolase [Wolbachia endosymbiont of Drosophila simulans] >gi|58698058|ref|ZP_00372982.1| peptidyl-tRNA hydrolase [Wolbachia endosymbiont of Drosophila ananassae] >gi|58535415|gb|EAL59490.1| peptidyl-tRNA hydrolase [Wolbachia endosymbiont of Drosophila ananassae] >gi|58536852|gb|EAL60060.1| peptidyl-tRNA hydrolase [Wolbachia endosymbiont of Drosophila simulans] (182 aa)
Score = 282, Expect = 7.5e-24, Identities = 65/153 (42%), Positives = 99/153 (64%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSI 156
           +L+VGLGNPG +YE T HN+GF+ +D + K     L + K +         +++I + KP ++MNNSG  V +I  FYK+   NI+VI+DD D ++G+I+VK  GSS G NG+KSI S +  +   R+R G+G+P    +L  +VL+KFS  D++
  S:     2 HLIVGLGNPGSQYELTHHNIGFITVDAICKYWGFQLFSKKADYLITSGMINDNKIMLIKPYSFMNNSGIPVAKIRNFYKLSLDNIVVIHDDADLELGRIKVKKGGSSAGHNGLKSIDSFIGND-YWRLRFGVGRPEDQRSLADYVLSKFSNFDNV 155
>gi|53724086|ref|YP_104606.1| peptidyl-tRNA hydrolase [Burkholderia mallei ATCC 23344] >gi|67643440|ref|ZP_00442186.1| COG0193: Peptidyl-tRNA hydrolase [Burkholderia mallei GB8 horse 4] >gi|121601224|ref|YP_991441.1| peptidyl-tRNA hydrolase [Burkholderia mallei SAVP1] >gi|167001047|ref|ZP_02266848.1| peptidyl-tRNA hydrolase [Burkholderia mallei PRL-20] >gi|194316578|ref|YP_002012907.1| peptidyl-tRNA hydrolase [Burkholderia mallei ATCC 10399] >gi|194523577|ref|YP_002059109.1| peptidyl-tRNA hydrolase [Burkholderia mallei FMH] >gi|194528559|ref|YP_002064081.1| peptidyl-tRNA hydrolase [Burkholderia mallei JHU] >gi|166199315|sp|A1UZN8|PTH_BURMS Peptidyl-tRNA hydrolase (PTH) >gi|68052910|sp|Q62FC1|PTH_BURMA Peptidyl-tRNA hydrolase (PTH) >gi|52427509|gb|AAU48102.1| peptidyl-tRNA hydrolase [Burkholderia mallei ATCC 23344] >gi|121230034|gb|ABM52552.1| peptidyl-tRNA hydrolase [Burkholderia mallei SAVP1] >gi|147747587|gb|EDK54663.1| peptidyl-tRNA hydrolase [Burkholderia mallei FMH] >gi|147752569|gb|EDK59635.1| peptidyl-tRNA hydrolase [Burkholderia mallei JHU] >gi|160695733|gb|EDP85703.1| peptidyl-tRNA hydrolase [Burkholderia mallei ATCC 10399] (201 aa)
Score = 282, Expect = 8.2e-24, Identities = 54/134 (40%), Positives = 84/134 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK-FNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           L+VGLGNPG EY  T+HN GF  +D+L +E    L + + F+G + K     +++ + +P TYMN SG+ V  +  F+KI    ILV +D++D   G  ++K    SGG NG+K I + +++++  R+RIGIG P
  S:     4 LIVGLGNPGAEYTATRHNAGFWLVDQLAREAGATLRDERRFHGFYAKARLFGEEVHLLEPQTYMNRSGQAVVALAHFFKILPTEILVAHDELDLPPGAAKLKLGSGSGGHNGLKDISAHLSSQQYWRLRIGIGHP 138
>gi|15237280|ref|NP_197118.1| peptidyl-tRNA hydrolase family protein [Arabidopsis thaliana] >gi|145334495|ref|NP_001078593.1| peptidyl-tRNA hydrolase family protein [Arabidopsis thaliana] >gi|75311128|sp|Q9LF14|CRS2B_ARATH Chloroplastic group IIB intron splicing facilitator CRS2-B, chloroplast precursor (Chloroplastic RNA splicing factor 2-B) (CRS2-like protein B) >gi|9755824|emb|CAC01855.1| CRS2-like protein [Arabidopsis thaliana] >gi|38016015|gb|AAR07514.1| At5g16140 [Arabidopsis thaliana] >gi|51968726|dbj|BAD43055.1| CRS2-like protein [Arabidopsis thaliana] (240 aa)
Score = 281, Expect = 8.8e-24, Identities = 65/186 (34%), Positives = 115/186 (61%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPED-QIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEK-IKRIRIGIGKPVHNLTHH--VLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           + +L+VGLGNPG +Y  T+HNVGF  ID L ++  + +N  + +   + +   ED  I +AKP TYMN SGE V  +   Y++  ++IL+IYD++    G +R++ KG  G  NG+KS++  ++  +   R+ IGIGKP  N+     +L KFS  +  ++++A+ +  +A    + +  F++ +++FN+
  S:    44 TPWLIVGLGNPGNKYHGTRHNVGFEMIDVLARKEGVLMNTIQ-SKALIGIGAIEDVPILLAKPQTYMNFSGESVGSLASHYRVPLRHILMIYDEMALPNGVLRLQPKGGQGYHNGVKSVMGHLDGRRNFPRLSIGIGKPPGNMDMKAFLLQKFSPLEQKQIEEALEQGSEAVKTLVLN-GFNQGISRFNL 231
>gi|87301942|ref|ZP_01084776.1| peptidyl-tRNA hydrolase [Synechococcus sp. WH 5701] >gi|87283510|gb|EAQ75465.1| peptidyl-tRNA hydrolase [Synechococcus sp. WH 5701] (208 aa)
Score = 281, Expect = 9.3e-24, Identities = 63/182 (34%), Positives = 109/182 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN-------LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L++GLGNPG +Y +T+HNVGFM +D+L  ++   F  N K  G    + Q  D++ + KP TYMN SG  +     ++ +    +LV+ DD+D  +G++R++  GS+GG NG++S IS + ++   R+RIGIG P  +          HVL +F A++   +QQ + +  +  + F+    +++   + N
  S:    13 LLIGLGNPGEKYAQTRHNVGFMALDQLAQRDGASFRANGKLQGTIADLGQGSDRLRLLKPSTYMNESGRSIRATLDWFGLRPDQMLVLVDDMDLPLGRLRLRRSGSAGGHNGLRSTISHLGSQDFARLRIGIGAPALDPALRKARTISHVLGRFEADELPLLQQVLTEVLEGVS-FIRRWGYERAGTRLN 201
>gi|68052869|sp|Q5FFA3|PTH_EHRRG Peptidyl-tRNA hydrolase (PTH) (193 aa)
Score = 280, Expect = 1.2e-23, Identities = 66/153 (43%), Positives = 99/153 (64%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPED-QIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSI 156
           +L+VGLGNPG EYE T+HNVGFM ID ++  H LF +  K +   +     +  ++ +AKP T+MNNSG  +  I K YKI   NI+V +D+ D D   IR+K  G + G NG+KSI + +  +   RIR GIG P   ++L++HVL++F+  +++
  S:     3 HLLVGLGNPGKEYELTRHNVGFMIIDAIM-HHFLFPDFKKKHNALISSGSIQSYKVILAKPYTFMNNSGAPISSIVKLYKIPLDNIIVFHDETDIDFCTIRIKKGGGNAGHNGLKSIDTLLGRD-YWRIRFGIGHPSNGYDLSYHVLSQFNNLNAV 156
>gi|58039601|ref|YP_191565.1| peptidyl-tRNA hydrolase [Gluconobacter oxydans 621H] >gi|68052871|sp|Q5FRT7|PTH_GLUOX Peptidyl-tRNA hydrolase (PTH) >gi|58002015|gb|AAW60909.1| Peptidyl-tRNA hydrolase [Gluconobacter oxydans 621H] (189 aa)
Score = 280, Expect = 1.2e-23, Identities = 57/164 (34%), Positives = 94/164 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDA 168
           L  GLGNP     + +HN+GFM +DE+ + H       +F G+  +      +I + KPMTYMN SG+ V +  +F+KI + +I V +D++D   GK+R+K  G + G NG++S+   +      R+R+GIG P H   +T HVL  F+  +  ++++ +    DA
  S:     3 LWTGLGNPEPGMSRHRHNIGFMAVDEIARRHGFSPWRKRFRGETSEGVIGGQKILLLKPMTYMNRSGDSVQQAAQFFKIAQDDITVFHDELDLAFGKLRIKRGGGAAGHNGLRSMDKCLPGPDYWRVRMGIGHPGHKDRVTGHVLGNFAKAEEPELERWLEAIADA 168
>gi|25027562|ref|NP_737616.1| peptidyl-tRNA hydrolase [Corynebacterium efficiens YS-314] >gi|23492844|dbj|BAC17816.1| putative peptidyl-tRNA hydrolase [Corynebacterium efficiens YS-314] (231 aa)
Score = 280, Expect = 1.5e-23, Identities = 54/142 (38%), Positives = 86/142 (60%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPE--DQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT 143
           +++LVVGLGNPG++YE T+HNVG+MC+D LL  H           + +    P+  D     +  T+MN+SG+ V  + +   I  + I+VI+D++D   GK+RVK  G+  G NG+KS+  ++ T    R+RIGI +P   ++
  S:    47 ARWLVVGLGNPGVKYEATRHNVGYMCVDTLLGTHDAPPLTPVRGLKVLTTPLPDAADSALAVRSTTFMNHSGQGVAPLAQTLGIPPERIIVIHDELDLPAGKVRVKKGGNENGHNGLKSLTQELGTRDYLRVRIGISRPPQGMS 190
>gi|15807362|ref|NP_296093.1| peptidyl-tRNA hydrolase [Deinococcus radiodurans R1] >gi|14195089|sp|Q9RRW3|PTH_DEIRA Peptidyl-tRNA hydrolase (PTH) >gi|6460187|gb|AAF11918.1|AE002068_1 peptidyl-tRNA hydrolase [Deinococcus radiodurans R1] (215 aa)
Score = 279, Expect = 1.5e-23, Identities = 50/134 (37%), Positives = 89/134 (66%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVD-----QPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           L+VGLGNPG +Y +T+HNVG++ +DEL +       + + +G+    +      P +++ + KP T+MN SG+ V+ +  FYK+  + +LV+ DD+D+  G +R +  G  GGQNG++ II+++  ++  R++IGI +P
  S:     3 LIVGLGNPGEKYAQTRHNVGWLVVDELARRAG---GSWRKDGEAEVCEVRLGTAPGEKVLLVKPQTFMNTSGKAVWPLMSFYKLEGEQLLVVQDDLDSPFGLLRFRLGGRHGGQNGVRDIIARLGYDRFPRLKIGISRP 138
>gi|58616811|ref|YP_196010.1| peptidyl-tRNA hydrolase [Ehrlichia ruminantium str. Gardel] >gi|58416423|emb|CAI27536.1| Peptidyl-tRNA hydrolase [Ehrlichia ruminantium str. Gardel] (215 aa)
Score = 279, Expect = 1.6e-23, Identities = 66/153 (43%), Positives = 99/153 (64%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPED-QIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSI 156
           +L+VGLGNPG EYE T+HNVGFM ID ++  H LF +  K +   +     +  ++ +AKP T+MNNSG  +  I K YKI   NI+V +D+ D D   IR+K  G + G NG+KSI + +  +   RIR GIG P   ++L++HVL++F+  +++
  S:    25 HLLVGLGNPGKEYELTRHNVGFMIIDAIM-HHFLFPDFKKKHNALISSGSIQSYKVILAKPYTFMNNSGAPISSIVKLYKIPLDNIIVFHDETDIDFCTIRIKKGGGNAGHNGLKSIDTLLGRD-YWRIRFGIGHPSNGYDLSYHVLSQFNNLNAV 178
>gi|57238822|ref|YP_179958.1| peptidyl-tRNA hydrolase [Ehrlichia ruminantium str. Welgevonden] >gi|68052874|sp|Q5HC85|PTH_EHRRW Peptidyl-tRNA hydrolase (PTH) >gi|57160901|emb|CAH57806.1| peptidyl-tRNA hydrolase [Ehrlichia ruminantium str. Welgevonden] (193 aa)
Score = 279, Expect = 1.7e-23, Identities = 67/153 (43%), Positives = 97/153 (63%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSI 156
           +L+VGLGNPG EYE T+HNVGFM ID ++  H LF +   K N           ++ +AKP T+MNNSG  +  I K YKI   NI+V +D+ D D   IR+K  G + G NG+KSI + +  +   RIR GIG P   ++L++HVL++F+  +++
  S:     3 HLLVGLGNPGKEYELTRHNVGFMIIDAIM-HHFLFPDFKKKHNALISSGSIRSHKVILAKPYTFMNNSGTPISSIVKLYKIPLDNIIVFHDETDIDFCTIRIKKGGGNAGHNGLKSIDTLLGRD-YWRIRFGIGHPSNGYDLSYHVLSQFNNLNAV 156
>gi|40889732|pdb|1RYN|A Chain A, Structure Of The Chloroplast Group Ii Intron Splicing Factor Crs2 (202 aa)
Score = 279, Expect = 1.8e-23, Identities = 56/167 (33%), Positives = 98/167 (58%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEK-IKRIRIGIGKPVHNLTHH--VLTKFSAEDSIKVQQAIIKAKDA 168
           + +L+ GLGNPG +Y  T+HNVGF  +D +  E  + +N ++F          E  + + KP +YMN SGE +  +  +Y++  ++IL+IYDD     G +R++ KG  G  NG++++I  ++  +   R+ IGIG P   +     +L KFS+E+ +++  A+ +  DA
  S:     4 TPWLIAGLGNPGNKYYGTRHNVGFEMVDRIAAEEGITMNTNQFKSLLGTGSIGEVPVLVVKPQSYMNYSGEAIGPLAAYYQVPLRHILLIYDDTSLPNGVLRLQKKGGHGRHNGLQNVIEHLDGRREFPRLSIGIGSPPGKMDPRAFLLQKFSSEERVQIDTALEQGVDA 173
>gi|46576752|sp|Q7VUH3|PTH_BORPE Peptidyl-tRNA hydrolase (PTH) (215 aa)
Score = 279, Expect = 1.8e-23, Identities = 53/134 (39%), Positives = 79/134 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           L+VGLGNPG +YE T+HN GF   D L  +  T F     F G   K     + + + KP+TYMN SG+ V  +  FYK+  + +LV++D++D   G++++K  G   G NG+K I + + +    R+RIGIG P
  S:    24 LIVGLGNPGPDYETTRHNAGFWLADHLADDLRTAFALEKGFFGMLAKARHAGENVVLLKPITYMNRSGQSVGAVACFYKLAPEQVLVLHDELDLLPGQVKIKQGGGHAGHNGLKDIQAALGSPNFWRLRIGIGHP 158
>gi|33594044|ref|NP_881688.1| peptidyl-tRNA hydrolase [Bordetella pertussis Tohama I] >gi|33564118|emb|CAE43390.1| peptidyl-tRNA hydrolase [Bordetella pertussis Tohama I] (198 aa)
Score = 279, Expect = 1.8e-23, Identities = 53/134 (39%), Positives = 79/134 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           L+VGLGNPG +YE T+HN GF   D L  +  T F     F G   K     + + + KP+TYMN SG+ V  +  FYK+  + +LV++D++D   G++++K  G   G NG+K I + + +    R+RIGIG P
  S:     7 LIVGLGNPGPDYETTRHNAGFWLADHLADDLRTAFALEKGFFGMLAKARHAGENVVLLKPITYMNRSGQSVGAVACFYKLAPEQVLVLHDELDLLPGQVKIKQGGGHAGHNGLKDIQAALGSPNFWRLRIGIGHP 141
>gi|34581436|ref|ZP_00142916.1| peptidyl-tRNA hydrolase [Rickettsia sibirica 246] >gi|28262821|gb|EAA26325.1| peptidyl-tRNA hydrolase [Rickettsia sibirica 246] (185 aa)
Score = 279, Expect = 1.8e-23, Identities = 66/158 (41%), Positives = 96/158 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAI 162
           LV+GLGNPG EY+ T+HNVGF+ I+++  ++ + F    KFN +  +      +I   KP TYMN SG+ V  +  +Y I+   I VI+DDID + G+I+ K    +GG NG+KSI   +      RIRIG+G+P +N  +  +VL  FS  +   V QAI
  S:     3 LVIGLGNPGKEYQYTRHNVGFIAIEKIANQYNSSFSTKKKFNCEIAETISDGQKIIFIKPTTYMNLSGKSVISVKTYYNIYPAKIFVIHDDIDLETGRIKFKTGDGNGGHNGLKSIDGVIGN-NYNRIRIGVGRPQNNQDVADYVLNHFSKPEYETVMQAI 162
>gi|85057847|ref|YP_456763.1| peptidyl-tRNA hydrolase [Aster yellows witches'-broom phytoplasma AYWB] >gi|119390912|sp|Q2NIQ9|PTH_AYWBP Peptidyl-tRNA hydrolase (PTH) >gi|84789952|gb|ABC65684.1| peptidyl-tRNA hydrolase [Aster yellows witches'-broom phytoplasma AYWB] (188 aa)
Score = 278, Expect = 2.1e-23, Identities = 66/182 (36%), Positives = 105/182 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIG-KPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG ++  T+HN+GF+ +D  L ++         N    +++    Q  + KP TYMN SGE V +I   Y+I  +NILVI DDI  D GK+++K +G  GG NG+++II ++ T++ KR++IG+       L  ++LT  +A     + + I         F+  VDF+ +MN +N
  S:     3 LIVGLGNPGKKFLNTRHNIGFVVVDSFLSQNKYQTLKEDTNAHIYQINFNNHQTLLIKPQTYMNLSGEVVKKIINKYRIKIENILVIVDDIYLDEGKLKLKMQGGHGGHNGLRNIIDRLCTKQFKRLKIGVSLDSCMPLDQYLLTPVNASSQKNILKNIDIINKIIFNFIQDVDFNILMNGYN 185
>gi|58578752|ref|YP_196964.1| peptidyl-tRNA hydrolase [Ehrlichia ruminantium str. Welgevonden] >gi|58417378|emb|CAI26582.1| Peptidyl-tRNA hydrolase [Ehrlichia ruminantium str. Welgevonden] (215 aa)
Score = 278, Expect = 2.3e-23, Identities = 67/153 (43%), Positives = 97/153 (63%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSI 156
           +L+VGLGNPG EYE T+HNVGFM ID ++  H LF +   K N           ++ +AKP T+MNNSG  +  I K YKI   NI+V +D+ D D   IR+K  G + G NG+KSI + +  +   RIR GIG P   ++L++HVL++F+  +++
  S:    25 HLLVGLGNPGKEYELTRHNVGFMIIDAIM-HHFLFPDFKKKHNALISSGSIRSHKVILAKPYTFMNNSGTPISSIVKLYKIPLDNIIVFHDETDIDFCTIRIKKGGGNAGHNGLKSIDTLLGRD-YWRIRFGIGHPSNGYDLSYHVLSQFNNLNAV 178
>gi|66769658|ref|YP_244420.1| peptidyl-tRNA hydrolase [Xanthomonas campestris pv. campestris str. 8004] >gi|81304387|sp|Q4URC3|PTH_XANC8 Peptidyl-tRNA hydrolase (PTH) >gi|66574990|gb|AAY50400.1| peptidyl tRNA hydrolase [Xanthomonas campestris pv. campestris str. 8004] (193 aa)
Score = 278, Expect = 2.3e-23, Identities = 63/182 (34%), Positives = 103/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG E+ +T+HN GF  +D L +        +SK  G+  K D     +++ KP T+MN SG+ +    +F+KI  + +LV +D++D   G  R+K  G  GGQNG++  I  +   K  R+R+GIG P H   +   VL +   +D + + +A+  A DA    L+  +F++ M + +
  S:     6 LIVGLGNPGPEHAQTRHNAGFRFVDALAERTGARWGLDSKLFGETAKADIAGHTVWLLKPATFMNLSGKSITAALRFWKIEPEQLLVAHDELDLAPGTARLKFDGGHGGQNGLRDTIRLLGHGKFHRLRVGIGHPGHKDRVVPWVLGRAGRDDDMAIGEAVDAAIDALPLALDG-NFNEAMKRLH 189
>gi|46199526|ref|YP_005193.1| peptidyl-tRNA hydrolase [Thermus thermophilus HB27] >gi|55981557|ref|YP_144854.1| peptidyl-tRNA hydrolase [Thermus thermophilus HB8] >gi|68052894|sp|Q5SHZ2|PTH_THET8 Peptidyl-tRNA hydrolase (PTH) >gi|68052973|sp|Q72IA8|PTH_THET2 Peptidyl-tRNA hydrolase (PTH) >gi|46197152|gb|AAS81566.1| peptidyl-tRNA hydrolase [Thermus thermophilus HB27] >gi|55772970|dbj|BAD71411.1| peptidyl-tRNA hydrolase [Thermus thermophilus HB8] (183 aa)
Score = 278, Expect = 2.3e-23, Identities = 64/165 (38%), Positives = 98/165 (59%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDA 168
           +LVVG GNPG  Y +T+HN+GFM +D L           +  G+ + V + E  +F+ KP+TY N +G  V  + +FYKI  + ILV++D++D  +G+IR KA GS+ G  G+ SI   + T    R+R+GIGKP        +VL+ F  E+   V++ +  AK+A
  S:     2 FLVVGQGNPGERYARTRHNLGFMVLDRLGLSF-------RPRGEAL-VAEAEGGLFL-KPLTYYNLTGRAVAPLARFYKIPPERILVVHDEMDLPLGRIRFKAGGSAAGNRGVLSIEEALGTRAFHRLRLGIGKPPDPSRGAEYVLSPFREEELPVVERVLEAAKEA 159
>gi|83859405|ref|ZP_00952926.1| peptidyl-tRNA hydrolase [Oceanicaulis alexandrii HTCC2633] >gi|83852852|gb|EAP90705.1| peptidyl-tRNA hydrolase [Oceanicaulis alexandrii HTCC2633] (194 aa)
Score = 278, Expect = 2.3e-23, Identities = 61/148 (41%), Positives = 90/148 (60%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQ----FVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFS 151
           +L+VGLGNPG +Y   +HNVGFM +D + ++  L    S+F+GQ     V+  Q   ++ + KP T+ N SG  V E  +FYKI    I+V +D++D   GK R+K  G   G NG++S  + +  +  KR RIGIG P   + +T+ VL  FS
  S:     2 HLIVGLGNPGGKYAGNRHNVGFMALDAIAEDWRLGPWKSRFSGQTAEGVVETGQGPKKVLLLKPQTFYNESGRAVAEAARFYKIEADKIMVFHDELDLAPGKFRLKTGGGHAGNNGLRSTKAHIEGD-FKRGRIGIGHPGDKNQVTNWVLGDFS 154
>gi|88800289|ref|ZP_01115856.1| peptidyl-tRNA hydrolase [Reinekea sp. MED297] >gi|88777004|gb|EAR08212.1| peptidyl-tRNA hydrolase [Reinekea sp. MED297] (215 aa)
Score = 278, Expect = 2.4e-23, Identities = 67/182 (36%), Positives = 108/182 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y++T+HN GF  +D L    H  +   SK+      +     ++++ KPMT+MN SG+ V     F+KI    ILV +D++D   G  R K  G  GG NG++ II+++ N +   R+R+GIG P H   +T++VL+K   E+ I +++AI  A ++ +  +   D+ K MN  +
  S:    26 LIVGLGNPGAQYDQTRHNAGFDYVDALADRFHGQWKTESKYQADITSIQLAGQKVWLMKPMTFMNRSGQSVGAFANFFKIPANEILVAHDELDIPAGNARFKLGGGHGGHNGLRDIIARLANNKGFYRLRLGIGHPGHASEVTNYVLSKGRPEERISLERAIDAATESTSLAVQG-DWAKAMNTLH 210
>gi|89900452|ref|YP_522923.1| peptidyl-tRNA hydrolase [Rhodoferax ferrireducens T118] >gi|89345189|gb|ABD69392.1| peptidyl-tRNA hydrolase [Rhodoferax ferrireducens T118] (225 aa)
Score = 277, Expect = 3.1e-23, Identities = 65/176 (36%), Positives = 101/176 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK-FNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDK 180
           L VGLGNPG EYE T+HN GF  +D + +E    L   K ++G   +V      +++ KP T+MN SG+ V  + +F+KI  Q ILV +D++D   G+ ++K  GS  G NG++ I +++ T+   R+R+G+G P     + + VL K S +  + + Q I +A  A    L   D DK
  S:    22 LFVGLGNPGPEYEFTRHNAGFWWLDAVARELKASLAMDKTYHGLVTRVTVNGQAVWLLKPQTFMNLSGKSVAALARFFKIEPQEILVAHDELDIVPGEAKLKLGGSHAGHNGLRDIHAQLGTDDYWRLRLGVGHPGVKSEVINWVLKKPSLDHRLAMDQCIARAITALPHLLAG-DMDK 199
>gi|68536581|ref|YP_251286.1| peptidyl-tRNA hydrolase [Corynebacterium jeikeium K411] >gi|68264180|emb|CAI37668.1| pthA [Corynebacterium jeikeium K411] (209 aa)
Score = 277, Expect = 3.1e-23, Identities = 64/168 (38%), Positives = 97/168 (57%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHT--LFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNE 171
           +L+VGLGNPG +Y  T+HNVG M I ELL        LN + K N    +V     ++ +A+P T+MN SG  V ++  F+KI  +NI+V YDD++ D G ++++  G   G NG+KSI   + T+   R+  GIG+P   +    +VL  F   ++ +V    I   DA +E
  S:    31 WLIVGLGNPGDKYANTRHNVGRMVIGELLDRQVPAASLNTHKKTNTDIAEVKIAGRKVVLAQPRTFMNVSGGPVQQLAAFFKIPAENIIVAYDDLEGDPGAVKLRQSGGDKGHNGLKSITKSLGTKDYWRLSCGIGRPPGRMDPAAYVLKPFPKSEAAEVA---IMCADAADE 200
>gi|33860808|ref|NP_892369.1| peptidyl-tRNA hydrolase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|46576734|sp|Q7V342|PTH_PROMP Peptidyl-tRNA hydrolase (PTH) >gi|33633750|emb|CAE18709.1| Peptidyl-tRNA hydrolase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (203 aa)
Score = 276, Expect = 3.9e-23, Identities = 72/182 (39%), Positives = 112/182 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQF--VKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-------VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
            ++GLGNPG EY + +HN+GF+ ++   +++ + F   +K    +   K++    ++F+  P T+MNNSG  V  I  +YKI    + +I DDID  +GKIR + KGSSGG NGIK II+K+ TE   RI+IGIG P         N   HVL   S+++S+ + +   K  ++  E LN  + D I+++ N
  S:     7 FIIGLGNPGKEYIQNRHNIGFLLLENFSEKYDSKFTLKNKLKSWYSEFKINNFTYRLFM--PNTFMNNSGNAVRAIVDWYKIDLDRLFIIVDDIDLPLGKIRFRKKGSSGGHNGIKDIINKLQTENFNRIKIGIGSPPVNERKKTLNTISHVLGNISSKESLTLDRVYKKLIESLIE-LNDKNEDYIISELN 195
>gi|83951129|ref|ZP_00959862.1| peptidyl-tRNA hydrolase [Roseovarius nubinhibens ISM] >gi|83839028|gb|EAP78324.1| peptidyl-tRNA hydrolase [Roseovarius nubinhibens ISM] (231 aa)
Score = 276, Expect = 4.1e-23, Identities = 57/154 (37%), Positives = 92/154 (59%)
  Q:     1 MSKYLV-VGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAED 154
           M++ L+  GLGNPG +Y   +HN+GFM +D + ++H      S+F GQ  +     +++ + KP T+MN SG+ V E  +FYK+   +++V +D++D   GKIRVK  G   G NG++SI   +  +   R+R+GIG P     +  +VL  F+  D
  S:     1 MTRMLIFAGLGNPGAKYAGNRHNIGFMALDRIAEDHGFGPWKSRFQGQASEGRLGSEKLLLLKPETFMNLSGQSVGEAMRFYKLTPADVIVFHDELDLAPGKIRVKQGGGHAGHNGLRSIHQHIGPD-YARVRLGIGHPGRKELVAQYVLHDFARAD 156
>gi|15839231|ref|NP_299919.1| peptidyl-tRNA hydrolase [Xylella fastidiosa 9a5c] >gi|14195084|sp|Q9PA78|PTH_XYLFA Peptidyl-tRNA hydrolase (PTH) >gi|9107873|gb|AAF85439.1|AE004071_7 peptidyl tRNA hydrolase [Xylella fastidiosa 9a5c] (192 aa)
Score = 276, Expect = 4.2e-23, Identities = 63/182 (34%), Positives = 105/182 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG E+ KT+HN GF  +D L+ +E   ++  SK      +V      +++ +P+T+MN SG+ +     F+KI  + +LV +D++D   G +R+K  G  GGQNG++ I   +   +  R+R+GIG P H   + + VL   + E++I +  A+ +A  A    +   DFD+ M K +
  S:     6 LIVGLGNPGSEHTKTRHNAGFRFVDGLVQREGQRWMLESKLFAHVARVFIAGQWVWLLRPVTFMNLSGKSICAGLSFWKIKPEQMLVAHDELDFPPGAVRLKFDGGHGGQNGLRDITKLLGHGRFHRLRVGIGHPGHKDRVVNWVLGCPTCEENIAIDAALERAS-AVLPLVVAGDFDEAMKKLH 189
>gi|39938638|ref|NP_950404.1| peptidyl-tRNA hydrolase [Onion yellows phytoplasma OY-M] >gi|68052967|sp|Q6YR64|PTH_ONYPE Peptidyl-tRNA hydrolase (PTH) >gi|39721747|dbj|BAD04237.1| peptidyl-tRNA hydrolase [Onion yellows phytoplasma OY-M] (188 aa)
Score = 276, Expect = 4.2e-23, Identities = 66/182 (36%), Positives = 104/182 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIG-KPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG ++  T+HNVGF  +D  L ++   +          +++    Q  + KP TYMN SGE V +I   Y+I  +NILVI DDI  D GK+++K +G  GG NG+++II ++ T++ KR++IG+       L  ++LT  +A     + + I         F+  VDF+ +MN +N
  S:     3 LIVGLGNPGTKFVNTRHNVGFAVVDSFLSQNKYQILKEDKTDHIYQINFNHHQSLLIKPQTYMNLSGEVVKKIINKYRIKIENILVIVDDIYLDEGKLKLKMQGGHGGHNGLRNIIDRLGTKQFKRLKIGVSLDSCMPLDQYLLTPVNASSQKNILKNINIINKIIFNFIQDVDFNILMNGYN 185
>gi|39995769|ref|NP_951720.1| peptidyl-tRNA hydrolase [Geobacter sulfurreducens PCA] >gi|68052978|sp|Q74FE6|PTH_GEOSL Peptidyl-tRNA hydrolase (PTH) >gi|39982533|gb|AAR33993.1| peptidyl-tRNA hydrolase [Geobacter sulfurreducens PCA] (193 aa)
Score = 275, Expect = 4.7e-23, Identities = 60/154 (38%), Positives = 97/154 (62%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAED 154
           M+  L+VGLGNPG +Y  T+HN GFM +D L       +    F+G F +     +++ + KP TYMN SG  V E  +F+K+   + +VI+DD+D   G+++VK  G  GG NG++S++ ++      R+R+GIG+PVH ++ ++VLT FS ++
  S:     1 MATKLIVGLGNPGPKYLWTRHNAGFMVLDRLAHAIGASVTRKSFSGVFGEGAWHGERLLLLKPQTYMNLSGRSVAEALRFHKLPLCDTIVIHDDLDIPFGRVKVKEGGGHGGHNGLRSLVQELGGAGFVRVRVGIGRPVHGDVVNYVLTNFSQDE 155
>gi|117929151|ref|YP_873702.1| peptidyl-tRNA hydrolase [Acidothermus cellulolyticus 11B] >gi|117649614|gb|ABK53716.1| peptidyl-tRNA hydrolase [Acidothermus cellulolyticus 11B] (196 aa)
Score = 275, Expect = 4.7e-23, Identities = 58/171 (33%), Positives = 93/171 (54%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLN 174
           +LVVGLGNPG  Y K +HNVGFM +D L +   +     +   Q            +AKP++YMN SG  V  +  +++I  + ++V++D++D   G +RVK  G   G NG++SI + +      R+R GIG+P  +L    +VL  FSA +  ++   + +A D     L+
  S:     6 WLVVGLGNPGPAYAKNRHNVGFMVVDLLAERAGMRFTVHRTRTQLANGRLAGQPAMLAKPLSYMNQSGGPVAGLLHYFRIPRERLIVVHDELDLPFGVLRVKRGGGDAGHNGLRSITAALRGADYLRVRFGIGRPPPHLDPAEYVLRDFSAAERAELGVHLEEAADVVESLLS 178
>gi|84515240|ref|ZP_01002602.1| peptidyl-tRNA hydrolase [Loktanella vestfoldensis SKA53] >gi|84510523|gb|EAQ06978.1| peptidyl-tRNA hydrolase [Loktanella vestfoldensis SKA53] (221 aa)
Score = 275, Expect = 5.3e-23, Identities = 54/150 (36%), Positives = 91/150 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAED 154
           L++GLGNPG +Y + +HN+GFM +D +  +H      +KF GQ  +     D++ + KP T+MN SG+ V E  ++ K+   +++V +D+ID   GK+R+K  G   G NG++SI + +  +   R+R+G+G P H   +  +VL  F+  D
  S:     3 LLIGLGNPGAKYAQNRHNIGFMAMDRIAGDHGFSPWRAKFQGQISEGRIGPDKVALLKPETFMNLSGQSVGEAMRYLKLTPADLIVFHDEIDLAPGKVRLKTGGGHAGHNGLRSIHAHIGPD-YDRVRLGVGHPGHKDAVPGYVLHDFAKAD 153
>gi|148265700|ref|YP_001232406.1| peptidyl-tRNA hydrolase [Geobacter uraniireducens Rf4] >gi|189038152|sp|A5G7R5|PTH_GEOUR Peptidyl-tRNA hydrolase (PTH) >gi|146399200|gb|ABQ27833.1| peptidyl-tRNA hydrolase [Geobacter uraniireducens Rf4] (191 aa)
Score = 274, Expect = 5.8e-23, Identities = 58/156 (37%), Positives = 101/156 (64%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAEDSI 156
           M+  L+VGLGNPG +Y+ T+HN GFM +D L     + +    F+G   +     D++ + KP T+MN SG  V E  +F+K+  ++++VI+DD+D   G++++KA G   G NG++S+  ++ +    R+R+GIG+P+H ++ ++VL+ FS E+ I
  S:     1 MAVKLIVGLGNPGPKYQWTRHNAGFMVLDRLSHLTGITVTRKNFSGLCGEGSWQGDRLILLKPQTFMNLSGRSVAEALRFHKLTVEDLIVIHDDLDIPFGRVKLKAGGGHAGHNGLRSLSQELGSGAFLRVRMGIGRPLHGDVVNYVLSNFSPEEMI 157
>gi|69936889|ref|ZP_00631644.1| Peptidyl-tRNA hydrolase [Paracoccus denitrificans PD1222] >gi|119384009|ref|YP_915065.1| peptidyl-tRNA hydrolase [Paracoccus denitrificans PD1222] >gi|166229430|sp|A1B1H5|PTH_PARDP Peptidyl-tRNA hydrolase (PTH) >gi|119373776|gb|ABL69369.1| peptidyl-tRNA hydrolase [Paracoccus denitrificans PD1222] (235 aa)
Score = 274, Expect = 5.9e-23, Identities = 56/157 (35%), Positives = 95/157 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQA 161
           L+VGLGNPG +Y   +HNVGFM ++ +  +H      ++F G+  +    E ++ + KP T+MN SG+ V E  ++ K+  Q+++V++D++D   GK+R+K  G   G NG++S+   +  E  +R+RIGIG P     +  +VL+ F+     K +QA
  S:     3 LIVGLGNPGAKYAANRHNVGFMAVERIAGDHGFSPWRARFQGEIAEGRLGETRVTLLKPATFMNLSGQSVGEAMRYLKLAPQDVIVLHDELDLAPGKVRLKTGGGHAGHNGLRSLHQHIG-EGYRRLRIGIGHPGDKDRVAGYVLSDFA-----KAEQA 155
>gi|85859732|ref|YP_461934.1| peptidyl-tRNA hydrolase [Syntrophus aciditrophicus SB] >gi|119391023|sp|Q2LUK5|PTH_SYNAS Peptidyl-tRNA hydrolase (PTH) >gi|85722823|gb|ABC77766.1| peptidyl-tRNA hydrolase [Syntrophus aciditrophicus SB] (196 aa)
Score = 274, Expect = 6.1e-23, Identities = 63/182 (34%), Positives = 106/182 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG  Y  T+HN GF  +D+L ++  + ++ + F+  + K       + +AKP T+MN SG+ V ++  F+KI  +++LV++DD+D   G IR+KA G  GG  G+ SI   +   + +R+R+GIGKP     +  +VL  F+  +   + + I+ A+ A  E ++       MN +N
  S:     3 LIVGLGNPGARYRFTRHNFGFFVLDQLAEDQDIMMSQTGFDALWGKGVIAGQSVLLAKPQTFMNLSGKSVRKLADFFKIVVEDVLVVHDDLDLPFGVIRLKAGGGQGGHKGLISICDSLGGPEFQRVRLGIGKPAQRSAVERYVLEPFTESELRILPRIIVTARSAILEVISS-GIKTAMNSYN 185
>gi|42520075|ref|NP_965990.1| peptidyl-tRNA hydrolase [Wolbachia endosymbiont of Drosophila melanogaster] >gi|68052975|sp|Q73II8|PTH_WOLPM Peptidyl-tRNA hydrolase (PTH) >gi|42409812|gb|AAS13924.1| peptidyl-tRNA hydrolase [Wolbachia endosymbiont of Drosophila melanogaster] (182 aa)
Score = 273, Expect = 8.0e-23, Identities = 63/148 (42%), Positives = 95/148 (64%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFS 151
           +L+VGLGNPG +YE T HN+GF+ +D + K       + K +         +++I + KP ++MNNSG  V +I  FYK+   NI+VI+DD D ++G+I+VK  GSS G NG+KSI S +  +   R+R G+G+P    +L  +VL+KFS
  S:     2 HLIVGLGNPGSQYELTHHNIGFIVVDTICKYWNFHSFSKKADYLITSGIINDNKIMLIKPYSFMNNSGIPVAKIQNFYKLSLDNIVVIHDDADLELGRIKVKKGGSSAGHNGLKSIDSFIGND-YWRLRFGVGRPEDQRSLADYVLSKFS 150
>gi|21230348|ref|NP_636265.1| peptidyl-tRNA hydrolase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|24418602|sp|Q8PC61|PTH_XANCP Peptidyl-tRNA hydrolase (PTH) >gi|21111901|gb|AAM40189.1| peptidyl tRNA hydrolase [Xanthomonas campestris pv. campestris str. ATCC 33913] (193 aa)
Score = 273, Expect = 8.0e-23, Identities = 62/182 (34%), Positives = 103/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG E+ +T+HN GF  +D L +        +SK  G+  K +     +++ KP T+MN SG+ +    +F+KI  + +LV +D++D   G  R+K  G  GGQNG++  I  +   K  R+R+GIG P H   +   VL +   +D + + +A+  A DA    L+  +F++ M + +
  S:     6 LIVGLGNPGPEHAQTRHNAGFRFVDALAERTGARWGLDSKLFGETAKAEIAGHTVWLLKPATFMNLSGKSITAALRFWKIEPEQLLVAHDELDLAPGTARLKFDGGHGGQNGLRDTIRLLGHGKFHRLRVGIGHPGHKDRVVPWVLGRAGRDDDMAIGEAVDAAIDALPLALDG-NFNEAMKRLH 189
>gi|84500228|ref|ZP_00998494.1| peptidyl-tRNA hydrolase [Oceanicola batsensis HTCC2597] >gi|84392162|gb|EAQ04430.1| peptidyl-tRNA hydrolase [Oceanicola batsensis HTCC2597] (228 aa)
Score = 273, Expect = 8.8e-23, Identities = 56/147 (38%), Positives = 89/147 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFS 151
           L VGLGNPG +Y   +HN+GFM +D +  +H      +KF G+  +     +++ + KPMT+MN SG+ V E  +FYK+   ++ V +D++D   GK+RVK  G   G NG++SI   +  +  +R+R+GIG P H   +  +VL  F+
  S:     3 LFVGLGNPGGKYAANRHNIGFMALDRIASDHGFAPWRTKFQGELAEGTLGGEKLLLLKPMTFMNLSGQSVGEAMRFYKLTPADVTVFHDELDLAPGKVRVKQGGGHAGHNGLRSIHQHIGAD-YQRVRLGIGHPGHKDKVAPYVLADFA 150
>gi|34499511|ref|NP_903726.1| peptidyl-tRNA hydrolase [Chromobacterium violaceum ATCC 12472] >gi|46576721|sp|Q7NQT1|PTH_CHRVO Peptidyl-tRNA hydrolase (PTH) >gi|34105361|gb|AAQ61716.1| aminoacyl-tRNA hydrolase [Chromobacterium violaceum ATCC 12472] (193 aa)
Score = 273, Expect = 8.9e-23, Identities = 64/161 (39%), Positives = 98/161 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHT-LFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKA 165
           L+VGLGNPG EYEKT+HN GF  +DEL  +    + +  KF+G   ++      +++ KPMTYMN SG+ V  +  FYKI    ILV++D++D   G  R K  G  GG NG+K I +++++    R+R+GIG P     + + VL K  AE+   + +A++ +
  S:     6 LIVGLGNPGPEYEKTRHNAGFWLVDELCWQFKGNWRSEGKFHGDVARIQIEGQDVWLLKPMTYMNLSGQAVLALAHFYKILPDEILVVHDELDLAPGVARFKQGGGHGGHNGLKDIAARLSSPAFWRLRLGIGHPGDKKEVANFVLKKPRAEEQQALDEAVLAS 169
>gi|158312638|ref|YP_001505146.1| peptidyl-tRNA hydrolase [Frankia sp. EAN1pec] >gi|158108043|gb|ABW10240.1| Aminoacyl-tRNA hydrolase [Frankia sp. EAN1pec] (195 aa)
Score = 272, Expect = 1.0e-22, Identities = 61/183 (33%), Positives = 95/183 (51%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +LVVGLGNPG  Y   +HNVGFM +D L +     L + +   +  +V      + +A+P T+MN SG  V  +  FYKI    ++V++D++D     IR+K  G   G NG++SI S + +    R+R+GIG+P   +     VL  FS  +   +   +  A DA    L   +     N+F+
  S:    10 WLVVGLGNPGASYAGNRHNVGFMVVDLLAERTGARLRSHRSRAEIDQVRLAGRSVVLARPRTFMNVSGPPVAAVRAFYKIDVSRVIVVHDELDIPFDAIRLKRGGGDNGHNGLRSITSSLGSRDYLRVRVGIGRPPGRMDPADFVLRDFSPVERKALPLIVDNAADAVESLLQE-ELAAAQNRFH 193
>gi|78046538|ref|YP_362713.1| peptidyl-tRNA hydrolase [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|119391036|sp|Q3BX00|PTH_XANC5 Peptidyl-tRNA hydrolase (PTH) >gi|78034968|emb|CAJ22613.1| peptidyl tRNA hydrolase [Xanthomonas campestris pv. vesicatoria str. 85-10] (193 aa)
Score = 272, Expect = 1.1e-22, Identities = 53/136 (38%), Positives = 84/136 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH 140
           L+VGLGNPG E+ +T+HN GF  +D L+ +    +  +SK  G+  KV+     +++ KP T+MN SG+ +    +F+KI  +++LV +D++D   G  R+K  G  GGQNG++  I  +   K  R+R+GIG P H
  S:     6 LIVGLGNPGPEHAQTRHNAGFRFVDALIERSGARWALDSKLFGETAKVEVAGQPVWLLKPATFMNLSGKSITAALRFWKIEPEHLLVAHDELDLAPGTARLKFDGGHGGQNGLRDTIRLLGHGKFHRLRVGIGHPGH 142
>gi|21241721|ref|NP_641303.1| peptidyl-tRNA hydrolase [Xanthomonas axonopodis pv. citri str. 306] >gi|24418603|sp|Q8PNT8|PTH_XANAC Peptidyl-tRNA hydrolase (PTH) >gi|21107090|gb|AAM35839.1| peptidyl tRNA hydrolase [Xanthomonas axonopodis pv. citri str. 306] (193 aa)
Score = 272, Expect = 1.1e-22, Identities = 53/136 (38%), Positives = 84/136 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH 140
           L+VGLGNPG E+ +T+HN GF  +D L+ +    +  +SK  G+  KV+     +++ KP T+MN SG+ +    +F+KI  +++LV +D++D   G  R+K  G  GGQNG++  I  +   K  R+R+GIG P H
  S:     6 LIVGLGNPGPEHAQTRHNAGFRFVDALIERSGARWALDSKLFGETAKVEVAGQPVWLLKPATFMNLSGKSITAALRFWKIEPEHLLVAHDELDLAPGTARLKFDGGHGGQNGLRDTIRLLGHGKFHRLRVGIGHPGH 142
>gi|116626136|ref|YP_828292.1| peptidyl-tRNA hydrolase [Solibacter usitatus Ellin6076] >gi|116229298|gb|ABJ88007.1| peptidyl-tRNA hydrolase [Solibacter usitatus Ellin6076] (196 aa)
Score = 272, Expect = 1.2e-22, Identities = 60/183 (32%), Positives = 101/183 (55%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGI--GKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +L+ GLGNPG +Y  + HN+GF+ +D L ++  + +            +    Q+ +AKP T+MN SGE +  + + ++I   N++VIYD++D   G +++K KGS+ G NG+KS+I    T +I R+R+GI  G P+ +    VL         ++ + +  A DA    +     +K M KFN
  S:     2 FLLAGLGNPGEQYALSPHNLGFLVVDRLAEQFGIRVTRKDSKALIGLGEIDGHQVMLAKPQTFMNLSGESLAPLMEKHQIEISNLVVIYDELDLPWGALKIKPKGSAAGHNGMKSVIQWFKTSEIVRVRLGIHPGHPIRSGAEFVLAPIKRSQMKELDEFVGFAADAVRT-ITAEGVEKAMTKFN 185
>gi|68052930|sp|Q6AJL9|PTH_DESPS Peptidyl-tRNA hydrolase (PTH) (197 aa)
Score = 272, Expect = 1.2e-22, Identities = 64/153 (41%), Positives = 98/153 (64%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTH-------HVLTKFSAE 153
           +++YL+VGLGNPG EY+ T+HN G + +D+L    +   +  K+N  F K     + + + +P+TYMN SG  V E  +F+KI  +NI+VI+DDID   G++++   G +GG NGIKSI S +      R++IG+G+P  +  H       +VL  FSAE
  S:     3 VNEYLLVGLGNPGREYQDTRHNAGSLLLDDLSSRWSGSNSIEKYNSTFRKARVAGNSLALMQPLTYMNRSGLAVAEYVRFFKIVAENIIVIHDDIDMAPGRVKLVRGGGAGGHNGIKSINSSLGFVDYYRLKIGVGRPGKHGIHPEIPVDKYVLAPFSAE 162
>gi|71082804|ref|YP_265523.1| peptidyl-tRNA hydrolase [Candidatus Pelagibacter ubique HTCC1062] >gi|119390975|sp|Q4FPG9|PTH_PELUB Peptidyl-tRNA hydrolase (PTH) >gi|71061917|gb|AAZ20920.1| Peptidyl-tRNA hydrolase [Candidatus Pelagibacter ubique HTCC1062] (186 aa)
Score = 272, Expect = 1.2e-22, Identities = 59/156 (37%), Positives = 97/156 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQ 160
           L VGLGNP  + E  +HN+GF  ID L ++  L     KF G     +  + +++  KP+T+MNNSG  + E+ +++KI  ++++V +DD+D + GK++ K  GSS G NGI+S I K   +   R+RIGIG+P    ++  HVL  F  ++ I++++
  S:     3 LFVGLGNPTPDSENNRHNIGFKLIDALNQKFGLSKQKPKFKGLLTTGNVEDKKVYAIKPLTFMNNSGICIRELIEYFKIDAEDVIVFHDDLDLEFGKVKAKFAGSSAGHNGIES-IDKFIGKDYSRVRIGIGRPKTKADVADHVLKDFDEDEMIQLEK 159
>gi|91762773|ref|ZP_01264738.1| Peptidyl-tRNA hydrolase [Candidatus Pelagibacter ubique HTCC1002] >gi|91718575|gb|EAS85225.1| Peptidyl-tRNA hydrolase [Candidatus Pelagibacter ubique HTCC1002] (186 aa)
Score = 272, Expect = 1.3e-22, Identities = 60/156 (38%), Positives = 97/156 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQ 160
           L VGLGNP  + E  +HN+GF  ID L ++  L     KF G     +  + +++  KP+T+MNNSG  + E+ +++KI  ++++V +DD+D + GK++ K  GSS G NGI+S I K   +   R+RIGIGKP    ++  HVL  F  ++ I++++
  S:     3 LFVGLGNPTPDSENNRHNIGFKLIDALNQKFGLSKQKPKFKGLLTTGNIEDKKVYAIKPLTFMNNSGICIRELIEYFKIDAEDVIVFHDDLDLEFGKVKAKFAGSSAGHNGIES-IDKFIGKDYSRVRIGIGKPKTKADVADHVLKDFDEDEMIQLEK 159
>gi|51246584|ref|YP_066468.1| peptidyl-tRNA hydrolase [Desulfotalea psychrophila LSv54] >gi|50877621|emb|CAG37461.1| related to peptidyl-tRNA hydrolase (PTH) [Desulfotalea psychrophila LSv54] (215 aa)
Score = 271, Expect = 1.3e-22, Identities = 64/153 (41%), Positives = 98/153 (64%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTH-------HVLTKFSAE 153
           +++YL+VGLGNPG EY+ T+HN G + +D+L    +   +  K+N  F K     + + + +P+TYMN SG  V E  +F+KI  +NI+VI+DDID   G++++   G +GG NGIKSI S +      R++IG+G+P  +  H       +VL  FSAE
  S:    21 VNEYLLVGLGNPGREYQDTRHNAGSLLLDDLSSRWSGSNSIEKYNSTFRKARVAGNSLALMQPLTYMNRSGLAVAEYVRFFKIVAENIIVIHDDIDMAPGRVKLVRGGGAGGHNGIKSINSSLGFVDYYRLKIGVGRPGKHGIHPEIPVDKYVLAPFSAE 180
>gi|77464401|ref|YP_353905.1| peptidyl-tRNA hydrolase [Rhodobacter sphaeroides 2.4.1] >gi|119390995|sp|Q3IZN0|PTH_RHOS4 Peptidyl-tRNA hydrolase (PTH) >gi|77388819|gb|ABA80004.1| peptidyl-tRNA hydrolase [Rhodobacter sphaeroides 2.4.1] (225 aa)
Score = 271, Expect = 1.3e-22, Identities = 54/150 (36%), Positives = 89/150 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAED 154
           L VGLGNPG  Y   +HN+G+M ++ +  +H      ++F G   +     +Q+ + KP T+MN SG+ V E  +FYK+   +++V +D++D   GK+R+K  G   G NG++SI + +  E   R+R+GIG P H   +  +VL+ F+  D
  S:     3 LFVGLGNPGARYAGNRHNIGYMAVEAIAADHGFGPWRARFQGLTSEGRLGSEQVLLLKPETFMNLSGQSVGEAMRFYKLTPADVIVFHDELDLAPGKLRLKQGGGHAGHNGLRSIHAHVG-EAYGRVRLGIGHPGHKDAVAPYVLSDFAKAD 153
>gi|126463243|ref|YP_001044357.1| peptidyl-tRNA hydrolase [Rhodobacter sphaeroides ATCC 17029] >gi|166229441|sp|A3PML9|PTH_RHOS1 Peptidyl-tRNA hydrolase (PTH) >gi|126104907|gb|ABN77585.1| peptidyl-tRNA hydrolase [Rhodobacter sphaeroides ATCC 17029] (225 aa)
Score = 271, Expect = 1.3e-22, Identities = 54/150 (36%), Positives = 89/150 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAED 154
           L VGLGNPG  Y   +HN+G+M ++ +  +H      ++F G   +     +Q+ + KP T+MN SG+ V E  +FYK+   +++V +D++D   GK+R+K  G   G NG++SI + +  E   R+R+GIG P H   +  +VL+ F+  D
  S:     3 LFVGLGNPGARYAGNRHNIGYMAVEAIAADHGFGPWRARFQGLTSEGRLGSEQVLLLKPETFMNLSGQSVGEAMRFYKLTPADVIVFHDELDLAPGKLRLKQGGGHAGHNGLRSIHAHVG-EAYGRVRLGIGHPGHKDAVAPYVLSDFAKAD 153
>gi|29830107|ref|NP_824741.1| peptidyl-tRNA hydrolase [Streptomyces avermitilis MA-4680] >gi|46576777|sp|Q82HE5|PTH_STRAW Peptidyl-tRNA hydrolase (PTH) >gi|29607217|dbj|BAC71276.1| putative peptidyl-tRNA hydrolase [Streptomyces avermitilis MA-4680] (203 aa)
Score = 271, Expect = 1.4e-22, Identities = 64/167 (38%), Positives = 99/167 (59%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHT--LFLNNSKFNGQFV--KVDQP---EDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDA 168
           + +L+VGLGNPG EY + +HNVGFM  D LL E     F    K   Q +  ++  P     ++ +AKPM+YMN SG  V  + +FYK+   NI+ ++D++D D G +R+K  G   G NG+KS+   M  +   R+R GIG+P   +     VL  F++ +  ++   + +A DA
  S:    12 APWLIVGLGNPGPEYARNRHNVGFMVAD-LLAERIGGKFKRAGKAQAQVIEGRIGPPGPANRRVILAKPMSYMNLSGGPVNALREFYKVPVANIVAVHDELDIDYGVLRLKLGGGDNGHNGLKSMTKAMGPD-YHRVRFGIGRPPGRMQVADFVLKDFASAERKELDYLVDRAADA 185
>gi|71064750|ref|YP_263477.1| peptidyl-tRNA hydrolase [Psychrobacter arcticus 273-4] >gi|119390984|sp|Q4FVB5|PTH_PSYA2 Peptidyl-tRNA hydrolase (PTH) >gi|71037735|gb|AAZ18043.1| peptidyl-tRNA hydrolase [Psychrobacter arcticus 273-4] (193 aa)
Score = 271, Expect = 1.5e-22, Identities = 63/186 (33%), Positives = 105/186 (56%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           M+  L+VGLGNPG EY  T+HN GF  +  L ++  + L  + KF+G   +       + +  P+T+MN SG+ V  + KFY I    +L+ +D++D   G I++K  G  GG NG++ I   +  +   R+R+GIG P H   ++ HVL+K + ++ I +  A+  A +A    L+  D +K  ++ N
  S:     1 MAIKLIVGLGNPGQEYMFTRHNAGFWFVHHLAQQFNIALAPDKKFHGVTGRGQIHGSDVRLLMPLTFMNKSGQSVVPMVKFYGIDNDELLIAHDELDIPAGSIKLKTDGGHGGHNGLRDITPHIGND-FHRLRVGIGHPGHKSKVSGHVLSKAAPDEQIAIDSALSAAFEALPLLLDG-DIEKARSQIN 187
>gi|53712488|ref|YP_098480.1| peptidyl-tRNA hydrolase [Bacteroides fragilis YCH46] >gi|60680688|ref|YP_210832.1| peptidyl-tRNA hydrolase [Bacteroides fragilis NCTC 9343] >gi|68052914|sp|Q64X30|PTH_BACFR Peptidyl-tRNA hydrolase (PTH) >gi|81316244|sp|Q5LG56|PTH_BACFN Peptidyl-tRNA hydrolase (PTH) >gi|52215353|dbj|BAD47946.1| peptidyl-tRNA hydrolase [Bacteroides fragilis YCH46] >gi|60492122|emb|CAH06885.1| putative peptidyl-tRNA hydrolase [Bacteroides fragilis NCTC 9343] (187 aa)
Score = 271, Expect = 1.6e-22, Identities = 66/184 (35%), Positives = 99/184 (53%)
  Q:     3 KYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGK--PVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           KYL+VGLGN G EY +T+HN+GFM +D L + + L   + ++ G    +     Q+ + KP T+MN SG  V    +   I  +N+L+I DD+    G +R+K+KGS  G NG+K I + + T+   R+R GIG   P       VL  F+ ED   + + +  A +    F      D  MN+FN
  S:     2 KYLIVGLGNIGPEYHETRHNIGFMVLDALARANNLSFTDGRY-GFTTTLSVKGRQMILLKPSTFMNLSGNAVRYWMQKENIPLENVLIIVDDLALPFGTLRLKSKGSDAGHNGLKHIATILGTQNYARLRFGIGNDFPRGGQIDFVLGHFTDEDWKTMDERLETAGEIAKSFC-LAGIDITMNQFN 185
>gi|68536582|ref|YP_251287.1| peptidyl-tRNA hydrolase [Corynebacterium jeikeium K411] >gi|119390905|sp|Q4JU38|PTH2_CORJK Peptidyl-tRNA hydrolase 2 (PTH 2) >gi|68264181|emb|CAI37669.1| pthB [Corynebacterium jeikeium K411] (240 aa)
Score = 270, Expect = 1.7e-22, Identities = 53/152 (34%), Positives = 94/152 (61%)
  Q:     3 KYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHT---LFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAED 154
           +++V+GLGNPG +Y  T+HN+G+  ID L++ +    L +   K +   + V+  E  + + +  TYMNNSGE V  +     +  + I+V +D++D   G++R+K KG  GG NG++S+ +++ T+   R+R+GIG+P    ++   VL+ F   D
  S:    47 EWIVIGLGNPGAKYADTRHNIGYWPIDRLVERYEAQWLPVEGQKAHAALITVE--ETPVLLLRSTTYMNNSGEAVGPLASALSLPAERIIVCHDELDIAAGQVRIKDKGGEGGHNGLRSMTAELGTQHYVRVRMGIGRPPKGTSVIDFVLSPFEEAD 201
>gi|93005014|ref|YP_579451.1| peptidyl-tRNA hydrolase [Psychrobacter cryohalolentis K5] >gi|119390985|sp|Q1QED6|PTH_PSYCK Peptidyl-tRNA hydrolase (PTH) >gi|92392692|gb|ABE73967.1| peptidyl-tRNA hydrolase [Psychrobacter cryohalolentis K5] (193 aa)
Score = 270, Expect = 2.1e-22, Identities = 60/168 (35%), Positives = 97/168 (57%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDA 168
           M+  L+VGLGNPG EY  T+HN GF  +  L ++  + L  + KF+G   +       + +  P+T+MN SG+ V  + KFY I    +L+ +D++D   G I++K  G  GG NG++ I   +  +   R+R+GIG P H   ++ HVL+K + ++ I +  A+  A DA
  S:     1 MAIKLIVGLGNPGQEYMFTRHNAGFWFVLHLAQQFNITLAPDKKFHGVTGRGQIHGHDVRLLMPLTFMNKSGQSVVPMVKFYGIDNDELLIAHDELDIPAGSIKLKTDGGHGGHNGLRDITPHIGND-FHRLRVGIGHPGHKSKVSGHVLSKAAPDEQIAIDSALSAAFDA 170
>gi|37525972|ref|NP_929316.1| peptidyl-tRNA hydrolase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|46576711|sp|Q7N5A1|PTH_PHOLL Peptidyl-tRNA hydrolase (PTH) >gi|36785401|emb|CAE14348.1| peptidyl-tRNA hydrolase [Photorhabdus luminescens subsp. laumondii TTO1] (196 aa)
Score = 268, Expect = 3.2e-22, Identities = 68/182 (37%), Positives = 100/182 (54%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNN-SKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY +T+HN G   +D L + H   L   SKF G   +++     + +  P T+MN SG+ V  +  FY+I    ILV +D++D   G  ++K  GS GG NG+K I +K  N     R+RIGIG P   + +   VL K  A +   +  AI +A+  C + L   D DK +N+ +
  S:     6 LIVGLANPGAEYAQTRHNAGAWYVDLLARSHNQSLKEESKFFGYTARINICGHDVRLLVPTTFMNLSGKSVVALASFYRIQPDEILVAHDELDLPPGVAKMKLGGSHGGHNGLKDIQNKFGNNPNFYRLRIGIGHPGDKNKVVGFVLGKPPASEQQLIDDAIDEAR-RCTDILMKQDMDKAINRLH 190
>gi|25027567|ref|NP_737621.1| peptidyl-tRNA hydrolase [Corynebacterium efficiens YS-314] >gi|46576823|sp|Q8FQV6|PTH_COREF Peptidyl-tRNA hydrolase (PTH) >gi|23492849|dbj|BAC17821.1| putative peptidyl-tRNA hydrolase [Corynebacterium efficiens YS-314] (177 aa)
Score = 268, Expect = 3.2e-22, Identities = 59/175 (33%), Positives = 101/175 (57%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHV 176
           S  LVVGLGNPG +Y  T+HN+GF  ++EL+ + +  F  + + N +  ++      + +AKP ++MN SG  +  +C F+KI   N+LV++D++D D G+++++  G   G NG+KS    + T+   ++ +GIG+P   +     VL  FS ++   V    I A DA +    H+
  S:     4 SPVLVVGLGNPGPKYVGTRHNIGFEVVEELVGRNYANFSVHKRSNTEIAQLPG----LIVAKPRSFMNLSGTPIRALCDFFKISPANVLVVHDELDLDFGQVKLRQGGGDHGHNGLKSTSRSLGTKDYWKLSVGIGRPPGRMDPATFVLKPFSKQEQDSVP---IMAADAADLIEEHI 174
>gi|21221563|ref|NP_627342.1| peptidyl-tRNA hydrolase [Streptomyces coelicolor A3(2)] >gi|22095998|sp|Q9K3T8|PTH_STRCO Peptidyl-tRNA hydrolase (PTH) >gi|8894758|emb|CAB95918.1| peptidyl-tRNA hydrolase [Streptomyces coelicolor A3(2)] (200 aa)
Score = 268, Expect = 3.6e-22, Identities = 65/167 (38%), Positives = 97/167 (58%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEH--TLFLNNSKFNGQFV--KVDQP---EDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDA 168
           + +LV GLGNPG EY   +HNVGFM  D LL E     F  + K   Q V  ++  P     ++ +AKPM++MN SG  V  +  FYK+   NI+ ++D++D D G +R+K  G   G NG+KSI   +  +   R+R GIG+P   +     VL  FS+ +  ++   + +A DA
  S:     9 APWLVAGLGNPGPEYASNRHNVGFMVAD-LLAERIGARFKRHGKAQAQVVEGRIGPPGPANRRVILAKPMSFMNVSGGPVTALRDFYKVPVGNIVAVHDELDIDYGVLRLKLGGGDNGHNGLKSITKSLGAD-YHRVRFGIGRPPGRMPVADFVLRDFSSTERKELDYFVDRAADA 182
>gi|121593315|ref|YP_985211.1| peptidyl-tRNA hydrolase [Acidovorax sp. JS42] >gi|166199298|sp|A1W4G0|PTH_ACISJ Peptidyl-tRNA hydrolase (PTH) >gi|120605395|gb|ABM41135.1| peptidyl-tRNA hydrolase [Acidovorax sp. JS42] (211 aa)
Score = 267, Expect = 4.2e-22, Identities = 62/176 (35%), Positives = 100/176 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK-FNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDK 180
           L VGLGNPG EYE T+HN GF  ID L +E  + L   + ++G   +       +++ +P T+MN SG+ V  + +F+KI  + ILV +D++D   G+ ++K  GS  G NG++ I +++ T    R+RIGIG P     + + VL K + +    ++ +I+ +  A    L   D DK
  S:     4 LFVGLGNPGPEYEATRHNAGFWWIDALARELKVTLVPERSYHGLVARASVAGHSVWLLQPQTFMNLSGKSVAALARFFKIPPEEILVAHDELDIPPGQAKLKRGGSHAGHNGLRDIHAQLGTSDYWRLRIGIGHPGVKAEVVNWVLKKPAPDQRTLIEDSILHSLKAYPALLAG-DMDK 181
>gi|62389825|ref|YP_225227.1| peptidyl-tRNA hydrolase [Corynebacterium glutamicum ATCC 13032] >gi|41325160|emb|CAF19641.1| PEPTIDYL-TRNA HYDROLASE [Corynebacterium glutamicum ATCC 13032] (201 aa)
Score = 267, Expect = 4.4e-22, Identities = 54/137 (39%), Positives = 80/137 (58%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           +K+LVVGLGNPG +YE T+HNVG+MC D L+  H      +   G      Q    +   +  T+MN+SG+ V  I     I  + I+VI+D++D   GK+R+K  G+  G NG+KS+  ++ T    R+RIGI +P
  S:    20 AKWLVVGLGNPGAKYESTRHNVGYMCQDMLIDAHQQ-QPLTPATGYKALTTQLAPGVLAVRSTTFMNHSGQGVAPIAAALGIPAERIIVIHDELDLPAGKVRLKKGGNENGHNGLKSLTEELGTRDYLRVRIGISRP 155
>gi|19552161|ref|NP_600163.1| peptidyl-tRNA hydrolase [Corynebacterium glutamicum ATCC 13032] >gi|45477195|sp|Q8NRV6|PTH2_CORGL Peptidyl-tRNA hydrolase 2 (PTH 2) >gi|21323701|dbj|BAB98328.1| Peptidyl-tRNA hydrolase [Corynebacterium glutamicum ATCC 13032] (204 aa)
Score = 267, Expect = 4.4e-22, Identities = 54/137 (39%), Positives = 80/137 (58%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           +K+LVVGLGNPG +YE T+HNVG+MC D L+  H      +   G      Q    +   +  T+MN+SG+ V  I     I  + I+VI+D++D   GK+R+K  G+  G NG+KS+  ++ T    R+RIGI +P
  S:    23 AKWLVVGLGNPGAKYESTRHNVGYMCQDMLIDAHQQ-QPLTPATGYKALTTQLAPGVLAVRSTTFMNHSGQGVAPIAAALGIPAERIIVIHDELDLPAGKVRLKKGGNENGHNGLKSLTEELGTRDYLRVRIGISRP 158
>gi|40889731|pdb|1RYM|A Chain A, Structure Of The Group Ii Intron Splicing Factor Crs2 (212 aa)
Score = 267, Expect = 4.4e-22, Identities = 55/167 (32%), Positives = 96/167 (57%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEK-IKRIRIGIGKPVHNLTHH--VLTKFSAEDSIKVQQAIIKAKDA 168
           + +L+ GLGNPG +Y  T+HNVGF  +D +  E  + +N  +           E  + + KP +YMN SGE +  +  +Y++  ++IL+IYDD     G +R++ KG  G  NG++++I  ++  +   R+ IGIG P   +     +L KFS+E+ +++  A+ +  DA
  S:    16 TPWLIAGLGNPGNKYYGTRHNVGFEMVDRIAAEEGITMNTEQSKSLLGIGSIGEVPVLVVKPQSYMNYSGEAIGPLAAYYQVPLRHILLIYDDTSLPNGVLRLQKKGGHGRHNGLQNVIEHLDGRREFPRLSIGIGSPPGKMDPRAFLLQKFSSEERVQIDTALEQGVDA 185
>gi|30249778|ref|NP_841848.1| peptidyl-tRNA hydrolase [Nitrosomonas europaea ATCC 19718] >gi|46576780|sp|Q82TQ6|PTH_NITEU Peptidyl-tRNA hydrolase (PTH) >gi|30180815|emb|CAD85735.1| Peptidyl-tRNA hydrolase [Nitrosomonas europaea ATCC 19718] (195 aa)
Score = 267, Expect = 4.4e-22, Identities = 61/158 (38%), Positives = 101/158 (63%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLK-EHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAI 162
           LVVGLGNPG +Y  T+HNVGF  +D L   +   F   ++F G   ++   +  I++ KP TYMN SG  V  +C++YKI  + +LV++D++D   G I++K+ G +GG NG+KSI++ ++++   R+RIG+G P   + +  +VL     E++  + +AI
  S:     7 LVVGLGNPGEKYASTRHNVGFDWLDRLASSQRVAFTLETRFRGLCARIMLADTDIWLLKPQTYMNASGMSVAAVCRYYKIVPEQMLVVHDELDLQPGVIKLKSGGGTGGHNGLKSIVADLSSQVFWRLRIGVGHPGDRNQVVDYVLHPPRREEAALIDEAI 167
>gi|111225610|ref|YP_716404.1| peptidyl-tRNA hydrolase [Frankia alni ACN14a] >gi|123142574|sp|Q0RCD6|PTH_FRAAA Peptidyl-tRNA hydrolase (PTH) >gi|111153142|emb|CAJ64889.1| Peptidyl-tRNA hydrolase (PTH) [Frankia alni ACN14a] (197 aa)
Score = 267, Expect = 4.5e-22, Identities = 54/151 (35%), Positives = 86/151 (56%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAED 154
           +LVVGLGNPG  Y   +HN GFM +D L +     L + +      +V     +  +A+P+++MN SG  V  +  FYKI    ++V++D++D   G +R+K  G   G NG++SI S + T    R+R+GIG+P   +    +VL  F+A +
  S:    11 WLVVGLGNPGPGYAGNRHNAGFMVVDLLAERAGSRLKSHRSRADVAEVRLAGTRAILARPLSFMNLSGGPVSAVRTFYKIDPARVIVVHDELDIPFGSVRLKRGGGDNGHNGLRSISSALGTRDYLRVRVGIGRPPGRMDPADYVLRDFAAAE 163
>gi|84683371|ref|ZP_01011274.1| peptidyl-tRNA hydrolase [Rhodobacterales bacterium HTCC2654] >gi|84668114|gb|EAQ14581.1| peptidyl-tRNA hydrolase [Rhodobacterales bacterium HTCC2654] (227 aa)
Score = 266, Expect = 4.9e-22, Identities = 54/150 (36%), Positives = 92/150 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAED 154
           L VGLGNPG +Y   +HN+GFM +D + ++H      SKF GQ  + +   +++ + KP T+MN SG+ V E  +FYK+   ++ V +D++D    K+++K  G   G NG++SI   + +    R+R+GIG P H   ++ +VL+ F+ ++
  S:     3 LFVGLGNPGSKYAGNRHNIGFMAVDRIREDHGFAPWRSKFQGQVSEGNLGGEKVILLKPETFMNLSGQSVGEAMRFYKLDSTDVTVFHDELDLPPFKVKLKLGGGHAGHNGLRSIHQHI-SPHYGRVRLGIGHPGHKDRVSPYVLSDFAKQE 153
>gi|83644561|ref|YP_432996.1| peptidyl-tRNA hydrolase [Hahella chejuensis KCTC 2396] >gi|119390948|sp|Q2SLA3|PTH_HAHCH Peptidyl-tRNA hydrolase (PTH) >gi|83632604|gb|ABC28571.1| peptidyl-tRNA hydrolase [Hahella chejuensis KCTC 2396] (195 aa)
Score = 266, Expect = 5.0e-22, Identities = 68/181 (37%), Positives = 106/181 (58%)
  Q:     6 VVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEK-IKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +VGLGNPG +Y +T+HN G + ++ L ++   FL  + K +G + K+    + I +  P T+MN SG+ V  + +FYKI  +NILV +D++D D G +R+K  G  GG NG++ II      K   R+R+GIG P     +T HVL + S ED  K++ A  +  D   E +    +D  MN+ +
  S:     8 IVGLGNPGPDYAQTRHNAGALWLEHLARKKGQFLRPDKKLHGDYCKISIAGEDIHLLFPSTFMNRSGQSVLSLSQFYKIELENILVAHDELDIDAGTLRLKFGGGHGGHNGLRDIIRCFGGNKDFPRMRLGIGHPGDKSKVTSHVLGRISKEDMDKLESAFYQL-DTHLEAIISGQWDTAMNRLH 191
>gi|79517018|ref|NP_197484.4| aminoacyl-tRNA hydrolase [Arabidopsis thaliana] >gi|75291353|sp|Q6NLS8|PTHM_ARATH Peptidyl-tRNA hydrolase, mitochondrial precursor (M-PTH) (Mitochondrial CRS2-like protein) (Mitochondrial RNA splicing factor) >gi|44681342|gb|AAS47611.1| At5g19830 [Arabidopsis thaliana] >gi|45773870|gb|AAS76739.1| At5g19830 [Arabidopsis thaliana] >gi|110735763|dbj|BAE99859.1| peptidyl tRNA hydrolases-like putative protein [Arabidopsis thaliana] (219 aa)
Score = 266, Expect = 5.2e-22, Identities = 67/184 (36%), Positives = 102/184 (55%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFN---GQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           +L +GLGNPG +Y+ T+HN+GF  ID   +   + +N   F    GQ    D P   + +AKP TYMN SGE    +  +YK+    +LV++DD+    G +R++ KG  G  NG+KS+++      +  R+RIGIGKP   +     +L KFS     ++ +A+ +  DA    L   DF +    FNV
  S:    19 WLFLGLGNPGDKYKGTRHNIGFEMIDVFAESVGIQMNLVNFKAIMGQGFVADLP---VILAKPQTYMNLSGESSGPLAAYYKLPLNRVLVVHDDMQLPCGVLRLQEKGGHGCHNGLKSVMNHFRGNREFARLRIGIGKPPGQMDPKAFLLQKFSMPARERMDKALAEGVDALKLVLAK-DFGESWRLFNV 204
>gi|162461597|ref|NP_001104963.1| CRS2 [Zea mays] >gi|75312019|sp|Q9M5P4|CRS2_MAIZE Chloroplastic group IIB intron splicing facilitator CRS2, chloroplast precursor (Chloroplastic RNA splicing factor 2) (Protein CHLOROPLAST RNA SPLICING 2) >gi|6752919|gb|AAF27939.1|AF225708_1 CRS2 [Zea mays] (256 aa)
Score = 266, Expect = 5.6e-22, Identities = 55/167 (32%), Positives = 96/167 (57%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEK-IKRIRIGIGKPVHNLTHH--VLTKFSAEDSIKVQQAIIKAKDA 168
           + +L+ GLGNPG +Y  T+HNVGF  +D +  E  + +N  +           E  + + KP +YMN SGE +  +  +Y++  ++IL+IYDD     G +R++ KG  G  NG++++I  ++  +   R+ IGIG P   +     +L KFS+E+ +++  A+ +  DA
  S:    60 TPWLIAGLGNPGNKYYGTRHNVGFEMVDRIAAEEGITMNTIQSKSLLGIGSIGEVPVLVVKPQSYMNYSGEAIGPLAAYYQVPLRHILLIYDDTSLPNGVLRLQKKGGHGRHNGLQNVIEHLDGRREFPRLSIGIGSPPGKMDPRAFLLQKFSSEERVQIDTALEQGVDA 229
>gi|146276404|ref|YP_001166563.1| peptidyl-tRNA hydrolase [Rhodobacter sphaeroides ATCC 17025] >gi|166229442|sp|A4WPE4|PTH_RHOS5 Peptidyl-tRNA hydrolase (PTH) >gi|145554645|gb|ABP69258.1| peptidyl-tRNA hydrolase [Rhodobacter sphaeroides ATCC 17025] (225 aa)
Score = 266, Expect = 6.2e-22, Identities = 54/150 (36%), Positives = 86/150 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAED 154
           L VGLGNPG  Y   +HN+G+M ++ +   H      S+F G   +     +Q+ + KP T+MN SG+ V E  +FYK+   ++ V +D++D   G++R+K  G   G NG++SI + +  E   R+R+GIG P H   +  +VL  F+  D
  S:     3 LFVGLGNPGARYAGNRHNIGYMAVEAIASAHGFGPWRSRFQGVTSEGRLGAEQVLLLKPETFMNLSGQSVGEAMRFYKLSPADLTVFHDELDLAPGRLRLKQGGGHAGHNGLRSIHAHVG-EAYGRVRLGIGHPGHKDAVASYVLNDFAKAD 153
>gi|58584354|ref|YP_197927.1| peptidyl-tRNA hydrolase [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|68052872|sp|Q5GTI9|PTH_WOLTR Peptidyl-tRNA hydrolase (PTH) >gi|58418670|gb|AAW70685.1| Peptidyl-tRNA hydrolase [Wolbachia endosymbiont strain TRS of Brugia malayi] (182 aa)
Score = 265, Expect = 6.8e-22, Identities = 61/153 (39%), Positives = 92/153 (60%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGK--PVHNLTHHVLTKFSAEDSI 156
           +L+VGLGNPG +YE T HN+GF+ +D + K       + K +         +++I + KP ++MNNSG  V  I  FYK    N++VI+DD D + G+I++K  G S G NG+KSI S +  +   R+R GIG+     +L  +VL+KFS  D +
  S:     2 HLIVGLGNPGSQYELTYHNIGFIIVDAICKHWNFQSFSKKADCLITSSVINDNKIMLMKPYSFMNNSGIPVARIRNFYKFSLDNVIVIHDDADLEPGRIKIKKGGGSAGHNGLKSIDSSIGND-YWRLRFGIGRSDSQRSLADYVLSKFSNLDDV 155
>gi|91775029|ref|YP_544785.1| peptidyl-tRNA hydrolase [Methylobacillus flagellatus KT] >gi|91709016|gb|ABE48944.1| peptidyl-tRNA hydrolase [Methylobacillus flagellatus KT] (213 aa)
Score = 265, Expect = 7.9e-22, Identities = 55/134 (41%), Positives = 80/134 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           L VGLGNPG +YE T+HN GF  ID+L  +        +KF G   +++   D  ++ KP T+MN SG  V  + +FYKI  + ILV++D++D   G  R+K  G   G NG+K I +++ T    R+R+GIG P
  S:    27 LFVGLGNPGAQYEDTRHNAGFWWIDQLCAQTASKTTLEAKFFGLSGRLNGHADT-WLLKPTTFMNASGRAVAALARFYKIPAEQILVVHDELDLPPGAARLKKGGGHSGHNGLKDIAAQLGTNDFWRLRLGIGHP 160
>gi|71275257|ref|ZP_00651544.1| Peptidyl-tRNA hydrolase [Xylella fastidiosa Dixon] >gi|71902208|ref|ZP_00684220.1| Peptidyl-tRNA hydrolase [Xylella fastidiosa Ann-1] >gi|170731255|ref|YP_001776688.1| aminoacyl-tRNA hydrolase [Xylella fastidiosa M12] >gi|71164066|gb|EAO13781.1| Peptidyl-tRNA hydrolase [Xylella fastidiosa Dixon] >gi|71728034|gb|EAO30245.1| Peptidyl-tRNA hydrolase [Xylella fastidiosa Ann-1] >gi|167966048|gb|ACA13058.1| Aminoacyl-tRNA hydrolase [Xylella fastidiosa M12] (192 aa)
Score = 265, Expect = 7.9e-22, Identities = 62/182 (34%), Positives = 101/182 (55%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG EY KT+HN GF  +D L+ +E   +   SK      +V      +++ +P+T+MN SG+ ++    F+KI  + +LV +D++D   G +R+K  G  GGQNG++ I   +   +  R+R+GIG P H   +   VL   + +++I +  A+ +A           DFD  M K +
  S:     6 LIVGLGNPGSEYIKTRHNAGFRFVDGLVQREGQCWALESKLFAYVARVFIAGQWVWLLRPVTFMNLSGKSIFAGLNFWKIKPEQMLVAHDELDFPPGAVRLKFDGGHGGQNGLRDITKLLGHGRFHRLRVGIGHPGHKERVVSWVLGCPTCDENIAIDAALERAS-VVLPLAVAGDFDGAMKKLH 189
>gi|40889730|pdb|1RYB|A Chain A, Crystal Structure Of The Chloroplast Group Ii Intron Splicing Factor Crs2 (212 aa)
Score = 264, Expect = 8.4e-22, Identities = 55/167 (32%), Positives = 96/167 (57%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEK-IKRIRIGIGKPVHNLTHH--VLTKFSAEDSIKVQQAIIKAKDA 168
           + +L+ GLGNPG +Y  T+HNVGF  +D +  E  + +N  +           E  + + KP +YMN SGE +  +  +Y++  ++IL+IYDD     G +R++ KG  G  NG++++I  ++  +   R+ IGIG P   +     +L KFS+E+ +++  A+ +  DA
  S:    16 TPWLIAGLGNPGNKYYGTRHNVGFEMVDRIAAEEGITMNTIQSKSLLGIGSIGEVPVLVVKPQSYMNYSGEAIGPLAAYYQVPLRHILLIYDDTSLPNGVLRLQKKGGHGRHNGLQNVIEHLDGRREFPRLSIGIGSPPGKMDPRAFLLQKFSSEERVQIDTALEQGVDA 185
>gi|41407076|ref|NP_959912.1| peptidyl-tRNA hydrolase [Mycobacterium avium subsp. paratuberculosis K-10] >gi|68052977|sp|Q741V9|PTH_MYCPA Peptidyl-tRNA hydrolase (PTH) >gi|41395427|gb|AAS03295.1| Pth [Mycobacterium avium subsp. paratuberculosis K-10] (191 aa)
Score = 264, Expect = 9.9e-22, Identities = 67/180 (37%), Positives = 102/180 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNK 184
           LVVGLGNPG  Y +T+HNVGFM  D L  +  + F  + +   + V        + +AKP  YMN SG  V  + KFY +   +I+VI+DD+D D G+IR+K  G  GG NG++S+ + + ++  +R+RIGIG+P    +    VL  F++ +   V     +A DA  E L  +  +   N+
  S:     6 LVVGLGNPGDNYARTRHNVGFMVADLLAARMGSKFKAHKRSGAEIVSGRLAGRSVVVAKPRCYMNESGRQVGPLAKFYSVPPGDIIVIHDDLDLDFGRIRLKIGGGEGGHNGLRSVANALGSKDFQRVRIGIGRPPGRKDPAAFVLENFTSTERADVPTICEQAADA-TELLIELGLEPAQNR 187
>gi|88810858|ref|ZP_01126115.1| peptidyl-tRNA hydrolase [Nitrococcus mobilis Nb-231] >gi|88792488|gb|EAR23598.1| peptidyl-tRNA hydrolase [Nitrococcus mobilis Nb-231] (202 aa)
Score = 263, Expect = 1.1e-21, Identities = 63/165 (38%), Positives = 96/165 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHT-LFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDAC 169
           L++GLGNPG  Y +T+HN GF  +DE+L+     F    KF G   +V     +  + KPMTYMN+SG  + +  ++Y++  ++ILV YDDID   G  R+K  G  GG NG++   + + T    R+RIG+G P H  ++  +VL+  S E+   ++  I    DAC
  S:    10 LLIGLGNPGPRYSRTRHNAGFWLLDEILRRFGGSFSTQRKFQGDVGRVRIGNIECHLLKPMTYMNHSGLAIGQFVRYYRLEPRSILVAYDDIDLLPGVTRLKQGGGHGGHNGLRDTANALGTRDFNRLRIGVGHPGHRDDVIGYVLSAPSREEQEAIEAGI---TDAC 174
>gi|90022898|ref|YP_528725.1| peptidyl-tRNA hydrolase [Saccharophagus degradans 2-40] >gi|119391000|sp|Q21FL6|PTH_SACD2 Peptidyl-tRNA hydrolase (PTH) >gi|89952498|gb|ABD82513.1| peptidyl-tRNA hydrolase [Saccharophagus degradans 2-40] (197 aa)
Score = 263, Expect = 1.1e-21, Identities = 69/182 (37%), Positives = 113/182 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNS-KFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG EYE T+HN G   ++EL ++    L+ + KF G F +++     + +  P TYMN SG+ V  +C+FYKI  + +LV++D++D   GK R+K  G  GG NG++ IIS + N +   R+R+GIG P +   ++++VL K  +E+   ++ AI  A+    + L   D++K M + +
  S:    10 LIVGLGNPGNEYEHTRHNAGQDFVEELARDLGQPLSPTPKFFGHFSRLNINGKDVRLLVPTTYMNRSGQAVAAVCQFYKIPPEAVLVVHDELDLPPGKARLKIGGGHGGHNGLRDIISSLGNNKDFGRLRLGIGHPGNAKLVSNYVLKKAPSEEFNAIEDAIRAAQPHVAD-LAKGDWEKAMRELH 194
>gi|86130925|ref|ZP_01049524.1| peptidyl-tRNA hydrolase [Cellulophaga sp. MED134] >gi|85818336|gb|EAQ39496.1| peptidyl-tRNA hydrolase [Dokdonia donghaensis MED134] (209 aa)
Score = 263, Expect = 1.2e-21, Identities = 62/186 (33%), Positives = 99/186 (53%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           M K+L+VGLGN G +YE T+HN+GF  +D   K         K  G   +       + + KP T+MN SG+ +    +  K+  +N+LVI DD++ + G IRVK KGS GG NG+K   +++NT K  R R GI           +VL +++ +++  + + + KA +    F+     +  MN +N
  S:    22 MKKFLIVGLGNIGPKYENTRHNIGFKVVDAFAKAQETTFETEKL-GDIARTRVKGKTVILLKPNTFMNLSGKAIRYWLQQEKVPVENLLVITDDLNLEFGTIRVKTKGSDGGHNGLKDTQAQLNTTKYNRFRFGISDQFSKGRQVDYVLGEWTPDENAALPERLDKASEVIASFVK-AGINNTMNAYN 207
>gi|114331140|ref|YP_747362.1| peptidyl-tRNA hydrolase [Nitrosomonas eutropha C91] >gi|122313983|sp|Q0AGY5|PTH_NITEC Peptidyl-tRNA hydrolase (PTH) >gi|114308154|gb|ABI59397.1| peptidyl-tRNA hydrolase [Nitrosomonas eutropha C91] (195 aa)
Score = 263, Expect = 1.3e-21, Identities = 62/158 (39%), Positives = 101/158 (63%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAI 162
           LVVGLGNPG +Y  T+HN+G   +D L     + F  + +F G   ++ Q +  I++ KP TYMN SG  V  +C++YKI  + ILV++D++D   G I++K+ G +GG NG+KSI++ ++T+   R+RIG+G P   + +  +VL     E++  + +AI
  S:     7 LVVGLGNPGDKYTSTRHNIGSDWLDRLADAQRVSFALDIRFRGLCARIVQSDTDIWLLKPQTYMNASGMSVGAMCRYYKITPEQILVVHDELDLQPGIIKLKSGGGTGGHNGLKSIVADLSTQVFWRLRIGVGHPGDRNQVVDYVLHLPRREEAALIDEAI 167
>gi|15966108|ref|NP_386461.1| peptidyl-tRNA hydrolase [Sinorhizobium meliloti 1021] >gi|21263853|sp|Q92N67|PTH_RHIME Peptidyl-tRNA hydrolase (PTH) >gi|15075378|emb|CAC46934.1| Probable peptidyl-tRNA hydrolase [Sinorhizobium meliloti 1021] (239 aa)
Score = 263, Expect = 1.3e-21, Identities = 60/150 (40%), Positives = 93/150 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTH-HVLTKFSAED 154
           ++ GLGNPG +Y   +HN+GFM +D + +       + KF  +  + +   +++ + KP T+MN SGE + +  +FYK+  ++I+VIYD++D   GK R+K  G  GG NGIKSI +    E  +R+R+GIG P V +L H HVL  F+  D
  S:     3 IIAGLGNPGPKYAGNRHNIGFMAVDAIQRRQGFSAWSRKFKSEVSEGEIDGERVLLMKPQTFMNLSGEALGDAMRFYKLAPKDIVVIYDELDLPAGKARIKTGGGHGGHNGIKSIDAHCGKE-YRRLRLGIGHPGVKDLVHAHVLGDFAKAD 153
>gi|103487103|ref|YP_616664.1| peptidyl-tRNA hydrolase [Sphingopyxis alaskensis RB2256] >gi|119391011|sp|Q1GSP1|PTH_SPHAL Peptidyl-tRNA hydrolase (PTH) >gi|98977180|gb|ABF53331.1| peptidyl-tRNA hydrolase [Sphingopyxis alaskensis RB2256] (189 aa)
Score = 263, Expect = 1.4e-21, Identities = 59/146 (40%), Positives = 81/146 (55%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKF 150
           L VGLGNPG +Y   +HNVGFM  D + + H       KF G          +I + KP T+MN SG  V     FYK+   ++ V YD++D    K++VK  G + G NGI+S+I  +  +  +RIRIGIG P H   +T HVL  +
  S:     3 LWVGLGNPGPKYAMHRHNVGFMAADVIAEIHDFPPPVKKFQGWLQDGRIGSTRILLLKPGTFMNESGRSVRAALDFYKLAATDVTVFYDELDLAPMKVKVKRGGGAAGHNGIRSMIQHIG-DDFRRIRIGIGHPGHKDRVTGHVLGNY 149
>gi|87200132|ref|YP_497389.1| peptidyl-tRNA hydrolase [Novosphingobium aromaticivorans DSM 12444] >gi|119390972|sp|Q2G6G8|PTH_NOVAD Peptidyl-tRNA hydrolase (PTH) >gi|87135813|gb|ABD26555.1| peptidyl-tRNA hydrolase [Novosphingobium aromaticivorans DSM 12444] (191 aa)
Score = 262, Expect = 1.4e-21, Identities = 56/150 (37%), Positives = 87/150 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAED 154
           L VGLGNPG +Y   +HNVGFM +D + + H       KF G   +     +++ + KP T+MN SG  V E  +FYK+    ++V +D++D    K++VK  G + G NG++SI   +  + + R+R+GIG P H   +T HVL  F+  +
  S:     3 LWVGLGNPGPQYALHRHNVGFMALDTIAEVHNFGPVQKKFQGWLQEGRIGTEKVLLLKPATFMNESGRSVGEAMRFYKLGMDALVVFHDELDLAPFKVKVKQGGGTAGHNGLRSIDKHLGPDFL-RVRLGIGHPGHKDRVTGHVLGNFAKSE 153
>gi|15608154|ref|NP_215530.1| peptidyl-tRNA hydrolase [Mycobacterium tuberculosis H37Rv] >gi|15840442|ref|NP_335479.1| peptidyl-tRNA hydrolase [Mycobacterium tuberculosis CDC1551] >gi|31792205|ref|NP_854698.1| peptidyl-tRNA hydrolase [Mycobacterium bovis AF2122/97] >gi|121636943|ref|YP_977166.1| peptidyl-tRNA hydrolase [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148660796|ref|YP_001282319.1| peptidyl-tRNA hydrolase [Mycobacterium tuberculosis H37Ra] >gi|148822223|ref|YP_001286977.1| peptidyl-tRNA hydrolase [Mycobacterium tuberculosis F11] >gi|167968127|ref|ZP_02550404.1| peptidyl-tRNA hydrolase [Mycobacterium tuberculosis H37Ra] >gi|194543360|ref|YP_002078389.1| peptidyl-tRNA hydrolase pth [Mycobacterium tuberculosis C] >gi|166229421|sp|A1KHF2|PTH_MYCBP Peptidyl-tRNA hydrolase (PTH) >gi|166229425|sp|A5U157|PTH_MYCTA Peptidyl-tRNA hydrolase (PTH) >gi|54038905|sp|P65866|PTH_MYCBO Peptidyl-tRNA hydrolase (PTH) >gi|54041591|sp|P65865|PTH_MYCTU Peptidyl-tRNA hydrolase (PTH) >gi|157836744|pdb|2Z2I|A Chain A, Crystal Structure Of Peptidyl-Trna Hydrolase From Mycobacterium Tuberculosis >gi|157836745|pdb|2Z2J|A Chain A, Crystal Structure Of Peptidyl-Trna Hydrolase From Mycobacterium Tuberculosis >gi|157836746|pdb|2Z2J|B Chain B, Crystal Structure Of Peptidyl-Trna Hydrolase From Mycobacterium Tuberculosis >gi|157836747|pdb|2Z2K|A Chain A, Crystal Structure Of Peptidyl-Trna Hydrolase From Mycobacterium Tuberculosis >gi|1870014|emb|CAB06865.1| PROBABLE PEPTIDYL-TRNA HYDROLASE PTH [Mycobacterium tuberculosis H37Rv] >gi|13880613|gb|AAK45293.1| peptidyl-tRNA hydrolase [Mycobacterium tuberculosis CDC1551] >gi|31617793|emb|CAD93902.1| PROBABLE PEPTIDYL-TRNA HYDROLASE PTH [Mycobacterium bovis AF2122/97] >gi|121492590|emb|CAL71058.1| Probable peptidyl-trna hydrolase pth [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124600367|gb|EAY59377.1| peptidyl-tRNA hydrolase pth [Mycobacterium tuberculosis C] >gi|134149444|gb|EBA41489.1| peptidyl-tRNA hydrolase pth [Mycobacterium tuberculosis str. Haarlem] >gi|148504948|gb|ABQ72757.1| peptidyl-tRNA hydrolase [Mycobacterium tuberculosis H37Ra] >gi|148720750|gb|ABR05375.1| peptidyl-tRNA hydrolase pth [Mycobacterium tuberculosis F11] (191 aa)
Score = 262, Expect = 1.5e-21, Identities = 63/164 (38%), Positives = 96/164 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQ-IFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAIIKAKDA 168
           LVVGLGNPG  Y +T+HN+GF+  D L           K +G  V   +   + + +AKP  YMN SG  +  + KFY +   NI+VI+DD+D + G+IR+K  G  GG NG++S+++ + T+  +R+RIGIG+P    +    VL  F+  +  +V     +A DA
  S:     6 LVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSLVLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRSVVAALGTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADA 172
>gi|54026867|ref|YP_121109.1| peptidyl-tRNA hydrolase [Nocardia farcinica IFM 10152] >gi|68052906|sp|Q5YPZ6|PTH_NOCFA Peptidyl-tRNA hydrolase (PTH) >gi|54018375|dbj|BAD59745.1| putative peptidyl-tRNA hydrolase [Nocardia farcinica IFM 10152] (193 aa)
Score = 262, Expect = 1.5e-21, Identities = 68/182 (37%), Positives = 103/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           LVVGLGNPG EYE+T+HNVGF+  D L +     F  + K     ++      Q+ IAKP +YMN SG  V  + +F+ +    ++V++D++D   G +R+K  G  GG NG++SI S + T+   R RIGIG+P    +    VL  F+A +  +V   + +A DA  E L  V  +   N+ +
  S:    10 LVVGLGNPGSEYERTRHNVGFLVADVLAERVGDRFAVHKKSGADLLQARLDGRQVLIAKPRSYMNLSGRPVAALARFFSVPPTEVIVVHDELDLPFGAVRLKRGGGEGGHNGLRSISSALTTKDYLRTRIGIGRPPGRQDPADFVLKPFAAAERKEVPVIVEQAADAV-ELLLRVGLEAAQNQLH 193
>gi|34558362|ref|NP_908177.1| peptidyl-tRNA hydrolase [Wolinella succinogenes DSM 1740] >gi|46576697|sp|Q7M7U8|PTH_WOLSU Peptidyl-tRNA hydrolase (PTH) >gi|34484081|emb|CAE11077.1| PEPTIDYL-TRNA HYDROLASE [Wolinella succinogenes] (192 aa)
Score = 262, Expect = 1.6e-21, Identities = 76/183 (41%), Positives = 113/183 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHT-LFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAII-KAKDACNEFLN-HVDFDKIMNKFNV 187
           LVVGLGNPG  YE T+HN+GF  ID LL+  + L    S F G+  K    E +    KP TYMN SGE    +  FYK   + ILVI+DD+D   G IR+K  G +GG NG+KS + K+      R+RIGIGKP     +  +VL +FS E+  ++++ +   AK+A   FL   +++D++++++++
  S:     3 LVVGLGNPGKTYESTRHNIGFRVIDALLERRSALNATKSTFKGELHK----EGENLFLKPTTYMNLSGESALPVSTFYK--PEKILVIHDDLDLPFGAIRLKRGGGNGGHNGLKS-LDKLLGNDYYRLRIGIGKPPLGWEVADYVLARFSQEEEQELEERLFPHAKEAIESFLEGKMEWDRLVSRYSL 183
>gi|49475909|ref|YP_033950.1| peptidyl-tRNA hydrolase [Bartonella henselae str. Houston-1] >gi|68052957|sp|Q6G2L1|PTH_BARHE Peptidyl-tRNA hydrolase (PTH) >gi|49238717|emb|CAF27969.1| Peptidyl-tRNA hydrolase [Bartonella henselae str. Houston-1] (193 aa)
Score = 262, Expect = 1.6e-21, Identities = 61/151 (40%), Positives = 92/151 (60%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAED 154
           +L+ GLGNPGL+Y+  +HN+GFM ID + +  +    + KF  +         + F+ KP T+MN SG+ + E  +FYK+  +N +VIYD++D   G++RVK  G + G NGIKSI +   T+   RIR+GIG+P     +  HVL  F+  D
  S:     2 WLIAGLGNPGLQYQNNRHNIGFMAIDAIYQSFSFSPWSKKFQAEISTGLINGKKTFLLKPQTFMNLSGQAIGEALRFYKLDLKNFIVIYDELDLPPGRVRVKIGGGNNGHNGIKSIDAHCGTDYC-RIRLGIGRPNSKELVYQHVLGNFTKSD 153
>gi|15605534|ref|NP_220320.1| peptidyl-tRNA hydrolase [Chlamydia trachomatis D/UW-3/CX] >gi|76789543|ref|YP_328629.1| peptidyl-tRNA hydrolase [Chlamydia trachomatis A/HAR-13] >gi|166154142|ref|YP_001654260.1| peptidyl-tRNA hydrolase [Chlamydia trachomatis 434/Bu] >gi|6831525|sp|O84806|PTH_CHLTR Peptidyl-tRNA hydrolase (PTH) >gi|119390924|sp|Q3KKP1|PTH_CHLTA Peptidyl-tRNA hydrolase (PTH) >gi|3329266|gb|AAC68395.1| Peptidyl tRNA Hydrolase [Chlamydia trachomatis D/UW-3/CX] >gi|76168073|gb|AAX51081.1| peptidyl-tRNA hydrolase [Chlamydia trachomatis A/HAR-13] >gi|165930130|emb|CAP03614.1| peptidyl-tRNA hydrolase [Chlamydia trachomatis 434/Bu] (179 aa)
Score = 262, Expect = 1.8e-21, Identities = 54/161 (33%), Positives = 92/161 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHT-LFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH----NLTHHVLTKFSAEDSIKVQQAIIKA 165
           LVVG+GNPG +Y  T+HN+GF+ +D L       F    +    F KV+   + + + KP TY+N +G+ V    KF+ +  ++ILV+ DDI+ + G +R +    SGG NGIK+    + +    ++R+G+G+P +     +  +VL+ FS  +  K+   + K 
  S:     4 LVVGIGNPGRQYVWTRHNIGFLLLDSLASRFLGAFREAPRLYASFAKVEISSEAVVLMKPTTYVNLTGKAVLAAKKFFDVSMEDILVVADDINREFGFVRFRQDCGSGGHNGIKNTTQILQSNHYWQLRLGVGRPSYPGAEGVADYVLSSFSLNEKEKLNDFLEKG 169
>gi|86358630|ref|YP_470522.1| peptidyl-tRNA hydrolase [Rhizobium etli CFN 42] >gi|119390988|sp|Q2K5U1|PTH_RHIEC Peptidyl-tRNA hydrolase (PTH) >gi|86282732|gb|ABC91795.1| peptidyl-tRNA hydrolase protein [Rhizobium etli CFN 42] (240 aa)
Score = 261, Expect = 1.8e-21, Identities = 62/180 (34%), Positives = 104/180 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNK 184
           ++ GLGNPG +Y   +HN+GF+ +D + + H+    + KF     + +   +++ + KP TYMN SGE V E  +FYK+   +++ IYD++D   GK R+K  G  GG NGIKS+ +    E  +R+R+GIG P     + +HVL  F+  D+  ++  +    D  +  + + D  ++MNK
  S:     3 IIAGLGNPGSKYAGNRHNIGFLAVDAIHRRHSFSPWSKKFKAAIAEGELGGEKVLLIKPQTYMNLSGEAVGEAMRFYKLQPADLVAIYDELDLPAGKARLKTGGGHGGHNGIKSLDAHCGKE-YRRLRLGIGHPGVKEMVQNHVLGDFAKADNAWLEPLLDTLADNADMLVRNED-SQLMNK 182
>gi|78776667|ref|YP_392982.1| peptidyl-tRNA hydrolase [Sulfurimonas denitrificans DSM 1251] >gi|119391034|sp|Q30TD4|PTH_THIDN Peptidyl-tRNA hydrolase (PTH) >gi|78497207|gb|ABB43747.1| peptidyl-tRNA hydrolase [Sulfurimonas denitrificans DSM 1251] (184 aa)
Score = 261, Expect = 1.9e-21, Identities = 66/158 (41%), Positives = 100/158 (63%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAI 162
           L+VGLGNPG  YE+T+HN+GFM IDEL+K+      +S F+G   K        F+ KP+T+MN SG  + ++ +FYKI E  ++VI+DD+D   G +R K  G  GG NG++S    ++ E I R+R+GIGKP H   +  +VL+ F+ ++   + + I
  S:     2 LIVGLGNPGANYERTRHNIGFMVIDELVKKQNAQKISSSFDGTLFKFSNH----FLLKPLTFMNLSGSAIRDVKQFYKIDE--VVVIHDDLDLPFGTLRFKKGGGHGGHNGLRSTDEHISKEYI-RVRMGIGKPEHKGEVASYVLSNFTKDEQAHLDEFI 154
>gi|56552807|ref|YP_163646.1| peptidyl-tRNA hydrolase [Zymomonas mobilis subsp. mobilis ZM4] >gi|68052886|sp|Q5NL75|PTH_ZYMMO Peptidyl-tRNA hydrolase (PTH) >gi|56544381|gb|AAV90535.1| peptidyl-tRNA hydrolase [Zymomonas mobilis subsp. mobilis ZM4] (189 aa)
Score = 261, Expect = 1.9e-21, Identities = 53/148 (35%), Positives = 87/148 (58%)
  Q:     8 GLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-----VHNLTHHVLTKFSAEDS 155
           GLGNPG  Y   +HNVGFM +D L  E +       F GQ       +++I + KP T+MN SG  + E  +FYK+  +++ V +D++D    +++VK  G + G NG++S I+ +  +  +R+R+GIG P     VH+   +VL  F+  ++
  S:     6 GLGNPGSSYALNRHNVGFMAVDMLASEKSFAPWKRAFQGQVSLGQIDQERILLLKPATFMNESGRAIGEAMRFYKLAPEDVTVFHDELDIAPMRVKVKKGGGAAGHNGLRSTIAHIG-QSFRRVRLGIGHPGEKSRVHD---YVLGNFAKSET 154
>gi|85713256|ref|ZP_01044281.1| peptidyl-tRNA hydrolase [Idiomarina baltica OS145] >gi|85692925|gb|EAQ30898.1| peptidyl-tRNA hydrolase [Idiomarina baltica OS145] (196 aa)
Score = 260, Expect = 2.6e-21, Identities = 65/166 (39%), Positives = 96/166 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACN 170
           L+VGLGNPG EYEKT+HN GF  ++   + H + L  ++K      +       + I  P T+MN SG  +  + +FYKI  + ILV YD++D D G  + K  G +GG NGIK  I+++ T+   R+R+GIG P H   +T  VL K SA +   + + I +A  A +
  S:     7 LLVGLGNPGPEYEKTRHNAGFWLVEAYCRRHGVTLTADTKTKALIGRHQTATRDLRIVLPQTFMNKSGYSIAAMARFYKIAPEQILVAYDELDLDPGVAKFKRGGGAGGHNGIKDTIAQLGTQDFMRLRVGIGHPGHRSQVTGFVLGKPSAPERALLDECIDEASRAID 175
>gi|89890033|ref|ZP_01201544.1| peptidyl-tRNA hydrolase [Flavobacteria bacterium BBFL7] >gi|89518306|gb|EAS20962.1| peptidyl-tRNA hydrolase [Flavobacteria bacterium BBFL7] (211 aa)
Score = 260, Expect = 2.8e-21, Identities = 65/186 (34%), Positives = 102/186 (54%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFN----GQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           M K+L++GLGN G +Y +T+HN+GF  +DE+ +     + +S F     G    +     +I + KP TYMN SG+ +        I ++ ILV+ DD++   G +R+KAKG+ GG NG+K    K+NT    R+R GI           +VL +++ ++   + + I KA  AC  F  H      MN+FN
  S:    24 MKKFLIIGLGNIGDKYTETRHNIGFKVLDEIAR-----IKDSSFETLTLGDVATITHKGKKITLLKPSTYMNLSGKAIKYYMNQESIPKEQILVVTDDLNLPFGTLRMKAKGTDGGHNGLKDTQIKLNTPNYPRLRFGISDEFSKGRQVDYVLGEWNKDELKALPERIDKAAAACLSF-THAGLANTMNQFN 209
>gi|17986763|ref|NP_539397.1| peptidyl-tRNA hydrolase [Brucella melitensis 16M] >gi|23502404|ref|NP_698531.1| peptidyl-tRNA hydrolase [Brucella suis 1330] >gi|148558902|ref|YP_001259413.1| peptidyl-tRNA hydrolase [Brucella ovis ATCC 25840] >gi|161619481|ref|YP_001593368.1| peptidyl-tRNA hydrolase [Brucella canis ATCC 23365] >gi|166199311|sp|A5VRR6|PTH_BRUO2 Peptidyl-tRNA hydrolase (PTH) >gi|189038280|sp|A9M6K1|PTH_BRUC2 Peptidyl-tRNA hydrolase (PTH) >gi|54038904|sp|P65864|PTH_BRUSU Peptidyl-tRNA hydrolase (PTH) >gi|54041590|sp|P65863|PTH_BRUME Peptidyl-tRNA hydrolase (PTH) >gi|17982391|gb|AAL51661.1| Peptidyl-tRNA hydrolase [Brucella melitensis 16M] >gi|23348390|gb|AAN30446.1| peptidyl-tRNA hydrolase [Brucella suis 1330] >gi|148370159|gb|ABQ60138.1| peptidyl-tRNA hydrolase [Brucella ovis ATCC 25840] >gi|161336292|gb|ABX62597.1| peptidyl-tRNA hydrolase [Brucella canis ATCC 23365] (250 aa)
Score = 260, Expect = 3.0e-21, Identities = 62/151 (41%), Positives = 94/151 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNT----EKIKRIRIGIGKP-----VHNLTHHVLTKFSAEDS 155
           L+ GLGNPG +Y   +HN+GFM  DE+ + H       KF  +        +++ + KP T+MN SG+ + E  +FYK+   +++VIYD++D   GK+R+K  G SGG NGIKSI + M +    +  +R+R+GIG P     VHN   +VL  F+  D+
  S:     3 LIAGLGNPGPQYAHNRHNIGFMAADEIFRRHRFSNWQKKFQAEIADGVIDGEKVLLVKPQTFMNLSGQSIGEAMRFYKLTPADLVVIYDELDLVPGKLRIKTGGGSGGHNGIKSIDAHMQSFPGGQNYRRMRLGIGHPGAKELVHN---YVLGDFAKADN 159
>gi|62290421|ref|YP_222214.1| peptidyl-tRNA hydrolase [Brucella abortus bv. 1 str. 9-941] >gi|82700344|ref|YP_414918.1| peptidyl-tRNA hydrolase [Brucella melitensis biovar Abortus 2308] >gi|30913141|sp|Q9AEQ5|PTH_BRUAB Peptidyl-tRNA hydrolase (PTH) >gi|119390916|sp|Q2YLX5|PTH_BRUA2 Peptidyl-tRNA hydrolase (PTH) >gi|13591431|gb|AAK29776.1| peptidyl tRNA hydrolase [Brucella melitensis biovar Abortus] >gi|62196553|gb|AAX74853.1| Pth, peptidyl-tRNA hydrolase [Brucella abortus biovar 1 str. 9-941] >gi|82616445|emb|CAJ11508.1| Peptidyl-tRNA hydrolase [Brucella melitensis biovar Abortus 2308] (250 aa)
Score = 259, Expect = 3.4e-21, Identities = 62/151 (41%), Positives = 94/151 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNT----EKIKRIRIGIGKP-----VHNLTHHVLTKFSAEDS 155
           L+ GLGNPG +Y   +HN+GFM  DE+ + H       KF  +        +++ + KP T+MN SG+ + E  +FYK+   +++VIYD++D   GK+R+K  G SGG NGIKSI + M +    +  +R+R+GIG P     VHN   +VL  F+  D+
  S:     3 LIAGLGNPGPQYAHNRHNIGFMAADEIFRRHRFSNWQKKFQAEIADGVIDGEKVLLVKPQTFMNLSGQSIGEAMRFYKMTPADLVVIYDELDLVPGKLRIKTGGGSGGHNGIKSIDAHMQSFPGGQNYRRMRLGIGHPGAKELVHN---YVLGDFAKADN 159
>gi|86156548|ref|YP_463333.1| peptidyl-tRNA hydrolase [Anaeromyxobacter dehalogenans 2CP-C] >gi|119390909|sp|Q2IM62|PTH_ANADE Peptidyl-tRNA hydrolase (PTH) >gi|85773059|gb|ABC79896.1| peptidyl-tRNA hydrolase [Anaeromyxobacter dehalogenans 2CP-C] (192 aa)
Score = 259, Expect = 3.6e-21, Identities = 59/158 (37%), Positives = 101/158 (63%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFS----AEDSIKVQQAI 162
           LVVGLGNPG EY +T+HNVGF+  D L +         KF  +  +     ++++I KP TYMN+SGE V    +F+K+   +++V++DD++ +  ++++K  G  GG NG+KS+ + + + +  R+R+G+G+P   +    +VL KF+    AE  + V+QA+
  S:     3 LVVGLGNPGEEYARTRHNVGFVVADRLAQLAGASFTAKKFAAELAEARLGPERVWILKPQTYMNHSGEAVGAALRFWKLGLDDLVVVHDDLELEPFRVQLKVGGGHGGHNGVKSVNAHVGSPEYARVRVGVGRPPPRMDPADYVLGKFAKGEDAELDLCVEQAV 166
>gi|107023737|ref|YP_622064.1| peptidyl-tRNA hydrolase [Burkholderia cenocepacia AU 1054] >gi|116690824|ref|YP_836447.1| peptidyl-tRNA hydrolase [Burkholderia cenocepacia HI2424] >gi|166199312|sp|A0KAM7|PTH_BURCH Peptidyl-tRNA hydrolase (PTH) >gi|119390917|sp|Q1BTG4|PTH_BURCA Peptidyl-tRNA hydrolase (PTH) >gi|105893926|gb|ABF77091.1| peptidyl-tRNA hydrolase [Burkholderia cenocepacia AU 1054] >gi|116648913|gb|ABK09554.1| peptidyl-tRNA hydrolase [Burkholderia cenocepacia HI2424] (199 aa)
Score = 259, Expect = 3.6e-21, Identities = 56/134 (41%), Positives = 87/134 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           L+VGLGNPG EY  T+HN GF  ID+L +E  T   +  +F+G + K     +++ + +P TYMN SG+ V  + +F+KI    ILV +D++D   G +++K  G SGG NG+K I + +++++  R+RIGIG P
  S:     4 LIVGLGNPGAEYTATRHNAGFWLIDQLAREAGTTLRDERRFHGFYAKARLHGEEVHLLEPQTYMNRSGQSVVALAQFFKILPDQILVAHDELDLPPGTVKLKLGGGSGGHNGLKDITAHLSSQQYWRLRIGIGHP 138
>gi|78067603|ref|YP_370372.1| peptidyl-tRNA hydrolase [Burkholderia sp. 383] >gi|170734149|ref|YP_001766096.1| aminoacyl-tRNA hydrolase [Burkholderia cenocepacia MC0-3] >gi|194558160|ref|YP_002093186.1| Peptidyl-tRNA hydrolase [Burkholderia cenocepacia PC184] >gi|119390919|sp|Q39CT8|PTH_BURS3 Peptidyl-tRNA hydrolase (PTH) >gi|77968348|gb|ABB09728.1| peptidyl-tRNA hydrolase [Burkholderia sp. 383] >gi|124871951|gb|EAY63667.1| Peptidyl-tRNA hydrolase [Burkholderia cenocepacia PC184] >gi|169817391|gb|ACA91974.1| Aminoacyl-tRNA hydrolase [Burkholderia cenocepacia MC0-3] (199 aa)
Score = 259, Expect = 3.6e-21, Identities = 56/134 (41%), Positives = 87/134 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           L+VGLGNPG EY  T+HN GF  ID+L +E  T   +  +F+G + K     +++ + +P TYMN SG+ V  + +F+KI    ILV +D++D   G +++K  G SGG NG+K I + +++++  R+RIGIG P
  S:     4 LIVGLGNPGAEYTATRHNAGFWLIDQLAREAGTTLRDERRFHGFYAKARLHGEEVHLLEPQTYMNRSGQSVVALAQFFKILPDQILVAHDELDLPPGTVKLKLGGGSGGHNGLKDITAHLSSQQYWRLRIGIGHP 138
>gi|94498283|ref|ZP_01304843.1| peptidyl-tRNA hydrolase [Sphingomonas sp. SKA58] >gi|94422285|gb|EAT07326.1| peptidyl-tRNA hydrolase [Sphingomonas sp. SKA58] (188 aa)
Score = 259, Expect = 3.7e-21, Identities = 51/133 (38%), Positives = 77/133 (57%)
  Q:     8 GLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH 140
           GLGNPG +Y   +HNVGFM ID +   H       +F G   +     D+I + KP T+MN SG  + E  +FYK+  Q++ V +D++D    K++VK  G + G NG++S  + +  +  +R+RIGIG P H
  S:     6 GLGNPGTQYAMHRHNVGFMAIDLIADMHRFSAPKKQFQGWSQEGRIGNDKILLLKPATFMNESGRSIGEAMRFYKLTPQDVTVFHDELDLVPMKVKVKRGGGNAGHNGLRSTDAHIGND-FRRVRIGIGHPGH 137
>gi|28199876|ref|NP_780190.1| peptidyl-tRNA hydrolase [Xylella fastidiosa Temecula1] >gi|182682628|ref|YP_001830788.1| aminoacyl-tRNA hydrolase [Xylella fastidiosa M23] >gi|32129853|sp|Q87A24|PTH_XYLFT Peptidyl-tRNA hydrolase (PTH) >gi|28057997|gb|AAO29839.1| peptidyl tRNA hydrolase [Xylella fastidiosa Temecula1] >gi|182632738|gb|ACB93514.1| Aminoacyl-tRNA hydrolase [Xylella fastidiosa M23] (192 aa)
Score = 259, Expect = 3.7e-21, Identities = 62/182 (34%), Positives = 100/182 (54%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG EY KT+HN GF  +D L+ +E   +   SK      +V      +++ +P+T+MN SG+ +     F+KI  + +LV +D++D   G +R+K  G  GGQNG++ I   +   +  R+R+GIG P H   +   VL   + +++I +  A+ +A           DFD  M K +
  S:     6 LIVGLGNPGSEYIKTRHNAGFRFVDGLVQREGQCWALESKLFAYVARVFIAGQWVWLLRPVTFMNLSGKSICAGLNFWKIKPEQMLVAHDELDFPPGAVRLKFDGGHGGQNGLRDITKLLGHGRFHRLRVGIGHPGHKDRVVSWVLGCPTCDENIAIDAALERAS-VVLPLAVAGDFDGAMKKLH 189
>gi|71278842|ref|YP_270233.1| peptidyl-tRNA hydrolase [Colwellia psychrerythraea 34H] >gi|119390929|sp|Q47Y87|PTH_COLP3 Peptidyl-tRNA hydrolase (PTH) >gi|71144582|gb|AAZ25055.1| peptidyl-tRNA hydrolase [Colwellia psychrerythraea 34H] (194 aa)
Score = 259, Expect = 4.0e-21, Identities = 70/186 (37%), Positives = 106/186 (56%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           M+  L+ GLGNPG EY KT+HN G   ++EL + H + L    K++G + K     + + +  P T+MN SG+ V  +  FYKI    ILV +D++D   G  ++K  G  GG NG++ II +M N +   R+RIGI  P H   +T HVL K  + +  K++QAI +A    + +L   D  K  N+ +
  S:     1 MTIKLIAGLGNPGPEYSKTRHNAGVWFVEELARSHNISLRPEKKYSGLYGKGLIAGNLVHLLIPTTFMNRSGQAVAPLANFYKISVDEILVAHDELDMLPGVCKIKKGGGHGGHNGLRDIIDRMANNKDFYRLRIGIDHPGHRDKVTGHVLGKAPSAEQAKIEQAIDEASRCLDIWLKD-DLKKAQNRLH 189
>gi|38233493|ref|NP_939260.1| peptidyl-tRNA hydrolase [Corynebacterium diphtheriae NCTC 13129] >gi|38199753|emb|CAE49413.1| Putative peptidyl tRNA hydrolase [Corynebacterium diphtheriae] (180 aa)
Score = 259, Expect = 4.0e-21, Identities = 52/132 (39%), Positives = 81/132 (61%)
  Q:     7 VGLGNPGLEYEKTKHNVGFMCIDELLKEHTLF-LNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           +GLGNPG+ Y  T+HNVG+M +DELL    L  L   K +G  ++V     ++ + +  T+MN SGE V  I + Y +   +++V++D++D    K+RVK  G+  G NG+KS+   + T    RIR+GIG+P
  S:     1 MGLGNPGVRYASTRHNVGYMVVDELLGPAELRPLRGFKASGAVIEVGGC--RVLVVRSSTFMNTSGEAVGPIVQEYGVSPDHVVVVHDELDLPAHKVRVKVGGNENGHNGLKSVSQWLGTRDYVRIRVGIGRP 131
>gi|115434354|ref|NP_001041935.1| Os01g0132800 [Oryza sativa (japonica cultivar-group)] >gi|75288538|sp|Q5ZCL8|CRS2_ORYSJ Chloroplastic group IIB intron splicing facilitator CRS2, chloroplast precursor (Chloroplastic RNA splicing factor 2) (CRS2-like protein) >gi|53792159|dbj|BAD52792.1| putative peptidyl-tRNA hydrolase [Oryza sativa Japonica Group] >gi|113531466|dbj|BAF03849.1| Os01g0132800 [Oryza sativa (japonica cultivar-group)] (259 aa)
Score = 258, Expect = 4.3e-21, Identities = 54/186 (29%), Positives = 107/186 (57%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEK-IKRIRIGIGKPVHNLTHH--VLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           + +L+ GLGNPG +Y  T+HNVGF  +D + ++  + +N  +           E  + + KP +Y+N SGE +  +  +Y++  ++ILV+YD++    G +R++ KG  G  NG+++++  +++ + + R+ IGIG P   +     +L KFS+E+ +++  A+ +  DA    +    F   + +FN+
  S:    63 TPWLIAGLGNPGSKYHGTRHNVGFEMVDRIARDEGITMNTIQSKSLLGIGSIGEVPVLLVKPQSYINYSGEAIGPLAAYYQVPLRHILVMYDEMSLPNGVLRLQRKGGHGRHNGLQNVMECLDSSRELPRLSIGIGSPPGKMDTRAFLLQKFSSEERLQIDTALEQGVDAVRTLVLK-GFSGSIERFNL 250
>gi|91781711|ref|YP_556917.1| peptidyl-tRNA hydrolase [Burkholderia xenovorans LB400] >gi|119390921|sp|Q145X4|PTH_BURXL Peptidyl-tRNA hydrolase (PTH) >gi|91685665|gb|ABE28865.1| peptidyl-tRNA hydrolase [Burkholderia xenovorans LB400] (200 aa)
Score = 258, Expect = 4.5e-21, Identities = 55/134 (41%), Positives = 87/134 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           L+VGLGNPG EY  T+HN GF  +D+L +E  T   +  +F+G + K     +++ + +P TYMN SG+ V  + +F+KI    ILV +D++D   G +++K  G SGG NG+K I + +++++  R+RIGIG P
  S:     4 LIVGLGNPGAEYTATRHNAGFWLVDQLAREAGTTLRDERRFHGFYAKARLHGEEVHLLEPQTYMNRSGQSVVALAQFFKILPDEILVAHDELDMPPGSVKLKLGGGSGGHNGLKDITAHLSSQQYWRLRIGIGHP 138
>gi|116617522|ref|YP_817893.1| peptidyl-tRNA hydrolase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122272277|sp|Q03Z52|PTH_LEUMM Peptidyl-tRNA hydrolase (PTH) >gi|116096369|gb|ABJ61520.1| peptidyl-tRNA hydrolase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (188 aa)
Score = 258, Expect = 4.5e-21, Identities = 61/182 (33%), Positives = 107/182 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN---LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
            + GLGN G EY++T+HN+GFM +D     + +  + SK      K     + + + KP TYMN+SG+ V  I  +Y     ++LV+ DD+D   GK+R +AKGS+GG NG+KSI++   ++   R++ G+G PVH    + ++VL KF+A +   +   + ++  A  +++      ++ N++N
  S:     3 FIFGLGNIGAEYDQTRHNIGFMAVDAFATANHMSFSPSKQFALVAKTIIGGESVMLVKPTTYMNDSGKAVRAILDYYDGDVDDVLVLVDDMDLPFGKMRFRAKGSAGGHNGLKSIMTHTGSQTFLRLKFGLGHPVHEQNVVVNYVLGKFTAAEKPDIDAMLDRSTQAIADWIQGATAPELSNRYN 187
>gi|15827040|ref|NP_301303.1| peptidyl-tRNA hydrolase [Mycobacterium leprae TN] >gi|14195075|sp|Q9CD49|PTH_MYCLE Peptidyl-tRNA hydrolase (PTH) >gi|13092587|emb|CAC29752.1| putative peptidyl-tRNA hydrolase [Mycobacterium leprae] (199 aa)
Score = 258, Expect = 4.9e-21, Identities = 61/164 (37%), Positives = 97/164 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDEL-LKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAIIKAKDA 168
           LVVGLGNPG  Y +T+HNVGFM  + L ++  + F  + +     V        + +AKP  YMN SG+ V  + K Y +   +I++++DD+D D G+IR+K  G  GG NG++S+ + + T+  +R+RIGIG+P    +    VL  F+  + ++V     +A DA
  S:    14 LVVGLGNPGKNYGRTRHNVGFMVANLLAVRLGSKFEVHKRSGADVVNGRLAGCSMLVAKPRNYMNESGQQVGLLAKLYSVTPADIIIVHDDLDLDFGRIRLKLGGGEGGHNGLRSVAAALGTKDFQRVRIGIGRPTGRKDPASFVLENFTTAERMQVPTICKRAADA 180
>gi|56417305|ref|YP_154379.1| peptidyl-tRNA hydrolase [Anaplasma marginale str. St. Maries] >gi|68052888|sp|Q5P9A6|PTH_ANAMM Peptidyl-tRNA hydrolase (PTH) >gi|56388537|gb|AAV87124.1| peptidyl-tRNA hydrolase [Anaplasma marginale str. St. Maries] (186 aa)
Score = 258, Expect = 5.2e-21, Identities = 63/170 (37%), Positives = 96/170 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLN 174
           L+VGLGNPG +YE T+HNVGF+  D + ++      +SK++      +    +  I KP T+MN SG  V +    +KI  + I V +DD D   G ++VK  G + G NG++SI + +  +   R+R+G+G+P V +L+ HVL+ F   DS  VQQ   K      E L+
  S:     3 LLVGLGNPGKQYEFTRHNVGFVVADTVARDFNFPEFSSKYDALVSVGNVGLHRAMIVKPATFMNRSGAAVLKAASMHKIPAEQITVFHDDADLQHGVVKVKQGGGNAGHNGLRSIDAAIGCQ-YWRVRLGVGRPDVGSLSGHVLSDFHDFDS--VQQLAHKISANLTELLD 170
>gi|120612259|ref|YP_971937.1| peptidyl-tRNA hydrolase [Acidovorax avenae subsp. citrulli AAC00-1] >gi|166199296|sp|A1TT75|PTH_ACIAC Peptidyl-tRNA hydrolase (PTH) >gi|120590723|gb|ABM34163.1| peptidyl-tRNA hydrolase [Acidovorax avenae subsp. citrulli AAC00-1] (213 aa)
Score = 257, Expect = 5.6e-21, Identities = 60/176 (34%), Positives = 100/176 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK-FNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDK 180
           L VGLGNPG +Y+ T+HN GF  ID L ++  + L   + ++G   + +     +++ +P T+MN SG+ V  + +F+KI  Q ILV +D++D   G+ ++K  GS  G NG++ I +++ +    R+RIGIG P     + + VL K S +    ++ +I  +  A    L   D DK
  S:     4 LFVGLGNPGPDYDATRHNAGFWWIDGLARDLKVHLVPERAYHGLVARANVNGQSVWLLQPQTFMNLSGKSVAALARFFKIQPQEILVAHDELDILPGQAKLKRGGSHAGHNGLRDIHAQLGSPDYWRLRIGIGHPGVKAEVANWVLKKPSPDHRTLIEDSIAHSLKAAPAMLAG-DMDK 181
>gi|54298642|ref|YP_125011.1| peptidyl-tRNA hydrolase [Legionella pneumophila str. Paris] >gi|68052900|sp|Q5X1N7|PTH_LEGPA Peptidyl-tRNA hydrolase (PTH) >gi|53752427|emb|CAH13859.1| hypothetical protein [Legionella pneumophila str. Paris] (189 aa)
Score = 257, Expect = 5.6e-21, Identities = 62/162 (38%), Positives = 100/162 (61%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTH-HVLTKFSAEDSIKVQQAI 162
           M+  L+VGL NPG  YE+T+HN G   +  L + H + F  + K   +  ++D       +A P+T+MN+SG+    I +FYKI    IL+++D++D  VG+I++K  G  GG NG++ I +++ T +  R+RIGIG P H +L H +VL++ S  D  ++  AI
  S:     1 MAIKLIVGLRNPGSAYEQTRHNAGAWLVTALAQRHNSHFKIDKKMQAELTEIDINNHPCRLALPLTFMNHSGQTTRIISQFYKIEPGEILIVHDELDLPVGRIKLKTGGGHGGHNGLRDITAQLGTGEFHRLRIGIGHPGHKDLVHQYVLSRPSMHDRQQIYDAI 165
>gi|17545112|ref|NP_518514.1| peptidyl-tRNA hydrolase [Ralstonia solanacearum GMI1000] >gi|17427403|emb|CAD13921.1| peptidyl-trna hydrolase (pth) protein [Ralstonia solanacearum] (217 aa)
Score = 257, Expect = 5.6e-21, Identities = 61/164 (37%), Positives = 100/164 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP------------VHNLTHHVLTKFSAEDSIKVQQAIIKAKDA 168
           L+VGLGNPG EY  T+HN GF  +D+L +  H    N ++F+G   +      ++++ +P T+MN SG     + +FYKI    ILV++D++D   G +++K  G SGG NG+K I + + T++  R+R+GIG P             H++ + VL     E+   + +AI ++ DA
  S:    21 LIVGLGNPGAEYAATRHNAGFWLVDQLARMGHVTLRNETRFHGYAARATLWSHEVWLLQPQTFMNRSGLATVALARFYKILPDEILVVHDELDLLPGAVKLKLGGGSGGHNGLKDIAAHLTTQQFWRLRVGIGHPRNLLPPGTAPSGQHDVANFVLKAPRREEQELIDRAIDRSLDA 197
>gi|21263845|sp|Q8Y2E3|PTH_RALSO Peptidyl-tRNA hydrolase (PTH) (200 aa)
Score = 257, Expect = 5.9e-21, Identities = 61/164 (37%), Positives = 100/164 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP------------VHNLTHHVLTKFSAEDSIKVQQAIIKAKDA 168
           L+VGLGNPG EY  T+HN GF  +D+L +  H    N ++F+G   +      ++++ +P T+MN SG     + +FYKI    ILV++D++D   G +++K  G SGG NG+K I + + T++  R+R+GIG P             H++ + VL     E+   + +AI ++ DA
  S:     4 LIVGLGNPGAEYAATRHNAGFWLVDQLARMGHVTLRNETRFHGYAARATLWSHEVWLLQPQTFMNRSGLATVALARFYKILPDEILVVHDELDLLPGAVKLKLGGGSGGHNGLKDIAAHLTTQQFWRLRVGIGHPRNLLPPGTAPSGQHDVANFVLKAPRREEQELIDRAIDRSLDA 180
>gi|150397464|ref|YP_001327931.1| peptidyl-tRNA hydrolase [Sinorhizobium medicae WSM419] >gi|150028979|gb|ABR61096.1| Aminoacyl-tRNA hydrolase [Sinorhizobium medicae WSM419] (248 aa)
Score = 257, Expect = 6.0e-21, Identities = 65/180 (36%), Positives = 101/180 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTH-HVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNK 184
           ++ GLGNPG +Y   +HN+GFM +D +         + KF  +  + +   +++ + KP T+MN SGE + +  +FYK+  ++I+VIYD++D   GK R+K  G  GG NGIKSI +    E  +R+R+GIG P   +L H HVL  F+  D   V   +    D     +   D  ++MNK
  S:    12 IIAGLGNPGPKYAGNRHNIGFMAVDAIQGRQGFSSWSKKFKSEISEGEIDGERVLLMKPQTFMNLSGEALGDAMRFYKLAPKDIVVIYDELDLPAGKARIKTGGGHGGHNGIKSIDAHCGRE-YRRLRLGIGHPGAKDLVHAHVLGDFAKADRAWVSPLLEAIADNAGMLVKGED-SQLMNK 191
>gi|134297000|ref|YP_001120735.1| peptidyl-tRNA hydrolase [Burkholderia vietnamiensis G4] >gi|134140157|gb|ABO55900.1| peptidyl-tRNA hydrolase [Burkholderia vietnamiensis G4] (211 aa)
Score = 257, Expect = 6.0e-21, Identities = 56/134 (41%), Positives = 86/134 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           L+VGLGNPG EY  T+HN GF  ID+L +E  T   +  +F+G + K     +++ + +P TYMN SG+ V  +  F+KI    ILV +D++D   G +++K  G SGG NG+K I + +++++  R+RIGIG P
  S:    16 LIVGLGNPGAEYTATRHNAGFWLIDQLAREAGTTLRDERRFHGFYAKARLHGEEVHLLEPQTYMNRSGQSVVAVASFFKILPDQILVAHDELDLPPGTVKLKLGGGSGGHNGLKDISAHLSSQQYWRLRIGIGHP 150
>gi|88704032|ref|ZP_01101747.1| Peptidyl-tRNA hydrolase [gamma proteobacterium KT 71] >gi|88701859|gb|EAQ98963.1| Peptidyl-tRNA hydrolase [Congregibacter litoralis KT71] (207 aa)
Score = 257, Expect = 6.4e-21, Identities = 57/158 (36%), Positives = 92/158 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHT-LFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAI 162
           L+VGLGNPG +YE T+HN G     EL+++    F   +K++G+  +V     ++ +  P T+MN SG+ V  +  FYKI    IL+ +D++D   G  R K  G  GG NG++ I+  + N +   R+R+GIG P     ++++VL+K S  D   +  +I
  S:     7 LIVGLGNPGSQYEGTRHNAGEDFARELVRQAGGTFKLETKYHGELAEVFFAGHKLRVLVPHTFMNRSGKSVAALANFYKIEPAQILIAHDELDIAPGTARFKFDGGHGGHNGLRDIVPALGNRKDFHRLRVGIGHPGSAKQVSNYVLSKASPADREAIAASI 168
>gi|22298927|ref|NP_682174.1| peptidyl-tRNA hydrolase [Thermosynechococcus elongatus BP-1] >gi|34222743|sp|Q8DJ45|PTH_SYNEL Peptidyl-tRNA hydrolase (PTH) >gi|22295108|dbj|BAC08936.1| peptidyl-tRNA hydrolase [Thermosynechococcus elongatus BP-1] (205 aa)
Score = 257, Expect = 6.6e-21, Identities = 66/182 (36%), Positives = 108/182 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK-FNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIG--------KPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGNPG+EY  T+HNVGF  +D L + + + L   + F G+  +V     ++ + KP TYMN+SG+ ++ +  FYK+  +  LV++DD D  +G++R++  GS+GG NGIKSII   ++++  R+++GI             N    VL  FSA +   +   +  A DA  E       +  MN++N
  S:     7 VIVGLGNPGIEYATTRHNVGFRVLDTLAQRYRVQLTQQRRFLGEVAEVLIQGQKVRLLKPTTYMNSSGQSLHALLNFYKLPLERTLVVHDDADLPLGRLRLRLSGSTGGHNGIKSIIQHCHSQQFPRLKVGIAFGDRLQQQTGPRNAVPFVLGHFSATELAILPAVLDLAVDAI-ELSIQSGVEVAMNRYN 196
>gi|148260672|ref|YP_001234799.1| peptidyl-tRNA hydrolase [Acidiphilium cryptum JF-5] >gi|166199297|sp|A5FZ48|PTH_ACICJ Peptidyl-tRNA hydrolase (PTH) >gi|146402353|gb|ABQ30880.1| peptidyl-tRNA hydrolase [Acidiphilium cryptum JF-5] (192 aa)
Score = 257, Expect = 6.6e-21, Identities = 57/150 (38%), Positives = 82/150 (54%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-----VHNLTHHVLTKFSAED 154
           L VGLGNP     + +HN+GFM ID +   H       +F+G   +     ++I   KP+TYMN SG  V     F+K+    + V +D++D   GK+RVK  G + G NG++SI   + T+   R+R+GIG P     VH    HVL  F+  D
  S:     3 LWVGLGNPEPGMARNRHNIGFMAIDVIADRHGFAPWRKRFSGLVSEGSVGGEKIVALKPLTYMNESGRAVQPASAFFKLPPDAVTVFHDELDLIPGKVRVKRGGGAAGHNGLRSIDRTLGTQDYWRVRLGIGHPGDKARVHG---HVLGNFAKTD 154
>gi|121602644|ref|YP_989278.1| peptidyl-tRNA hydrolase [Bartonella bacilliformis KC583] >gi|166199307|sp|A1UTH5|PTH_BARBK Peptidyl-tRNA hydrolase (PTH) >gi|120614821|gb|ABM45422.1| peptidyl-tRNA hydrolase [Bartonella bacilliformis KC583] (193 aa)
Score = 256, Expect = 7.1e-21, Identities = 55/150 (36%), Positives = 86/150 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAED 154
           L+ GLGNPG  Y+  +HN+GFM +D + +  +    + KF  +        ++I + KP T+MN SG+ + E  +FYK+   +++V YD++D   G +RVK  G S G NGIKSI S         +R+GIG+P+    +  +VL  F+  D
  S:     3 LIAGLGNPGSHYQNNRHNIGFMAVDAIHEAFSFSPWSKKFQAEVSNGLINGEKILLIKPQTFMNLSGQAIGEALRFYKLDLDHLIVFYDELDLPPGTVRVKIGGRSNGHNGIKSIDSHCGN-NYHHVRLGIGRPISKELVDQYVLGNFTQSD 153
>gi|13472407|ref|NP_103974.1| peptidyl-tRNA hydrolase [Mesorhizobium loti MAFF303099] >gi|21263856|sp|Q98HV6|PTH_RHILO Peptidyl-tRNA hydrolase (PTH) >gi|14023153|dbj|BAB49760.1| peptidyl-tRNA hydrolase [Mesorhizobium loti MAFF303099] (240 aa)
Score = 256, Expect = 7.4e-21, Identities = 60/147 (40%), Positives = 86/147 (58%)
  Q:     8 GLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAED 154
           GLGNPG +Y   +HNVGFM  D + + H+    + KF G   +     ++I + KP T+MN SG+ V E  +FYK+    + V YD+ID   GK+R+K  G +GG NGI+SI   +     +R+RIG+G P     + HHVL  F+  D
  S:     6 GLGNPGAKYADNRHNVGFMAADAIARRHSFSPWSKKFQGLIAEGTIAGEKIILIKPQTFMNLSGQSVGEALRFYKLELSALTVFYDEIDLAEGKLRIKTGGGAGGHNGIRSIDGHIGN-AYRRVRIGVGHPGIKEMVQHHVLGDFAKAD 153
>gi|121607938|ref|YP_995745.1| peptidyl-tRNA hydrolase [Verminephrobacter eiseniae EF01-2] >gi|121552578|gb|ABM56727.1| peptidyl-tRNA hydrolase [Verminephrobacter eiseniae EF01-2] (216 aa)
Score = 256, Expect = 7.5e-21, Identities = 53/158 (33%), Positives = 88/158 (55%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAI 162
           L  GLGNPG +Y  T+HN GF  ID L +E  T  L          +       +++ +P T+MN+SG+ V  + +F+K+  + ILV++D++D   G++++K  G   G NG++ I  ++ +    R+RIGIG P     + + VL K S E    ++ +I
  S:    18 LFAGLGNPGPDYAATRHNAGFWWIDALARELKTTLLPERSHQALLARTTVHGQSVWLLQPQTFMNHSGQSVASLARFFKLQPEEILVVHDELDIAPGQVKLKRGGGHAGHNGLRDIHGQLGSPDYWRLRIGIGHPGVRSEVINWVLKKPSPEQRALIEDSI 178
>gi|56460039|ref|YP_155320.1| peptidyl-tRNA hydrolase [Idiomarina loihiensis L2TR] >gi|68052890|sp|Q5QV03|PTH_IDILO Peptidyl-tRNA hydrolase (PTH) >gi|56179049|gb|AAV81771.1| Peptidyl-tRNA hydrolase [Idiomarina loihiensis L2TR] (198 aa)
Score = 256, Expect = 7.5e-21, Identities = 64/169 (37%), Positives = 94/169 (55%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFL 173
           L+VGLGNPG EYE+T+HN GF  +D+  + H + L+ ++K      +  Q    + I  P  +MN SG  V  +  FYKI    ILV YD++D   G  + K  G +GG NGIK II++  ++   R+RIGIG P     +T  VL K SA +   +   I +A  + +  +
  S:     7 LLVGLGNPGPEYERTRHNAGFWLVDDFCRRHAITLSPDTKSKALIGRWQQGAHDLRIVLPQNFMNRSGFSVAALANFYKIPANEILVAYDELDLPPGVAKFKKGGGAGGHNGIKDIIAQTGSQDFMRLRIGIGHPGDKTKVTGFVLGKASANEQRLIDDCIDEASRSIDTLM 178
>gi|78224042|ref|YP_385789.1| peptidyl-tRNA hydrolase [Geobacter metallireducens GS-15] >gi|119390945|sp|Q39RR0|PTH_GEOMG Peptidyl-tRNA hydrolase (PTH) >gi|78195297|gb|ABB33064.1| peptidyl-tRNA hydrolase [Geobacter metallireducens GS-15] (194 aa)
Score = 256, Expect = 8.9e-21, Identities = 54/154 (35%), Positives = 95/154 (61%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAED 154
           M+  L++GLGNPG +Y+ T+HN GFM +D L +     +    F+G + +     D++ + KP T+MN SG    E  +F+K+   +++VI+DD+D   G++++K  G  GG NG++S++ ++      RIRIG+G+P+  +   +VL  FS+ +
  S:     1 MATRLIIGLGNPGPKYQWTRHNAGFMVLDHLSRVMGTSVAKKSFSGLYGEGSWHGDRLLLLKPQTFMNLSGRSAAEALRFHKLTLSDLIVIHDDLDIPFGRVKLKEGGGHGGHNGLRSLMQELGGGGFVRIRIGVGRPLRGDAADYVLANFSSAE 155
>gi|154707189|ref|YP_001423505.1| peptidyl-tRNA hydrolase [Coxiella burnetii Dugway 5J108-111] >gi|189038286|sp|A9KF13|PTH_COXBN Peptidyl-tRNA hydrolase (PTH) >gi|154356475|gb|ABS77937.1| peptidyl-tRNA hydrolase [Coxiella burnetii Dugway 5J108-111] (187 aa)
Score = 255, Expect = 1.0e-20, Identities = 67/182 (36%), Positives = 103/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+ GLGNPG +Y +T+HNVG   ++ L ++    L   +KF+G   K +      ++ KP T+MN SG+ V  + +FYKI    IL+ +D++D   G IR+K  G  GG NG+++II  + +    R+RIGI  P H   +T +VL+  S  D I +  AI K      E +   DF K+M + +
  S:     7 LIAGLGNPGDQYARTRHNVGAWFLETLAQQRNQSLAKENKFHGFVAKCND----YWLLKPTTFMNESGQAVAALARFYKIKPSEILIAHDELDFPAGDIRLKEGGGHGGHNGLRNIIQHLGSSDFYRLRIGINHPGHKDRVTPYVLSPPSENDRIAILAAIEKGLRLIPELVQG-DFQKVMRELH 186
>gi|82523965|emb|CAI78776.1| Peptidyl-tRNA hydrolase [uncultured epsilon proteobacterium] (185 aa)
Score = 255, Expect = 1.0e-20, Identities = 68/150 (45%), Positives = 95/150 (63%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAED 154
           L+VGLGNPG  YE  +HN+GFM IDEL+K      L +S F G+  K  +     F+ KP+TYMN SGE +  +  FYKI  + ++VI+DD+D   G +R K  G  GG NG+KS   K++ E + RIR+GIGKP H   +  +VL+ F+  +
  S:     2 LIVGLGNPGPTYENNRHNIGFMVIDELIKRFDARKLPSSPFKGELFKFSEH----FLLKPLTYMNLSGESIQAVKNFYKI--EQVIVIHDDLDLPFGTLRFKFGGGHGGHNGLKSADEKISREYL-RIRMGIGKPEHKGEVASYVLSDFNPSE 147
>gi|6714302|gb|AAF25998.1|AC013354_17 F15H18.8 [Arabidopsis thaliana] (777 aa)
Score = 255, Expect = 1.1e-20, Identities = 58/151 (38%), Positives = 84/151 (55%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMN-TEKIKRIRIGIGKPVHNL--THHVLTKFSAED 154
           +L+VGLGNPG +Y+ T+HNVGF  +D L     + +N   F   F K       I +AKP T+MN SGE V                 YDD+D   GK+R+  KG  GG NG++SII ++  +    R+RIGIG+P   +   + VL +F+ ++
  S:    95 WLIVGLGNPGKKYQGTRHNVGFEMVDALADAEGISMNTVNFKALFGKGVIGNIPIMLAKPQTFMNLSGESV-----------------YDDLDLPFGKLRLLPKGGHGGHNGMRSIIDRLKGSRDFPRLRIGIGRPPGKMDTANFVLRQFNRQE 231
>gi|42526159|ref|NP_971257.1| peptidyl-tRNA hydrolase [Treponema denticola ATCC 35405] >gi|68052976|sp|Q73Q01|PTH_TREDE Peptidyl-tRNA hydrolase (PTH) >gi|41816271|gb|AAS11138.1| peptidyl-tRNA hydrolase [Treponema denticola ATCC 35405] (203 aa)
Score = 254, Expect = 1.2e-20, Identities = 59/169 (34%), Positives = 101/169 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDEL-LKEHTLFLNNSKFNGQFVKVDQ---PEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP---------VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFL 173
           L+V LGN G +YE T+HN  ++  D + +  + ++   SKF GQ+ K+     P   + + KP TYMN SGE V     F+++  +NIL+++D+++   G +  K  G  GG NG++SI S +NT    R+RIGIG+P           +++ +VL++F+  +   ++  + +A     E L
  S:     4 LIVFLGNYGKKYENTRHNAAWVLCDSIEIGSNAVW--QSKFKGQYAKLPSSMTPGRAVHLLKPETYMNLSGESVIAAASFFRLKPENILIVHDELELKPGILSFKWSGGLGGHNGLRSIKSVLNTADFFRLRIGIGRPDFSSQGGDASPDISGYVLSRFAQSELDVLKSQVPQADSFFKELL 183
>gi|89069014|ref|ZP_01156395.1| peptidyl-tRNA hydrolase [Oceanicola granulosus HTCC2516] >gi|89045383|gb|EAR51448.1| peptidyl-tRNA hydrolase [Oceanicola granulosus HTCC2516] (230 aa)
Score = 254, Expect = 1.3e-20, Identities = 53/134 (39%), Positives = 84/134 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           L VGLGNPG +Y +T+HN+GFM +D++  +H      +KF G+  +     +++ + KPMT+MN SG+ V E  +FYK+   ++ V +D+ID   GK+R+KA G   G NG++SI   +      R+R+G+G P
  S:     3 LFVGLGNPGPKYARTRHNIGFMAVDQIASDHGFPSFRAKFQGELSEGRLGGERVVLLKPMTFMNLSGQSVGEAMRFYKLESTDVTVFHDEIDLAPGKVRLKAGGGHAGHNGLRSIHQHIGPH-YDRVRLGVGHP 135
>gi|15618859|ref|NP_225145.1| peptidyl-tRNA hydrolase [Chlamydophila pneumoniae CWL029] >gi|15836483|ref|NP_301007.1| peptidyl-tRNA hydrolase [Chlamydophila pneumoniae J138] >gi|16752080|ref|NP_445446.1| peptidyl-tRNA hydrolase [Chlamydophila pneumoniae AR39] >gi|33242318|ref|NP_877259.1| peptidyl-tRNA hydrolase [Chlamydophila pneumoniae TW-183] >gi|6647699|sp|Q9Z6V6|PTH_CHLPN Peptidyl-tRNA hydrolase (PTH) >gi|4377275|gb|AAD19088.1| Peptidyl tRNA Hydrolase [Chlamydophila pneumoniae CWL029] >gi|7189822|gb|AAF38694.1| peptidyl-tRNA hydrolase [Chlamydophila pneumoniae AR39] >gi|8979324|dbj|BAA99158.1| peptidyl tRNA hydrolase [Chlamydophila pneumoniae J138] >gi|33236829|gb|AAP98916.1| peptidyl tRNA hydrolase [Chlamydophila pneumoniae TW-183] (180 aa)
Score = 254, Expect = 1.3e-20, Identities = 57/168 (33%), Positives = 100/168 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE--HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH---NLTHHVLTKFSAEDSIKVQQAIIKAK----DACNEF 172
           L+V +GNP   Y  T+HN GF+  D L++E     F   SK +     V+     +   KP T++N SG+ V    K++ +   +ILV+ DD++   GK+R+   G SGG NG+KSI + + + +  ++R G+G+P+     L++ VL KFS E+++++    ++A     + C++F
  S:     4 LIVAIGNPRHGYANTRHNAGFLLADRLVEELQGPPFKPLSKCHALMTLVESSSGPLVFIKPTTFVNLSGKAVVLAKKYFNVALSHILVLADDVNRSFGKLRLCFNGGSGGHNGLKSITASLGSNEYWQLRFGVGRPLEEGVELSNFVLGKFSEEENLQLGSIFVEASTLFTEWCSKF 180
>gi|88801938|ref|ZP_01117466.1| peptidyl-tRNA hydrolase [Polaribacter irgensii 23-P] >gi|88782596|gb|EAR13773.1| peptidyl-tRNA hydrolase [Polaribacter irgensii 23-P] (195 aa)
Score = 254, Expect = 1.3e-20, Identities = 54/136 (39%), Positives = 77/136 (56%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIG 136
           M K+L+VGLGN G  Y+ T+HN+GF  +D +   H +     K  G             + KP TYMN SG+ V        I  +NIL++ DD+  D G IR+KAKG++GG NG++ I  K+NT++  R R G+G
  S:     8 MKKFLIVGLGNIGDAYKNTRHNIGFKILDAVAAAHAVTFETEKL-GDIASFGFKGKSFTLLKPSTYMNLSGKAVKYWMDKENIAIENILIVTDDVHIDFGTIRIKAKGTAGGHNGLRDIQEKLNTQEYSRFRFGVG 142
>gi|86140923|ref|ZP_01059482.1| peptidyl-tRNA hydrolase [Flavobacterium sp. MED217] >gi|85832865|gb|EAQ51314.1| peptidyl-tRNA hydrolase [Leeuwenhoekiella blandensis MED217] (206 aa)
Score = 254, Expect = 1.4e-20, Identities = 58/136 (42%), Positives = 81/136 (59%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIG 136
           M+KYL++GLGN G +Y+ T+HN+GF  ID   +E     +  K  G           + + KP TYMN SG+ V    +   I  +NILVI DD++ + G IRVK+KGS GG NG+K I ++++T K  R R GIG
  S:    19 MNKYLIIGLGNIGPKYDNTRHNIGFKIIDAYAQEKETSWSTEKL-GDVAYTKVRGRTVVLLKPNTYMNLSGKAVKYWMQKENISIENILVITDDLNLEFGTIRVKSKGSDGGHNGLKDIQNQLSTTKYPRFRFGIG 153
>gi|90418285|ref|ZP_01226197.1| peptidyl-tRNA hydrolase [Aurantimonas sp. SI85-9A1] >gi|90337957|gb|EAS51608.1| peptidyl-tRNA hydrolase [Aurantimonas sp. SI85-9A1] (244 aa)
Score = 254, Expect = 1.5e-20, Identities = 54/150 (36%), Positives = 94/150 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAED 154
           L+ GLGNPG  Y   +HN+GFM ++E+ ++      + KF+ +  +     +++ + KP T+MN SG  V +  +F+K+    I+VI+D++D   GK+RVK  G +GG NG++SI + + T+  +R+R+GIG P +   ++ +VL  F+  D
  S:     3 LIAGLGNPGSRYAGNRHNIGFMALEEIARDPAFSPWSKKFSAEISEGQIGGEKVVLIKPQTFMNESGRSVGDAARFFKLEPSQIVVIHDELDLPPGKLRVKTGGGNGGHNGLRSIDAHLGTKDYRRVRMGIGHPGNKDAVSPYVLGDFAKVD 154
>gi|154246547|ref|YP_001417505.1| aminoacyl-tRNA hydrolase [Xanthobacter autotrophicus Py2] >gi|154160632|gb|ABS67848.1| Aminoacyl-tRNA hydrolase [Xanthobacter autotrophicus Py2] (202 aa)
Score = 253, Expect = 2.0e-20, Identities = 56/169 (33%), Positives = 90/169 (53%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAK-DACNEF 172
           +L  GLGNPG +Y   +HN+GFM ++ + + H L     +F     + +   +++    P TYMN SG  V E  +FYKI   +I V +D++D    K+R+K  G + G NG++SI ++   +   R+R+GIG P      H    +   D  K ++  + A  DAC +F
  S:     2 FLFAGLGNPGPKYAGNRHNIGFMALEAICRRHRLGPLRRRFQSLAAEGEIAGEKVIALFPETYMNESGRAVSEAQRFYKIPLDHIFVFHDELDLPPAKLRIKKGGGNAGHNGLRSITAQCGNDYF-RVRLGIGHPGDKALVHA---YVLNDFAKSEKPWLDAVCDACADF 167
>gi|114330911|ref|YP_747133.1| peptidyl-tRNA hydrolase [Nitrosomonas eutropha C91] >gi|114307925|gb|ABI59168.1| peptidyl-tRNA hydrolase [Nitrosomonas eutropha C91] (617 aa)
Score = 252, Expect = 2.1e-20, Identities = 49/158 (31%), Positives = 85/158 (53%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAI 162
           ++VGLGNPG EY+ T HN+G+  +D L + H      +   GQ   +      + + K   YMN +G  +           +  ++++DD D + GKI +K+ G   G  G++S +  + T+++KR+R+G+G P    +    VLT FS E+  ++QQ +
  S:   442 IIVGLGNPGAEYKNTPHNIGYFVLDSLAENHGAIWQETD-EGQICSIQLESKPVSLFKATAYMNETGPKLQRYLAKTGCLPEQCIIVHDDTDIEFGKIYIKSDGGDAGHWGVRSCLVALGTDQVKRLRLGVGVPGKTGSAKRRVLTNFSQEEQQRLQQIV 600
>gi|99080055|ref|YP_612209.1| peptidyl-tRNA hydrolase [Silicibacter sp. TM1040] >gi|119391009|sp|Q1GK69|PTH_SILST Peptidyl-tRNA hydrolase (PTH) >gi|99036335|gb|ABF62947.1| peptidyl-tRNA hydrolase [Silicibacter sp. TM1040] (248 aa)
Score = 252, Expect = 2.2e-20, Identities = 55/150 (36%), Positives = 88/150 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAED 154
           L VGLGNPG +Y   +HN+GFM +D++  +H      SKF  Q  +     +++ + KP T+MNNSG+ V E  +F+K+   +++V +D++D    K RVK  G   G NG++SI + +  +   R+R+G+G P H   +  +VL  F   D
  S:     3 LFVGLGNPGAKYAGNRHNIGFMALDQIASDHGFSPWKSKFQAQMSEGTLSGEKVILLKPQTFMNNSGQSVGEALRFFKLTPADVVVFHDELDLAPSKCRVKNGGGHAGHNGLRSIHAHIGAD-YGRVRLGVGHPGHKDAVAGYVLRDFPKAD 153
>gi|194562363|ref|YP_002097386.1| Peptidyl-tRNA hydrolase [Burkholderia dolosa AUO158] >gi|124893987|gb|EAY67867.1| Peptidyl-tRNA hydrolase [Burkholderia dolosa AUO158] (199 aa)
Score = 252, Expect = 2.2e-20, Identities = 56/134 (41%), Positives = 86/134 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK-FNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           L+VGLGNPG EY  T+HN GF  ID+L +E    L + + F+G + K     +++ + +P TYMN SG+ V  +  F+KI    ILV +D++D   G +++K  G SGG NG+K I + +++++  R+RIGIG P
  S:     4 LIVGLGNPGAEYTATRHNAGFWLIDQLAREAGATLRDERRFHGFYAKARVHGEEVHLLEPQTYMNRSGQSVVALAHFFKILPDQILVAHDELDLPPGTVKLKLGGGSGGHNGLKDISAHLSSQQYWRLRIGIGHP 138
>gi|86742630|ref|YP_483030.1| peptidyl-tRNA hydrolase [Frankia sp. CcI3] >gi|119390941|sp|Q2J5Z1|PTH_FRASC Peptidyl-tRNA hydrolase (PTH) >gi|86569492|gb|ABD13301.1| peptidyl-tRNA hydrolase [Frankia sp. CcI3] (197 aa)
Score = 252, Expect = 2.2e-20, Identities = 52/135 (38%), Positives = 79/135 (58%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQI-----FIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           +LV GLGNPG  Y   +HN GFM +D LL E T     S+      + D  E ++      +A+P+++MN SG  V     FYK+    ++V++D++D   G +R+K  G   G NG++SI S + T    R+R+GIG+P
  S:    11 WLVAGLGNPGPTYAGNRHNAGFMVVD-LLAERT----GSRLKSHRSRADVAETRLAGARAVLARPLSFMNLSGGPVAAARSFYKVEVSRLIVVHDELDIPFGAVRLKRGGGDNGHNGLRSISSALGTRDYLRVRVGIGRP 145
>gi|71909344|ref|YP_286931.1| peptidyl-tRNA hydrolase [Dechloromonas aromatica RCB] >gi|119390931|sp|Q479M0|PTH_DECAR Peptidyl-tRNA hydrolase (PTH) >gi|71848965|gb|AAZ48461.1| peptidyl-tRNA hydrolase [Dechloromonas aromatica RCB] (192 aa)
Score = 252, Expect = 2.3e-20, Identities = 62/143 (43%), Positives = 90/143 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTHHVL 147
           L+VGLGNPG EYE T+HNVGF  +D+L  +  + L   +KF G+  +  +     ++ +P T+MN SG+ V  +  FYKI    ILVI+D++D   G IR+K  G +GG NG+K I +K+ T    R+R+GIG P   NL+  V+
  S:     6 LIVGLGNPGPEYEATRHNVGFWFVDQLADKLKVSLAPQAKFFGRAARTGE----TWLLQPTTFMNRSGQAVAALANFYKIPADEILVIHDELDLPPGGIRLKQGGGNGGHNGLKDIQAKLGTPDFWRLRLGIGHPRTLNLSQQVV 146
>gi|29349996|ref|NP_813499.1| peptidyl-tRNA hydrolase [Bacteroides thetaiotaomicron VPI-5482] >gi|46576804|sp|Q89YZ2|PTH_BACTN Peptidyl-tRNA hydrolase (PTH) >gi|29341907|gb|AAO79693.1| peptidyl-tRNA hydrolase [Bacteroides thetaiotaomicron VPI-5482] (189 aa)
Score = 252, Expect = 2.4e-20, Identities = 66/186 (35%), Positives = 101/186 (54%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK--FNGQF---VKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGK--PVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           M KYL+VGLGN G EY +T+HN+GFM ++ L +     +NN+    +G++           Q+ + KP T+MN SG  V    +   I  +N+L++ DD+    G +R+K KGS  G NG+K I + + T+   R+R GIG   P      +VL  F+ ED   + + +  A +    F      D  MN+FN
  S:     1 MIKYLIVGLGNIGPEYHETRHNIGFMTVEALAR-----INNAPPFIDGRYGFTTSFSIKGRQLILLKPSTFMNLSGLAVRYWMQKENIPLENVLIVVDDLALPFGTLRLKGKGSDAGHNGLKHIAAILGTQNYARLRFGIGNDFPKGGQIDYVLGHFTDEDRKTMDERLETAGEIIKSFC-LAGIDITMNQFN 187
>gi|15892854|ref|NP_360568.1| peptidyl-tRNA hydrolase [Rickettsia conorii str. Malish 7] >gi|21263852|sp|Q92H41|PTH_RICCN Peptidyl-tRNA hydrolase (PTH) >gi|15620040|gb|AAL03469.1| peptidyl-tRNA hydrolase [EC:3.1.1.29] [Rickettsia conorii str. Malish 7] (185 aa)
Score = 252, Expect = 2.6e-20, Identities = 67/158 (42%), Positives = 98/158 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAI 162
           LV+GLGNPG EY+ T+HNVGF+ I++++ ++ + F    KFN +  +      +I   KP TYMN SG+ V  +  +Y I+   I VI+DDID + G+I+ K  G +GG NG+KSI   +      RIRIG+G+P +N  +  +VL  FS  +   V QAI
  S:     3 LVIGLGNPGKEYQYTRHNVGFIAIEKIVNQYNSSFSTKKKFNCEIAETISDGQKIIFIKPTTYMNLSGKSVISVKTYYNIYPAKIFVIHDDIDLETGRIKFKTGGGNGGHNGLKSIDGVIGN-NYNRIRIGVGRPQNNQGVADYVLNHFSKPEYETVMQAI 162
>gi|115352915|ref|YP_774754.1| peptidyl-tRNA hydrolase [Burkholderia ambifaria AMMD] >gi|171320166|ref|ZP_02909228.1| Aminoacyl-tRNA hydrolase [Burkholderia ambifaria MEX-5] >gi|172061763|ref|YP_001809415.1| aminoacyl-tRNA hydrolase [Burkholderia ambifaria MC40-6] >gi|122322182|sp|Q0BBQ3|PTH_BURCM Peptidyl-tRNA hydrolase (PTH) >gi|115282903|gb|ABI88420.1| peptidyl-tRNA hydrolase [Burkholderia ambifaria AMMD] >gi|171094580|gb|EDT39632.1| Aminoacyl-tRNA hydrolase [Burkholderia ambifaria MEX-5] >gi|171994280|gb|ACB65199.1| Aminoacyl-tRNA hydrolase [Burkholderia ambifaria MC40-6] (199 aa)
Score = 251, Expect = 2.7e-20, Identities = 55/134 (41%), Positives = 86/134 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK-FNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           L+VGLGNPG EY  T+HN GF  +D+L +E    L + + F+G + K     +++ + +P TYMN SG+ V  +  F+KI    ILV +D++D   G +++K  G SGG NG+K I + +++++  R+RIGIG P
  S:     4 LIVGLGNPGAEYTATRHNAGFWLVDQLAREAGATLRDERRFHGFYAKARLHGEEVHLLEPQTYMNRSGQSVVALASFFKILPDQILVAHDELDLPPGTVKLKLGGGSGGHNGLKDISAHLSSQQYWRLRIGIGHP 138
>gi|86134893|ref|ZP_01053475.1| peptidyl-tRNA hydrolase [Tenacibaculum sp. MED152] >gi|85821756|gb|EAQ42903.1| peptidyl-tRNA hydrolase [Polaribacter dokdonensis MED152] (209 aa)
Score = 251, Expect = 2.7e-20, Identities = 59/136 (43%), Positives = 78/136 (57%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIG 136
           M K L+VGLGN G +Y  T+HN+GF  +DE+ +EH +     K  G             + KP T+MN SG+ V       KI  +NILV+ DD++ D G IR+KAKGS GG NG+K I  K+ T K  R R G+G
  S:    22 MKKKLIVGLGNIGDKYTNTRHNIGFKILDEVAEEHNVSFETEKL-GDIASYRFKGRTFILLKPSTFMNLSGKAVKYWMDKEKISIENILVVTDDLNIDFGTIRLKAKGSDGGHNGLKDIQEKLCTNKYPRFRFGVG 156
>gi|88711278|ref|ZP_01105366.1| peptidyl-tRNA hydrolase [Flavobacteriales bacterium HTCC2170] >gi|88710219|gb|EAR02451.1| peptidyl-tRNA hydrolase [Flavobacteriales bacterium HTCC2170] (209 aa)
Score = 251, Expect = 2.9e-20, Identities = 56/136 (41%), Positives = 78/136 (57%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIG 136
           M K+L+VGLGN G EY +T+HN+GF  +D+L KE       +K  G           +   KP TYMN SG+ +    +  KI  +N+LV+ DDI+ + G IR+K KGS GG NG+K I   +N+    R R G+G
  S:    22 MKKFLIVGLGNIGSEYAETRHNIGFKILDQLAKEKDFVFETAKL-GAIGSFKIKGRTVLCLKPSTYMNRSGKALKYWMEKEKIPIENLLVVTDDINLEFGTIRLKTKGSDGGHNGLKDIQLFLNSTSYNRFRFGVG 156
>gi|152965022|ref|YP_001360806.1| aminoacyl-tRNA hydrolase [Kineococcus radiotolerans SRS30216] >gi|189038154|sp|A6W6V3|PTH_KINRD Peptidyl-tRNA hydrolase (PTH) >gi|151359539|gb|ABS02542.1| Aminoacyl-tRNA hydrolase [Kineococcus radiotolerans SRS30216] (198 aa)
Score = 251, Expect = 3.0e-20, Identities = 60/170 (35%), Positives = 99/170 (58%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDEL-------LKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFL 173
           +LVVGLGNPG EYE+T+HNVG M +DEL        K H      ++          P  ++ +A P +YMN SG  V  + K++ +  ++++V++D++D   G +R+K  G  GG NG++SI   +  +   R+R+GIG+P    +    VL +FS+ +   +   ++ A DA  E +
  S:     5 WLVVGLGNPGAEYERTRHNVGQMVLDELASRTRGSFKRHRTGARTAEVRLGVAPGGAPGPRVVLAAPTSYMNVSGGPVAGLAKYFDVDVEHLVVVHDELDVPFGSVRLKRGGGEGGHNGLRSISKSLGDKDYARVRVGIGRPPGRQDPADFVLKEFSSTEKKDMPFLVMDAADAVEELV 183
>gi|29655128|ref|NP_820820.1| peptidyl-tRNA hydrolase [Coxiella burnetii RSA 493] >gi|161831131|ref|YP_001597665.1| peptidyl-tRNA hydrolase [Coxiella burnetii RSA 331] >gi|189038287|sp|A9NAT7|PTH_COXBR Peptidyl-tRNA hydrolase (PTH) >gi|46576785|sp|Q83AP0|PTH_COXBU Peptidyl-tRNA hydrolase (PTH) >gi|29542397|gb|AAO91334.1| peptidyl-tRNA hydrolase [Coxiella burnetii RSA 493] >gi|161762998|gb|ABX78640.1| peptidyl-tRNA hydrolase [Coxiella burnetii RSA 331] (187 aa)
Score = 251, Expect = 3.1e-20, Identities = 67/182 (36%), Positives = 102/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+ GLGNPG +Y +T+HNVG   ++ L ++    L   +KF+G   K +      ++ KP T+MN SG+ V  +  FYKI    IL+ +D++D   G IR+K  G  GG NG+++II  + +    R+RIGI  P H   +T +VL+  S  D I +  AI K      E +   DF K+M + +
  S:     7 LIAGLGNPGDQYARTRHNVGAWFLETLAQQRNQSLAKENKFHGFVAKCND----YWLLKPTTFMNESGQAVAALAHFYKIKPSEILIAHDELDFPAGDIRLKEGGGHGGHNGLRNIIQHLGSSDFYRLRIGINHPGHKDRVTPYVLSPPSENDRIAILAAIEKGLRLIPELVQG-DFQKVMRELH 186
>gi|68171277|ref|ZP_00544678.1| Peptidyl-tRNA hydrolase [Ehrlichia chaffeensis str. Sapulpa] >gi|88658161|ref|YP_506969.1| peptidyl-tRNA hydrolase [Ehrlichia chaffeensis str. Arkansas] >gi|119390940|sp|Q2GHW4|PTH_EHRCR Peptidyl-tRNA hydrolase (PTH) >gi|67999292|gb|EAM85940.1| Peptidyl-tRNA hydrolase [Ehrlichia chaffeensis str. Sapulpa] >gi|88599618|gb|ABD45087.1| peptidyl-tRNA hydrolase [Ehrlichia chaffeensis str. Arkansas] (198 aa)
Score = 251, Expect = 3.2e-20, Identities = 54/147 (36%), Positives = 89/147 (60%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH------NLTHHVLTKF 150
           YL+ GLGNPG +YE ++HN GFM +D +  E        + N      +    ++ + KP T+MNNSG  +  I   YKI   NI++ +D+++ +   IRVK  G + G NG+KSI + +  +   R+R GIG+P++      +L+++VL++F
  S:     3 YLLAGLGNPGKKYELSRHNAGFMIVDAIASEFYFPSFRERHNALISIGNIKSHRVILVKPWTFMNNSGAPIMSIASLYKIPLDNIIIFHDEVEINFCTIRVKKSGGNAGHNGLKSIDNLLGKD-YWRVRFGIGRPINKTNLKIDLSYYVLSQF 154
>gi|30350188|gb|AAP31496.1| putative peptidyl-tRNA hydrolase [Western X phytoplasma] (205 aa)
Score = 251, Expect = 3.4e-20, Identities = 58/179 (32%), Positives = 100/179 (55%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE--HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMN 183
           L+VGLGNPG  +E T HN+GFM I+ L KE    +     + +     +   ++ I + +P TYMN SG+ + ++   Y I + ++LV+ DDI+ + G  ++K KG  GG NG+++II  ++++  KR+RIG+G      L  +VL + + +   ++       K   + F+    F  +MN
  S:    21 LIVGLGNPGKMFELTPHNIGFMLINYLEKEWKKNILTTKKELSSIVSHLQLEQETILLVQPQTYMNISGKAIKQLMLKYNIPKDDVLVLVDDINLEPGAFKLKYKGGHGGHNGLRNIIDMLHSKDFKRLRIGVGLDSRIPLEQYVLNRLNTQTQQQITHNFPLFKKLISNFIQGYPFANLMN 202
>gi|56695713|ref|YP_166064.1| peptidyl-tRNA hydrolase [Silicibacter pomeroyi DSS-3] >gi|68052881|sp|Q5LV91|PTH_SILPO Peptidyl-tRNA hydrolase (PTH) >gi|56677450|gb|AAV94116.1| peptidyl-tRNA hydrolase [Silicibacter pomeroyi DSS-3] (239 aa)
Score = 250, Expect = 3.5e-20, Identities = 57/150 (38%), Positives = 89/150 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAED 154
           L VGLGNPG +Y + +HN+GFM +D + ++H       KF GQ  +     +++ + KP T+MN SG+ V E  +FYK+   +I V++D++D   GK++VKA G   G NG++SI   +      R+R+GIG P     +  +VL  F+  D
  S:     3 LFVGLGNPGAKYARNRHNIGFMALDRIAEDHGFGPWRVKFQGQIAEGRLGREKVLLLKPETFMNRSGQSVGEAMRFYKLDSTDITVLHDELDLAPGKVKVKAGGGHAGHNGLRSIHDHIGA-AYDRVRLGIGHPGRKEAVAGYVLHDFARAD 153
>gi|54295491|ref|YP_127906.1| peptidyl-tRNA hydrolase [Legionella pneumophila str. Lens] >gi|68052899|sp|Q5WTE7|PTH_LEGPL Peptidyl-tRNA hydrolase (PTH) >gi|53755323|emb|CAH16819.1| hypothetical protein [Legionella pneumophila str. Lens] (189 aa)
Score = 250, Expect = 3.5e-20, Identities = 61/162 (37%), Positives = 99/162 (61%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTH-HVLTKFSAEDSIKVQQAI 162
           M+  L+VGL NPG  YE+T+HN G   +  L + H + F  + K   +  ++D       +  P+T+MN+SG+    I +FYKI    IL+++D++D  VG+I++K  G  GG NG++ I +++ T +  R+RIGIG P H +L H +VL++ S  D  ++  AI
  S:     1 MAIKLIVGLRNPGSAYEQTRHNAGAWLVTALAQRHNSHFKIDKKMQAELTEIDINNHPCRLLLPLTFMNHSGQTTRIISQFYKIEPGEILIVHDELDLPVGRIKLKTGGGHGGHNGLRDITAQLGTGEFHRLRIGIGHPGHKDLVHQYVLSRPSMHDRQQIYDAI 165
>gi|83719915|ref|YP_441030.1| peptidyl-tRNA hydrolase [Burkholderia thailandensis E264] >gi|167579759|ref|ZP_02372633.1| peptidyl-tRNA hydrolase [Burkholderia thailandensis TXDOH] >gi|167617835|ref|ZP_02386466.1| peptidyl-tRNA hydrolase [Burkholderia thailandensis Bt4] >gi|119390920|sp|Q2T1B9|PTH_BURTA Peptidyl-tRNA hydrolase (PTH) >gi|83653740|gb|ABC37803.1| peptidyl-tRNA hydrolase [Burkholderia thailandensis E264] (201 aa)
Score = 250, Expect = 3.6e-20, Identities = 55/134 (41%), Positives = 86/134 (64%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK-FNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           L+VGLGNPG EY  T+HN GF  +D+L +E    L + + F+G + K     +++ + +P TYMN SG+ V  +  F+KI    ILV +D++D   G +++K  G SGG NG+K I + +++++  R+RIGIG P
  S:     4 LIVGLGNPGAEYTATRHNAGFWLVDQLAREAGATLRDERRFHGFYAKARLYGEEVHLLEPQTYMNRSGQSVVALAHFFKILPNEILVAHDELDLPPGAVKLKLGGGSGGHNGLKDISAHLSSQQYWRLRIGIGHP 138
>gi|51599038|ref|YP_073226.1| peptidyl-tRNA hydrolase [Borrelia garinii PBi] >gi|68052917|sp|Q65ZY7|PTH_BORGA Peptidyl-tRNA hydrolase (PTH) >gi|51573609|gb|AAU07634.1| peptidyl-tRNA hydrolase [Borrelia garinii PBi] (185 aa)
Score = 250, Expect = 4.0e-20, Identities = 52/156 (33%), Positives = 96/156 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV-HNLTHHVLTKFSAEDSIKVQQ 160
           +++GLGNPGLE+  T+HNVGF  +D ++ ++ LFL   K   ++ ++     ++ + KP+TYMN SG     I   + +  +N+LV+ D++D  +GK R+K +G +   NG+KSI S + +    R+ IG+G  V  ++   VL++F  ++  ++++
  S:     1 MILGLGNPGLEFSLTRHNVGFSLLDRIISKNGLFLKRKK-KYEYSEMRMISGRVILVKPLTYMNLSGSLFPSIFSDFYMCIKNLLVVLDNVDLPLGKCRLKERGGASTHNGLKSISSILGSSNYSRLYIGVGSNVMRDIKSFVLSRFCKDEIDRLEK 156
>gi|110833377|ref|YP_692236.1| peptidyl-tRNA hydrolase [Alcanivorax borkumensis SK2] >gi|119390907|sp|Q0VS84|PTH_ALCBS Peptidyl-tRNA hydrolase (PTH) >gi|110646488|emb|CAL15964.1| aminoacyl-tRNA hydrolase [Alcanivorax borkumensis SK2] (195 aa)
Score = 250, Expect = 4.1e-20, Identities = 69/182 (37%), Positives = 99/182 (54%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG EYE T+HN G   +D L +   +FL  + K+ G         + I +  P T+MN SG+    +  F+KI    ILV +D++D   G  R K  G  GG NG++ IIS+  N+    R+R+GIG P     +T HVL+K S  D   + +AI +A     + L   D +  MN+ N
  S:     7 LIVGLGNPGREYEDTRHNAGVWYVDALARRQGVFLTEDKKYFGLTATFSFEGETIRLLVPTTFMNRSGQATAALANFFKIPVTQILVAHDELDLPPGCARFKQGGGHGGHNGLRDIISRHGNSRDFYRLRLGIGHPGSADRVTPHVLSKPSKADRDLIDRAIDEAVHNTADMLRG-DLNSAMNRLN 191
>gi|52842859|ref|YP_096658.1| peptidyl-tRNA hydrolase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|68052907|sp|Q5ZS66|PTH_LEGPH Peptidyl-tRNA hydrolase (PTH) >gi|52629970|gb|AAU28711.1| peptidyl tRNA hydrolase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (189 aa)
Score = 249, Expect = 5.1e-20, Identities = 60/158 (37%), Positives = 97/158 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTH-HVLTKFSAEDSIKVQQAI 162
           L+VGL NPG  YE+T+HN G   +  L + H + F  + K   +  ++D       +  P+T+MN+SG+    I +FYKI    IL+++D++D  VG+I++K  G  GG NG++ I +++ T +  R+RIGIG P H +L H +VL++ S  D  ++  AI
  S:     5 LIVGLRNPGSAYEQTRHNAGAWLVTALAQRHNSHFKIDKKMQAELTEIDINNHPCRLVLPLTFMNHSGQTTRIISQFYKIEPGEILIVHDELDLPVGRIKLKTGGGHGGHNGLRDITAQLGTGEFHRLRIGIGHPGHKDLVHQYVLSRPSMHDRQQIYDAI 165
>gi|111022659|ref|YP_705631.1| peptidyl-tRNA hydrolase [Rhodococcus sp. RHA1] >gi|119390996|sp|Q0S4R3|PTH_RHOSR Peptidyl-tRNA hydrolase (PTH) >gi|110822189|gb|ABG97473.1| aminoacyl-tRNA hydrolase [Rhodococcus sp. RHA1] (190 aa)
Score = 249, Expect = 5.3e-20, Identities = 67/182 (36%), Positives = 103/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDEL-LKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNL--THHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           LVVGLGNPG +YEKT+HNVGFM    L  +    F  + K   + V+         +AKP ++MN SG  V  + +F+ +   NI+VI+D++D D G IR+K  G  GG NG++SI S + T+   R R+GIG+P   +    +VL  FS+ +  ++     ++ DA  E +  V  +   N+ +
  S:     7 LVVGLGNPGPQYEKTRHNVGFMVAGVLSARMGGKFSAHKKSGAEIVQGRFEGRPTILAKPRSFMNLSGSAVAGLARFFSVDPGNIVVIHDELDLDFGTIRLKQGGGEGGHNGLRSISSALGTKDYLRTRVGIGRPPGRMDPASYVLKPFSSVERKELDLVCEESADAV-ELVLRVGLEAAQNRLH 190
>gi|91205676|ref|YP_538031.1| peptidyl-tRNA hydrolase [Rickettsia bellii RML369-C] >gi|119390997|sp|Q1RI72|PTH_RICBR Peptidyl-tRNA hydrolase (PTH) >gi|91069220|gb|ABE04942.1| Peptidyl-tRNA hydrolase [Rickettsia bellii RML369-C] (185 aa)
Score = 249, Expect = 5.7e-20, Identities = 68/171 (39%), Positives = 103/171 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNH 175
           L++GLGNPG EYE T+HN+GF+ ++ + K++ T F    KF+ +  +      ++   KP TYMN SG+ V  +  +Y I  + I VI+DDID ++GKI+ K  G +GG NG+KSI   +      RIRIG+G+P    ++  +VL  FS  + +  +QAI K  D  N  L +
  S:     3 LIIGLGNPGKEYEHTRHNIGFIALENIAKQYETSFSVKKKFHCEIAESTNNGQKLIFVKPTTYMNLSGKSVIAVKTYYNIPLEKIFVIHDDIDLELGKIKFKTGGGNGGHNGLKSIDGIIGN-NYHRIRIGVGRPQNSQDVADYVLNNFSKTEYVIAEQAIDKITDNFNLILEN 175
>gi|111115621|ref|YP_710239.1| peptidyl-tRNA hydrolase [Borrelia afzelii PKo] >gi|167942918|ref|ZP_02529992.1| peptidyl-tRNA hydrolase [Borrelia afzelii ACA-1] >gi|119390915|sp|Q0SM65|PTH_BORAP Peptidyl-tRNA hydrolase (PTH) >gi|110890895|gb|ABH02063.1| peptidyl-tRNA hydrolase [Borrelia afzelii PKo] (188 aa)
Score = 248, Expect = 6.5e-20, Identities = 53/156 (33%), Positives = 96/156 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV-HNLTHHVLTKFSAEDSIKVQQ 160
           L++GLGNPGLE+  T+HNVGF  +D+++ ++ LFL   K   ++ ++     ++ + KP+TYMN SG     I   + +  +N+LV+ D++D  +GK R+K +G     NG+KSI S + +    R+ IG+G  V  ++   VL++F  ++  ++++
  S:     4 LILGLGNPGLEFSLTRHNVGFSLLDKIVSKNGLFLKRKK-KYEYSELRVISRRVILVKPLTYMNLSGSLFPSIFSDFYMCIKNLLVVLDNVDLPLGKCRLKERGGMSTHNGLKSISSVLGSSNYSRLYIGVGSNVMRDIKSFVLSRFCKDEIDRLEK 159
>gi|83746830|ref|ZP_00943877.1| Peptidyl-tRNA hydrolase [Ralstonia solanacearum UW551] >gi|83726415|gb|EAP73546.1| Peptidyl-tRNA hydrolase [Ralstonia solanacearum UW551] (217 aa)
Score = 248, Expect = 6.5e-20, Identities = 61/164 (37%), Positives = 98/164 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP------------VHNLTHHVLTKFSAEDSIKVQQAIIKAKDA 168
           L+VGLGNPG EY  T+HN GF  +D+L +  H    N ++F+G   +       +++ +P T+MN SG     + +FYKI    ILV +D++D   G +++K  G SGG NG+K I + + T++  R+R+GIG P             H++ + VL     E+   + +AI ++ DA
  S:    21 LIVGLGNPGAEYAATRHNAGFWLVDQLARMGHVTLRNETRFHGYAARATLWGHDVWLLQPQTFMNRSGLATVALARFYKIPPDEILVAHDELDLPPGAVKLKLGGGSGGHNGLKDIGAHLTTQQFWRLRLGIGHPRNLLPPGTAPSGQHDVANFVLKAPRREEQELIDRAIDRSLDA 197
>gi|77919598|ref|YP_357413.1| peptidyl-tRNA hydrolase [Pelobacter carbinolicus DSM 2380] >gi|119390973|sp|Q3A314|PTH_PELCD Peptidyl-tRNA hydrolase (PTH) >gi|77545681|gb|ABA89243.1| peptidyl-tRNA hydrolase [Pelobacter carbinolicus DSM 2380] (191 aa)
Score = 248, Expect = 6.8e-20, Identities = 64/172 (37%), Positives = 101/172 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSA----------EDSIKVQQAIIK--AKDACNEFLNHV 176
           LVVGLGNPG EY  T+HN+GF+   +  ++  + L    + G          +  +  P TYMN SG  V   CK   I  ++++VI+D+ID   G IR+K  G  GG NG++SI+  +      R+R+G+G+P    ++  +VL +FS+          E+S+K  + +++  A+ A NEF N V
  S:     3 LVVGLGNPGPEYAATRHNIGFLVAQKFAQQMGVSLKRQAYQGIVGTGRADGQETMVLLPQTYMNRSGVSVVSACKSKGIAVEDVVVIHDEIDLPFGSIRIKVGGGHGGHNGLRSIVDLLGCRDFLRVRMGVGRPQGQVDVAKYVLGQFSSTEKSQLDNVLENSVKALEVLLQKGAQQAMNEFNNRV 188
>gi|157826866|ref|YP_001495930.1| peptidyl-tRNA hydrolase [Rickettsia bellii OSU 85-389] >gi|166229444|sp|A8GVL6|PTH_RICB8 Peptidyl-tRNA hydrolase (PTH) >gi|157802170|gb|ABV78893.1| peptidyl-tRNA hydrolase [Rickettsia bellii OSU 85-389] (185 aa)
Score = 248, Expect = 7.2e-20, Identities = 68/171 (39%), Positives = 103/171 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNH 175
           L++GLGNPG EYE T+HN+GF+ ++ + K++ T F    KF+ +  +      ++   KP TYMN SG+ V  +  +Y I  + I VI+DDID ++GKI+ K  G +GG NG+KS I  +      RIRIG+G+P    ++  +VL  FS  + +  +QAI K  D  N  L +
  S:     3 LIIGLGNPGKEYEHTRHNIGFIALENIAKQYETSFSVKKKFHCEIAESTNNGQKLIFVKPTTYMNLSGKSVIAVKTYYNIPLEKIFVIHDDIDLELGKIKFKTGGGNGGHNGLKS-IDGIIENNYHRIRIGVGRPQNSQDVADYVLNNFSKTEYVIAEQAIDKITDNFNLILEN 175
>gi|26451849|dbj|BAC43017.1| putative CRS2 [Arabidopsis thaliana] (246 aa)
Score = 247, Expect = 8.5e-20, Identities = 59/186 (31%), Positives = 100/186 (53%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMN-TEKIKRIRIGIGKPVHNLTHH--VLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           + +L+VGLGNPGL+Y  T+HN+GF  ID + +   + +N  +           E  I + KP  YMN SGE V  +  +Y+I  ++IL+IYDD+    G +R++ KG     NG+K++   +N      R+ IGIG P  N+     +L KFS  +  ++ + + +  +     +    F   +++FN+
  S:    50 TPWLIVGLGNPGLKYYGTRHNIGFEMIDHIARATDISMNTIQSKALVGIGSVGEVPILLVKPQGYMNFSGESVGPLAAYYQIPLRHILMIYDDLGLSNGVLRLQPKGGHSQHNGLKNVTEHLNGCRGYPRLSIGIGNPPGNMDMKAFLLQKFSPLERKQMDEGLEQGVEGVKTLVEE-GFSDSISRFNL 237
>gi|42573527|ref|NP_974860.1| peptidyl-tRNA hydrolase family protein [Arabidopsis thaliana] (250 aa)
Score = 247, Expect = 9.0e-20, Identities = 59/186 (31%), Positives = 100/186 (53%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMN-TEKIKRIRIGIGKPVHNLTHH--VLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           + +L+VGLGNPGL+Y  T+HN+GF  ID + +   + +N  +           E  I + KP  YMN SGE V  +  +Y+I  ++IL+IYDD+    G +R++ KG     NG+K++   +N      R+ IGIG P  N+     +L KFS  +  ++ + + +  +     +    F   +++FN+
  S:    54 TPWLIVGLGNPGLKYYGTRHNIGFEMIDHIARATDISMNTIQSKALVGIGSVGEVPILLVKPQGYMNFSGESVGPLAAYYQIPLRHILMIYDDMGLSNGVLRLQPKGGHSQHNGLKNVTEHLNGCRGYPRLSIGIGNPPGNMDMKAFLLQKFSPLERKQMDEGLEQGVEGVKTLVEE-GFSDSISRFNL 241
>gi|83313446|ref|YP_423710.1| peptidyl-tRNA hydrolase [Magnetospirillum magneticum AMB-1] >gi|119390956|sp|Q2VZ24|PTH_MAGMM Peptidyl-tRNA hydrolase (PTH) >gi|82948287|dbj|BAE53151.1| Peptidyl-tRNA hydrolase [Magnetospirillum magneticum AMB-1] (234 aa)
Score = 247, Expect = 9.5e-20, Identities = 58/150 (38%), Positives = 94/150 (62%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAED 154
           LVVGLGNPG +Y + +HN+GFM  D L++ ++     SKF G+  +     +++   KP TYMN SG+ V    +F K+   +I+V++D++D   G+++VK  G +GG NG+KSI S +  +  +R+R+GIG P     ++ +VL  F+  D
  S:     3 LVVGLGNPGSDYARNRHNIGFMAADVLVRRYSFGPWRSKFQGEVAEGIIGGEKVIALKPQTYMNLSGQSVAAAARFLKVPVDDIIVLHDELDVAPGRLKVKRGGGAGGHNGLKSIDSHLG-QNYRRVRLGIGHPGDRDLVSGYVLHDFAKAD 153
>gi|73666724|ref|YP_302740.1| peptidyl-tRNA hydrolase [Ehrlichia canis str. Jake] >gi|119390939|sp|Q3YT13|PTH_EHRCJ Peptidyl-tRNA hydrolase (PTH) >gi|72393865|gb|AAZ68142.1| peptidyl-tRNA hydrolase [Ehrlichia canis str. Jake] (193 aa)
Score = 247, Expect = 9.9e-20, Identities = 59/147 (40%), Positives = 89/147 (60%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPED-QIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKF 150
           +L+ GLGNPG +Y  T+HN GFM ID +L +   F N  K N   + +   E  ++ + KP T+MNNSG  +  I   YKI   N++V +D+++ D   IRVK  G + G NG+KSI + +  +   R+R GIG P +  +L+ +VL+ F
  S:     3 HLLAGLGNPGTQYTLTRHNAGFMVIDAILDKFH-FPNFKKKNNALISIGNIESYRVILVKPWTFMNNSGVPIMNIVSLYKIPLDNMIVFHDEVEIDFCTIRVKKSGGNAGHNGLKSIDNFLGKD-YWRVRFGIGHPRNKMDLSDYVLSHF 150
>gi|15595132|ref|NP_212921.1| peptidyl-tRNA hydrolase [Borrelia burgdorferi B31] >gi|167933979|ref|ZP_02521054.1| peptidyl-tRNA hydrolase [Borrelia burgdorferi ZS7] >gi|168580073|ref|ZP_02724053.1| peptidyl-tRNA hydrolase [Borrelia burgdorferi 72a] >gi|168692640|ref|ZP_02725432.1| peptidyl-tRNA hydrolase [Borrelia burgdorferi 94a] >gi|195942002|ref|ZP_03087384.1| peptidyl-tRNA hydrolase [Borrelia burgdorferi 80a] >gi|195955431|ref|ZP_03094124.1| peptidyl-tRNA hydrolase [Borrelia burgdorferi CA-11.2a] >gi|195960748|ref|ZP_03096953.1| peptidyl-tRNA hydrolase [Borrelia burgdorferi 64b] >gi|1346894|sp|P47714|PTH_BORBU Peptidyl-tRNA hydrolase (PTH) >gi|476008|gb|AAC41525.1| Peptidyl-tRNA hydrolase-like protein >gi|2688714|gb|AAC67122.1| peptidyl-tRNA hydrolase (pth) [Borrelia burgdorferi B31] (188 aa)
Score = 246, Expect = 1.0e-19, Identities = 51/156 (32%), Positives = 96/156 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV-HNLTHHVLTKFSAEDSIKVQQ 160
           L++GLGNPGLE+  T+HNVGF  +D+++ ++ LFL   K   ++ ++     ++ + KP+TYMN SG     I   + +  +N+LV+ D++D  +GK R+K +G     NG++SI S + +    R+ IG+G  +  ++   VL++F  ++  ++++
  S:     4 LILGLGNPGLEFSLTRHNVGFSLLDKIVSKNGLFLKRKK-KYEYSELKMISGRVILVKPLTYMNLSGSLFPSIFSDFYMCIKNLLVVLDNVDLPLGKCRLKERGGVSTHNGLRSISSVLGSSNYSRLYIGVGSNLMRDIKSFVLSRFCKDEMDRLEK 159
>gi|15240875|ref|NP_198645.1| peptidyl-tRNA hydrolase family protein [Arabidopsis thaliana] >gi|75309164|sp|Q9FKN4|CRS2A_ARATH Chloroplastic group IIB intron splicing facilitator CRS2-A, chloroplast precursor (Chloroplastic RNA splicing factor 2-A) (CRS2-like protein A) >gi|9758861|dbj|BAB09443.1| unnamed protein product [Arabidopsis thaliana] >gi|90962962|gb|ABE02405.1| At5g38290 [Arabidopsis thaliana] (246 aa)
Score = 246, Expect = 1.1e-19, Identities = 59/186 (31%), Positives = 100/186 (53%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMN-TEKIKRIRIGIGKPVHNLTHH--VLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           + +L+VGLGNPGL+Y  T+HN+GF  ID + +   + +N  +           E  I + KP  YMN SGE V  +  +Y+I  ++IL+IYDD+    G +R++ KG     NG+K++   +N      R+ IGIG P  N+     +L KFS  +  ++ + + +  +     +    F   +++FN+
  S:    50 TPWLIVGLGNPGLKYYGTRHNIGFEMIDHIARATDISMNTIQSKALVGIGSVGEVPILLVKPQGYMNFSGESVGPLAAYYQIPLRHILMIYDDMGLSNGVLRLQPKGGHSQHNGLKNVTEHLNGCRGYPRLSIGIGNPPGNMDMKAFLLQKFSPLERKQMDEGLEQGVEGVKTLVEE-GFSDSISRFNL 237
>gi|88608638|ref|YP_506197.1| peptidyl-tRNA hydrolase [Neorickettsia sennetsu str. Miyayama] >gi|119390967|sp|Q2GE99|PTH_NEOSM Peptidyl-tRNA hydrolase (PTH) >gi|88600807|gb|ABD46275.1| peptidyl-tRNA hydrolase [Neorickettsia sennetsu str. Miyayama] (194 aa)
Score = 246, Expect = 1.3e-19, Identities = 56/149 (37%), Positives = 91/149 (61%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSA 152
           +++ GLGNPGL Y +T+HN+GFM ID +    +      KF+G           +++ KP+ +MNNSG  + ++  FYK+  +N++V +DDID D  K+++K  G SGG NG+KS+   +  +   R R G+G+ V +   HVL++F+A
  S:     7 FVLCGLGNPGLRYAQTRHNLGFMLIDYVRYTFSFPEFLPKFSGLLSSGRVSSFLLYLFKPVAFMNNSGRPLVQLVNFYKVELENVIVFHDDIDLDFAKVKIKRGGGSGGHNGLKSLDFNLGRD-YWRFRFGVGRGVGDPAEHVLSRFTA 154
>gi|50955305|ref|YP_062593.1| peptidyl-tRNA hydrolase [Leifsonia xyli subsp. xyli str. CTCB07] >gi|68052929|sp|Q6ADQ8|PTH_LEIXX Peptidyl-tRNA hydrolase (PTH) >gi|50951787|gb|AAT89488.1| peptidyl-tRNA hydrolase [Leifsonia xyli subsp. xyli str. CTCB07] (193 aa)
Score = 245, Expect = 1.3e-19, Identities = 59/165 (35%), Positives = 92/165 (55%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFV--KVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDA 168
           +LVVGLGNPG  Y  T+HNVG + +DEL     L     K N      ++     +  +AKP TYMN SG  V ++ +FY +    ++V+ D++D     +R+K  G  GG NG++ +I+++ +    R+R+G+G+P  V     HVL  FSA +   +   +  A DA
  S:     5 WLVVGLGNPGPGYAATRHNVGQLVLDELASRDRLSFKTHKTNATVAEGRIVPGGPRFVLAKPNTYMNGSGGPVSQLLRFYSLEPSRLIVVQDELDIPFDTLRLKFGGGHGGHNGVRDVIAEVGSGDFTRVRVGVGRPPGVQAAADHVLKGFSAAERKNLPILVADAADA 173
>gi|157828785|ref|YP_001495027.1| peptidyl-tRNA hydrolase [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165933513|ref|YP_001650302.1| peptidyl-tRNA hydrolase [Rickettsia rickettsii str. Iowa] >gi|166229446|sp|A8GSZ4|PTH_RICRS Peptidyl-tRNA hydrolase (PTH) >gi|189038161|sp|B0BUI6|PTH_RICRO Peptidyl-tRNA hydrolase (PTH) >gi|157801266|gb|ABV76519.1| peptidyl-tRNA hydrolase [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165908600|gb|ABY72896.1| peptidyl-tRNA hydrolase [Rickettsia rickettsii str. Iowa] (185 aa)
Score = 245, Expect = 1.3e-19, Identities = 66/158 (41%), Positives = 96/158 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAI 162
           LV+GLGNPG EY+ T+HNVGF+ I+++  ++ + F    KFN +  +      +I   KP TYMN SG+ V  +  +Y I+     VI+DDID + G+++ K  G +GG NG+KSI   +      RIRIG+G+P +N  L  +VL  FS  +   V QAI
  S:     3 LVIGLGNPGKEYQYTRHNVGFIAIEKIANQYNSSFSTKKKFNCEIAETISYGQKIIFIKPTTYMNLSGKSVISVKTYYNIYPAKSFVIHDDIDLETGRVKFKTGGGNGGHNGLKSIDGVIGN-NYNRIRIGVGRPQNNQDLADYVLNHFSKPEYKTVMQAI 162
>gi|88804174|ref|ZP_01119694.1| peptidyl-tRNA hydrolase [Robiginitalea biformata HTCC2501] >gi|88785053|gb|EAR16222.1| peptidyl-tRNA hydrolase [Robiginitalea biformata HTCC2501] (188 aa)
Score = 245, Expect = 1.5e-19, Identities = 53/136 (38%), Positives = 73/136 (53%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIG 136
           M K+L+ GLGN G EY +T+HN+GF  +D L +       +++  G+          +   KP TYMN SG  V       KI  QN+LV+ DD++   G +R+K KGS GG NG+K I   + T    R R GIG
  S:     1 MKKFLIAGLGNIGDEYAETRHNIGFRILDHLSRSEDFSFESARL-GEVGTWKVKGRSLLCLKPATYMNRSGRAVQYWLDKEKIPLQNLLVVTDDLNLPFGTLRLKTKGSDGGHNGLKDIQQILGTTGYARFRFGIG 135
>gi|159185111|ref|NP_355187.2| peptidyl-tRNA hydrolase [Agrobacterium tumefaciens str. C58] >gi|22095994|sp|Q8UD97|PTH_AGRT5 Peptidyl-tRNA hydrolase (PTH) >gi|159140382|gb|AAK87972.2| peptidyl tRNA hydrolase [Agrobacterium tumefaciens str. C58] (238 aa)
Score = 245, Expect = 1.6e-19, Identities = 63/181 (34%), Positives = 102/181 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-----VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKF 185
           ++ GLGNPG +Y   +HN+GFM +D L +  +    + KF  +  + +   +++ + KP+TYMN SGE V E  +F+K+   +I+ I+D++D   G+ R+K  G  GG NG+KS+ +    E  +R+R+GIG P     VH    HVL  F+  D + +   +    D     L   D  ++MNK 
  S:     3 IIAGLGNPGAQYAGNRHNIGFMAVDALQRLPSFAPWSKKFKAEISEGEIGGEKVLLMKPLTYMNLSGESVGEAMRFFKLTPADIIAIHDELDLLAGRTRIKIGGGHGGHNGLKSLDAHCGKE-YRRLRLGIGHPGDKERVHG---HVLGDFAKSDRVWLDPLLDAIADNA-AMLVKGDDSQLMNKL 183
>gi|53718159|ref|YP_107145.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei K96243] >gi|167737030|ref|ZP_02409804.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 14] >gi|167814139|ref|ZP_02445819.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 91] >gi|194511196|ref|YP_002023725.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei Pasteur 52237] >gi|194572504|ref|YP_002107500.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 406e] >gi|68052913|sp|Q63XM0|PTH_BURPS Peptidyl-tRNA hydrolase (PTH) >gi|52208573|emb|CAH34509.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei K96243] >gi|157805711|gb|EDO82881.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 406e] >gi|157935481|gb|EDO91151.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei Pasteur 52237] (201 aa)
Score = 245, Expect = 1.6e-19, Identities = 55/134 (41%), Positives = 85/134 (63%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK-FNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           L+VGLGNPG EY  T+HN GF  +D+L +E    L + + F+G + K     +++ + +P TYMN SG+ V  +  F+KI    ILV +D++D   G  ++K  G SGG NG+K I + +++++  R+RIGIG P
  S:     4 LIVGLGNPGAEYTATRHNAGFWLVDQLAREAGATLRDERRFHGFYAKARLFGEEVHLLEPQTYMNRSGQAVVALAHFFKILPTEILVAHDELDLPPGAAKLKLGGGSGGHNGLKDISAHLSSQQYWRLRIGIGHP 138
>gi|76809605|ref|YP_332165.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 1710b] >gi|124384025|ref|YP_001027483.1| peptidyl-tRNA hydrolase [Burkholderia mallei NCTC 10229] >gi|126439060|ref|YP_001057620.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 668] >gi|126448794|ref|YP_001082449.1| peptidyl-tRNA hydrolase [Burkholderia mallei NCTC 10247] >gi|126453669|ref|YP_001064866.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 1106a] >gi|134279603|ref|ZP_01766315.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 305] >gi|161360199|ref|ZP_02106064.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 1106b] >gi|161369926|ref|ZP_02109494.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 1710a] >gi|167718013|ref|ZP_02401249.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei DM98] >gi|167822664|ref|ZP_02454135.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 9] >gi|167844235|ref|ZP_02469743.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei B7210] >gi|167892745|ref|ZP_02480147.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 7894] >gi|167909459|ref|ZP_02496550.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 112] >gi|167917487|ref|ZP_02504578.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei BCC215] >gi|194504568|ref|YP_002034140.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 1655] >gi|194516087|ref|YP_002051801.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei S13] >gi|194576249|ref|YP_002111132.1| peptidyl-tRNA hydrolase [Burkholderia mallei 2002721280] >gi|166199313|sp|A3MQB3|PTH_BURM7 Peptidyl-tRNA hydrolase (PTH) >gi|166199314|sp|A2S6B4|PTH_BURM9 Peptidyl-tRNA hydrolase (PTH) >gi|166199316|sp|A3NR95|PTH_BURP0 Peptidyl-tRNA hydrolase (PTH) >gi|166199317|sp|A3N5J9|PTH_BURP6 Peptidyl-tRNA hydrolase (PTH) >gi|119390918|sp|Q3JW88|PTH_BURP1 Peptidyl-tRNA hydrolase (PTH) >gi|76579058|gb|ABA48533.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 1710b] >gi|124292045|gb|ABN01314.1| peptidyl-tRNA hydrolase [Burkholderia mallei NCTC 10229] >gi|126218553|gb|ABN82059.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 668] >gi|126227311|gb|ABN90851.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 1106a] >gi|126241664|gb|ABO04757.1| peptidyl-tRNA hydrolase [Burkholderia mallei NCTC 10247] >gi|134248803|gb|EBA48885.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 305] >gi|148026570|gb|EDK84655.1| peptidyl-tRNA hydrolase [Burkholderia mallei 2002721280] >gi|169653320|gb|EDS86013.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei S13] >gi|184212405|gb|EDU09448.1| peptidyl-tRNA hydrolase [Burkholderia pseudomallei 1655] (201 aa)
Score = 245, Expect = 1.6e-19, Identities = 55/134 (41%), Positives = 85/134 (63%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK-FNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           L+VGLGNPG EY  T+HN GF  +D+L +E    L + + F+G + K     +++ + +P TYMN SG+ V  +  F+KI    ILV +D++D   G  ++K  G SGG NG+K I + +++++  R+RIGIG P
  S:     4 LIVGLGNPGAEYTATRHNAGFWLVDQLAREAGATLRDERRFHGFYAKARLFGEEVHLLEPQTYMNRSGQAVVALAHFFKILPTEILVAHDELDLPPGAAKLKLGGGSGGHNGLKDISAHLSSQQYWRLRIGIGHP 138
>gi|94500014|ref|ZP_01306549.1| peptidyl-tRNA hydrolase [Oceanobacter sp. RED65] >gi|94427872|gb|EAT12847.1| peptidyl-tRNA hydrolase [Oceanobacter sp. RED65] (195 aa)
Score = 244, Expect = 2.2e-19, Identities = 67/153 (43%), Positives = 92/153 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIK 157
           L+VGLGNPG EYE T+HN G   ++E+ + + + L    KF+G   K       +F+  P T+MN SG+ V  +  FYKI    ILV++D++D   G  R K  G  GGQNG+K IISKM N +   R+RIGIG P     +T HVL K + ++  K
  S:     7 LIVGLGNPGSEYENTRHNAGAWLLNEVARRYGVQLKPEKKFHGLCGKAQIKGQDVFLLFPTTFMNRSGQAVQALANFYKIPVNQILVVHDELDLPSGIARFKQGGGHGGQNGLKDIISKMANDKNFYRLRIGIGHPGDKTKVTGHVLGKPNKDEQNK 163
>gi|94309232|ref|YP_582442.1| peptidyl-tRNA hydrolase [Ralstonia metallidurans CH34] >gi|119390987|sp|Q1LRQ3|PTH_RALME Peptidyl-tRNA hydrolase (PTH) >gi|93353084|gb|ABF07173.1| peptidyl-tRNA hydrolase [Ralstonia metallidurans CH34] (198 aa)
Score = 243, Expect = 2.3e-19, Identities = 65/165 (39%), Positives = 98/165 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH----------NLTHHVLTKFSAEDSIKVQQAIIKAKDAC 169
           L+VGLGNPG EYE T+HN GF  +D+L +   T     S+F+G   +    +  +++ KP T+MN SG  V  + +FYKI    I+V +D++D   G  ++K  G SGG NG+K I + + T+   R+RIG+G P +          ++ + VL     E+    QQAI +A D C
  S:     4 LIVGLGNPGAEYEATRHNAGFWLVDQLARMGGTTLRVESRFHGLAGRARLWDQDVWLLKPSTFMNRSGLSVVSLARFYKILPDEIVVAHDEMDLPAGSAKLKRGGGSGGHNGLKDISAHLTTQDYWRLRIGVGHPRNAPGGAAGGREDVVNFVLKPPRKEE----QQAIDEAIDRC 175
>gi|119715157|ref|YP_922122.1| peptidyl-tRNA hydrolase [Nocardioides sp. JS614] >gi|119535818|gb|ABL80435.1| peptidyl-tRNA hydrolase [Nocardioides sp. JS614] (217 aa)
Score = 243, Expect = 2.3e-19, Identities = 56/183 (30%), Positives = 95/183 (51%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSK------FNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +LVVGLGNPG  Y   +HNVG++  DEL           K        G+     QP  ++ + +   YMN +G  V ++  FYK+  + I+ ++D++D     +RVK  G   G NG++S+ S + T    R+R+GIG+P    +    VL+ +S+ +   +   + +A DA    +     ++   +FN
  S:    27 WLVVGLGNPGPTYAGHRHNVGYLVADELASRLGAPFRAHKSGRAEVVEGRLGVPGQPGPRVVLMRARCYMNETGGPVKQLAGFYKVPPERIIAVHDELDIAFDTMRVKLGGGDNGHNGLRSMRSSLGTGDFYRVRVGIGRPPGRQDPADFVLSNYSSSERKVLPFQVDRAADAVEALVTE-GLERTQQRFN 216
>gi|15834803|ref|NP_296562.1| peptidyl-tRNA hydrolase [Chlamydia muridarum Nigg] >gi|7404431|sp|P49607|PTH_CHLMU Peptidyl-tRNA hydrolase (PTH) >gi|7190220|gb|AAF39057.1| peptidyl-tRNA hydrolase [Chlamydia muridarum Nigg] (179 aa)
Score = 243, Expect = 2.6e-19, Identities = 50/147 (34%), Positives = 87/147 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHT-LFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH----NLTHHVLTKFS 151
           LVVG+GNPG +Y  T+HN+GF+ +D L    +  F    +    F+KV+     I + KP TY+N +G+ V    +F+ +  + IL++ DDI+ + G IR +    +GG NG+K+    + +    ++R+G+G+P +     +  +VL+ FS
  S:     4 LVVGIGNPGRQYVWTRHNIGFLFLDMLASRFSGAFREAPRLFSSFMKVETSCGVIVLIKPSTYVNLTGKAVLAAKRFFGVSVEGILIVADDINREFGSIRFRQDCGAGGHNGLKNTTQVLQSNHYWQLRLGVGRPSNPESEGVADYVLSNFS 155
>gi|82544342|ref|YP_408289.1| peptidyl-tRNA hydrolase [Shigella boydii Sb227] >gi|119391006|sp|Q31ZP7|PTH_SHIBS Peptidyl-tRNA hydrolase (PTH) >gi|81245753|gb|ABB66461.1| peptidyl-tRNA hydrolase [Shigella boydii Sb227] (194 aa)
Score = 243, Expect = 2.7e-19, Identities = 54/138 (39%), Positives = 78/138 (56%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP 138
           M+  L+VGL NPG EY  T+HN G   +D L +         +KF G   +V    + + +  P T+MN SG+ V  +  F++I+   ILV +D++D   G  + K  G+ GG NG+K IISK+ N     R+RIGIG P
  S:     1 MTIKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLAGAHGGHNGLKDIISKLGNNPNFHRLRIGIGHP 140
>gi|114319447|ref|YP_741130.1| peptidyl-tRNA hydrolase [Alkalilimnicola ehrlichei MLHE-1] >gi|119390908|sp|Q0ABZ7|PTH_ALHEH Peptidyl-tRNA hydrolase (PTH) >gi|114225841|gb|ABI55640.1| peptidyl-tRNA hydrolase [Alkalilimnicola ehrlichei MLHE-1] (197 aa)
Score = 242, Expect = 3.3e-19, Identities = 60/169 (35%), Positives = 100/169 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEK-IKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFL 173
           L+VGLGNPG  Y  T+HN GF  +DELL+ H   L    +++     +     Q  + +P TYMN SG+ V    +F+++  ++ILV++D+ID   G++++K  G  GG NG++ II  +  E+   R RIG+G P H   +  +VL++ + ++   +  A+ +  D C E+L
  S:    10 LIVGLGNPGDRYAGTRHNAGFWLLDELLRRHGGALRPERRYHADLATLHLGPHQCRLMRPQTYMNRSGQAVGPYAQFFRLPPESILVVHDEIDLPPGQVKLKQGGGHGGHNGLRDIIRALGNERGFCRARIGVGHPGHRDGVVPYVLSRPAPDERRAIADAVEELAD-CVEWL 181
>gi|118579183|ref|YP_900433.1| peptidyl-tRNA hydrolase [Pelobacter propionicus DSM 2379] >gi|166229431|sp|A1AM05|PTH_PELPD Peptidyl-tRNA hydrolase (PTH) >gi|118501893|gb|ABK98375.1| peptidyl-tRNA hydrolase [Pelobacter propionicus DSM 2379] (193 aa)
Score = 242, Expect = 3.6e-19, Identities = 54/153 (35%), Positives = 89/153 (58%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLT-HHVLTKFSAE 153
           MS +++ GLGNPG  Y+ T+HN GF+ +D L     + +    F+G   +  +   +  + KP T+MN SG  V +  +FYK+     +V++DD+D   G +R+K  G  GG NG++SI+ ++      R+R+GIG+P+H  T ++VL     E
  S:     1 MSMHIIAGLGNPGSHYQWTRHNAGFLFLDRLAHLENVSITRKSFSGLAGEWSRANCRHILLKPQTFMNLSGRSVMQALQFYKLPLSQAIVVHDDLDLPFGTVRLKQGGGHGGHNGLRSIMEQLGKGDFIRLRVGIGRPLHGDTVNYVLGSMPPE 154
>gi|91217231|ref|ZP_01254192.1| peptidyl-tRNA hydrolase [Psychroflexus torquis ATCC 700755] >gi|91184574|gb|EAS70956.1| peptidyl-tRNA hydrolase [Psychroflexus torquis ATCC 700755] (207 aa)
Score = 241, Expect = 3.9e-19, Identities = 62/186 (33%), Positives = 99/186 (53%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTH--HVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           M K+L+VGLGNPG +YE T+HN+GF  +D L ++  +     ++ G   +V     +  + KP T+MN SG+ V    +   I   N++VI DD++ + G  R+KAKGS GG NG+K I S + T +  R R GI           +VL+ +  E+  ++++ +  + +    F         MN FN
  S:    20 MKKFLIVGLGNPGPKYENTRHNIGFKILDTLAEKKEVSFEPDRY-GDKAEVSFKGRKFILIKPSTFMNLSGKAVRYWLEKENIAIDNLIVITDDLNLNFGIFRLKAKGSDGGHNGLKHIQSILQTTQYPRFRFGISDEFSKGKQIDYVLSNWDEEEKTQLKERLDASAELILSF-GTAGIHNTMNTFN 205
>gi|28493618|ref|NP_787779.1| peptidyl-tRNA hydrolase [Tropheryma whipplei str. Twist] >gi|46576787|sp|Q83FR1|PTH_TROWT Peptidyl-tRNA hydrolase (PTH) >gi|28476660|gb|AAO44748.1| peptidyl-tRNA hydrolase [Tropheryma whipplei str. Twist] (186 aa)
Score = 241, Expect = 4.0e-19, Identities = 60/168 (35%), Positives = 95/168 (56%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDA 168
           M  Y+V GLGNPG  Y+KT+HNVG M +D +L     F    K N  ++ +      I + KP  YMN SG  +  + KF+ +   ++LV++DDID  +G +R K  G + G  G++SI   + ++   R+R+GIG+P +N  +   VL+ FS   +  + + I  A +A
  S:     1 MCVYIVAGLGNPGPSYDKTRHNVGQMVLD-ILSGGARF-RRHKTNNFYLSL----GDILLVKPDAYMNLSGPVIASLMKFHSV--SDLLVLHDDIDLPLGTLRFKQGGGTAGHRGLRSISDCLGSD-YARLRVGIGRPENNQSIEDFVLSNFSPVQTDIISRTIQLAAEA 161
>gi|28572814|ref|NP_789594.1| peptidyl-tRNA hydrolase [Tropheryma whipplei TW08/27] >gi|46576789|sp|Q83HD8|PTH_TROW8 Peptidyl-tRNA hydrolase (PTH) >gi|28410947|emb|CAD67332.1| peptidyl-tRNA hydrolase [Tropheryma whipplei TW08/27] (186 aa)
Score = 241, Expect = 4.1e-19, Identities = 60/168 (35%), Positives = 95/168 (56%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDA 168
           M  Y+V GLGNPG  Y+KT+HNVG M +D +L     F    K N  ++ +      I + KP  YMN SG  +  + KF+ +   ++LV++DDID  +G +R K  G + G  G++SI   + ++   R+R+GIG+P +N  +   VL+ FS   +  + + I  A +A
  S:     1 MCVYIVAGLGNPGPSYDKTRHNVGQMVLD-ILSGGARF-RRHKTNNFYLSL----GDILLVKPDAYMNLSGPVIASLMKFHSV--SDLLVLHDDIDLPLGTLRFKQGGGTAGHRGLRSISDCLGSD-YARLRVGIGRPENNQSIEDFVLSNFSPVQTDIISRTIQLAAEA 161
>gi|167644634|ref|YP_001682297.1| peptidyl-tRNA hydrolase [Caulobacter sp. K31] >gi|167347064|gb|ABZ69799.1| Aminoacyl-tRNA hydrolase [Caulobacter sp. K31] (208 aa)
Score = 241, Expect = 4.6e-19, Identities = 60/150 (40%), Positives = 93/150 (62%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFV--KVDQPED--QIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKF 150
           MS  ++ GLGNP  +YEK +HNVGFM +D L ++  +    S+F G     +V  P    ++ + KP T+ N SG  V E  KF+K+   +++V +D+ID   G+ R+KA G + G NG++SI S++  +  +R RIG+G P H   + H+VL  F
  S:     1 MSMLILAGLGNPEPKYEKNRHNVGFMAVDALARKWGVAPWRSRFQGLACEGQVSTPNGPVKLLLLKPKTFYNESGRAVGEAMKFFKLSPADVIVFHDEIDMAPGRFRMKAGGGAAGNNGVRSITSQIG-DGFRRGRIGVGHPGHKDAVMHYVLGDF 155
>gi|62389829|ref|YP_225231.1| peptidyl-tRNA hydrolase [Corynebacterium glutamicum ATCC 13032] >gi|24418600|sp|Q8NRV3|PTH1_CORGL Peptidyl-tRNA hydrolase 1 (PTH 1) >gi|21323704|dbj|BAB98331.1| Peptidyl-tRNA hydrolase [Corynebacterium glutamicum ATCC 13032] >gi|41325164|emb|CAF19645.1| PROBABLE PEPTIDYL-TRNA HYDROLASE PROTEIN [Corynebacterium glutamicum ATCC 13032] (177 aa)
Score = 241, Expect = 4.9e-19, Identities = 47/137 (34%), Positives = 82/137 (59%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           S  LVVGLGNPG +Y  T+HN+GF   +EL+ +    F  + + N    ++      + +AKP ++MN SG  +  +C F+KI   N++V++D+++ D G ++++  G   G NG+KS    + T+   ++ +GIG+P
  S:     4 SPLLVVGLGNPGPKYVGTRHNIGFEVAEELVSRSFGSFSVHKRSNTDIAQLPG----LIVAKPRSFMNLSGTPIRALCDFFKISPANVIVVHDELELDFGSVKLRQGGGDHGHNGLKSTSKSLGTKDYWKLSMGIGRP 137
>gi|19552164|ref|NP_600166.1| peptidyl-tRNA hydrolase [Corynebacterium glutamicum ATCC 13032] (180 aa)
Score = 240, Expect = 5.0e-19, Identities = 47/137 (34%), Positives = 82/137 (59%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           S  LVVGLGNPG +Y  T+HN+GF   +EL+ +    F  + + N    ++      + +AKP ++MN SG  +  +C F+KI   N++V++D+++ D G ++++  G   G NG+KS    + T+   ++ +GIG+P
  S:     7 SPLLVVGLGNPGPKYVGTRHNIGFEVAEELVSRSFGSFSVHKRSNTDIAQLPG----LIVAKPRSFMNLSGTPIRALCDFFKISPANVIVVHDELELDFGSVKLRQGGGDHGHNGLKSTSKSLGTKDYWKLSMGIGRP 140
>gi|53733244|ref|ZP_00156231.2| COG0193: Peptidyl-tRNA hydrolase [Haemophilus influenzae R2866] >gi|145630433|ref|ZP_01786214.1| peptidyl-tRNA hydrolase [Haemophilus influenzae 22.4-21] >gi|145638695|ref|ZP_01794304.1| peptidyl-tRNA hydrolase [Haemophilus influenzae PittII] >gi|144984168|gb|EDJ91605.1| peptidyl-tRNA hydrolase [Haemophilus influenzae R3021] >gi|145272290|gb|EDK12198.1| peptidyl-tRNA hydrolase [Haemophilus influenzae PittII] (194 aa)
Score = 240, Expect = 6.2e-19, Identities = 67/182 (36%), Positives = 104/182 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y  T+HN G   I+ L +   + LN  +KF G+ V+      ++ +  P T+MN SG+ V  +  FY+I  + ILVI+D++D   G  ++K  G  GG NG+K I++++ N     R+RIGIG P H   +  +VL K S  D   +++ + +A D C E +      K  N+ N
  S:     6 LIVGLGNPGEKYADTRHNAGEWLIERLARRFNVSLNPENKFFGKTVRTLLNGKEVRLLVPTTFMNLSGKAVGALASFYRIKPEEILVIHDELDLPAGTAKLKQGGGHGGHNGLKDIVAQLGNNNNFYRLRIGIGHPGHRDLVAGYVLNKPSPADRDALEKVLDEATD-CVEMIFKDGMVKATNRLN 190
>gi|53729108|ref|ZP_00134069.2| COG0193: Peptidyl-tRNA hydrolase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126207521|ref|YP_001052746.1| peptidyl-tRNA hydrolase [Actinobacillus pleuropneumoniae L20] >gi|166199299|sp|A3MYA5|PTH_ACTP2 Peptidyl-tRNA hydrolase (PTH) >gi|126096313|gb|ABN73141.1| peptidyl-tRNA hydrolase [Actinobacillus pleuropneumoniae L20] (194 aa)
Score = 240, Expect = 6.2e-19, Identities = 66/182 (36%), Positives = 104/182 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNN-SKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG +YE T+HN G   I+E+ ++  + L   +KF G+  K++    ++ +  P T+MN SG+ V  +  FY+I  + ILV +D++D   G  ++K  G  GG NG+K II+ + N+    R+RIGIG P     +  +VL K S +D  K+  A+ +A   C + L      K  N+ N
  S:     6 LIVGLANPGTKYEDTRHNAGEWLINEIARQFNVSLKEEAKFFGKVAKINAAGGEVRLLVPTTFMNLSGKAVGALANFYRIKPEEILVAHDELDLPPGVAKIKQGGGHGGHNGLKDIIASLGNSNNFYRVRIGIGHPGSKELVAGYVLGKPSPQDQEKINAAVDEA-GRCVDLLLKDGITKATNRLN 190
>gi|89056083|ref|YP_511534.1| peptidyl-tRNA hydrolase [Jannaschia sp. CCS1] >gi|119390951|sp|Q28LA3|PTH_JANSC Peptidyl-tRNA hydrolase (PTH) >gi|88865632|gb|ABD56509.1| peptidyl-tRNA hydrolase [Jannaschia sp. CCS1] (239 aa)
Score = 240, Expect = 6.3e-19, Identities = 56/151 (37%), Positives = 90/151 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDS 155
           L VGLGNPG +Y   +HN+G+M +D + ++H      +KF G+  +     +++ + KP T+MN SG+ V E  +FYK+   ++ V +D+ID    KIRVKA G   G NG++SI   +      R+R+G+G P H   +  +VL+ F+  D+
  S:     3 LWVGLGNPGAKYAGNRHNIGWMAVDRVAEDHGFAPWRAKFQGEVSEGVLDGEKVLLLKPTTFMNLSGQSVGEAMRFYKLDSTDVTVWHDEIDLAPAKIRVKAGGGHAGHNGLRSIHQHIGPH-YDRVRLGVGHPGHKDRVPGYVLSDFAKADA 154
>gi|68248997|ref|YP_248109.1| peptidyl-tRNA hydrolase [Haemophilus influenzae 86-028NP] >gi|81336591|sp|Q4QNE8|PTH_HAEI8 Peptidyl-tRNA hydrolase (PTH) >gi|68057196|gb|AAX87449.1| peptidyl-tRNA hydrolase [Haemophilus influenzae 86-028NP] (194 aa)
Score = 239, Expect = 7.0e-19, Identities = 67/182 (36%), Positives = 103/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y  T+HN G   I+ L +   + LN  SKF G+  +      ++ +  P T+MN SG+ V  +  FY+I  + ILVI+D++D   G  ++K  G  GG NG+K I++++ N     R+RIGIG P H   +  +VL K S  D   +++ + +A D C E +      K  N+ N
  S:     6 LIVGLGNPGEKYADTRHNAGEWLIERLARRFNVSLNPESKFFGKTARTLVNGKEVRLLVPTTFMNLSGKAVGALASFYRIKPEEILVIHDELDLPAGTAKLKQGGGHGGHNGLKDIVAQLGNNNNFYRLRIGIGHPGHRDLVAGYVLNKPSPADRDALEKVLDEATD-CVEIIFKDGMIKATNRLN 190
>gi|84703891|ref|ZP_01017719.1| peptidyl-tRNA hydrolase [Parvularcula bermudensis HTCC2503] >gi|84690325|gb|EAQ16166.1| peptidyl-tRNA hydrolase [Parvularcula bermudensis HTCC2503] (231 aa)
Score = 239, Expect = 7.2e-19, Identities = 58/147 (39%), Positives = 84/147 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFS 151
           L++GLGNPG +Y + +HN GF  ++E+   H      SKF G   +      + F  +P TY N+SG  V    +FYKI   +I+V +D+ID   GK+RVK  G   G NG++SI + +  +   R+RIGIG P H   +  +VL  FS
  S:     3 LLIGLGNPGAQYAQNRHNAGFHAVEEIHGAHDFGPERSKFRGALAEGRVGSCRAFTLRPDTYYNDSGTAVLAASQFYKIPLDDIIVFHDEIDLAPGKVRVKKGGGLAGNNGLRSIAAHLGPD-FWRVRIGIGHPGHKDKVMPYVLGNFS 150
>gi|83856226|ref|ZP_00949755.1| peptidyl-tRNA hydrolase [Croceibacter atlanticus HTCC2559] >gi|83850026|gb|EAP87894.1| peptidyl-tRNA hydrolase [Croceibacter atlanticus HTCC2559] (219 aa)
Score = 239, Expect = 7.5e-19, Identities = 62/186 (33%), Positives = 95/186 (51%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           M K+L+VGLGN G +Y  T+HN+GF  +D L ++  L    +K  G             + KP T+MN SG+ V    +  KI   N+L+I DD++   G IR+K KGS GG NG+K I +++ T    R R GI           +VL ++S E+  ++++ +  + +    F         MN FN
  S:    32 MRKFLIVGLGNIGPKYHNTRHNIGFKILDHLAEQEDLVFEPNKL-GDTATYKFKGRTFILLKPSTFMNLSGKAVNYWMQKEKIRTSNLLIITDDLNLPFGTIRLKTKGSDGGHNGLKDIQAQLKTVGYPRFRFGISNEFSKGRQVDYVLGEWSEEEESQMKERLDTSVELIKSF-GTAGVSITMNTFN 217
>gi|85708584|ref|ZP_01039650.1| peptidyl-tRNA hydrolase [Erythrobacter sp. NAP1] >gi|85690118|gb|EAQ30121.1| peptidyl-tRNA hydrolase [Erythrobacter sp. NAP1] (189 aa)
Score = 239, Expect = 7.6e-19, Identities = 58/176 (32%), Positives = 96/176 (54%)
  Q:     8 GLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMN 183
           GLGNPG +Y   +HNVGFM +D +   +       KF+G   +      ++ + KP T+MN SG  V E  +FYK+    + V +D++D    K++VK  G + G NG++SI   +  +  +R+RIGIG P H   ++ +VL  ++  +   +  A++ A  A  E+L   D  + M+
  S:     6 GLGNPGPKYALHRHNVGFMVLDVIADMYDFGPIQKKFSGWVQEGRIGTQKVLLLKPATFMNESGRSVGEAIRFYKLDLDALTVFHDELDLAPFKVKVKQGGGTAGHNGLRSIDKHLGPD-FRRVRIGIGHPGHKDRVSGYVLGNYAKSEQDDL-AAMLGAIGAEAEWLAKGDDPRFMS 181
>gi|1127571|gb|AAB06184.1| peptidyl-tRNA hydrolase [Chlamydia trachomatis] (194 aa)
Score = 239, Expect = 7.9e-19, Identities = 50/147 (34%), Positives = 87/147 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHT-LFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTH----HVLTKFS 151
           LVVG+GNPG +Y  T+HN+GF+ +D L    +  F    +    F+KV+     I + KP TY+N +G+ V    +F+ +  + IL++ DDI+ + G IR +    +GG NG+K+    + +    ++R+G+G+P +  +     +VL+ FS
  S:     4 LVVGIGNPGRQYVWTRHNIGFLFLDMLASRFSGAFREAPRLFSSFMKVETSCGVIVLIKPSTYVNLTGKAVLAAKRFFGVSVEGILIVADDINREFGSIRFRQDCGAGGHNGLKNTTQVLQSNHYWQLRLGVGRPSNPESEGGADYVLSNFS 155
>gi|15604455|ref|NP_220973.1| peptidyl-tRNA hydrolase [Rickettsia prowazekii str. Madrid E] >gi|6647700|sp|Q9ZCV4|PTH_RICPR Peptidyl-tRNA hydrolase (PTH) >gi|3861149|emb|CAA15049.1| PEPTIDYL-TRNA HYDROLASE (pth) [Rickettsia prowazekii] (185 aa)
Score = 238, Expect = 8.8e-19, Identities = 66/158 (41%), Positives = 95/158 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAI 162
           LV+GLGNPG EY+ T+HN+GF+ I+ +  K H  F    KFN +  +      +I   KP TYMN SG+ V  +  +Y I  + + VI+DDID ++G+I+ K  G +GG NG+KSI   +      RIRIGIG+P   H++  +VL  FS  +     Q+I
  S:     3 LVIGLGNPGTEYQYTRHNIGFIAIERIASKYHLSFSIKKKFNCEIAEAVIDRQKIIFIKPTTYMNLSGKSVILVKTYYNIKYEKVFVIHDDIDLEIGRIKFKTGGGNGGHNGLKSIDVVIGNH-YNRIRIGIGRPKNNHDVADYVLNNFSESEYKIAMQSI 162
>gi|157803534|ref|YP_001492083.1| peptidyl-tRNA hydrolase [Rickettsia canadensis str. McKiel] >gi|166229445|sp|A8EY65|PTH_RICCK Peptidyl-tRNA hydrolase (PTH) >gi|157784797|gb|ABV73298.1| peptidyl-tRNA hydrolase [Rickettsia canadensis str. McKiel] (185 aa)
Score = 238, Expect = 9.4e-19, Identities = 65/160 (40%), Positives = 99/160 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIK 164
            V+GLGNPG EY+ T+HN+GF+ I+++  ++ L F    KFN + V+    + ++   KP TYMN SG+ V  +  +Y I  + I VI+DDID + G+I+ K  G +GG NG+KS I ++      RIRIG+G+P +N  +  +VL  F   +   V Q+I K
  S:     3 FVIGLGNPGKEYQYTRHNIGFIVIEKIANQYNLSFSTKKKFNCEIVESSVEKQKLIFIKPTTYMNLSGKSVISVKTYYNICSEKIFVIHDDIDLETGRIKFKTGGGNGGHNGLKS-IDRVIGNNYNRIRIGVGRPQNNQDVADYVLNNFPRSEYEIVIQSIDK 164
>gi|16124739|ref|NP_419303.1| peptidyl-tRNA hydrolase [Caulobacter crescentus CB15] >gi|22095997|sp|Q9AAV9|PTH_CAUCR Peptidyl-tRNA hydrolase (PTH) >gi|13421661|gb|AAK22471.1| peptidyl-tRNA hydrolase [Caulobacter crescentus CB15] (205 aa)
Score = 238, Expect = 9.8e-19, Identities = 58/146 (39%), Positives = 90/146 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNG-----QFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKF 150
           ++ GLGNP  +YEK +HNVGFM +D L ++       ++F G     Q    D P  ++ + KP TY N SG  V E  KF+K+   +++V +D+ID   G+ R+K+ G + G NGI+S+ S++  +  +R RIG+G P H   + H+VL  F
  S:     3 ILAGLGNPEPKYEKNRHNVGFMAVDALARKWGTAPWRARFQGLACEGQVSTPDGPV-KLLLLKPKTYYNESGRAVGEAMKFFKLQPTDVIVFHDEIDMAPGRFRMKSGGGAAGNNGIRSVTSQVG-DAFRRGRIGVGHPGHKDAVMHYVLGDF 153
>gi|16272343|ref|NP_438556.1| peptidyl-tRNA hydrolase [Haemophilus influenzae Rd KW20] >gi|1172722|sp|P44682|PTH_HAEIN Peptidyl-tRNA hydrolase (PTH) >gi|1573366|gb|AAC22053.1| peptidyl-tRNA hydrolase (pth) [Haemophilus influenzae Rd KW20] (194 aa)
Score = 238, Expect = 9.8e-19, Identities = 67/182 (36%), Positives = 103/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y  T+HN G   I+ L +   + LN  SKF G+  +      ++ +  P T+MN SG+ V  +  FY+I  + ILVI+D++D   G  ++K  G  GG NG+K I++++ N     R+RIGIG P H   +  +VL K S  D   +++ + +A D C E +      K  N+ N
  S:     6 LIVGLGNPGDKYTDTRHNAGEWLIERLARRFNVSLNPESKFFGKTARTLVNGKEVRLLVPTTFMNLSGKAVGALASFYRIKPEEILVIHDELDLPPGTAKLKQGGGHGGHNGLKDIVAQLGNNNNFYRLRIGIGHPGHRDLVAGYVLNKPSPADRDALEKVLDEATD-CVEMIFRDGMVKATNRLN 190
>gi|62263425|gb|AAX78159.1| unknown protein [synthetic construct] (226 aa)
Score = 238, Expect = 1.1e-18, Identities = 66/182 (36%), Positives = 104/182 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +++GLGN G EY+ T+HNVG   I ++ +++   F +N K N    KV    + + +  P TYMNNSG  V ++  FYKI    ILV++D++D D G+IR+K  G  GG NG++SI   + T    R+RIGIG P H   + ++VL+  S      +  AI       ++ +N+   + +M K +
  S:    32 MIIGLGNIGKEYQDTRHNVGEWFIAKIAQDNNQSFSSNPKLNCNLAKVSIDYNNVVLVFPTTYMNNSGLAVSKVANFYKIAPAEILVVHDELDIDSGEIRLKKGGGHGGHNGLRSINQHLGTNDYLRLRIGIGHPGHKSKVANYVLSNPSIAQKKDIDSAIDNGICFLDDIINY-KLEPVMQKLH 215
>gi|56707800|ref|YP_169696.1| peptidyl-tRNA hydrolase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110670271|ref|YP_666828.1| peptidyl-tRNA hydrolase [Francisella tularensis subsp. tularensis FSC198] >gi|68052885|sp|Q5NGZ6|PTH_FRATT Peptidyl-tRNA hydrolase (PTH) >gi|119390942|sp|Q14IE8|PTH_FRAT1 Peptidyl-tRNA hydrolase (PTH) >gi|54112801|gb|AAV29034.1| NT02FT1020 [synthetic construct] >gi|56604292|emb|CAG45313.1| Peptidyl-tRNA hydrolase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320604|emb|CAL08696.1| Peptidyl-tRNA hydrolase [Francisella tularensis subsp. tularensis FSC 198] >gi|151568541|gb|EDN34195.1| peptidyl-tRNA hydrolase [Francisella tularensis subsp. tularensis FSC033] (191 aa)
Score = 237, Expect = 1.1e-18, Identities = 66/182 (36%), Positives = 104/182 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           +++GLGN G EY+ T+HNVG   I ++ +++   F +N K N    KV    + + +  P TYMNNSG  V ++  FYKI    ILV++D++D D G+IR+K  G  GG NG++SI   + T    R+RIGIG P H   + ++VL+  S      +  AI       ++ +N+   + +M K +
  S:     6 MIIGLGNIGKEYQDTRHNVGEWFIAKIAQDNNQSFSSNPKLNCNLAKVSIDYNNVVLVFPTTYMNNSGLAVSKVANFYKIAPAEILVVHDELDIDSGEIRLKKGGGHGGHNGLRSINQHLGTNDYLRLRIGIGHPGHKSKVANYVLSNPSIAQKKDIDSAIDNGICFLDDIINY-KLEPVMQKLH 189
>gi|95930455|ref|ZP_01313191.1| Aminoacyl-tRNA hydrolase [Desulfuromonas acetoxidans DSM 684] >gi|95133495|gb|EAT15158.1| Aminoacyl-tRNA hydrolase [Desulfuromonas acetoxidans DSM 684] (191 aa)
Score = 237, Expect = 1.2e-18, Identities = 57/182 (31%), Positives = 97/182 (53%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++ GLGNPG  Y  T+HNVGFM +D+L   H + L      G +        Q+ + +P T+MN SG  V   CK   +   +++VI+D+ID   G++R+K  G  GG NG++ I   ++T    R+R+G+ +P    ++  +VL  FSA +  ++   ++ A +     ++     K M  +N
  S:     2 VIAGLGNPGERYAVTRHNVGFMVVDQLAARHQISLKKKGHQGLYGIGRCGGQQVMLLQPQTFMNLSGASVASACKSLDVTSGDLVVIHDEIDLPFGEVRIKQGGGHGGHNGLRHIDQALSTRDYIRVRVGVDRPPAGADVAAYVLKSFSASEKKQLTTVLMYAAEIVEAIIDQ-GLQKAMCNYN 184
>gi|89256305|ref|YP_513667.1| peptidyl-tRNA hydrolase [Francisella tularensis subsp. holarctica] >gi|115314752|ref|YP_763475.1| peptidyl-tRNA hydrolase [Francisella tularensis subsp. holarctica OSU18] >gi|167010180|ref|ZP_02275111.1| peptidyl-tRNA hydrolase [Francisella tularensis subsp. holarctica FSC200] >gi|169656592|ref|YP_001428439.2| peptidyl-tRNA hydrolase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|189038313|sp|A7NBY0|PTH_FRATF Peptidyl-tRNA hydrolase (PTH) >gi|119390943|sp|Q2A3N5|PTH_FRATH Peptidyl-tRNA hydrolase (PTH) >gi|119390944|sp|Q0BM46|PTH_FRATO Peptidyl-tRNA hydrolase (PTH) >gi|89144136|emb|CAJ79395.1| Peptidyl-tRNA hydrolase [Francisella tularensis subsp. holarctica LVS] >gi|115129651|gb|ABI82838.1| aminoacyl-tRNA hydrolase [Francisella tularensis subsp. holarctica OSU18] >gi|134253449|gb|EBA52543.1| peptidyl-tRNA hydrolase [Francisella tularensis subsp. holarctica 257] >gi|157122234|gb|EDO66374.1| peptidyl-tRNA hydrolase [Francisella tularensis subsp. holarctica FSC022] >gi|164551660|gb|ABU61483.2| peptidyl-tRNA hydrolase [Francisella tularensis subsp. holarctica FTNF002-00] (191 aa)
Score = 237, Expect = 1.2e-18, Identities = 67/182 (36%), Positives = 104/182 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGLGN G EY+ T+HNVG   I ++ +++   F +N+K N    KV    + + +  P TYMNNSG  V ++  FYKI    ILV +D++D D G+IR+K  G  GG NG++SI   + T    R+RIGIG P H   + ++VL+  S      +  AI       ++ +N+   + +M K +
  S:     6 MIVGLGNIGKEYQDTRHNVGEWFIAKIAQDNNQSFSSNTKLNCNLAKVSIDYNNVVLVFPTTYMNNSGLAVSKVANFYKIAPAEILVAHDELDIDSGEIRLKKGGGHGGHNGLRSINQHLGTNDYLRLRIGIGHPGHKSKVANYVLSNPSIAQKKDIDSAIDNGICFLDDIINY-KLEPVMQKLH 189
>gi|15646106|ref|NP_208288.1| peptidyl-tRNA hydrolase [Helicobacter pylori 26695] >gi|2499985|sp|P56077|PTH_HELPY Peptidyl-tRNA hydrolase (PTH) >gi|2314676|gb|AAD08538.1| peptidyl-tRNA hydrolase (pth) [Helicobacter pylori 26695] (186 aa)
Score = 237, Expect = 1.2e-18, Identities = 72/183 (39%), Positives = 103/183 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           L+VGLGNP L Y  T+HN GF  +D L+ E  L    S  +  F+ V +  D IF+ KP TYMN SGE V     FYK  E  +L+++DD+D  +G +R K  G +GG NG+KS I  + +    R+R+GI K +  +  HVL+KF   +      A   AK+A   F+   DF+ + N+F +
  S:     3 LLVGLGNPTLRYAHTRHNAGFDILDSLVSELDLSFTFSPKHNAFLCVYK--DFIFL-KPQTYMNLSGESVLSAKNFYKTKE--LLIVHDDLDLPLGVVRFKNGGGNGGHNGLKS-IDLLCSNSYYRLRVGISKGI-GVIEHVLSKFHKNEEPLKNAAFEHAKNALKFFIESHDFNAMQNRFTL 178
>gi|148653904|ref|YP_001280997.1| peptidyl-tRNA hydrolase [Psychrobacter sp. PRwf-1] >gi|148572988|gb|ABQ95047.1| peptidyl-tRNA hydrolase [Psychrobacter sp. PRwf-1] (207 aa)
Score = 237, Expect = 1.3e-18, Identities = 60/161 (37%), Positives = 95/161 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKA 165
           L+VGLGNPG +Y +T+HN GF  +  +  +  + L  + KFNG   +       + +  PMT+MN SG+ V  + K+Y I  + +L+ +D++D   G I++K  G  GG NG++ I   +  +   R+RIGIG P H   ++ HVL+K S ED I ++ A+  A
  S:    19 LIVGLGNPGQQYVETRHNAGFWFVALIADQFNIELAADKKFNGLTGRGRIFGTDVRLLLPMTFMNKSGQSVVPMAKYYDIKPEELLIAHDELDIAAGSIKLKTGGGHGGHNGLRDITPHLGND-FHRLRIGIGHPGHKSKVSGHVLSKPSPEDQIAIEAALDAA 181
>gi|47227662|emb|CAG09659.1| unnamed protein product [Tetraodon nigroviridis] (232 aa)
Score = 237, Expect = 1.3e-18, Identities = 53/165 (32%), Positives = 97/165 (58%)
  Q:     3 KYLVVGLGNPGLEYEKTKHNVGFMCIDEL---LKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAIIKAKD 167
           + LVVGLGNPG++   T+H+VG   +  L   L+    +  +   +G+ +  ++P   + + +P   MN +G  V      Y I  ++IL+++D++D  +GKI +K  GS  G NG++S I  + T+ + R+R+GIG+P    ++  HVL +FS E+   +   ++++ D
  S:    60 RKLVVGLGNPGMD--GTRHSVGMAVLGALAARLRVADRWRPDKHVSGEVIVCEEPTSVVLL-RPRLLMNVNGVSVARAAGKYGIQPEDILLVHDELDKPLGKISIKQGGSPRGHNGVRSCIDCLQTDVMPRLRVGIGRPAGKSSVERHVLGRFSCEEKKVLDSVLLQSVD 226
>gi|33152133|ref|NP_873486.1| peptidyl-tRNA hydrolase [Haemophilus ducreyi 35000HP] >gi|33148355|gb|AAP95875.1| peptidyl-tRNA hydrolase [Haemophilus ducreyi 35000HP] (200 aa)
Score = 236, Expect = 1.4e-18, Identities = 64/182 (35%), Positives = 103/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNN-SKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG +YE T+HN G   ++EL + +   L + +K+ G+  K++     +++  P T+MN SG+ V  +  F++I  + IL+ +D++D   G  ++K  G  GG NG+K IIS + N     RIR+GIG P H   +  +VL+K + +D  K+  A+I     C E L         N+ N
  S:    12 LIVGLANPGAKYEGTRHNAGEWLVNELARMYNTSLKDEAKYFGKTAKINTVNGDVWLLIPTTFMNLSGKAVGALAHFFRIKAEEILIAHDELDLPPGVAKLKQGGGHGGHNGLKDIISALGNNNNFYRIRLGIGHPGHKDQVAGYVLSKPAPQDQQKI-NAVIDEASRCLEILFKDGVTSATNRLN 196
>gi|88861338|ref|ZP_01135968.1| peptidyl-tRNA hydrolase [Pseudoalteromonas tunicata D2] >gi|88816604|gb|EAR26429.1| peptidyl-tRNA hydrolase [Pseudoalteromonas tunicata D2] (189 aa)
Score = 236, Expect = 1.5e-18, Identities = 69/182 (37%), Positives = 104/182 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGL NPG EY KT+HN G   I+EL   +   L ++ K++G   K+   + +  +  P TYMN SG+ V  +  F+KI  +NILV +D++D   G  + K  G  GG NG+K II+KM N ++  R+R+GIG P H   +T  VL K S  +  ++  A+ +A   C E L      K  N+ +
  S:     1 MLVGLANPGPEYSKTRHNAGAWFIEELAARYNCILKHDPKYHGLTGKIFIQDQEFLLLIPTTYMNLSGKSVSALANFFKIPVENILVAHDEMDLPTGVAKFKRGGGHGGHNGLKDIIAKMANNKEFLRLRVGIGHPGHREMVTGWVLGKASKAEQEQMDAAVDEAV-RCMEILAKDGVLKAQNRLH 185
>gi|46576747|sp|Q7VMI1|PTH_HAEDU Peptidyl-tRNA hydrolase (PTH) (194 aa)
Score = 236, Expect = 1.7e-18, Identities = 64/182 (35%), Positives = 103/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNN-SKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG +YE T+HN G   ++EL + +   L + +K+ G+  K++     +++  P T+MN SG+ V  +  F++I  + IL+ +D++D   G  ++K  G  GG NG+K IIS + N     RIR+GIG P H   +  +VL+K + +D  K+  A+I     C E L         N+ N
  S:     6 LIVGLANPGAKYEGTRHNAGEWLVNELARMYNTSLKDEAKYFGKTAKINTVNGDVWLLIPTTFMNLSGKAVGALAHFFRIKAEEILIAHDELDLPPGVAKLKQGGGHGGHNGLKDIISALGNNNNFYRIRLGIGHPGHKDQVAGYVLSKPAPQDQQKI-NAVIDEASRCLEILFKDGVTSATNRLN 190
>gi|15612455|ref|NP_224108.1| peptidyl-tRNA hydrolase [Helicobacter pylori J99] >gi|7388027|sp|Q9ZJC3|PTH_HELPJ Peptidyl-tRNA hydrolase (PTH) >gi|4156010|gb|AAD06971.1| PEPTIDYL-TRNA HYDROLASE [Helicobacter pylori J99] (186 aa)
Score = 236, Expect = 1.9e-18, Identities = 70/183 (38%), Positives = 101/183 (55%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           L+VGLGNP L Y+ T+HN GF  +D L+ E  L F+ + K N              + KP TYMN SGE V     FYK  E  +L+++DD+D  +G ++ K  G +GG NG+KS I  + +    R+R+GI K + N+T HVL+KF   +      A   AK+A   F+   DF+   N+F +
  S:     3 LLVGLGNPTLRYDHTRHNAGFDILDSLVSELDLSFIFSPKHNAYLCVY----KDFILLKPQTYMNLSGESVLSAKNFYKTKE--LLIVHDDLDLPLGVVKFKKGGGNGGHNGLKS-IDALCSNSYYRLRVGISKGI-NITEHVLSKFHNNEEPLKNAAFEHAKNALKFFIESHDFNATQNRFTL 178
>gi|42629852|ref|ZP_00155397.1| COG0193: Peptidyl-tRNA hydrolase [Haemophilus influenzae R2846] >gi|145632641|ref|ZP_01788375.1| peptidyl-tRNA hydrolase [Haemophilus influenzae 3655] >gi|144986836|gb|EDJ93388.1| peptidyl-tRNA hydrolase [Haemophilus influenzae 3655] (194 aa)
Score = 235, Expect = 2.4e-18, Identities = 67/182 (36%), Positives = 103/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y  T+HN G   I+ L +   + LN  SKF G+  +      ++ +  P T+MN SG+ V  +  FY+I  + ILVI+D++D   G  ++K  G  GG NG+K I++++ N     R+RIGIG P H   +  +VL K S  D   +++ + +A D C E +      K  N+ N
  S:     6 LIVGLGNPGDKYTDTRHNAGEWLIERLARRFNVSLNPESKFFGKTARTLVNGKEVRLLVPTTFMNLSGKAVGALANFYRIKPEEILVIHDELDLPAGIAKLKQGGGHGGHNGLKDIVAQLGNNNNFYRLRIGIGHPGHRDLVAGYVLNKPSPADRNALEKVLDEATD-CVEMIFKDGMVKATNRLN 190
>gi|83595076|ref|YP_428828.1| peptidyl-tRNA hydrolase [Rhodospirillum rubrum ATCC 11170] >gi|119390994|sp|Q2RMV4|PTH_RHORT Peptidyl-tRNA hydrolase (PTH) >gi|83577990|gb|ABC24541.1| peptidyl-tRNA hydrolase [Rhodospirillum rubrum ATCC 11170] (243 aa)
Score = 234, Expect = 2.6e-18, Identities = 55/136 (40%), Positives = 80/136 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH 140
           LVVGLGNPG  Y   +HNVGFM +  L + H +     KF  Q         ++ +  P T+MN SG+ V E  +F+KI  ++I+V++D++D   GKI+VK  G +GG NGI+ I + +      R+R+GIG P H
  S:     3 LVVGLGNPGPRYAGNRHNVGFMAVAALARRHGIGPFRRKFQAQVADGQIAGARLLLLAPETFMNASGQAVGEAARFHKIAPEDIIVLHDELDLAPGKIKVKQGGGAGGHNGIRDIEAHLGP-AFWRVRLGIGHPGH 137
>gi|56476201|ref|YP_157790.1| peptidyl-tRNA hydrolase [Azoarcus sp. EbN1] >gi|68052887|sp|Q5P722|PTH_AZOSE Peptidyl-tRNA hydrolase (PTH) >gi|56312244|emb|CAI06889.1| peptidyl-tRNA hydrolase [Azoarcus sp. EbN1] (196 aa)
Score = 234, Expect = 2.7e-18, Identities = 62/161 (38%), Positives = 98/161 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKA 165
           LVVGLGNPG EY +T+HN GF   + L  K    F + S+F+G FV  +  +  +++  P TYMN SG+ V  + +FY+I    ILV++D++D   G++R+K  G  GG NG+K   + + T    R+RIGIG P   + + ++VL     E+  ++ +A+ +A
  S:     8 LVVGLGNPGAEYTETRHNAGFRFCERLADKLGVRFSHESRFHG-FV-ANARDAGVWLLMPQTYMNRSGQAVGALARFYRIAPAEILVVHDELDIPPGQLRLKFGGGLGGHNGLKDTSAHLATNDYWRLRIGIGHPGDRNEVVNYVLKPARREEQGQIDEALDRA 169
>gi|89073086|ref|ZP_01159625.1| peptidyl-tRNA hydrolase [Photobacterium sp. SKA34] >gi|89051039|gb|EAR56496.1| peptidyl-tRNA hydrolase [Photobacterium sp. SKA34] (196 aa)
Score = 234, Expect = 2.9e-18, Identities = 56/158 (35%), Positives = 90/158 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAI 162
           L+VGL NPG EY  T+HN G   ++EL + H + L  + K+ G   ++      + +  P T+MN SG+ V  +  F++I  + ILV +D++D   G  + K  G  GG NG++ II+KM N +   R+RI IG P   + +  +VL K  A++   +  A+
  S:     7 LLVGLANPGQEYANTRHNAGAWVVEELARVHNVTLRPDPKYFGLTGRITVNGQDLRLLIPSTFMNLSGKSVAALANFFQIKPEEILVAHDELDLPPGVAKFKKSGGHGGHNGLRDIINKMGNNKDFYRLRIAIGHPGDKNRVAGYVLGKAPAKEQELIDAAV 168
>gi|73540046|ref|YP_294566.1| peptidyl-tRNA hydrolase [Ralstonia eutropha JMP134] >gi|119390986|sp|Q476G1|PTH_RALEJ Peptidyl-tRNA hydrolase (PTH) >gi|72117459|gb|AAZ59722.1| peptidyl-tRNA hydrolase [Ralstonia eutropha JMP134] (199 aa)
Score = 234, Expect = 3.0e-18, Identities = 53/134 (39%), Positives = 82/134 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           L+VGLGNPG EYE T+HN GF  +D+L +   T      +F+G   +    +  I++ KP T+MN SG  V  + +FYKI    I+V +D++D   G  ++K  G +GG NG+K I + + T++  R+R+G+G P
  S:     4 LIVGLGNPGAEYEATRHNAGFWLVDQLARMGGTTLRVEGRFHGLAGRARLWDQDIWLLKPSTFMNRSGLAVVSLARFYKILPDEIVVAHDEMDLPPGAAKLKRGGGAGGHNGLKDIAAHLTTQEFWRLRLGVGHP 138
>gi|33239733|ref|NP_874675.1| peptidyl-tRNA hydrolase [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|46576740|sp|Q7VDT7|PTH_PROMA Peptidyl-tRNA hydrolase (PTH) >gi|33237258|gb|AAP99327.1| Peptidyl-tRNA hydrolase [Prochlorococcus marinus subsp. marinus str. CCMP1375] (204 aa)
Score = 234, Expect = 3.2e-18, Identities = 64/168 (38%), Positives = 96/168 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN-------LTHHVLTKFSAEDS---IKVQQAIIKAKDACNEF 172
           L+ GLGNPG +Y  T+HNVGFM ++ L K+ ++ F  N K  G    ++   ++  +  P TYMN SG  +    K++ +    IL+  DD+D  +GK+R +  G SGG NG+K II  + ++   R+RIGIG P  N          HVL KF   +S    KV   +IK  +   ++
  S:     8 LLAGLGNPGSKYTSTRHNVGFMALERLAKKESVQFAMNKKIFGHIANIEIGANKRKLLMPNTYMNESGRSISAAIKWFDLEINQILIFVDDMDLPLGKLRFREGGGSGGHNGLKDIIKHLGSQDFCRLRIGIGPPSINQGDRKQKTIPHVLGKFDQAESKVITKVLDKVIKGLEVIEQY 186
>gi|113866400|ref|YP_724889.1| peptidyl-tRNA hydrolase [Ralstonia eutropha H16] >gi|123033305|sp|Q0KEQ0|PTH_RALEH Peptidyl-tRNA hydrolase (PTH) >gi|113525176|emb|CAJ91521.1| Peptidyl-tRNA hydrolase [Ralstonia eutropha H16] (198 aa)
Score = 233, Expect = 3.9e-18, Identities = 62/169 (36%), Positives = 99/169 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH----------NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFL 173
           L+VGLGNPG EYE T+HN GF  +D+L +     +    +F+G   +    +  I++ KP T+MN SG  V  + +FYK+    I+V +D++D   G  ++K  G +GG NG+K I + ++T+   R+R+G+G P +          ++ + VL     E+    Q+AI  A D C E L
  S:     4 LIVGLGNPGAEYEATRHNAGFWLVDQLARMGGATMRVEGRFHGLAARARLWDQDIWLLKPSTFMNRSGLAVVSLARFYKVLPDEIVVAHDEMDLPAGAAKLKRGGGAGGHNGLKDISAHLSTQDYWRLRLGVGHPRNAPGGAGAGREDVVNFVLKPPRREE----QEAIDAAIDRCIEPL 179
>gi|90416945|ref|ZP_01224874.1| peptidyl-tRNA hydrolase [marine gamma proteobacterium HTCC2207] >gi|90331292|gb|EAS46536.1| peptidyl-tRNA hydrolase [marine gamma proteobacterium HTCC2207] (195 aa)
Score = 230, Expect = 8.3e-18, Identities = 60/161 (37%), Positives = 91/161 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNN-SKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKA 165
           L+VGLGNPG  Y++T+HN G   + EL K  +  L + SKF G   K+      + +  P T+MN SG+ V  + +FY++  + ILV++D++D   G  R K  G  GG NG++ I+  + N +   R+RIGIG P     +  +VL K S  D   +  +I  A
  S:     7 LIVGLGNPGPNYDRTRHNAGADLVLELAKSCSGTLKHESKFFGDTAKITIDNRDVRLLIPTTFMNRSGQSVAALARFYQVPVEAILVVHDELDISPGAARFKKGGGHGGHNGLRDIVQSLANNKNFARLRIGIGHPGDARQVADYVLKKASPSDQQLISNSIDDA 171
>gi|50842020|ref|YP_055247.1| peptidyl-tRNA hydrolase [Propionibacterium acnes KPA171202] >gi|68052928|sp|Q6AAC7|PTH_PROAC Peptidyl-tRNA hydrolase (PTH) >gi|50839622|gb|AAT82289.1| peptidyl-tRNA hydrolase [Propionibacterium acnes KPA171202] (200 aa)
Score = 230, Expect = 8.3e-18, Identities = 50/135 (37%), Positives = 81/135 (60%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKE----------HTLFLNNSKFNGQFVKVDQPEDQ-IFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           +LV+GLGNPG  Y+ T+HNVG   I EL +               L  ++ +   + V   + Q + + +  TYMN SG  V ++  F  I   +++V++D+ID D G++R+K  G   G NG+KSI + + T    R+R+G+G+P
  S:     5 WLVIGLGNPGPRYDGTRHNVGADVIAELCRRAGEKLSPARGQRAELVRTRLSSAGLGVPAVDAQTVILMRSRTYMNESGIAVSKVASFAGITPDHLIVVHDEIDLDPGRLRLKKGGGDNGHNGLKSIRAHLRTGDFIRVRLGVGRP 150
>gi|92113646|ref|YP_573574.1| peptidyl-tRNA hydrolase [Chromohalobacter salexigens DSM 3043] >gi|119390925|sp|Q1QXD3|PTH_CHRSD Peptidyl-tRNA hydrolase (PTH) >gi|91796736|gb|ABE58875.1| peptidyl-tRNA hydrolase [Chromohalobacter salexigens DSM 3043] (194 aa)
Score = 230, Expect = 8.5e-18, Identities = 55/157 (35%), Positives = 88/157 (56%)
  Q:     6 VVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEK-IKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAI 162
           ++GLGNPG EY+ T+HN G   ++ L ++  T      KF GQ+ KV      + +  P TYMN SG+ V  +C+F+K+    +L+ +D++D   G  R K  G  GG NG++  +S +  +K   R+RIGIG P     + ++VL +    +   +  AI
  S:     7 IIGLGNPGTEYDATRHNAGAWVVEALARDSLTPLRAERKFLGQYAKVRYAGHDVHLLVPSTYMNRSGKAVAALCQFFKLTPDELLIAHDELDIAPGTARYKHGGGHGGHNGLRDTVSALGNDKSFHRLRIGIGHPGSAKQVVNYVLGRPGKAERAAIDAAI 167
>gi|67458745|ref|YP_246369.1| peptidyl-tRNA hydrolase [Rickettsia felis URRWXCal2] >gi|75536798|sp|Q4UMK4|PTH_RICFE Peptidyl-tRNA hydrolase (PTH) >gi|67004278|gb|AAY61204.1| Peptidyl-tRNA hydrolase [Rickettsia felis URRWXCal2] (185 aa)
Score = 229, Expect = 1.0e-17, Identities = 63/158 (39%), Positives = 94/158 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAI 162
           LV+GLGNPG EY+ T+HN+GF+ I+++  ++ + F    KFN +  +      +I   KP TYMN SG+ V  +  +Y I    I VI+DDID + G+I+ K  G +GG NG+KSI   +      RIR+G+G+P +N  +  +VL  F   +     QAI
  S:     3 LVIGLGNPGKEYQYTRHNIGFIAIEKIANQYNSSFSIKKKFNCEIAETISDGQKIIFIKPTTYMNLSGKSVISVKTYYNIQSAKIFVIHDDIDLETGRIKFKTGGGNGGHNGLKSIDGVIGN-NYNRIRVGVGRPQNNQDVADYVLNNFLKSEYETALQAI 162
>gi|113460649|ref|YP_718715.1| peptidyl-tRNA hydrolase [Haemophilus somnus 129PT] >gi|119390947|sp|Q0I248|PTH_HAES1 Peptidyl-tRNA hydrolase (PTH) >gi|112822692|gb|ABI24781.1| peptidyl-tRNA hydrolase [Haemophilus somnus 129PT] (194 aa)
Score = 229, Expect = 1.0e-17, Identities = 66/182 (36%), Positives = 102/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y  T+HN G   I+ L +     L+  SKF+G+  +      ++    P T+MN SG+ V  +  FY+I  + ILV++D++D   G  ++K  G  GG NG+K II+++ N +   R+RIGIG P     +  +VL K S  D   + +++ +A D C E L      K  N+ N
  S:     6 LIVGLGNPGDKYADTRHNAGEWLIERLARRFNFNLSVESKFSGKTARAVISGQEMRFLVPTTFMNLSGKAVSALANFYRIPPEQILVLHDELDFSPGIAKIKQGGGHGGHNGLKDIIAQLANNKNFYRLRIGIGHPGDKNLVASYVLNKPSPTDRQLIDRSLEEATD-CIEILMKEGITKATNRLN 190
>gi|50085940|ref|YP_047450.1| peptidyl-tRNA hydrolase [Acinetobacter sp. ADP1] >gi|68052955|sp|Q6F8I7|PTH_ACIAD Peptidyl-tRNA hydrolase (PTH) >gi|49531916|emb|CAG69628.1| peptidyl-tRNA hydrolase [Acinetobacter sp. ADP1] (193 aa)
Score = 228, Expect = 1.3e-17, Identities = 65/162 (40%), Positives = 96/162 (59%)
  Q:     1 MSKY-LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQ-IFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAI 162
           MSK  L+VGLGNPG EY +T+HN GF  +++L   + + L  + KF+G F    Q E   + +  P T+MN SG+ V    KFY+I  + IL+ +D++D D G IR+K  G  GG NG++ I+  +      R+RIGIG P     ++ HVL K    +   ++ AI
  S:     1 MSKISLIVGLGNPGAEYAQTRHNAGFWFVEQLADRYNITLKKDPKFHG-FSGRGQIEGHDVRLLIPTTFMNRSGQSVVPFSKFYQISPEAILIAHDELDMDPGVIRLKTGGGHGGHNGLRDIVPHIGA-NFHRLRIGIGHPGSKDRVSGHVLGKAPQNEQTLMEDAI 165
>gi|27363739|ref|NP_759267.1| peptidyl-tRNA hydrolase [Vibrio vulnificus CMCP6] >gi|27359855|gb|AAO08794.1|AE016797_249 Peptidyl-tRNA hydrolase [Vibrio vulnificus CMCP6] (222 aa)
Score = 228, Expect = 1.4e-17, Identities = 55/136 (40%), Positives = 84/136 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNN-SKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVH 140
           L+VGL NPG EY KT+HN G   ++EL + H + L N +KF G   ++     ++ +  P T+MN SG+ +  + KFY+I  + I+V +D++D   G  + K  G  GG NG++  ISK+ N ++  R+RIGIG P H
  S:    33 LLVGLANPGPEYAKTRHNAGAWVVEELARVHNITLKNEAKFYGLTGRIVMNGQELRLLIPTTFMNLSGKAIAALAKFYQIQPEEIMVAHDELDLPPGIAKFKKGGGHGGHNGLRDTISKLGNNKEFYRLRIGIGHPGH 170
>gi|37679109|ref|NP_933718.1| peptidyl-tRNA hydrolase [Vibrio vulnificus YJ016] >gi|37197851|dbj|BAC93689.1| Peptidyl-tRNA hydrolase [Vibrio vulnificus YJ016] (211 aa)
Score = 227, Expect = 1.6e-17, Identities = 55/136 (40%), Positives = 84/136 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNN-SKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVH 140
           L+VGL NPG EY KT+HN G   ++EL + H + L N +KF G   ++     ++ +  P T+MN SG+ +  + KFY+I  + I+V +D++D   G  + K  G  GG NG++  ISK+ N ++  R+RIGIG P H
  S:    22 LLVGLANPGPEYAKTRHNAGAWVVEELARVHNITLKNEAKFYGLTGRIVMNGQELRLLIPTTFMNLSGKAIAALAKFYQIQPEEIMVAHDELDLPPGIAKFKKGGGHGGHNGLRDTISKLGNNKEFYRLRIGIGHPGH 159
>gi|31340303|sp|Q8DFF4|PTH_VIBVU Peptidyl-tRNA hydrolase (PTH) >gi|46576704|sp|Q7MMZ2|PTH_VIBVY Peptidyl-tRNA hydrolase (PTH) (196 aa)
Score = 227, Expect = 1.7e-17, Identities = 55/136 (40%), Positives = 84/136 (61%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNN-SKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVH 140
           L+VGL NPG EY KT+HN G   ++EL + H + L N +KF G   ++     ++ +  P T+MN SG+ +  + KFY+I  + I+V +D++D   G  + K  G  GG NG++  ISK+ N ++  R+RIGIG P H
  S:     7 LLVGLANPGPEYAKTRHNAGAWVVEELARVHNITLKNEAKFYGLTGRIVMNGQELRLLIPTTFMNLSGKAIAALAKFYQIQPEEIMVAHDELDLPPGIAKFKKGGGHGGHNGLRDTISKLGNNKEFYRLRIGIGHPGH 144
>gi|66814068|ref|XP_641213.1| hypothetical protein DDBDRAFT_0205243 [Dictyostelium discoideum AX4] >gi|60469238|gb|EAL67233.1| hypothetical protein DDBDRAFT_0205243 [Dictyostelium discoideum AX4] (452 aa)
Score = 227, Expect = 1.9e-17, Identities = 51/110 (46%), Positives = 74/110 (67%)
  Q:    56 DQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKA 165
           +Q+ + KPMTYMN SG  +  I + Y +  QNILV+ DDI TD+G I+++ KG S GQ GI+S+IS++ TEK  RI+ G+G P      ++ VL KFS E    ++++I KA
  S:   320 NQVILLKPMTYMNASGNPLRTIQQKYNVPLQNILVLVDDISTDIGVIKMRTKGGSAGQKGIESVISRLGTEKFSRIKFGVGVPNAGEIRSNFVLKKFSREKEHLLKESIDKA 431
Score = 104, Expect = 3.5e-03, Identities = 18/30 (60%), Positives = 24/30 (80%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDEL 31
           ++Y++VGLGNPG EY  T+HN+GF  ID L
  S:   164 NRYIIVGLGNPGTEYVNTRHNIGFSAIDHL 193
>gi|160871789|ref|ZP_02061921.1| peptidyl-tRNA hydrolase [Rickettsiella grylli] >gi|159120588|gb|EDP45926.1| peptidyl-tRNA hydrolase [Rickettsiella grylli] (198 aa)
Score = 226, Expect = 2.1e-17, Identities = 60/168 (35%), Positives = 89/168 (52%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL--FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEF 172
           L+ GL NPG +Y K++HN G   I+ LL++  L      +KF+           + +I  P T+MN SG  +  I  FY I    IL+++DD+D   G  R K  G  GG NG+K I+  + ++   R+R+GIG P H   + H+VL+  S  D  ++ QAI  A      F
  S:     8 LIAGLANPGKDYAKSRHNAGAWLIETLLQQRDLTPLKRENKFHALISAWSLSAVKCWILIPTTFMNESGRAIKAIAHFYHIPVSAILIVHDDLDLLPGIARYKHGGGDGGHNGLKDIMRHLQSKDFWRLRLGIGHPGHRDKVHHYVLSSPSIADKQRINQAIEDANSTLRLF 179
>gi|89094726|ref|ZP_01167661.1| peptidyl-tRNA hydrolase [Oceanospirillum sp. MED92] >gi|89080980|gb|EAR60217.1| peptidyl-tRNA hydrolase [Oceanospirillum sp. MED92] (198 aa)
Score = 226, Expect = 2.1e-17, Identities = 66/182 (36%), Positives = 102/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHV---DFDKIMNKFN 186
           L+VGLGNPG +Y +T+HN G   +++L   H   L    K++G + +       I +  P T+MN SG+ V  +  FYKI  Q ILV +D++D   G  + K  G  GG NG++ IISK+ N +   R+R+GIG P H+  ++  VL K   ++    + A + A D    +L      D+ K MN+ +
  S:     9 LIVGLGNPGDKYAQTRHNAGAEFVEQLAARHLAPLKPEKKYHGLYSRAQIGGQTIHLLVPTTFMNLSGQAVAALANFYKIPPQEILVAHDELDLPPGIAKFKQGGGHGGHNGLRDIISKLGNNKNFYRLRLGIGHPGHSSQVSGFVLKKAPNKE----RDATMAALDEAERYLELAISGDWGKAMNQLH 193
>gi|170718048|ref|YP_001785087.1| aminoacyl-tRNA hydrolase [Haemophilus somnus 2336] >gi|189038153|sp|B0UVY6|PTH_HAES2 Peptidyl-tRNA hydrolase (PTH) >gi|168826177|gb|ACA31548.1| Aminoacyl-tRNA hydrolase [Haemophilus somnus 2336] (194 aa)
Score = 226, Expect = 2.3e-17, Identities = 66/182 (36%), Positives = 101/182 (55%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y  T+HN G   I+ L +     L+  SKF+G+  +      ++    P T+MN SG+ V  +  FY+I  + ILV++D++D   G  ++K  G  GG NG+K II+++ N +   R+RIGIG P     +  +VL K S  D   + + + +A D C E L      K  N+ N
  S:     6 LIVGLGNPGDKYADTRHNAGEWLIERLARRFNFNLSVESKFSGKTARAVISGQEMRFLVPTTFMNLSGKAVSALANFYRIPPEQILVLHDELDLPPGIAKLKQGGGHGGHNGLKDIIAQLANNKNFYRLRIGIGHPGDKNLVASYVLNKPSPTDWQLIDRTLDEATD-CIEILMKEGITKATNRLN 190
>gi|57241440|ref|ZP_00369386.1| peptidyl-tRNA hydrolase [Campylobacter lari RM2100] >gi|57017776|gb|EAL54552.1| peptidyl-tRNA hydrolase [Campylobacter lari RM2100] (156 aa)
Score = 225, Expect = 3.5e-17, Identities = 63/162 (38%), Positives = 94/162 (58%)
  Q:    26 MCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           M ID LLK+     L+N+KF G+  K        F  KP TYMN SGE V  +  FYK     I+VI+DDID ++G ++ K  GSSGG NG+KS I  +     +R+RIG+GK   ++  HVL KF  E+   + + + +AK A  E L   + +++ +K+++
  S:     1 MLIDLLLKDLEVAKLSNTKFKGELFK----SSLAFFLKPSTYMNLSGESVKAVSDFYKC--DRIIVIHDDIDLNLGTLKFKIGGSSGGHNGLKS-IDNLCGNAYERVRIGVGKD-QDVISHVLGKFKQEEQESLNKVLEQAKKALFELLKS-NIEQVASKYSI 154
>gi|187608018|ref|NP_001119866.1| hypothetical protein LOC559192 [Danio rerio] >gi|122890585|emb|CAM14093.1| novel protein similar to human and mouse peptidyl-tRNA hydrolase 1 homolog (S. cerevisiae) (PTRH1; zgc:112961) [Danio rerio] (266 aa)
Score = 224, Expect = 3.6e-17, Identities = 54/171 (31%), Positives = 98/171 (57%)
  Q:     3 KYLVVGLGNPGLEYEKTKHNVGFMCIDEL---LKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFL 173
           + +VVGLGNPG+    ++H+VG   +  L   L     + ++ K +G+ V     + Q+ + +P   MN +G  V +    Y I  ++IL+I+D++D  +GK  +K  GS+ G NG++S +  + T+ + R+RIGIG+P     +  +VL +FS E+   +   I ++ D   ++L
  S:    56 RKMVVGLGNPGMT--GSRHSVGMAVLTTLAERLGAPDGWRSDRKVSGEVVVTQLQDVQLVLLRPKLLMNVNGVSVAKAASRYLIQPEHILLIHDELDKPLGKFGIKHGGSARGHNGVRSCVDCLQTDVMPRLRIGIGRPSDKTPIDRYVLGRFSKEEQNVLDSVIKQSLDVLLDYL 229
>gi|94676649|ref|YP_588743.1| peptidyl-tRNA hydrolase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|119390913|sp|Q1LTH1|PTH_BAUCH Peptidyl-tRNA hydrolase (PTH) >gi|94219799|gb|ABF13958.1| peptidyl-tRNA hydrolase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (193 aa)
Score = 224, Expect = 3.7e-17, Identities = 56/164 (34%), Positives = 91/164 (55%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIK 164
           M+  L+VGL NPG +Y  T+HNVG   +++L    H   +N S F G    ++  + +IF+  P  +MN +G+ V  I KFY I  + IL+ +D+++   G  R K  G  GG NG+K +I ++ +     R+RIGIG P      + + KF  +  +  +Q +I+
  S:     1 MTIKLIVGLANPGNKYLLTRHNVGSWYVNQLANNYHVSLINKSSFLGYTGYLNIGKRRIFLLIPTIFMNYNGQAVAAIAKFYNIMPEEILIAHDELNFLPGYARFKYSGGHGGHNGLKDVIYRLGDNNNFYRLRIGIGHPGDK---NKVIKFVLDTPLDTEQQLIQ 163
>gi|34540028|ref|NP_904507.1| peptidyl-tRNA hydrolase [Porphyromonas gingivalis W83] >gi|46576708|sp|Q7MXK9|PTH_PORGI Peptidyl-tRNA hydrolase (PTH) >gi|34396339|gb|AAQ65406.1| peptidyl-tRNA hydrolase [Porphyromonas gingivalis W83] (185 aa)
Score = 224, Expect = 4.4e-17, Identities = 49/134 (36%), Positives = 76/134 (56%)
  Q:     3 KYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIG 136
           KYL+VGLGN G EY  T+HNVGF  ++ L ++  +    +++ G   ++     ++ + KP TYMN SG  V    +   I  + +LV+ DD+    G +R+K KGS  G NG+K+I   M +    R+R G+G
  S:     2 KYLIVGLGNIGGEYNGTRHNVGFRMVNALAEDGGVQFVEARY-GAIARMRVKNAELILLKPNTYMNLSGNAVRYWMQQENIPREQVLVLVDDLALPFGTLRLKPKGSDAGHNGLKNIAEVMGSIDYARLRFGLG 134
>gi|61651816|ref|NP_001013348.1| peptidyl-tRNA hydrolase 1 homolog [Danio rerio] >gi|60416153|gb|AAH90788.1| Peptidyl-tRNA hydrolase 1 homolog (S. cerevisiae) [Danio rerio] >gi|182890234|gb|AAI65428.1| Ptrh1 protein [synthetic construct] (230 aa)
Score = 223, Expect = 4.8e-17, Identities = 55/171 (32%), Positives = 100/171 (58%)
  Q:     3 KYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEH----TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFL 173
           + +VVGLGNPG+    ++H+VG M +   L EH      + ++ K +G+ V     + Q+ + +P   MN +G  V +    Y I  ++IL+I+D++D  +GK  +K  GS+ G NG++S +  + T+ + R+RIGIG+P     +  +VL +FS E+   +   + ++ D   ++L
  S:    20 RKMVVGLGNPGMT--GSRHSVG-MAVLTTLAEHLGAPDGWRSDRKVSGEVVVTQLQDVQLVLLRPKLLMNVNGVSVAKAASRYLIPPEHILLIHDELDKPLGKFGIKHGGSARGHNGVRSCVDCLQTDVMPRLRIGIGRPSDKTPIDRYVLGRFSKEEQNVLDSVMKQSLDVLLDYL 193
>gi|152979077|ref|YP_001344706.1| peptidyl-tRNA hydrolase [Actinobacillus succinogenes 130Z] >gi|171704338|sp|A6VP74|PTH_ACTSZ Peptidyl-tRNA hydrolase (PTH) >gi|150840800|gb|ABR74771.1| Aminoacyl-tRNA hydrolase [Actinobacillus succinogenes 130Z] (194 aa)
Score = 222, Expect = 6.2e-17, Identities = 65/182 (35%), Positives = 100/182 (54%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNN-SKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y  T+HN G   ID L +     L + +KF G+  +      +I    P T+MN SG+ +  +  FY+I  + IL+ +D++D   G +++K  G  GG NG+K  I+++ N +   R+RIGIG P     +T +VL K S  D   + +A+ +A   C E L      K  N+ N
  S:     6 LIVGLGNPGDKYADTRHNAGEWLIDRLSRRFNFTLKDEAKFFGKTARTVIDGHEIRFLVPATFMNLSGKAIGALASFYRIRPEEILLAHDELDLPPGTVKIKQGGGHGGHNGLKDTIAQLGNNKNFYRLRIGIGHPGDRNLVTSYVLGKPSPADWALIDKALDEAV-VCVEILLKDGITKATNRLN 190
>gi|77959384|ref|ZP_00823404.1| COG0193: Peptidyl-tRNA hydrolase [Yersinia bercovieri ATCC 43970] (196 aa)
Score = 222, Expect = 6.5e-17, Identities = 68/182 (37%), Positives = 101/182 (55%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY +T+HN G   +D L + H   L   +KF G   +++     + +  P T+MN SG+ V  +  FY+I  + ILV +D++D   G  ++K  G +GG NG+K I SK+ N     R+RIGIG P     +   VL K  A + + + +AI +A   C E L   D  K MN+ +
  S:     6 LIVGLANPGAEYAQTRHNAGAWYVDLLAERHNQSLKEEAKFFGYTARLNLAGQDVRLLVPSTFMNLSGKAVVAMAGFYRIQPEEILVAHDELDIPPGAAKLKLGGGNGGHNGLKDIQSKLGNNPNFYRLRIGIGHPGDKSKVVGFVLGKPPASEQLLIDEAIDEAI-RCTEVLMKEDITKAMNRLH 190
>gi|91792179|ref|YP_561830.1| peptidyl-tRNA hydrolase [Shewanella denitrificans OS217] >gi|119391002|sp|Q12R19|PTH_SHEDO Peptidyl-tRNA hydrolase (PTH) >gi|91714181|gb|ABE54107.1| Aminoacyl-tRNA hydrolase [Shewanella denitrificans OS217] (195 aa)
Score = 222, Expect = 7.5e-17, Identities = 66/182 (36%), Positives = 102/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEK-IKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY +T+HN G   + EL +  +   +  SK+ G   +       + +  P T+MN SG+ V  +  F++I  + ILV +D++D + G  + K  G  GG NG+K II++M  +K   R+RIGIG P   + ++ +VL K  A +  K+  AI +A  A  E L   D  K MN+ +
  S:     6 LIVGLANPGAEYAQTRHNAGAWYVHELARVCNVTLVPESKYYGLAARATLHGRDVRLLIPATFMNLSGKSVAALANFFRILPEEILVAHDELDIEPGVAKFKLGGGHGGHNGLKDIIAQMGNDKGFHRLRIGIGHPGDKNKVSGYVLGKAPASEQEKMDAAIDEAVRA-TEILFKQDMVKAMNRLH 190
>gi|52424611|ref|YP_087748.1| peptidyl-tRNA hydrolase [Mannheimia succiniciproducens MBEL55E] >gi|68052916|sp|Q65V47|PTH_MANSM Peptidyl-tRNA hydrolase (PTH) >gi|52306663|gb|AAU37163.1| Pth protein [Mannheimia succiniciproducens MBEL55E] (194 aa)
Score = 221, Expect = 8.8e-17, Identities = 64/182 (35%), Positives = 103/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNN-SKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y  T+HN G   ++ L +     L + +KF G+  +     +++    P T+MN SG+ V  +  FY+I  + ILVI+D++D   G  ++K  G  GG NG+K  I+++ N +   R+RIGIG P     ++ +VL+K S  D   + +A+ +A  +C E L      K  N+ N
  S:     6 LIVGLGNPGDKYADTRHNAGEWLVERLARRFNFNLKDEAKFFGKTARAVIGGEEVRFLIPTTFMNLSGKAVGALATFYRIKPEEILVIHDELDLPPGVAKIKQGGGHGGHNGLKDTIAQLANNKNFYRLRIGIGHPGDKNLVSAYVLSKPSPIDRSAIDKALDEAA-SCMEILLKDGITKATNRLN 190
>gi|15642183|ref|NP_231815.1| peptidyl-tRNA hydrolase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121730803|ref|ZP_01682882.1| peptidyl-tRNA hydrolase [Vibrio cholerae V52] >gi|147675550|ref|YP_001217700.1| peptidyl-tRNA hydrolase [Vibrio cholerae O395] >gi|172047626|sp|A5F686|PTH_VIBC3 Peptidyl-tRNA hydrolase (PTH) >gi|14195083|sp|Q9KQ21|PTH_VIBCH Peptidyl-tRNA hydrolase (PTH) >gi|9656739|gb|AAF95329.1| peptidyl-tRNA hydrolase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121627624|gb|EAX60305.1| peptidyl-tRNA hydrolase [Vibrio cholerae V52] >gi|146317433|gb|ABQ21972.1| peptidyl-tRNA hydrolase [Vibrio cholerae O395] (196 aa)
Score = 221, Expect = 9.9e-17, Identities = 64/182 (35%), Positives = 100/182 (54%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNS-KFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY KT+HN G   ++EL + H + L N  KF G   ++     ++ +  P T+MN SG+ +  +  FY+I  + I+V +D++D   G  + K  G  GG NG+K  ISK+ N ++  R+R+GIG P H   +  +VL K  A++  +   A +     C E L      K  N+ +
  S:     7 LLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELDLPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHKDKVAGYVLGKAPAKEQ-ECLDAAVDESVRCLEILMKDGLTKAQNRLH 191
>gi|145593349|ref|YP_001157646.1| aminoacyl-tRNA hydrolase [Salinispora tropica CNB-440] >gi|145302686|gb|ABP53268.1| peptidyl-tRNA hydrolase [Salinispora tropica CNB-440] (196 aa)
Score = 220, Expect = 1.0e-16, Identities = 51/135 (37%), Positives = 81/135 (60%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPED-----QIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           +LVVGLGNPG +Y   +HNVGF+  D L+    L     +      +V +        ++ + KP+TYMN SG  V  + +FYK+    ++ +YD++D   G++RVK  G  GG NG++S+   + T++  R+R GIG+P
  S:     8 WLVVGLGNPGRQYAGNRHNVGFLVADLLVGR--LGARFGRHKRAMAEVAEGRSGLGGPRLVLVKPLTYMNLSGAAVAGLAQFYKVPPARVVAVYDELDIPYGQVRVKFGGGEGGHNGLRSMTKSLGTKEYARVRFGIGRP 145
>gi|119775704|ref|YP_928444.1| peptidyl-tRNA hydrolase [Shewanella amazonensis SB2B] >gi|166229449|sp|A1S8R8|PTH_SHEAM Peptidyl-tRNA hydrolase (PTH) >gi|119768204|gb|ABM00775.1| Aminoacyl-tRNA hydrolase [Shewanella amazonensis SB2B] (195 aa)
Score = 220, Expect = 1.0e-16, Identities = 66/182 (36%), Positives = 103/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY +T+HN G   ++EL +   + L  + K+ G   +       + +  P T+MN SG+ V  +  F++I  + ILV +D++D + G  R K  G  GG NG+K II+KM N +   R+RIGIG P   + ++ +VL K  A +  K+  AI +A  +  E L   D  K M++ +
  S:     6 LIVGLANPGAEYAQTRHNAGAWYVEELARIANVSLAPDPKYFGLTARAILCGKDVRLLIPSTFMNLSGKSVAALANFFRIEPEQILVAHDELDMEPGVARFKLGGGHGGHNGLKDIIAKMGNNKNFYRLRIGIGHPGDKNKVSGYVLGKAPATEQEKMNAAIDEAVRS-TEILFKQDMTKAMHRLH 190
>gi|15602029|ref|NP_245101.1| peptidyl-tRNA hydrolase [Pasteurella multocida subsp. multocida str. Pm70] >gi|13431784|sp|P57820|PTH_PASMU Peptidyl-tRNA hydrolase (PTH) >gi|12720383|gb|AAK02248.1| Pth [Pasteurella multocida subsp. multocida str. Pm70] (194 aa)
Score = 220, Expect = 1.2e-16, Identities = 63/182 (34%), Positives = 103/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGLGNPG +Y  T+HN G   I+ L ++ H      SKF+G+  +     ++I    P T+MN SG+ +  +  FY+I  + ILVI+D++D   G  ++K  G  GG NG++  I+++ N +   R+R+GIG P     ++ +VL K S  D   + +A+ +A  +C + L      K  N+ N
  S:     6 LIVGLGNPGDKYADTRHNAGEWLINRLARQFHFSLTPESKFSGKTARTVINGNEIRFLVPTTFMNLSGKAISSLANFYRIKPEEILVIHDELDLPPGVAKIKQGGGHGGHNGLRDTIAQLGNNKNFYRLRVGIGHPGDKNLVSAYVLNKPSLTDWQLIDKALDEAT-SCVDILIKDGITKATNRLN 190
>gi|62424034|ref|ZP_00379186.1| COG0193: Peptidyl-tRNA hydrolase [Brevibacterium linens BL2] (199 aa)
Score = 219, Expect = 1.4e-16, Identities = 60/170 (35%), Positives = 91/170 (53%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKF----------NGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFL 173
           +LV GLGNPG +YE T+HN+G M I EL     + L  +K            G    V  P  ++ +A    YMN SG  V ++  FY I    I+ ++DD+D     I+ K  G  GG NG++S+ S + T+   RIR G+G+P+   +   +VL  FS ++   +   I    DA   ++
  S:     6 WLVFGLGNPGPKYETTRHNIGQMVIAELAHRIGVNLTRTKLRSNVGTSRLPTGSIPGVPGP--RVVLATSTGYMNESGGPVRQLADFYSIDTDRIIAVHDDVDIPYDTIKAKVGGGEGGHNGLRSMTSALGTKNYPRIRAGVGRPLGRQDTADYVLKPFSKDERATLPIFISDIADAVEMYI 185
>gi|109948224|ref|YP_665452.1| peptidyl-tRNA hydrolase [Helicobacter acinonychis str. Sheeba] >gi|123066069|sp|Q17V73|PTH_HELAH Peptidyl-tRNA hydrolase (PTH) >gi|109715445|emb|CAK00453.1| pth [Helicobacter acinonychis str. Sheeba] (186 aa)
Score = 219, Expect = 1.5e-16, Identities = 71/183 (38%), Positives = 103/183 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIK-AKDACNEFLNHVDFDKIMNKFNV 187
           L+VGLGNP L Y  T+HNVGF  +D L+    L F  + K N              + KP TYMN SGE V     FYK  E  +L+++DD+D  +G ++ K  G +GG NG+KS I  + +    R+R+GI K   N T HVL+KF+ E+   ++ A+ + AK+A   F+   DF+ + N F +
  S:     3 LLVGLGNPTLRYAHTRHNVGFDILDSLVSGLNLSFTFSPKHNAHLCIY----KDFILLKPQTYMNLSGESVLSTKNFYKPKE--LLIVHDDLDLPLGVVKFKNGGGNGGHNGLKS-IDALCSNAYYRLRVGISKGT-NATEHVLSKFN-ENEEPLKNAVFEHAKNALKFFIECNDFNAMCNHFTL 178
>gi|108563841|ref|YP_628157.1| peptidyl-tRNA hydrolase [Helicobacter pylori HPAG1] >gi|119390949|sp|Q1CRD9|PTH_HELPH Peptidyl-tRNA hydrolase (PTH) >gi|107837614|gb|ABF85483.1| peptidyl-tRNA hydrolase [Helicobacter pylori HPAG1] (186 aa)
Score = 219, Expect = 1.7e-16, Identities = 67/183 (36%), Positives = 98/183 (53%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFNV 187
           L+VGLGNP L Y  T+HN GF  +D L+ E  L    S  +   + V +      + KP TYMN SGE V     FYK  E  +L+++DD+D  +G +R K  G +GG NG+KS I  + +    R+R+GI K +  +  HVL+KF   +          AK+A   F+   DF+ + N+F +
  S:     3 LLVGLGNPTLRYAHTRHNAGFDILDSLVSELDLSFTFSPKHNACLCVYK---DFILLKPQTYMNLSGESVLSTKNFYKPKE--LLIVHDDLDLPLGVVRFKNGGGNGGHNGLKS-IDLLCSNSYYRLRVGISKGI-GVIEHVLSKFHKNEEPLKNAVFEHAKNALKFFIESHDFNAMQNRFTL 178
>gi|116669781|ref|YP_830714.1| peptidyl-tRNA hydrolase [Arthrobacter sp. FB24] >gi|166199303|sp|A0JU94|PTH_ARTS2 Peptidyl-tRNA hydrolase (PTH) >gi|116609890|gb|ABK02614.1| peptidyl-tRNA hydrolase [Arthrobacter sp. FB24] (194 aa)
Score = 219, Expect = 1.7e-16, Identities = 50/135 (37%), Positives = 81/135 (60%)
  Q:     4 YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVK----VDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP 138
           +L+VGLGNPG EY   +HNVG M +DEL +         K     ++    +  P  ++ +AKPM+YMN SG  V  + KFY I  ++++ ++D+ID     +++K  G  GG NG++ I   + T+   R+R+G+G+P
  S:     5 WLIVGLGNPGTEYSNNRHNVGQMVLDELARRVGGSFKVHKARAHVLEGRLGIGGP--RVVLAKPMSYMNVSGGPVSALSKFYDIDPEHVVAVHDEIDIPFNTVKLKIGGGEGGHNGLRDISKALATKDYLRVRVGVGRP 141
>gi|28897512|ref|NP_797117.1| peptidyl-tRNA hydrolase [Vibrio parahaemolyticus RIMD 2210633] >gi|31076864|sp|Q87RN9|PTH_VIBPA Peptidyl-tRNA hydrolase (PTH) >gi|28805724|dbj|BAC59001.1| peptidyl-tRNA hydrolase [Vibrio parahaemolyticus RIMD 2210633] (196 aa)
Score = 218, Expect = 2.1e-16, Identities = 55/136 (40%), Positives = 81/136 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNS-KFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVH 140
           L+VGL NPG EY KT+HN G   ++EL + H + L N  KF G   ++      + +  P T+MN SG+ +  + KFY+I  + I+V +D++D   G  + K  G  GG NG++  ISK+ N +   R+RIGIG P H
  S:     7 LLVGLANPGPEYAKTRHNAGAWVVEELARVHNVTLKNEPKFFGLTGRIMVNGQDLRLLIPTTFMNLSGKAIAALAKFYQIKPEEIMVAHDELDLPPGVAKFKKGGGHGGHNGLRDTISKLGNNKDFYRLRIGIGHPGH 144
>gi|26987456|ref|NP_742881.1| peptidyl-tRNA hydrolase [Pseudomonas putida KT2440] >gi|148546000|ref|YP_001266102.1| peptidyl-tRNA hydrolase [Pseudomonas putida F1] >gi|166229439|sp|A5VYF8|PTH_PSEP1 Peptidyl-tRNA hydrolase (PTH) >gi|37999417|sp|Q88PX8|PTH_PSEPK Peptidyl-tRNA hydrolase (PTH) >gi|24982119|gb|AAN66345.1|AE016263_2 peptidyl-tRNA hydrolase [Pseudomonas putida KT2440] >gi|148510058|gb|ABQ76918.1| peptidyl-tRNA hydrolase [Pseudomonas putida F1] (194 aa)
Score = 218, Expect = 2.2e-16, Identities = 51/134 (38%), Positives = 80/134 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP 138
           L+VGLGNPG EYE+T+HN G + ++ L     + L  + K+ G   K     + + +  P TYMN SG+ V  +  F++I  + ILV +D++D   G  ++K  G  GG NG++ II+++ N     R+R+GIG P
  S:     6 LIVGLGNPGPEYEQTRHNAGALFVERLASAQRVSLTADKKYFGLTAKFSHQGNDVRLLIPTTYMNRSGQSVAALANFFRIKPEAILVAHDELDLPPGVAKLKRGGGHGGHNGLRDIIAQLGNQNDFHRLRLGIGHP 141
>gi|104780083|ref|YP_606581.1| peptidyl-tRNA hydrolase [Pseudomonas entomophila L48] >gi|123255952|sp|Q1IEY8|PTH_PSEE4 Peptidyl-tRNA hydrolase (PTH) >gi|95109070|emb|CAK13766.1| peptidyl-tRNA hydrolase [Pseudomonas entomophila L48] (194 aa)
Score = 218, Expect = 2.2e-16, Identities = 51/134 (38%), Positives = 80/134 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP 138
           L+VGLGNPG EYE+T+HN G + ++ L     + L  + K+ G   K     + + +  P TYMN SG+ V  +  F++I  + ILV +D++D   G  ++K  G  GG NG++ II+++ N     R+R+GIG P
  S:     6 LIVGLGNPGPEYEQTRHNAGALFVERLASAQRVSLTADKKYFGLTAKFSHQGNDVRLLIPTTYMNRSGQSVAALANFFRIKPEAILVAHDELDLPPGVAKLKRGGGHGGHNGLRDIIAQLGNQNDFHRLRLGIGHP 141
>gi|157825997|ref|YP_001493717.1| peptidyl-tRNA hydrolase [Rickettsia akari str. Hartford] >gi|166229443|sp|A8GP84|PTH_RICAH Peptidyl-tRNA hydrolase (PTH) >gi|157799955|gb|ABV75209.1| peptidyl-tRNA hydrolase [Rickettsia akari str. Hartford] (185 aa)
Score = 217, Expect = 2.4e-16, Identities = 60/158 (37%), Positives = 94/158 (59%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEH-TLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAI 162
           LV+GLGNPG EY+ T+HN+GF+ I+++  ++ + F    +FN +  +      +I   KP TYMN SG+ V  +  +Y I+   I VI+DDID +  +I+ K  G +GG NG+KSI   +      RIR+G+G+P +N  +  ++L  F   +     QAI
  S:     3 LVIGLGNPGKEYQYTRHNIGFIAIEKIANQYNSSFSTKKQFNCEIAETISDGQKIIFIKPTTYMNLSGKSVISVKTYYNINPAKIFVIHDDIDLETCRIKFKTGGGNGGHNGLKSIDGVIGN-NYNRIRVGVGRPKNNQDVADYLLNNFLQSEYEIAMQAI 162
>gi|90408737|ref|ZP_01216884.1| Peptidyl-tRNA hydrolase [Psychromonas sp. CNPT3] >gi|90310154|gb|EAS38292.1| Peptidyl-tRNA hydrolase [Psychromonas sp. CNPT3] (196 aa)
Score = 217, Expect = 2.6e-16, Identities = 63/182 (34%), Positives = 102/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EYE T+HN G   +++L+ +  + L   +KF G   ++    + + +  P T+MN SG+ V  +  FY+I  + IL+ +D++D   G  + K  G  GG NG++ IIS++ N +   R+RIGIG P   + ++  VL K S  +   + Q+I +A   C   L      K MN+ +
  S:     7 LLVGLANPGPEYENTRHNAGQRFLNQLVSQENVHLKAEAKFYGLTGRIQFAGNDLRLLVPTTFMNLSGKSVAAMANFYRIKPEEILIAHDELDLPPGIAKFKLGGGHGGHNGLRDIISQLGNNKNFYRLRIGIGHPGDRNRVSGFVLGKASRTEQDLIDQSIDEAA-RCTLILGQDGLAKAMNRLH 191
>gi|50121111|ref|YP_050278.1| peptidyl-tRNA hydrolase [Pectobacterium atrosepticum SCRI1043] >gi|68052943|sp|Q6D557|PTH_ERWCT Peptidyl-tRNA hydrolase (PTH) >gi|49611637|emb|CAG75086.1| peptidyl-tRNA hydrolase [Erwinia carotovora subsp. atroseptica SCRI1043] (195 aa)
Score = 216, Expect = 3.1e-16, Identities = 69/182 (37%), Positives = 98/182 (53%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNN-SKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY  T+HN G   +D L + +   L   SKF G   +++     + +  P T+MN SG+ V  +  FY+I    ILV +D++D   G  ++K  G  GG NG+K IISK+ N     R+RIGIG P     +T  VL K    +   + +AI +A   C E L   D  K MN+ +
  S:     6 LIVGLANPGAEYAATRHNAGAWFVDRLAESYRQSLKEESKFFGYTSRLNLAGQDVRLLVPTTFMNLSGKAVAAMATFYRIQPDEILVAHDELDLLPGIAKLKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHPGDKSKVTGFVLGKPPMSEQTLIDEAIDEAV-RCTEILMKEDMIKAMNRLH 190
>gi|115453001|ref|NP_001050101.1| Os03g0347800 [Oryza sativa (japonica cultivar-group)] >gi|122247022|sp|Q10LI6|CRS2L_ORYSJ CRS2-like protein, chloroplast precursor (Chloroplastic RNA splicing factor 2-like protein) >gi|108708119|gb|ABF95914.1| Peptidyl-tRNA hydrolase, putative, expressed [Oryza sativa (japonica cultivar-group)] >gi|113548572|dbj|BAF12015.1| Os03g0347800 [Oryza sativa (japonica cultivar-group)] (186 aa)
Score = 216, Expect = 3.4e-16, Identities = 45/115 (39%), Positives = 65/115 (56%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNG 115
           ++ +L VGLGNPG +Y+ T+HNVGF  ID   +   + L    F   F +       + +AKP TYMN SGE V  +  +YK+    +LV +DD+D   G +R++ KG  G  NG
  S:    58 INPWLFVGLGNPGEKYQCTRHNVGFDMIDMFAQSQGISLTRHPFKALFGEGMVEGVPVLLAKPQTYMNLSGESVGPLAAYYKLPLNRVLVAFDDMDLPCGVLRLQPKGGYGRHNG 172
>gi|149038990|gb|EDL93210.1| rCG45678, isoform CRA_b [Rattus norvegicus] (204 aa)
Score = 215, Expect = 4.0e-16, Identities = 52/174 (29%), Positives = 98/174 (56%)
  Q:     3 KYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN---NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH-NLTH-HVLTKFSAEDSIKVQQAIIKAKDACNEFLNHV 176
           ++LV GLGNPG+    T+H+VG   + ++ +   +  N   +S+           + Q+ + +P   MN +G  V +  + + +  + I +++D++D  +GK+ +K  GS+ G NG++S IS +N+  + R+ +GIG+P H N+   HVL  FS E+   +   + +A D     L+H+
  S:    20 RWLVAGLGNPGMP--GTRHSVGMAVLGQIAQRLGVAENWARDSRCAADLALAPFGDAQLVLLRPRRLMNVNGRSVAKAAELFGLSAEEIYLVHDELDKPLGKLALKLGGSARGHNGVRSCISCLNSNAMPRLLVGIGRPTHPNMVETHVLGCFSPEEQELLSPLMDQATDL---LLDHI 193
>gi|74316407|ref|YP_314147.1| peptidyl-tRNA hydrolase [Thiobacillus denitrificans ATCC 25259] >gi|119391033|sp|Q3SLR3|PTH_THIDA Peptidyl-tRNA hydrolase (PTH) >gi|74055902|gb|AAZ96342.1| peptidyl-tRNA hydrolase [Thiobacillus denitrificans ATCC 25259] (202 aa)
Score = 215, Expect = 4.5e-16, Identities = 58/161 (36%), Positives = 93/161 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKA 165
           L+VGLGNPG +YE+T+HN GF     L +     L + S+F+G    +       ++  P T+MN SG+ V  + +F++I    ILV++D++D   G++R+K  G  GG NG+K I + + T+   R+RIGIG P     + ++VL     E+   +  AI +A
  S:    11 LIVGLGNPGRDYEETRHNAGFWFCARLAQAWGAALAHESRFHG----IVGRHGTRWMLLPQTFMNRSGQAVGALARFHRIAPAEILVVHDELDIPPGQLRLKFGGGMGGHNGLKDITAHLGTQDYWRLRIGIGHPGDRSEVVNYVLKPPRREEQADIDAAIERA 170
>gi|73968190|ref|XP_537833.2| PREDICTED: hypothetical protein XP_537833 [Canis familiaris] (222 aa)
Score = 214, Expect = 5.9e-16, Identities = 50/174 (28%), Positives = 95/174 (54%)
  Q:     3 KYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL---FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHV 176
           ++LV GLGNPGL    T+H+VG   + +L +   +   +  + +           + Q+ + +P   MN +G  V    + + +  + + +++D++D  +GK+ +K  GSS G NG++S IS +N+  + R+R+GIG+P     +  +VL  FSA +   +   + +A D     L+H+
  S:    30 RWLVAGLGNPGLP--STRHSVGLAVLGQLARRLGVADGWARDRRCAADLALASLDDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVHDELDKPLGKLALKLGGSSRGHNGVRSCISCLNSSAMPRLRVGIGRPTEPDTVKAYVLGCFSAAEQELLPPLLERATDL---LLDHI 203
>gi|77973492|ref|ZP_00829039.1| COG0193: Peptidyl-tRNA hydrolase [Yersinia frederiksenii ATCC 33641] (196 aa)
Score = 214, Expect = 6.3e-16, Identities = 68/182 (37%), Positives = 100/182 (54%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY +T+HN G   +D L + H   L   SKF G   +++     + +  P T+MN SG+ V  +  FY+I  + ILV +D++D   G  ++K  G +GG NG+K I S++ N     R+RIGIG P     +T  VL K  A +   +  AI ++   C E L   D  K MN+ +
  S:     6 LIVGLANPGAEYAQTRHNAGAWYVDLLAERHNQSLKEESKFFGYTARLNLAGQDVRLLVPSTFMNLSGKAVAAMAGFYRILPEEILVAHDELDIPPGVAKLKLGGGNGGHNGLKDIQSRLGNNPNFYRLRIGIGHPGDKSKVTGFVLGKPPASEQTLIDDAIDESI-RCTEVLLKEDITKAMNRLH 190
>gi|27904680|ref|NP_777806.1| peptidyl-tRNA hydrolase [Buchnera aphidicola str. Bp (Baizongia pistaciae)] >gi|29611784|sp|P59490|PTH_BUCBP Peptidyl-tRNA hydrolase (PTH) >gi|27904077|gb|AAO26911.1| peptidyl-tRNA hydrolase [Buchnera aphidicola str. Bp (Baizongia pistaciae)] (207 aa)
Score = 213, Expect = 7.3e-16, Identities = 55/161 (34%), Positives = 97/161 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELL-KEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTE-KIKRIRIGIGKPV---HNLTHHVLTKFSAEDSIKVQQAIIKA 165
           L+VGL NP  +Y  T+HNVG   ++ L+ +++     N+KF G   +++     I +  P T+MN SG  V  I  FY I    ILV++D++D   G ++ + + S  G NGI+++++ + T  K  RI+IGIG+P+   + ++  VL+K +  + + + +AI+ A
  S:     6 LIVGLANPIKKYNDTRHNVGSWLVNSLVTQQNKKLKKNNKFLGYSTEINILSKNIHVLVPDTFMNLSGISVLAISNFYNIKLHEILVVHDELDLKPGNVKFRLRSSHNGHNGIRNVLAVLGTNIKFLRIQIGIGRPINSGYKISKFVLSKPNVSEKLLINRAILCA 171
>gi|70732482|ref|YP_262245.1| peptidyl-tRNA hydrolase [Pseudomonas fluorescens Pf-5] >gi|68346781|gb|AAY94387.1| peptidyl-tRNA hydrolase [Pseudomonas fluorescens Pf-5] (208 aa)
Score = 213, Expect = 7.6e-16, Identities = 49/134 (36%), Positives = 81/134 (60%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP 138
           L+VGLGNPG EYE+T+HN G + ++ + ++  +  + + K+ G   +       I +  P TYMN SG+ V  +  F++I  + ILV +D++D   G  ++K  G  GG NG++ II+++ N     R+R+GIG P
  S:    20 LIVGLGNPGTEYEQTRHNAGALFVERIAEKQGINLVADRKYFGLTGRFSHQGQDIRLLIPTTYMNRSGQAVAALAGFFRIKPEEILVAHDELDLPPGVAKLKTGGGHGGHNGLRDIIAQLGNQNTFHRLRLGIGHP 155
>gi|114569307|ref|YP_755987.1| peptidyl-tRNA hydrolase [Maricaulis maris MCS10] >gi|114339769|gb|ABI65049.1| peptidyl-tRNA hydrolase [Maricaulis maris MCS10] (220 aa)
Score = 213, Expect = 8.1e-16, Identities = 62/180 (34%), Positives = 102/180 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFS-AEDS--IKVQQAIIKAKDACNEFLNHVDFDKIMNK 184
           ++ GLGN   +Y + +HNVGFM +D + +         +F G   +V    +++ + KP T+ NN+G  V     FY++  ++I+V +D++D   GK R+K  G + G NGIKSI S++  +  +R RIGIG P   + +T +VL+ F+ AE++  I +  AI  + D     L   D+D    K
  S:    23 ILAGLGNYEPKYLRNRHNVGFMALDIIAQAWNAGPWRKRFQGLASEVTIGSNKLLLLKPQTFYNNAGNSVGAAAAFYRVKPEDIIVFHDELDLAPGKFRMKMGGGAAGNNGIKSITSQLGPD-FRRARIGIGHPGDRNRVTGYVLSDFAKAEEAWLIDLLDAIAGSLD----LLAAGDYDAFQTK 202
>gi|114561899|ref|YP_749412.1| peptidyl-tRNA hydrolase [Shewanella frigidimarina NCIMB 400] >gi|119391003|sp|Q087J1|PTH_SHEFN Peptidyl-tRNA hydrolase (PTH) >gi|114333192|gb|ABI70574.1| Aminoacyl-tRNA hydrolase [Shewanella frigidimarina NCIMB 400] (195 aa)
Score = 213, Expect = 8.1e-16, Identities = 63/182 (34%), Positives = 102/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEK-IKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY +T+HN G   + EL +   +  +  SK+ G   +       + +  P TYMN SG+ V  +  F++I  + ILV +D++D D G  + K  G  GG NG+K II+ +  +K   R+RIGIG P   + ++ +VL +  A +  ++  AI +A  +  E L + D  K M++ +
  S:     6 LIVGLANPGAEYAQTRHNAGAWYVQELARICNVPLVAESKYFGVTARATLHGRDVRLLIPTTYMNLSGKSVAALANFFRILPEEILVAHDELDMDPGVAKFKLGGGHGGHNGLKDIIASLGNDKNFHRLRIGIGHPGDKNKVSGYVLGRAPAVEQERINAAIDEAVRS-TEILFNQDMAKAMHRLH 190
>gi|119944670|ref|YP_942350.1| aminoacyl-tRNA hydrolase [Psychromonas ingrahamii 37] >gi|166229440|sp|A1STD6|PTH_PSYIN Peptidyl-tRNA hydrolase (PTH) >gi|119863274|gb|ABM02751.1| peptidyl-tRNA hydrolase [Psychromonas ingrahamii 37] (197 aa)
Score = 212, Expect = 1.0e-15, Identities = 62/182 (34%), Positives = 100/182 (54%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEK-IKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY +T+HN G   + +L  +  + L    KF G   ++    + + +  P T+MN SG+ V  +  FY+I  + IL+ +D++D   G  + K  G  GG NG+K II K+  +K   R+RIGIG P   + ++ +VL K  + +   + Q+I +A   C   L     +K MN+ +
  S:     7 LLVGLANPGPEYAQTRHNAGQWYVSQLASQENIQLKAEPKFYGLTGRIQFAGNDLRLLVPTTFMNLSGKAVAAMANFYRIKPEEILIAHDELDLLPGIAKFKLGGGHGGHNGLKDIIQKLGNDKNFYRLRIGIGHPGDKNRVSGYVLGKAPSSEQNLIDQSIDEAA-RCTHILGQDGLEKAMNRLH 191
>gi|90414101|ref|ZP_01222084.1| peptidyl-tRNA hydrolase [Photobacterium profundum 3TCK] >gi|90324896|gb|EAS41424.1| peptidyl-tRNA hydrolase [Photobacterium profundum 3TCK] (196 aa)
Score = 211, Expect = 1.2e-15, Identities = 65/182 (35%), Positives = 101/182 (55%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDA---CNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY KT+HN G   + EL + H + L   SK+ G   ++      + +  P TYMN SG+ V  +  F++I  + IL+ +D++D   G  + K  G  GG NG++  ISKM N ++  R+R+GIG P   + + + VL K      +K Q+ I  A D    C + L +   +K  N+ +
  S:     7 LLVGLANPGAEYAKTRHNAGAWVVQELARVHNVTLREESKYFGVTGRITTNGQDLRLLIPTTYMNLSGKSVAALANFFQIKPEEILIAHDELDLPPGVAKFKKGGGHGGHNGLRDTISKMGNNKEFYRLRVGIGHPGDKNKVANFVLGK----APVKEQECIDAAVDEAVRCMDILLNDGLNKAQNRLH 191
>gi|38233496|ref|NP_939263.1| peptidyl-tRNA hydrolase [Corynebacterium diphtheriae NCTC 13129] >gi|68052966|sp|Q6NI78|PTH_CORDI Peptidyl-tRNA hydrolase (PTH) >gi|38199756|emb|CAE49416.1| Putative peptidyl tRNA hydrolase [Corynebacterium diphtheriae] (184 aa)
Score = 211, Expect = 1.4e-15, Identities = 48/125 (38%), Positives = 73/125 (58%)
  Q:     2 SKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHT----LFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTE 126
           S YL+VGLGN G EY KT+HN+G+M IDELL   +        + K N    +      ++ +AKP  +MN +G  V ++  F+ +    I+V+YDD+D + G I+ +  G   G NG+KSI   + T+
  S:     3 SPYLIVGLGNLGPEYTKTRHNIGYMAIDELLTRTSPMPATLTVHKKTNTLVAETRLGTQKVIVAKPRAFMNVTGPSVRKLADFFTVDRNRIVVLYDDLDLEFGAIKFRHGGGDHGHNGLKSITQALGTK 131
>gi|77979783|ref|ZP_00835199.1| COG0193: Peptidyl-tRNA hydrolase [Yersinia intermedia ATCC 29909] (196 aa)
Score = 210, Expect = 1.5e-15, Identities = 67/182 (36%), Positives = 100/182 (54%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY +T+HN G   +D L + H   L   SKF G   +++     + +  P T+MN SG+ V  +  FY+I  + ILV +D++D   G  ++K  G +GG NG+K I S++ N     R+RIGIG P     +T  VL K  + +   +  AI ++   C E L   D  K MN+ +
  S:     6 LIVGLANPGAEYAQTRHNAGAWYVDLLAQRHNQPLKEESKFFGYTARLNLAGQDVRLLVPSTFMNLSGKAVAAMAGFYRILPEEILVAHDELDIPPGVAKLKLGGGNGGHNGLKDIQSRLGNNPNFYRLRIGIGHPGDKSKVTGFVLGKPPSSEQTLIDDAIDESI-RCTEILLKEDITKAMNRLH 190
>gi|15599867|ref|NP_253361.1| peptidyl-tRNA hydrolase [Pseudomonas aeruginosa PAO1] >gi|107099661|ref|ZP_01363579.1| hypothetical protein PaerPA_01000679 [Pseudomonas aeruginosa PACS2] >gi|116052817|ref|YP_793134.1| peptidyl-tRNA hydrolase [Pseudomonas aeruginosa UCBPP-PA14] >gi|194549573|ref|YP_002084601.1| peptidyl-tRNA hydrolase [Pseudomonas aeruginosa C3719] >gi|194555421|ref|YP_002090448.1| peptidyl-tRNA hydrolase [Pseudomonas aeruginosa 2192] >gi|122257172|sp|Q02G02|PTH_PSEAB Peptidyl-tRNA hydrolase (PTH) >gi|14195078|sp|Q9HVC3|PTH_PSEAE Peptidyl-tRNA hydrolase (PTH) >gi|9950928|gb|AAG08059.1|AE004881_2 peptidyl-tRNA hydrolase [Pseudomonas aeruginosa PAO1] >gi|115588038|gb|ABJ14053.1| peptidyl-tRNA hydrolase [Pseudomonas aeruginosa UCBPP-PA14] >gi|126170519|gb|EAZ56030.1| peptidyl-tRNA hydrolase [Pseudomonas aeruginosa C3719] >gi|126197814|gb|EAZ61877.1| peptidyl-tRNA hydrolase [Pseudomonas aeruginosa 2192] (194 aa)
Score = 210, Expect = 1.6e-15, Identities = 51/137 (37%), Positives = 80/137 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHN 141
           L+VGLGNPG EY++T+HN G + ++ L     + L  + K+ G   K       + +  P TYMN SG+ V  +  F++I    ILV +D++D   G  ++K  G  GG NG++ II+++ N     R+R+GIG P H+
  S:     6 LIVGLGNPGPEYDQTRHNAGALFVERLAHAQGVSLVADRKYFGLVGKFSHQGKDVRLLIPTTYMNRSGQSVAALAGFFRIAPDAILVAHDELDMPPGVAKLKTGGGHGGHNGLRDIIAQLGNQNSFHRLRLGIGHPGHS 144
>gi|84497835|ref|ZP_00996632.1| peptidyl-tRNA hydrolase [Janibacter sp. HTCC2649] >gi|84381335|gb|EAP97218.1| peptidyl-tRNA hydrolase [Janibacter sp. HTCC2649] (196 aa)
Score = 210, Expect = 1.7e-15, Identities = 61/171 (35%), Positives = 88/171 (51%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKV-------DQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNH 175
           +VVGLGNPG  Y   +HNVG M IDEL       L   K      +V         P     IA P +YMN SG  V  +  F+ +    ++VI+D++D   G +R+K  G  GG NG++SI   + T+   R+R+GIG+P    +    VL  FS  +  ++   +  A DA    + H
  S:     1 MVVGLGNPGPTYAGNRHNVGAMVIDELASRTKSALRTHKARAVAAQVRIGTGPGGVPGPSAVIAVPGSYMNESGGPVKALMGFFSVEPDRLVVIHDELDIPAGDVRLKLGGGEGGHNGLRSISKSLGTKDYLRVRVGIGRPPGRQDAADFVLKDFSPVERKELPFLLGDAADAVEMLVTH 180
>gi|54309999|ref|YP_131019.1| peptidyl-tRNA hydrolase [Photobacterium profundum SS9] >gi|68052961|sp|Q6LNA9|PTH_PHOPR Peptidyl-tRNA hydrolase (PTH) >gi|46914438|emb|CAG21217.1| putative peptidyl-tRNA hydrolase [Photobacterium profundum SS9] (196 aa)
Score = 210, Expect = 1.8e-15, Identities = 65/182 (35%), Positives = 100/182 (54%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDA---CNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY KT+HN G   + EL + H + L   SK+ G   ++      + +  P TYMN SG+ V  +  F++I  + IL+ +D++D   G  + K  G  GG NG++  ISKM N ++  R+R+GIG P   + + + VL K      +K Q+ I  A D    C + L     +K  N+ +
  S:     7 LLVGLANPGAEYAKTRHNAGAWVVQELARVHNVSLREESKYFGVTGRITTNGQDLRLLIPTTYMNLSGKSVAALANFFQIKPEEILIAHDELDLPPGVAKFKKGGGHGGHNGLRDTISKMGNNKEFYRLRVGIGHPGDKNKVANFVLGK----APVKEQECIDAAVDEAVRCMDILLKDGLNKAQNRLH 191
>gi|77359995|ref|YP_339570.1| peptidyl-tRNA hydrolase [Pseudoalteromonas haloplanktis TAC125] >gi|119390982|sp|Q3IK86|PTH_PSEHT Peptidyl-tRNA hydrolase (PTH) >gi|76874906|emb|CAI86127.1| peptidyl-tRNA hydrolase [Pseudoalteromonas haloplanktis TAC125] (194 aa)
Score = 209, Expect = 2.2e-15, Identities = 69/182 (37%), Positives = 104/182 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           ++VGL NPG EY  T+HN G   I++L   +   L ++ K++G   KV   + +  +  P TYMN SG+ V  +  F+KI  ++ILV +D++D + G  ++K  G  GG NG+K II+KM N +   R+RIG+G P H   +T  VL K +  D  K+  AI +A   C E L      K  N+ +
  S:     6 MLVGLANPGPEYANTRHNAGAWFIEQLAARYNCTLKHDPKYHGLTGKVIIQDQEFKLLIPTTYMNLSGKAVGSLANFFKIPVESILVAHDELDLEPGVAKLKKGGGHGGHNGLKDIIAKMANQKDFMRLRIGVGHPGHREMVTGWVLGKAAKADQEKMDAAIDEAV-RCMEILAKDGVLKAQNRLH 190
>gi|77460976|ref|YP_350483.1| peptidyl-tRNA hydrolase [Pseudomonas fluorescens PfO-1] >gi|119390983|sp|Q3K6W2|PTH_PSEPF Peptidyl-tRNA hydrolase (PTH) >gi|77384979|gb|ABA76492.1| peptidyl-tRNA hydrolase [Pseudomonas fluorescens PfO-1] (194 aa)
Score = 209, Expect = 2.4e-15, Identities = 48/134 (35%), Positives = 79/134 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP 138
           L+VGLGNPG EYE+T+HN G + ++ +     +  + + K+ G   +       + +  P TYMN SG+ V  +  F++I  + ILV +D++D   G  ++K  G  GG NG++ II+++ N     R+R+GIG P
  S:     6 LIVGLGNPGAEYEQTRHNAGALFVERIAHAQNVNLVADRKYFGLTGRFSHQGQDVRLLIPTTYMNRSGQAVAALAGFFRIKPEEILVAHDELDLPPGVAKLKVGGGHGGHNGLRDIIAQLGNQNTFHRLRLGIGHP 141
>gi|152987749|ref|YP_001350653.1| peptidyl-tRNA hydrolase [Pseudomonas aeruginosa PA7] >gi|166229437|sp|A6VC68|PTH_PSEA7 Peptidyl-tRNA hydrolase (PTH) >gi|150962907|gb|ABR84932.1| peptidyl-tRNA hydrolase [Pseudomonas aeruginosa PA7] (194 aa)
Score = 209, Expect = 2.5e-15, Identities = 51/137 (37%), Positives = 79/137 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKPVHN 141
           L+VGLGNPG EY++T+HN G + ++ L     + L    K+ G   K       + +  P TYMN SG+ V  +  F++I    ILV +D++D   G  ++K  G  GG NG++ II+++ N     R+R+GIG P H+
  S:     6 LIVGLGNPGPEYDQTRHNAGALFVERLAHAQGISLVAERKYFGLVGKFSHQGKDVRLLIPTTYMNRSGQSVAALAGFFRIPPDAILVAHDELDMPPGVAKLKTGGGHGGHNGLRDIIAQLGNQNSFHRLRLGIGHPGHS 144
>gi|16122254|ref|NP_405567.1| peptidyl-tRNA hydrolase [Yersinia pestis CO92] >gi|51596325|ref|YP_070516.1| peptidyl-tRNA hydrolase [Yersinia pseudotuberculosis IP 32953] >gi|149366057|ref|ZP_01888092.1| peptidyl-tRNA hydrolase [Yersinia pestis CA88-4125] >gi|167470769|ref|ZP_02335473.1| peptidyl-tRNA hydrolase [Yersinia pestis FV-1] >gi|21263849|sp|Q8ZEY4|PTH_YERPE Peptidyl-tRNA hydrolase (PTH) >gi|68052918|sp|Q66AY1|PTH_YERPS Peptidyl-tRNA hydrolase (PTH) >gi|119391038|sp|Q1C861|PTH_YERPA Peptidyl-tRNA hydrolase (PTH) >gi|119391039|sp|Q1CJK8|PTH_YERPN Peptidyl-tRNA hydrolase (PTH) >gi|51589607|emb|CAH21237.1| peptidyl-tRNA hydrolase [Yersinia pseudotuberculosis IP 32953] >gi|115347733|emb|CAL20648.1| peptidyl-tRNA hydrolase [Yersinia pestis CO92] >gi|149292470|gb|EDM42544.1| peptidyl-tRNA hydrolase [Yersinia pestis CA88-4125] (196 aa)
Score = 208, Expect = 2.6e-15, Identities = 68/182 (37%), Positives = 100/182 (54%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY +T+HN G   +D L + H   L   SKF G   +++     I +  P T+MN SG+ V  +  FY+I  + ILV +D++D   G  ++K  G +GG NG+K I +K+ N     R+RIGIG P     +T  VL K  A +   +  AI ++   C E L +    K MN+ +
  S:     6 LIVGLANPGAEYAQTRHNAGAWYVDLLAERHNQSLKEESKFFGYTARLNLAGQDIRLLVPATFMNLSGKAVAAMASFYRILPEEILVAHDELDILPGMAKLKLGGGNGGHNGLKDIQNKLGNNPNFYRLRIGIGHPGDKSKVTGFVLGKPPASEQTLIDDAIDESI-RCTEVLLNEGMTKAMNRLH 190
>gi|120555279|ref|YP_959630.1| aminoacyl-tRNA hydrolase [Marinobacter aquaeolei VT8] >gi|166199357|sp|A1U374|PTH_MARAV Peptidyl-tRNA hydrolase (PTH) >gi|120325128|gb|ABM19443.1| peptidyl-tRNA hydrolase [Marinobacter aquaeolei VT8] (196 aa)
Score = 208, Expect = 2.7e-15, Identities = 51/151 (33%), Positives = 87/151 (57%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDS 155
           +VVGLGNPG +YE T+HN G + ++ L +E    L    K++G + ++      + +  P T+MN SG  +  +  F+KI  + ILV +D++D   G  ++K  G  GG NG++  I+ + T   +R+R+GIG P     +T  VL +   +++
  S:     7 MVVGLGNPGSDYENTRHNAGALFVEALAREAGQTLRPEKKYHGLYARIQWQGLDLHLLNPSTFMNRSGTAIKALADFFKISPEQILVAHDELDLPPGTAKLKKGGGHGGHNGLRDTIAHLGTNDFQRLRLGIGHPGDSRKVTGFVLGRLGKQET 160
>gi|153950891|ref|YP_001401047.1| peptidyl-tRNA hydrolase [Yersinia pseudotuberculosis IP 31758] >gi|167011998|sp|A7FIG9|PTH_YERP3 Peptidyl-tRNA hydrolase (PTH) >gi|152962386|gb|ABS49847.1| peptidyl-tRNA hydrolase [Yersinia pseudotuberculosis IP 31758] (196 aa)
Score = 208, Expect = 2.8e-15, Identities = 68/182 (37%), Positives = 100/182 (54%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY +T+HN G   +D L + H   L   SKF G   +++     I +  P T+MN SG+ V  +  FY+I  + ILV +D++D   G  ++K  G +GG NG+K I +K+ N     R+RIGIG P     +T  VL K  A +   +  AI ++   C E L +    K MN+ +
  S:     6 LIVGLANPGAEYAQTRHNAGAWYVDLLAERHNQSLKEESKFFGYTARLNLAGQDIRLLVPATFMNLSGKAVAAMASFYRILPEEILVAHDELDILPGMAKLKLGGGNGGHNGLKDIQNKLGNNPNFYRLRIGIGHPGDKSKVTGFVLGKPPASEQTLIDNAIDESI-RCTEVLLNEGMTKAMNRLH 190
>gi|71735978|ref|YP_273261.1| peptidyl-tRNA hydrolase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|119390979|sp|Q48MW1|PTH_PSE14 Peptidyl-tRNA hydrolase (PTH) >gi|71556531|gb|AAZ35742.1| peptidyl-tRNA hydrolase [Pseudomonas syringae pv. phaseolicola 1448A] (194 aa)
Score = 208, Expect = 3.2e-15, Identities = 50/134 (37%), Positives = 78/134 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP 138
           L+VGLGNPG EYE+T+HN G   ++ +     +  +   KF G   +       + +  P TYMN SG+ V  +  FY+I  ++ILV +D++D   G  ++K  G  GG NG++ II+++ N     R+R+GIG P
  S:     6 LIVGLGNPGAEYEQTRHNAGAFFVERIAAAQRVNLVPERKFFGLTGRFTHQGQDVRLLIPTTYMNRSGQAVAALAGFYRIPVESILVAHDELDLPPGVAKLKVGGGHGGHNGLRDIIAQLGNQNTFHRLRLGIGHP 141
>gi|66044195|ref|YP_234036.1| peptidyl-tRNA hydrolase [Pseudomonas syringae pv. syringae B728a] >gi|81308516|sp|Q4ZXX4|PTH_PSEU2 Peptidyl-tRNA hydrolase (PTH) >gi|63254902|gb|AAY35998.1| Peptidyl-tRNA hydrolase [Pseudomonas syringae pv. syringae B728a] (194 aa)
Score = 208, Expect = 3.2e-15, Identities = 50/134 (37%), Positives = 78/134 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP 138
           L+VGLGNPG EYE+T+HN G   ++ +     +  +   KF G   +       + +  P TYMN SG+ V  +  FY+I  ++ILV +D++D   G  ++K  G  GG NG++ II+++ N     R+R+GIG P
  S:     6 LIVGLGNPGAEYEQTRHNAGAFFVERIAAAQRVDLVPERKFFGLTGRFTHQGQDVRLLIPTTYMNRSGQAVAALAGFYRIPVESILVAHDELDLPPGVAKLKVGGGHGGHNGLRDIIAQLGNQNTFHRLRLGIGHP 141
>gi|67154371|ref|ZP_00416116.1| Peptidyl-tRNA hydrolase [Azotobacter vinelandii AvOP] >gi|67088504|gb|EAM07970.1| Peptidyl-tRNA hydrolase [Azotobacter vinelandii AvOP] (194 aa)
Score = 207, Expect = 3.3e-15, Identities = 51/134 (38%), Positives = 78/134 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP 138
           L+VGLGNPG EYE+T+HN G + ++ +     + L+ + K+ G   K       + +  P TYMN SG+ V  +  F++I    ILV +D++D   G  R+K  G  GG NG++ II++  N     R+R+GIG P
  S:     6 LIVGLGNPGPEYEQTRHNAGALFVERVASAKGVRLSADKKYFGLVGKFSHQGRDVRLLIPTTYMNRSGQSVAALANFFRIPPAAILVAHDELDMPPGTARLKQGGGHGGHNGLRDIIAQFGNQNSFYRLRLGIGHP 141
>gi|22126182|ref|NP_669605.1| peptidyl-tRNA hydrolase [Yersinia pestis KIM] >gi|45441663|ref|NP_993202.1| peptidyl-tRNA hydrolase [Yersinia pestis biovar Microtus str. 91001] >gi|108807390|ref|YP_651306.1| peptidyl-tRNA hydrolase [Yersinia pestis Antiqua] >gi|108811655|ref|YP_647422.1| peptidyl-tRNA hydrolase [Yersinia pestis Nepal516] >gi|145598403|ref|YP_001162479.1| peptidyl-tRNA hydrolase [Yersinia pestis Pestoides F] >gi|162419541|ref|YP_001606885.1| peptidyl-tRNA hydrolase [Yersinia pestis Angola] >gi|165926493|ref|ZP_02222325.1| peptidyl-tRNA hydrolase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165938866|ref|ZP_02227420.1| peptidyl-tRNA hydrolase [Yersinia pestis biovar Orientalis str. IP275] >gi|166009227|ref|ZP_02230125.1| peptidyl-tRNA hydrolase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166210569|ref|ZP_02236604.1| peptidyl-tRNA hydrolase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167401435|ref|ZP_02306932.1| peptidyl-tRNA hydrolase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167420300|ref|ZP_02312053.1| peptidyl-tRNA hydrolase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167424700|ref|ZP_02316453.1| peptidyl-tRNA hydrolase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|186895367|ref|YP_001872479.1| peptidyl-tRNA hydrolase [Yersinia pseudotuberculosis PB1/+] >gi|21959147|gb|AAM85856.1|AE013832_6 peptidyl-tRNA hydrolase [Yersinia pestis KIM] >gi|45436525|gb|AAS62079.1| peptidyl-tRNA hydrolase [Yersinia pestis biovar Microtus str. 91001] >gi|108775303|gb|ABG17822.1| peptidyl-tRNA hydrolase [Yersinia pestis Nepal516] >gi|108779303|gb|ABG13361.1| peptidyl-tRNA hydrolase [Yersinia pestis Antiqua] >gi|145210099|gb|ABP39506.1| peptidyl-tRNA hydrolase [Yersinia pestis Pestoides F] >gi|162352356|gb|ABX86304.1| peptidyl-tRNA hydrolase [Yersinia pestis Angola] >gi|165913229|gb|EDR31852.1| peptidyl-tRNA hydrolase [Yersinia pestis biovar Orientalis str. IP275] >gi|165921714|gb|EDR38911.1| peptidyl-tRNA hydrolase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991782|gb|EDR44083.1| peptidyl-tRNA hydrolase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166207749|gb|EDR52229.1| peptidyl-tRNA hydrolase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166961995|gb|EDR58016.1| peptidyl-tRNA hydrolase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167049131|gb|EDR60539.1| peptidyl-tRNA hydrolase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167056582|gb|EDR66351.1| peptidyl-tRNA hydrolase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|186698393|gb|ACC89022.1| peptidyl-tRNA hydrolase [Yersinia pseudotuberculosis PB1/+] (206 aa)
Score = 207, Expect = 3.5e-15, Identities = 68/182 (37%), Positives = 100/182 (54%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY +T+HN G   +D L + H   L   SKF G   +++     I +  P T+MN SG+ V  +  FY+I  + ILV +D++D   G  ++K  G +GG NG+K I +K+ N     R+RIGIG P     +T  VL K  A +   +  AI ++   C E L +    K MN+ +
  S:    16 LIVGLANPGAEYAQTRHNAGAWYVDLLAERHNQSLKEESKFFGYTARLNLAGQDIRLLVPATFMNLSGKAVAAMASFYRILPEEILVAHDELDILPGMAKLKLGGGNGGHNGLKDIQNKLGNNPNFYRLRIGIGHPGDKSKVTGFVLGKPPASEQTLIDDAIDESI-RCTEVLLNEGMTKAMNRLH 200
>gi|88607642|ref|YP_505815.1| peptidyl-tRNA hydrolase [Anaplasma phagocytophilum HZ] >gi|119390910|sp|Q2GII6|PTH_ANAPZ Peptidyl-tRNA hydrolase (PTH) >gi|88598705|gb|ABD44175.1| peptidyl-tRNA hydrolase [Anaplasma phagocytophilum HZ] (183 aa)
Score = 207, Expect = 3.9e-15, Identities = 57/146 (39%), Positives = 85/146 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP-VHNLTHHVLTKF 150
           L+VGLGNPG  Y +T+HNVGFM ID + +        SK +      +    ++ + KP+ YMN SG  V      +KI  ++I V +DD++   G IRVK  G SGG NG++SI S +  +   R+R G+G+  + NL+ +VL+ F
  S:     3 LLVGLGNPGKRYAETRHNVGFMIIDAVARGFFFPEFCSKHDALVSIGNIGTHRVMLMKPLLYMNRSGTSVLSCTSMHKIAPEHITVFHDDVELQPGTIRVKLGGGSGGHNGLRSIDSAIG-KAYWRVRFGVGRAELCNLSDYVLSDF 148
>gi|28868317|ref|NP_790936.1| peptidyl-tRNA hydrolase [Pseudomonas syringae pv. tomato str. DC3000] >gi|37999393|sp|Q888C8|PTH_PSESM Peptidyl-tRNA hydrolase (PTH) >gi|28851554|gb|AAO54631.1| peptidyl-tRNA hydrolase [Pseudomonas syringae pv. tomato str. DC3000] (194 aa)
Score = 207, Expect = 4.1e-15, Identities = 50/134 (37%), Positives = 78/134 (58%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP 138
           L+VGLGNPG EYE+T+HN G   ++ +     +  +   KF G   +       + +  P TYMN SG+ V  +  FY+I  ++ILV +D++D   G  ++K  G  GG NG++ II+++ N     R+R+GIG P
  S:     6 LIVGLGNPGAEYEQTRHNAGAFFVERIAAAQRVNLVPERKFFGLTGRFTHQGQDVRLLIPTTYMNRSGQAVAALAGFYRIPIESILVAHDELDLPPGVAKLKVGGGHGGHNGLRDIIAQLGNQNTFHRLRLGIGHP 141
>gi|109112165|ref|XP_001095651.1| PREDICTED: hypothetical protein isoform 2 [Macaca mulatta] (214 aa)
Score = 207, Expect = 4.2e-15, Identities = 51/174 (29%), Positives = 96/174 (55%)
  Q:     3 KYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQP-----EDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHV 176
           +++V GLGNPGL    T+H+VG   + +L +   L +  S    +    D       + Q+ + +P   MN +G  V    + + +  + + +++D++D  +G++ +K  GS+ G NG++S IS +N+  + R+R+GIG+P H   +  HVL  FS  +   +   + +A D     L+H+
  S:    30 RWMVAGLGNPGLP--GTRHSVGMAVLGQLARR--LGVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVHDELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPTHPEAVQAHVLGCFSPAEQELLPLLLDRATDL---ILDHI 203
>gi|50897284|ref|NP_001002913.1| peptidyl-tRNA hydrolase 1 homolog [Homo sapiens] >gi|114626791|ref|XP_520273.2| PREDICTED: peptidyl-tRNA hydrolase 1 homolog isoform 4 [Pan troglodytes] >gi|74750555|sp|Q86Y79|PTH_HUMAN Probable peptidyl-tRNA hydrolase (PTH) >gi|28422548|gb|AAH47012.1| Peptidyl-tRNA hydrolase 1 homolog (S. cerevisiae) [Homo sapiens] (214 aa)
Score = 206, Expect = 4.4e-15, Identities = 51/174 (29%), Positives = 96/174 (55%)
  Q:     3 KYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQP-----EDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHV 176
           +++V GLGNPGL    T+H+VG   + +L +   L +  S    +    D       + Q+ + +P   MN +G  V    + + +  + + +++D++D  +G++ +K  GS+ G NG++S IS +N+  + R+R+GIG+P H   +  HVL  FS  +   +   + +A D     L+H+
  S:    30 RWMVAGLGNPGLP--GTRHSVGMAVLGQLARR--LGVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVHDELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATDL---ILDHI 203
>gi|30519902|ref|NP_848710.1| peptidyl-tRNA hydrolase 1 homolog [Mus musculus] >gi|81913689|sp|Q8BW00|PTH_MOUSE Probable peptidyl-tRNA hydrolase (PTH) >gi|26344690|dbj|BAC35994.1| unnamed protein product [Mus musculus] >gi|68085781|gb|AAH98218.1| Peptidyl-tRNA hydrolase 1 homolog (S. cerevisiae) [Mus musculus] >gi|123858283|emb|CAM16629.1| peptidyl-tRNA hydrolase 1 homolog (S. cerevisiae) [Mus musculus] >gi|148676630|gb|EDL08577.1| peptidyl-tRNA hydrolase 1 homolog (S. cerevisiae) [Mus musculus] (204 aa)
Score = 206, Expect = 4.4e-15, Identities = 50/174 (28%), Positives = 96/174 (55%)
  Q:     3 KYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN---NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHV 176
           ++LV GLGN G+    T+H+VG   + ++ +   +  N   +S+           + Q+ + +P   MN +G  V    + + +  + I +++D++D  +GK+ +K  GS+ G NG++S IS +N+  + R+ +GIG+P H   + +HVL  FS E+   +   + +A D     L+H+
  S:    20 RWLVAGLGNHGMP--GTRHSVGMAVLGQIARRLGVAENWTRDSRCAADLALAPLGDAQLVLLRPRRLMNVNGRSVARAAELFGLTAEEIYLVHDELDKPLGKLALKLGGSARGHNGVRSCISCLNSNAMPRLLVGIGRPTHPNMVENHVLGCFSPEEQELLSPLMDQATDL---LLDHI 193
>gi|82776544|ref|YP_402893.1| peptidyl-tRNA hydrolase [Shigella dysenteriae Sd197] >gi|119391007|sp|Q32H03|PTH_SHIDS Peptidyl-tRNA hydrolase (PTH) >gi|81240692|gb|ABB61402.1| peptidyl-tRNA hydrolase [Shigella dysenteriae Sd197] (194 aa)
Score = 206, Expect = 4.7e-15, Identities = 54/138 (39%), Positives = 78/138 (56%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP 138
           M+  L+VGL NPG EY  T+HN G   +D L +         +KF G   +V    + + +  P T+MN SG+ V  +  F++I+   ILV++D++D   G  + K  G  GG NG+K IISK+ N     R+RIGIG P
  S:     1 MTIKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVVHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHP 140
>gi|24112603|ref|NP_707113.1| peptidyl-tRNA hydrolase [Shigella flexneri 2a str. 301] >gi|30062728|ref|NP_836899.1| peptidyl-tRNA hydrolase [Shigella flexneri 2a str. 2457T] >gi|46576792|sp|Q83LE1|PTH_SHIFL Peptidyl-tRNA hydrolase (PTH) >gi|24051507|gb|AAN42820.1| peptidyl-tRNA hydrolase [Shigella flexneri 2a str. 301] >gi|30040976|gb|AAP16706.1| peptidyl-tRNA hydrolase [Shigella flexneri 2a str. 2457T] (194 aa)
Score = 204, Expect = 7.7e-15, Identities = 54/138 (39%), Positives = 77/138 (55%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP 138
           M+  L+VGL NPG EY  T+HN G   +D L +         +KF G   +V    + + +  P T+MN SG+ V  +  F++I+   ILV +D++D   G  + K  G  GG NG+K IISK+ N     R+RIGIG P
  S:     1 MTIKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGSEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHP 140
>gi|117919460|ref|YP_868652.1| peptidyl-tRNA hydrolase [Shewanella sp. ANA-3] >gi|166229454|sp|A0KTX7|PTH_SHESA Peptidyl-tRNA hydrolase (PTH) >gi|117611792|gb|ABK47246.1| peptidyl-tRNA hydrolase [Shewanella sp. ANA-3] (195 aa)
Score = 204, Expect = 8.8e-15, Identities = 64/182 (35%), Positives = 102/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY +T+HN G   ++EL +   + L  +SK+ G   +       + +  P TYMN SG+ V  +  F++I  + ILV +D++D   G  + K  G  GG NG+K II+K+ N +   R+RIGIG P   + ++ +VL K  A++   +  A+ +A  +  E L   D  K M + +
  S:     6 LIVGLANPGAEYAQTRHNAGAWYVEELARICGVSLVPDSKYFGLTARAVLHGKDVRLLIPTTYMNLSGKAVGALANFFRITPEEILVAHDELDMPPGVAKFKLGGGHGGHNGLKDIIAKLANDKNFYRLRIGIGHPGDKNKVSGYVLGKAPAKEQELINAAVDEAVRS-TEVLFKEDMVKAMTRLH 190
>gi|113969351|ref|YP_733144.1| peptidyl-tRNA hydrolase [Shewanella sp. MR-4] >gi|114046578|ref|YP_737128.1| peptidyl-tRNA hydrolase [Shewanella sp. MR-7] >gi|119391004|sp|Q0HLI0|PTH_SHESM Peptidyl-tRNA hydrolase (PTH) >gi|119391005|sp|Q0HXT4|PTH_SHESR Peptidyl-tRNA hydrolase (PTH) >gi|113884035|gb|ABI38087.1| peptidyl-tRNA hydrolase [Shewanella sp. MR-4] >gi|113888020|gb|ABI42071.1| peptidyl-tRNA hydrolase [Shewanella sp. MR-7] (195 aa)
Score = 204, Expect = 9.1e-15, Identities = 64/182 (35%), Positives = 102/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY +T+HN G   ++EL +   + L  +SK+ G   +       + +  P TYMN SG+ V  +  F++I  + ILV +D++D   G  + K  G  GG NG+K II+K+ N +   R+RIGIG P   + ++ +VL K  A++   +  A+ +A  +  E L   D  K M + +
  S:     6 LIVGLANPGAEYAQTRHNAGAWYVEELARICGVSLVPDSKYFGLTARAVLHGKDVRLLIPTTYMNLSGKAVGALANFFRITPEEILVAHDELDMPPGVAKFKLGGGHGGHNGLKDIIAKLANDKNFYRLRIGIGHPGDKNKVSGYVLGKAPAKEQELINAAVDEAVRS-TEVLFKEDMVKAMTRLH 190
>gi|15616809|ref|NP_240021.1| peptidyl-tRNA hydrolase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11133756|sp|P57287|PTH_BUCAI Peptidyl-tRNA hydrolase (PTH) >gi|25319087|pir||C84952 aminoacyl-tRNA hydrolase (EC 3.1.1.29) [imported] - Buchnera sp. (strain APS) >gi|10038872|dbj|BAB12907.1| peptidyl-tRNA hydrolase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (177 aa)
Score = 203, Expect = 1.1e-14, Identities = 51/161 (31%), Positives = 91/161 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTE-KIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKA 165
           ++VGL NP  EY  T+HNVG   +  L + +   F N  KF G    ++   + I +  P  +MN +G+ V+++  FY I+   IL+++DD++   G  ++K      G NG++ I++  N      R RIGIG+P++   +   VL+  + ++ I +Q++I+ A
  S:     1 MIVGLSNPKKEYHSTRHNVGSWYLYSLAESYLRNFKNEKKFFGFTTSLNIESNYIRLLIPNIFMNINGQSVFKMASFYNINLSEILIVHDDLELQPGISKLKYSYGHNGHNGLRDIVNTFNKNINFYRFRIGIGRPINRDQIASFVLSNPTKKEKILIQKSILHA 165
>gi|15639995|ref|NP_219448.1| peptidyl-tRNA hydrolase [Treponema pallidum subsp. pallidum str. Nichols] >gi|189026234|ref|YP_001934006.1| peptidyl-tRNA hydrolase [Treponema pallidum subsp. pallidum SS14] >gi|6647698|sp|O83975|PTH_TREPA Peptidyl-tRNA hydrolase (PTH) >gi|3323339|gb|AAC65962.1| peptidyl-tRNA hydrolase (pth) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018809|gb|ACD71427.1| peptidyl-tRNA hydrolase [Treponema pallidum subsp. pallidum SS14] (202 aa)
Score = 203, Expect = 1.1e-14, Identities = 53/150 (35%), Positives = 87/150 (57%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPE---DQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH---NLTHHVLTKF 150
           M   L+V LGNPG EYE+T+HN  ++ +  L     L        G   +++  E   +++++ KP+TYMN SG+ V   C F +   + +LV++D+++   G + +K  G  GG NG++SI   + T    R+RIGIG+P     N+  +VL+ F
  S:     1 MGIQLIVFLGNPGAEYEETRHNAAWLLLTYLFPSIVLPWR-CGCRGSIARIEGFEGSSEEVWLLKPLTYMNRSGKSVGAACAFLQTDAKQLLVVHDELELPFGVVSLKQGGGLGGHNGLRSIKEVLGTADFWRLRIGIGRPPSESVNIAQYVLSAF 155
>gi|32491099|ref|NP_871353.1| peptidyl-tRNA hydrolase [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|31340302|sp|Q8D2K4|PTH_WIGBR Peptidyl-tRNA hydrolase (PTH) >gi|25166306|dbj|BAC24496.1| pth [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (191 aa)
Score = 203, Expect = 1.1e-14, Identities = 62/183 (33%), Positives = 95/183 (51%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKI-KRIRIGIGKPV--HNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMN 183
           M   L+VGL NP   Y  T+HN+G   I  L K++    + N K+   ++ V   +    +  P TYMN +G  +Y I  FYKI+   +L+++DD+D D G  R K    +   NGIKSI      + I   +RIGIG+P    N+  ++L   S ++ I +++ I K    C + L   + D  MN
  S:     1 MKLKLIVGLSNPINLYYNTRHNIGSWYIKFLAKKYKKNLIKNKKYCFYYIDVKIGDYYSKLVIPDTYMNVNGTIIYNITNFYKIYSNEMLIVHDDLDLDTGIARFKFNHKNSTHNGIKSIYKSFGAKCIFNTLRIGIGRPKLNKNINSYLLNNPSPKEEILIKKTITKCIK-CTDVLIKKNKDHAMN 186
>gi|126175458|ref|YP_001051607.1| aminoacyl-tRNA hydrolase [Shewanella baltica OS155] >gi|149117322|ref|ZP_01844019.1| Aminoacyl-tRNA hydrolase [Shewanella baltica OS223] >gi|153001809|ref|YP_001367490.1| peptidyl-tRNA hydrolase [Shewanella baltica OS185] >gi|160876542|ref|YP_001555858.1| peptidyl-tRNA hydrolase [Shewanella baltica OS195] >gi|166229450|sp|A3D7M5|PTH_SHEB5 Peptidyl-tRNA hydrolase (PTH) >gi|166229451|sp|A6WRI8|PTH_SHEB8 Peptidyl-tRNA hydrolase (PTH) >gi|189038164|sp|A9KZZ0|PTH_SHEB9 Peptidyl-tRNA hydrolase (PTH) >gi|125998663|gb|ABN62738.1| Aminoacyl-tRNA hydrolase [Shewanella baltica OS155] >gi|146862626|gb|EDK48275.1| Aminoacyl-tRNA hydrolase [Shewanella baltica OS223] >gi|151366427|gb|ABS09427.1| Aminoacyl-tRNA hydrolase [Shewanella baltica OS185] >gi|160862064|gb|ABX50598.1| Aminoacyl-tRNA hydrolase [Shewanella baltica OS195] (195 aa)
Score = 202, Expect = 1.3e-14, Identities = 65/182 (35%), Positives = 101/182 (55%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY  T+HN G   + EL +   + L  +SK+ G   +       + +  P TYMN SG+ V  +  F++I  + ILV +D++D   G  + K  G  GG NG+K II+K+ N +   R+R+GIG P   + ++ +VL K  A++   +  AI +A  +  E L   D  K MN+ +
  S:     6 LIVGLANPGAEYAHTRHNAGAWYVLELARICGVTLVADSKYFGLTARAVLHGKDVRLLIPTTYMNLSGKAVGALANFFRITPEEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIIAKLANDKNFYRLRLGIGHPGDKNQVSGYVLGKAPAKEQELIDAAIDEAVRS-TEILFKQDMVKAMNRLH 190
>gi|24372767|ref|NP_716809.1| peptidyl-tRNA hydrolase [Shewanella oneidensis MR-1] >gi|38503270|sp|Q8EHN5|PTH_SHEON Peptidyl-tRNA hydrolase (PTH) >gi|24346845|gb|AAN54254.1|AE015562_4 peptidyl-tRNA hydrolase [Shewanella oneidensis MR-1] (195 aa)
Score = 202, Expect = 1.3e-14, Identities = 64/182 (35%), Positives = 102/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY +T+HN G   ++EL +   + L  +SK+ G   +       + +  P TYMN SG+ V  +  F++I  + ILV +D++D   G  + K  G  GG NG+K II+K+ N +   R+RIGIG P   + ++ +VL K  A++   +  A+ +A  +  E L   D  K M + +
  S:     6 LIVGLANPGAEYVQTRHNAGAWYVEELARICGVSLVADSKYFGLTARAVLHGKDVRLLIPTTYMNLSGKAVGALANFFRITPEEILVAHDELDMPPGVAKFKLGGGHGGHNGLKDIIAKLANDKNFYRLRIGIGHPGDKNKVSGYVLGKAPAKEQELINAAVDEAVRS-TEILFKEDMVKAMTRLH 190
>gi|15801433|ref|NP_287450.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 EDL933] >gi|15830963|ref|NP_309736.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. Sakai] >gi|16129167|ref|NP_415722.1| peptidyl-tRNA hydrolase [Escherichia coli str. K-12 substr. MG1655] >gi|26247527|ref|NP_753567.1| peptidyl-tRNA hydrolase [Escherichia coli CFT073] >gi|74312456|ref|YP_310875.1| peptidyl-tRNA hydrolase [Shigella sonnei Ss046] >gi|89108049|ref|AP_001829.1| peptidyl-tRNA hydrolase [Escherichia coli W3110] >gi|91210425|ref|YP_540411.1| peptidyl-tRNA hydrolase [Escherichia coli UTI89] >gi|110641434|ref|YP_669164.1| peptidyl-tRNA hydrolase [Escherichia coli 536] >gi|110805209|ref|YP_688729.1| peptidyl-tRNA hydrolase [Shigella flexneri 5 str. 8401] >gi|157156333|ref|YP_001462456.1| peptidyl-tRNA hydrolase [Escherichia coli E24377A] >gi|157160709|ref|YP_001458027.1| peptidyl-tRNA hydrolase [Escherichia coli HS] >gi|168711504|ref|ZP_02743781.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC4045] >gi|168721931|ref|ZP_02754208.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC4206] >gi|168738425|ref|ZP_02770702.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC4115] >gi|168750763|ref|ZP_02775785.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC4113] >gi|168756565|ref|ZP_02781572.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC4401] >gi|168764412|ref|ZP_02789419.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC4501] >gi|168771091|ref|ZP_02796098.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC4486] >gi|168782558|ref|ZP_02807565.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC4076] >gi|168787706|ref|ZP_02812713.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC869] >gi|168795969|ref|ZP_02820976.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC4042] >gi|168802106|ref|ZP_02827113.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC508] >gi|170020429|ref|YP_001725383.1| aminoacyl-tRNA hydrolase [Escherichia coli ATCC 8739] >gi|170080832|ref|YP_001730152.1| peptidyl-tRNA hydrolase [Escherichia coli str. K12 substr. DH10B] >gi|170681473|ref|YP_001743990.1| peptidyl-tRNA hydrolase [Escherichia coli SMS-3-5] >gi|188494692|ref|ZP_03001962.1| peptidyl-tRNA hydrolase [Escherichia coli 53638] >gi|191168523|ref|ZP_03030309.1| peptidyl-tRNA hydrolase [Escherichia coli B7A] >gi|191171008|ref|ZP_03032559.1| peptidyl-tRNA hydrolase [Escherichia coli F11] >gi|193066741|ref|ZP_03047766.1| peptidyl-tRNA hydrolase [Escherichia coli E22] >gi|193071180|ref|ZP_03052103.1| peptidyl-tRNA hydrolase [Escherichia coli E110019] >gi|194425799|ref|ZP_03058355.1| peptidyl-tRNA hydrolase [Escherichia coli B171] >gi|194437104|ref|ZP_03069203.1| peptidyl-tRNA hydrolase [Escherichia coli 101-1] >gi|195938853|ref|ZP_03084235.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC4024] >gi|67471520|sp|P0A7D1|PTH_ECOLI Peptidyl-tRNA hydrolase (PTH) >gi|122957492|sp|Q0T5J1|PTH_SHIF8 Peptidyl-tRNA hydrolase (PTH) >gi|167011992|sp|A7ZKX7|PTH_ECO24 Peptidyl-tRNA hydrolase (PTH) >gi|167011993|sp|A7ZZE0|PTH_ECOHS Peptidyl-tRNA hydrolase (PTH) >gi|189038290|sp|B1IU89|PTH_ECOLC Peptidyl-tRNA hydrolase (PTH) >gi|67471521|sp|P0A7D2|PTH_ECOL6 Peptidyl-tRNA hydrolase (PTH) >gi|67471524|sp|P0A7D3|PTH_ECO57 Peptidyl-tRNA hydrolase (PTH) >gi|119390937|sp|Q0TIG6|PTH_ECOL5 Peptidyl-tRNA hydrolase (PTH) >gi|119390938|sp|Q1RCN4|PTH_ECOUT Peptidyl-tRNA hydrolase (PTH) >gi|119391008|sp|Q3Z0S2|PTH_SHISS Peptidyl-tRNA hydrolase (PTH) >gi|12514917|gb|AAG56062.1|AE005338_2 peptidyl-tRNA hydrolase [Escherichia coli O157:H7 EDL933] >gi|26107928|gb|AAN80127.1|AE016759_401 Peptidyl-tRNA hydrolase [Escherichia coli CFT073] >gi|581202|emb|CAA43945.1| peptidyl-tRNA hydrolase [Escherichia coli] >gi|1651597|dbj|BAA36062.1| peptidyl-tRNA hydrolase [Escherichia coli W3110] >gi|1787455|gb|AAC74288.1| peptidyl-tRNA hydrolase [Escherichia coli str. K-12 substr. MG1655] >gi|13361174|dbj|BAB35132.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. Sakai] >gi|73855933|gb|AAZ88640.1| peptidyl-tRNA hydrolase [Shigella sonnei Ss046] >gi|91071999|gb|ABE06880.1| peptidyl-tRNA hydrolase [Escherichia coli UTI89] >gi|110343026|gb|ABG69263.1| peptidyl-tRNA hydrolase [Escherichia coli 536] >gi|110614757|gb|ABF03424.1| peptidyl-tRNA hydrolase [Shigella flexneri 5 str. 8401] >gi|157066389|gb|ABV05644.1| peptidyl-tRNA hydrolase [Escherichia coli HS] >gi|157078363|gb|ABV18071.1| peptidyl-tRNA hydrolase [Escherichia coli E24377A] >gi|169755357|gb|ACA78056.1| Aminoacyl-tRNA hydrolase [Escherichia coli ATCC 8739] >gi|169888667|gb|ACB02374.1| peptidyl-tRNA hydrolase [Escherichia coli str. K12 substr. DH10B] >gi|170519191|gb|ACB17369.1| peptidyl-tRNA hydrolase [Escherichia coli SMS-3-5] >gi|188015067|gb|EDU53189.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC4113] >gi|188489891|gb|EDU64994.1| peptidyl-tRNA hydrolase [Escherichia coli 53638] >gi|188999990|gb|EDU68976.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC4076] >gi|189356406|gb|EDU74825.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC4401] >gi|189360056|gb|EDU78475.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC4486] >gi|189365581|gb|EDU83997.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC4501] >gi|189372477|gb|EDU90893.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC869] >gi|189375858|gb|EDU94274.1| peptidyl-tRNA hydrolase [Escherichia coli O157:H7 str. EC508] >gi|190901421|gb|EDV61184.1| peptidyl-tRNA hydrolase [Escherichia coli B7A] >gi|190908740|gb|EDV68328.1| peptidyl-tRNA hydrolase [Escherichia coli F11] >gi|192925611|gb|EDV80280.1| peptidyl-tRNA hydrolase [Escherichia coli E22] >gi|192955512|gb|EDV85992.1| peptidyl-tRNA hydrolase [Escherichia coli E110019] >gi|194415854|gb|EDX32120.1| peptidyl-tRNA hydrolase [Escherichia coli B171] >gi|194424087|gb|EDX40075.1| peptidyl-tRNA hydrolase [Escherichia coli 101-1] (194 aa)
Score = 202, Expect = 1.4e-14, Identities = 54/138 (39%), Positives = 77/138 (55%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP 138
           M+  L+VGL NPG EY  T+HN G   +D L +         +KF G   +V    + + +  P T+MN SG+ V  +  F++I+   ILV +D++D   G  + K  G  GG NG+K IISK+ N     R+RIGIG P
  S:     1 MTIKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHP 140
>gi|90581722|ref|ZP_01237509.1| peptidyl-tRNA hydrolase [Vibrio angustum S14] >gi|90437076|gb|EAS62280.1| peptidyl-tRNA hydrolase [Vibrio angustum S14] (196 aa)
Score = 202, Expect = 1.6e-14, Identities = 57/158 (36%), Positives = 90/158 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAI 162
           L+VGL NPG EY  T+HN G   ++EL + H + L  + K+ G   ++      + +  P T+MN SG+ V  +  F++I  + ILV +D++D   G  + K  G  GG NG++ IISKM N +   R+RI IG P   + +  +VL K  A++   +  A+
  S:     7 LLVGLANPGQEYANTRHNAGAWVVEELARVHNVSLRPDPKYFGLTGRITANGQDLRLLIPSTFMNLSGKSVAALANFFQIKPEEILVAHDELDLPPGVAKFKKGGGHGGHNGLRDIISKMGNNKDFYRLRIAIGHPGDKNKVAGYVLGKAPAKEQELIDAAV 168
>gi|127513848|ref|YP_001095045.1| peptidyl-tRNA hydrolase [Shewanella loihica PV-4] >gi|166229452|sp|A3QH38|PTH_SHELP Peptidyl-tRNA hydrolase (PTH) >gi|126639143|gb|ABO24786.1| Aminoacyl-tRNA hydrolase [Shewanella loihica PV-4] (195 aa)
Score = 201, Expect = 1.7e-14, Identities = 63/182 (34%), Positives = 102/182 (56%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFL-NNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEK-IKRIRIGIGKPVHN--LTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG +YE+T+HN G   ++EL +   + L  +SK+ G   +       + +  P T+MN SG+ V  +  F++I    ILV +D++D   G  + K  G  GG NG+K II+K+  +K   R+RIGIG P     ++++VL K    +   +++ I +A  A  E L   D  K M++ +
  S:     6 LIVGLANPGDKYEQTRHNAGAWYVNELARVCGVSLVADSKYYGLTARATLYGKDVRLLIPTTFMNLSGKSVGALANFFRIAPDEILVAHDELDMPPGVAKFKLGGGHGGHNGLKDIIAKLANDKGFYRLRIGIGHPGDKSMVSNYVLGKAPQTEQRLIEEVIDEAVRA-TEVLFKEDMSKAMHRLH 190
>gi|39546325|ref|NP_460739.2| peptidyl-tRNA hydrolase [Salmonella typhimurium LT2] >gi|167546258|ref|ZP_02341823.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167553611|ref|ZP_02347360.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167993230|ref|ZP_02574325.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168228800|ref|ZP_02654031.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168233818|ref|ZP_02658876.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168237841|ref|ZP_02662899.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168259988|ref|ZP_02681961.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168462737|ref|ZP_02696668.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168478181|ref|ZP_02707204.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168820525|ref|ZP_02832525.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194444828|ref|YP_002041035.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194472071|ref|ZP_03078055.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194737518|ref|YP_002114815.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|61230024|sp|P0A281|PTH_SALTY Peptidyl-tRNA hydrolase (PTH) >gi|61230025|sp|P0A282|PTH_SALTI Peptidyl-tRNA hydrolase (PTH) >gi|119364641|sp|Q5PCR7|PTH_SALPA Peptidyl-tRNA hydrolase (PTH) >gi|194403491|gb|ACF63713.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194458435|gb|EDX47274.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194713020|gb|ACF92241.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195634529|gb|EDX52881.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Newport str. SL317] (194 aa)
Score = 201, Expect = 2.0e-14, Identities = 62/172 (36%), Positives = 90/172 (52%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNS-KFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEF 172
           M+  L+VGL NPG EY  T+HN G   +D L +     L    KF G   ++    + + +  P T+MN SG+ V  +  FY+I    ILV +D++D   G  + K  G  GG NG+K IISK+ N     R+R+GIG P   + +   VL K    +   + +AI +A   C E 
  S:     1 MAIKLIVGLANPGAEYAATRHNAGAWYVDLLAERLRAPLREEPKFFGYTSRITLEGEDVRLLVPTTFMNLSGKAVGAMASFYRIQPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRVGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAA-RCTEL 175
>gi|109112167|ref|XP_001095323.1| PREDICTED: hypothetical protein isoform 1 [Macaca mulatta] (221 aa)
Score = 200, Expect = 2.6e-14, Identities = 51/171 (29%), Positives = 93/171 (54%)
  Q:     6 VVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQP-----EDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKPVH--NLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHV 176
           V GLGNPGL    T+H+VG   + +L +   L +  S    +    D       + Q+ + +P   MN +G  V    + + +  + + +++D++D  +G++ +K  GS+ G NG++S IS +N+  + R+R+GIG+P H   +  HVL  FS  +   +   + +A D     L+H+
  S:    40 VAGLGNPGLP--GTRHSVGMAVLGQLARR--LGVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVHDELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPTHPEAVQAHVLGCFSPAEQELLPLLLDRATDL---ILDHI 210
>gi|157835761|pdb|2PTH|A Chain A, Peptidyl-Trna Hydrolase From Escherichia Coli (193 aa)
Score = 200, Expect = 2.6e-14, Identities = 53/134 (39%), Positives = 75/134 (55%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP 138
           L+VGL NPG EY  T+HN G   +D L +         +KF G   +V    + + +  P T+MN SG+ V  +  F++I+   ILV +D++D   G  + K  G  GG NG+K IISK+ N     R+RIGIG P
  S:     4 LIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHP 139
>gi|1093598|prf||2104267B peptidyl-tRNA hydrolase (194 aa)
Score = 200, Expect = 2.7e-14, Identities = 53/134 (39%), Positives = 75/134 (55%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKE-HTLFLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP 138
           L+VGL NPG EY  T+HN G   +D L +         +KF G   +V    + + +  P T+MN SG+ V  +  F++I+   ILV +D++D   G  + K  G  GG NG+K IISK+ N     R+RIGIG P
  S:     5 LIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHP 140
>gi|16760676|ref|NP_456293.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29141565|ref|NP_804907.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56413296|ref|YP_150371.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|16420313|gb|AAL20698.1| peptidyl-tRNA hydrolase [Salmonella typhimurium LT2] >gi|16502972|emb|CAD02138.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29137192|gb|AAO68756.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56127553|gb|AAV77059.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (202 aa)
Score = 198, Expect = 3.7e-14, Identities = 61/168 (36%), Positives = 88/168 (52%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNS-KFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEF 172
           L+VGL NPG EY  T+HN G   +D L +     L    KF G   ++    + + +  P T+MN SG+ V  +  FY+I    ILV +D++D   G  + K  G  GG NG+K IISK+ N     R+R+GIG P   + +   VL K    +   + +AI +A   C E 
  S:    13 LIVGLANPGAEYAATRHNAGAWYVDLLAERLRAPLREEPKFFGYTSRITLEGEDVRLLVPTTFMNLSGKAVGAMASFYRIQPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRVGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAA-RCTEL 183
>gi|62180347|ref|YP_216764.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|62127980|gb|AAX65683.1| peptidyl-tRNA hydrolase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (202 aa)
Score = 198, Expect = 4.0e-14, Identities = 61/168 (36%), Positives = 88/168 (52%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNS-KFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEF 172
           L+VGL NPG EY  T+HN G   +D L +     L    KF G   ++    + + +  P T+MN SG+ V  +  FY+I    ILV +D++D   G  + K  G  GG NG+K IISK+ N     R+R+GIG P   + +   VL K    +   + +AI +A   C E 
  S:    13 LIVGLANPGTEYAATRHNAGAWYVDLLAERLRAPLREEPKFFGYTSRITLEGEDVRLLVPTTFMNLSGKAVGAMVSFYRIQPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRVGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAA-RCTEL 183
>gi|85059859|ref|YP_455561.1| peptidyl-tRNA hydrolase [Sodalis glossinidius str. 'morsitans'] >gi|119391010|sp|Q2NRR9|PTH_SODGM Peptidyl-tRNA hydrolase (PTH) >gi|84780379|dbj|BAE75156.1| peptidyl-tRNA hydrolase [Sodalis glossinidius str. 'morsitans'] (194 aa)
Score = 197, Expect = 4.9e-14, Identities = 67/186 (36%), Positives = 99/186 (53%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNN-SKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           M   L+VGL NPG EY  T+HN G   ++ L + +   L   SKF G   ++      + +  P T+MN SG+ V  +  FY+I  ++ILV +D++D   G  R+K  G  GG NG+K IIS++ N  +  R+RIGI  P   + +   VL K    +   +  AI +A   C E L   D  K MN+ +
  S:     1 MKIKLIVGLANPGAEYAATRHNAGAWYVELLAERYRQTLKEESKFYGYTGRLTLGGQDVRLLVPTTFMNLSGKAVAAMATFYRIAPEDILVAHDELDLLPGSARLKLGGGHGGHNGLKDIISRLGNNPQFHRLRIGISHPGDKNQVVGFVLGKPPTAERQLIDSAIDEAV-RCTEILVTQDAVKAMNRLH 189
>gi|1127573|gb|AAB06185.1| peptidyl-tRNA hydrolase (194 aa)
Score = 197, Expect = 5.4e-14, Identities = 62/172 (36%), Positives = 89/172 (51%)
  Q:     1 MSKYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNS-KFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEF 172
           M+  L+VGL NPG EY  T+HN G   +D L       L    KF G   ++    + + +  P T+MN SG+ V  +  FY+I    ILV +D++D   G  + K  G  GG NG+K IISK+ N     R+R+GIG P   + +   VL K    +   + +AI +A   C E 
  S:     1 MAIKLIVGLANPGAEYAATRHNAGAWYVDLLADGLRAPLREEPKFFGYTSRITLEGEDVRLLVPTTFMNLSGKAVGAMASFYRIQPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRVGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAA-RCTEL 175
>gi|77963720|ref|ZP_00827528.1| COG0193: Peptidyl-tRNA hydrolase [Yersinia mollaretii ATCC 43969] (196 aa)
Score = 196, Expect = 6.3e-14, Identities = 65/182 (35%), Positives = 97/182 (53%)
  Q:     5 LVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLN-NSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM-NTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDKIMNKFN 186
           L+VGL NPG EY +T+HN G   +D L + H   L   +KF G   +++     + +  P T+MN SG+ V  +  FY+I  + ILV +D++D   G  ++K  G +GG NG+K I SK+ N     R+RIGIG P     +   VL K    +   +  AI ++   C E L      K MN+ +
  S:     6 LIVGLANPGAEYAQTRHNAGAWYVDLLAERHNQSLKEEAKFFGYTARLNLAGQDVRLLVPSTFMNLSGKAVVAMAGFYRILPEEILVAHDELDIPPGVAKLKLGGGNGGHNGLKDIQSKLGNNPNFYRLRIGIGHPGDKSKVVGFVLGKPPTSEQTLIDDAIDESI-RCTEVLMTEGITKAMNRLH 190
>gi|24215049|ref|NP_712530.1| peptidyl-tRNA hydrolase [Leptospira interrogans serovar Lai str. 56601] >gi|45657470|ref|YP_001556.1| peptidyl-tRNA hydrolase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|46576821|sp|Q8F3Q2|PTH_LEPIN Peptidyl-tRNA hydrolase (PTH) >gi|59798053|sp|Q72RZ0|PTH_LEPIC Peptidyl-tRNA hydrolase (PTH) >gi|24196101|gb|AAN49548.1|AE011404_1 Peptidyl-tRNA hydrolase [Leptospira interrogans serovar Lai str. 56601] >gi|45600709|gb|AAS70193.1| peptidyl tRNA hydrolase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (190 aa)
Score = 194, Expect = 1.2e-13, Identities = 60/160 (37%), Positives = 99/160 (61%)
  Q:     3 KYLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTL-FLNNSKFNGQFVKVDQPEDQIFIAKPMTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKMNTEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAI 162
           K L+VG+GNPG +Y   +HN+GF+ +D LL   ++ +  NSK++    + D+    IF  KP+ +MN SG+ V EI K   I  +NIL+I+D+ID + GK+++K  G   G NG+++I+ K+ T    R+R G+GKP     +  +VL+ F   +  K+ + +
  S:     5 KLLLVGIGNPGQKYVHNRHNIGFVILDSLLDSSSVSYQTNSKYS--LARTDEDGVTIFYLKPLEFMNLSGKSVAEIAKKNGISPENILIIHDEIDFEFGKLKLKGGGGHAGHNGLRNIVEKLGTNTFFRLRFGVGKPSITSEVPDYVLSNFLPNEKEKIPELV 165